4QY6A

Crystal structures of chimeric beta-lactamase ctem-19m showing different conformations
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPLTSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM, Beta-lactamase PSE-4
publication title Crystal structures of chimeric beta-lactamase cTEM-19m showing different conformations
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 94
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4qy6A00
3C4OA 4EUZA 3Q7VA 3VP4A 2OLUA 1NRFA 3ZG5A 2X02A 4DXCA 5F1FA 4S2JA 1MWTA 3Q81A 5AQ7A 2WGWB 2XEPA 5GL9A 3GR2A 3LY3A 3FWLA 4LCMA 1FR1A 4KZ4A 1N4OA 3M6HA 1M6KA 2V1ZA 1PZPA 1LL5A 3QNCA 3IF6C 3GQZA 2JBFA 3IF5A 4OQIA 4MBKA 3NI9A 4FH2A 4IVIA 4UHUA 3AGEA 3GV9A 2HDQA 4HEFA 5CGWA 4UA7A 2Y2PA 1RCJA 5EE8A 3A3FA 4EV4A 5DTTA 2FFFB 3BRMA 4GDNA 1BTLA 5CRFA 4WMCD 5CGSA 5FQJA 4M3KA 4QHCA 1HTZA 1LI0A 2EFXA 5E2HA 2X71A 3V50A 5FQQA 1QMFA 1XXMA 1PW8A 5CHMA 4BQMA 1KDSA 2PBYA 5DF8A 3D4FA 3A3EA 4LV1A 2VGJA 3IXBA 2WKIA 4DE3A 3N8SA 3BYDA 4JF6A 3BECA 3IQAA 3BFEA 3CG5A 5CXWA 5EPHA 1I5QA 1FR6A 1JWZA 4OQ0A 5FAQA 3IF6A 1HZOA 4EWFA 1MKIA 4OPYA 4X68A 2WADA 3Q7ZA 4YINA 2ZLYA 5CEBA 4JXWA 1KVLA 4S2MA 4WZ5C 3PBNA 4P85A 1GHMA 4UAAA 3VSLA 2X01A 5HAQA 4U0TA 4KZAA 4RX3A 4E3OA 1YLYA 3B3XA 4FH4A 4P87A 1YM1A 2Y2LA 2G2WA 3A3DA 5FAPA 3ZGAB 1YLJA 3LY4A 4X53A 3HLFA 1JTGA 4KQRA 2PU4A 5CGXA 3FV7A 5EOEA 1Y54A 1L0DA 4JLFA 4MBFA 2G2UA 2HDUA 2ZMAA 5FI6A 1W8QA 3UE1A 2ZQCA 4E3IA 4Y0OA 1K4EA 5M19A 2XD1A 2QPNA 4LV2A 3ZHHA 4OLDA 4BD0A 4R4SA 4DE2A 2P9VB 4S2IA 4WZ5A 2JE5A 5CECA 2Y2NA 1Z6FA 4E6XA 4E3LA 1KE3A 3CMZA 4S2LA 1GHPA 2HDSA 3HL9A 2IWCA 4WBGA 2WAEA 1MY8A 5CHJA 4C6YA 5TGFA 2WYXA 4BJPA 4BL3A 5EVIA 3UE3A 3W8KA 5A93A 1XA7A 1HVBA 5HL1A 1ONHA 3W4PA 4ID4A 1TDLA 4MLLA 4GN2A 4OKPA 3PAEA 4KG2A 1XP4A 3HLBA 2I72A 3UDIA 5HX9A 4EBNA 2E8IA 1I2SA 2BLSA 4Y7PA 3VP3A 1LL9A 1J9MA 4RA7A 5IHVA 3UO9A 4QJGA 3IH9A 2WGIA 4H8RA 5AQBA 5I94A 2HP9A 1K4FA 3OPLA 5KZHA 3PBOA 4MEZA 3QHYA 3UPOA 1JVJA 4U3TA 4DKIA 4GDBA 3MKEA 5DVAA 2P74A 3V5MA 1AXBA 3RXXA 3DWKA 3W4OA 4CPKA 3TOIA 3S1YA 5GHXA 3Q82A 4BL2A 3M2KA 3MZDA 5EECA 4WZ4A 4QB8A 5TFQA 2Y2KA 3ZG8B 3N8LA 1ESIA 1BLCA 2H10A 4R1GA 5FDHA 2OSUA 1Q2PA 1JWVA 1CEFA 3MFDA 3MXSA 2JC7A 1CK3A 4X56A 1VQQA 3FKWA 3ZVWA 4BLMA 4RYEA 4N1XA 3G35A 4E6WA 5FQMA 4ZBEA 1PWDA 5GLBA 2WAFA 4OOLA 4KQQA 5E2EA 1ERMA 2HP6A 2ZM8A 2R9WA 3PBQA 2ZM0A 1IEMA 4PM8A 4C3QA 4DE1A 1W79A 5FQKA 1ZKJA 1L2SA 1XKZA 1CI9A 1KDWA 2DRWA 2EFUA 4KZ5A 4OPRA 5CTMA 1W5DA 2Y4AA 4KZ6A 4DRTA 3WS4A 2DNSA 3Q1FA 4GKUA 4JBFA 1MBLA 4K0XA 3VMAA 2RL3A 2R9XA 1LI9A 2ZC4B 1TVFA 1XPBA 4JF5A 4B4ZA 5DTSA 1QMEA 2ZQ8A 2BG1A 3ITAA 4E3KA 4E3JA 1M40A 4S2NC 1O7EA 4KENB 5GLAA 5CHUA 1E3UA 1K55C 3BLSA 2H0YA 4LV3A 3G31A 4N92A 4NETA 4B4XA 3V39A 1BLPA 4IEDA 1GA9A 5M18A 3AGDA 2Q9MA 1KE0A 4JPMA 3VOYA 5FQIA 3PAGA 1MXOA 2XK1A 1ES3A 4X69A 2EXBA 5DF7A 2Q9NA 4KG6A 4OP8A 1H8YA 3G4PA 4F94A 5GHYA 4QY6A 3BFDA 2XFSA 5CTNA 2EX9A 3JYIA 2ZC5B 3W4QA 1BZAA 2C6WB 1WE4A 3Q7VB 3SH7A 5EVIC 1LHYA 2WK0A 4U0XA 3WRTA 4L0LA 2QZ6A 4S2NA 1MWRA 3SH8A 1PWGA 3BFFA 4S2KA 3OPPA 3E2LA 1K55A 2ZM2A 3MXRA 2GDNA 3FKVA 2A49A 4KZ3A 3IWQA 4WYYA 4DF6A 2EX2A 3PTEA 1PI4A 1IYOA 5DTKA 1DJBA 4X6TA 1GHIA 3NBLA 5F1GA 3I7JA 4WMCA 4JXSA 5JYOA 3A3IA 2Z2MB 3WRZA 1O07A 4IBXA 5BOHA 5A90A 1YLZA 2XDMA 3GMWA 4OPQA 4E3MA 4FCFA 1W7FA 1K56D 2JCHA 3SS3A 1YT4A 1RGZA 1I2WA 3HBRA 1DJCA 4P6BA 1SKFA 4EBLA 2A3UA 3PBSA 3ZG7B 3IXHA 1NY0A 4OPZA 4QY5A 1L0GA 1K54A 3BFCA 5U47A 3OCNA 4QD4A 4R0QA 1SCWA 1K38A 4PPRA 1ONGA 2ZQ9A 2V2FF 5FI7A 3DW0A 3VOZA 4ZJ3A 3BFGA 4GZBA 4BENA 4LENA 3IF6B 5E2GA 4R4RA 4R23A 2J7VA 1G6AA 3VP1A 2EX6A 1H8ZA 4NK3A 2H0TA 4WEKA 3VSKA 4Q8IA 2H5SA 4KQOA 4PMAA 1PI5A 1EROA 2XFTA 3HVFA 1ES5A 5DF9A 2B5RA 1C3BA 3RXWA 2PU2A 4BD1A 3C4PA 4GOGA 1XGJA 1MPLA 1MWSA 3BEBA 3S22A 1PYYA 4Y0UA 3DWZA 3OCLA 3OC2A 1DY6A 2XQZA 4FSFA 2Y91A 3ITBA 3WWXA 5L2FA 1KGGA 3C7VA 4Z9QA 1HD8A 3G30A 5FSRA 4DE0A 1IYPA 1KVMA 4GNUA 5HAIA 5TR7A 1IYSA 4OVDA 4E3NA 2Y2JA 3MZFA 3VP0A 3AGFA 3HUMA 4JKTA 2WKHA 3IXGA 3UDFA 1PIOA 5HW3A 3ZDJA 2ZJ9A 5EUAA 4ZJ1A 1YLTA 1L0EA 1E3UD 3G32A 1S0WA 5GHZA 3PBTA 1E25A 5J8XA 2UWXA 1FQGA 3V3SA 4UA6A 4KZ8A 4ZTKA 1SHVA 4XXRA 1NJ4A 3CJMA 2Y2MA 3NCKA 3LCEA 1NZOA 1BSGA 1K6RA 3PBRA 5EOOA 3ZCZA 3ZNYA 5D3OA 4CJNA 3MZEA 3O87A 3TG9A 3SS4A 2J8YA 3NY4A 1FCOA 4IVKA 5EVIB 3V3RA 2OLVA 4XUZA 3S4XA 5KSCA 4GD6A 1RGYA 1BULA 2ZQAA 3HLEA 2EXAA 4JXGA 4X55A 1DJAA 3OPRA 2ZC6B 3P98A 3G2YA 1TEMA 5M1AA 5G18A 5HARA 1N9BA 1WYCA 5FI2A 4EQIA 4RX2A 1YMXA 4C75A 3RJUA 4K0WA 1KE4A 4K91A 2XH9A 2XGNA 3NDGA 3MKFA 1SDNA 3O88A 3G34A 2DCFA 4PM7A 3HLDA 4R3BA 1YLPA 4OOMA 3ZNTA 3LEZA 3P09A 4N1HA 1ESUA 2RCXA 1OMEA 2P9VA 1GCEA 1IELA 1LLBA 1NYYA 3A3JA 1ZG6A 1BT5A 2CC1A 4JXVA 4EBPA 2J9OA 1ERQA 2HP5A 2Z2LB 1XA1A 1FCNA 3UPPA 3VFFA 4XUXA 1IYQA 2HPBA 3UY6A 1K57C 4DDSA 3GTCA 1ES4A 5E43A 3HLGA 2C5WB 3M6BA 3N7WA 5EVID 2IWBA 1MWUA 2IWDA 1EI5A 1YMSA 3GSGA 4KZ7A 5A92A 1TDGA 3IWOA 2WKEA 3M2JA 4YFMA 3O3VA 4HESA 4DDYA 1IKIA 3IHBA 4KZBA 1PW1A 2ZD8A 1YQSA 4OOYA 1EWZA 4A5RA 4PM6A 1BLSA 2Y2OA 1CI8A 1K54C 3CZDA 4JF4A 1YLWA 3GRJA 5CEDA 1JWPA 3Q07A 5FAOA 5EVLA 4ZDXA 1VM1A 3C5AA 3IHAA 2V20A 4QU3A 4KZ9A 3BLMA 3WS5A 4OLGA 3WS2A 2Y2GA 2OV5A 2XD5A 4ZJ2A 3EQVA 5HAPA 3G2ZA 2FFYA 1CEGA 3GVBA 4D2OA 5FASA 1K57A 5F82A 2Y2IA 4HBTA 3O86A 5KMWA 5HFOA 5AQAA 2Y2HA 4S2OA 3ZFZA 1BLHA 4P0MA 1SDEA 3FZCA 4OP5A 3FYZA 3VFHA 1G68A 1PWCA 3IWIA 4PM5A 5F83A 4N9KA 5JYPA 3BM6A 1IKGA 1NZUA 4UA9A 3QNBA 1ALQA 3IXDA 3EQUA 3SS5A 3MBZA 1NYMA 2J9PA 5E2FA 3N4IA 4LCLA 2ZC3B 4HBUA 5GLCA 2WGWA 3ZG9B 2XLNA 3N6IA 1FSWA 5GLDA 3UN7A 2ZQDA 4MNRA 5FATA 4OQGA 1FCMA 2WZZA 2VGKA 3SOIA 3WS0A 3LO7A 3ZVTA 4PM9A 1K6SA 4KG5A 1E4DA 3C7UA 1W8YA 3N8RA 1JTDA 2ZQ7A 2WGVA 3TSGA 1K25A 1PZOA 1FOFA 2Y59A 3OPHA 1RP5A 3HUOA 4WELA 5KSHA 5FQ9A 2XF3A 3HLCA 4DXBA 4IBRA 1ZG4A 4S2PA 1BUEA 3OZHA 3UE0A 4GD8A 1ES2A 1KGFA 1XGIA 1ZC2A 2Y2QA 2HDRA 3HLWA 1L0FA 2EX8A 3HUNA 3IT9A 1WYBA 4WEJA 4RVAA 1KGEA 3WS1A 1S6RA 3IH8A 5AQ9A 3ZG0A 2QMIA 2WUQA 2ZC7A 4GB7A 4FD8A 3NIAA 4O7DA 4OONA 1NXYA 1FSYA 2XR0A 3DTMA 1H5XA 3E2KA 4Y0TA 1K56A 1U60A 2WZXA 3ISGA 5A91A 1Q2QA 3NDEA 3UDXA 4OH0A 3UPNA 4B88A 3NC8A 4MBHA 4N9LA 3UNWA 3VP2A 3HREA 4LV0A 5FA7A 3SH9A 5CERA 4WM9A 4OQHA 4R3JA 1XX2A 4ZAMA 2Y55A 1GA0A
chains in the Genus database with same CATH superfamily
