1BLPA

Structural basis for the inactivation of the p54 mutant of beta-lactamase from staphylococcus aureus pc1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
257
structure length
253
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRLNYYSPKSKKNTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Structural basis for the inactivation of the P54 mutant of beta-lactamase from Staphylococcus aureus PC1.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(acting on cyclic amides)
total genus 89
structure length 253
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1993-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1blpA00
1PYYA 3SS3A 3UNWA 4XUZA 1C3BA 3ZG8B 1KGFA 2H0TA 2WZXA 2Y2JA 3C5AA 3HUOA 2WGWA 4IVIA 2Y2NA 4Z9QA 4E3MA 5FQKA 5HAPA 2WKIA 3HLWA 3HREA 3IF6A 4DE2A 1K54A 4CJNA 3GRJA 4PMAA 4JF6A 4OLGA 1MY8A 2A3UA 3OPRA 1SDEA 4KQRA 3G34A 1YLJA 4CPKA 4WEKA 1ZKJA 2XK1A 5M18A 1I2WA 5DTSA 1K54C 5D3OA 3MXSA 2HP9A 2CC1A 1FOFA 1FQGA 3IH9A 3BRMA 4OPQA 1EROA 1MWUA 1ESUA 4KENB 5F1GA 1TVFA 5AQBA 3ZNYA 1MPLA 2HDSA 1GCEA 5EVIB 2IWBA 2ZQ8A 1HZOA 1EI5A 4HBUA 2XFSA 1LL9A 1NZOA 2HDUA 5EVID 4LV3A 1ES3A 3C4OA 2C6WB 2ZC6B 5A90A 4JBFA 4GN2A 1KDWA 2HP5A 3M2KA 2I72A 1Q2QA 4WEJA 2Q9NA 3WS1A 3S4XA 3VP2A 1FSWA 4KG5A 1E3UD 4U0TA 3NCKA 5HARA 2ZQ9A 3BYDA 4N1XA 2JC7A 3OCLA 1KE3A 4IVKA 5U47A 3SH8A 3UE0A 3Q7ZA 4KG2A 5F1FA 5TGFA 3WS0A 2ZQDA 1Z6FA 1M6KA 2WZZA 4PM8A 3W4QA 4E3IA 4OKPA 4DXBA 4OPYA 2GDNA 5F82A 4BL3A 1H8YA 4Y0OA 3WWXA 2XDMA 4WMCD 1XKZA 1HD8A 1PI5A 5AQAA 4EQIA 1ES4A 1GA9A 3PBSA 3UDIA 3G2ZA 3MXRA 3GR2A 1ERMA 4OPRA 1W7FA 1YLTA 4GDNA 3HLEA 4BENA 3LCEA 4EWFA 1W79A 4FCFA 4LCLA 2R9XA 1IYPA 1IKIA 3MZDA 5DTKA 3SH9A 5J8XA 4KQOA 5FAQA 1M40A 2J8YA 5IHVA 1RGZA 4XUXA 5DF7A 5GL9A 3M2JA 1HVBA 3PBTA 5TR7A 3RJUA 4OQ0A 3Q1FA 4E6WA 3UPPA 2OLUA 4DDYA 1LL5A 2P74A 4OOMA 4X56A 4FH4A 4QB8A 4B4XA 5L2FA 5E2HA 5E2GA 5TFQA 5EUAA 4MBHA 2XQZA 3NIAA 4R0QA 1TDLA 1K57A 4GZBA 1PWCA 3DW0A 1YM1A 3A3DA 3OPHA 4ZJ2A 3FYZA 3N4IA 2P9VA 4JF5A 1LLBA 1H5XA 3PAGA 4DF6A 1KVLA 1K57C 3BFCA 4GOGA 4QY5A 1BSGA 3WS5A 4DXCA 3LY3A 3AGDA 1JWZA 3ZFZA 5M1AA 4ZJ3A 4C6YA 2DNSA 1W8QA 2Y4AA 5EVIA 1KGGA 1K6SA 3WS4A 4PM6A 1ES5A 2V20A 4EV4A 3BECA 4K0WA 4JXWA 5FQQA 5DTTA 3PBNA 1K38A 1MWTA 1IKGA 3NC8A 5CRFA 1DJAA 4X68A 5EVIC 5GHXA 2IWCA 4WM9A 4RVAA 4GD6A 3RXWA 3WS2A 4JPMA 1DY6A 1O7EA 4FSFA 1SKFA 1E3UA 1N4OA 3ZDJA 1SHVA 1JWVA 1ONHA 2Y2PA 1PZOA 3Q7VB 4R3JA 1CK3A 2R9WA 2ZC4B 3S1YA 4ZAMA 1NZUA 1I2SA 4IBRA 5FQIA 5CGWA 1NY0A 2H10A 2ZLYA 4LV1A 2IWDA 2WADA 3ITBA 4WMCA 2WKEA 1I5QA 4BD1A 3UO9A 3CZDA 1FSYA 3O3VA 3O88A 4P6BA 1Q2PA 1W5DA 2XD5A 5HW3A 4QHCA 3VP1A 1S0WA 4UHUA 1XA1A 3A3JA 5FQMA 4IBXA 1GHPA 3VSLA 3HLBA 2OLVA 5CEBA 4QD4A 1QMFA 4K0XA 2X02A 3ZG9B 4KZ8A 5FAPA 3NI9A 5FI2A 4B4ZA 3HVFA 2Y2KA 3NY4A 4NETA 2WAEA 2Y2HA 3WRTA 4OLDA 3UDFA 5I94A 1E25A 4ZTKA 5G18A 1KVMA 3Q82A 4Y0TA 1JTGA 4UA9A 4FD8A 1PZPA 4EBLA 2VGKA 3FZCA 3VOZA 5HL1A 3HLDA 4OVDA 1VM1A 5KMWA 1YLZA 4YFMA 2Z2LB 1FR1A 1E4DA 3MKFA 4MBKA 5AQ9A 3HBRA 3N8LA 5FQJA 4EBNA 4UAAA 5CTMA 3GQZA 3HUMA 5JYOA 2JE5A 5KZHA 3V3RA 5FA7A 3BFFA 2Y2OA 3IHBA 2C5WB 4KZ6A 2ZC7A 5FATA 3ZVWA 2G2UA 2Y2MA 3M6HA 1K25A 5FDHA 3TG9A 3ZG0A 1NYMA 5GLCA 4BJPA 4GKUA 4WZ4A 3PBRA 2XEPA 5CGXA 2EX8A 2XF3A 1XXMA 4S2NA 1L0GA 4RX2A 5FASA 4GDBA 1CEGA 1KGEA 5GLAA 3ZNTA 3NDEA 1DJCA 5M19A 4RX3A 1J9MA 2WKHA 4R4RA 3BM6A 3QHYA 2WYXA 4DKIA 4S2NC 3TSGA 3UPOA 4GD8A 5HAIA 3WRZA 3AGEA 3LY4A 2BLSA 3OCNA 5HX9A 3S22A 3ZGAB 4KZ3A 4S2MA 3PTEA 4OH0A 3DWZA 1GHIA 3P98A 4L0LA 1ONGA 2ZC3B 5EOOA 4GNUA 4RA7A 2QZ6A 4DE0A 1XGJA 1FCNA 3LO7A 1N9BA 3PAEA 4FH2A 5EPHA 5GHYA 2ZQAA 2WGVA 4KG6A 3TOIA 2Y91A 3A3EA 1NJ4A 4UA7A 1PW8A 2Q9MA 1TDGA 1K55A 3Q7VA 4C3QA 4X69A 3EQVA 5EVLA 3UY6A 2OV5A 2WGWB 2ZC5B 3IXHA 2ZM2A 4JXSA 4QU3A 2G2WA 4HEFA 3IF6B 3HUNA 3SH7A 2E8IA 1YLPA 1K55C 2RL3A 3BFDA 4E3OA 5CGSA 1BTLA 1ZG6A 3A3FA 1CEFA 5CHUA 4S2PA 3UPNA 3IWQA 4YINA 5JYPA 3W4PA 3OC2A 1GA0A 1IEMA 5DVAA 4OOLA 5CHJA 4PM5A 3G31A 3BFGA 2ZQ7A 3BLMA 4N92A 4R1GA 4EBPA 4LCMA 5KSHA 4X6TA 2XFTA 1K56D 3FV7A 4OQGA 4E3KA 4HESA 3O86A 3VFHA 2EX9A 3UN7A 1OMEA 3N6IA 1GHMA 4Y7PA 4WZ5A 1O07A 2VGJA 1CI8A 1QMEA 2EXBA 1AXBA 3MZEA 3V50A 3E2KA 2WGIA 4S2LA 2FFYA 5FAOA 2HDQA 2HPBA 4P0MA 4C75A 1XX2A 4WZ5C 3VMAA 3FWLA 1ERQA 3CJMA 1YMXA 1LI0A 1NXYA 2ZQCA 4N9LA 1XA7A 2ZM8A 4EUZA 1PIOA 3MBZA 1L0DA 2WK0A 2EX6A 1S6RA 2B5RA 3EQUA 1ZC2A 1IYSA 4UA6A 4E3LA 1SDNA 3B3XA 4R3BA 3GVBA 4BQMA 4ZDXA 5EECA 1VQQA 2OSUA 4R4SA 1CI9A 3IQAA 3OPPA 2XH9A 4WELA 5FSRA 2XGNA 3SS5A 1NRFA 4JKTA 4PM7A 4OP8A 4A5RA 3BLSA 1BZAA 2Z2MB 1SCWA 3SS4A 2Y2LA 3N8SA 4OONA 1PW1A 1WYBA 3BEBA 4DDSA 3DWKA 3ITAA 4OP5A 4U3TA 5CECA 2Y59A 1BLHA 3OZHA 2FFFB 3A3IA 3JYIA 3UE3A 1L2SA 3NBLA 5DF9A 4ZBEA 1NYYA 3ZVTA 4LENA 4LV2A 5EE8A 3VP4A 1IYQA 3QNBA 1XP4A 1H8ZA 1TEMA 4DE1A 1K6RA 2EFUA 3IXDA 5BOHA 1BLPA 5GLBA 4WYYA 4E6XA 2J9PA 1YMSA 3IXGA 2DRWA 3PBOA 3HLGA 3GV9A 4JXGA 2JBFA 5CERA 1IYOA 5FQ9A 2QPNA 3G4PA 2HDRA 2ZMAA 4X53A 3GSGA 1BULA 4R23A 2P9VB 3IF6C 2V2FF 5GHZA 3IH8A 4E3JA 2PU4A 3MZFA 4PM9A 1MWRA 3IXBA 3LEZA 2Y2QA 5A92A 2EXAA 1K4FA 4D2OA 1K56A 2WAFA 2XD1A 3CG5A 3P09A 3IWIA 2A49A 5HFOA 3ZHHA 3W4OA 4F94A 3CMZA 5CEDA 3Q81A 5E2FA 3IF5A 4S2KA 2J7VA 1RGYA 4S2IA 3N7WA 3ISGA 4MLLA 4N9KA 3VP3A 1FR6A 4KZ7A 1L0EA 4LV0A 1G68A 4GB7A 4NK3A 2PU2A 4ID4A 3V5MA 1JVJA 1XPBA 3ZCZA 3D4FA 5FI6A 4ZJ1A 4DE3A 1ALQA 2EX2A 3VFFA 4OQHA 5HAQA 3G35A 2WUQA 2Y2GA 2ZD8A 3IWOA 1KE4A 4JXVA 4OQIA 4O7DA 4S2OA 1HTZA 2V1ZA 3E2LA 1ESIA 3MKEA 3Q07A 5AQ7A 3VSKA 3ZG5A 3FKVA 5CHMA 5A91A 4BLMA 1YLWA 3I7JA 4BL2A 5GLDA 4XXRA 1BUEA 1K4EA 1BLSA 5CXWA 1MKIA 4KZAA 2XLNA 1PWGA 3V3SA 2H0YA 3ZG7B 1WYCA 5FI7A 2X01A 2ZJ9A 4KZ4A 4KZ5A 1KE0A 1G6AA 1DJBA 3GMWA 1JTDA 1U60A 3V39A 2J9OA 1LHYA 3SOIA 4S2JA 4MNRA 3O87A 4IEDA 5CTNA 4QJGA 3M6BA 3BFEA 3G2YA 3GTCA 3OPLA 3UE1A 2H5SA 2BG1A 3G32A 1PI4A 3FKWA 2JCHA 3C7UA 4MEZA 5E43A 1JWPA 3HL9A 4E3NA 2X71A 4KQQA 1XGIA 3W8KA 1MXOA 1ZG4A 5KSCA 1L0FA 3VOYA 1EWZA 1IELA 5A93A 4B88A 3UDXA 4JLFA 4OPZA 2PBYA 4DRTA 2HP6A 4PPRA 3G30A 1PWDA 1RP5A 1W8YA 3IHAA 2EFXA 1BT5A 3AGFA 3C4PA 4OOYA 4X55A 2Y2IA 4KZBA 3VP0A 1ES2A 3RXXA 4RYEA 1WE4A 5DF8A 5F83A 3N8RA 4P85A 5E2EA 1Y54A 1RCJA 3QNCA 4M3KA 2ZM0A 1FCOA 4KZ9A 4WBGA 2XR0A 3HLCA 3MFDA 4HBTA 3HLFA 4MBFA 1BLCA 1YT4A 3NDGA 1KDSA 4N1HA 4QY6A 5EOEA 2RCXA 3C7VA 1MWSA 1YLYA 2DCFA 2QMIA 3PBQA 4K91A 3IT9A 4U0XA 4JF4A 4Q8IA 4H8RA 4Y0UA 2UWXA 3DTMA 1LI9A 4P87A 4BD0A 2Y55A 1YQSA 1FCMA 1MBLA
chains in the Genus database with same CATH superfamily
