4QY6A

Crystal structures of chimeric beta-lactamase ctem-19m showing different conformations
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPLTSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM, Beta-lactamase PSE-4
publication title Crystal structures of chimeric beta-lactamase cTEM-19m showing different conformations
rcsb
source organism Escherichia coli
total genus 94
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4qy6A00
3WRZA 4DE2A 4EBLA 2XF3A 3V3SA 1XGIA 2JC7A 1XX2A 3W8KA 3VP3A 2ZQCA 2Y55A 1YLTA 4RYEA 4S2NA 1E3UA 3G2ZA 4S2OA 1VM1A 2EX8A 4JBFA 2XDMA 4QY6A 4DXBA 4PMAA 3BFDA 3HLCA 5GLCA 3VOYA 1MXOA 2J9OA 2XLNA 3JYIA 3VOZA 2Z2MB 3I7JA 3IXGA 3OC2A 1GA0A 3IWIA 1GHPA 1XA1A 3Q7ZA 4OQ0A 4DXCA 3GQZA 5JYPA 2PU2A 4DE3A 4WZ4A 1SHVA 5DTSA 1KE4A 4S2IA 4BJPA 3C7VA 3GVBA 4OOMA 1E25A 2RL3A 2QPNA 3HUMA 5GHYA 3Q7VA 3P98A 3DWKA 4PM7A 3WS5A 5CTNA 3UDXA 3A3EA 4LCMA 2VGJA 5J8XA 2Y2KA 1ES5A 2WKEA 5JYOA 3SS5A 4LCLA 1LL5A 4LV3A 3FV7A 3LO7A 1HZOA 5FASA 3VSKA 1SCWA 3IXBA 5HW3A 3OCLA 3CZDA 1MKIA 4GNUA 4EWFA 3SH8A 5E2EA 3ZG8B 3IF6B 1Z6FA 5EUAA 4KQRA 3E2KA 4LENA 1N4OA 4S2KA 4CJNA 4B4ZA 4KZ4A 2HPBA 3HLWA 4R1GA 2ZM0A 4Y7PA 1AXBA 2IWCA 1EWZA 3WRTA 3OZHA 1K54C 3IHBA 1BSGA 3MKEA 3UN7A 3W4QA 4QD4A 1IYQA 3OCNA 5TFQA 4KZ6A 5EE8A 3IF5A 1NXYA 1TDGA 4GKUA 5GL9A 4X53A 2ZM8A 3O88A 4JF5A 4S2JA 5CGXA 1DJCA 4WELA 4RVAA 3HLFA 3RXXA 3HLGA 4S2PA 5IHVA 4UA7A 2JBFA 1KVMA 5FQMA 4Y0OA 1IYOA 2WUQA 5D3OA 1BLPA 1SKFA 5GLAA 1CI8A 1ERQA 1K57A 1SDEA 1U60A 5CTMA 3NY4A 2ZC5B 1PW8A 4R3BA 2ZQ8A 1W8QA 3RJUA 3HREA 1LLBA 2EX6A 1PIOA 2GDNA 3G4PA 1QMEA 3GV9A 3O87A 4N92A 5FAQA 3CMZA 3V5MA 2QZ6A 4E3OA 5CXWA 2ZC7A 1JWPA 1IYPA 4JXSA 4FD8A 3IWOA 3OPHA 3PBOA 4HBTA 1FQGA 2Y59A 4UA9A 5EVIA 4GOGA 1IEMA 3UNWA 3UY6A 2Y2GA 4E3LA 4OP5A 4PPRA 4WZ5C 5TR7A 1BZAA 4GB7A 4LV1A 2XD5A 4BD0A 4JXWA 5BOHA 2Y2IA 3VMAA 1FSWA 2Y2MA 2HP5A 2WAFA 2P9VA 5GLDA 4GN2A 3V3RA 2HDSA 4CPKA 3DW0A 3MXSA 3VFFA 1W7FA 1KVLA 4DDSA 2DNSA 1JWZA 4JXVA 4PM6A 3IWQA 3ZGAB 3BLMA 1TEMA 5HARA 1YLZA 5EECA 1FR6A 3BYDA 4KZAA 4KZ9A 3ZFZA 3C4PA 4OQHA 5F82A 4P0MA 3N6IA 5GLBA 4BQMA 1KGFA 3MKFA 2WAEA 4Y0TA 4K0XA 3UE0A 3MBZA 1ONHA 3D4FA 4QJGA 4JF4A 4N1HA 3C7UA 3PBTA 1WE4A 4ZBEA 3IHAA 1DY6A 3BFCA 4RX3A 5GHZA 3S22A 1CEGA 1ESIA 1RCJA 3HVFA 3M6BA 4XUXA 4ZDXA 3AGFA 2Y4AA 5FI7A 3GRJA 4WM9A 4B4XA 1KE3A 2XFTA 2WGWA 5A90A 2H10A 1I5QA 3ZNYA 1BTLA 4ZTKA 3ZHHA 3UDIA 4GDNA 2H0YA 1IKGA 3UPNA 4WEKA 3Q82A 2CC1A 1NYYA 2Y91A 1G68A 2ZC6B 1XP4A 1NYMA 2E8IA 1YLJA 1LHYA 3PBNA 1MY8A 4B88A 3M6HA 4IVKA 1K55C 4PM8A 4U0XA 4OH0A 4E3IA 3N7WA 4HBUA 3IF6C 5A92A 3GR2A 5CHJA 5FI2A 2Q9MA 3SOIA 3UE1A 5FQ9A 4NK3A 4ZJ3A 3TG9A 1NJ4A 3PBQA 3UE3A 2J7VA 1YMSA 1BUEA 4X69A 1JVJA 2ZM2A 4H8RA 3B3XA 5EVIB 5HFOA 1PWDA 1YQSA 3UDFA 3EQUA 3A3FA 4JF6A 4N9KA 2X01A 4OPRA 2PBYA 3BFEA 1BLCA 1YLYA 2B5RA 4R4RA 2RCXA 4UHUA 5DF7A 2ZQAA 5GHXA 2WKIA 1FSYA 5FSRA 1K25A 2WZXA 5KSHA 3C5AA 1C3BA 2P9VB 2FFFB 3NC8A 4OLDA 5EOOA 2XK1A 3BLSA 4Z9QA 4KG2A 4S2LA 3GSGA 4QHCA 3WS4A 3WS1A 2JE5A 1FOFA 1ES2A 1BLHA 3RXWA 1PW1A 3LY4A 3SS4A 2ZD8A 1YMXA 5E2FA 3VP1A 4EBPA 1KDWA 5FAOA 1KGGA 2ZQDA 1XKZA 4DE0A 2Y2NA 3G31A 2QMIA 4KQQA 4WBGA 5CERA 1NY0A 3OPPA 4WZ5A 1W79A 4IBXA 4OQIA 4S2NC 2G2WA 1EROA 2XD1A 2XEPA 5E43A 1G6AA 4OPZA 4EV4A 4WEJA 5G18A 5FAPA 4MEZA 3ZCZA 2I72A 4N9LA 2XFSA 1NZOA 3ZVWA 4YFMA 4ID4A 5FQKA 4M3KA 1NRFA 3ZVTA 4JLFA 5EVLA 2WGWB 4FH2A 4YINA 4RX2A 4D2OA 4F94A 2EFUA 4WMCD 4ZAMA 3O86A 1YT4A 2UWXA 1YM1A 4L0LA 3AGDA 3A3IA 3O3VA 3UPPA 4BL3A 1MWRA 1FCMA 1WYCA 5DVAA 4E3NA 4OVDA 3E2LA 3TSGA 4C75A 3QNBA 2DRWA 4OP8A 1MWUA 4P85A 4Y0UA 1CEFA 3TOIA 3N8LA 3G32A 3N4IA 1NZUA 1YLWA 1ZG4A 4KZ8A 3HLBA 3S4XA 5CEDA 2Z2LB 3VP4A 3FZCA 3IXHA 4E6XA 4O7DA 1ALQA 1IYSA 1LI9A 3OPRA 2XQZA 3M2KA 3Q81A 2H5SA 1L0GA 5AQAA 3SH7A 3SS3A 5CECA 2R9WA 5F83A 4ZJ2A 3ZG9B 1KE0A 3CG5A 3NBLA 2Y2PA 2WKHA 3EQVA 5CGSA 4RA7A 3ZNTA 2X71A 1DJAA 3FKVA 1O07A 5FI6A 5AQBA 3GTCA 4U3TA 1ZKJA 1PI5A 3S1YA 4BL2A 1IKIA 1LI0A 3BECA 4BENA 5M18A 1MWSA 3BM6A 5CEBA 5FQJA 4OPQA 3VP2A 5E2HA 3HLDA 5F1GA 3NIAA 2WGIA 1BULA 4PM9A 5DTTA 1ZG6A 1HD8A 1ZC2A 3IQAA 4LV0A 2HP9A 1ES4A 1JTDA 1N9BA 4K0WA 4KZ3A 5FATA 5HAIA 3G2YA 2JCHA 5DTKA 2V1ZA 4P87A 4E3KA 2A49A 1L2SA 3UPOA 3DWZA 1GHMA 4GD8A 3IH8A 1MBLA 4KZBA 4GZBA 3FKWA 1RP5A 2ZLYA 3P09A 1RGYA 1Y54A 4K91A 1K56D 4OQGA 3ITAA 4MLLA 1Q2QA 3PAEA 4XUZA 1JWVA 5EVIC 4DE1A 3UO9A 3FYZA 5A93A 2WYXA 4DF6A 1K38A 1W5DA 3NDEA 4XXRA 5FQQA 5CGWA 1E3UD 2HDUA 3ITBA 2Y2JA 2Y2OA 4KQOA 2EFXA 3BRMA 1K54A 1O7EA 4MBKA 4X55A 3DTMA 3WWXA 3W4PA 2VGKA 1BT5A 3ISGA 3PTEA 1HTZA 2J9PA 1GA9A 2OV5A 1L0FA 2ZQ7A 3G34A 4KG6A 5M1AA 3SH9A 4MBFA 3WS2A 3G30A 4C6YA 1SDNA 4FCFA 3CJMA 1MWTA 2XH9A 3V50A 1VQQA 3FWLA 4KENB 4DRTA 2HDQA 3QNCA 3LEZA 4PM5A 2WGVA 2ZJ9A 3NI9A 5E2GA 4QY5A 3GMWA 4OONA 1I2WA 2ZQ9A 2IWBA 1TDLA 2DCFA 4IBRA 1DJBA 5FDHA 3HUNA 2HP6A 2EXAA 4U0TA 3ZG5A 4HEFA 2H0TA 3ZDJA 1XPBA 1JTGA 2ZC3B 4FH4A 3C4OA 3MXRA 1FCOA 4HESA 3HLEA 5EPHA 3VSLA 4MNRA 1PWCA 1W8YA 3OPLA 4WYYA 5A91A 1H8YA 3NCKA 4QU3A 2X02A 1S0WA 1PWGA 1YLPA 4A5RA 2ZMAA 5TGFA 1QMFA 5AQ7A 1ERMA 3IT9A 3QHYA 1CK3A 4IEDA 1M6KA 3G35A 2EX2A 5L2FA 1ES3A 1L0EA 3PBSA 4C3QA 1OMEA 2C5WB 4R4SA 4X6TA 4S2MA 3PAGA 4EUZA 5HAQA 5KSCA 2G2UA 4N1XA 4R0QA 1XA7A 3VFHA 4BD1A 4Q8IA 3HBRA 4KG5A 1I2SA 2V20A 5HX9A 2PU4A 4NETA 4OKPA 1GHIA 1M40A 3M2JA 2OLUA 4JXGA 5DF8A 3HL9A 3Q1FA 3V39A 4R23A 3NDGA 4WMCA 5EOEA 5I94A 3LCEA 2BLSA 2WZZA 3BFFA 2OSUA 3PBRA 3BFGA 3MZFA 1FR1A 2WK0A 4X68A 4IVIA 5CHUA 5EVID 3W4OA 3AGEA 1LL9A 1IELA 1MPLA 2EX9A 3LY3A 1PZPA 3IXDA 3ZG0A 2IWDA 4BLMA 1KGEA 2OLVA 5AQ9A 4KZ7A 2XGNA 4FSFA 1K4FA 1FCNA 1TVFA 3MZEA 2A3UA 2EXBA 1ESUA 1Q2PA 4E3JA 1PI4A 5HL1A 1EI5A 1RGZA 3HUOA 2J8YA 1BLSA 4JPMA 2Y2QA 5DF9A 2WADA 2P74A 4EBNA 5U47A 1J9MA 5KMWA 5FQIA 1XXMA 1K55A 2C6WB 3A3JA 1ONGA 5KZHA 4P6BA 2XR0A 3IF6A 4KZ5A 1HVBA 4UAAA 2R9XA 1K57C 3BEBA 3Q7VB 4OOLA 5CRFA 4GDBA 1E4DA 1H8ZA 4GD6A 4ZJ1A 4OPYA 2Q9NA 2Y2LA 1H5XA 3ZG7B 1WYBA 1PYYA 4UA6A 3WS0A 1PZOA 1CI9A 5CHMA 3MFDA 3N8SA 3IH9A 4MBHA 4OLGA 4DKIA 4LV2A 2Y2HA 4EQIA 1GCEA 4QB8A 5M19A 1K6SA 4OOYA 2V2FF 3N8RA 1KDSA 1XGJA 3Q07A 5HAPA 3MZDA 1K6RA 4DDYA 4E3MA 4X56A 1S6RA 1L0DA 4E6WA 3A3DA 3VP0A 2FFYA 5FA7A 4JKTA 2BG1A 1K4EA 1K56A 2HDRA 2ZC4B 4R3JA 5F1FA
chains in the Genus database with same CATH superfamily