4EUZA 3Q7VA 2OLUA 4EXOA 3DTKA 2NUTC 3ZG5A 5AQ7A 1PRQA 4XT2A 3M6HA 1LL5A 2P7JA 3IF6C 4I3IA 4OQIA 1LSWA 3AGEA 2HDQA 3BJNA 3UB6A 5EE8A 3A3FA 2INWA 4GDNA 3DTEA 1V9YA 2B02A 1S1YA 3VE3A 3ZQ5A 5EM0A 4BQMA 2QKPA 2GZAA 2WKIA 3BYDA 4JF6A 5CXWA 5EPHA 1I5QA 4GS9B 3K3DA 4CLCC 1HZOA 2JKTI 2VLGA 1KVLA 4P85A 3VSLA 4EW7A 3B3XA 4P87A 3BW6A 3S7OA 4X53A 5FL3A 1Y4OA 1T1BA 3F1OB 2LB5A 5HWTA 2J3TD 1Y54A 1VB6A 5L09A 4MBFA 2G2UA 4Y2FA 2MJ6A 3QP4A 3E98A 5M19A 1S67L 4S2IA 4WZ5A 2JE5A 3C8CA 2HDSA 2VX8A 2WAEA 5CHJA 5TGFA 3O5YA 5EVIA 5HL1A 1HVBA 3E0YA 3TJZC 4MLLA 2KLIA 3PAEA 2ZMVA 3VP3A 2BLSA 2UV0E 1LL9A 3RFBA 4H8RA 1Z09A 4M4XA 2HP9A 3KSHA 2QWSA 4U3TA 4DKIA 2OAQ1 3MKEA 3RXXA 1BYWA 1J3WA 3MMHA 1DP6A 5TFQA 3N8LA 2VGLS 4RYEA 3CPTB 4PKYG 4EU0A 5FQMA 2WAFA 3F1NA 2R9WA 3KSGA 4C3QA 1KDWA 2DRWA 2EFUA 5CTMA 5I5LA 4KZ6A 2Y4AA 4DRTA 1XJ2A 3B33A 3MQQA 2V1BA 1LI9A 1QMEA 1MKMA 4E3JA 1XJ3A 4KENB 3RH8B 1E3UA 3BLSA 4NETA 1OTIA 2VJWA 2KOIA 3AGDA 4WLAA 1LL8A 2PAVP 3PAGA 3QP6A 4X69A 2EXBA 4OP8A 3G4PA 3BFDA 2XFSA 5CTNA 3JYIA 3IX8A 2C6WB 3BWLA 3OPPA 2ZM2A 3T4SA 3EGDC 4NXEA 4KZ3A 3UB9A 1T18A 3I7JA 4WMCA 4JXSA 3B42A 4IBXA 3GMWA 5F5YA 3HBRA 4P6BA 2J3TC 4OPZA 4QD4A 4R0QA 1SCWA 1K38A 5J4EA 1ONGA 3SW1A 4P6ZM 3LEQA 1ZTUA 2OWJA 3T4TA 2EX6A 1LSVA 4KQOA 2B18A 5F69A 1C3BA 2PU2A 4GOGA 3S22A 1TS8A 3BEBA 4FSFA 4Z9QA 2H28A 5FSRA 1GSWA 5G4ZA 5HWVA 3CAXA 3MJQA 1PIOA 5HW3A 3ZDJA 3TRCA 1CQAA 1E3UD 3KSFA 5GHZA 3PBTA 4GS9A 2UWXA 1OTDA 3V3SA 4H6JB 4KZ8A 4ZTKA 1NJ4A 3KYEA 3NCKA 1NZOA 1BSGA 3PBRA 5EOOA 3ZCZA 5D3OA 3MZEA 3S4XA 4GD6A 2HF6A 1BULA 2EXAA 4GHIB 3OPRA 1DP9A 4WF0A 3F1OA 4IJGA 5M1AA 4BBVA 3RJUA 3OLOA 1KE4A 3O88A 1F9IA 3G34A 1K0KA 2DCFA 4PM7A 1OTEA 2RCXA 1IELA 3A3JA 2CC1A 4JXVA 2Z2LB 1XA1A 1TS6A 3MS6A 5E43A 3M6BA 3N7WA 5A92A 3CI6A 4HY8A 1GSXA 2L4RA 3DTIA 3O3VA 1FIKA 2Z6DA 1IKIA 4PM6A 1CI8A 1OT6A 3LGOA 1VETA 5FAOA 2YKHA 4QU3A 3OBFA 2PBDP 3WS2A 2OV5A 3EQVA 2FFYA 4HBTA 5HFOA 3FYZA 3VFHA 4PM5A 5JYPA 1NZUA 5FEFA 2J80A 3CPTA 3EQUA 3MBZA 2J9PA 3SS5A 5E2FA 5GLCA 3ZG9B 4HIAA 1FSWA 2ZQDA 4MNRA 5TBMB 3S7QA 3LI8A 2VGKA 4L9EA 4Z1WA 3SOIA 3T4LA 1E4DA 1JTDA 2ZQ7A 3UE6A 1FOFA 5L8MA 3H82B 1RP5A 3HUOA 3HLCA 4IBRA 3UE0A 1KGFA 1XGIA 2Y2QA 3MQOA 3WS1A 5AQ9A 5HDSA 4FD8A 2E8JA 1NXYA 2XR0A 3E2KA 4OH0A 3NC8A 4N9LA 4LV0A 5FA7A 3P7NA 2JKTM 4OQHA 4R3JA 4WM9A 3C4OA 3VP4A 4P6ZS 4RQ9A 2X02A 4S2JA 1MWTA 3VOLA 3QP2A 1N4OA 1S66L 1NWZA 3E4PA 3IF5A 4MBKA 2KDKA 4FH2A 3GV9A 5EFWA 4HJ6A 5HZHA 5J7EA 5C5KA 5FQJA 4M3KA 1LI0A 4Y15A 3IBRA 3V67A 3V50A 3HJIA 1QMFA 4WN5A 1XXMA 4Y5FA 1PW8A 5CHMA 5HSQA 3CUEC 4LV1A 3IQAA 2VV6A 3EEAA 1FR6A 3KX0X 4EWFA 2WADA 3Q7ZA 4JXWA 1H0MA 3LR0A 4S2MA 2NUPC 1X0OA 1GHMA 2D02A 5HAQA 4U0TA 5HPFA 4EEPA 3HLFA 4UEYA 5LBRA 1N9OA 3FV7A 1XJ6A 1L0DA 4EQ1A 4JLFA 5FI6A 2HDUA 3U4LP 3UE1A 4E3IA 4Y0OA 1K4EA 4R4SA 4LLOB 4H6JA 3CMZA 3HL9A 1H3QA 2HJ9C 4BL3A 3BY8A 2O99A 3W8KA 1YAXA 5G4YA 1ONHA 4ID4A 2V0WA 4GN2A 4KG2A 2I72A 2YKFA 4EBNA 2WKPA 2GX5A 4NXGA 3UO9A 5AQBA 2WGIA 2W3HA 5HDCA 4MEZA 2V0UA 1JVJA 1P0ZA 5DKKA 4GDBA 5DVAA 3PXPA 4CPKA 3Q82A 4BWIA 3ZG8B 2EWWA 3TW8A 1JWVA 5HWWA 3FKWA 3KO6A 4BLMA 4N1XA 4PHTA 3FPWA 4E6WA 1PWDA 1W63Q 5DFYA 2ZM8A 1IEMA 1W79A 5FQKA 1CI9A 3EEHA 4OPRA 4ETZA 3Q1FA 1MZUA 4GKUA 4JBFA 1STZA 2L0WA 4FUWA 1TVFA 3NOTC 4JF5A 5GLAA 4LV3A 1BLPA 4IEDA 4LRZE 3FPVA 3VOYA 2W1RA 1HLUP 5FQIA 5TBMA 3MXQA 4BMWA 4JGOA 1G6OA 5GHYA 2EX9A 1BZAA 4LGWA 3SH7A 1LHYA 4U0XA 3B47A 3WRTA 3SZTA 3H82A 4L0LA 5F68A 4ARZB 4S2NA 1MWRA 4S2KA 3E2LA 1K55A 2GDNA 4HH2A 4WYYA 4L9FA 3PTEA 2W3DA 3HCYA 4X6TA 1GHIA 3JPUA 1O07A 2OOLA 5A90A 4OPQA 4FCFA 1T1CA 3LR3A 1K56D 1YT4A 1RGZA 1T1AA 1DJCA 3PBSA 3ZG7B 1IFQA 4O01A 4HJ3A 1VEUB 3ZVWA 3VOZA 1TF1A 3RTYA 4GZBA 4BENA 4LENA 3IF6B 3F1PB 4R4RA 4R23A 3VP1A 1G6AA 5TJJA 4NK3A 3VSKA 2H5SA 4KUKA 4PMAA 3UMEA 1EROA 2XFTA 4O8GA 1ES5A 1XGJA 1MPLA 4JGRA 1PYYA 3OCLA 4KQDA 2Y91A 3ITBA 1S4RA 1IYPA 4GNUA 1IYSA 3MZFA 3VP0A 4JKTA 1A0KA 3IXGA 3UDFA 2ZL1A 3IS2B 1S4SA 2ZJ9A 5EUAA 4CLCB 1YLTA 2Z6CA 1PFLA 2QJ7A 1FQGA 5L10A 1SHVA 4XXRA 2Y2MA 4ETXA 1G28A 3O87A 3TG9A 4B9OA 3SS4A 5F6AA 5KSCA 1ACFA 2ZQAA 4QPRA 2HGVA 2XRNA 5FI2A 4EQIA 4HHDA 3QP8A 1YMXA 4C75A 4YOFA 3LFVA 4K91A 4F3LA 3MKFA 1OJ5A 5EVEA 3HLDA 4R3BA 1YLPA 4OOMA 3ZNTA 3LEZA 1ESUA 1OMEA 2QHKA 1NYYA 3NULA 3UPPA 4XUXA 1N9LA 1IYQA 2HPBA 4DDSA 3GTCA 5EVID 2IWDA 1YMSA 3GSGA 4X25A 2WKEA 3M2JA 4YFMA 1ODVA 4KZBA 1YQSA 4OOYA 3R7WB 3GRJA 1KOUA 2WKRA 1JWPA 4ZDXA 3H9WA 1SZVA 2V20A 2GNXA 3NECA 3CWFA 4ZJ2A 3GVBA 5FASA 1K57A 2Y2IA 1P9RA 3O86A 4FOFA 5KMWA 2Y2HA 4S2OA 2R78A 1SDEA 1G68A 3IWIA 5F83A 4N9KA 3BM6A 4UA9A 5KIZA 4MDZA 2P08A 3EWKA 3N4IA 1G5UA 4LCLA 2VV7A 4HBUA 1S1ZA 3U2AA 2XLNA 1EW0A 4GLQA 4ME4A 3ZVTA 2IA2A 3C7UA 1W8YA 1K25A 1PZOA 1VHMA 4KUOA 1CJFA 1YSPA 3OPHA 4DXBA 1BUEA 1OTAA 3OZHA 1ZC2A 3HLWA 2OWHA 3HUNA 3EOIA 3IT9A 3IX3A 3IH8A 3ZG0A 4NEED 3NIAA 4O7DA 3DTMA 2WZXA 2VKSA 3T1XA 5A91A 2V1AA 3NDEA 3UDXA 3UNWA 3SH9A 4A5RA 1GA0A 2W1TB 1XJ4A 4ARZA 3E4QA 5F1FA 3Q81A 2WGWB 2XEPA 3GR2A 3FWLA 1FR1A 4KZ4A 2V1ZA 1DP8A 1PZPA 2J3WA 3QNCA 1DRMA 2JBFA 4UHUA 4GJ4A 4GCZA 3BQAA 4UA7A 3T50A 2Y2PA 5DTTA 3BRMA 3D72A 4WMCD 5CGSA 4QHCA 2EFXA 3LIEA 4DMZA 4I3AA 4MCWA 3D4FA 3FC7A 3A3EA 2VGJA 3IXBA 4DE3A 1VEUA 3BECA 3HJKA 1L3LA 1JWZA 3L7HA 4OQ0A 3IF6A 5FAQA 1MKIA 4OPYA 3F1PA 2ZLYA 5CEBA 4G3KA 4WZ5C 3PBNA 5HD3A 3CHWP 4HQAA 4E3OA 3UB7A 4AFIA 4FH4A 4JGPA 2Y2LA 2G2WA 3A3DA 1YLJA 3LY4A 1OJGA 2V9AA 1JTGA 4D60A 2PU4A 3LICA 5CGXA 1P97A 2AVXA 3IS2A 5HDDA 2PRFA 4CLCA 3LYXA 3ZHHA 4OLDA 4BD0A 2M7VA 4E3LA 2Q0OA 1KE3A 4S2LA 2ACGA 1GHPA 1MY8A 4C6YA 2WYXA 1NLZA 3UE3A 3W4PA 1N9NA 1TDLA 4OKPA 3NHQA 3HLBA 5HX9A 2E8IA 4Y7PA 1OPXA 5I94A 4HP4A 2JHEA 4BBTA 2PD8A 1F98A 1AXBA 3DWKA 3W4OA 1W63M 5EM1A 4WZ4A 2Y2KA 2M7UA 2ZMFA 2H10A 5FDHA 4Q0JA 3MFDA 2JC7A 1CK3A 2PD7A 3G35A 2O0YA 4ZBEA 4KQQA 1ERMA 1UGUA 4HP9A 5AJGA 3G6OA 4PM8A 2VV8A 2PR5A 1ZKJA 1L2SA 2Y79A 4KZ5A 3ZYTA 2HV1A 2R9XA 2RL3A 2ZC4B 2W3GA 4E3KA 4Y3IA 2KX6A 4PAUA 4N92A 2K31A 2W0NA 3V39A 1KE0A 4JPMA 4R6LA 4X1LA 4MN5A 3JVVA 1MXOA 1ES3A 4LPZA 2Q9NA 4KG6A 3QP5A 3BY9A 1F2KA 2ZC5B 3A0VA 1WE4A 3H7WB 2WK0A 1Y28A 3F1NB 4L9GA 1PWGA 3BFFA 3MXRA 3FKVA 2A49A 5DKLA 1IYOA 3NBLA 5F1GA 2I9VA 5JYOA 3A3IA 2Z2MB 5MC7A 5BOHA 4E3MA 2PDRA 1W7FA 2V8FA 2JCHA 5FDSA 1I2WA 2JKFA 1SKFA 1OT9A 1NY0A 4GHIA 2W1TA 2EWVA 1L0GA 4HJ4A 5FI7A 2ZQ9A 3BFGA 5E2GA 3S7NA 3DBAA 5L07A 2VA0A 2PYRA 1JNUA 3D3OA 2B5RA 1MWSA 3TE8A 1AWIA 4NG2A 4Y0UA 3DWZA 3OC2A 5L2FA 3C7VA 1HD8A 3G30A 2A24B 4DE0A 5HAIA 4OVDA 3HUMA 5CX7A 2WKHA 3T4QA 4FTXA 4ZJ1A 2VZWA 2D01A 1L0EA 4Q0HA 3G32A 3T12B 1S0WA 5J8XA 3UMDA 4UA6A 3CJMA 5K5BA 4II7A 4CJNA 3T4OA 2J8YA 3NY4A 1PNEA 3V3RA 2EA9A 4XUZA 4MN6A 4X55A 2JKRI 2ZC6B 3P98A 5G18A 1IOUA 4RX2A 3R4KA 4K0WA 2XH9A 3NDGA 1SDNA 4EETB 3IBJA 4N1HA 2CMNA 1LLBA 1ZG6A 1BT5A 4G3WA 2J9OA 1F5MA 1FCNA 1T19A 3HLGA 2C5WB 2IWBA 4KZ7A 1TDGA 3IWOA 4DDYA 5FEGA 1EWZA 3MQ0A 1K54C 4JF4A 4QWOA 5CEDA 5EVLA 2Y8HA 3C5AA 3IHAA 2FH5A 2Y2GA 2XD5A 3C30A 3LIFA 5HAPA 4R70A 2ZOIA 4D2OA 4EEUA 5AQAA 4MMNA 3LI9A 3IX4A 3ZFZA 4P0MA 2PT7A 3S7PA 1IKGA 3QNBA 1TD5A 4I5SA 3CITA 3N6IA 3PYPA 5GLDA 3UN7A 5FATA 1NRJA 2W3FA 3PR6A 2WZZA 3WS0A 1K6SA 4KG5A 2WGVA 2HZ5A 3TSGA 4I3JA 1XFNA 2DMWA 4WELA 5KSHA 3KYZA 5HL6A 2XF3A 3PHYA 1ZG4A 2QYBA 3BQ8A 4R38A 1VETB 4DJ3A 2G7UA 2M1CA 4WEJA 4RVAA 1S6RA 3UB5P 2WUQA 2ZC7A 4OONA 1FSYA 1H5XA 2K7SA 4IUHA 4B88A 3UPNA 3D9YA 4B93A 4Y13A 1XX2A 3H7WA 1NRFA 4WL9A 