3UNWA 1C3BA 3ZG8B 4G3KA 2Y2JA 1VHMA 4HH3A 5FQKA 5HAPA 3HLWA 2J3WA 4P6ZM 3S7NA 1K54A 4CJNA 3GRJA 1V9YA 4JF6A 2A3UA 4WEKA 2XK1A 3T4SA 1K54C 4PKYG 3MXSA 2HP9A 2CC1A 1FOFA 1EROA 1ESUA 3ZNYA 1MPLA 3NHQA 3NOTC 2IWBA 1LL9A 2QHKA 4NXFA 2C6WB 5A90A 4JBFA 1KDWA 1Q2QA 2Q9NA 3KSGA 3S4XA 3T4LA 4KG5A 4LPZA 1E3UD 5HARA 3NCKA 4YWZA 4KG2A 2NUPC 3OBFA 3OLOA 3W4QA 4E3IA 3EEHA 3QP8A 1NLZA 4EQIA 2QKPA 3CPTB 3GR2A 4OPRA 1YLTA 4BENA 4H6JA 4LCLA 2VX8A 5EM0A 3MZDA 5DTKA 3SH9A 5J8XA 2PHYA 1RGZA 4XUXA 1OTEA 3M2JA 1HVBA 2VJWA 3Q1FA 3VE4A 4E6WA 4DDYA 2P74A 5MC7A 4B4XA 5E2GA 5EUAA 1TDLA 2P9VA 1H5XA 4HJ6A 3BFCA 3LR4A 1JWZA 3ZFZA 2PD8A 1V9ZA 1KGGA 3GECA 3LR0A 3BECA 3E4PA 5DTTA 5GHXA 3CWFA 3RXWA 4FSFA 3IS2A 3ZDJA 3EGXC 3L7HA 4G3VA 1JWVA 4R3JA 5EFWA 4WN5A 4ZAMA 1NY0A 2H10A 2ZLYA 4LV1A 2IWDA 2WADA 4Q0HA 4WMCA 2E8JA 4BD1A 5K5BA 3PHYA 1VETA 3O88A 4QHCA 1XA1A 5FQMA 2A24A 2X02A 4KZ8A 5FAPA 3NI9A 5FI2A 4KUKA 3HVFA 3NY4A 4OLDA 3UDFA 4I3JA 4FD8A 2VGKA 5HL1A 3NJAA 1GSXA 1FR1A 3N8LA 5CTMA 4BBUA 3HUMA 5JYOA 4XT2A 3V3RA 5FA7A 3UMEA 3ZVWA 2G2UA 2Y2MA 3TG9A 1NYMA 4O8GA 2XEPA 1CEGA 3KYQA 3ZNTA 3NDEA 3BQ8A 4RX3A 1J9MA 3T4KA 2WKHA 4R4RA 3QHYA 4DKIA 3UPOA 4NXEA 3TSGA 1TS0A 4JGOA 3LY4A 3S22A 1GHIA 3MFXA 3DTIA 2B95A 5IU1A 1N9BA 2ZQAA 3CLOA 2Y91A 1NJ4A 4UA7A 2OV5A 4BBVA 2ZM2A 4JXSA 2IA2A 4QU3A 2W3HA 2G2WA 2RL3A 5CGSA 2P7JA 1OJ5A 4QWOA 2PYRA 5CHJA 4PM5A 3G31A 2ZQ7A 4LCMA 5KSHA 4OQGA 3O86A 3VFHA 2EX9A 1OMEA 3N6IA 2PR6A 2VGJA 1QMEA 2EXBA 3F1OA 2WGIA 4LLOB 3PYPA 4P0MA 1XX2A 3CJMA 2V9AA 1NXYA 2V8FA 4HOIA 2O9CA 3QP1A 1IYSA 3BQAA 3NOUC 1W63M 3IQAA 2XH9A 4ETZA 4JKTA 4PM7A 3N8SA 2PRFA 1WYBA 4I38A 2O99A 2XA7M 1BLHA 3A3IA 4Z1WA 3NBLA 3ZVTA 3VP4A 1TEMA 2EFUA 3IXDA 2DRWA 3HLGA 3GV9A 4JXGA 5FQ9A 2QPNA 2HDRA 4R23A 1BULA 2P9VB 5GHZA 4PM9A 4YOFA 3LEZA 4I5SA 1K4FA 1K56A 2WAFA 2XD1A 4CLCD 1PRQA 5HFOA 3T1QB 3H82A 3IF5A 4KQDA 4S2KA 1OJGA 3N7WA 4M4XA 1FR6A 4LRYC 1L0EA 2UV0E 3V5MA 3D4FA 1YKDA 3VFFA 4OQHA 2ZD8A 4JXVA 1OTBA 2HJEA 1HTZA 3Q07A 3VSKA 1ESIA 3FKVA 4BLMA 4GHIA 1Z09A 1YLWA 1K4EA 1BLSA 1MKIA 2A24B 4KZAA 4ARZA 4I3IA 5HPFA 3MMHA 3GDIA 2JN7A 4EEPA 2ZJ9A 4KZ4A 4KZ5A 1G6AA 4MCWA 3GMWA 1JTDA 4EU0A 2GX5A 2J9OA 4MNRA 4QJGA 3M6BA 4GJ4A 3BY9A 3MQ0A 4HP4A 2W27A 3A0RA 3EOIA 3FKWA 2JCHA 2W3EA 1XGIA 1ZG4A 3RFBA 1L0FA 3H7WB 4OPZA 2Y79A 3VV4A 4DRTA 2HP6A 2J3TD 1PWDA 4OOYA 4EESA 5F6AA 3VP0A 4MN5A 3RXXA 3QNCA 2PYPA 4UEYA 3G6OA 2XR0A 2QYBA 1OTDA 3MFDA 4HBTA 4MBFA 1BLCA 3EWKA 5EOEA 2DCFA 4Q8IA 2WKRA 1UWPX 1LI9A 4P87A 4BD0A 2Y55A 4EBLA 1FCMA 1MBLA 1PYYA 4EEUA 1DP6A 2WGWA 4E3MA 3HREA 4LRZE 3IF6A 4NEED 1YPRA 2L0WA 3UB8A 4PMAA 3OPRA 3LR3A 1S1ZA 3G34A 4CPKA 2K7SA 1ZKJA 5M18A 5DTSA 5D3OA 2HF6A 3BRMA 4OPQA 1TVFA 5AQBA 5J4EA 2CMNA 2HDSA 1EI5A 4HBUA 4ETXA 2HDUA 5C5KA 1ES3A 3LICA 4UQIS 2HP5A 3M2KA 4WEJA 1H0MA 2ZQ9A 3BYDA 3CI6A 4N1XA 2JC7A 3OCLA 1KE3A 5U47A 3CHWP 3Q7ZA 3WS0A 4DXBA 4OKPA 2GDNA 4BL3A 5IS1A 1H8YA 2XDMA 4WMCD 1HD8A 1PI5A 1GA9A 3UDIA 1S67L 1PFLA 2H28A 3HLEA 1T1AA 4FCFA 3JVUA 1T18A 2R9XA 4HHDA 5DKKA 4KQOA 5FAQA 4L9EA 1D06A 5GL9A 5DF7A 2JHEA 5TR7A 4OQ0A 3LUQA 2OLUA 2I9VA 5TFQA 4MBHA 1MC0A 1MKMA 2NUTC 1T19A 1PWCA 3N4IA 1DP8A 3KYZA 1KVLA 1L3LA 2DNSA 5EVIA 2V20A 4JXWA 4GW9A 3PBNA 5CRFA 2VV8A 5EVIC 4RVAA 1DY6A 1O7EA 2YKHA 2XRNA 4WF0A 5G4YA 2R9WA 2ZC4B 4GHIB 3T4TA 3S1YA 2O9BA 4AFIA 5FQIA 3MF0A 5CGWA 2WKEA 3S7PA 4ARZB 1FSYA 3T12B 1W63Q 3ZYTA 2XD5A 2OOLA 3VP1A 3VSLA 5CEBA 1QMFA 4DMZA 4NETA 2HZ5A 5DJUA 4ZTKA 1KVMA 3Q82A 2K31A 3VOZA 4OVDA 1YLZA 3UB6A 1E4DA 3HBRA 1J3WA 1YAXA 5KZHA 2WKPA 3BFFA 2Y2OA 5FDHA 3ZG0A 5GLCA 4GKUA 2XF3A 1XXMA 1L0GA 2A2LA 4RX2A 1KGEA 4HJ4A 5AVEA 3IBRA 2WYXA 3HJIA 1CJFA 5HAIA 4S2MA 3PTEA 2YKFA 4ZRRA 5EOOA 4I3AA 2QZ6A 4DE0A 1FCNA 4WL9A 2L4RA 5GHYA 2L1MA 2V1AA 4G3WA 3Q7VA 4C3QA 1XFQA 5EVLA 2WGWB 4HY8A 3FC7A 1S4SA 3IF6B 4HJ3A 4E3OA 2KOIA 4S2PA 3QP4A 3IWQA 4YINA 4ME4A 1F5MA 2ZMVA 1STZA 2MJ6A 3BFGA 4R6LA 2KX6A 3BLMA 4N92A 4R1GA 4EBPA 2QWSA 2XFTA 1K56D 3FV7A 4GCZA 3VOLA 2PT7A 2V0WA 4S2LA 2FFYA 2HDQA 2HPBA 4C75A 2V1BA 3VMAA 1YMXA 2HV1A 2ZM8A 1L0DA 2WK0A 1G6OA 3TE8A 1ZC2A 2EA9A 4ZDXA 4LGWA 2OSUA 4R4SA 4O0PA 3H9WA 1NRFA 4OP8A 1XJ3A 3BLSA 1BZAA 1NRJA 2Z2MB 3JVVA 4PKYA 2Y2LA 3O5YA 4OONA 3E0YA 3ITAA 4U3TA 5CECA 2Y59A 3OZHA 4MDZA 2HJ9C 3QP6A 2ZL1B 2W3GA 5DF9A 4LV2A 2VEAA 4L9FA 1XP4A 4DE1A 1K6RA 3F1NA 1BLPA 4E6XA 3R4KA 1YMSA 3PBOA 2ZMAA 3MSHA 2V2FF 4E3JA 4CLCB 1FIKA 3IXBA 2GZAA 2Y2QA 4D2OA 2A49A 4B9OA 4CLCE 1ZTUA 3ZHHA 5CEDA 1G28A 2J7VA 4GS9B 4MLLA 1UGUA 3P7NA 1G68A 4LV0A 4NK3A 4ID4A 4NG2A 3LYXA 3K2NA 4R70A 4ZJ1A 1ALQA 2EX2A 5HAQA 3G35A 1P9WA 4O7DA 4S2OA 1P0ZA 5AQ7A 2V1ZA 1BYWA 5CHMA 3UB5P 2PBDP 1BUEA 3V67A 5CXWA 3B47A 2H0YA 3ZG7B 5FI7A 1KE0A 3LIBA 3V39A 3ICYA 3O87A 3BFEA 4Y17A 1K0KA 1OT6A 3UE1A 1LL8A 1PI4A 5E43A 3HL9A 4E3NA 2X71A 4KQQA 5KSCA 2GNXA 1IELA 4JLFA 3DTKA 3RTYA 2D02A 4QPRA 2PBYA 4PPRA 3C2WA 1RP5A 3IHAA 3AGFA 2V0UA 2Y2IA 5E2EA 1RCJA 4M3KA 4WBGA 3LIEA 4KZ9A 1TS6A 4Y5FA 4F3LA 4H6JB 1YT4A 2VKSA 2DMWA 1YLYA 3PBQA 4K91A 4U0XA 1P9RA 1VB6A 4H8RA 4Y0UA 3DTMA 3T50A 4ZBEA 3SS3A 2JKTI 1KGFA 2H0TA 3C5AA 3HUOA 4IVIA 2Y2NA 4Z9QA 2LB9A 3DAVA 1SDEA 2M1CA 2FZ0A 4IJGA 1FQGA 3IH9A 5F1GA 4KENB 1HZOA 5HL6A 2XFSA 5EVID 4PHTA 3NULA 1DP9A 5TBMA 1NLYA 2W1TA 3MXQA 3C4OA 2ZC6B 5AVFA 5FEGA 2I72A 3IS2B 3T1XA 3WS1A 4U0TA 1VEUA 3F1PA 3UE6A 4EETB 4IVKA 3CITA 3UE0A 1XJ2A 2ZQDA 2WZZA 1M6KA 4PM8A 3VE3A 4Y0OA 3WWXA 1VETB 1D7EA 1SKOA 3G2ZA 3MXRA 4GDNA 1SZVA 5EVEA 3IX3A 4EWFA 2W0NA 3KX0X 1IKIA 4X1MA 1M40A 5IHVA 3PBTA 3RJUA 3F1NB 2XSSA 5CX7A 1LL5A 4OOMA 2ZBBA 4X56A 4QB8A 5L09A 4XT2B 2XQZA 2OWJA 1CQAA 1N9NA 4GZBA 4ZJ2A 4JF5A 1LLBA 2VZWA 3PAGA 3E98A 4DF6A 2VGLS 4QY5A 4GOGA 1GSVA 3LY3A 4LRXC 4ZJ3A 4C6YA 5HDSA 4Q0JA 1K6SA 4EV4A 4K0WA 2O9AA 2KDKA 1MWTA 1IKGA 4LFUA 4X68A 4WM9A 1ODVA 2VGLM 3LEQA 1SKFA 1N4OA 1ONHA 1PZOA 2PR5A 5EV0A 1H3QA 2B18A 1I2SA 3SW1A 1A0KA 3ITBA 3UB9A 1X0OA 1I5QA 3UO9A 3O3VA 4P6BA 5F69A 1Q2PA 1W5DA 4BMWA 1S0WA 3A3JA 5L8MA 5IT5A 1GHPA 2OLVA 5TJJA 1TS8A 4K0XA 3MS6A 2ZOIA 2OAP1 3WRTA 4DJ2A 1E25A 3PR6A 4Y0TA 3F1OB 3HLDA 1VM1A 4YFMA 3MKFA 4EBNA 4UAAA 3TW8A 4JGPA 2JE5A 3UB7A 3T1RA 2KLIA 5FATA 2C5WB 4IUKA 4KZ6A 4BJPA 3PBRA 2EX8A 5KIZA 4E04A 5M19A 3WRZA 4F3LB 3AGEA 4UQIM 3ZGAB 5HX9A 3OCNA 5FDSA 1N9OA 3DWZA 5AJGA 3P98A 2OWHA 4L0LA 5A8BA 4RA7A 3LO7A 5L10A 3PAEA 1F2KA 4KG6A 3A3EA 1TDGA 4EUVA 2ZC5B 3IXHA 4HEFA 3SH7A 3HUNA 2VV7A 1BTLA 3A3FA 4MN6A 3UPNA 5JYPA 2JKTM 3OC2A 4HI4A 1GA0A 1IEMA 5DVAA 4OOLA 3LGOA 3K3DA 3H82B 4NXGA 4HESA 1XFNA 4FOFA 4JGQA 3UN7A 4Y7PA 1GHMA 4WZ5A 1O07A 5TBMB 1CI8A 1AXBA 3V50A 3BY8A 3MQOA 3IX4A 3IX8A 4WZ5C 3CAXA 5HDDA 3FWLA 1ERQA 2ZQCA 4EUZA 1ZHHB 4N9LA 1XA7A 1PIOA 3MBZA 2EX6A 2B5RA 4YNRA 3KSFA 4UA6A 4E3LA 3HCYA 1VQQA 4WELA 4GLQA 2XGNA 3SS5A 4Y3IA 4A5RA 3SS4A 2EWVA 1PW1A 3BEBA 4FUWA 4P6ZS 3DWKA 4OP5A 2FFFB 3JYIA 3UE3A 1CF0A 1L2SA 1NYYA 4LENA 2P08A 3QNBA 1H8ZA 3LR5A 5HD3A 5BOHA 3T4QA 4WYYA 3IXGA 2JBFA 5CERA 3HJKA 3G4PA 4X53A 3KSIA 3GSGA 2PU4A 5A92A 1KOUA 2EXAA 3P09A 3IWIA 1WA9A 5G4ZA 3ULFA 4BWIA 3U4LP 3CMZA 3UMDA 3D72A 4S2IA 4N9KA 3FG8A 3KO6A 4KZ7A 4PAUA 4Q0IA 4Y2FA 3MJQA 3E4QA 2VV6A 1JVJA 3ZCZA 1GSWA 4DE3A 5I5LA 2WUQA 3IWOA 4EXOA 1KE4A 4OQIA 2W1RA 3E2LA 3MKEA 3E4OA 2J3TC 4BL2A 3R7WA 5GLDA 2XLNA 4KUOA 3EEAA 1WYCA 