3A0RA 3RFBA 2JC7A 1XX2A 3LR0A 3VP3A 3W8KA 4JBFA 3LIFA 4QY6A 2PHYA 2J3TD 3QP8A 1T18A 5GLCA 3VOYA 3I7JA 4MCWA 3GVBA 1E25A 3LR4A 3RTYA 3WS5A 5CTNA 2VGJA 2Y2KA 5JYOA 1K0KA 4LCLA 1SCWA 3UB8A 4GNUA 5K5BA 3ZG8B 4S2KA 5F6AA 3HLWA 4Y7PA 1K54C 1BSGA 2XA7M 3W4QA 4WL9A 4QD4A 1IYQA 1G5UA 4LFUA 5EE8A 3O88A 1F98A 3F1NB 4WELA 3HLFA 3RXXA 5CX7A 3HLGA 5FQMA 3EWKA 1IYOA 4NXEA 5CTMA 3NY4A 1PW8A 4DJ2A 2AVXA 3RJUA 1PIOA 3O87A 3V5MA 1XJ4A 5C5KA 3VE4A 3IWOA 3OPHA 3VE3A 5EVIA 2QHKA 2W3DA 2HZ5A 4LV1A 4G3WA 2Y2IA 1FSWA 2WAFA 5GLDA 3K3CA 1W7FA 2DNSA 3IWQA 5HARA 4Y13A 3BYDA 4KZAA 5F82A 1CJFA 1VHMA 4Y0TA 3MBZA 1GSXA 4O01A 1WE4A 4ZBEA 3IHAA 4I5SA 4BWIA 3BFCA 1PFLA 4RX3A 5GHZA 3LUQA 4WM9A 1KE3A 1OTEA 3MS6A 1D06A 5A90A 2V1AA 3ZHHA 4GDNA 2H0YA 4ARZB 4ESPA 2CC1A 2W1TB 1NYYA 1NYMA 4H6JB 4K08A 4Y17A 2WKRA 1K55C 4OH0A 2KX6A 1XJ6A 4YOFA 5FI2A 2Q9MA 3H7WB 4CLCA 3SOIA 5FQ9A 2YKHA 3MMHA 3B3XA 3UDFA 2GX5A 3P01A 2PBYA 1CF0A 3LIEA 3T4TA 2QJ5A 4R4RA 5DF7A 4UHUA 3GECA 2WKIA 5FSRA 5GHXA 1C3BA 2P9VB 3LYXA 3NC8A 2ZOIA 4S2LA 3GSGA 2JE5A 1FOFA 3SS4A 2PYRA 2EWVA 3CPTA 1KGGA 3H82A 3VOLA 1XKZA 4DE0A 2Y2NA 5EVEA 1UWPX 3CUEA 1W79A 4S2NC 4B93A 4I3AA 2XEPA 4QWOA 3ZVTA 4M3KA 1Z09A 4F94A 2EFUA 2B02A 1S4SA 4O0PA 4QPRA 4C75A 3CLOA 3QNBA 3KYZA 2I9VA 4G3VA 4P85A 4Y0UA 3T4JA 1ZG4A 2EWWA 3CITA 1N9NA 2Z2LB 4I39A 1ALQA 2R9WA 3ZG9B 1KE0A 2Y79A 3EQVA 2XROA 4RA7A 2X71A 1DJAA 1O07A 4HJ6A 5FI6A 1OTIA 4U3TA 1ZKJA 3HJKA 1IKIA 3K3DA 5FQJA 4OPQA 3NIAA 2WGIA 4MN6A 4PM9A 5DTTA 1HD8A 1ZC2A 5L10A 4KZ3A 1N9BA 5HAIA 3DTEA 3G2YA 2JCHA 3D9YA 3MFXA 5DTKA 4P87A 4D60A 3LIBA 3UPOA 3ITAA 3L7HA 3PAEA 4DE1A 2HV1A 5A93A 5AVEA 3T12B 1LL8A 5F68A 1K38A 1W5DA 5KIZA 5CGWA 2Y2JA 5EV0A 2Y2OA 2EFXA 1FIKA 1O7EA 4X55A 5HDCA 3W4PA 2VGKA 1GSVA 3PTEA 5FDSA 1GA9A 5G4ZA 3SH9A 5M1AA 2D01A 3WS2A 4FCFA 5DJUA 1MWTA 3V50A 4KENB 3QNCA 2WGVA 1VEUA 3GMWA 1I2WA 2PT7A 5HWVA 2JKTI 1DJBA 2V0UA 5DKKA 2HP6A 4EETB 3ZG5A 2ZL1A 4M4XA 3ZDJA 4B9OA 1XPBA 1FCOA 3VSLA 1W8YA 5A91A 2QJ7A 5TGFA 4LPZA 3PBSA 4C3QA 3PYPA 4EUZA 5HAQA 2L1MA 1L3LA 4R0QA 4O8GA 2W0NA 3HBRA 5L07A 5HX9A 2P04A 4NETA 4OKPA 2HJEA 1X0OA 3M2JA 4JXGA 4EESA 4IHQA 1F5MA 3NDGA 4WMCA 3LCEA 2BLSA 2H28A 1ZHHB 2OSUA 2WK0A 4L9GA 2EX9A 2PYPA 1KGEA 4KZ7A 1J3WA 4G3KA 2XGNA 1K4FA 1TVFA 3KO6A 4E3JA 1ESUA 1OTAA 3F1PA 1BLSA 2WADA 2DMWA 1P0ZA 2P08A 5HDSA 5FQIA 1XXMA 5KZHA 3A3JA 1ONGA 3IF6A 1K57C 3BEBA 1T19A 2PRFA 1E4DA 2VGLS 2Q9NA 2Y2LA 1H5XA 2W3GA 4EXOA 1DP9A 1PZOA 3N8SA 4LV2A 1V9ZA 2A2LA 4QB8A 1G28A 4OOYA 3N8RA 2PR6A 3DAVA 1KDSA 3KYQA 1S6RA 5FA7A 4JKTA 5F1FA 2HDRA 4LRZE 3TW8A 1E3UA 3R4KA 1VM1A 2EX8A 3E4QA 5HD5A 1MXOA 1DRMA 2J9OA 2O9AA 2LB5A 1GA0A 4OQ0A 3TJZC 1YSQA 4DE3A 4PKYA 1SHVA 4BJPA 2QPNA 3HUMA 4PM7A 3UDXA 3UB7A 1NWZA 2WKEA 3SS5A 3EGXC 2V9AA 3LO7A 1HZOA 2OWJA 1GSWA 3A0SA 3CZDA 1XFQA 2R78A 4HH2A 4HNBA 1ODVA 4KQRA 4NXBA 1N4OA 1AWIA 4B4ZA 2ZM0A 1AXBA 2IWCA 2OWHA 5AJGA 3MKEA 4JGQA 4KZ6A 3KSHA 3B47A 3IF5A 1TDGA 5GL9A 4RVAA 3OLOA 3MQQA 2W3HA 4S2PA 2JBFA 4Y0OA 3T50A 3QP4A 3T1RA 5GLAA 2GNXA 4IUHA 2ZC5B 4X1MA 3DBAA 1MZUA 1W8QA 3HREA 3GV9A 2EX6A 4N92A 4R38A 3CMZA 3KSIA 4E3OA 1UGUA 1IYPA 4JXSA 1KOUA 4L9FA 3MQOA 1FQGA 2Y59A 4UA9A 3UNWA 3UY6A 4PPRA 4WZ5C 1BZAA 4GB7A 2XD5A 3BY8A 4JXWA 4BD0A 5BOHA 4HHDA 4Y5FA 1OTDA 4Z1WA 2HDSA 3MXSA 3VFFA 1KVLA 4PM6A 3BLMA 1TEMA 5F5YA 1YLZA 5MC7A 2L0WA 2CMNA 5HZHA 3U4LP 4WLAA 1ONHA 3D4FA 4N1HA 1P9RA 3S22A 3HVFA 4XUXA 3IS2A 5TBMA 3EEHA 2Y4AA 5FI7A 3GRJA 1A0KA 2WGWA 3CPTB 2H10A 1I5QA 3ZNYA 5HPFA 1IKGA 3Q82A 1G68A 2ZC6B 1XP4A 1YLJA 1LHYA 4GS9A 3MJQA 4P6ZS 1STZA 4B88A 4IVKA 2ACGA 4PM8A 3S7QA 5DFYA 4E3IA 4HQAA 5FEGA 5A92A 3TG9A 5HFOA 4H8RA 1SZVA 2O9BA 3EQUA 4UQIM 3NHQA 4JF6A 4N9KA 3BFEA 3P7NA 5HWWA 2RCXA 1SKOB 5EOOA 2XK1A 3C2WA 3UMDA 4BBTA 5EFWA 3WS1A 1ES2A 1PW1A 4WF0A 3VP1A 1T1BA 2M1CA 4GHIB 4X1LA 4WBGA 1EW0A 3OPPA 4HH3A 4OQIA 4WN5A 5E43A 4KUKA 5G18A 4MEZA 2L4RA 2I72A 2JKRM 5EVLA 4D2OA 4RX2A 5A8BA 1YT4A 1VETB 1LSXA 4BL3A 1MWRA 1FCMA 1WYCA 5DVAA 4E3NA 4OVDA 5AVFA 2Y8HA 3E2LA 3EOIA 3T4OA 4HIAA 1MWUA 3UB5P 4IJGA 3DTIA 3IXHA 4E6XA 1LI9A 1IYSA 3Q81A 3M2KA 1L0GA 4F3LA 1TS6A 3CG5A 5DKLA 5CGSA 1NLYA 4HJ4A 2K7SA 3FKVA 4GW9A 5F69A 3R7WB 4UEYA 4BENA 1MWSA 1XJ3A 5E2HA 4II7A 3HLDA 1ZG6A 4LV0A 2HP9A 4K0WA 2ZL1B 1ACFA 1FILA 3DWZA 4GD8A 3FKWA 3P09A 3SW1A 1RGYA 1K56D 4OQGA 4MLLA 4LGWA 5EVIC 3UO9A 1S1ZA 1P9WA 1YAXA 3D3OA 1IFQA 1OJGA 3PR6A 4MBKA 3ZYTA 1HTZA 3L9KA 2J9PA 4EEPA 2PAVP 4KQDA 5IT5A 1TS7A 3CAXA 3G34A 4MBFA 3S7OA 3CJMA 3MSHA 2Z6DA 1VQQA 3LEZA 4PM5A 3F1OB 4QY5A 2DCFA 4IBRA 4NXFA 2ZBBA 4U0TA 4HEFA 2H0TA 2EA9A 1H3QA 1H8YA 1S0WA 4A5RA 1D7EA 2VKSA 4YNRA 1H0MA 4HY8A 4IEDA 1HLUP 3G35A 3B33A 2C5WB 4R4SA 4CLCC 5KSCA 4BD1A 1XA7A 4Q8IA 1I2SA 2V20A 1DP6A 1TS0A 4I3IA 5I94A 5EOEA 3PBRA 2WZZA 4X68A 3BFGA 5CHUA 4IVIA 3W4OA 3AGEA 3KSFA 3IXDA 3IBJA 4FSFA 1FCNA 1W63Q 2NUTC 4PAUA 2EXBA 1Q2PA 5HD3A 1RGZA 3HUOA 3BWLA 4NXGA 3D72A 1CQAA 4XT2B 5DF9A 3CUEC 5U47A 2A24A 2WKPA 2J80A 4UAAA 2R9XA 1S1YA 4GDBA 4UQIS 1OJ5A 4ZJ1A 4OPYA 3JVVA 4Q0JA 3ZG7B 1CI9A 4Q0IA 3IH9A 3FC7A 2Y2HA 3T4QA 1GCEA 3F1NA 1PRQA 1K6SA 2V2FF 4PKYG 2XA7S 5HAPA 1D1JA 1XGJA 3Q07A 3MZDA 4DDYA 4X56A 4R3AA 2FFYA 2BG1A 2ZC4B 3DTKA 1V9YA 4EBLA 1XGIA 2ZQCA 4ZRRA 1YLTA 1YPRA 3FG8A 1H8MA 3OOVA 2XDMA 4Y2FA 4FUWA 2O99A 3HLCA 3JYIA 3VOZA 2Z2MB 3IXGA 3OC2A 2WKQA 3LEQA 3IWIA 4DXCA 1GHPA 3GQZA 5JYPA 2PU2A 4FOFA 5DTSA 3BQAA 4S2IA 2VV6A 3LICA 4GJ4A 2RL3A 4OOMA 4Y15A 5GHYA 3P98A 3A3EA 5J8XA 3BY9A 1ES5A 4I38A 1TD5A 3K2NA 5FASA 3VSKA 1WA9A 3OCLA 1MKIA 4EWFA 4X25A 5E2EA 1Z6FA 5EUAA 3C8CA 2HPBA 2HGVA 5IS1A 1EWZA 3WRTA 3OZHA 3IHBA 2OAQ1 5TFQA 4GKUA 4X53A 1OT9A 3IX4A 1DJCA 1Y4OA 3BQ8A 5IU1A 1KVMA 4H6JA 2WUQA 3IS2B 5TBMB 1BLPA 1CI8A 2IA2A 1K57A 1U60A 3IX3A 2ZQ8A 2W3FA 5FAQA 2GDNA 3H7WA 1JWPA 4FD8A 2VK3A 3PBOA 4E3LA 5TR7A 3W2ZA 4NG2A 2GJ3A 1W63M 2HP5A 1XFNA 2P9VA 3T4SA 4GN2A 4CPKA 3DW0A 4DDSA 1JWZA 2HF6A 4KZ9A 3ZFZA 3C4PA 4OQHA 5GLBA 4P0MA 4BQMA 1KGFA 3MKFA 2WAEA 4K0XA 3UE0A 3C30A 4JF4A 3BJNA 3PBTA 3OBFA 1DY6A 1CEGA 3M6BA 3TE8A 2KOIA 4ZDXA 3AGFA 2XFTA 2MJ6A 3MR0A 2QKPA 3UPNA 1F9IA 2Y91A 5J7EA 2VX8A 1MY8A 4Q0HA 3KYEA 4PHTA 4U0XA 3LIDA 3N7WA 4HBUA 3IF6C 3GR2A 5CHJA 4MDZA 1TS8A 3PBQA 3UE3A 2J7VA 1YMSA 3H9WA 1JVJA 5EVIB 5HDDA 5HSQA 3A3FA 1S66L 2FZ0A 2X01A 4OPRA 3U2AA 5LBRA 1YLYA 2B5RA 2ZQAA 1FSYA 1K25A 2WZXA 5KSHA 3C5AA 2BASA 1JNUA 4OLDA 3BLSA 4Z9QA 4QHCA 3WS4A 3A0VA 5FL3A 4F3LB 3MQ0A 4GLQA 3RXWA 3VV4A 1YMXA 3FPWA 5E2FA 4EBPA 1KDWA 5FAOA 2QMIA 4KQQA 1T1AA 5CERA 4CLCE 4WZ5A 4IBXA 2G2WA 1EROA 2XD1A 2J3WA 4EV4A 4WEJA 5FAPA 3HJIA 3ZCZA 4MN5A 4ID4A 5FQKA 4JLFA 4FH2A 4YINA 2UV0E 4ZAMA 3O86A 2UWXA 4ETXA 1YM1A 4L0LA 3AGDA 3A3IA 3UPPA 2DRWA 4OP8A 4BBVA 3N8LA 1ZTUA 3N4IA 5CEDA 3S4XA 3HLBA 3RH8B 4CLCB 4O7DA 3OPRA 5CECA 2XQZA 5AQAA 5F83A 4ZJ2A 1S4RA 2WKHA 2NUPC 3ZNTA 2V1BA 4RQ9A 5AQBA 3GTCA 3GDIA 4BL2A 3S7NA 5M18A 5CEBA 1BULA 2G7UA 3IQAA 1ES4A 2B95A 4NEED 5HL6A 3LIAA 4E3KA 3H82B 5J4EA 1PNEA 1GHMA 4KZBA 1VB6A 3IH8A 1OTBA 1RP5A 1Y54A 2PD8A 4K91A 1Q2QA 3LFVA 4BMWA 3FYZA 2WYXA 3ZQ5A 5EM0A 3QP6A 1OT6A 2HDUA 3ITBA 3MXQA 1LSWA 4YWZA 3BRMA 1K54A 2VLGA 3DTMA 3LR3A 4ME4A 2OV5A 4R6LA 4MMNA 1L0FA 4KG6A 1SDNA 2VV7A 3FWLA 2HDQA 4Y3IA 5E2GA 2ZQ9A 2IWBA 3LI9A 3HUNA 3C38A 2LB9A 2ZMVA 1JTGA 4FH4A 3MXRA 4HESA 5EPHA 2A24B 2W3EA 2PD7A 4MNRA 1MKMA 1PWCA 3OPLA 4IUKA 2JN7A 2X02A 2ZMAA 1QMFA 3IT9A 3QHYA 1CK3A 1Y28A 2EX2A 5L2FA 1ES3A 1L0EA 1OMEA 4E04A 4N1XA 