4DXCA 3LR5A 5GL9A 3EGXC 3LY3A 4LCMA 2VK3A 3NOUC 1M6KA 4WUJA 2PHYA 4HOIA 3GQZA 3NJAA 1UWNX 3NI9A 4IVIA 4HEFA 1SKOB 5CGWA 1RCJA 4EV4A 2FFFB 5CRFA 1BTLA 3UB8A 1HTZA 1LT0A 5E2HA 4IUKA 2X71A 2A2LA 3LIBA 5FQQA 4YNRA 2JN7A 1KDSA 2PBYA 2V8CA 3VV4A 5DF8A 1D7EA 1OTBA 3N8SA 3BFEA 4DJ2A 3CG5A 1YPRA 3OOVA 4LFUA 4X68A 1UWPX 1WA9A 4YINA 3T4JA 2PR6A 4UAAA 2X01A 2ZOHA 4NXFA 4KZAA 4RX3A 1D1JA 1YLYA 1NLYA 1YM1A 5FAPA 3ZGAB 4KQRA 3JVUA 2A24A 1TS7A 4JGQA 5EOEA 3CUEA 3T4KA 2ZMAA 1W8QA 3A0SA 2ZQCA 3VE4A 1V9ZA 1ZHHB 2XD1A 2QPNA 4LV2A 4DE2A 2P9VB 5IT5A 2HJEA 5CECA 2Y2NA 1Z6FA 2VEAA 4G3VA 4E6XA 3ICYA 2OAP1 2IWCA 3MFXA 4WBGA 3LIAA 4BJPA 2FZ0A 5A93A 1XA7A 2ZBBA 1H8MA 1XFQA 1XP4A 1TS0A 3UDIA 1I2SA 1J9MA 4RA7A 5IHVA 4QJGA 3IH9A 3OPLA 1K4FA 5KZHA 2BTFP 3PBOA 3QHYA 4ZRRA 3UPOA 4I39A 3V5MA 2P74A 2O9CA 3NOPC 3TOIA 3S1YA 5GHXA 4BL2A 3CLOA 3M2KA 3MZDA 5EECA 4QB8A 5A8BA 1ESIA 3KYQA 1BLCA 4R1GA 1D06A 2OSUA 1Q2PA 4BBUA 1CEFA 3MXSA 4CLCE 4X56A 1VQQA 4Q0IA 3KSIA 5EV0A 5J3WA 5GLBA 4OOLA 5E2EA 2HP6A 3PBQA 2ZM0A 3ULFA 4DE1A 1YKDA 3MSHA 3T1QB 1XKZA 1W5DA 3WS4A 2DNSA 3QP1A 1MC0A 1MBLA 4K0XA 3VMAA 1XPBA 2BASA 4B4ZA 5DTSA 2ZQ8A 2BG1A 3ITAA 4IHQA 4ESPA 1M40A 4S2NC 1O7EA 3E4OA 5CHUA 5AVEA 1K55C 2H0YA 3G31A 4B4XA 4NKPA 2XROA 1GA9A 5M18A 2Q9MA 3GDIA 5AVFA 4K08A 2XK1A 5DF7A 1H8YA 2O9AA 4F94A 4YWZA 4QY6A 5DJTA 3W4QA 3Q7VB 5EVIC 2QZ6A 3SH8A 3MF0A 2XA7M 3T1SA 2O9BA 4XT2B 3IWQA 4DF6A 2EX2A 5DFXA 1PI4A 5DTKA 1DJBA 3C2WA 3WRZA 3LUQA 2WKQA 1YLZA 2XDMA 3SS3A 1FILA 4EBLA 2A3UA 3IXHA 4UQIM 1YSQA 4QY5A 1K54A 3BFCA 5U47A 3OCNA 3GECA 4PPRA 2V2FF 3DW0A 4ZJ3A 2J7VA 2B95A 1H8ZA 2H0TA 2JKRM 4WEKA 4Q8IA 2JKGA 4R3AA 1PI5A 5DF9A 3HVFA 1CF0A 3RXWA 5IS1A 4BD1A 3L9KA 3C4PA 1SKOA 1P9WA 2LB9A 2W27A 1DY6A 2XQZA 3WWXA 1KGGA 4EESA 1KVMA 5TR7A 4E3NA 2Y2JA 3AGFA 4EERA 3P01A 3A0RA 2QJ5A 4LRYC 1E25A 3R7WA 3MR0A 2P04A 3T1RA 3LCEA 3FG8A 1K6RA 3ZNYA 4IVKA 1FCOA 5EVIB 2OLVA 1RGYA 3HLEA 4JXGA 1DJAA 3LIDA 4PKYA 4DN0A 3G2YA 1TEMA 4HNBA 5HARA 1N9BA 1WYCA 2XGNA 2XSSA 4CLCD 3P09A 1GSVA 1GCEA 2P9VA 2GJ3A 4HI4A 4EBPA 1ERQA 2HP5A 3VFFA 2PYPA 3UY6A 1K57C 1ES4A 4CQHA 1MWUA 1EI5A 2ZL1B 4HESA 4MN7A 3IHBA 1PW1A 2ZD8A 4NXBA 1BLSA 2Y2OA 3CZDA 1YLWA 3W2ZA 4O0PA 3Q07A 5HPIA 1VM1A 4KZ9A 5DJUA 3BLMA 3WS5A 4OLGA 3G2ZA 3K3CA 1CEGA 4LRXC 4HH3A 5F82A 4EUVA 1BLHA 3FZCA 4OP5A 1PWCA 2VGLM 3K2NA 5IU1A 5HD5A 1ALQA 3IXDA 3LR4A 4F3LB 1NYMA 2K2NA 2ZC3B 4X1MA 2WGWA 3C38A 4OQGA 1FCMA 4I38A 3LO7A 4PM9A 3N8RA 2Y59A 1LSXA 5FQ9A 2XA7S 4S2PA 4GD8A 1ES2A 3DAVA 4Y17A 2HDRA 1L0FA 2EX8A 2L1MA 1WYBA 1KGEA 2QMIA 4GB7A 4Y0TA 1K56A 1U60A 4E04A 3ISGA 1Q2QA 4MBHA 3VP2A 3HREA 5CERA 2W3EA 4GW9A 4UQIS 4ZAMA 2Y55A
chains in the Genus database with same CATH topology
3C4OA 4EUZA 3Q7VA 3VP4A 2OLUA 1NRFA 3ZG5A 2X02A 4DXCA 5F1FA 4S2JA 1MWTA 3Q81A 5AQ7A 2WGWB 2XEPA 5GL9A 3GR2A 3LY3A 3FWLA 4LCMA 1FR1A 4KZ4A 1N4OA 3M6HA 1M6KA 2V1ZA 1PZPA 1LL5A 3QNCA 3IF6C 3GQZA 2JBFA 3IF5A 4OQIA 4MBKA 3NI9A 4FH2A 4IVIA 4UHUA 3AGEA 3GV9A 2HDQA 4HEFA 5CGWA 4UA7A 2Y2PA 1RCJA 5EE8A 3A3FA 4EV4A 5DTTA 2FFFB 3BRMA 4GDNA 1BTLA 5CRFA 4WMCD 5CGSA 5FQJA 4M3KA 4QHCA 1HTZA 1LI0A 2EFXA 5E2HA 2X71A 3V50A 5FQQA 1QMFA 1XXMA 1PW8A 5CHMA 4BQMA 1KDSA 2PBYA 5DF8A 3D4FA 3A3EA 4LV1A 2VGJA 3IXBA 2WKIA 4DE3A 3N8SA 3BYDA 4JF6A 3BECA 3IQAA 3BFEA 3CG5A 5CXWA 5EPHA 1I5QA 1FR6A 1JWZA 4OQ0A 5FAQA 3IF6A 1HZOA 4EWFA 1MKIA 4OPYA 4X68A 2WADA 3Q7ZA 4YINA 2ZLYA 5CEBA 4JXWA 1KVLA 4S2MA 4WZ5C 3PBNA 4P85A 1GHMA 4UAAA 3VSLA 2X01A 5HAQA 4U0TA 4KZAA 4RX3A 4E3OA 1YLYA 3B3XA 4FH4A 4P87A 1YM1A 2Y2LA 2G2WA 3A3DA 5FAPA 3ZGAB 1YLJA 3LY4A 4X53A 3HLFA 1JTGA 4KQRA 2PU4A 5CGXA 3FV7A 5EOEA 1Y54A 1L0DA 4JLFA 4MBFA 2G2UA 2HDUA 2ZMAA 5FI6A 1W8QA 3UE1A 2ZQCA 4E3IA 4Y0OA 1K4EA 5M19A 2XD1A 2QPNA 4LV2A 3ZHHA 4OLDA 4BD0A 4R4SA 4DE2A 2P9VB 4S2IA 4WZ5A 2JE5A 5CECA 2Y2NA 1Z6FA 4E6XA 4E3LA 1KE3A 3CMZA 4S2LA 1GHPA 2HDSA 3HL9A 2IWCA 4WBGA 2WAEA 1MY8A 5CHJA 4C6YA 5TGFA 2WYXA 4BJPA 4BL3A 5EVIA 3UE3A 3W8KA 5A93A 1XA7A 1HVBA 5HL1A 1ONHA 3W4PA 4ID4A 1TDLA 4MLLA 4GN2A 4OKPA 3PAEA 4KG2A 1XP4A 3HLBA 2I72A 3UDIA 5HX9A 4EBNA 2E8IA 1I2SA 2BLSA 4Y7PA 3VP3A 1LL9A 1J9MA 4RA7A 5IHVA 3UO9A 4QJGA 3IH9A 2WGIA 4H8RA 5AQBA 5I94A 2HP9A 1K4FA 3OPLA 5KZHA 3PBOA 4MEZA 3QHYA 3UPOA 1JVJA 4U3TA 4DKIA 4GDBA 3MKEA 5DVAA 2P74A 3V5MA 1AXBA 3RXXA 3DWKA 3W4OA 4CPKA 3TOIA 3S1YA 5GHXA 3Q82A 4BL2A 3M2KA 3MZDA 5EECA 4WZ4A 4QB8A 5TFQA 2Y2KA 3ZG8B 3N8LA 1ESIA 1BLCA 2H10A 4R1GA 5FDHA 2OSUA 1Q2PA 1JWVA 1CEFA 3MFDA 3MXSA 2JC7A 1CK3A 4X56A 1VQQA 3FKWA 3ZVWA 4BLMA 4RYEA 4N1XA 3G35A 4E6WA 5FQMA 4ZBEA 1PWDA 5GLBA 2WAFA 4OOLA 4KQQA 5E2EA 1ERMA 2HP6A 2ZM8A 2R9WA 3PBQA 2ZM0A 1IEMA 4PM8A 4C3QA 4DE1A 1W79A 5FQKA 1ZKJA 1L2SA 1XKZA 1CI9A 1KDWA 2DRWA 2EFUA 4KZ5A 4OPRA 5CTMA 1W5DA 2Y4AA 4KZ6A 4DRTA 3WS4A 2DNSA 3Q1FA 4GKUA 4JBFA 1MBLA 4K0XA 3VMAA 2RL3A 2R9XA 1LI9A 2ZC4B 1TVFA 1XPBA 4JF5A 4B4ZA 5DTSA 1QMEA 2ZQ8A 2BG1A 3ITAA 4E3KA 4E3JA 1M40A 4S2NC 1O7EA 4KENB 5GLAA 5CHUA 1E3UA 1K55C 3BLSA 2H0YA 4LV3A 3G31A 4N92A 4NETA 4B4XA 3V39A 1BLPA 4IEDA 1GA9A 5M18A 3AGDA 2Q9MA 1KE0A 4JPMA 3VOYA 5FQIA 3PAGA 1MXOA 2XK1A 1ES3A 4X69A 2EXBA 5DF7A 2Q9NA 4KG6A 4OP8A 1H8YA 3G4PA 4F94A 5GHYA 4QY6A 3BFDA 2XFSA 5CTNA 2EX9A 3JYIA 2ZC5B 3W4QA 1BZAA 2C6WB 1WE4A 3Q7VB 3SH7A 5EVIC 1LHYA 2WK0A 4U0XA 3WRTA 4L0LA 2QZ6A 4S2NA 1MWRA 3SH8A 1PWGA 3BFFA 4S2KA 3OPPA 3E2LA 1K55A 2ZM2A 3MXRA 2GDNA 3FKVA 2A49A 4KZ3A 3IWQA 4WYYA 4DF6A 2EX2A 3PTEA 1PI4A 1IYOA 5DTKA 1DJBA 4X6TA 1GHIA 3NBLA 5F1GA 3I7JA 4WMCA 4JXSA 5JYOA 3A3IA 2Z2MB 3WRZA 1O07A 4IBXA 5BOHA 5A90A 1YLZA 2XDMA 3GMWA 4OPQA 4E3MA 4FCFA 1W7FA 1K56D 2JCHA 3SS3A 1YT4A 1RGZA 1I2WA 3HBRA 1DJCA 4P6BA 1SKFA 4EBLA 2A3UA 3PBSA 3ZG7B 3IXHA 1NY0A 4OPZA 4QY5A 1L0GA 1K54A 3BFCA 5U47A 3OCNA 4QD4A 4R0QA 1SCWA 1K38A 4PPRA 1ONGA 2ZQ9A 2V2FF 5FI7A 3DW0A 3VOZA 4ZJ3A 3BFGA 4GZBA 4BENA 4LENA 3IF6B 5E2GA 4R4RA 4R23A 2J7VA 1G6AA 3VP1A 2EX6A 1H8ZA 4NK3A 2H0TA 4WEKA 3VSKA 4Q8IA 2H5SA 4KQOA 4PMAA 1PI5A 1EROA 2XFTA 3HVFA 1ES5A 5DF9A 2B5RA 1C3BA 3RXWA 2PU2A 4BD1A 3C4PA 4GOGA 1XGJA 1MPLA 1MWSA 3BEBA 3S22A 1PYYA 4Y0UA 3DWZA 3OCLA 3OC2A 1DY6A 2XQZA 4FSFA 2Y91A 3ITBA 3WWXA 5L2FA 1KGGA 3C7VA 4Z9QA 1HD8A 3G30A 5FSRA 4DE0A 1IYPA 1KVMA 4GNUA 5HAIA 5TR7A 1IYSA 4OVDA 4E3NA 2Y2JA 3MZFA 3VP0A 3AGFA 3HUMA 4JKTA 2WKHA 3IXGA 3UDFA 1PIOA 5HW3A 3ZDJA 2ZJ9A 5EUAA 4ZJ1A 1YLTA 1L0EA 1E3UD 3G32A 1S0WA 5GHZA 3PBTA 1E25A 5J8XA 2UWXA 1FQGA 3V3SA 4UA6A 4KZ8A 4ZTKA 1SHVA 4XXRA 1NJ4A 3CJMA 2Y2MA 3NCKA 3LCEA 1NZOA 1BSGA 1K6RA 3PBRA 5EOOA 3ZCZA 3ZNYA 5D3OA 4CJNA 3MZEA 3O87A 3TG9A 3SS4A 2J8YA 3NY4A 1FCOA 4IVKA 5EVIB 3V3RA 2OLVA 4XUZA 3S4XA 5KSCA 4GD6A 1RGYA 1BULA 2ZQAA 3HLEA 2EXAA 4JXGA 4X55A 1DJAA 3OPRA 2ZC6B 3P98A 3G2YA 1TEMA 5M1AA 5G18A 5HARA 1N9BA 1WYCA 5FI2A 4EQIA 4RX2A 1YMXA 4C75A 3RJUA 4K0WA 1KE4A 4K91A 2XH9A 2XGNA 3NDGA 3MKFA 1SDNA 3O88A 3G34A 2DCFA 4PM7A 3HLDA 4R3BA 1YLPA 