4MN7A 1DJBA 2Q0OA 3C30A 1LHYA 4S2JA 5CTNA 3LI8A 3LFVA 3G2YA 3C8CA 3OPLA 2BG1A 5DFXA 4RQ9A 3C7UA 2Z6CA 4HQAA 3VOYA 2PD7A 4B88A 3UDXA 2BTFP 1S1YA 2P04A 1LT0A 3G30A 5EM1A 1W8YA 3T4OA 3C4PA 3OOVA 4KZBA 1JNUA 3JPUA 4P85A 1OTIA 1Y54A 4K08A 1FCOA 3EGDC 3LIAA 4MMNA 1UWNX 3HLCA 3HLFA 3U2AA 4N1HA 1DRMA 4I39A 1LSWA 3IT9A 4JF4A 5HWTA 1PNEA 5L07A 1YQSA 4EERA 4XUZA 2WZXA 3K3CA 2WKIA 4DE2A 4WUJA 4Y13A 4OLGA 1MY8A 2J80A 4KQRA 1YLJA 2G7UA 1I2WA 3SZTA 1MWUA 5DKLA 5HDCA 3TRCA 1GCEA 1Y28A 5EVIB 2ZQ8A 2QJ5A 2GJ3A 4CQHA 1NZOA 1D1JA 4LV3A 4GN2A 3RH8B 3H7WA 2JKFA 3VP2A 1FSWA 3SH8A 3LI9A 5F1FA 5TGFA 3S7QA 2INWA 1Z6FA 5HD5A 4OPYA 5F82A 3D3OA 1XKZA 5AQAA 4O01A 1ES4A 3B42A 3PBSA 1ERMA 1W7FA 3LCEA 1W79A 4L9GA 1IYPA 2J8YA 5DFYA 1MZUA 3UPPA 2LB5A 4FH4A 1YSQA 2QJ7A 5L2FA 5E2HA 3KSHA 1LSXA 3NIAA 4R0QA 3S7OA 1T1BA 1K57A 3DW0A 1YM1A 3A3DA 3OPHA 3FYZA 1YSPA 2EWWA 1K57C 1BSGA 3WS5A 4DXCA 3AGDA 5M1AA 1W8QA 2Y4AA 3WS4A 4PM6A 1ES5A 1Y4OA 5FQQA 3T4JA 1K38A 1XJ6A 3NC8A 1DJAA 2IWCA 3WS2A 4GD6A 4JPMA 1LSVA 1E3UA 1SHVA 3KYEA 2Y2PA 3NOPC 3Q7VB 2XA7S 1CK3A 3MQQA 1NZUA 2JKRI 3R7WB 4BBTA 4IBRA 2BASA 2ZOHA 1OPXA 3QP5A 3CZDA 4B93A 3LIDA 1F9IA 5HW3A 4UHUA 4IBXA 2WKQA 4HP9A 4NKPA 5HWWA 3HLBA 4QD4A 4B4ZA 3ZG9B 2Y2KA 2WAEA 2Y2HA 5HSQA 5I94A 3NECA 5G18A 4DN0A 1JTGA 4UA9A 1PZPA 3FZCA 4HIAA 1T1CA 2VK3A 5KMWA 3A0VA 2Z2LB 5HWVA 4MBKA 5AQ9A 5FQJA 1FILA 3GQZA 3IHBA 4EQ1A 2ZC7A 4EW7A 3M6HA 1K25A 1F98A 4WZ4A 1IFQA 4D60A 5CGXA 4S2NA 5FASA 4GDBA 5GLAA 2PDRA 1TS7A 5J7EA 1DJCA 4II7A 3BM6A 4S2NC 4GD8A 4IUHA 2BLSA 2VLGA 4KZ3A 4OH0A 1ONGA 2ZC3B 1HLUP 4GNUA 2O0YA 1XGJA 2JKGA 3IBJA 2VA0A 4FH2A 5EPHA 5FEFA 2WGVA 1S4RA 2ACGA 5J3WA 3TOIA 4DJ3A 4WLAA 1PW8A 2Q9MA 1K55A 2W3DA 4X69A 3EQVA 5F5YA 3UY6A 4R3AA 3BWLA 2V8CA 2E8IA 1YLPA 2XROA 1K55C 3BFDA 1ZG6A 1CEFA 5CHUA 5F68A 3W4PA 1S66L 3DBAA 3CUEA 2W3FA 2Z6DA 1TD5A 3CUEC 4X6TA 4ESPA 3MR0A 4E3KA 1OT9A 3MZEA 3E2KA 1EW0A 2D01A 5FAOA 3PXPA 1H8MA 1LI0A 3BW6A 3C38A 1S6RA 3EQUA 1TF1A 1P97A 2HGVA 1SDNA 3B3XA 4R3BA 3GVBA 4BQMA 5EECA 1CI9A 3OPPA 5FSRA 4X1LA 1SCWA 3FPVA 2FH5A 4DDSA 1NWZA 4HH2A 3CPTA 4X25A 4HNBA 5EE8A 3TJZC 1IYQA 5GLBA 2J9PA 5HZHA 1IYOA 2OAQ1 3ZQ5A 5LBRA 4NXBA 3IF6C 3IH8A 3MZFA 4IHQA 4JGRA 1MWRA 3D9YA 3CG5A 3W4OA 2M7VA 4F94A 2K2NA 3Q81A 5E2FA 3B33A 1N9LA 1RGYA 5FL3A 3ISGA 3VP3A 4GB7A 2PU2A 1XPBA 5FI6A 4FTXA 2Y2GA 2R78A 3LIFA 3ZG5A 1IOUA 1AWIA 5A91A 3I7JA 2AVXA 4XXRA 1PWGA 3A0SA 3V3SA 2JKRM 2X01A 5DJTA 2Y8HA 2M7UA 3FPWA 1U60A 3W2ZA 4R38A 2B02A 3SOIA 4IEDA 2ZL1A 1G5UA 3GTCA 4Y15A 2H5SA 3BJNA 3G32A 4MEZA 2W1TB 1JWPA 3W8KA 1MXOA 1OTAA 1EWZA 5A93A 1VEUB 3F1PB 4CLCA 1XJ4A 2EFXA 1BT5A 4X55A 4CLCC 1ES2A 4RYEA 1WE4A 5DF8A 5F83A 3N8RA 1ACFA 1SKOB 2ZM0A 3L9KA 4GS9A 3T1SA 3DTEA 1KDSA 3NDGA 2PAVP 4QY6A 2RCXA 3C7VA 1MWSA 2QMIA 3P01A 2UWXA 2ZMFA 5HPIA 3QP2A
chains in the Genus database with same CATH topology
1PYYA 3SS3A 3UNWA 4XUZA 1C3BA 3ZG8B 1KGFA 2H0TA 2WZXA 2Y2JA 3C5AA 3HUOA 2WGWA 4IVIA 2Y2NA 4Z9QA 4E3MA 5FQKA 5HAPA 2WKIA 3HLWA 3HREA 3IF6A 4DE2A 1K54A 4CJNA 3GRJA 4PMAA 4JF6A 4OLGA 1MY8A 2A3UA 3OPRA 1SDEA 4KQRA 3G34A 1YLJA 4CPKA 4WEKA 1ZKJA 2XK1A 5M18A 1I2WA 5DTSA 1K54C 5D3OA 3MXSA 2HP9A 2CC1A 1FOFA 1FQGA 3IH9A 3BRMA 4OPQA 1EROA 1MWUA 1ESUA 4KENB 5F1GA 1TVFA 5AQBA 3ZNYA 1MPLA 2HDSA 1GCEA 5EVIB 2IWBA 2ZQ8A 1HZOA 1EI5A 4HBUA 2XFSA 1LL9A 1NZOA 2HDUA 5EVID 4LV3A 1ES3A 3C4OA 2C6WB 2ZC6B 5A90A 4JBFA 4GN2A 1KDWA 2HP5A 3M2KA 2I72A 1Q2QA 4WEJA 2Q9NA 3WS1A 3S4XA 3VP2A 1FSWA 4KG5A 1E3UD 4U0TA 3NCKA 5HARA 2ZQ9A 3BYDA 4N1XA 2JC7A 3OCLA 1KE3A 4IVKA 5U47A 3SH8A 3UE0A 3Q7ZA 4KG2A 5F1FA 5TGFA 3WS0A 2ZQDA 1Z6FA 1M6KA 2WZZA 4PM8A 3W4QA 4E3IA 4OKPA 4DXBA 4OPYA 2GDNA 5F82A 4BL3A 1H8YA 4Y0OA 3WWXA 2XDMA 4WMCD 1XKZA 1HD8A 1PI5A 5AQAA 4EQIA 1ES4A 1GA9A 3PBSA 3UDIA 3G2ZA 3MXRA 3GR2A 1ERMA 4OPRA 1W7FA 1YLTA 4GDNA 3HLEA 4BENA 3LCEA 4EWFA 1W79A 4FCFA 4LCLA 2R9XA 1IYPA 1IKIA 3MZDA 5DTKA 3SH9A 5J8XA 4KQOA 5FAQA 1M40A 2J8YA 5IHVA 1RGZA 4XUXA 5DF7A 5GL9A 3M2JA 1HVBA 3PBTA 5TR7A 3RJUA 4OQ0A 3Q1FA 4E6WA 3UPPA 2OLUA 4DDYA 1LL5A 2P74A 4OOMA 4X56A 4FH4A 4QB8A 4B4XA 5L2FA 5E2HA 5E2GA 5TFQA 5EUAA 4MBHA 2XQZA 3NIAA 4R0QA 1TDLA 1K57A 4GZBA 1PWCA 3DW0A 1YM1A 3A3DA 3OPHA 4ZJ2A 3FYZA 3N4IA 2P9VA 4JF5A 1LLBA 1H5XA 3PAGA 4DF6A 1KVLA 1K57C 3BFCA 4GOGA 4QY5A 1BSGA 3WS5A 4DXCA 3LY3A 3AGDA 1JWZA 3ZFZA 5M1AA 4ZJ3A 4C6YA 2DNSA 1W8QA 2Y4AA 5EVIA 1KGGA 1K6SA 3WS4A 4PM6A 1ES5A 2V20A 4EV4A 3BECA 4K0WA 4JXWA 5FQQA 5DTTA 3PBNA 1K38A 1MWTA 1IKGA 3NC8A 5CRFA 1DJAA 4X68A 5EVIC 5GHXA 2IWCA 4WM9A 4RVAA 4GD6A 3RXWA 3WS2A 4JPMA 1DY6A 1O7EA 4FSFA 1SKFA 1E3UA 1N4OA 3ZDJA 1SHVA 1JWVA 1ONHA 2Y2PA 1PZOA 3Q7VB 4R3JA 1CK3A 2R9WA 2ZC4B 3S1YA 4ZAMA 1NZUA 1I2SA 4IBRA 5FQIA 5CGWA 1NY0A 2H10A 2ZLYA 4LV1A 2IWDA 2WADA 3ITBA 4WMCA 2WKEA 1I5QA 4BD1A 3UO9A 3CZDA 1FSYA 3O3VA 3O88A 4P6BA 1Q2PA 1W5DA 2XD5A 5HW3A 4QHCA 3VP1A 1S0WA 4UHUA 1XA1A 3A3JA 5FQMA 4IBXA 1GHPA 3VSLA 3HLBA 2OLVA 5CEBA 4QD4A 1QMFA 4K0XA 2X02A 3ZG9B 4KZ8A 5FAPA 3NI9A 5FI2A 4B4ZA 3HVFA 2Y2KA 3NY4A 4NETA 2WAEA 2Y2HA 3WRTA 4OLDA 3UDFA 5I94A 1E25A 4ZTKA 5G18A 1KVMA 3Q82A 4Y0TA 1JTGA 4UA9A 4FD8A 1PZPA 4EBLA 2VGKA 3FZCA 3VOZA 5HL1A 3HLDA 4OVDA 1VM1A 5KMWA 1YLZA 4YFMA 2Z2LB 1FR1A 1E4DA 3MKFA 4MBKA 5AQ9A 3HBRA 3N8LA 5FQJA 4EBNA 4UAAA 5CTMA 3GQZA 3HUMA 5JYOA 2JE5A 5KZHA 3V3RA 5FA7A 3BFFA 2Y2OA 3IHBA 2C5WB 4KZ6A 2ZC7A 5FATA 3ZVWA 2G2UA 2Y2MA 3M6HA 1K25A 5FDHA 3TG9A 3ZG0A 1NYMA 5GLCA 4BJPA 4GKUA 4WZ4A 3PBRA 2XEPA 5CGXA 2EX8A 2XF3A 1XXMA 4S2NA 1L0GA 4RX2A 5FASA 4GDBA 1CEGA 1KGEA 5GLAA 3ZNTA 3NDEA 1DJCA 5M19A 4RX3A 1J9MA 2WKHA 4R4RA 3BM6A 3QHYA 2WYXA 4DKIA 4S2NC 3TSGA 3UPOA 4GD8A 5HAIA 3WRZA 3AGEA 3LY4A 2BLSA 3OCNA 5HX9A 3S22A 3ZGAB 4KZ3A 4S2MA 3PTEA 4OH0A 3DWZA 1GHIA 3P98A 4L0LA 1ONGA 2ZC3B 5EOOA 4GNUA 4RA7A 2QZ6A 4DE0A 1XGJA 1FCNA 3LO7A 1N9BA 3PAEA 4FH2A 5EPHA 5GHYA 2ZQAA 2WGVA 4KG6A 3TOIA 2Y91A 3A3EA 1NJ4A 4UA7A 1PW8A 2Q9MA 1TDGA 1K55A 3Q7VA 4C3QA 4X69A 3EQVA 5EVLA 3UY6A 2OV5A 2WGWB 2ZC5B 3IXHA 2ZM2A 4JXSA 4QU3A 2G2WA 4HEFA 3IF6B 3HUNA 3SH7A 2E8IA 1YLPA 1K55C 2RL3A 3BFDA 4E3OA 5CGSA 1BTLA 1ZG6A 3A3FA 1CEFA 5CHUA 4S2PA 3UPNA 3IWQA 4YINA 5JYPA 3W4PA 3OC2A 1GA0A 1IEMA 5DVAA 4OOLA 5CHJA 4PM5A 3G31A 3BFGA 2ZQ7A 3BLMA 4N92A 4R1GA 4EBPA 4LCMA 5KSHA 4X6TA 2XFTA 1K56D 3FV7A 4OQGA 4E3KA 4HESA 3O86A 3VFHA 2EX9A 3UN7A 1OMEA 3N6IA 1GHMA 4Y7PA 4WZ5A 1O07A 2VGJA 1CI8A 1QMEA 2EXBA 1AXBA 3MZEA 3V50A 3E2KA 2WGIA 4S2LA 2FFYA 5FAOA 2HDQA 2HPBA 4P0MA 4C75A 1XX2A 4WZ5C 3VMAA 3FWLA 1ERQA 3CJMA 1YMXA 1LI0A 1NXYA 2ZQCA 4N9LA 1XA7A 2ZM8A 4EUZA 1PIOA 3MBZA 1L0DA 2WK0A 2EX6A 1S6RA 2B5RA 3EQUA 1ZC2A 1IYSA 4UA6A 4E3LA 1SDNA 3B3XA 4R3BA 3GVBA 4BQMA 4ZDXA 5EECA 1VQQA 2OSUA 4R4SA 1CI9A 3IQAA 3OPPA 2XH9A 4WELA 5FSRA 2XGNA 3SS5A 1NRFA 4JKTA 4PM7A 4OP8A 4A5RA 3BLSA 1BZAA 2Z2MB 1SCWA 3SS4A 2Y2LA 3N8SA 4OONA 1PW1A 1WYBA 3BEBA 4DDSA 3DWKA 3ITAA 4OP5A 4U3TA 5CECA 2Y59A 1BLHA 3OZHA 