3VFHA 4BBUA 1P97A 2J3TC 2ZOHA 4KG5A 1TF1A 2PU4A 1M40A 3UMEA 2OLUA 3HL9A 3Q1FA 3V39A 4R23A 3BFFA 5EVID 4FTXA 2B18A 2M7VA 1MPLA 1MC0A 3LY3A 1PZPA 3ZG0A 4BLMA 2OLVA 1N9OA 3MZEA 2A3UA 1PI4A 2YKFA 4JPMA 2Y2QA 5DFXA 1J9MA 2Z6CA 2V8FA 1K55A 1VEUB 1YKDA 3PXPA 4P6BA 2XR0A 4HI4A 3ULFA 4KZ5A 5CRFA 1H8ZA 3PHYA 4LLOB 3NOUC 4UA6A 1PYYA 3T1QB 5CHMA 3MFDA 4OLGA 4DKIA 4MBHA 4EQIA 3JPUA 5M19A 4DMZA 4E3MA 4L9EA 1L0DA 4E6WA 3VP0A 1K4EA 1K56A 2JKTM 3WRZA 4DE2A 2XF3A 3V3SA 4CLCD 2Y55A 3NULA 4RYEA 4S2NA 3G2ZA 4S2OA 4DXBA 4PMAA 3BFDA 1G6OA 2K31A 2XLNA 5G4YA 3Q7ZA 1N9LA 1XA1A 4WZ4A 1KE4A 3C7VA 3Q7VA 3DWKA 3F1PB 4LCMA 3UB6A 3O5YA 2VGLM 3NOPC 1LL5A 2ZMFA 4LV3A 3FV7A 5HW3A 3IXBA 3LGOA 3SH8A 3IF6B 5L8MA 3E2KA 4LENA 4CJNA 4KZ4A 4R1GA 4EUVA 3UN7A 3SZTA 3OCNA 1NXYA 3IX8A 2ZM8A 4JF5A 4S2JA 5CGXA 2Q0OA 2BTFP 2D02A 2W27A 5IHVA 4UA7A 3QP5A 2OAP1 5D3OA 1SKFA 1ERQA 1SDEA 4R3BA 1LLBA 3G4PA 3T1XA 3UE6A 1QMEA 2QYBA 2QZ6A 5CXWA 2P7JA 2ZC7A 4HBTA 4GOGA 1IEMA 2Y2GA 2JKRI 1IOUA 3VMAA 2Y2MA 1SKOA 3V3RA 3V67A 3LR5A 4JXVA 3ZGAB 4DJ3A 1LSVA 5EECA 1FR6A 3G6OA 4EW7A 2OOLA 2K2NA 3N6IA 4GHIA 2JHEA 3NOTC 2FH5A 4QJGA 3C7UA 3NJAA 1ESIA 1RCJA 2M7UA 3NECA 4JGRA 4B4XA 2JKFA 1BTLA 4ZTKA 3UDIA 1VETA 4WEKA 2E8IA 4LRXC 4JGPA 3PBNA 3M6HA 2INWA 2W1RA 1OPXA 3UE1A 4KUOA 4NK3A 4ZJ3A 1NJ4A 3EEAA 1BUEA 4X69A 2ZM2A 3B42A 1PWDA 1YQSA 1BLCA 3R7WA 5DJTA 3T1SA 2VA0A 2FFFB 5I5LA 5J3WA 2PBDP 4KG2A 1BLHA 3LY4A 2ZD8A 1LT0A 2ZQDA 3G31A 1NY0A 4ARZA 2W1TA 3E4OA 1G6AA 4OPZA 3MF0A 4N9LA 2XFSA 1NZOA 4GCZA 3ZVWA 4YFMA 1NRFA 2WGWB 4P6ZM 1BYWA 3IBRA 4WMCD 3T4KA 1DP8A 4WUJA 3BW6A 3O3VA 3S7PA 2GZAA 3FPVA 4GS9B 3TSGA 2KLIA 5TJJA 1CEFA 3E98A 3TOIA 3G32A 1NZUA 1YLWA 4KZ8A 3VP4A 3FZCA 4AFIA 3F1OA 3SS3A 2H5SA 3SH7A 4LRYC 3NBLA 2Y2PA 1S67L 2XRNA 1NLZA 1PI5A 3S1YA 1LI0A 3BECA 2E8JA 3BM6A 3VP2A 4EQ1A 4I3JA 4NKPA 5F1GA 3CWFA 3CI6A 3T4LA 2KDKA 1JTDA 5FATA 2V1ZA 2A49A 4EU0A 1L2SA 1MBLA 4GZBA 2ZLYA 2QWSA 4XUZA 1JWVA 4JGOA 4DF6A 3NDEA 4HP4A 4XXRA 3EGDC 2V0WA 5FQQA 2PDRA 1E3UD 4DN0A 1YSPA 4KQOA 3WWXA 1BT5A 3ISGA 5EM1A 2ZQ7A 3G30A 4C6YA 2PR5A 4XT2A 3JVUA 2XH9A 4ETZA 3LI8A 4DRTA 3TRCA 2ZJ9A 3NI9A 4OONA 1TDLA 4HJ3A 5FDHA 2JKGA 5HWTA 2EXAA 4MN7A 2ZC3B 3C4OA 3HLEA 3UB9A 4WYYA 2VZWA 4R70A 3NCKA 4QU3A 5HPIA 1PWGA 1YLPA 4EERA 4HP9A 5AQ7A 1ERMA 5FEFA 1M6KA 4X6TA 4S2MA 3PAGA 2G2UA 2V8CA 1GHIA 3E0YA 4HOIA 2O9CA 3E4PA 5DF8A 4CQHA 3KSGA 4OP5A 1XJ2A 1FR1A 3MZFA 1LL9A 1UWNX 1IELA 3ICYA 2IWDA 4EEUA 5AQ9A 2VJWA 1NRJA 5HL1A 1EI5A 2J8YA 3KX0X 2P74A 4EBNA 5KMWA 2C6WB 3CHWP 3QP1A 1HVBA 2HJ9C 3Q7VB 4OOLA 4GD6A 5L09A 1T1CA 1WYBA 3WS0A 2O0YA 3QP2A 2XSSA 1F2KA 1K6RA 2VV8A 3A3DA 3HCYA 2VEAA 4R3JA
chains in the Genus database with same CATH topology
3WRZA 4DE2A 4EBLA 2XF3A 3V3SA 1XGIA 2JC7A 1XX2A 3W8KA 3VP3A 2ZQCA 2Y55A 1YLTA 4RYEA 4S2NA 1E3UA 3G2ZA 4S2OA 1VM1A 2EX8A 4JBFA 2XDMA 4QY6A 4DXBA 4PMAA 3BFDA 3HLCA 5GLCA 3VOYA 1MXOA 2J9OA 2XLNA 3JYIA 3VOZA 2Z2MB 3I7JA 3IXGA 3OC2A 1GA0A 3IWIA 1GHPA 1XA1A 3Q7ZA 4OQ0A 4DXCA 3GQZA 5JYPA 2PU2A 4DE3A 4WZ4A 1SHVA 5DTSA 1KE4A 4S2IA 4BJPA 3C7VA 3GVBA 4OOMA 1E25A 2RL3A 2QPNA 3HUMA 5GHYA 3Q7VA 3P98A 3DWKA 4PM7A 3WS5A 5CTNA 3UDXA 3A3EA 4LCMA 2VGJA 5J8XA 2Y2KA 1ES5A 2WKEA 5JYOA 3SS5A 4LCLA 1LL5A 4LV3A 3FV7A 3LO7A 1HZOA 5FASA 3VSKA 1SCWA 3IXBA 5HW3A 3OCLA 3CZDA 1MKIA 4GNUA 4EWFA 3SH8A 5E2EA 3ZG8B 3IF6B 1Z6FA 5EUAA 4KQRA 3E2KA 4LENA 1N4OA 4S2KA 4CJNA 4B4ZA 4KZ4A 2HPBA 3HLWA 4R1GA 2ZM0A 4Y7PA 1AXBA 2IWCA 1EWZA 3WRTA 3OZHA 1K54C 3IHBA 1BSGA 3MKEA 3UN7A 3W4QA 4QD4A 1IYQA 3OCNA 5TFQA 4KZ6A 5EE8A 3IF5A 1NXYA 1TDGA 4GKUA 5GL9A 4X53A 2ZM8A 3O88A 4JF5A 4S2JA 5CGXA 1DJCA 4WELA 4RVAA 3HLFA 3RXXA 3HLGA 4S2PA 5IHVA 4UA7A 2JBFA 1KVMA 5FQMA 4Y0OA 1IYOA 2WUQA 5D3OA 1BLPA 1SKFA 5GLAA 1CI8A 1ERQA 1K57A 1SDEA 1U60A 5CTMA 3NY4A 2ZC5B 1PW8A 4R3BA 2ZQ8A 1W8QA 3RJUA 3HREA 1LLBA 2EX6A 1PIOA 2GDNA 3G4PA 1QMEA 3GV9A 3O87A 4N92A 5FAQA 3CMZA 3V5MA 2QZ6A 4E3OA 5CXWA 2ZC7A 1JWPA 1IYPA 4JXSA 4FD8A 3IWOA 3OPHA 3PBOA 4HBTA 1FQGA 2Y59A 4UA9A 5EVIA 4GOGA 1IEMA 3UNWA 3UY6A 2Y2GA 4E3LA 4OP5A 4PPRA 4WZ5C 5TR7A 1BZAA 4GB7A 4LV1A 2XD5A 4BD0A 4JXWA 5BOHA 2Y2IA 3VMAA 1FSWA 2Y2MA 2HP5A 2WAFA 2P9VA 5GLDA 4GN2A 3V3RA 2HDSA 4CPKA 3DW0A 3MXSA 3VFFA 1W7FA 1KVLA 4DDSA 2DNSA 1JWZA 4JXVA 4PM6A 3IWQA 3ZGAB 3BLMA 1TEMA 5HARA 1YLZA 5EECA 1FR6A 3BYDA 4KZAA 4KZ9A 3ZFZA 3C4PA 4OQHA 5F82A 4P0MA 3N6IA 5GLBA 4BQMA 1KGFA 3MKFA 2WAEA 4Y0TA 4K0XA 3UE0A 3MBZA 1ONHA 3D4FA 4QJGA 4JF4A 4N1HA 3C7UA 3PBTA 1WE4A 4ZBEA 3IHAA 1DY6A 3BFCA 4RX3A 5GHZA 3S22A 1CEGA 1ESIA 1RCJA 3HVFA 3M6BA 4XUXA 4ZDXA 3AGFA 2Y4AA 5FI7A 3GRJA 4WM9A 4B4XA 1KE3A 2XFTA 2WGWA 5A90A 2H10A 1I5QA 3ZNYA 1BTLA 4ZTKA 3ZHHA 3UDIA 4GDNA 2H0YA 1IKGA 3UPNA 4WEKA 3Q82A 2CC1A 1NYYA 2Y91A 1G68A 2ZC6B 1XP4A 1NYMA 2E8IA 1YLJA 1LHYA 3PBNA 1MY8A 4B88A 3M6HA 4IVKA 1K55C 4PM8A 4U0XA 4OH0A 4E3IA 3N7WA 4HBUA 3IF6C 5A92A 3GR2A 5CHJA 5FI2A 2Q9MA 3SOIA 3UE1A 5FQ9A 4NK3A 4ZJ3A 3TG9A 1NJ4A 3PBQA 3UE3A 2J7VA 1YMSA 1BUEA 4X69A 1JVJA 2ZM2A 4H8RA 3B3XA 5EVIB 5HFOA 1PWDA 1YQSA 3UDFA 3EQUA 3A3FA 4JF6A 4N9KA 2X01A 4OPRA 2PBYA 3BFEA 1BLCA 1YLYA 2B5RA 4R4RA 2RCXA 4UHUA 5DF7A 2ZQAA 5GHXA 2WKIA 1FSYA 5FSRA 1K25A 2WZXA 5KSHA 3C5AA 1C3BA 2P9VB 2FFFB 3NC8A 4OLDA 5EOOA 2XK1A 3BLSA 4Z9QA 4KG2A 4S2LA 3GSGA 4QHCA 3WS4A 3WS1A 2JE5A 1FOFA 1ES2A 1BLHA 3RXWA 1PW1A 3LY4A 3SS4A 2ZD8A 1YMXA 5E2FA 3VP1A 4EBPA 1KDWA 5FAOA 1KGGA 2ZQDA 1XKZA 4DE0A 2Y2NA 3G31A 2QMIA 4KQQA 4WBGA 5CERA 1NY0A 3OPPA 4WZ5A 1W79A 4IBXA 4OQIA 4S2NC 2G2WA 1EROA 2XD1A 2XEPA 5E43A 1G6AA 4OPZA 4EV4A 4WEJA 5G18A 5FAPA 4MEZA 3ZCZA 2I72A 4N9LA 2XFSA 1NZOA 3ZVWA 4YFMA 4ID4A 5FQKA 4M3KA 1NRFA 3ZVTA 4JLFA 5EVLA 2WGWB 4FH2A 4YINA 4RX2A 4D2OA 4F94A 2EFUA 4WMCD 4ZAMA 3O86A 1YT4A 2UWXA 1YM1A 4L0LA 3AGDA 3A3IA 3O3VA 3UPPA 4BL3A 1MWRA 1FCMA 1WYCA 5DVAA 4E3NA 4OVDA 3E2LA 3TSGA 4C75A 3QNBA 2DRWA 4OP8A 1MWUA 4P85A 4Y0UA 1CEFA 3TOIA 3N8LA 3G32A 3N4IA 1NZUA 1YLWA 1ZG4A 4KZ8A 3HLBA 3S4XA 5CEDA 2Z2LB 3VP4A 3FZCA 3IXHA 4E6XA 4O7DA 1ALQA 1IYSA 1LI9A 3OPRA 2XQZA 3M2KA 3Q81A 2H5SA 1L0GA 5AQAA 3SH7A 3SS3A 5CECA 2R9WA 5F83A 4ZJ2A 3ZG9B 1KE0A 3CG5A 3NBLA 2Y2PA 2WKHA 3EQVA 5CGSA 4RA7A 3ZNTA 2X71A 1DJAA 3FKVA 1O07A 5FI6A 5AQBA 3GTCA 4U3TA 1ZKJA 1PI5A 3S1YA 4BL2A 1IKIA 1LI0A 3BECA 4BENA 5M18A 1MWSA 3BM6A 5CEBA 5FQJA 4OPQA 3VP2A 5E2HA 3HLDA 5F1GA 3NIAA 2WGIA 1BULA 4PM9A 5DTTA 1ZG6A 1HD8A 1ZC2A 3IQAA 4LV0A 2HP9A 1ES4A 1JTDA 1N9BA 4K0WA 4KZ3A 5FATA 5HAIA 3G2YA 2JCHA 5DTKA 2V1ZA 4P87A 4E3KA 2A49A 1L2SA 3UPOA 3DWZA 1GHMA 4GD8A 3IH8A 1MBLA 4KZBA 4GZBA 3FKWA 1RP5A 2ZLYA 3P09A 1RGYA 1Y54A 4K91A 1K56D 4OQGA 3ITAA 4MLLA 1Q2QA 3PAEA 4XUZA 1JWVA 5EVIC 4DE1A 3UO9A 3FYZA 5A93A 2WYXA 4DF6A 1K38A 1W5DA 3NDEA 4XXRA 5FQQA 5CGWA 1E3UD 2HDUA 3ITBA 2Y2JA 2Y2OA 4KQOA 2EFXA 3BRMA 1K54A 1O7EA 4MBKA 4X55A 3DTMA 3WWXA 3W4PA 2VGKA 1BT5A 3ISGA 3PTEA 1HTZA 2J9PA 1GA9A 2OV5A 1L0FA 2ZQ7A 