4OOMA 3ZNTA 3LEZA 3P09A 4N1HA 1ESUA 2RCXA 1OMEA 2P9VA 1GCEA 1IELA 1LLBA 1NYYA 3A3JA 1ZG6A 1BT5A 2CC1A 4JXVA 4EBPA 2J9OA 1ERQA 2HP5A 2Z2LB 1XA1A 1FCNA 3UPPA 3VFFA 4XUXA 1IYQA 2HPBA 3UY6A 1K57C 4DDSA 3GTCA 1ES4A 5E43A 3HLGA 2C5WB 3M6BA 3N7WA 5EVID 2IWBA 1MWUA 2IWDA 1EI5A 1YMSA 3GSGA 4KZ7A 5A92A 1TDGA 3IWOA 2WKEA 3M2JA 4YFMA 3O3VA 4HESA 4DDYA 1IKIA 3IHBA 4KZBA 1PW1A 2ZD8A 1YQSA 4OOYA 1EWZA 4A5RA 4PM6A 1BLSA 2Y2OA 1CI8A 1K54C 3CZDA 4JF4A 1YLWA 3GRJA 5CEDA 1JWPA 3Q07A 5FAOA 5EVLA 4ZDXA 1VM1A 3C5AA 3IHAA 2V20A 4QU3A 4KZ9A 3BLMA 3WS5A 4OLGA 3WS2A 2Y2GA 2OV5A 2XD5A 4ZJ2A 3EQVA 5HAPA 3G2ZA 2FFYA 1CEGA 3GVBA 4D2OA 5FASA 1K57A 5F82A 2Y2IA 4HBTA 3O86A 5KMWA 5HFOA 5AQAA 2Y2HA 4S2OA 3ZFZA 1BLHA 4P0MA 1SDEA 3FZCA 4OP5A 3FYZA 3VFHA 1G68A 1PWCA 3IWIA 4PM5A 5F83A 4N9KA 5JYPA 3BM6A 1IKGA 1NZUA 4UA9A 3QNBA 1ALQA 3IXDA 3EQUA 3SS5A 3MBZA 1NYMA 2J9PA 5E2FA 3N4IA 4LCLA 2ZC3B 4HBUA 5GLCA 2WGWA 3ZG9B 2XLNA 3N6IA 1FSWA 5GLDA 3UN7A 2ZQDA 4MNRA 5FATA 4OQGA 1FCMA 2WZZA 2VGKA 3SOIA 3WS0A 3LO7A 3ZVTA 4PM9A 1K6SA 4KG5A 1E4DA 3C7UA 1W8YA 3N8RA 1JTDA 2ZQ7A 2WGVA 3TSGA 1K25A 1PZOA 1FOFA 2Y59A 3OPHA 1RP5A 3HUOA 4WELA 5KSHA 5FQ9A 2XF3A 3HLCA 4DXBA 4IBRA 1ZG4A 4S2PA 1BUEA 3OZHA 3UE0A 4GD8A 1ES2A 1KGFA 1XGIA 1ZC2A 2Y2QA 2HDRA 3HLWA 1L0FA 2EX8A 3HUNA 3IT9A 1WYBA 4WEJA 4RVAA 1KGEA 3WS1A 1S6RA 3IH8A 5AQ9A 3ZG0A 2QMIA 2WUQA 2ZC7A 4GB7A 4FD8A 3NIAA 4O7DA 4OONA 1NXYA 1FSYA 2XR0A 3DTMA 1H5XA 3E2KA 4Y0TA 1K56A 1U60A 2WZXA 3ISGA 5A91A 1Q2QA 3NDEA 3UDXA 4OH0A 3UPNA 4B88A 3NC8A 4MBHA 4N9LA 3UNWA 3VP2A 3HREA 4LV0A 5FA7A 3SH9A 5CERA 4WM9A 4OQHA 4R3JA 1XX2A 4ZAMA 2Y55A 1GA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C4O A;  4EUZ A;  3Q7V A;  3VP4 A;  2OLU A;  1NRF A;  3ZG5 A;  2X02 A;  4DXC A;  5F1F A;  4S2J A;  1MWT A;  3Q81 A;  5AQ7 A;  2WGW B;  2XEP A;  5GL9 A;  3GR2 A;  3LY3 A;  3FWL A;  4LCM A;  1FR1 A;  4KZ4 A;  1N4O A;  3M6H A;  1M6K A;  2V1Z A;  1PZP A;  1LL5 A;  3QNC A;  3IF6 C;  3GQZ A;  2JBF A;  3IF5 A;  4OQI A;  4MBK A;  3NI9 A;  4FH2 A;  4IVI A;  4UHU A;  3AGE A;  3GV9 A;  2HDQ A;  4HEF A;  5CGW A;  4UA7 A;  2Y2P A;  1RCJ A;  5EE8 A;  3A3F A;  4EV4 A;  5DTT A;  2FFF B;  3BRM A;  4GDN A;  1BTL A;  5CRF A;  4WMC D;  5CGS A;  5FQJ A;  4M3K A;  4QHC A;  1HTZ A;  1LI0 A;  2EFX A;  5E2H A;  2X71 A;  3V50 A;  5FQQ A;  1QMF A;  1XXM A;  1PW8 A;  5CHM A;  4BQM A;  1KDS A;  2PBY A;  5DF8 A;  3D4F A;  3A3E A;  4LV1 A;  2VGJ A;  3IXB A;  2WKI A;  4DE3 A;  3N8S A;  3BYD A;  4JF6 A;  3BEC A;  3IQA A;  3BFE A;  3CG5 A;  5CXW A;  5EPH A;  1I5Q A;  1FR6 A;  1JWZ A;  4OQ0 A;  5FAQ A;  3IF6 A;  1HZO A;  4EWF A;  1MKI A;  4OPY A;  4X68 A;  2WAD A;  3Q7Z A;  4YIN A;  2ZLY A;  5CEB A;  4JXW A;  1KVL A;  4S2M A;  4WZ5 C;  3PBN A;  4P85 A;  1GHM A;  4UAA A;  3VSL A;  2X01 A;  5HAQ A;  4U0T A;  4KZA A;  4RX3 A;  4E3O A;  1YLY A;  3B3X A;  4FH4 A;  4P87 A;  1YM1 A;  2Y2L A;  2G2W A;  3A3D A;  5FAP A;  3ZGA B;  1YLJ A;  3LY4 A;  4X53 A;  3HLF A;  1JTG A;  4KQR A;  2PU4 A;  5CGX A;  3FV7 A;  5EOE A;  1Y54 A;  1L0D A;  4JLF A;  4MBF A;  2G2U A;  2HDU A;  2ZMA A;  5FI6 A;  1W8Q A;  3UE1 A;  2ZQC A;  4E3I A;  4Y0O A;  1K4E A;  5M19 A;  2XD1 A;  2QPN A;  4LV2 A;  3ZHH A;  4OLD A;  4BD0 A;  4R4S A;  4DE2 A;  2P9V B;  4S2I A;  4WZ5 A;  2JE5 A;  5CEC A;  2Y2N A;  1Z6F A;  4E6X A;  4E3L A;  1KE3 A;  3CMZ A;  4S2L A;  1GHP A;  2HDS A;  3HL9 A;  2IWC A;  4WBG A;  2WAE A;  1MY8 A;  5CHJ A;  4C6Y A;  5TGF A;  2WYX A;  4BJP A;  4BL3 A;  5EVI A;  3UE3 A;  3W8K A;  5A93 A;  1XA7 A;  1HVB A;  5HL1 A;  1ONH A;  3W4P A;  4ID4 A;  1TDL A;  4MLL A;  4GN2 A;  4OKP A;  3PAE A;  4KG2 A;  1XP4 A;  3HLB A;  2I72 A;  3UDI A;  5HX9 A;  4EBN A;  2E8I A;  1I2S A;  2BLS A;  4Y7P A;  3VP3 A;  1LL9 A;  1J9M A;  4RA7 A;  5IHV A;  3UO9 A;  4QJG A;  3IH9 A;  2WGI A;  4H8R A;  5AQB A;  5I94 A;  2HP9 A;  1K4F A;  3OPL A;  5KZH A;  3PBO A;  4MEZ A;  3QHY A;  3UPO A;  1JVJ A;  4U3T A;  4DKI A;  4GDB A;  3MKE A;  5DVA A;  2P74 A;  3V5M A;  1AXB A;  3RXX A;  3DWK A;  3W4O A;  4CPK A;  3TOI A;  3S1Y A;  5GHX A;  3Q82 A;  4BL2 A;  3M2K A;  3MZD A;  5EEC A;  4WZ4 A;  4QB8 A;  5TFQ A;  2Y2K A;  3ZG8 B;  3N8L A;  1ESI A;  1BLC A;  2H10 A;  4R1G A;  5FDH A;  2OSU A;  1Q2P A;  1JWV A;  1CEF A;  3MFD A;  3MXS A;  2JC7 A;  1CK3 A;  4X56 A;  1VQQ A;  3FKW A;  3ZVW A;  4BLM A;  4RYE A;  4N1X A;  3G35 A;  4E6W A;  5FQM A;  4ZBE A;  1PWD A;  5GLB A;  2WAF A;  4OOL A;  4KQQ A;  5E2E A;  1ERM A;  2HP6 A;  2ZM8 A;  2R9W A;  3PBQ A;  2ZM0 A;  1IEM A;  4PM8 A;  4C3Q A;  4DE1 A;  1W79 A;  5FQK A;  1ZKJ A;  1L2S A;  1XKZ A;  1CI9 A;  1KDW A;  2DRW A;  2EFU A;  4KZ5 A;  4OPR A;  5CTM A;  1W5D A;  2Y4A A;  4KZ6 A;  4DRT A;  3WS4 A;  2DNS A;  3Q1F A;  4GKU A;  4JBF A;  1MBL A;  4K0X A;  3VMA A;  2RL3 A;  2R9X A;  1LI9 A;  2ZC4 B;  1TVF A;  1XPB A;  4JF5 A;  4B4Z A;  5DTS A;  1QME A;  2ZQ8 A;  2BG1 A;  3ITA A;  4E3K A;  4E3J A;  1M40 A;  4S2N C;  1O7E A;  4KEN B;  5GLA A;  5CHU A;  1E3U A;  1K55 C;  3BLS A;  2H0Y A;  4LV3 A;  3G31 A;  4N92 A;  4NET A;  4B4X A;  3V39 A;  1BLP A;  4IED A;  1GA9 A;  5M18 A;  3AGD A;  2Q9M A;  1KE0 A;  4JPM A;  3VOY A;  5FQI A;  3PAG A;  1MXO A;  2XK1 A;  1ES3 A;  4X69 A;  2EXB A;  5DF7 A;  2Q9N A;  4KG6 A;  4OP8 A;  1H8Y A;  3G4P A;  4F94 A;  5GHY A;  4QY6 A;  3BFD A;  2XFS A;  5CTN A;  2EX9 A;  3JYI A;  2ZC5 B;  3W4Q A;  1BZA A;  2C6W B;  1WE4 A;  3Q7V B;  3SH7 A;  5EVI C;  1LHY A;  2WK0 A;  4U0X A;  3WRT A;  4L0L A;  2QZ6 A;  4S2N A;  1MWR A;  3SH8 A;  1PWG A;  3BFF A;  4S2K A;  3OPP A;  3E2L A;  1K55 A;  2ZM2 A;  3MXR A;  2GDN A;  3FKV A;  2A49 A;  4KZ3 A;  3IWQ A;  4WYY A;  4DF6 A;  2EX2 A;  3PTE A;  1PI4 A;  1IYO A;  5DTK A;  1DJB A;  4X6T A;  1GHI A;  3NBL A;  5F1G A;  3I7J A;  4WMC A;  4JXS A;  5JYO A;  3A3I A;  2Z2M B;  3WRZ A;  1O07 A;  4IBX A;  5BOH A;  5A90 A;  1YLZ A;  2XDM A;  3GMW A;  4OPQ A;  4E3M A;  4FCF A;  1W7F A;  1K56 D;  2JCH A;  3SS3 A;  1YT4 A;  1RGZ A;  1I2W A;  3HBR A;  1DJC A;  4P6B A;  1SKF A;  4EBL A;  2A3U A;  3PBS A;  3ZG7 B;  3IXH A;  1NY0 A;  4OPZ A;  4QY5 A;  1L0G A;  1K54 A;  3BFC A;  5U47 A;  3OCN A;  4QD4 A;  4R0Q A;  1SCW A;  1K38 A;  4PPR A;  1ONG A;  2ZQ9 A;  2V2F F;  5FI7 A;  3DW0 A;  3VOZ A;  4ZJ3 A;  3BFG A;  4GZB A;  4BEN A;  4LEN A;  3IF6 B;  5E2G A;  4R4R A;  4R23 A;  2J7V A;  1G6A A;  3VP1 A;  2EX6 A;  1H8Z A;  4NK3 A;  2H0T A;  4WEK A;  3VSK A;  4Q8I A;  2H5S A;  4KQO A;  4PMA A;  1PI5 A;  1ERO A;  2XFT A;  3HVF A;  1ES5 A;  5DF9 A;  2B5R A;  1C3B A;  3RXW A;  2PU2 A;  4BD1 A;  3C4P A;  4GOG A;  1XGJ A;  1MPL A;  1MWS A;  3BEB A;  3S22 A;  1PYY A;  4Y0U A;  3DWZ A;  3OCL A;  3OC2 A;  1DY6 A;  2XQZ A;  4FSF A;  2Y91 A;  3ITB A;  3WWX A;  5L2F A;  1KGG A;  3C7V A;  4Z9Q A;  1HD8 A;  3G30 A;  5FSR A;  