2FFFB 3A3IA 3JYIA 3UE3A 1L2SA 3NBLA 5DF9A 4ZBEA 1NYYA 3ZVTA 4LENA 4LV2A 5EE8A 3VP4A 1IYQA 3QNBA 1XP4A 1H8ZA 1TEMA 4DE1A 1K6RA 2EFUA 3IXDA 5BOHA 1BLPA 5GLBA 4WYYA 4E6XA 2J9PA 1YMSA 3IXGA 2DRWA 3PBOA 3HLGA 3GV9A 4JXGA 2JBFA 5CERA 1IYOA 5FQ9A 2QPNA 3G4PA 2HDRA 2ZMAA 4X53A 3GSGA 1BULA 4R23A 2P9VB 3IF6C 2V2FF 5GHZA 3IH8A 4E3JA 2PU4A 3MZFA 4PM9A 1MWRA 3IXBA 3LEZA 2Y2QA 5A92A 2EXAA 1K4FA 4D2OA 1K56A 2WAFA 2XD1A 3CG5A 3P09A 3IWIA 2A49A 5HFOA 3ZHHA 3W4OA 4F94A 3CMZA 5CEDA 3Q81A 5E2FA 3IF5A 4S2KA 2J7VA 1RGYA 4S2IA 3N7WA 3ISGA 4MLLA 4N9KA 3VP3A 1FR6A 4KZ7A 1L0EA 4LV0A 1G68A 4GB7A 4NK3A 2PU2A 4ID4A 3V5MA 1JVJA 1XPBA 3ZCZA 3D4FA 5FI6A 4ZJ1A 4DE3A 1ALQA 2EX2A 3VFFA 4OQHA 5HAQA 3G35A 2WUQA 2Y2GA 2ZD8A 3IWOA 1KE4A 4JXVA 4OQIA 4O7DA 4S2OA 1HTZA 2V1ZA 3E2LA 1ESIA 3MKEA 3Q07A 5AQ7A 3VSKA 3ZG5A 3FKVA 5CHMA 5A91A 4BLMA 1YLWA 3I7JA 4BL2A 5GLDA 4XXRA 1BUEA 1K4EA 1BLSA 5CXWA 1MKIA 4KZAA 2XLNA 1PWGA 3V3SA 2H0YA 3ZG7B 1WYCA 5FI7A 2X01A 2ZJ9A 4KZ4A 4KZ5A 1KE0A 1G6AA 1DJBA 3GMWA 1JTDA 1U60A 3V39A 2J9OA 1LHYA 3SOIA 4S2JA 4MNRA 3O87A 4IEDA 5CTNA 4QJGA 3M6BA 3BFEA 3G2YA 3GTCA 3OPLA 3UE1A 2H5SA 2BG1A 3G32A 1PI4A 3FKWA 2JCHA 3C7UA 4MEZA 5E43A 1JWPA 3HL9A 4E3NA 2X71A 4KQQA 1XGIA 3W8KA 1MXOA 1ZG4A 5KSCA 1L0FA 3VOYA 1EWZA 1IELA 5A93A 4B88A 3UDXA 4JLFA 4OPZA 2PBYA 4DRTA 2HP6A 4PPRA 3G30A 1PWDA 1RP5A 1W8YA 3IHAA 2EFXA 1BT5A 3AGFA 3C4PA 4OOYA 4X55A 2Y2IA 4KZBA 3VP0A 1ES2A 3RXXA 4RYEA 1WE4A 5DF8A 5F83A 3N8RA 4P85A 5E2EA 1Y54A 1RCJA 3QNCA 4M3KA 2ZM0A 1FCOA 4KZ9A 4WBGA 2XR0A 3HLCA 3MFDA 4HBTA 3HLFA 4MBFA 1BLCA 1YT4A 3NDGA 1KDSA 4N1HA 4QY6A 5EOEA 2RCXA 3C7VA 1MWSA 1YLYA 2DCFA 2QMIA 3PBQA 4K91A 3IT9A 4U0XA 4JF4A 4Q8IA 4H8RA 4Y0UA 2UWXA 3DTMA 1LI9A 4P87A 4BD0A 2Y55A 1YQSA 1FCMA 1MBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PYY A;  3SS3 A;  3UNW A;  4XUZ A;  1C3B A;  3ZG8 B;  1KGF A;  2H0T A;  2WZX A;  2Y2J A;  3C5A A;  3HUO A;  2WGW A;  4IVI A;  2Y2N A;  4Z9Q A;  4E3M A;  5FQK A;  5HAP A;  2WKI A;  3HLW A;  3HRE A;  3IF6 A;  4DE2 A;  1K54 A;  4CJN A;  3GRJ A;  4PMA A;  4JF6 A;  4OLG A;  1MY8 A;  2A3U A;  3OPR A;  1SDE A;  4KQR A;  3G34 A;  1YLJ A;  4CPK A;  4WEK A;  1ZKJ A;  2XK1 A;  5M18 A;  1I2W A;  5DTS A;  1K54 C;  5D3O A;  3MXS A;  2HP9 A;  2CC1 A;  1FOF A;  1FQG A;  3IH9 A;  3BRM A;  4OPQ A;  1ERO A;  1MWU A;  1ESU A;  4KEN B;  5F1G A;  1TVF A;  5AQB A;  3ZNY A;  1MPL A;  2HDS A;  1GCE A;  5EVI B;  2IWB A;  2ZQ8 A;  1HZO A;  1EI5 A;  4HBU A;  2XFS A;  1LL9 A;  1NZO A;  2HDU A;  5EVI D;  4LV3 A;  1ES3 A;  3C4O A;  2C6W B;  2ZC6 B;  5A90 A;  4JBF A;  4GN2 A;  1KDW A;  2HP5 A;  3M2K A;  2I72 A;  1Q2Q A;  4WEJ A;  2Q9N A;  3WS1 A;  3S4X A;  3VP2 A;  1FSW A;  4KG5 A;  1E3U D;  4U0T A;  3NCK A;  5HAR A;  2ZQ9 A;  3BYD A;  4N1X A;  2JC7 A;  3OCL A;  1KE3 A;  4IVK A;  5U47 A;  3SH8 A;  3UE0 A;  3Q7Z A;  4KG2 A;  5F1F A;  5TGF A;  3WS0 A;  2ZQD A;  1Z6F A;  1M6K A;  2WZZ A;  4PM8 A;  3W4Q A;  4E3I A;  4OKP A;  4DXB A;  4OPY A;  2GDN A;  5F82 A;  4BL3 A;  1H8Y A;  4Y0O A;  3WWX A;  2XDM A;  4WMC D;  1XKZ A;  1HD8 A;  1PI5 A;  5AQA A;  4EQI A;  1ES4 A;  1GA9 A;  3PBS A;  3UDI A;  3G2Z A;  3MXR A;  3GR2 A;  1ERM A;  4OPR A;  1W7F A;  1YLT A;  4GDN A;  3HLE A;  4BEN A;  3LCE A;  4EWF A;  1W79 A;  4FCF A;  4LCL A;  2R9X A;  1IYP A;  1IKI A;  3MZD A;  5DTK A;  3SH9 A;  5J8X A;  4KQO A;  5FAQ A;  1M40 A;  2J8Y A;  5IHV A;  1RGZ A;  4XUX A;  5DF7 A;  5GL9 A;  3M2J A;  1HVB A;  3PBT A;  5TR7 A;  3RJU A;  4OQ0 A;  3Q1F A;  4E6W A;  3UPP A;  2OLU A;  4DDY A;  1LL5 A;  2P74 A;  4OOM A;  4X56 A;  4FH4 A;  4QB8 A;  4B4X A;  5L2F A;  5E2H A;  5E2G A;  5TFQ A;  5EUA A;  4MBH A;  2XQZ A;  3NIA A;  4R0Q A;  1TDL A;  1K57 A;  4GZB A;  1PWC A;  3DW0 A;  1YM1 A;  3A3D A;  3OPH A;  4ZJ2 A;  3FYZ A;  3N4I A;  2P9V A;  4JF5 A;  1LLB A;  1H5X A;  3PAG A;  4DF6 A;  1KVL A;  1K57 C;  3BFC A;  4GOG A;  4QY5 A;  1BSG A;  3WS5 A;  4DXC A;  3LY3 A;  3AGD A;  1JWZ A;  3ZFZ A;  5M1A A;  4ZJ3 A;  4C6Y A;  2DNS A;  1W8Q A;  2Y4A A;  5EVI A;  1KGG A;  1K6S A;  3WS4 A;  4PM6 A;  1ES5 A;  2V20 A;  4EV4 A;  3BEC A;  4K0W A;  4JXW A;  5FQQ A;  5DTT A;  3PBN A;  1K38 A;  1MWT A;  1IKG A;  3NC8 A;  5CRF A;  1DJA A;  4X68 A;  5EVI C;  5GHX A;  2IWC A;  4WM9 A;  4RVA A;  4GD6 A;  3RXW A;  3WS2 A;  4JPM A;  1DY6 A;  1O7E A;  4FSF A;  1SKF A;  1E3U A;  1N4O A;  3ZDJ A;  1SHV A;  1JWV A;  1ONH A;  2Y2P A;  1PZO A;  3Q7V B;  4R3J A;  1CK3 A;  2R9W A;  2ZC4 B;  3S1Y A;  4ZAM A;  1NZU A;  1I2S A;  4IBR A;  5FQI A;  5CGW A;  1NY0 A;  2H10 A;  2ZLY A;  4LV1 A;  2IWD A;  2WAD A;  3ITB A;  4WMC A;  2WKE A;  1I5Q A;  4BD1 A;  3UO9 A;  3CZD A;  1FSY A;  3O3V A;  3O88 A;  4P6B A;  1Q2P A;  1W5D A;  2XD5 A;  5HW3 A;  4QHC A;  3VP1 A;  1S0W A;  4UHU A;  1XA1 A;  3A3J A;  5FQM A;  4IBX A;  1GHP A;  3VSL A;  3HLB A;  2OLV A;  5CEB A;  4QD4 A;  1QMF A;  4K0X A;  2X02 A;  3ZG9 B;  4KZ8 A;  5FAP A;  3NI9 A;  5FI2 A;  4B4Z A;  3HVF A;  2Y2K A;  3NY4 A;  4NET A;  2WAE A;  2Y2H A;  3WRT A;  4OLD A;  3UDF A;  5I94 A;  1E25 A;  4ZTK A;  5G18 A;  1KVM A;  3Q82 A;  4Y0T A;  1JTG A;  4UA9 A;  4FD8 A;  1PZP A;  4EBL A;  2VGK A;  3FZC A;  3VOZ A;  5HL1 A;  3HLD A;  4OVD A;  1VM1 A;  5KMW A;  1YLZ A;  4YFM A;  2Z2L B;  1FR1 A;  1E4D A;  3MKF A;  4MBK A;  5AQ9 A;  3HBR A;  3N8L A;  5FQJ A;  4EBN A;  4UAA A;  5CTM A;  3GQZ A;  3HUM A;  5JYO A;  2JE5 A;  5KZH A;  3V3R A;  5FA7 A;  3BFF A;  2Y2O A;  3IHB A;  2C5W B;  4KZ6 A;  2ZC7 A;  5FAT A;  3ZVW A;  2G2U A;  2Y2M A;  3M6H A;  1K25 A;  5FDH A;  3TG9 A;  3ZG0 A;  1NYM A;  5GLC A;  4BJP A;  4GKU A;  4WZ4 A;  3PBR A;  2XEP A;  5CGX A;  2EX8 A;  2XF3 A;  1XXM A;  4S2N A;  1L0G A;  4RX2 A;  5FAS A;  4GDB A;  1CEG A;  1KGE A;  5GLA A;  3ZNT A;  3NDE A;  1DJC A;  5M19 A;  4RX3 A;  1J9M A;  2WKH A;  4R4R A;  3BM6 A;  3QHY A;  2WYX A;  4DKI A;  4S2N C;  3TSG A;  3UPO A;  4GD8 A;  5HAI A;  3WRZ A;  3AGE A;  3LY4 A;  2BLS A;  3OCN A;  5HX9 A;  3S22 A;  3ZGA B;  4KZ3 A;  4S2M A;  3PTE A;  4OH0 A;  3DWZ A;  1GHI A;  3P98 A;  4L0L A;  1ONG A;  2ZC3 B;  5EOO A;  4GNU A;  4RA7 A;  2QZ6 A;  4DE0 A;  1XGJ A;  1FCN A;  3LO7 A;  1N9B A;  3PAE A;  4FH2 A;  5EPH A;  5GHY A;  2ZQA A;  2WGV A;  4KG6 A;  3TOI A;  2Y91 A;  3A3E A;  1NJ4 A;  4UA7 A;  1PW8 A;  2Q9M A;  1TDG A;  1K55 A;  3Q7V A;  4C3Q A;  4X69 A;  3EQV A;  5EVL A;  3UY6 A;  2OV5 A;  2WGW B;  2ZC5 B;  3IXH A;  2ZM2 A;  4JXS A;  4QU3 A;  2G2W A;  4HEF A;  3IF6 B;  3HUN A;  3SH7 A;  2E8I A;  1YLP A;  1K55 C;  2RL3 A;  3BFD A;  4E3O A;  5CGS A;  1BTL A;  1ZG6 A;  3A3F A;  1CEF A;  5CHU A;  4S2P A;  3UPN A;  3IWQ A;  4YIN A;  5JYP A;  3W4P A;  3OC2 A;  1GA0 A;  1IEM A;  5DVA A;  4OOL A;  5CHJ A;  4PM5 A;  3G31 A;  3BFG A;  2ZQ7 A;  3BLM A;  4N92 A;  4R1G A;  4EBP A;  4LCM A;  5KSH A;  4X6T A;  2XFT A;  