3G34A 4KG6A 5M1AA 3SH9A 4MBFA 3WS2A 3G30A 4C6YA 1SDNA 4FCFA 3CJMA 1MWTA 2XH9A 3V50A 1VQQA 3FWLA 4KENB 4DRTA 2HDQA 3QNCA 3LEZA 4PM5A 2WGVA 2ZJ9A 3NI9A 5E2GA 4QY5A 3GMWA 4OONA 1I2WA 2ZQ9A 2IWBA 1TDLA 2DCFA 4IBRA 1DJBA 5FDHA 3HUNA 2HP6A 2EXAA 4U0TA 3ZG5A 4HEFA 2H0TA 3ZDJA 1XPBA 1JTGA 2ZC3B 4FH4A 3C4OA 3MXRA 1FCOA 4HESA 3HLEA 5EPHA 3VSLA 4MNRA 1PWCA 1W8YA 3OPLA 4WYYA 5A91A 1H8YA 3NCKA 4QU3A 2X02A 1S0WA 1PWGA 1YLPA 4A5RA 2ZMAA 5TGFA 1QMFA 5AQ7A 1ERMA 3IT9A 3QHYA 1CK3A 4IEDA 1M6KA 3G35A 2EX2A 5L2FA 1ES3A 1L0EA 3PBSA 4C3QA 1OMEA 2C5WB 4R4SA 4X6TA 4S2MA 3PAGA 4EUZA 5HAQA 5KSCA 2G2UA 4N1XA 4R0QA 1XA7A 3VFHA 4BD1A 4Q8IA 3HBRA 4KG5A 1I2SA 2V20A 5HX9A 2PU4A 4NETA 4OKPA 1GHIA 1M40A 3M2JA 2OLUA 4JXGA 5DF8A 3HL9A 3Q1FA 3V39A 4R23A 3NDGA 4WMCA 5EOEA 5I94A 3LCEA 2BLSA 2WZZA 3BFFA 2OSUA 3PBRA 3BFGA 3MZFA 1FR1A 2WK0A 4X68A 4IVIA 5CHUA 5EVID 3W4OA 3AGEA 1LL9A 1IELA 1MPLA 2EX9A 3LY3A 1PZPA 3IXDA 3ZG0A 2IWDA 4BLMA 1KGEA 2OLVA 5AQ9A 4KZ7A 2XGNA 4FSFA 1K4FA 1FCNA 1TVFA 3MZEA 2A3UA 2EXBA 1ESUA 1Q2PA 4E3JA 1PI4A 5HL1A 1EI5A 1RGZA 3HUOA 2J8YA 1BLSA 4JPMA 2Y2QA 5DF9A 2WADA 2P74A 4EBNA 5U47A 1J9MA 5KMWA 5FQIA 1XXMA 1K55A 2C6WB 3A3JA 1ONGA 5KZHA 4P6BA 2XR0A 3IF6A 4KZ5A 1HVBA 4UAAA 2R9XA 1K57C 3BEBA 3Q7VB 4OOLA 5CRFA 4GDBA 1E4DA 1H8ZA 4GD6A 4ZJ1A 4OPYA 2Q9NA 2Y2LA 1H5XA 3ZG7B 1WYBA 1PYYA 4UA6A 3WS0A 1PZOA 1CI9A 5CHMA 3MFDA 3N8SA 3IH9A 4MBHA 4OLGA 4DKIA 4LV2A 2Y2HA 4EQIA 1GCEA 4QB8A 5M19A 1K6SA 4OOYA 2V2FF 3N8RA 1KDSA 1XGJA 3Q07A 5HAPA 3MZDA 1K6RA 4DDYA 4E3MA 4X56A 1S6RA 1L0DA 4E6WA 3A3DA 3VP0A 2FFYA 5FA7A 4JKTA 2BG1A 1K4EA 1K56A 2HDRA 2ZC4B 4R3JA 5F1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WRZ A;  4DE2 A;  4EBL A;  2XF3 A;  3V3S A;  1XGI A;  2JC7 A;  1XX2 A;  3W8K A;  3VP3 A;  2ZQC A;  2Y55 A;  1YLT A;  4RYE A;  4S2N A;  1E3U A;  3G2Z A;  4S2O A;  1VM1 A;  2EX8 A;  4JBF A;  2XDM A;  4QY6 A;  4DXB A;  4PMA A;  3BFD A;  3HLC A;  5GLC A;  3VOY A;  1MXO A;  2J9O A;  2XLN A;  3JYI A;  3VOZ A;  2Z2M B;  3I7J A;  3IXG A;  3OC2 A;  1GA0 A;  3IWI A;  1GHP A;  1XA1 A;  3Q7Z A;  4OQ0 A;  4DXC A;  3GQZ A;  5JYP A;  2PU2 A;  4DE3 A;  4WZ4 A;  1SHV A;  5DTS A;  1KE4 A;  4S2I A;  4BJP A;  3C7V A;  3GVB A;  4OOM A;  1E25 A;  2RL3 A;  2QPN A;  3HUM A;  5GHY A;  3Q7V A;  3P98 A;  3DWK A;  4PM7 A;  3WS5 A;  5CTN A;  3UDX A;  3A3E A;  4LCM A;  2VGJ A;  5J8X A;  2Y2K A;  1ES5 A;  2WKE A;  5JYO A;  3SS5 A;  4LCL A;  1LL5 A;  4LV3 A;  3FV7 A;  3LO7 A;  1HZO A;  5FAS A;  3VSK A;  1SCW A;  3IXB A;  5HW3 A;  3OCL A;  3CZD A;  1MKI A;  4GNU A;  4EWF A;  3SH8 A;  5E2E A;  3ZG8 B;  3IF6 B;  1Z6F A;  5EUA A;  4KQR A;  3E2K A;  4LEN A;  1N4O A;  4S2K A;  4CJN A;  4B4Z A;  4KZ4 A;  2HPB A;  3HLW A;  4R1G A;  2ZM0 A;  4Y7P A;  1AXB A;  2IWC A;  1EWZ A;  3WRT A;  3OZH A;  1K54 C;  3IHB A;  1BSG A;  3MKE A;  3UN7 A;  3W4Q A;  4QD4 A;  1IYQ A;  3OCN A;  5TFQ A;  4KZ6 A;  5EE8 A;  3IF5 A;  1NXY A;  1TDG A;  4GKU A;  5GL9 A;  4X53 A;  2ZM8 A;  3O88 A;  4JF5 A;  4S2J A;  5CGX A;  1DJC A;  4WEL A;  4RVA A;  3HLF A;  3RXX A;  3HLG A;  4S2P A;  5IHV A;  4UA7 A;  2JBF A;  1KVM A;  5FQM A;  4Y0O A;  1IYO A;  2WUQ A;  5D3O A;  1BLP A;  1SKF A;  5GLA A;  1CI8 A;  1ERQ A;  1K57 A;  1SDE A;  1U60 A;  5CTM A;  3NY4 A;  2ZC5 B;  1PW8 A;  4R3B A;  2ZQ8 A;  1W8Q A;  3RJU A;  3HRE A;  1LLB A;  2EX6 A;  1PIO A;  2GDN A;  3G4P A;  1QME A;  3GV9 A;  3O87 A;  4N92 A;  5FAQ A;  3CMZ A;  3V5M A;  2QZ6 A;  4E3O A;  5CXW A;  2ZC7 A;  1JWP A;  1IYP A;  4JXS A;  4FD8 A;  3IWO A;  3OPH A;  3PBO A;  4HBT A;  1FQG A;  2Y59 A;  4UA9 A;  5EVI A;  4GOG A;  1IEM A;  3UNW A;  3UY6 A;  2Y2G A;  4E3L A;  4OP5 A;  4PPR A;  4WZ5 C;  5TR7 A;  1BZA A;  4GB7 A;  4LV1 A;  2XD5 A;  4BD0 A;  4JXW A;  5BOH A;  2Y2I A;  3VMA A;  1FSW A;  2Y2M A;  2HP5 A;  2WAF A;  2P9V A;  5GLD A;  4GN2 A;  3V3R A;  2HDS A;  4CPK A;  3DW0 A;  3MXS A;  3VFF A;  1W7F A;  1KVL A;  4DDS A;  2DNS A;  1JWZ A;  4JXV A;  4PM6 A;  3IWQ A;  3ZGA B;  3BLM A;  1TEM A;  5HAR A;  1YLZ A;  5EEC A;  1FR6 A;  3BYD A;  4KZA A;  4KZ9 A;  3ZFZ A;  3C4P A;  4OQH A;  5F82 A;  4P0M A;  3N6I A;  5GLB A;  4BQM A;  1KGF A;  3MKF A;  2WAE A;  4Y0T A;  4K0X A;  3UE0 A;  3MBZ A;  1ONH A;  3D4F A;  4QJG A;  4JF4 A;  4N1H A;  3C7U A;  3PBT A;  1WE4 A;  4ZBE A;  3IHA A;  1DY6 A;  3BFC A;  4RX3 A;  5GHZ A;  3S22 A;  1CEG A;  1ESI A;  1RCJ A;  3HVF A;  3M6B A;  4XUX A;  4ZDX A;  3AGF A;  2Y4A A;  5FI7 A;  3GRJ A;  4WM9 A;  4B4X A;  1KE3 A;  2XFT A;  2WGW A;  5A90 A;  2H10 A;  1I5Q A;  3ZNY A;  1BTL A;  4ZTK A;  3ZHH A;  3UDI A;  4GDN A;  2H0Y A;  1IKG A;  3UPN A;  4WEK A;  3Q82 A;  2CC1 A;  1NYY A;  2Y91 A;  1G68 A;  2ZC6 B;  1XP4 A;  1NYM A;  2E8I A;  1YLJ A;  1LHY A;  3PBN A;  1MY8 A;  4B88 A;  3M6H A;  4IVK A;  1K55 C;  4PM8 A;  4U0X A;  4OH0 A;  4E3I A;  3N7W A;  4HBU A;  3IF6 C;  5A92 A;  3GR2 A;  5CHJ A;  5FI2 A;  2Q9M A;  3SOI A;  3UE1 A;  5FQ9 A;  4NK3 A;  4ZJ3 A;  3TG9 A;  1NJ4 A;  3PBQ A;  3UE3 A;  2J7V A;  1YMS A;  1BUE A;  4X69 A;  1JVJ A;  2ZM2 A;  4H8R A;  3B3X A;  5EVI B;  5HFO A;  1PWD A;  1YQS A;  3UDF A;  3EQU A;  3A3F A;  4JF6 A;  4N9K A;  2X01 A;  4OPR A;  2PBY A;  3BFE A;  1BLC A;  1YLY A;  2B5R A;  4R4R A;  2RCX A;  4UHU A;  5DF7 A;  2ZQA A;  5GHX A;  2WKI A;  1FSY A;  5FSR A;  1K25 A;  2WZX A;  5KSH A;  3C5A A;  1C3B A;  2P9V B;  2FFF B;  3NC8 A;  4OLD A;  5EOO A;  2XK1 A;  3BLS A;  4Z9Q A;  4KG2 A;  4S2L A;  3GSG A;  4QHC A;  3WS4 A;  3WS1 A;  2JE5 A;  1FOF A;  1ES2 A;  1BLH A;  3RXW A;  1PW1 A;  3LY4 A;  3SS4 A;  2ZD8 A;  1YMX A;  5E2F A;  3VP1 A;  4EBP A;  1KDW A;  5FAO A;  1KGG A;  2ZQD A;  1XKZ A;  4DE0 A;  2Y2N A;  3G31 A;  2QMI A;  4KQQ A;  4WBG A;  5CER A;  1NY0 A;  3OPP A;  4WZ5 A;  1W79 A;  4IBX A;  4OQI A;  4S2N C;  2G2W A;  1ERO A;  2XD1 A;  2XEP A;  5E43 A;  1G6A A;  4OPZ A;  4EV4 A;  4WEJ A;  5G18 A;  5FAP A;  4MEZ A;  3ZCZ A;  2I72 A;  4N9L A;  2XFS A;  1NZO A;  3ZVW A;  4YFM A;  4ID4 A;  5FQK A;  4M3K A;  1NRF A;  3ZVT A;  4JLF A;  5EVL A;  2WGW B;  4FH2 A;  4YIN A;  4RX2 A;  4D2O A;  4F94 A;  2EFU A;  4WMC D;  4ZAM A;  3O86 A;  1YT4 A;  2UWX A;  1YM1 A;  4L0L A;  3AGD A;  3A3I A;  3O3V A;  3UPP A;  4BL3 A;  1MWR A;  1FCM A;  1WYC A;  5DVA A;  4E3N A;  4OVD A;  3E2L A;  3TSG A;  4C75 A;  3QNB A;  2DRW A;  4OP8 A;  1MWU A;  4P85 A;  4Y0U A;  1CEF A;  3TOI A;  3N8L A;  3G32 A;  3N4I A;  1NZU A;  1YLW A;  1ZG4 A;  4KZ8 A;  3HLB A;  3S4X A;  5CED A;  2Z2L B;  3VP4 A;  3FZC A;  3IXH A;  4E6X A;  4O7D A;  1ALQ A;  1IYS A;  1LI9 A;  3OPR A;  2XQZ A;  3M2K A;  3Q81 A;  2H5S A;  1L0G A;  5AQA A;  3SH7 A;  3SS3 A;  5CEC A;  2R9W A;  5F83 A;  4ZJ2 A;  3ZG9 B;  1KE0 A;  3CG5 A;  3NBL A;  2Y2P A;  2WKH A;  3EQV A;  5CGS A;  4RA7 A;  3ZNT A;  2X71 A;  1DJA A;  3FKV A;  1O07 A;  5FI6 