4DE0 A;  1IYP A;  1KVM A;  4GNU A;  5HAI A;  5TR7 A;  1IYS A;  4OVD A;  4E3N A;  2Y2J A;  3MZF A;  3VP0 A;  3AGF A;  3HUM A;  4JKT A;  2WKH A;  3IXG A;  3UDF A;  1PIO A;  5HW3 A;  3ZDJ A;  2ZJ9 A;  5EUA A;  4ZJ1 A;  1YLT A;  1L0E A;  1E3U D;  3G32 A;  1S0W A;  5GHZ A;  3PBT A;  1E25 A;  5J8X A;  2UWX A;  1FQG A;  3V3S A;  4UA6 A;  4KZ8 A;  4ZTK A;  1SHV A;  4XXR A;  1NJ4 A;  3CJM A;  2Y2M A;  3NCK A;  3LCE A;  1NZO A;  1BSG A;  1K6R A;  3PBR A;  5EOO A;  3ZCZ A;  3ZNY A;  5D3O A;  4CJN A;  3MZE A;  3O87 A;  3TG9 A;  3SS4 A;  2J8Y A;  3NY4 A;  1FCO A;  4IVK A;  5EVI B;  3V3R A;  2OLV A;  4XUZ A;  3S4X A;  5KSC A;  4GD6 A;  1RGY A;  1BUL A;  2ZQA A;  3HLE A;  2EXA A;  4JXG A;  4X55 A;  1DJA A;  3OPR A;  2ZC6 B;  3P98 A;  3G2Y A;  1TEM A;  5M1A A;  5G18 A;  5HAR A;  1N9B A;  1WYC A;  5FI2 A;  4EQI A;  4RX2 A;  1YMX A;  4C75 A;  3RJU A;  4K0W A;  1KE4 A;  4K91 A;  2XH9 A;  2XGN A;  3NDG A;  3MKF A;  1SDN A;  3O88 A;  3G34 A;  2DCF A;  4PM7 A;  3HLD A;  4R3B A;  1YLP A;  4OOM A;  3ZNT A;  3LEZ A;  3P09 A;  4N1H A;  1ESU A;  2RCX A;  1OME A;  2P9V A;  1GCE A;  1IEL A;  1LLB A;  1NYY A;  3A3J A;  1ZG6 A;  1BT5 A;  2CC1 A;  4JXV A;  4EBP A;  2J9O A;  1ERQ A;  2HP5 A;  2Z2L B;  1XA1 A;  1FCN A;  3UPP A;  3VFF A;  4XUX A;  1IYQ A;  2HPB A;  3UY6 A;  1K57 C;  4DDS A;  3GTC A;  1ES4 A;  5E43 A;  3HLG A;  2C5W B;  3M6B A;  3N7W A;  5EVI D;  2IWB A;  1MWU A;  2IWD A;  1EI5 A;  1YMS A;  3GSG A;  4KZ7 A;  5A92 A;  1TDG A;  3IWO A;  2WKE A;  3M2J A;  4YFM A;  3O3V A;  4HES A;  4DDY A;  1IKI A;  3IHB A;  4KZB A;  1PW1 A;  2ZD8 A;  1YQS A;  4OOY A;  1EWZ A;  4A5R A;  4PM6 A;  1BLS A;  2Y2O A;  1CI8 A;  1K54 C;  3CZD A;  4JF4 A;  1YLW A;  3GRJ A;  5CED A;  1JWP A;  3Q07 A;  5FAO A;  5EVL A;  4ZDX A;  1VM1 A;  3C5A A;  3IHA A;  2V20 A;  4QU3 A;  4KZ9 A;  3BLM A;  3WS5 A;  4OLG A;  3WS2 A;  2Y2G A;  2OV5 A;  2XD5 A;  4ZJ2 A;  3EQV A;  5HAP A;  3G2Z A;  2FFY A;  1CEG A;  3GVB A;  4D2O A;  5FAS A;  1K57 A;  5F82 A;  2Y2I A;  4HBT A;  3O86 A;  5KMW A;  5HFO A;  5AQA A;  2Y2H A;  4S2O A;  3ZFZ A;  1BLH A;  4P0M A;  1SDE A;  3FZC A;  4OP5 A;  3FYZ A;  3VFH A;  1G68 A;  1PWC A;  3IWI A;  4PM5 A;  5F83 A;  4N9K A;  5JYP A;  3BM6 A;  1IKG A;  1NZU A;  4UA9 A;  3QNB A;  1ALQ A;  3IXD A;  3EQU A;  3SS5 A;  3MBZ A;  1NYM A;  2J9P A;  5E2F A;  3N4I A;  4LCL A;  2ZC3 B;  4HBU A;  5GLC A;  2WGW A;  3ZG9 B;  2XLN A;  3N6I A;  1FSW A;  5GLD A;  3UN7 A;  2ZQD A;  4MNR A;  5FAT A;  4OQG A;  1FCM A;  2WZZ A;  2VGK A;  3SOI A;  3WS0 A;  3LO7 A;  3ZVT A;  4PM9 A;  1K6S A;  4KG5 A;  1E4D A;  3C7U A;  1W8Y A;  3N8R A;  1JTD A;  2ZQ7 A;  2WGV A;  3TSG A;  1K25 A;  1PZO A;  1FOF A;  2Y59 A;  3OPH A;  1RP5 A;  3HUO A;  4WEL A;  5KSH A;  5FQ9 A;  2XF3 A;  3HLC A;  4DXB A;  4IBR A;  1ZG4 A;  4S2P A;  1BUE A;  3OZH A;  3UE0 A;  4GD8 A;  1ES2 A;  1KGF A;  1XGI A;  1ZC2 A;  2Y2Q A;  2HDR A;  3HLW A;  1L0F A;  2EX8 A;  3HUN A;  3IT9 A;  1WYB A;  4WEJ A;  4RVA A;  1KGE A;  3WS1 A;  1S6R A;  3IH8 A;  5AQ9 A;  3ZG0 A;  2QMI A;  2WUQ A;  2ZC7 A;  4GB7 A;  4FD8 A;  3NIA A;  4O7D A;  4OON A;  1NXY A;  1FSY A;  2XR0 A;  3DTM A;  1H5X A;  3E2K A;  4Y0T A;  1K56 A;  1U60 A;  2WZX A;  3ISG A;  5A91 A;  1Q2Q A;  3NDE A;  3UDX A;  4OH0 A;  3UPN A;  4B88 A;  3NC8 A;  4MBH A;  4N9L A;  3UNW A;  3VP2 A;  3HRE A;  4LV0 A;  5FA7 A;  3SH9 A;  5CER A;  4WM9 A;  4OQH A;  4R3J A;  1XX2 A;  4ZAM A;  2Y55 A;  1GA0 A; 
#chains in the Genus database with same CATH topology
 4EUZ A;  3Q7V A;  2OLU A;  4EXO A;  3DTK A;  2NUT C;  3ZG5 A;  5AQ7 A;  1PRQ A;  4XT2 A;  3M6H A;  1LL5 A;  2P7J A;  3IF6 C;  4I3I A;  4OQI A;  1LSW A;  3AGE A;  2HDQ A;  3BJN A;  3UB6 A;  5EE8 A;  3A3F A;  2INW A;  4GDN A;  3DTE A;  1V9Y A;  2B02 A;  1S1Y A;  3VE3 A;  3ZQ5 A;  5EM0 A;  4BQM A;  2QKP A;  2GZA A;  2WKI A;  3BYD A;  4JF6 A;  5CXW A;  5EPH A;  1I5Q A;  4GS9 B;  3K3D A;  4CLC C;  1HZO A;  2JKT I;  2VLG A;  1KVL A;  4P85 A;  3VSL A;  4EW7 A;  3B3X A;  4P87 A;  3BW6 A;  3S7O A;  4X53 A;  5FL3 A;  1Y4O A;  1T1B A;  3F1O B;  2LB5 A;  5HWT A;  2J3T D;  1Y54 A;  1VB6 A;  5L09 A;  4MBF A;  2G2U A;  4Y2F A;  2MJ6 A;  3QP4 A;  3E98 A;  5M19 A;  1S67 L;  4S2I A;  4WZ5 A;  2JE5 A;  3C8C A;  2HDS A;  2VX8 A;  2WAE A;  5CHJ A;  5TGF A;  3O5Y A;  5EVI A;  5HL1 A;  1HVB A;  3E0Y A;  3TJZ C;  4MLL A;  2KLI A;  3PAE A;  2ZMV A;  3VP3 A;  2BLS A;  2UV0 E;  1LL9 A;  3RFB A;  4H8R A;  1Z09 A;  4M4X A;  2HP9 A;  3KSH A;  2QWS A;  4U3T A;  4DKI A;  2OAQ 1;  3MKE A;  3RXX A;  1BYW A;  1J3W A;  3MMH A;  1DP6 A;  5TFQ A;  3N8L A;  2VGL S;  4RYE A;  3CPT B;  4PKY G;  4EU0 A;  5FQM A;  2WAF A;  3F1N A;  2R9W A;  3KSG A;  4C3Q A;  1KDW A;  2DRW A;  2EFU A;  5CTM A;  5I5L A;  4KZ6 A;  2Y4A A;  4DRT A;  1XJ2 A;  3B33 A;  3MQQ A;  2V1B A;  1LI9 A;  1QME A;  1MKM A;  4E3J A;  1XJ3 A;  4KEN B;  3RH8 B;  1E3U A;  3BLS A;  4NET A;  1OTI A;  2VJW A;  2KOI A;  3AGD A;  4WLA A;  1LL8 A;  2PAV P;  3PAG A;  3QP6 A;  4X69 A;  2EXB A;  4OP8 A;  3G4P A;  3BFD A;  2XFS A;  5CTN A;  3JYI A;  3IX8 A;  2C6W B;  3BWL A;  3OPP A;  2ZM2 A;  3T4S A;  3EGD C;  4NXE A;  4KZ3 A;  3UB9 A;  1T18 A;  3I7J A;  4WMC A;  4JXS A;  3B42 A;  4IBX A;  3GMW A;  5F5Y A;  3HBR A;  4P6B A;  2J3T C;  4OPZ A;  4QD4 A;  4R0Q A;  1SCW A;  1K38 A;  5J4E A;  1ONG A;  3SW1 A;  4P6Z M;  3LEQ A;  1ZTU A;  2OWJ A;  3T4T A;  2EX6 A;  1LSV A;  4KQO A;  2B18 A;  5F69 A;  1C3B A;  2PU2 A;  4GOG A;  3S22 A;  1TS8 A;  3BEB A;  4FSF A;  4Z9Q A;  2H28 A;  5FSR A;  1GSW A;  5G4Z A;  5HWV A;  3CAX A;  3MJQ A;  1PIO A;  5HW3 A;  3ZDJ A;  3TRC A;  1CQA A;  1E3U D;  3KSF A;  5GHZ A;  3PBT A;  4GS9 A;  2UWX A;  1OTD A;  3V3S A;  4H6J B;  4KZ8 A;  4ZTK A;  1NJ4 A;  3KYE A;  3NCK A;  1NZO A;  1BSG A;  3PBR A;  5EOO A;  3ZCZ A;  5D3O A;  3MZE A;  3S4X A;  4GD6 A;  2HF6 A;  1BUL A;  2EXA A;  4GHI B;  3OPR A;  1DP9 A;  4WF0 A;  3F1O A;  4IJG A;  5M1A A;  4BBV A;  3RJU A;  3OLO A;  1KE4 A;  3O88 A;  1F9I A;  3G34 A;  1K0K A;  2DCF A;  4PM7 A;  1OTE A;  2RCX A;  1IEL A;  3A3J A;  2CC1 A;  4JXV A;  2Z2L B;  1XA1 A;  1TS6 A;  3MS6 A;  5E43 A;  3M6B A;  3N7W A;  5A92 A;  3CI6 A;  4HY8 A;  1GSX A;  2L4R A;  3DTI A;  3O3V A;  1FIK A;  2Z6D A;  1IKI A;  4PM6 A;  1CI8 A;  1OT6 A;  3LGO A;  1VET A;  5FAO A;  2YKH A;  4QU3 A;  3OBF A;  2PBD P;  3WS2 A;  2OV5 A;  3EQV A;  2FFY A;  4HBT A;  5HFO A;  3FYZ A;  3VFH A;  4PM5 A;  5JYP A;  1NZU A;  5FEF A;  2J80 A;  3CPT A;  3EQU A;  3MBZ A;  2J9P A;  3SS5 A;  5E2F A;  5GLC A;  3ZG9 B;  4HIA A;  1FSW A;  2ZQD A;  4MNR A;  5TBM B;  3S7Q A;  3LI8 A;  2VGK A;  4L9E A;  4Z1W A;  3SOI A;  3T4L A;  1E4D A;  1JTD A;  2ZQ7 A;  3UE6 A;  1FOF A;  5L8M A;  3H82 B;  1RP5 A;  3HUO A;  3HLC A;  4IBR A;  3UE0 A;  1KGF A;  1XGI