1K56 D;  3FV7 A;  4OQG A;  4E3K A;  4HES A;  3O86 A;  3VFH A;  2EX9 A;  3UN7 A;  1OME A;  3N6I A;  1GHM A;  4Y7P A;  4WZ5 A;  1O07 A;  2VGJ A;  1CI8 A;  1QME A;  2EXB A;  1AXB A;  3MZE A;  3V50 A;  3E2K A;  2WGI A;  4S2L A;  2FFY A;  5FAO A;  2HDQ A;  2HPB A;  4P0M A;  4C75 A;  1XX2 A;  4WZ5 C;  3VMA A;  3FWL A;  1ERQ A;  3CJM A;  1YMX A;  1LI0 A;  1NXY A;  2ZQC A;  4N9L A;  1XA7 A;  2ZM8 A;  4EUZ A;  1PIO A;  3MBZ A;  1L0D A;  2WK0 A;  2EX6 A;  1S6R A;  2B5R A;  3EQU A;  1ZC2 A;  1IYS A;  4UA6 A;  4E3L A;  1SDN A;  3B3X A;  4R3B A;  3GVB A;  4BQM A;  4ZDX A;  5EEC A;  1VQQ A;  2OSU A;  4R4S A;  1CI9 A;  3IQA A;  3OPP A;  2XH9 A;  4WEL A;  5FSR A;  2XGN A;  3SS5 A;  1NRF A;  4JKT A;  4PM7 A;  4OP8 A;  4A5R A;  3BLS A;  1BZA A;  2Z2M B;  1SCW A;  3SS4 A;  2Y2L A;  3N8S A;  4OON A;  1PW1 A;  1WYB A;  3BEB A;  4DDS A;  3DWK A;  3ITA A;  4OP5 A;  4U3T A;  5CEC A;  2Y59 A;  1BLH A;  3OZH A;  2FFF B;  3A3I A;  3JYI A;  3UE3 A;  1L2S A;  3NBL A;  5DF9 A;  4ZBE A;  1NYY A;  3ZVT A;  4LEN A;  4LV2 A;  5EE8 A;  3VP4 A;  1IYQ A;  3QNB A;  1XP4 A;  1H8Z A;  1TEM A;  4DE1 A;  1K6R A;  2EFU A;  3IXD A;  5BOH A;  1BLP A;  5GLB A;  4WYY A;  4E6X A;  2J9P A;  1YMS A;  3IXG A;  2DRW A;  3PBO A;  3HLG A;  3GV9 A;  4JXG A;  2JBF A;  5CER A;  1IYO A;  5FQ9 A;  2QPN A;  3G4P A;  2HDR A;  2ZMA A;  4X53 A;  3GSG A;  1BUL A;  4R23 A;  2P9V B;  3IF6 C;  2V2F F;  5GHZ A;  3IH8 A;  4E3J A;  2PU4 A;  3MZF A;  4PM9 A;  1MWR A;  3IXB A;  3LEZ A;  2Y2Q A;  5A92 A;  2EXA A;  1K4F A;  4D2O A;  1K56 A;  2WAF A;  2XD1 A;  3CG5 A;  3P09 A;  3IWI A;  2A49 A;  5HFO A;  3ZHH A;  3W4O A;  4F94 A;  3CMZ A;  5CED A;  3Q81 A;  5E2F A;  3IF5 A;  4S2K A;  2J7V A;  1RGY A;  4S2I A;  3N7W A;  3ISG A;  4MLL A;  4N9K A;  3VP3 A;  1FR6 A;  4KZ7 A;  1L0E A;  4LV0 A;  1G68 A;  4GB7 A;  4NK3 A;  2PU2 A;  4ID4 A;  3V5M A;  1JVJ A;  1XPB A;  3ZCZ A;  3D4F A;  5FI6 A;  4ZJ1 A;  4DE3 A;  1ALQ A;  2EX2 A;  3VFF A;  4OQH A;  5HAQ A;  3G35 A;  2WUQ A;  2Y2G A;  2ZD8 A;  3IWO A;  1KE4 A;  4JXV A;  4OQI A;  4O7D A;  4S2O A;  1HTZ A;  2V1Z A;  3E2L A;  1ESI A;  3MKE A;  3Q07 A;  5AQ7 A;  3VSK A;  3ZG5 A;  3FKV A;  5CHM A;  5A91 A;  4BLM A;  1YLW A;  3I7J A;  4BL2 A;  5GLD A;  4XXR A;  1BUE A;  1K4E A;  1BLS A;  5CXW A;  1MKI A;  4KZA A;  2XLN A;  1PWG A;  3V3S A;  2H0Y A;  3ZG7 B;  1WYC A;  5FI7 A;  2X01 A;  2ZJ9 A;  4KZ4 A;  4KZ5 A;  1KE0 A;  1G6A A;  1DJB A;  3GMW A;  1JTD A;  1U60 A;  3V39 A;  2J9O A;  1LHY A;  3SOI A;  4S2J A;  4MNR A;  3O87 A;  4IED A;  5CTN A;  4QJG A;  3M6B A;  3BFE A;  3G2Y A;  3GTC A;  3OPL A;  3UE1 A;  2H5S A;  2BG1 A;  3G32 A;  1PI4 A;  3FKW A;  2JCH A;  3C7U A;  4MEZ A;  5E43 A;  1JWP A;  3HL9 A;  4E3N A;  2X71 A;  4KQQ A;  1XGI A;  3W8K A;  1MXO A;  1ZG4 A;  5KSC A;  1L0F A;  3VOY A;  1EWZ A;  1IEL A;  5A93 A;  4B88 A;  3UDX A;  4JLF A;  4OPZ A;  2PBY A;  4DRT A;  2HP6 A;  4PPR A;  3G30 A;  1PWD A;  1RP5 A;  1W8Y A;  3IHA A;  2EFX A;  1BT5 A;  3AGF A;  3C4P A;  4OOY A;  4X55 A;  2Y2I A;  4KZB A;  3VP0 A;  1ES2 A;  3RXX A;  4RYE A;  1WE4 A;  5DF8 A;  5F83 A;  3N8R A;  4P85 A;  5E2E A;  1Y54 A;  1RCJ A;  3QNC A;  4M3K A;  2ZM0 A;  1FCO A;  4KZ9 A;  4WBG A;  2XR0 A;  3HLC A;  3MFD A;  4HBT A;  3HLF A;  4MBF A;  1BLC A;  1YT4 A;  3NDG A;  1KDS A;  4N1H A;  4QY6 A;  5EOE A;  2RCX A;  3C7V A;  1MWS A;  1YLY A;  2DCF A;  2QMI A;  3PBQ A;  4K91 A;  3IT9 A;  4U0X A;  4JF4 A;  4Q8I A;  4H8R A;  4Y0U A;  2UWX A;  3DTM A;  1LI9 A;  4P87 A;  4BD0 A;  2Y55 A;  1YQS A;  1FCM A;  1MBL A; 
#chains in the Genus database with same CATH topology
 3UNW A;  1C3B A;  3ZG8 B;  4G3K A;  2Y2J A;  1VHM A;  4HH3 A;  5FQK A;  5HAP A;  3HLW A;  2J3W A;  4P6Z M;  3S7N A;  1K54 A;  4CJN A;  3GRJ A;  1V9Y A;  4JF6 A;  2A3U A;  4WEK A;  2XK1 A;  3T4S A;  1K54 C;  4PKY G;  3MXS A;  2HP9 A;  2CC1 A;  1FOF A;  1ERO A;  1ESU A;  3ZNY A;  1MPL A;  3NHQ A;  3NOT C;  2IWB A;  1LL9 A;  2QHK A;  4NXF A;  2C6W B;  5A90 A;  4JBF A;  1KDW A;  1Q2Q A;  2Q9N A;  3KSG A;  3S4X A;  3T4L A;  4KG5 A;  4LPZ A;  1E3U D;  5HAR A;  3NCK A;  4YWZ A;  4KG2 A;  2NUP C;  3OBF A;  3OLO A;  3W4Q A;  4E3I A;  3EEH A;  3QP8 A;  1NLZ A;  4EQI A;  2QKP A;  3CPT B;  3GR2 A;  4OPR A;  1YLT A;  4BEN A;  4H6J A;  4LCL A;  2VX8 A;  5EM0 A;  3MZD A;  5DTK A;  3SH9 A;  5J8X A;  2PHY A;  1RGZ A;  4XUX A;  1OTE A;  3M2J A;  1HVB A;  2VJW A;  3Q1F A;  3VE4 A;  4E6W A;  4DDY A;  2P74 A;  5MC7 A;  4B4X A;  5E2G A;  5EUA A;  1TDL A;  2P9V A;  1H5X A;  4HJ6 A;  3BFC A;  3LR4 A;  1JWZ A;  3ZFZ A;  2PD8 A;  1V9Z A;  1KGG A;  3GEC A;  3LR0 A;  3BEC A;  3E4P A;  5DTT A;  5GHX A;  3CWF A;  3RXW A;  4FSF A;  3IS2 A;  3ZDJ A;  3EGX C;  3L7H A;  4G3V A;  1JWV A;  4R3J A;  5EFW A;  4WN5 A;  4ZAM A;  1NY0 A;  2H10 A;  2ZLY A;  4LV1 A;  2IWD A;  2WAD A;  4Q0H A;  4WMC A;  2E8J A;  4BD1 A;  5K5B A;  3PHY A;  1VET A;  3O88 A;  4QHC A;  1XA1 A;  5FQM A;  2A24 A;  2X02 A;  4KZ8 A;  5FAP A;  3NI9 A;  5FI2 A;  4KUK A;  3HVF A;  3NY4 A;  4OLD A;  3UDF A;  4I3J A;  4FD8 A;  2VGK A;  5HL1 A;  3NJA A;  1GSX A;  1FR1 A;  3N8L A;  5CTM A;  4BBU A;  3HUM A;  5JYO A;  4XT2 A;  3V3R A;  5FA7 A;  3UME A;  3ZVW A;  2G2U A;  2Y2M A;  3TG9 A;  1NYM A;  4O8G A;  2XEP A;  1CEG A;  3KYQ A;  3ZNT A;  3NDE A;  3BQ8 A;  4RX3 A;  1J9M A;  3T4K A;  2WKH A;  4R4R A;  3QHY A;  4DKI A;  3UPO A;  4NXE A;  3TSG A;  1TS0 A;  4JGO A;  3LY4 A;  3S22 A;  1GHI A;  3MFX A;  3DTI A;  2B95 A;  5IU1 A;  1N9B A;  2ZQA A;  3CLO A;  2Y91 A;  1NJ4 A;  4UA7 A;  2OV5 A;  4BBV A;  2ZM2 A;  4JXS A;  2IA2 A;  4QU3 A;  2W3H A;  2G2W A;  2RL3 A;  5CGS A;  2P7J A;  1OJ5 A;  4QWO A;  2PYR A;  5CHJ A;  4PM5 A;  3G31 A;  2ZQ7 A;  4LCM A;  5KSH A;  4OQG A;  3O86 A;  3VFH A;  2EX9 A;  1OME A;  3N6I A;  2PR6 A;  2VGJ A;  1QME A;  2EXB A;  3F1O A;  2WGI A;  4LLO B;  3PYP A;  4P0M A;  1XX2 A;  3CJM A;  2V9A A;  1NXY A;  2V8F A;  4HOI A;  2O9C A;  3QP1 A;  1IYS A;  3BQA A;  3NOU C;  1W63 M;  3IQA A;  2XH9 A;  4ETZ A;  4JKT A;  4PM7 A;  3N8S A;  2PRF A;  1WYB A;  4I38 A;  2O99 A;  2XA7 M;  1BLH A;  3A3I A;  4Z1W A;  3NBL A;  3ZVT A;  3VP4 A;  1TEM A;  2EFU A;  3IXD A;  2DRW A;  3HLG A;  3GV9 A;  4JXG A;  5FQ9 A;  2QPN A;  2HDR A;  4R23 A;  1BUL A;  2P9V B;  5GHZ A;  4PM9 A;  4YOF A;  3LEZ A;  4I5S A;  1K4F A;  1K56 A;  2WAF A;  2XD1 A;  4CLC D;  1PRQ A;  5HFO A;  3T1Q B;  3H82 A;  3IF5 A;  4KQD A;  4S2K A;  1OJG A;  3N7W A;  4M4X A;  1FR6 A;  4LRY C;  1L0E A;  2UV0 E;  3V5M A;  3D4F A;  1YKD A;  3VFF A;  4OQH A;  2ZD8 A;  4JXV A;  1OTB A;  2HJE A;  1HTZ A;  3Q07 A;  3VSK A;  1ESI A;  3FKV A;  4BLM A;  4GHI A;  1Z09 A;  1YLW A;  1K4E A;  1BLS A;  1MKI A;  2A24 B;  4KZA A;  4ARZ A;  4I3I A;  5HPF A;  3MMH A;  3GDI A;  2JN7 A;  4EEP A;  2ZJ9 A;  4KZ4 A;  4KZ5 A;  1G6A