A;  5AQB A;  3GTC A;  4U3T A;  1ZKJ A;  1PI5 A;  3S1Y A;  4BL2 A;  1IKI A;  1LI0 A;  3BEC A;  4BEN A;  5M18 A;  1MWS A;  3BM6 A;  5CEB A;  5FQJ A;  4OPQ A;  3VP2 A;  5E2H A;  3HLD A;  5F1G A;  3NIA A;  2WGI A;  1BUL A;  4PM9 A;  5DTT A;  1ZG6 A;  1HD8 A;  1ZC2 A;  3IQA A;  4LV0 A;  2HP9 A;  1ES4 A;  1JTD A;  1N9B A;  4K0W A;  4KZ3 A;  5FAT A;  5HAI A;  3G2Y A;  2JCH A;  5DTK A;  2V1Z A;  4P87 A;  4E3K A;  2A49 A;  1L2S A;  3UPO A;  3DWZ A;  1GHM A;  4GD8 A;  3IH8 A;  1MBL A;  4KZB A;  4GZB A;  3FKW A;  1RP5 A;  2ZLY A;  3P09 A;  1RGY A;  1Y54 A;  4K91 A;  1K56 D;  4OQG A;  3ITA A;  4MLL A;  1Q2Q A;  3PAE A;  4XUZ A;  1JWV A;  5EVI C;  4DE1 A;  3UO9 A;  3FYZ A;  5A93 A;  2WYX A;  4DF6 A;  1K38 A;  1W5D A;  3NDE A;  4XXR A;  5FQQ A;  5CGW A;  1E3U D;  2HDU A;  3ITB A;  2Y2J A;  2Y2O A;  4KQO A;  2EFX A;  3BRM A;  1K54 A;  1O7E A;  4MBK A;  4X55 A;  3DTM A;  3WWX A;  3W4P A;  2VGK A;  1BT5 A;  3ISG A;  3PTE A;  1HTZ A;  2J9P A;  1GA9 A;  2OV5 A;  1L0F A;  2ZQ7 A;  3G34 A;  4KG6 A;  5M1A A;  3SH9 A;  4MBF A;  3WS2 A;  3G30 A;  4C6Y A;  1SDN A;  4FCF A;  3CJM A;  1MWT A;  2XH9 A;  3V50 A;  1VQQ A;  3FWL A;  4KEN B;  4DRT A;  2HDQ A;  3QNC A;  3LEZ A;  4PM5 A;  2WGV A;  2ZJ9 A;  3NI9 A;  5E2G A;  4QY5 A;  3GMW A;  4OON A;  1I2W A;  2ZQ9 A;  2IWB A;  1TDL A;  2DCF A;  4IBR A;  1DJB A;  5FDH A;  3HUN A;  2HP6 A;  2EXA A;  4U0T A;  3ZG5 A;  4HEF A;  2H0T A;  3ZDJ A;  1XPB A;  1JTG A;  2ZC3 B;  4FH4 A;  3C4O A;  3MXR A;  1FCO A;  4HES A;  3HLE A;  5EPH A;  3VSL A;  4MNR A;  1PWC A;  1W8Y A;  3OPL A;  4WYY A;  5A91 A;  1H8Y A;  3NCK A;  4QU3 A;  2X02 A;  1S0W A;  1PWG A;  1YLP A;  4A5R A;  2ZMA A;  5TGF A;  1QMF A;  5AQ7 A;  1ERM A;  3IT9 A;  3QHY A;  1CK3 A;  4IED A;  1M6K A;  3G35 A;  2EX2 A;  5L2F A;  1ES3 A;  1L0E A;  3PBS A;  4C3Q A;  1OME A;  2C5W B;  4R4S A;  4X6T A;  4S2M A;  3PAG A;  4EUZ A;  5HAQ A;  5KSC A;  2G2U A;  4N1X A;  4R0Q A;  1XA7 A;  3VFH A;  4BD1 A;  4Q8I A;  3HBR A;  4KG5 A;  1I2S A;  2V20 A;  5HX9 A;  2PU4 A;  4NET A;  4OKP A;  1GHI A;  1M40 A;  3M2J A;  2OLU A;  4JXG A;  5DF8 A;  3HL9 A;  3Q1F A;  3V39 A;  4R23 A;  3NDG A;  4WMC A;  5EOE A;  5I94 A;  3LCE A;  2BLS A;  2WZZ A;  3BFF A;  2OSU A;  3PBR A;  3BFG A;  3MZF A;  1FR1 A;  2WK0 A;  4X68 A;  4IVI A;  5CHU A;  5EVI D;  3W4O A;  3AGE A;  1LL9 A;  1IEL A;  1MPL A;  2EX9 A;  3LY3 A;  1PZP A;  3IXD A;  3ZG0 A;  2IWD A;  4BLM A;  1KGE A;  2OLV A;  5AQ9 A;  4KZ7 A;  2XGN A;  4FSF A;  1K4F A;  1FCN A;  1TVF A;  3MZE A;  2A3U A;  2EXB A;  1ESU A;  1Q2P A;  4E3J A;  1PI4 A;  5HL1 A;  1EI5 A;  1RGZ A;  3HUO A;  2J8Y A;  1BLS A;  4JPM A;  2Y2Q A;  5DF9 A;  2WAD A;  2P74 A;  4EBN A;  5U47 A;  1J9M A;  5KMW A;  5FQI A;  1XXM A;  1K55 A;  2C6W B;  3A3J A;  1ONG A;  5KZH A;  4P6B A;  2XR0 A;  3IF6 A;  4KZ5 A;  1HVB A;  4UAA A;  2R9X A;  1K57 C;  3BEB A;  3Q7V B;  4OOL A;  5CRF A;  4GDB A;  1E4D A;  1H8Z A;  4GD6 A;  4ZJ1 A;  4OPY A;  2Q9N A;  2Y2L A;  1H5X A;  3ZG7 B;  1WYB A;  1PYY A;  4UA6 A;  3WS0 A;  1PZO A;  1CI9 A;  5CHM A;  3MFD A;  3N8S A;  3IH9 A;  4MBH A;  4OLG A;  4DKI A;  4LV2 A;  2Y2H A;  4EQI A;  1GCE A;  4QB8 A;  5M19 A;  1K6S A;  4OOY A;  2V2F F;  3N8R A;  1KDS A;  1XGJ A;  3Q07 A;  5HAP A;  3MZD A;  1K6R A;  4DDY A;  4E3M A;  4X56 A;  1S6R A;  1L0D A;  4E6W A;  3A3D A;  3VP0 A;  2FFY A;  5FA7 A;  4JKT A;  2BG1 A;  1K4E A;  1K56 A;  2HDR A;  2ZC4 B;  4R3J A;  5F1F A; 
#chains in the Genus database with same CATH topology
 3A0R A;  3RFB A;  2JC7 A;  1XX2 A;  3LR0 A;  3VP3 A;  3W8K A;  4JBF A;  3LIF A;  4QY6 A;  2PHY A;  2J3T D;  3QP8 A;  1T18 A;  5GLC A;  3VOY A;  3I7J A;  4MCW A;  3GVB A;  1E25 A;  3LR4 A;  3RTY A;  3WS5 A;  5CTN A;  2VGJ A;  2Y2K A;  5JYO A;  1K0K A;  4LCL A;  1SCW A;  3UB8 A;  4GNU A;  5K5B A;  3ZG8 B;  4S2K A;  5F6A A;  3HLW A;  4Y7P A;  1K54 C;  1BSG A;  2XA7 M;  3W4Q A;  4WL9 A;  4QD4 A;  1IYQ A;  1G5U A;  4LFU A;  5EE8 A;  3O88 A;  1F98 A;  3F1N B;  4WEL A;  3HLF A;  3RXX A;  5CX7 A;  3HLG A;  5FQM A;  3EWK A;  1IYO A;  4NXE A;  5CTM A;  3NY4 A;  1PW8 A;  4DJ2 A;  2AVX A;  3RJU A;  1PIO A;  3O87 A;  3V5M A;  1XJ4 A;  5C5K A;  3VE4 A;  3IWO A;  3OPH A;  3VE3 A;  5EVI A;  2QHK A;  2W3D A;  2HZ5 A;  4LV1 A;  4G3W A;  2Y2I A;  1FSW A;  2WAF A;  5GLD A;  3K3C A;  1W7F A;  2DNS A;  3IWQ A;  5HAR A;  4Y13 A;  3BYD A;  4KZA A;  5F82 A;  1CJF A;  1VHM A;  4Y0T A;  3MBZ A;  1GSX A;  4O01 A;  1WE4 A;  4ZBE A;  3IHA A;  4I5S A;  4BWI A;  3BFC A;  1PFL A;  4RX3 A;  5GHZ A;  3LUQ A;  4WM9 A;  1KE3 A;  1OTE A;  3MS6 A;  1D06 A;  5A90 A;  2V1A A;  3ZHH A;  4GDN A;  2H0Y A;  4ARZ B;  4ESP A;  2CC1 A;  2W1T B;  1NYY A;  1NYM A;  4H6J B;  4K08 A;  4Y17 A;  2WKR A;  1K55 C;  4OH0 A;  2KX6 A;  1XJ6 A;  4YOF A;  5FI2 A;  2Q9M A;  3H7W B;  4CLC A;  3SOI A;  5FQ9 A;  2YKH A;  3MMH A;  3B3X A;  3UDF A;  2GX5 A;  3P01 A;  2PBY A;  1CF0 A;  3LIE A;  3T4T A;  2QJ5 A;  4R4R A;  5DF7 A;  4UHU A;  3GEC A;  2WKI A;  5FSR A;  5GHX A;  1C3B A;  2P9V B;  3LYX A;  3NC8 A;  2ZOI A;  4S2L A;  3GSG A;  2JE5 A;  1FOF A;  3SS4 A;  2PYR A;  2EWV A;  3CPT A;  1KGG A;  3H82 A;  3VOL A;  1XKZ A;  4DE0 A;  2Y2N A;  5EVE A;  1UWP X;  3CUE A;  1W79 A;  4S2N C;  4B93 A;  4I3A A;  2XEP A;  4QWO A;  3ZVT A;  4M3K A;  1Z09 A;  4F94 A;  2EFU A;  2B02 A;  1S4S A;  4O0P A;  4QPR A;  4C75 A;  3CLO A;  3QNB A;  3KYZ A;  2I9V A;  4G3V A;  4P85 A;  4Y0U A;  3T4J A;  1ZG4 A;  2EWW A;  3CIT A;  1N9N A;  2Z2L B;  4I39 A;  1ALQ A;  2R9W A;  3ZG9 B;  1KE0 A;  2Y79 A;  3EQV A;  2XRO A;  4RA7 A;  2X71 A;  1DJA A;  1O07 A;  4HJ6 A;  5FI6 A;  1OTI A;  4U3T A;  1ZKJ A;  3HJK A;  1IKI A;  3K3D A;  5FQJ A;  4OPQ A;  3NIA A;  2WGI A;  4MN6 A;  4PM9 A;  5DTT A;  1HD8 A;  1ZC2 A;  5L10 A;  4KZ3 A;  1N9B A;  5HAI A;  3DTE A;  3G2Y A;  2JCH A;  3D9Y A;  3MFX A;  5DTK A;  4P87 A;  4D60 A;  3LIB A;  3UPO A;  3ITA A;  3L7H A;  3PAE A;  4DE1 A;  2HV1 A;  5A93 A;  5AVE A;  3T12 B;  1LL8 A;  5F68 A;  1K38 A;  1W5D A;  5KIZ A;  5CGW A;  2Y2J A;  5EV0 A;  2Y2O A;  2EFX A;  1FIK A;  1O7E A;  4X55 A;  5HDC A;  3W4P A;  2VGK A;  1GSV A;  3PTE A;  5FDS A;  1GA9 A;  5G4Z A;  3SH9 A;  5M1A A;  2D01 A;  3WS2 A;  4FCF A;  5DJU A;  1MWT A;  3V50 A;  4KEN B;  3QNC A;  2WGV A;  1VEU A;  3GMW A;  1I2W A;  2PT7 A;  5HWV A;  2JKT I;  1DJB A;  2V0U A;  5DKK A;  2HP6 A;  4EET B;  3ZG5 A;  2ZL1 A;  4M4X A;  3ZDJ A;  4B9O A;  1XPB A;  1FCO A;  3VSL A;  1W8Y A;  5A91 A;  2QJ7 A;  5TGF A;  4LPZ A;  3PBS A;  4C3Q A;  3PYP A;  4EUZ A;  5HAQ A;  2L1M A;  1L3L A;  4R0Q A;  4O8G A;  2W0N A;  3HBR A;  5L07 A;  5HX9 A;  2P04 A;  4NET A;  4OKP A;  2HJE A;  1X0O A;  3M2J A;  4JXG A;  4EES A;  4IHQ A;  1F5M A;  3NDG A;  4WMC A;  3LCE A;  2BLS A;  2H28 A;  1ZHH B;  2OSU A;  