A;  2Y2Q A;  3MQO A;  3WS1 A;  5AQ9 A;  5HDS A;  4FD8 A;  2E8J A;  1NXY A;  2XR0 A;  3E2K A;  4OH0 A;  3NC8 A;  4N9L A;  4LV0 A;  5FA7 A;  3P7N A;  2JKT M;  4OQH A;  4R3J A;  4WM9 A;  3C4O A;  3VP4 A;  4P6Z S;  4RQ9 A;  2X02 A;  4S2J A;  1MWT A;  3VOL A;  3QP2 A;  1N4O A;  1S66 L;  1NWZ A;  3E4P A;  3IF5 A;  4MBK A;  2KDK A;  4FH2 A;  3GV9 A;  5EFW A;  4HJ6 A;  5HZH A;  5J7E A;  5C5K A;  5FQJ A;  4M3K A;  1LI0 A;  4Y15 A;  3IBR A;  3V67 A;  3V50 A;  3HJI A;  1QMF A;  4WN5 A;  1XXM A;  4Y5F A;  1PW8 A;  5CHM A;  5HSQ A;  3CUE C;  4LV1 A;  3IQA A;  2VV6 A;  3EEA A;  1FR6 A;  3KX0 X;  4EWF A;  2WAD A;  3Q7Z A;  4JXW A;  1H0M A;  3LR0 A;  4S2M A;  2NUP C;  1X0O A;  1GHM A;  2D02 A;  5HAQ A;  4U0T A;  5HPF A;  4EEP A;  3HLF A;  4UEY A;  5LBR A;  1N9O A;  3FV7 A;  1XJ6 A;  1L0D A;  4EQ1 A;  4JLF A;  5FI6 A;  2HDU A;  3U4L P;  3UE1 A;  4E3I A;  4Y0O A;  1K4E A;  4R4S A;  4LLO B;  4H6J A;  3CMZ A;  3HL9 A;  1H3Q A;  2HJ9 C;  4BL3 A;  3BY8 A;  2O99 A;  3W8K A;  1YAX A;  5G4Y A;  1ONH A;  4ID4 A;  2V0W A;  4GN2 A;  4KG2 A;  2I72 A;  2YKF A;  4EBN A;  2WKP A;  2GX5 A;  4NXG A;  3UO9 A;  5AQB A;  2WGI A;  2W3H A;  5HDC A;  4MEZ A;  2V0U A;  1JVJ A;  1P0Z A;  5DKK A;  4GDB A;  5DVA A;  3PXP A;  4CPK A;  3Q82 A;  4BWI A;  3ZG8 B;  2EWW A;  3TW8 A;  1JWV A;  5HWW A;  3FKW A;  3KO6 A;  4BLM A;  4N1X A;  4PHT A;  3FPW A;  4E6W A;  1PWD A;  1W63 Q;  5DFY A;  2ZM8 A;  1IEM A;  1W79 A;  5FQK A;  1CI9 A;  3EEH A;  4OPR A;  4ETZ A;  3Q1F A;  1MZU A;  4GKU A;  4JBF A;  1STZ A;  2L0W A;  4FUW A;  1TVF A;  3NOT C;  4JF5 A;  5GLA A;  4LV3 A;  1BLP A;  4IED A;  4LRZ E;  3FPV A;  3VOY A;  2W1R A;  1HLU P;  5FQI A;  5TBM A;  3MXQ A;  4BMW A;  4JGO A;  1G6O A;  5GHY A;  2EX9 A;  1BZA A;  4LGW A;  3SH7 A;  1LHY A;  4U0X A;  3B47 A;  3WRT A;  3SZT A;  3H82 A;  4L0L A;  5F68 A;  4ARZ B;  4S2N A;  1MWR A;  4S2K A;  3E2L A;  1K55 A;  2GDN A;  4HH2 A;  4WYY A;  4L9F A;  3PTE A;  2W3D A;  3HCY A;  4X6T A;  1GHI A;  3JPU A;  1O07 A;  2OOL A;  5A90 A;  4OPQ A;  4FCF A;  1T1C A;  3LR3 A;  1K56 D;  1YT4 A;  1RGZ A;  1T1A A;  1DJC A;  3PBS A;  3ZG7 B;  1IFQ A;  4O01 A;  4HJ3 A;  1VEU B;  3ZVW A;  3VOZ A;  1TF1 A;  3RTY A;  4GZB A;  4BEN A;  4LEN A;  3IF6 B;  3F1P B;  4R4R A;  4R23 A;  3VP1 A;  1G6A A;  5TJJ A;  4NK3 A;  3VSK A;  2H5S A;  4KUK A;  4PMA A;  3UME A;  1ERO A;  2XFT A;  4O8G A;  1ES5 A;  1XGJ A;  1MPL A;  4JGR A;  1PYY A;  3OCL A;  4KQD A;  2Y91 A;  3ITB A;  1S4R A;  1IYP A;  4GNU A;  1IYS A;  3MZF A;  3VP0 A;  4JKT A;  1A0K A;  3IXG A;  3UDF A;  2ZL1 A;  3IS2 B;  1S4S A;  2ZJ9 A;  5EUA A;  4CLC B;  1YLT A;  2Z6C A;  1PFL A;  2QJ7 A;  1FQG A;  5L10 A;  1SHV A;  4XXR A;  2Y2M A;  4ETX A;  1G28 A;  3O87 A;  3TG9 A;  4B9O A;  3SS4 A;  5F6A A;  5KSC A;  1ACF A;  2ZQA A;  4QPR A;  2HGV A;  2XRN A;  5FI2 A;  4EQI A;  4HHD A;  3QP8 A;  1YMX A;  4C75 A;  4YOF A;  3LFV A;  4K91 A;  4F3L A;  3MKF A;  1OJ5 A;  5EVE A;  3HLD A;  4R3B A;  1YLP A;  4OOM A;  3ZNT A;  3LEZ A;  1ESU A;  1OME A;  2QHK A;  1NYY A;  3NUL A;  3UPP A;  4XUX A;  1N9L A;  1IYQ A;  2HPB A;  4DDS A;  3GTC A;  5EVI D;  2IWD A;  1YMS A;  3GSG A;  4X25 A;  2WKE A;  3M2J A;  4YFM A;  1ODV A;  4KZB A;  1YQS A;  4OOY A;  3R7W B;  3GRJ A;  1KOU A;  2WKR A;  1JWP A;  4ZDX A;  3H9W A;  1SZV A;  2V20 A;  2GNX A;  3NEC A;  3CWF A;  4ZJ2 A;  3GVB A;  5FAS A;  1K57 A;  2Y2I A;  1P9R A;  3O86 A;  4FOF A;  5KMW A;  2Y2H A;  4S2O A;  2R78 A;  1SDE A;  1G68 A;  3IWI A;  5F83 A;  4N9K A;  3BM6 A;  4UA9 A;  5KIZ A;  4MDZ A;  2P08 A;  3EWK A;  3N4I A;  1G5U A;  4LCL A;  2VV7 A;  4HBU A;  1S1Z A;  3U2A A;  2XLN A;  1EW0 A;  4GLQ A;  4ME4 A;  3ZVT A;  2IA2 A;  3C7U A;  1W8Y A;  1K25 A;  1PZO A;  1VHM A;  4KUO A;  1CJF A;  1YSP A;  3OPH A;  4DXB A;  1BUE A;  1OTA A;  3OZH A;  1ZC2 A;  3HLW A;  2OWH A;  3HUN A;  3EOI A;  3IT9 A;  3IX3 A;  3IH8 A;  3ZG0 A;  4NEE D;  3NIA A;  4O7D A;  3DTM A;  2WZX A;  2VKS A;  3T1X A;  5A91 A;  2V1A A;  3NDE A;  3UDX A;  3UNW A;  3SH9 A;  4A5R A;  1GA0 A;  2W1T B;  1XJ4 A;  4ARZ A;  3E4Q A;  5F1F A;  3Q81 A;  2WGW B;  2XEP A;  3GR2 A;  3FWL A;  1FR1 A;  4KZ4 A;  2V1Z A;  1DP8 A;  1PZP A;  2J3W A;  3QNC A;  1DRM A;  2JBF A;  4UHU A;  4GJ4 A;  4GCZ A;  3BQA A;  4UA7 A;  3T50 A;  2Y2P A;  5DTT A;  3BRM A;  3D72 A;  4WMC D;  5CGS A;  4QHC A;  2EFX A;  3LIE A;  4DMZ A;  4I3A A;  4MCW A;  3D4F A;  3FC7 A;  3A3E A;  2VGJ A;  3IXB A;  4DE3 A;  1VEU A;  3BEC A;  3HJK A;  1L3L A;  1JWZ A;  3L7H A;  4OQ0 A;  3IF6 A;  5FAQ A;  1MKI A;  4OPY A;  3F1P A;  2ZLY A;  5CEB A;  4G3K A;  4WZ5 C;  3PBN A;  5HD3 A;  3CHW P;  4HQA A;  4E3O A;  3UB7 A;  4AFI A;  4FH4 A;  4JGP A;  2Y2L A;  2G2W A;  3A3D A;  1YLJ A;  3LY4 A;  1OJG A;  2V9A A;  1JTG A;  4D60 A;  2PU4 A;  3LIC A;  5CGX A;  1P97 A;  2AVX A;  3IS2 A;  5HDD A;  2PRF A;  4CLC A;  3LYX A;  3ZHH A;  4OLD A;  4BD0 A;  2M7V A;  4E3L A;  2Q0O A;  1KE3 A;  4S2L A;  2ACG A;  1GHP A;  1MY8 A;  4C6Y A;  2WYX A;  1NLZ A;  3UE3 A;  3W4P A;  1N9N A;  1TDL A;  4OKP A;  3NHQ A;  3HLB A;  5HX9 A;  2E8I A;  4Y7P A;  1OPX A;  5I94 A;  4HP4 A;  2JHE A;  4BBT A;  2PD8 A;  1F98 A;  1AXB A;  3DWK A;  3W4O A;  1W63 M;  5EM1 A;  4WZ4 A;  2Y2K A;  2M7U A;  2ZMF A;  2H10 A;  5FDH A;  4Q0J A;  3MFD A;  2JC7 A;  1CK3 A;  2PD7 A;  3G35 A;  2O0Y A;  4ZBE A;  4KQQ A;  1ERM A;  1UGU A;  4HP9 A;  5AJG A;  3G6O A;  4PM8 A;  2VV8 A;  2PR5 A;  1ZKJ A;  1L2S A;  2Y79 A;  4KZ5 A;  3ZYT A;  2HV1 A;  2R9X A;  2RL3 A;  2ZC4 B;  2W3G A;  4E3K A;  4Y3I A;  2KX6 A;  4PAU A;  4N92 A;  2K31 A;  2W0N A;  3V39 A;  1KE0 A;  4JPM A;  4R6L A;  4X1L A;  4MN5 A;  3JVV A;  1MXO A;  1ES3 A;  4LPZ A;  2Q9N A;  4KG6 A;  3QP5 A;  3BY9 A;  1F2K A;  2ZC5 B;  3A0V A;  1WE4 A;  3H7W B;  2WK0 A;  1Y28 A;  3F1N B;  4L9G A;  1PWG A;  3BFF A;  3MXR A;  3FKV A;  2A49 A;  5DKL A;  1IYO A;  3NBL A;  5F1G A;  2I9V A;  5JYO A;  3A3I A;  2Z2M B;  5MC7 A;  5BOH A;  4E3M A;  2PDR A;  1W7F A;  2V8F A;  2JCH A;  5FDS A;  1I2W A;  2JKF A;  1SKF A;  1OT9 A;  1NY0 A;  4GHI A;  2W1T A;  2EWV A;  1L0G A;  4HJ4 A;  5FI7 A;  2ZQ9 A;  3BFG A;  5E2G A;  3S7N A;  3DBA A;  5L07 A;  2VA0 A;  2PYR A;  1JNU A;  3D3O A;  2B5R A;  1MWS A;  3TE8 A;  1AWI A;  4NG2 A;  4Y0U A;  3DWZ A;  3OC2 A;  5L2F A;  3C7V A;  1HD8 A;  3G30 A;  2A24 B;  4DE0 A;  5HAI A;  4OVD A;  3HUM A;  5CX7 A;  2WKH A;  3T4Q A;  4FTX A;  4ZJ1 A;  2VZW A;  2D01 A;  1L0E A;  4Q0H A;  3G32 A;  3T12 B;  1S0W A;  5J8X A;  3UMD A;  4UA6 A;  3CJM A;  5K5B A;  4II7 A;  4CJN A;  3T4O A;  2J8Y A;  3NY4 A;  1PNE A;  3V3R A;  2EA9 A;  4XUZ A;  4MN6 A;  4X55 A;  2JKR I;  2ZC6 B;  3P98 A;  5G18 A;  1IOU A;  4RX2 A;  3R4K A;  4K0W A;  2XH9 A;  3NDG A;  1SDN A;  4EET B;  3IBJ A;  4N1H A;  2CMN A;  1LLB A;  1ZG6 A;  1BT5 