A;  4MCW A;  3GMW A;  1JTD A;  4EU0 A;  2GX5 A;  2J9O A;  4MNR A;  4QJG A;  3M6B A;  4GJ4 A;  3BY9 A;  3MQ0 A;  4HP4 A;  2W27 A;  3A0R A;  3EOI A;  3FKW A;  2JCH A;  2W3E A;  1XGI A;  1ZG4 A;  3RFB A;  1L0F A;  3H7W B;  4OPZ A;  2Y79 A;  3VV4 A;  4DRT A;  2HP6 A;  2J3T D;  1PWD A;  4OOY A;  4EES A;  5F6A A;  3VP0 A;  4MN5 A;  3RXX A;  3QNC A;  2PYP A;  4UEY A;  3G6O A;  2XR0 A;  2QYB A;  1OTD A;  3MFD A;  4HBT A;  4MBF A;  1BLC A;  3EWK A;  5EOE A;  2DCF A;  4Q8I A;  2WKR A;  1UWP X;  1LI9 A;  4P87 A;  4BD0 A;  2Y55 A;  4EBL A;  1FCM A;  1MBL A;  1PYY A;  4EEU A;  1DP6 A;  2WGW A;  4E3M A;  3HRE A;  4LRZ E;  3IF6 A;  4NEE D;  1YPR A;  2L0W A;  3UB8 A;  4PMA A;  3OPR A;  3LR3 A;  1S1Z A;  3G34 A;  4CPK A;  2K7S A;  1ZKJ A;  5M18 A;  5DTS A;  5D3O A;  2HF6 A;  3BRM A;  4OPQ A;  1TVF A;  5AQB A;  5J4E A;  2CMN A;  2HDS A;  1EI5 A;  4HBU A;  4ETX A;  2HDU A;  5C5K A;  1ES3 A;  3LIC A;  4UQI S;  2HP5 A;  3M2K A;  4WEJ A;  1H0M A;  2ZQ9 A;  3BYD A;  3CI6 A;  4N1X A;  2JC7 A;  3OCL A;  1KE3 A;  5U47 A;  3CHW P;  3Q7Z A;  3WS0 A;  4DXB A;  4OKP A;  2GDN A;  4BL3 A;  5IS1 A;  1H8Y A;  2XDM A;  4WMC D;  1HD8 A;  1PI5 A;  1GA9 A;  3UDI A;  1S67 L;  1PFL A;  2H28 A;  3HLE A;  1T1A A;  4FCF A;  3JVU A;  1T18 A;  2R9X A;  4HHD A;  5DKK A;  4KQO A;  5FAQ A;  4L9E A;  1D06 A;  5GL9 A;  5DF7 A;  2JHE A;  5TR7 A;  4OQ0 A;  3LUQ A;  2OLU A;  2I9V A;  5TFQ A;  4MBH A;  1MC0 A;  1MKM A;  2NUT C;  1T19 A;  1PWC A;  3N4I A;  1DP8 A;  3KYZ A;  1KVL A;  1L3L A;  2DNS A;  5EVI A;  2V20 A;  4JXW A;  4GW9 A;  3PBN A;  5CRF A;  2VV8 A;  5EVI C;  4RVA A;  1DY6 A;  1O7E A;  2YKH A;  2XRN A;  4WF0 A;  5G4Y A;  2R9W A;  2ZC4 B;  4GHI B;  3T4T A;  3S1Y A;  2O9B A;  4AFI A;  5FQI A;  3MF0 A;  5CGW A;  2WKE A;  3S7P A;  4ARZ B;  1FSY A;  3T12 B;  1W63 Q;  3ZYT A;  2XD5 A;  2OOL A;  3VP1 A;  3VSL A;  5CEB A;  1QMF A;  4DMZ A;  4NET A;  2HZ5 A;  5DJU A;  4ZTK A;  1KVM A;  3Q82 A;  2K31 A;  3VOZ A;  4OVD A;  1YLZ A;  3UB6 A;  1E4D A;  3HBR A;  1J3W A;  1YAX A;  5KZH A;  2WKP A;  3BFF A;  2Y2O A;  5FDH A;  3ZG0 A;  5GLC A;  4GKU A;  2XF3 A;  1XXM A;  1L0G A;  2A2L A;  4RX2 A;  1KGE A;  4HJ4 A;  5AVE A;  3IBR A;  2WYX A;  3HJI A;  1CJF A;  5HAI A;  4S2M A;  3PTE A;  2YKF A;  4ZRR A;  5EOO A;  4I3A A;  2QZ6 A;  4DE0 A;  1FCN A;  4WL9 A;  2L4R A;  5GHY A;  2L1M A;  2V1A A;  4G3W A;  3Q7V A;  4C3Q A;  1XFQ A;  5EVL A;  2WGW B;  4HY8 A;  3FC7 A;  1S4S A;  3IF6 B;  4HJ3 A;  4E3O A;  2KOI A;  4S2P A;  3QP4 A;  3IWQ A;  4YIN A;  4ME4 A;  1F5M A;  2ZMV A;  1STZ A;  2MJ6 A;  3BFG A;  4R6L A;  2KX6 A;  3BLM A;  4N92 A;  4R1G A;  4EBP A;  2QWS A;  2XFT A;  1K56 D;  3FV7 A;  4GCZ A;  3VOL A;  2PT7 A;  2V0W A;  4S2L A;  2FFY A;  2HDQ A;  2HPB A;  4C75 A;  2V1B A;  3VMA A;  1YMX A;  2HV1 A;  2ZM8 A;  1L0D A;  2WK0 A;  1G6O A;  3TE8 A;  1ZC2 A;  2EA9 A;  4ZDX A;  4LGW A;  2OSU A;  4R4S A;  4O0P A;  3H9W A;  1NRF A;  4OP8 A;  1XJ3 A;  3BLS A;  1BZA A;  1NRJ A;  2Z2M B;  3JVV A;  4PKY A;  2Y2L A;  3O5Y A;  4OON A;  3E0Y A;  3ITA A;  4U3T A;  5CEC A;  2Y59 A;  3OZH A;  4MDZ A;  2HJ9 C;  3QP6 A;  2ZL1 B;  2W3G A;  5DF9 A;  4LV2 A;  2VEA A;  4L9F A;  1XP4 A;  4DE1 A;  1K6R A;  3F1N A;  1BLP A;  4E6X A;  3R4K A;  1YMS A;  3PBO A;  2ZMA A;  3MSH A;  2V2F F;  4E3J A;  4CLC B;  1FIK A;  3IXB A;  2GZA A;  2Y2Q A;  4D2O A;  2A49 A;  4B9O A;  4CLC E;  1ZTU A;  3ZHH A;  5CED A;  1G28 A;  2J7V A;  4GS9 B;  4MLL A;  1UGU A;  3P7N A;  1G68 A;  4LV0 A;  4NK3 A;  4ID4 A;  4NG2 A;  3LYX A;  3K2N A;  4R70 A;  4ZJ1 A;  1ALQ A;  2EX2 A;  5HAQ A;  3G35 A;  1P9W A;  4O7D A;  4S2O A;  1P0Z A;  5AQ7 A;  2V1Z A;  1BYW A;  5CHM A;  3UB5 P;  2PBD P;  1BUE A;  3V67 A;  5CXW A;  3B47 A;  2H0Y A;  3ZG7 B;  5FI7 A;  1KE0 A;  3LIB A;  3V39 A;  3ICY A;  3O87 A;  3BFE A;  4Y17 A;  1K0K A;  1OT6 A;  3UE1 A;  1LL8 A;  1PI4 A;  5E43 A;  3HL9 A;  4E3N A;  2X71 A;  4KQQ A;  5KSC A;  2GNX A;  1IEL A;  4JLF A;  3DTK A;  3RTY A;  2D02 A;  4QPR A;  2PBY A;  4PPR A;  3C2W A;  1RP5 A;  3IHA A;  3AGF A;  2V0U A;  2Y2I A;  5E2E A;  1RCJ A;  4M3K A;  4WBG A;  3LIE A;  4KZ9 A;  1TS6 A;  4Y5F A;  4F3L A;  4H6J B;  1YT4 A;  2VKS A;  2DMW A;  1YLY A;  3PBQ A;  4K91 A;  4U0X A;  1P9R A;  1VB6 A;  4H8R A;  4Y0U A;  3DTM A;  3T50 A;  4ZBE A;  3SS3 A;  2JKT I;  1KGF A;  2H0T A;  3C5A A;  3HUO A;  4IVI A;  2Y2N A;  4Z9Q A;  2LB9 A;  3DAV A;  1SDE A;  2M1C A;  2FZ0 A;  4IJG A;  1FQG A;  3IH9 A;  5F1G A;  4KEN B;  1HZO A;  5HL6 A;  2XFS A;  5EVI D;  4PHT A;  3NUL A;  1DP9 A;  5TBM A;  1NLY A;  2W1T A;  3MXQ A;  3C4O A;  2ZC6 B;  5AVF A;  5FEG A;  2I72 A;  3IS2 B;  3T1X A;  3WS1 A;  4U0T A;  1VEU A;  3F1P A;  3UE6 A;  4EET B;  4IVK A;  3CIT A;  3UE0 A;  1XJ2 A;  2ZQD A;  2WZZ A;  1M6K A;  4PM8 A;  3VE3 A;  4Y0O A;  3WWX A;  1VET B;  1D7E A;  1SKO A;  3G2Z A;  3MXR A;  4GDN A;  1SZV A;  5EVE A;  3IX3 A;  4EWF A;  2W0N A;  3KX0 X;  1IKI A;  4X1M A;  1M40 A;  5IHV A;  3PBT A;  3RJU A;  3F1N B;  2XSS A;  5CX7 A;  1LL5 A;  4OOM A;  2ZBB A;  4X56 A;  4QB8 A;  5L09 A;  4XT2 B;  2XQZ A;  2OWJ A;  1CQA A;  1N9N A;  4GZB A;  4ZJ2 A;  4JF5 A;  1LLB A;  2VZW A;  3PAG A;  3E98 A;  4DF6 A;  2VGL S;  4QY5 A;  4GOG A;  1GSV A;  3LY3 A;  4LRX C;  4ZJ3 A;  4C6Y A;  5HDS A;  4Q0J A;  1K6S A;  4EV4 A;  4K0W A;  2O9A A;  2KDK A;  1MWT A;  1IKG A;  4LFU A;  4X68 A;  4WM9 A;  1ODV A;  2VGL M;  3LEQ A;  1SKF A;  1N4O A;  1ONH A;  1PZO A;  2PR5 A;  5EV0 A;  1H3Q A;  2B18 A;  1I2S A;  3SW1 A;  1A0K A;  3ITB A;  3UB9 A;  1X0O A;  1I5Q A;  3UO9 A;  3O3V A;  4P6B A;  5F69 A;  1Q2P A;  1W5D A;  4BMW A;  1S0W A;  3A3J A;  5L8M A;  5IT5 A;  1GHP A;  2OLV A;  5TJJ A;  1TS8 A;  4K0X A;  3MS6 A;  2ZOI A;  2OAP 1;  3WRT A;  4DJ2 A;  1E25 A;  3PR6 A;  4Y0T A;  3F1O B;  3HLD A;  1VM1 A;  4YFM A;  3MKF A;  4EBN A;  4UAA A;  3TW8 A;  4JGP A;  2JE5 A;  3UB7 A;  3T1R A;  2KLI A;  5FAT A;  2C5W B;  4IUK A;  4KZ6 A;  4BJP A;  3PBR A;  2EX8 A;  5KIZ A;  4E04 A;  5M19 A;  3WRZ A;  4F3L B;  3AGE A;  4UQI M;  3ZGA B;  5HX9 A;  3OCN A;  5FDS A;  1N9O A;  3DWZ A;  5AJG A;  3P98 A;  2OWH A;  4L0L A;  5A8B A;  4RA7 A;  3LO7 A;  5L10 A;  3PAE A;  1F2K A;  4KG6 A;  3A3E A;  1TDG A;  4EUV A;  2ZC5 B;  3IXH A;  4HEF A;  3SH7 A;  3HUN A;  2VV7 A;  1BTL A;  3A3F A;  4MN6 A;  3UPN A;  5JYP A;  2JKT M;  3OC2 A;  4HI4 A;  1GA0 A;  1IEM A;  5DVA A;  4OOL A;  3LGO A;  3K3D A;  3H82 B;  4NXG A;  4HES A;  1XFN A;  4FOF A;  4JGQ A;  3UN7 A;  4Y7P A;  1GHM A;  4WZ5 A;  1O07 A;  5TBM B;  1CI8 A;  1AXB A;  3V50 A;  3BY8 A;  3MQO A;  3IX4 A;  3IX8 A;  4WZ5 C;  3CAX A;  5HDD A;  3FWL A;  1ERQ A;  2ZQC A;  4EUZ A;  1ZHH B;  4N9L A;  1XA7 A;  1PIO A;  3MBZ A;  2EX6 A;  2B5R A;  4YNR A;  3KSF A;  4UA6 A;  4E3L A;  3HCY A;  1VQQ A;  4WEL A;  4GLQ A;  2XGN A;  3SS5 A;  