2WK0 A;  4L9G A;  2EX9 A;  2PYP A;  1KGE A;  4KZ7 A;  1J3W A;  4G3K A;  2XGN A;  1K4F A;  1TVF A;  3KO6 A;  4E3J A;  1ESU A;  1OTA A;  3F1P A;  1BLS A;  2WAD A;  2DMW A;  1P0Z A;  2P08 A;  5HDS A;  5FQI A;  1XXM A;  5KZH A;  3A3J A;  1ONG A;  3IF6 A;  1K57 C;  3BEB A;  1T19 A;  2PRF A;  1E4D A;  2VGL S;  2Q9N A;  2Y2L A;  1H5X A;  2W3G A;  4EXO A;  1DP9 A;  1PZO A;  3N8S A;  4LV2 A;  1V9Z A;  2A2L A;  4QB8 A;  1G28 A;  4OOY A;  3N8R A;  2PR6 A;  3DAV A;  1KDS A;  3KYQ A;  1S6R A;  5FA7 A;  4JKT A;  5F1F A;  2HDR A;  4LRZ E;  3TW8 A;  1E3U A;  3R4K A;  1VM1 A;  2EX8 A;  3E4Q A;  5HD5 A;  1MXO A;  1DRM A;  2J9O A;  2O9A A;  2LB5 A;  1GA0 A;  4OQ0 A;  3TJZ C;  1YSQ A;  4DE3 A;  4PKY A;  1SHV A;  4BJP A;  2QPN A;  3HUM A;  4PM7 A;  3UDX A;  3UB7 A;  1NWZ A;  2WKE A;  3SS5 A;  3EGX C;  2V9A A;  3LO7 A;  1HZO A;  2OWJ A;  1GSW A;  3A0S A;  3CZD A;  1XFQ A;  2R78 A;  4HH2 A;  4HNB A;  1ODV A;  4KQR A;  4NXB A;  1N4O A;  1AWI A;  4B4Z A;  2ZM0 A;  1AXB A;  2IWC A;  2OWH A;  5AJG A;  3MKE A;  4JGQ A;  4KZ6 A;  3KSH A;  3B47 A;  3IF5 A;  1TDG A;  5GL9 A;  4RVA A;  3OLO A;  3MQQ A;  2W3H A;  4S2P A;  2JBF A;  4Y0O A;  3T50 A;  3QP4 A;  3T1R A;  5GLA A;  2GNX A;  4IUH A;  2ZC5 B;  4X1M A;  3DBA A;  1MZU A;  1W8Q A;  3HRE A;  3GV9 A;  2EX6 A;  4N92 A;  4R38 A;  3CMZ A;  3KSI A;  4E3O A;  1UGU A;  1IYP A;  4JXS A;  1KOU A;  4L9F A;  3MQO A;  1FQG A;  2Y59 A;  4UA9 A;  3UNW A;  3UY6 A;  4PPR A;  4WZ5 C;  1BZA A;  4GB7 A;  2XD5 A;  3BY8 A;  4JXW A;  4BD0 A;  5BOH A;  4HHD A;  4Y5F A;  1OTD A;  4Z1W A;  2HDS A;  3MXS A;  3VFF A;  1KVL A;  4PM6 A;  3BLM A;  1TEM A;  5F5Y A;  1YLZ A;  5MC7 A;  2L0W A;  2CMN A;  5HZH A;  3U4L P;  4WLA A;  1ONH A;  3D4F A;  4N1H A;  1P9R A;  3S22 A;  3HVF A;  4XUX A;  3IS2 A;  5TBM A;  3EEH A;  2Y4A A;  5FI7 A;  3GRJ A;  1A0K A;  2WGW A;  3CPT B;  2H10 A;  1I5Q A;  3ZNY A;  5HPF A;  1IKG A;  3Q82 A;  1G68 A;  2ZC6 B;  1XP4 A;  1YLJ A;  1LHY A;  4GS9 A;  3MJQ A;  4P6Z S;  1STZ A;  4B88 A;  4IVK A;  2ACG A;  4PM8 A;  3S7Q A;  5DFY A;  4E3I A;  4HQA A;  5FEG A;  5A92 A;  3TG9 A;  5HFO A;  4H8R A;  1SZV A;  2O9B A;  3EQU A;  4UQI M;  3NHQ A;  4JF6 A;  4N9K A;  3BFE A;  3P7N A;  5HWW A;  2RCX A;  1SKO B;  5EOO A;  2XK1 A;  3C2W A;  3UMD A;  4BBT A;  5EFW A;  3WS1 A;  1ES2 A;  1PW1 A;  4WF0 A;  3VP1 A;  1T1B A;  2M1C A;  4GHI B;  4X1L A;  4WBG A;  1EW0 A;  3OPP A;  4HH3 A;  4OQI A;  4WN5 A;  5E43 A;  4KUK A;  5G18 A;  4MEZ A;  2L4R A;  2I72 A;  2JKR M;  5EVL A;  4D2O A;  4RX2 A;  5A8B A;  1YT4 A;  1VET B;  1LSX A;  4BL3 A;  1MWR A;  1FCM A;  1WYC A;  5DVA A;  4E3N A;  4OVD A;  5AVF A;  2Y8H A;  3E2L A;  3EOI A;  3T4O A;  4HIA A;  1MWU A;  3UB5 P;  4IJG A;  3DTI A;  3IXH A;  4E6X A;  1LI9 A;  1IYS A;  3Q81 A;  3M2K A;  1L0G A;  4F3L A;  1TS6 A;  3CG5 A;  5DKL A;  5CGS A;  1NLY A;  4HJ4 A;  2K7S A;  3FKV A;  4GW9 A;  5F69 A;  3R7W B;  4UEY A;  4BEN A;  1MWS A;  1XJ3 A;  5E2H A;  4II7 A;  3HLD A;  1ZG6 A;  4LV0 A;  2HP9 A;  4K0W A;  2ZL1 B;  1ACF A;  1FIL A;  3DWZ A;  4GD8 A;  3FKW A;  3P09 A;  3SW1 A;  1RGY A;  1K56 D;  4OQG A;  4MLL A;  4LGW A;  5EVI C;  3UO9 A;  1S1Z A;  1P9W A;  1YAX A;  3D3O A;  1IFQ A;  1OJG A;  3PR6 A;  4MBK A;  3ZYT A;  1HTZ A;  3L9K A;  2J9P A;  4EEP A;  2PAV P;  4KQD A;  5IT5 A;  1TS7 A;  3CAX A;  3G34 A;  4MBF A;  3S7O A;  3CJM A;  3MSH A;  2Z6D A;  1VQQ A;  3LEZ A;  4PM5 A;  3F1O B;  4QY5 A;  2DCF A;  4IBR A;  4NXF A;  2ZBB A;  4U0T A;  4HEF A;  2H0T A;  2EA9 A;  1H3Q A;  1H8Y A;  1S0W A;  4A5R A;  1D7E A;  2VKS A;  4YNR A;  1H0M A;  4HY8 A;  4IED A;  1HLU P;  3G35 A;  3B33 A;  2C5W B;  4R4S A;  4CLC C;  5KSC A;  4BD1 A;  1XA7 A;  4Q8I A;  1I2S A;  2V20 A;  1DP6 A;  1TS0 A;  4I3I A;  5I94 A;  5EOE A;  3PBR A;  2WZZ A;  4X68 A;  3BFG A;  5CHU A;  4IVI A;  3W4O A;  3AGE A;  3KSF A;  3IXD A;  3IBJ A;  4FSF A;  1FCN A;  1W63 Q;  2NUT C;  4PAU A;  2EXB A;  1Q2P A;  5HD3 A;  1RGZ A;  3HUO A;  3BWL A;  4NXG A;  3D72 A;  1CQA A;  4XT2 B;  5DF9 A;  3CUE C;  5U47 A;  2A24 A;  2WKP A;  2J80 A;  4UAA A;  2R9X A;  1S1Y A;  4GDB A;  4UQI S;  1OJ5 A;  4ZJ1 A;  4OPY A;  3JVV A;  4Q0J A;  3ZG7 B;  1CI9 A;  4Q0I A;  3IH9 A;  3FC7 A;  2Y2H A;  3T4Q A;  1GCE A;  3F1N A;  1PRQ A;  1K6S A;  2V2F F;  4PKY G;  2XA7 S;  5HAP A;  1D1J A;  1XGJ A;  3Q07 A;  3MZD A;  4DDY A;  4X56 A;  4R3A A;  2FFY A;  2BG1 A;  2ZC4 B;  3DTK A;  1V9Y A;  4EBL A;  1XGI A;  2ZQC A;  4ZRR A;  1YLT A;  1YPR A;  3FG8 A;  1H8M A;  3OOV A;  2XDM A;  4Y2F A;  4FUW A;  2O99 A;  3HLC A;  3JYI A;  3VOZ A;  2Z2M B;  3IXG A;  3OC2 A;  2WKQ A;  3LEQ A;  3IWI A;  4DXC A;  1GHP A;  3GQZ A;  5JYP A;  2PU2 A;  4FOF A;  5DTS A;  3BQA A;  4S2I A;  2VV6 A;  3LIC A;  4GJ4 A;  2RL3 A;  4OOM A;  4Y15 A;  5GHY A;  3P98 A;  3A3E A;  5J8X A;  3BY9 A;  1ES5 A;  4I38 A;  1TD5 A;  3K2N A;  5FAS A;  3VSK A;  1WA9 A;  3OCL A;  1MKI A;  4EWF A;  4X25 A;  5E2E A;  1Z6F A;  5EUA A;  3C8C A;  2HPB A;  2HGV A;  5IS1 A;  1EWZ A;  3WRT A;  3OZH A;  3IHB A;  2OAQ 1;  5TFQ A;  4GKU A;  4X53 A;  1OT9 A;  3IX4 A;  1DJC A;  1Y4O A;  3BQ8 A;  5IU1 A;  1KVM A;  4H6J A;  2WUQ A;  3IS2 B;  5TBM B;  1BLP A;  1CI8 A;  2IA2 A;  1K57 A;  1U60 A;  3IX3 A;  2ZQ8 A;  2W3F A;  5FAQ A;  2GDN A;  3H7W A;  1JWP A;  4FD8 A;  2VK3 A;  3PBO A;  4E3L A;  5TR7 A;  3W2Z A;  4NG2 A;  2GJ3 A;  1W63 M;  2HP5 A;  1XFN A;  2P9V A;  3T4S A;  4GN2 A;  4CPK A;  3DW0 A;  4DDS A;  1JWZ A;  2HF6 A;  4KZ9 A;  3ZFZ A;  3C4P A;  4OQH A;  5GLB A;  4P0M A;  4BQM A;  1KGF A;  3MKF A;  2WAE A;  4K0X A;  3UE0 A;  3C30 A;  4JF4 A;  3BJN A;  3PBT A;  3OBF A;  1DY6 A;  1CEG A;  3M6B A;  3TE8 A;  2KOI A;  4ZDX A;  3AGF A;  2XFT A;  2MJ6 A;  3MR0 A;  2QKP A;  3UPN A;  1F9I A;  2Y91 A;  5J7E A;  2VX8 A;  1MY8 A;  4Q0H A;  3KYE A;  4PHT A;  4U0X A;  3LID A;  3N7W A;  4HBU A;  3IF6 C;  3GR2 A;  5CHJ A;  4MDZ A;  1TS8 A;  3PBQ A;  3UE3 A;  2J7V A;  1YMS A;  3H9W A;  1JVJ A;  5EVI B;  5HDD A;  5HSQ A;  3A3F A;  1S66 L;  2FZ0 A;  2X01 A;  4OPR A;  3U2A A;  5LBR A;  1YLY A;  2B5R A;  2ZQA A;  1FSY A;  1K25 A;  2WZX A;  5KSH A;  3C5A A;  2BAS A;  1JNU A;  4OLD A;  3BLS A;  4Z9Q A;  4QHC A;  3WS4 A;  3A0V A;  5FL3 A;  4F3L B;  3MQ0 A;  4GLQ A;  3RXW A;  3VV4 A;  1YMX A;  3FPW A;  5E2F A;  4EBP A;  1KDW A;  5FAO A;  2QMI A;  4KQQ A;  1T1A A;  5CER A;  4CLC E;  4WZ5 A;  4IBX A;  2G2W A;  1ERO A;  2XD1 A;  2J3W A;  4EV4 A;  4WEJ A;  5FAP A;  3HJI A;  3ZCZ A;  4MN5 A;  4ID4 A;  5FQK A;  4JLF A;  4FH2 A;  4YIN A;  2UV0 E;  4ZAM A;  3O86 A;  2UWX A;  4ETX A;  1YM1 A;  4L0L A;  3AGD A;  3A3I A;  3UPP A;  2DRW A;  4OP8 A;  4BBV A;  3N8L A;  1ZTU A;  3N4I A;  5CED A;  3S4X A;  3HLB A;  3RH8 B;  4CLC B;  4O7D A;  3OPR A;  5CEC A;  2XQZ A;  5AQA A;  5F83 A;  4ZJ2 A;  1S4R