A;  4G3W A;  2J9O A;  1F5M A;  1FCN A;  1T19 A;  3HLG A;  2C5W B;  2IWB A;  4KZ7 A;  1TDG A;  3IWO A;  4DDY A;  5FEG A;  1EWZ A;  3MQ0 A;  1K54 C;  4JF4 A;  4QWO A;  5CED A;  5EVL A;  2Y8H A;  3C5A A;  3IHA A;  2FH5 A;  2Y2G A;  2XD5 A;  3C30 A;  3LIF A;  5HAP A;  4R70 A;  2ZOI A;  4D2O A;  4EEU A;  5AQA A;  4MMN A;  3LI9 A;  3IX4 A;  3ZFZ A;  4P0M A;  2PT7 A;  3S7P A;  1IKG A;  3QNB A;  1TD5 A;  4I5S A;  3CIT A;  3N6I A;  3PYP A;  5GLD A;  3UN7 A;  5FAT A;  1NRJ A;  2W3F A;  3PR6 A;  2WZZ A;  3WS0 A;  1K6S A;  4KG5 A;  2WGV A;  2HZ5 A;  3TSG A;  4I3J A;  1XFN A;  2DMW A;  4WEL A;  5KSH A;  3KYZ A;  5HL6 A;  2XF3 A;  3PHY A;  1ZG4 A;  2QYB A;  3BQ8 A;  4R38 A;  1VET B;  4DJ3 A;  2G7U A;  2M1C A;  4WEJ A;  4RVA A;  1S6R A;  3UB5 P;  2WUQ A;  2ZC7 A;  4OON A;  1FSY A;  1H5X A;  2K7S A;  4IUH A;  4B88 A;  3UPN A;  3D9Y A;  4B93 A;  4Y13 A;  1XX2 A;  3H7W A;  1NRF A;  4WL9 A;  4DXC A;  3LR5 A;  5GL9 A;  3EGX C;  3LY3 A;  4LCM A;  2VK3 A;  3NOU C;  1M6K A;  4WUJ A;  2PHY A;  4HOI A;  3GQZ A;  3NJA A;  1UWN X;  3NI9 A;  4IVI A;  4HEF A;  1SKO B;  5CGW A;  1RCJ A;  4EV4 A;  2FFF B;  5CRF A;  1BTL A;  3UB8 A;  1HTZ A;  1LT0 A;  5E2H A;  4IUK A;  2X71 A;  2A2L A;  3LIB A;  5FQQ A;  4YNR A;  2JN7 A;  1KDS A;  2PBY A;  2V8C A;  3VV4 A;  5DF8 A;  1D7E A;  1OTB A;  3N8S A;  3BFE A;  4DJ2 A;  3CG5 A;  1YPR A;  3OOV A;  4LFU A;  4X68 A;  1UWP X;  1WA9 A;  4YIN A;  3T4J A;  2PR6 A;  4UAA A;  2X01 A;  2ZOH A;  4NXF A;  4KZA A;  4RX3 A;  1D1J A;  1YLY A;  1NLY A;  1YM1 A;  5FAP A;  3ZGA B;  4KQR A;  3JVU A;  2A24 A;  1TS7 A;  4JGQ A;  5EOE A;  3CUE A;  3T4K A;  2ZMA A;  1W8Q A;  3A0S A;  2ZQC A;  3VE4 A;  1V9Z A;  1ZHH B;  2XD1 A;  2QPN A;  4LV2 A;  4DE2 A;  2P9V B;  5IT5 A;  2HJE A;  5CEC A;  2Y2N A;  1Z6F A;  2VEA A;  4G3V A;  4E6X A;  3ICY A;  2OAP 1;  2IWC A;  3MFX A;  4WBG A;  3LIA A;  4BJP A;  2FZ0 A;  5A93 A;  1XA7 A;  2ZBB A;  1H8M A;  1XFQ A;  1XP4 A;  1TS0 A;  3UDI A;  1I2S A;  1J9M A;  4RA7 A;  5IHV A;  4QJG A;  3IH9 A;  3OPL A;  1K4F A;  5KZH A;  2BTF P;  3PBO A;  3QHY A;  4ZRR A;  3UPO A;  4I39 A;  3V5M A;  2P74 A;  2O9C A;  3NOP C;  3TOI A;  3S1Y A;  5GHX A;  4BL2 A;  3CLO A;  3M2K A;  3MZD A;  5EEC A;  4QB8 A;  5A8B A;  1ESI A;  3KYQ A;  1BLC A;  4R1G A;  1D06 A;  2OSU A;  1Q2P A;  4BBU A;  1CEF A;  3MXS A;  4CLC E;  4X56 A;  1VQQ A;  4Q0I A;  3KSI A;  5EV0 A;  5J3W A;  5GLB A;  4OOL A;  5E2E A;  2HP6 A;  3PBQ A;  2ZM0 A;  3ULF A;  4DE1 A;  1YKD A;  3MSH A;  3T1Q B;  1XKZ A;  1W5D A;  3WS4 A;  2DNS A;  3QP1 A;  1MC0 A;  1MBL A;  4K0X A;  3VMA A;  1XPB A;  2BAS A;  4B4Z A;  5DTS A;  2ZQ8 A;  2BG1 A;  3ITA A;  4IHQ A;  4ESP A;  1M40 A;  4S2N C;  1O7E A;  3E4O A;  5CHU A;  5AVE A;  1K55 C;  2H0Y A;  3G31 A;  4B4X A;  4NKP A;  2XRO A;  1GA9 A;  5M18 A;  2Q9M A;  3GDI A;  5AVF A;  4K08 A;  2XK1 A;  5DF7 A;  1H8Y A;  2O9A A;  4F94 A;  4YWZ A;  4QY6 A;  5DJT A;  3W4Q A;  3Q7V B;  5EVI C;  2QZ6 A;  3SH8 A;  3MF0 A;  2XA7 M;  3T1S A;  2O9B A;  4XT2 B;  3IWQ A;  4DF6 A;  2EX2 A;  5DFX A;  1PI4 A;  5DTK A;  1DJB A;  3C2W A;  3WRZ A;  3LUQ A;  2WKQ A;  1YLZ A;  2XDM A;  3SS3 A;  1FIL A;  4EBL A;  2A3U A;  3IXH A;  4UQI M;  1YSQ A;  4QY5 A;  1K54 A;  3BFC A;  5U47 A;  3OCN A;  3GEC A;  4PPR A;  2V2F F;  3DW0 A;  4ZJ3 A;  2J7V A;  2B95 A;  1H8Z A;  2H0T A;  2JKR M;  4WEK A;  4Q8I A;  2JKG A;  4R3A A;  1PI5 A;  5DF9 A;  3HVF A;  1CF0 A;  3RXW A;  5IS1 A;  4BD1 A;  3L9K A;  3C4P A;  1SKO A;  1P9W A;  2LB9 A;  2W27 A;  1DY6 A;  2XQZ A;  3WWX A;  1KGG A;  4EES A;  1KVM A;  5TR7 A;  4E3N A;  2Y2J A;  3AGF A;  4EER A;  3P01 A;  3A0R A;  2QJ5 A;  4LRY C;  1E25 A;  3R7W A;  3MR0 A;  2P04 A;  3T1R A;  3LCE A;  3FG8 A;  1K6R A;  3ZNY A;  4IVK A;  1FCO A;  5EVI B;  2OLV A;  1RGY A;  3HLE A;  4JXG A;  1DJA A;  3LID A;  4PKY A;  4DN0 A;  3G2Y A;  1TEM A;  4HNB A;  5HAR A;  1N9B A;  1WYC A;  2XGN A;  2XSS A;  4CLC D;  3P09 A;  1GSV A;  1GCE A;  2P9V A;  2GJ3 A;  4HI4 A;  4EBP A;  1ERQ A;  2HP5 A;  3VFF A;  2PYP A;  3UY6 A;  1K57 C;  1ES4 A;  4CQH A;  1MWU A;  1EI5 A;  2ZL1 B;  4HES A;  4MN7 A;  3IHB A;  1PW1 A;  2ZD8 A;  4NXB A;  1BLS A;  2Y2O A;  3CZD A;  1YLW A;  3W2Z A;  4O0P A;  3Q07 A;  5HPI A;  1VM1 A;  4KZ9 A;  5DJU A;  3BLM A;  3WS5 A;  4OLG A;  3G2Z A;  3K3C A;  1CEG A;  4LRX C;  4HH3 A;  5F82 A;  4EUV A;  1BLH A;  3FZC A;  4OP5 A;  1PWC A;  2VGL M;  3K2N A;  5IU1 A;  5HD5 A;  1ALQ A;  3IXD A;  3LR4 A;  4F3L B;  1NYM A;  2K2N A;  2ZC3 B;  4X1M A;  2WGW A;  3C38 A;  4OQG A;  1FCM A;  4I38 A;  3LO7 A;  4PM9 A;  3N8R A;  2Y59 A;  1LSX A;  5FQ9 A;  2XA7 S;  4S2P A;  4GD8 A;  1ES2 A;  3DAV A;  4Y17 A;  2HDR A;  1L0F A;  2EX8 A;  2L1M A;  1WYB A;  1KGE A;  2QMI A;  4GB7 A;  4Y0T A;  1K56 A;  1U60 A;  4E04 A;  3ISG A;  1Q2Q A;  4MBH A;  3VP2 A;  3HRE A;  5CER A;  2W3E A;  4GW9 A;  4UQI S;  4ZAM A;  2Y55 A; 
#chains in the Genus database with same CATH homology
 3C4O A;  4EUZ A;  3Q7V A;  3VP4 A;  2OLU A;  1NRF A;  3ZG5 A;  2X02 A;  4DXC A;  5F1F A;  4S2J A;  1MWT A;  3Q81 A;  5AQ7 A;  2WGW B;  2XEP A;  5GL9 A;  3GR2 A;  3LY3 A;  3FWL A;  4LCM A;  1FR1 A;  4KZ4 A;  1N4O A;  3M6H A;  1M6K A;  2V1Z A;  1PZP A;  1LL5 A;  3QNC A;  3IF6 C;  3GQZ A;  2JBF A;  3IF5 A;  4OQI A;  4MBK A;  3NI9 A;  4FH2 A;  4IVI A;  4UHU A;  3AGE A;  3GV9 A;  2HDQ A;  4HEF A;  5CGW A;  4UA7 A;  2Y2P A;  1RCJ A;  5EE8 A;  3A3F A;  4EV4 A;  5DTT A;  2FFF B;  3BRM A;  4GDN A;  1BTL A;  5CRF A;  4WMC D;  5CGS A;  5FQJ A;  4M3K A;  4QHC A;  1HTZ A;  1LI0 A;  2EFX A;  5E2H A;  2X71 A;  3V50 A;  5FQQ A;  1QMF A;  1XXM A;  1PW8 A;  5CHM A;  4BQM A;  1KDS A;  2PBY A;  5DF8 A;  3D4F A;  3A3E A;  4LV1 A;  2VGJ A;  3IXB A;  2WKI A;  4DE3 A;  3N8S A;  3BYD A;  4JF6 A;  3BEC A;  3IQA A;  3BFE A;  3CG5 A;  5CXW A;  5EPH A;  1I5Q A;  1FR6 A;  1JWZ A;  4OQ0 A;  5FAQ A;  3IF6 A;  1HZO A;  4EWF A;  1MKI A;  4OPY A;  4X68 A;  2WAD A;  3Q7Z A;  4YIN A;  2ZLY A;  5CEB A;  4JXW A;  1KVL A;  4S2M A;  4WZ5 C;  3PBN A;  4P85 A;  1GHM A;  4UAA A;  3VSL A;  2X01 A;  5HAQ A;  4U0T A;  4KZA A;  4RX3 A;  4E3O A;  1YLY A;  3B3X A;  4FH4 A;  4P87 A;  1YM1 A;  2Y2L A;  2G2W A;  3A3D A;  5FAP A;  3ZGA B;  1YLJ A;  3LY4 A;  4X53 A;  3HLF A;  1JTG A;  4KQR A;  2PU4 A;  5CGX A;  3FV7 A;  5EOE A;  1Y54 A;  1L0D A;  4JLF A;  4MBF A;  2G2U A;  2HDU A;  2ZMA A;  5FI6 A;  1W8Q A;  3UE1 A;  2ZQC A;  4E3I A;  4Y0O A;  1K4E A;  5M19 A;  2XD1 A;  2QPN A;  4LV2 A;  3ZHH A;  4OLD A;  4BD0 A;  4R4S A;  4DE2 A;  2P9V B;  4S2I A;  4WZ5 A;  2JE5 A;  5CEC A;  2Y2N A;  1Z6F A;  4E6X A;  4E3L A;  1KE3 A;  3CMZ A;  4S2L A;  1GHP A;  2HDS A;  3HL9 A;  2IWC A;  4WBG A;  2WAE A;  1MY8 A;  5CHJ A;  4C6Y A;  5TGF A;  2WYX A;  4BJP A;  4BL3 A;  5EVI A;  3UE3 A;  3W8K A;  