4Y3I A;  4A5R A;  3SS4 A;  2EWV A;  1PW1 A;  3BEB A;  4FUW A;  4P6Z S;  3DWK A;  4OP5 A;  2FFF B;  3JYI A;  3UE3 A;  1CF0 A;  1L2S A;  1NYY A;  4LEN A;  2P08 A;  3QNB A;  1H8Z A;  3LR5 A;  5HD3 A;  5BOH A;  3T4Q A;  4WYY A;  3IXG A;  2JBF A;  5CER A;  3HJK A;  3G4P A;  4X53 A;  3KSI A;  3GSG A;  2PU4 A;  5A92 A;  1KOU A;  2EXA A;  3P09 A;  3IWI A;  1WA9 A;  5G4Z A;  3ULF A;  4BWI A;  3U4L P;  3CMZ A;  3UMD A;  3D72 A;  4S2I A;  4N9K A;  3FG8 A;  3KO6 A;  4KZ7 A;  4PAU A;  4Q0I A;  4Y2F A;  3MJQ A;  3E4Q A;  2VV6 A;  1JVJ A;  3ZCZ A;  1GSW A;  4DE3 A;  5I5L A;  2WUQ A;  3IWO A;  4EXO A;  1KE4 A;  4OQI A;  2W1R A;  3E2L A;  3MKE A;  3E4O A;  2J3T C;  4BL2 A;  3R7W A;  5GLD A;  2XLN A;  4KUO A;  3EEA A;  1WYC A;  4MN7 A;  1DJB A;  2Q0O A;  3C30 A;  1LHY A;  4S2J A;  5CTN A;  3LI8 A;  3LFV A;  3G2Y A;  3C8C A;  3OPL A;  2BG1 A;  5DFX A;  4RQ9 A;  3C7U A;  2Z6C A;  4HQA A;  3VOY A;  2PD7 A;  4B88 A;  3UDX A;  2BTF P;  1S1Y A;  2P04 A;  1LT0 A;  3G30 A;  5EM1 A;  1W8Y A;  3T4O A;  3C4P A;  3OOV A;  4KZB A;  1JNU A;  3JPU A;  4P85 A;  1OTI A;  1Y54 A;  4K08 A;  1FCO A;  3EGD C;  3LIA A;  4MMN A;  1UWN X;  3HLC A;  3HLF A;  3U2A A;  4N1H A;  1DRM A;  4I39 A;  1LSW A;  3IT9 A;  4JF4 A;  5HWT A;  1PNE A;  5L07 A;  1YQS A;  4EER A;  4XUZ A;  2WZX A;  3K3C A;  2WKI A;  4DE2 A;  4WUJ A;  4Y13 A;  4OLG A;  1MY8 A;  2J80 A;  4KQR A;  1YLJ A;  2G7U A;  1I2W A;  3SZT A;  1MWU A;  5DKL A;  5HDC A;  3TRC A;  1GCE A;  1Y28 A;  5EVI B;  2ZQ8 A;  2QJ5 A;  2GJ3 A;  4CQH A;  1NZO A;  1D1J A;  4LV3 A;  4GN2 A;  3RH8 B;  3H7W A;  2JKF A;  3VP2 A;  1FSW A;  3SH8 A;  3LI9 A;  5F1F A;  5TGF A;  3S7Q A;  2INW A;  1Z6F A;  5HD5 A;  4OPY A;  5F82 A;  3D3O A;  1XKZ A;  5AQA A;  4O01 A;  1ES4 A;  3B42 A;  3PBS A;  1ERM A;  1W7F A;  3LCE A;  1W79 A;  4L9G A;  1IYP A;  2J8Y A;  5DFY A;  1MZU A;  3UPP A;  2LB5 A;  4FH4 A;  1YSQ A;  2QJ7 A;  5L2F A;  5E2H A;  3KSH A;  1LSX A;  3NIA A;  4R0Q A;  3S7O A;  1T1B A;  1K57 A;  3DW0 A;  1YM1 A;  3A3D A;  3OPH A;  3FYZ A;  1YSP A;  2EWW A;  1K57 C;  1BSG A;  3WS5 A;  4DXC A;  3AGD A;  5M1A A;  1W8Q A;  2Y4A A;  3WS4 A;  4PM6 A;  1ES5 A;  1Y4O A;  5FQQ A;  3T4J A;  1K38 A;  1XJ6 A;  3NC8 A;  1DJA A;  2IWC A;  3WS2 A;  4GD6 A;  4JPM A;  1LSV A;  1E3U A;  1SHV A;  3KYE A;  2Y2P A;  3NOP C;  3Q7V B;  2XA7 S;  1CK3 A;  3MQQ A;  1NZU A;  2JKR I;  3R7W B;  4BBT A;  4IBR A;  2BAS A;  2ZOH A;  1OPX A;  3QP5 A;  3CZD A;  4B93 A;  3LID A;  1F9I A;  5HW3 A;  4UHU A;  4IBX A;  2WKQ A;  4HP9 A;  4NKP A;  5HWW A;  3HLB A;  4QD4 A;  4B4Z A;  3ZG9 B;  2Y2K A;  2WAE A;  2Y2H A;  5HSQ A;  5I94 A;  3NEC A;  5G18 A;  4DN0 A;  1JTG A;  4UA9 A;  1PZP A;  3FZC A;  4HIA A;  1T1C A;  2VK3 A;  5KMW A;  3A0V A;  2Z2L B;  5HWV A;  4MBK A;  5AQ9 A;  5FQJ A;  1FIL A;  3GQZ A;  3IHB A;  4EQ1 A;  2ZC7 A;  4EW7 A;  3M6H A;  1K25 A;  1F98 A;  4WZ4 A;  1IFQ A;  4D60 A;  5CGX A;  4S2N A;  5FAS A;  4GDB A;  5GLA A;  2PDR A;  1TS7 A;  5J7E A;  1DJC A;  4II7 A;  3BM6 A;  4S2N C;  4GD8 A;  4IUH A;  2BLS A;  2VLG A;  4KZ3 A;  4OH0 A;  1ONG A;  2ZC3 B;  1HLU P;  4GNU A;  2O0Y A;  1XGJ A;  2JKG A;  3IBJ A;  2VA0 A;  4FH2 A;  5EPH A;  5FEF A;  2WGV A;  1S4R A;  2ACG A;  5J3W A;  3TOI A;  4DJ3 A;  4WLA A;  1PW8 A;  2Q9M A;  1K55 A;  2W3D A;  4X69 A;  3EQV A;  5F5Y A;  3UY6 A;  4R3A A;  3BWL A;  2V8C A;  2E8I A;  1YLP A;  2XRO A;  1K55 C;  3BFD A;  1ZG6 A;  1CEF A;  5CHU A;  5F68 A;  3W4P A;  1S66 L;  3DBA A;  3CUE A;  2W3F A;  2Z6D A;  1TD5 A;  3CUE C;  4X6T A;  4ESP A;  3MR0 A;  4E3K A;  1OT9 A;  3MZE A;  3E2K A;  1EW0 A;  2D01 A;  5FAO A;  3PXP A;  1H8M A;  1LI0 A;  3BW6 A;  3C38 A;  1S6R A;  3EQU A;  1TF1 A;  1P97 A;  2HGV A;  1SDN A;  3B3X A;  4R3B A;  3GVB A;  4BQM A;  5EEC A;  1CI9 A;  3OPP A;  5FSR A;  4X1L A;  1SCW A;  3FPV A;  2FH5 A;  4DDS A;  1NWZ A;  4HH2 A;  3CPT A;  4X25 A;  4HNB A;  5EE8 A;  3TJZ C;  1IYQ A;  5GLB A;  2J9P A;  5HZH A;  1IYO A;  2OAQ 1;  3ZQ5 A;  5LBR A;  4NXB A;  3IF6 C;  3IH8 A;  3MZF A;  4IHQ A;  4JGR A;  1MWR A;  3D9Y A;  3CG5 A;  3W4O A;  2M7V A;  4F94 A;  2K2N A;  3Q81 A;  5E2F A;  3B33 A;  1N9L A;  1RGY A;  5FL3 A;  3ISG A;  3VP3 A;  4GB7 A;  2PU2 A;  1XPB A;  5FI6 A;  4FTX A;  2Y2G A;  2R78 A;  3LIF A;  3ZG5 A;  1IOU A;  1AWI A;  5A91 A;  3I7J A;  2AVX A;  4XXR A;  1PWG A;  3A0S A;  3V3S A;  2JKR M;  2X01 A;  5DJT A;  2Y8H A;  2M7U A;  3FPW A;  1U60 A;  3W2Z A;  4R38 A;  2B02 A;  3SOI A;  4IED A;  2ZL1 A;  1G5U A;  3GTC A;  4Y15 A;  2H5S A;  3BJN A;  3G32 A;  4MEZ A;  2W1T B;  1JWP A;  3W8K A;  1MXO A;  1OTA A;  1EWZ A;  5A93 A;  1VEU B;  3F1P B;  4CLC A;  1XJ4 A;  2EFX A;  1BT5 A;  4X55 A;  4CLC C;  1ES2 A;  4RYE A;  1WE4 A;  5DF8 A;  5F83 A;  3N8R A;  1ACF A;  1SKO B;  2ZM0 A;  3L9K A;  4GS9 A;  3T1S A;  3DTE A;  1KDS A;  3NDG A;  2PAV P;  4QY6 A;  2RCX A;  3C7V A;  1MWS A;  2QMI A;  3P01 A;  2UWX A;  2ZMF A;  5HPI A;  3QP2 A; 
#chains in the Genus database with same CATH homology
 1PYY A;  3SS3 A;  3UNW A;  4XUZ A;  1C3B A;  3ZG8 B;  1KGF A;  2H0T A;  2WZX A;  2Y2J A;  3C5A A;  3HUO A;  2WGW A;  4IVI A;  2Y2N A;  4Z9Q A;  4E3M A;  5FQK A;  5HAP A;  2WKI A;  3HLW A;  3HRE A;  3IF6 A;  4DE2 A;  1K54 A;  4CJN A;  3GRJ A;  4PMA A;  4JF6 A;  4OLG A;  1MY8 A;  2A3U A;  3OPR A;  1SDE A;  4KQR A;  3G34 A;  1YLJ A;  4CPK A;  4WEK A;  1ZKJ A;  2XK1 A;  5M18 A;  1I2W A;  5DTS A;  1K54 C;  5D3O A;  3MXS A;  2HP9 A;  2CC1 A;  1FOF A;  1FQG A;  3IH9 A;  3BRM A;  4OPQ A;  1ERO A;  1MWU A;  1ESU A;  4KEN B;  5F1G A;  1TVF A;  5AQB A;  3ZNY A;  1MPL A;  2HDS A;  1GCE A;  5EVI B;  2IWB A;  2ZQ8 A;  1HZO A;  1EI5 A;  4HBU A;  2XFS A;  1LL9 A;  1NZO A;  2HDU A;  5EVI D;  4LV3 A;  1ES3 A;  3C4O A;  2C6W B;  2ZC6 B;  5A90 A;  4JBF A;  4GN2 A;  1KDW A;  2HP5 A;  3M2K A;  2I72 A;  1Q2Q A;  4WEJ A;  2Q9N A;  3WS1 A;  3S4X A;  3VP2 A;  1FSW A;  4KG5 A;  1E3U D;  4U0T A;  3NCK A;  5HAR A;  2ZQ9 A;  3BYD A;  4N1X A;  2JC7 A;  3OCL A;  1KE3 A;  4IVK A;  5U47 A;  3SH8 A;  3UE0 A;  3Q7Z A;  4KG2 A;  5F1F A;  5TGF A;  3WS0 A;  2ZQD A;  1Z6F A;  1M6K A;  2WZZ A;  4PM8 A;  3W4Q A;  4E3I A;  4OKP A;  4DXB A;  4OPY A;  2GDN A;  5F82 A;  4BL3 A;  1H8Y A;  4Y0O A;  3WWX A;  2XDM A;  4WMC D;  1XKZ A;  1HD8 A;  1PI5 A;  5AQA A;  4EQI A;  1ES4 A;  1GA9 A;  3PBS A;  3UDI A;  3G2Z A;  3MXR A;  3GR2 A;  1ERM A;  4OPR A;  1W7F A;  1YLT A;  4GDN A;  3HLE A;  4BEN A;  3LCE A;  4EWF A;  1W79 A;  4FCF A;  4LCL A;  2R9X A;  1IYP A;  1IKI A;  3MZD A;  5DTK A;  3SH9 A;  5J8X A;  4KQO A;  5FAQ A;  1M40 A;  2J8Y A;  5IHV A;  1RGZ A;  4XUX A;  5DF7 A;  5GL9 A;  3M2J A;  1HVB A;  3PBT A;  5TR7 A;  3RJU A;  4OQ0 A;  3Q1F A;  4E6W A;  3UPP A;  2OLU A;  4DDY A;  1LL5 A;  2P74 A;  4OOM A;  4X56 A;  4FH4 A;  4QB8 A;  4B4X A;  5L2F A;  