A;  2WKH A;  2NUP C;  3ZNT A;  2V1B A;  4RQ9 A;  5AQB A;  3GTC A;  3GDI A;  4BL2 A;  3S7N A;  5M18 A;  5CEB A;  1BUL A;  2G7U A;  3IQA A;  1ES4 A;  2B95 A;  4NEE D;  5HL6 A;  3LIA A;  4E3K A;  3H82 B;  5J4E A;  1PNE A;  1GHM A;  4KZB A;  1VB6 A;  3IH8 A;  1OTB A;  1RP5 A;  1Y54 A;  2PD8 A;  4K91 A;  1Q2Q A;  3LFV A;  4BMW A;  3FYZ A;  2WYX A;  3ZQ5 A;  5EM0 A;  3QP6 A;  1OT6 A;  2HDU A;  3ITB A;  3MXQ A;  1LSW A;  4YWZ A;  3BRM A;  1K54 A;  2VLG A;  3DTM A;  3LR3 A;  4ME4 A;  2OV5 A;  4R6L A;  4MMN A;  1L0F A;  4KG6 A;  1SDN A;  2VV7 A;  3FWL A;  2HDQ A;  4Y3I A;  5E2G A;  2ZQ9 A;  2IWB A;  3LI9 A;  3HUN A;  3C38 A;  2LB9 A;  2ZMV A;  1JTG A;  4FH4 A;  3MXR A;  4HES A;  5EPH A;  2A24 B;  2W3E A;  2PD7 A;  4MNR A;  1MKM A;  1PWC A;  3OPL A;  4IUK A;  2JN7 A;  2X02 A;  2ZMA A;  1QMF A;  3IT9 A;  3QHY A;  1CK3 A;  1Y28 A;  2EX2 A;  5L2F A;  1ES3 A;  1L0E A;  1OME A;  4E04 A;  4N1X A;  3VFH A;  4BBU A;  1P97 A;  2J3T C;  2ZOH A;  4KG5 A;  1TF1 A;  2PU4 A;  1M40 A;  3UME A;  2OLU A;  3HL9 A;  3Q1F A;  3V39 A;  4R23 A;  3BFF A;  5EVI D;  4FTX A;  2B18 A;  2M7V A;  1MPL A;  1MC0 A;  3LY3 A;  1PZP A;  3ZG0 A;  4BLM A;  2OLV A;  1N9O A;  3MZE A;  2A3U A;  1PI4 A;  2YKF A;  4JPM A;  2Y2Q A;  5DFX A;  1J9M A;  2Z6C A;  2V8F A;  1K55 A;  1VEU B;  1YKD A;  3PXP A;  4P6B A;  2XR0 A;  4HI4 A;  3ULF A;  4KZ5 A;  5CRF A;  1H8Z A;  3PHY A;  4LLO B;  3NOU C;  4UA6 A;  1PYY A;  3T1Q B;  5CHM A;  3MFD A;  4OLG A;  4DKI A;  4MBH A;  4EQI A;  3JPU A;  5M19 A;  4DMZ A;  4E3M A;  4L9E A;  1L0D A;  4E6W A;  3VP0 A;  1K4E A;  1K56 A;  2JKT M;  3WRZ A;  4DE2 A;  2XF3 A;  3V3S A;  4CLC D;  2Y55 A;  3NUL A;  4RYE A;  4S2N A;  3G2Z A;  4S2O A;  4DXB A;  4PMA A;  3BFD A;  1G6O A;  2K31 A;  2XLN A;  5G4Y A;  3Q7Z A;  1N9L A;  1XA1 A;  4WZ4 A;  1KE4 A;  3C7V A;  3Q7V A;  3DWK A;  3F1P B;  4LCM A;  3UB6 A;  3O5Y A;  2VGL M;  3NOP C;  1LL5 A;  2ZMF A;  4LV3 A;  3FV7 A;  5HW3 A;  3IXB A;  3LGO A;  3SH8 A;  3IF6 B;  5L8M A;  3E2K A;  4LEN A;  4CJN A;  4KZ4 A;  4R1G A;  4EUV A;  3UN7 A;  3SZT A;  3OCN A;  1NXY A;  3IX8 A;  2ZM8 A;  4JF5 A;  4S2J A;  5CGX A;  2Q0O A;  2BTF P;  2D02 A;  2W27 A;  5IHV A;  4UA7 A;  3QP5 A;  2OAP 1;  5D3O A;  1SKF A;  1ERQ A;  1SDE A;  4R3B A;  1LLB A;  3G4P A;  3T1X A;  3UE6 A;  1QME A;  2QYB A;  2QZ6 A;  5CXW A;  2P7J A;  2ZC7 A;  4HBT A;  4GOG A;  1IEM A;  2Y2G A;  2JKR I;  1IOU A;  3VMA A;  2Y2M A;  1SKO A;  3V3R A;  3V67 A;  3LR5 A;  4JXV A;  3ZGA B;  4DJ3 A;  1LSV A;  5EEC A;  1FR6 A;  3G6O A;  4EW7 A;  2OOL A;  2K2N A;  3N6I A;  4GHI A;  2JHE A;  3NOT C;  2FH5 A;  4QJG A;  3C7U A;  3NJA A;  1ESI A;  1RCJ A;  2M7U A;  3NEC A;  4JGR A;  4B4X A;  2JKF A;  1BTL A;  4ZTK A;  3UDI A;  1VET A;  4WEK A;  2E8I A;  4LRX C;  4JGP A;  3PBN A;  3M6H A;  2INW A;  2W1R A;  1OPX A;  3UE1 A;  4KUO A;  4NK3 A;  4ZJ3 A;  1NJ4 A;  3EEA A;  1BUE A;  4X69 A;  2ZM2 A;  3B42 A;  1PWD A;  1YQS A;  1BLC A;  3R7W A;  5DJT A;  3T1S A;  2VA0 A;  2FFF B;  5I5L A;  5J3W A;  2PBD P;  4KG2 A;  1BLH A;  3LY4 A;  2ZD8 A;  1LT0 A;  2ZQD A;  3G31 A;  1NY0 A;  4ARZ A;  2W1T A;  3E4O A;  1G6A A;  4OPZ A;  3MF0 A;  4N9L A;  2XFS A;  1NZO A;  4GCZ A;  3ZVW A;  4YFM A;  1NRF A;  2WGW B;  4P6Z M;  1BYW A;  3IBR A;  4WMC D;  3T4K A;  1DP8 A;  4WUJ A;  3BW6 A;  3O3V A;  3S7P A;  2GZA A;  3FPV A;  4GS9 B;  3TSG A;  2KLI A;  5TJJ A;  1CEF A;  3E98 A;  3TOI A;  3G32 A;  1NZU A;  1YLW A;  4KZ8 A;  3VP4 A;  3FZC A;  4AFI A;  3F1O A;  3SS3 A;  2H5S A;  3SH7 A;  4LRY C;  3NBL A;  2Y2P A;  1S67 L;  2XRN A;  1NLZ A;  1PI5 A;  3S1Y A;  1LI0 A;  3BEC A;  2E8J A;  3BM6 A;  3VP2 A;  4EQ1 A;  4I3J A;  4NKP A;  5F1G A;  3CWF A;  3CI6 A;  3T4L A;  2KDK A;  1JTD A;  5FAT A;  2V1Z A;  2A49 A;  4EU0 A;  1L2S A;  1MBL A;  4GZB A;  2ZLY A;  2QWS A;  4XUZ A;  1JWV A;  4JGO A;  4DF6 A;  3NDE A;  4HP4 A;  4XXR A;  3EGD C;  2V0W A;  5FQQ A;  2PDR A;  1E3U D;  4DN0 A;  1YSP A;  4KQO A;  3WWX A;  1BT5 A;  3ISG A;  5EM1 A;  2ZQ7 A;  3G30 A;  4C6Y A;  2PR5 A;  4XT2 A;  3JVU A;  2XH9 A;  4ETZ A;  3LI8 A;  4DRT A;  3TRC A;  2ZJ9 A;  3NI9 A;  4OON A;  1TDL A;  4HJ3 A;  5FDH A;  2JKG A;  5HWT A;  2EXA A;  4MN7 A;  2ZC3 B;  3C4O A;  3HLE A;  3UB9 A;  4WYY A;  2VZW A;  4R70 A;  3NCK A;  4QU3 A;  5HPI A;  1PWG A;  1YLP A;  4EER A;  4HP9 A;  5AQ7 A;  1ERM A;  5FEF A;  1M6K A;  4X6T A;  4S2M A;  3PAG A;  2G2U A;  2V8C A;  1GHI A;  3E0Y A;  4HOI A;  2O9C A;  3E4P A;  5DF8 A;  4CQH A;  3KSG A;  4OP5 A;  1XJ2 A;  1FR1 A;  3MZF A;  1LL9 A;  1UWN X;  1IEL A;  3ICY A;  2IWD A;  4EEU A;  5AQ9 A;  2VJW A;  1NRJ A;  5HL1 A;  1EI5 A;  2J8Y A;  3KX0 X;  2P74 A;  4EBN A;  5KMW A;  2C6W B;  3CHW P;  3QP1 A;  1HVB A;  2HJ9 C;  3Q7V B;  4OOL A;  4GD6 A;  5L09 A;  1T1C A;  1WYB A;  3WS0 A;  2O0Y A;  3QP2 A;  2XSS A;  1F2K A;  1K6R A;  2VV8 A;  3A3D A;  3HCY A;  2VEA A;  4R3J A; 
#chains in the Genus database with same CATH homology
 3WRZ A;  4DE2 A;  4EBL A;  2XF3 A;  3V3S A;  1XGI A;  2JC7 A;  1XX2 A;  3W8K A;  3VP3 A;  2ZQC A;  2Y55 A;  1YLT A;  4RYE A;  4S2N A;  1E3U A;  3G2Z A;  4S2O A;  1VM1 A;  2EX8 A;  4JBF A;  2XDM A;  4QY6 A;  4DXB A;  4PMA A;  3BFD A;  3HLC A;  5GLC A;  3VOY A;  1MXO A;  2J9O A;  2XLN A;  3JYI A;  3VOZ A;  2Z2M B;  3I7J A;  3IXG A;  3OC2 A;  1GA0 A;  3IWI A;  1GHP A;  1XA1 A;  3Q7Z A;  4OQ0 A;  4DXC A;  3GQZ A;  5JYP A;  2PU2 A;  4DE3 A;  4WZ4 A;  1SHV A;  5DTS A;  1KE4 A;  4S2I A;  4BJP A;  3C7V A;  3GVB A;  4OOM A;  1E25 A;  2RL3 A;  2QPN A;  3HUM A;  5GHY A;  3Q7V A;  3P98 A;  3DWK A;  4PM7 A;  3WS5 A;  5CTN A;  3UDX A;  3A3E A;  4LCM A;  2VGJ A;  5J8X A;  2Y2K A;  1ES5 A;  2WKE A;  5JYO A;  3SS5 A;  4LCL A;  1LL5 A;  4LV3 A;  3FV7 A;  3LO7 A;  1HZO A;  5FAS A;  3VSK A;  1SCW A;  3IXB A;  5HW3 A;  3OCL A;  3CZD A;  1MKI A;  4GNU A;  4EWF A;  3SH8 A;  5E2E A;  3ZG8 B;  3IF6 B;  1Z6F A;  5EUA A;  4KQR A;  3E2K A;  4LEN A;  1N4O A;  4S2K A;  4CJN A;  4B4Z A;  4KZ4 A;  2HPB A;  3HLW A;  4R1G A;  2ZM0 A;  4Y7P A;  1AXB A;  2IWC A;  1EWZ A;  3WRT A;  3OZH A;  1K54 C;  3IHB A;  1BSG A;  3MKE A;  3UN7 A;  3W4Q A;  4QD4 A;  1IYQ A;  3OCN A;  5TFQ A;  4KZ6 A;  5EE8 A;  3IF5 A;  1NXY A;  1TDG A;  4GKU A;  5GL9 A;  4X53 A;  2ZM8 A;  3O88 A;  4JF5 A;  4S2J A;  5CGX A;  1DJC A;  4WEL A;  4RVA A;  3HLF A;  3RXX A;  3HLG A;  4S2P A;  5IHV A;  4UA7 A;  2JBF A;  1KVM A;  5FQM A;  4Y0O A;  1IYO A;  2WUQ A;  5D3O A;  1BLP A;  1SKF A;  5GLA A;  1CI8 A;  1ERQ A;  1K57 A;  1SDE A;  1U60 A;  5CTM A;  3NY4 A;  2ZC5 B;  1PW8 A;  4R3B A;  2ZQ8 A;  1W8Q A;  3RJU A;  3HRE A;  1LLB A;  2EX6 A;  1PIO A;  2GDN A;  3G4P A;  1QME A;  3GV9 A;  3O87 A;  4N92 A;  5FAQ A;  3CMZ A;  3V5M A;  2QZ6 A;  4E3O A;  5CXW A;  2ZC7 A;  1JWP A;  1IYP A;  4JXS A;  4FD8 A;  