5A93 A;  1XA7 A;  1HVB A;  5HL1 A;  1ONH A;  3W4P A;  4ID4 A;  1TDL A;  4MLL A;  4GN2 A;  4OKP A;  3PAE A;  4KG2 A;  1XP4 A;  3HLB A;  2I72 A;  3UDI A;  5HX9 A;  4EBN A;  2E8I A;  1I2S A;  2BLS A;  4Y7P A;  3VP3 A;  1LL9 A;  1J9M A;  4RA7 A;  5IHV A;  3UO9 A;  4QJG A;  3IH9 A;  2WGI A;  4H8R A;  5AQB A;  5I94 A;  2HP9 A;  1K4F A;  3OPL A;  5KZH A;  3PBO A;  4MEZ A;  3QHY A;  3UPO A;  1JVJ A;  4U3T A;  4DKI A;  4GDB A;  3MKE A;  5DVA A;  2P74 A;  3V5M A;  1AXB A;  3RXX A;  3DWK A;  3W4O A;  4CPK A;  3TOI A;  3S1Y A;  5GHX A;  3Q82 A;  4BL2 A;  3M2K A;  3MZD A;  5EEC A;  4WZ4 A;  4QB8 A;  5TFQ A;  2Y2K A;  3ZG8 B;  3N8L A;  1ESI A;  1BLC A;  2H10 A;  4R1G A;  5FDH A;  2OSU A;  1Q2P A;  1JWV A;  1CEF A;  3MFD A;  3MXS A;  2JC7 A;  1CK3 A;  4X56 A;  1VQQ A;  3FKW A;  3ZVW A;  4BLM A;  4RYE A;  4N1X A;  3G35 A;  4E6W A;  5FQM A;  4ZBE A;  1PWD A;  5GLB A;  2WAF A;  4OOL A;  4KQQ A;  5E2E A;  1ERM A;  2HP6 A;  2ZM8 A;  2R9W A;  3PBQ A;  2ZM0 A;  1IEM A;  4PM8 A;  4C3Q A;  4DE1 A;  1W79 A;  5FQK A;  1ZKJ A;  1L2S A;  1XKZ A;  1CI9 A;  1KDW A;  2DRW A;  2EFU A;  4KZ5 A;  4OPR A;  5CTM A;  1W5D A;  2Y4A A;  4KZ6 A;  4DRT A;  3WS4 A;  2DNS A;  3Q1F A;  4GKU A;  4JBF A;  1MBL A;  4K0X A;  3VMA A;  2RL3 A;  2R9X A;  1LI9 A;  2ZC4 B;  1TVF A;  1XPB A;  4JF5 A;  4B4Z A;  5DTS A;  1QME A;  2ZQ8 A;  2BG1 A;  3ITA A;  4E3K A;  4E3J A;  1M40 A;  4S2N C;  1O7E A;  4KEN B;  5GLA A;  5CHU A;  1E3U A;  1K55 C;  3BLS A;  2H0Y A;  4LV3 A;  3G31 A;  4N92 A;  4NET A;  4B4X A;  3V39 A;  1BLP A;  4IED A;  1GA9 A;  5M18 A;  3AGD A;  2Q9M A;  1KE0 A;  4JPM A;  3VOY A;  5FQI A;  3PAG A;  1MXO A;  2XK1 A;  1ES3 A;  4X69 A;  2EXB A;  5DF7 A;  2Q9N A;  4KG6 A;  4OP8 A;  1H8Y A;  3G4P A;  4F94 A;  5GHY A;  4QY6 A;  3BFD A;  2XFS A;  5CTN A;  2EX9 A;  3JYI A;  2ZC5 B;  3W4Q A;  1BZA A;  2C6W B;  1WE4 A;  3Q7V B;  3SH7 A;  5EVI C;  1LHY A;  2WK0 A;  4U0X A;  3WRT A;  4L0L A;  2QZ6 A;  4S2N A;  1MWR A;  3SH8 A;  1PWG A;  3BFF A;  4S2K A;  3OPP A;  3E2L A;  1K55 A;  2ZM2 A;  3MXR A;  2GDN A;  3FKV A;  2A49 A;  4KZ3 A;  3IWQ A;  4WYY A;  4DF6 A;  2EX2 A;  3PTE A;  1PI4 A;  1IYO A;  5DTK A;  1DJB A;  4X6T A;  1GHI A;  3NBL A;  5F1G A;  3I7J A;  4WMC A;  4JXS A;  5JYO A;  3A3I A;  2Z2M B;  3WRZ A;  1O07 A;  4IBX A;  5BOH A;  5A90 A;  1YLZ A;  2XDM A;  3GMW A;  4OPQ A;  4E3M A;  4FCF A;  1W7F A;  1K56 D;  2JCH A;  3SS3 A;  1YT4 A;  1RGZ A;  1I2W A;  3HBR A;  1DJC A;  4P6B A;  1SKF A;  4EBL A;  2A3U A;  3PBS A;  3ZG7 B;  3IXH A;  1NY0 A;  4OPZ A;  4QY5 A;  1L0G A;  1K54 A;  3BFC A;  5U47 A;  3OCN A;  4QD4 A;  4R0Q A;  1SCW A;  1K38 A;  4PPR A;  1ONG A;  2ZQ9 A;  2V2F F;  5FI7 A;  3DW0 A;  3VOZ A;  4ZJ3 A;  3BFG A;  4GZB A;  4BEN A;  4LEN A;  3IF6 B;  5E2G A;  4R4R A;  4R23 A;  2J7V A;  1G6A A;  3VP1 A;  2EX6 A;  1H8Z A;  4NK3 A;  2H0T A;  4WEK A;  3VSK A;  4Q8I A;  2H5S A;  4KQO A;  4PMA A;  1PI5 A;  1ERO A;  2XFT A;  3HVF A;  1ES5 A;  5DF9 A;  2B5R A;  1C3B A;  3RXW A;  2PU2 A;  4BD1 A;  3C4P A;  4GOG A;  1XGJ A;  1MPL A;  1MWS A;  3BEB A;  3S22 A;  1PYY A;  4Y0U A;  3DWZ A;  3OCL A;  3OC2 A;  1DY6 A;  2XQZ A;  4FSF A;  2Y91 A;  3ITB A;  3WWX A;  5L2F A;  1KGG A;  3C7V A;  4Z9Q A;  1HD8 A;  3G30 A;  5FSR A;  4DE0 A;  1IYP A;  1KVM A;  4GNU A;  5HAI A;  5TR7 A;  1IYS A;  4OVD A;  4E3N A;  2Y2J A;  3MZF A;  3VP0 A;  3AGF A;  3HUM A;  4JKT A;  2WKH A;  3IXG A;  3UDF A;  1PIO A;  5HW3 A;  3ZDJ A;  2ZJ9 A;  5EUA A;  4ZJ1 A;  1YLT A;  1L0E A;  1E3U D;  3G32 A;  1S0W A;  5GHZ A;  3PBT A;  1E25 A;  5J8X A;  2UWX A;  1FQG A;  3V3S A;  4UA6 A;  4KZ8 A;  4ZTK A;  1SHV A;  4XXR A;  1NJ4 A;  3CJM A;  2Y2M A;  3NCK A;  3LCE A;  1NZO A;  1BSG A;  1K6R A;  3PBR A;  5EOO A;  3ZCZ A;  3ZNY A;  5D3O A;  4CJN A;  3MZE A;  3O87 A;  3TG9 A;  3SS4 A;  2J8Y A;  3NY4 A;  1FCO A;  4IVK A;  5EVI B;  3V3R A;  2OLV A;  4XUZ A;  3S4X A;  5KSC A;  4GD6 A;  1RGY A;  1BUL A;  2ZQA A;  3HLE A;  2EXA A;  4JXG A;  4X55 A;  1DJA A;  3OPR A;  2ZC6 B;  3P98 A;  3G2Y A;  1TEM A;  5M1A A;  5G18 A;  5HAR A;  1N9B A;  1WYC A;  5FI2 A;  4EQI A;  4RX2 A;  1YMX A;  4C75 A;  3RJU A;  4K0W A;  1KE4 A;  4K91 A;  2XH9 A;  2XGN A;  3NDG A;  3MKF A;  1SDN A;  3O88 A;  3G34 A;  2DCF A;  4PM7 A;  3HLD A;  4R3B A;  1YLP A;  4OOM A;  3ZNT A;  3LEZ A;  3P09 A;  4N1H A;  1ESU A;  2RCX A;  1OME A;  2P9V A;  1GCE A;  1IEL A;  1LLB A;  1NYY A;  3A3J A;  1ZG6 A;  1BT5 A;  2CC1 A;  4JXV A;  4EBP A;  2J9O A;  1ERQ A;  2HP5 A;  2Z2L B;  1XA1 A;  1FCN A;  3UPP A;  3VFF A;  4XUX A;  1IYQ A;  2HPB A;  3UY6 A;  1K57 C;  4DDS A;  3GTC A;  1ES4 A;  5E43 A;  3HLG A;  2C5W B;  3M6B A;  3N7W A;  5EVI D;  2IWB A;  1MWU A;  2IWD A;  1EI5 A;  1YMS A;  3GSG A;  4KZ7 A;  5A92 A;  1TDG A;  3IWO A;  2WKE A;  3M2J A;  4YFM A;  3O3V A;  4HES A;  4DDY A;  1IKI A;  3IHB A;  4KZB A;  1PW1 A;  2ZD8 A;  1YQS A;  4OOY A;  1EWZ A;  4A5R A;  4PM6 A;  1BLS A;  2Y2O A;  1CI8 A;  1K54 C;  3CZD A;  4JF4 A;  1YLW A;  3GRJ A;  5CED A;  1JWP A;  3Q07 A;  5FAO A;  5EVL A;  4ZDX A;  1VM1 A;  3C5A A;  3IHA A;  2V20 A;  4QU3 A;  4KZ9 A;  3BLM A;  3WS5 A;  4OLG A;  3WS2 A;  2Y2G A;  2OV5 A;  2XD5 A;  4ZJ2 A;  3EQV A;  5HAP A;  3G2Z A;  2FFY A;  1CEG A;  3GVB A;  4D2O A;  5FAS A;  1K57 A;  5F82 A;  2Y2I A;  4HBT A;  3O86 A;  5KMW A;  5HFO A;  5AQA A;  2Y2H A;  4S2O A;  3ZFZ A;  1BLH A;  4P0M A;  1SDE A;  3FZC A;  4OP5 A;  3FYZ A;  3VFH A;  1G68 A;  1PWC A;  3IWI A;  4PM5 A;  5F83 A;  4N9K A;  5JYP A;  3BM6 A;  1IKG A;  1NZU A;  4UA9 A;  3QNB A;  1ALQ A;  3IXD A;  3EQU A;  3SS5 A;  3MBZ A;  1NYM A;  2J9P A;  5E2F A;  3N4I A;  4LCL A;  2ZC3 B;  4HBU A;  5GLC A;  2WGW A;  3ZG9 B;  2XLN A;  3N6I A;  1FSW A;  5GLD A;  3UN7 A;  2ZQD A;  4MNR A;  5FAT A;  4OQG A;  1FCM A;  2WZZ A;  2VGK A;  3SOI A;  3WS0 A;  3LO7 A;  3ZVT A;  4PM9 A;  1K6S A;  4KG5 A;  1E4D A;  3C7U A;  1W8Y A;  3N8R A;  1JTD A;  2ZQ7 A;  2WGV A;  3TSG A;  1K25 A;  1PZO A;  1FOF A;  2Y59 A;  3OPH A;  1RP5 A;  3HUO A;  4WEL A;  5KSH A;  5FQ9 A;  2XF3 A;  3HLC A;  4DXB A;  4IBR A;  1ZG4 A;  4S2P A;  1BUE A;  3OZH A;  3UE0 A;  4GD8 A;  1ES2 A;  1KGF A;  1XGI A;  1ZC2 A;  2Y2Q A;  2HDR A;  3HLW A;  1L0F A;  2EX8 A;  3HUN A;  3IT9 A;  1WYB A;  4WEJ A;  4RVA A;  1KGE A;  3WS1 A;  1S6R A;  3IH8 A;  5AQ9 A;  3ZG0 A;  2QMI A;  2WUQ A;  2ZC7 A;  4GB7 A;  4FD8 A;  3NIA A;  4O7D A;  4OON A;  1NXY A;  1FSY A;  2XR0 A;  3DTM A;  1H5X A;  3E2K A;  4Y0T A;  1K56 A;  1U60 A;  2WZX A;  3ISG A;  5A91 A;  1Q2Q A;  3NDE A;  3UDX A;  4OH0 A;  3UPN A;  4B88 A;  3NC8 A;  4MBH A;  4N9L A;  3UNW A;  3VP2 A;  3HRE A;  4LV0 A;  5FA7 A;  3SH9 A;  5CER A;  4WM9 A;  4OQH A;  4R3J A;  1XX2 A;  4ZAM A;  2Y55 A;  1GA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...