5E2H A;  5E2G A;  5TFQ A;  5EUA A;  4MBH A;  2XQZ A;  3NIA A;  4R0Q A;  1TDL A;  1K57 A;  4GZB A;  1PWC A;  3DW0 A;  1YM1 A;  3A3D A;  3OPH A;  4ZJ2 A;  3FYZ A;  3N4I A;  2P9V A;  4JF5 A;  1LLB A;  1H5X A;  3PAG A;  4DF6 A;  1KVL A;  1K57 C;  3BFC A;  4GOG A;  4QY5 A;  1BSG A;  3WS5 A;  4DXC A;  3LY3 A;  3AGD A;  1JWZ A;  3ZFZ A;  5M1A A;  4ZJ3 A;  4C6Y A;  2DNS A;  1W8Q A;  2Y4A A;  5EVI A;  1KGG A;  1K6S A;  3WS4 A;  4PM6 A;  1ES5 A;  2V20 A;  4EV4 A;  3BEC A;  4K0W A;  4JXW A;  5FQQ A;  5DTT A;  3PBN A;  1K38 A;  1MWT A;  1IKG A;  3NC8 A;  5CRF A;  1DJA A;  4X68 A;  5EVI C;  5GHX A;  2IWC A;  4WM9 A;  4RVA A;  4GD6 A;  3RXW A;  3WS2 A;  4JPM A;  1DY6 A;  1O7E A;  4FSF A;  1SKF A;  1E3U A;  1N4O A;  3ZDJ A;  1SHV A;  1JWV A;  1ONH A;  2Y2P A;  1PZO A;  3Q7V B;  4R3J A;  1CK3 A;  2R9W A;  2ZC4 B;  3S1Y A;  4ZAM A;  1NZU A;  1I2S A;  4IBR A;  5FQI A;  5CGW A;  1NY0 A;  2H10 A;  2ZLY A;  4LV1 A;  2IWD A;  2WAD A;  3ITB A;  4WMC A;  2WKE A;  1I5Q A;  4BD1 A;  3UO9 A;  3CZD A;  1FSY A;  3O3V A;  3O88 A;  4P6B A;  1Q2P A;  1W5D A;  2XD5 A;  5HW3 A;  4QHC A;  3VP1 A;  1S0W A;  4UHU A;  1XA1 A;  3A3J A;  5FQM A;  4IBX A;  1GHP A;  3VSL A;  3HLB A;  2OLV A;  5CEB A;  4QD4 A;  1QMF A;  4K0X A;  2X02 A;  3ZG9 B;  4KZ8 A;  5FAP A;  3NI9 A;  5FI2 A;  4B4Z A;  3HVF A;  2Y2K A;  3NY4 A;  4NET A;  2WAE A;  2Y2H A;  3WRT A;  4OLD A;  3UDF A;  5I94 A;  1E25 A;  4ZTK A;  5G18 A;  1KVM A;  3Q82 A;  4Y0T A;  1JTG A;  4UA9 A;  4FD8 A;  1PZP A;  4EBL A;  2VGK A;  3FZC A;  3VOZ A;  5HL1 A;  3HLD A;  4OVD A;  1VM1 A;  5KMW A;  1YLZ A;  4YFM A;  2Z2L B;  1FR1 A;  1E4D A;  3MKF A;  4MBK A;  5AQ9 A;  3HBR A;  3N8L A;  5FQJ A;  4EBN A;  4UAA A;  5CTM A;  3GQZ A;  3HUM A;  5JYO A;  2JE5 A;  5KZH A;  3V3R A;  5FA7 A;  3BFF A;  2Y2O A;  3IHB A;  2C5W B;  4KZ6 A;  2ZC7 A;  5FAT A;  3ZVW A;  2G2U A;  2Y2M A;  3M6H A;  1K25 A;  5FDH A;  3TG9 A;  3ZG0 A;  1NYM A;  5GLC A;  4BJP A;  4GKU A;  4WZ4 A;  3PBR A;  2XEP A;  5CGX A;  2EX8 A;  2XF3 A;  1XXM A;  4S2N A;  1L0G A;  4RX2 A;  5FAS A;  4GDB A;  1CEG A;  1KGE A;  5GLA A;  3ZNT A;  3NDE A;  1DJC A;  5M19 A;  4RX3 A;  1J9M A;  2WKH A;  4R4R A;  3BM6 A;  3QHY A;  2WYX A;  4DKI A;  4S2N C;  3TSG A;  3UPO A;  4GD8 A;  5HAI A;  3WRZ A;  3AGE A;  3LY4 A;  2BLS A;  3OCN A;  5HX9 A;  3S22 A;  3ZGA B;  4KZ3 A;  4S2M A;  3PTE A;  4OH0 A;  3DWZ A;  1GHI A;  3P98 A;  4L0L A;  1ONG A;  2ZC3 B;  5EOO A;  4GNU A;  4RA7 A;  2QZ6 A;  4DE0 A;  1XGJ A;  1FCN A;  3LO7 A;  1N9B A;  3PAE A;  4FH2 A;  5EPH A;  5GHY A;  2ZQA A;  2WGV A;  4KG6 A;  3TOI A;  2Y91 A;  3A3E A;  1NJ4 A;  4UA7 A;  1PW8 A;  2Q9M A;  1TDG A;  1K55 A;  3Q7V A;  4C3Q A;  4X69 A;  3EQV A;  5EVL A;  3UY6 A;  2OV5 A;  2WGW B;  2ZC5 B;  3IXH A;  2ZM2 A;  4JXS A;  4QU3 A;  2G2W A;  4HEF A;  3IF6 B;  3HUN A;  3SH7 A;  2E8I A;  1YLP A;  1K55 C;  2RL3 A;  3BFD A;  4E3O A;  5CGS A;  1BTL A;  1ZG6 A;  3A3F A;  1CEF A;  5CHU A;  4S2P A;  3UPN A;  3IWQ A;  4YIN A;  5JYP A;  3W4P A;  3OC2 A;  1GA0 A;  1IEM A;  5DVA A;  4OOL A;  5CHJ A;  4PM5 A;  3G31 A;  3BFG A;  2ZQ7 A;  3BLM A;  4N92 A;  4R1G A;  4EBP A;  4LCM A;  5KSH A;  4X6T A;  2XFT A;  1K56 D;  3FV7 A;  4OQG A;  4E3K A;  4HES A;  3O86 A;  3VFH A;  2EX9 A;  3UN7 A;  1OME A;  3N6I A;  1GHM A;  4Y7P A;  4WZ5 A;  1O07 A;  2VGJ A;  1CI8 A;  1QME A;  2EXB A;  1AXB A;  3MZE A;  3V50 A;  3E2K A;  2WGI A;  4S2L A;  2FFY A;  5FAO A;  2HDQ A;  2HPB A;  4P0M A;  4C75 A;  1XX2 A;  4WZ5 C;  3VMA A;  3FWL A;  1ERQ A;  3CJM A;  1YMX A;  1LI0 A;  1NXY A;  2ZQC A;  4N9L A;  1XA7 A;  2ZM8 A;  4EUZ A;  1PIO A;  3MBZ A;  1L0D A;  2WK0 A;  2EX6 A;  1S6R A;  2B5R A;  3EQU A;  1ZC2 A;  1IYS A;  4UA6 A;  4E3L A;  1SDN A;  3B3X A;  4R3B A;  3GVB A;  4BQM A;  4ZDX A;  5EEC A;  1VQQ A;  2OSU A;  4R4S A;  1CI9 A;  3IQA A;  3OPP A;  2XH9 A;  4WEL A;  5FSR A;  2XGN A;  3SS5 A;  1NRF A;  4JKT A;  4PM7 A;  4OP8 A;  4A5R A;  3BLS A;  1BZA A;  2Z2M B;  1SCW A;  3SS4 A;  2Y2L A;  3N8S A;  4OON A;  1PW1 A;  1WYB A;  3BEB A;  4DDS A;  3DWK A;  3ITA A;  4OP5 A;  4U3T A;  5CEC A;  2Y59 A;  1BLH A;  3OZH A;  2FFF B;  3A3I A;  3JYI A;  3UE3 A;  1L2S A;  3NBL A;  5DF9 A;  4ZBE A;  1NYY A;  3ZVT A;  4LEN A;  4LV2 A;  5EE8 A;  3VP4 A;  1IYQ A;  3QNB A;  1XP4 A;  1H8Z A;  1TEM A;  4DE1 A;  1K6R A;  2EFU A;  3IXD A;  5BOH A;  1BLP A;  5GLB A;  4WYY A;  4E6X A;  2J9P A;  1YMS A;  3IXG A;  2DRW A;  3PBO A;  3HLG A;  3GV9 A;  4JXG A;  2JBF A;  5CER A;  1IYO A;  5FQ9 A;  2QPN A;  3G4P A;  2HDR A;  2ZMA A;  4X53 A;  3GSG A;  1BUL A;  4R23 A;  2P9V B;  3IF6 C;  2V2F F;  5GHZ A;  3IH8 A;  4E3J A;  2PU4 A;  3MZF A;  4PM9 A;  1MWR A;  3IXB A;  3LEZ A;  2Y2Q A;  5A92 A;  2EXA A;  1K4F A;  4D2O A;  1K56 A;  2WAF A;  2XD1 A;  3CG5 A;  3P09 A;  3IWI A;  2A49 A;  5HFO A;  3ZHH A;  3W4O A;  4F94 A;  3CMZ A;  5CED A;  3Q81 A;  5E2F A;  3IF5 A;  4S2K A;  2J7V A;  1RGY A;  4S2I A;  3N7W A;  3ISG A;  4MLL A;  4N9K A;  3VP3 A;  1FR6 A;  4KZ7 A;  1L0E A;  4LV0 A;  1G68 A;  4GB7 A;  4NK3 A;  2PU2 A;  4ID4 A;  3V5M A;  1JVJ A;  1XPB A;  3ZCZ A;  3D4F A;  5FI6 A;  4ZJ1 A;  4DE3 A;  1ALQ A;  2EX2 A;  3VFF A;  4OQH A;  5HAQ A;  3G35 A;  2WUQ A;  2Y2G A;  2ZD8 A;  3IWO A;  1KE4 A;  4JXV A;  4OQI A;  4O7D A;  4S2O A;  1HTZ A;  2V1Z A;  3E2L A;  1ESI A;  3MKE A;  3Q07 A;  5AQ7 A;  3VSK A;  3ZG5 A;  3FKV A;  5CHM A;  5A91 A;  4BLM A;  1YLW A;  3I7J A;  4BL2 A;  5GLD A;  4XXR A;  1BUE A;  1K4E A;  1BLS A;  5CXW A;  1MKI A;  4KZA A;  2XLN A;  1PWG A;  3V3S A;  2H0Y A;  3ZG7 B;  1WYC A;  5FI7 A;  2X01 A;  2ZJ9 A;  4KZ4 A;  4KZ5 A;  1KE0 A;  1G6A A;  1DJB A;  3GMW A;  1JTD A;  1U60 A;  3V39 A;  2J9O A;  1LHY A;  3SOI A;  4S2J A;  4MNR A;  3O87 A;  4IED A;  5CTN A;  4QJG A;  3M6B A;  3BFE A;  3G2Y A;  3GTC A;  3OPL A;  3UE1 A;  2H5S A;  2BG1 A;  3G32 A;  1PI4 A;  3FKW A;  2JCH A;  3C7U A;  4MEZ A;  5E43 A;  1JWP A;  3HL9 A;  4E3N A;  2X71 A;  4KQQ A;  1XGI A;  3W8K A;  1MXO A;  1ZG4 A;  5KSC A;  1L0F A;  3VOY A;  1EWZ A;  1IEL A;  5A93 A;  4B88 A;  3UDX A;  4JLF A;  4OPZ A;  2PBY A;  4DRT A;  2HP6 A;  4PPR A;  3G30 A;  1PWD A;  1RP5 A;  1W8Y A;  3IHA A;  2EFX A;  1BT5 A;  3AGF A;  3C4P A;  4OOY A;  4X55 A;  2Y2I A;  4KZB A;  3VP0 A;  1ES2 A;  3RXX A;  4RYE A;  1WE4 A;  5DF8 A;  5F83 A;  3N8R A;  4P85 A;  5E2E A;  1Y54 A;  1RCJ A;  3QNC A;  4M3K A;  2ZM0 A;  1FCO A;  4KZ9 A;  4WBG A;  2XR0 A;  3HLC A;  3MFD A;  4HBT A;  3HLF A;  4MBF A;  1BLC A;  1YT4 A;  3NDG A;  1KDS A;  4N1H A;  4QY6 A;  5EOE A;  2RCX A;  3C7V A;  1MWS A;  1YLY A;  2DCF A;  2QMI A;  3PBQ A;  4K91 A;  3IT9 A;  4U0X A;  4JF4 A;  4Q8I A;  4H8R A;  4Y0U A;  2UWX A;  3DTM A;  1LI9 A;  4P87 A;  4BD0 A;  2Y55 A;  1YQS A;  1FCM A;  1MBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...