3IWO A;  3OPH A;  3PBO A;  4HBT A;  1FQG A;  2Y59 A;  4UA9 A;  5EVI A;  4GOG A;  1IEM A;  3UNW A;  3UY6 A;  2Y2G A;  4E3L A;  4OP5 A;  4PPR A;  4WZ5 C;  5TR7 A;  1BZA A;  4GB7 A;  4LV1 A;  2XD5 A;  4BD0 A;  4JXW A;  5BOH A;  2Y2I A;  3VMA A;  1FSW A;  2Y2M A;  2HP5 A;  2WAF A;  2P9V A;  5GLD A;  4GN2 A;  3V3R A;  2HDS A;  4CPK A;  3DW0 A;  3MXS A;  3VFF A;  1W7F A;  1KVL A;  4DDS A;  2DNS A;  1JWZ A;  4JXV A;  4PM6 A;  3IWQ A;  3ZGA B;  3BLM A;  1TEM A;  5HAR A;  1YLZ A;  5EEC A;  1FR6 A;  3BYD A;  4KZA A;  4KZ9 A;  3ZFZ A;  3C4P A;  4OQH A;  5F82 A;  4P0M A;  3N6I A;  5GLB A;  4BQM A;  1KGF A;  3MKF A;  2WAE A;  4Y0T A;  4K0X A;  3UE0 A;  3MBZ A;  1ONH A;  3D4F A;  4QJG A;  4JF4 A;  4N1H A;  3C7U A;  3PBT A;  1WE4 A;  4ZBE A;  3IHA A;  1DY6 A;  3BFC A;  4RX3 A;  5GHZ A;  3S22 A;  1CEG A;  1ESI A;  1RCJ A;  3HVF A;  3M6B A;  4XUX A;  4ZDX A;  3AGF A;  2Y4A A;  5FI7 A;  3GRJ A;  4WM9 A;  4B4X A;  1KE3 A;  2XFT A;  2WGW A;  5A90 A;  2H10 A;  1I5Q A;  3ZNY A;  1BTL A;  4ZTK A;  3ZHH A;  3UDI A;  4GDN A;  2H0Y A;  1IKG A;  3UPN A;  4WEK A;  3Q82 A;  2CC1 A;  1NYY A;  2Y91 A;  1G68 A;  2ZC6 B;  1XP4 A;  1NYM A;  2E8I A;  1YLJ A;  1LHY A;  3PBN A;  1MY8 A;  4B88 A;  3M6H A;  4IVK A;  1K55 C;  4PM8 A;  4U0X A;  4OH0 A;  4E3I A;  3N7W A;  4HBU A;  3IF6 C;  5A92 A;  3GR2 A;  5CHJ A;  5FI2 A;  2Q9M A;  3SOI A;  3UE1 A;  5FQ9 A;  4NK3 A;  4ZJ3 A;  3TG9 A;  1NJ4 A;  3PBQ A;  3UE3 A;  2J7V A;  1YMS A;  1BUE A;  4X69 A;  1JVJ A;  2ZM2 A;  4H8R A;  3B3X A;  5EVI B;  5HFO A;  1PWD A;  1YQS A;  3UDF A;  3EQU A;  3A3F A;  4JF6 A;  4N9K A;  2X01 A;  4OPR A;  2PBY A;  3BFE A;  1BLC A;  1YLY A;  2B5R A;  4R4R A;  2RCX A;  4UHU A;  5DF7 A;  2ZQA A;  5GHX A;  2WKI A;  1FSY A;  5FSR A;  1K25 A;  2WZX A;  5KSH A;  3C5A A;  1C3B A;  2P9V B;  2FFF B;  3NC8 A;  4OLD A;  5EOO A;  2XK1 A;  3BLS A;  4Z9Q A;  4KG2 A;  4S2L A;  3GSG A;  4QHC A;  3WS4 A;  3WS1 A;  2JE5 A;  1FOF A;  1ES2 A;  1BLH A;  3RXW A;  1PW1 A;  3LY4 A;  3SS4 A;  2ZD8 A;  1YMX A;  5E2F A;  3VP1 A;  4EBP A;  1KDW A;  5FAO A;  1KGG A;  2ZQD A;  1XKZ A;  4DE0 A;  2Y2N A;  3G31 A;  2QMI A;  4KQQ A;  4WBG A;  5CER A;  1NY0 A;  3OPP A;  4WZ5 A;  1W79 A;  4IBX A;  4OQI A;  4S2N C;  2G2W A;  1ERO A;  2XD1 A;  2XEP A;  5E43 A;  1G6A A;  4OPZ A;  4EV4 A;  4WEJ A;  5G18 A;  5FAP A;  4MEZ A;  3ZCZ A;  2I72 A;  4N9L A;  2XFS A;  1NZO A;  3ZVW A;  4YFM A;  4ID4 A;  5FQK A;  4M3K A;  1NRF A;  3ZVT A;  4JLF A;  5EVL A;  2WGW B;  4FH2 A;  4YIN A;  4RX2 A;  4D2O A;  4F94 A;  2EFU A;  4WMC D;  4ZAM A;  3O86 A;  1YT4 A;  2UWX A;  1YM1 A;  4L0L A;  3AGD A;  3A3I A;  3O3V A;  3UPP A;  4BL3 A;  1MWR A;  1FCM A;  1WYC A;  5DVA A;  4E3N A;  4OVD A;  3E2L A;  3TSG A;  4C75 A;  3QNB A;  2DRW A;  4OP8 A;  1MWU A;  4P85 A;  4Y0U A;  1CEF A;  3TOI A;  3N8L A;  3G32 A;  3N4I A;  1NZU A;  1YLW A;  1ZG4 A;  4KZ8 A;  3HLB A;  3S4X A;  5CED A;  2Z2L B;  3VP4 A;  3FZC A;  3IXH A;  4E6X A;  4O7D A;  1ALQ A;  1IYS A;  1LI9 A;  3OPR A;  2XQZ A;  3M2K A;  3Q81 A;  2H5S A;  1L0G A;  5AQA A;  3SH7 A;  3SS3 A;  5CEC A;  2R9W A;  5F83 A;  4ZJ2 A;  3ZG9 B;  1KE0 A;  3CG5 A;  3NBL A;  2Y2P A;  2WKH A;  3EQV A;  5CGS A;  4RA7 A;  3ZNT A;  2X71 A;  1DJA A;  3FKV A;  1O07 A;  5FI6 A;  5AQB A;  3GTC A;  4U3T A;  1ZKJ A;  1PI5 A;  3S1Y A;  4BL2 A;  1IKI A;  1LI0 A;  3BEC A;  4BEN A;  5M18 A;  1MWS A;  3BM6 A;  5CEB A;  5FQJ A;  4OPQ A;  3VP2 A;  5E2H A;  3HLD A;  5F1G A;  3NIA A;  2WGI A;  1BUL A;  4PM9 A;  5DTT A;  1ZG6 A;  1HD8 A;  1ZC2 A;  3IQA A;  4LV0 A;  2HP9 A;  1ES4 A;  1JTD A;  1N9B A;  4K0W A;  4KZ3 A;  5FAT A;  5HAI A;  3G2Y A;  2JCH A;  5DTK A;  2V1Z A;  4P87 A;  4E3K A;  2A49 A;  1L2S A;  3UPO A;  3DWZ A;  1GHM A;  4GD8 A;  3IH8 A;  1MBL A;  4KZB A;  4GZB A;  3FKW A;  1RP5 A;  2ZLY A;  3P09 A;  1RGY A;  1Y54 A;  4K91 A;  1K56 D;  4OQG A;  3ITA A;  4MLL A;  1Q2Q A;  3PAE A;  4XUZ A;  1JWV A;  5EVI C;  4DE1 A;  3UO9 A;  3FYZ A;  5A93 A;  2WYX A;  4DF6 A;  1K38 A;  1W5D A;  3NDE A;  4XXR A;  5FQQ A;  5CGW A;  1E3U D;  2HDU A;  3ITB A;  2Y2J A;  2Y2O A;  4KQO A;  2EFX A;  3BRM A;  1K54 A;  1O7E A;  4MBK A;  4X55 A;  3DTM A;  3WWX A;  3W4P A;  2VGK A;  1BT5 A;  3ISG A;  3PTE A;  1HTZ A;  2J9P A;  1GA9 A;  2OV5 A;  1L0F A;  2ZQ7 A;  3G34 A;  4KG6 A;  5M1A A;  3SH9 A;  4MBF A;  3WS2 A;  3G30 A;  4C6Y A;  1SDN A;  4FCF A;  3CJM A;  1MWT A;  2XH9 A;  3V50 A;  1VQQ A;  3FWL A;  4KEN B;  4DRT A;  2HDQ A;  3QNC A;  3LEZ A;  4PM5 A;  2WGV A;  2ZJ9 A;  3NI9 A;  5E2G A;  4QY5 A;  3GMW A;  4OON A;  1I2W A;  2ZQ9 A;  2IWB A;  1TDL A;  2DCF A;  4IBR A;  1DJB A;  5FDH A;  3HUN A;  2HP6 A;  2EXA A;  4U0T A;  3ZG5 A;  4HEF A;  2H0T A;  3ZDJ A;  1XPB A;  1JTG A;  2ZC3 B;  4FH4 A;  3C4O A;  3MXR A;  1FCO A;  4HES A;  3HLE A;  5EPH A;  3VSL A;  4MNR A;  1PWC A;  1W8Y A;  3OPL A;  4WYY A;  5A91 A;  1H8Y A;  3NCK A;  4QU3 A;  2X02 A;  1S0W A;  1PWG A;  1YLP A;  4A5R A;  2ZMA A;  5TGF A;  1QMF A;  5AQ7 A;  1ERM A;  3IT9 A;  3QHY A;  1CK3 A;  4IED A;  1M6K A;  3G35 A;  2EX2 A;  5L2F A;  1ES3 A;  1L0E A;  3PBS A;  4C3Q A;  1OME A;  2C5W B;  4R4S A;  4X6T A;  4S2M A;  3PAG A;  4EUZ A;  5HAQ A;  5KSC A;  2G2U A;  4N1X A;  4R0Q A;  1XA7 A;  3VFH A;  4BD1 A;  4Q8I A;  3HBR A;  4KG5 A;  1I2S A;  2V20 A;  5HX9 A;  2PU4 A;  4NET A;  4OKP A;  1GHI A;  1M40 A;  3M2J A;  2OLU A;  4JXG A;  5DF8 A;  3HL9 A;  3Q1F A;  3V39 A;  4R23 A;  3NDG A;  4WMC A;  5EOE A;  5I94 A;  3LCE A;  2BLS A;  2WZZ A;  3BFF A;  2OSU A;  3PBR A;  3BFG A;  3MZF A;  1FR1 A;  2WK0 A;  4X68 A;  4IVI A;  5CHU A;  5EVI D;  3W4O A;  3AGE A;  1LL9 A;  1IEL A;  1MPL A;  2EX9 A;  3LY3 A;  1PZP A;  3IXD A;  3ZG0 A;  2IWD A;  4BLM A;  1KGE A;  2OLV A;  5AQ9 A;  4KZ7 A;  2XGN A;  4FSF A;  1K4F A;  1FCN A;  1TVF A;  3MZE A;  2A3U A;  2EXB A;  1ESU A;  1Q2P A;  4E3J A;  1PI4 A;  5HL1 A;  1EI5 A;  1RGZ A;  3HUO A;  2J8Y A;  1BLS A;  4JPM A;  2Y2Q A;  5DF9 A;  2WAD A;  2P74 A;  4EBN A;  5U47 A;  1J9M A;  5KMW A;  5FQI A;  1XXM A;  1K55 A;  2C6W B;  3A3J A;  1ONG A;  5KZH A;  4P6B A;  2XR0 A;  3IF6 A;  4KZ5 A;  1HVB A;  4UAA A;  2R9X A;  1K57 C;  3BEB A;  3Q7V B;  4OOL A;  5CRF A;  4GDB A;  1E4D A;  1H8Z A;  4GD6 A;  4ZJ1 A;  4OPY A;  2Q9N A;  2Y2L A;  1H5X A;  3ZG7 B;  1WYB A;  1PYY A;  4UA6 A;  3WS0 A;  1PZO A;  1CI9 A;  5CHM A;  3MFD A;  3N8S A;  3IH9 A;  4MBH A;  4OLG A;  4DKI A;  4LV2 A;  2Y2H A;  4EQI A;  1GCE A;  4QB8 A;  5M19 A;  1K6S A;  4OOY A;  2V2F F;  3N8R A;  1KDS A;  1XGJ A;  3Q07 A;  5HAP A;  3MZD A;  1K6R A;  4DDY A;  4E3M A;  4X56 A;  1S6R A;  1L0D A;  4E6W A;  3A3D A;  3VP0 A;  2FFY A;  5FA7 A;  4JKT A;  2BG1 A;  1K4E A;  1K56 A;  2HDR A;  2ZC4 B;  4R3J A;  5F1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...