1BLPA

Structural basis for the inactivation of the p54 mutant of beta-lactamase from staphylococcus aureus pc1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
257
structure length
253
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRLNYYSPKSKKNTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(acting on cyclic amides)
molecule keywords BETA-LACTAMASE
publication title Structural basis for the inactivation of the P54 mutant of beta-lactamase from Staphylococcus aureus PC1.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 89
structure length 253
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1993-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1blpA00
1FCMA 3SH8A 3WRZA 3BYDA 4FCFA 3TSGA 1JWZA 2DCFA 3BFCA 3OZHA 1DJCA 4GNUA 4OLDA 3ZGAB 3I7JA 3ZG5A 3VP1A 4LCLA 4WZ5A 2XF3A 4R3JA 4X55A 3NI9A 2HDRA 5EVIB 3WS0A 4MBKA 2RCXA 3IXBA 4KG5A 2WZXA 5E2GA 2XEPA 3UDXA 4OVDA 3GMWA 2A3UA 4KG2A 3IF5A 3PTEA 4X68A 5CTNA 1BUEA 2EFUA 2X71A 1FR1A 1MWRA 3A3DA 3V39A 4E3NA 3M6HA 1ZG6A 2XR0A 1KGGA 2Y2MA 3VFFA 1ALQA 2IWCA 3C7UA 5FAOA 4NK3A 1MWTA 1SDNA 2B5RA 1PZPA 3V3RA 2JC7A 2ZC5B 1I2SA 3IXDA 1RCJA 3ZHHA 3LEZA 4BQMA 4DDSA 2C5WB 3Q82A 1K57A 3QNCA 3Q81A 1IELA 1MKIA 1XXMA 4DE0A 2Y2OA 5HL1A 5CXWA 3ZG8B 2Y2GA 3E2LA 3G2ZA 3JYIA 4GOGA 4ZTKA 4E3IA 4PM7A 3P98A 1XP4A 3MXSA 4S2JA 3M6BA 3MBZA 3PAGA 5EUAA 4Y0UA 3LY4A 4QY6A 2Y55A 1EWZA 3ZG7B 3TG9A 3C7VA 2ZJ9A 1PI5A 3C4OA 4X69A 1GHMA 1PW1A 4DRTA 1KGEA 2ZM2A 1O07A 5CHMA 1XGJA 5FQQA 3RXXA 3RXWA 3CJMA 5DF9A 1YLJA 3WWXA 3G30A 1I5QA 5E43A 3IWQA 1GCEA 2HDUA 4YFMA 2WKEA 4EBNA 3IH8A 3V50A 5AQAA 1KE3A 3IF6C 1FCNA 2Y2KA 5F83A 4KG6A 5KSCA 2EXAA 2FFFB 5JYPA 5F82A 5E2EA 1MXOA 2QMIA 4U0TA 5EPHA 4ZJ3A 4QHCA 1NYYA 3N8LA 3QNBA 2XH9A 1ES2A 1C3BA 4LV2A 3VP4A 1K56D 1YMSA 1E3UD 3DWKA 2XLNA 3UDFA 5A93A 5AQ7A 4LV3A 4JPMA 3IWIA 4KQRA 4C75A 3IQAA 4JF6A 1FSYA 3RJUA 4E3LA 3NCKA 1ZG4A 3BFEA 2I72A 2Y2HA 3MKEA 2H10A 4FH4A 3CMZA 3M2KA 3GVBA 5M1AA 1E3UA 1JWVA 1FCOA 4B4XA 1K6RA 1L0DA 1Q2QA 5EVIC 1L0EA 1OMEA 1YLTA 4C6YA 4DXCA 2WGIA 1G68A 1W79A 3G34A 3N8RA 4WEKA 1TDGA 2XFSA 5CTMA 1U60A 4JXWA 1NJ4A 3SS5A 1SCWA 4WZ5C 1KE4A 1K54C 5GLAA 4DE3A 3UE1A 1M6KA 2Y2IA 1DJAA 3IHAA 4IVKA 4L0LA 1O7EA 1L0GA 1ONHA 3ZCZA 4S2OA 1RP5A 2XDMA 2JBFA 3N6IA 1XKZA 2EX2A 3BM6A 3ZG0A 4PPRA 3P09A 3FWLA 3Q7VA 1HVBA 3W4OA 2WGWA 3ISGA 4KZAA 3HLDA 4R1GA 1BLSA 3HVFA 2ZQ9A 3UE3A 4DE1A 1WYBA 4BD0A 5CECA 1H8ZA 1JTDA 5AQ9A 3UO9A 3UPPA 3ITAA 1YM1A 4RX3A 4N92A 4ZJ2A 5CGSA 3OCLA 4LV1A 1ERMA 5EVID 1XA1A 1FOFA 4OQIA 1IKGA 1FSWA 2WGWB 4OOYA 3NDGA 1ONGA 1LI0A 1MBLA 5CGWA 3S4XA 1BSGA 4E3MA 1MPLA 4KZBA 1SDEA 1RGZA 2X01A 1K57C 5EVIA 4B4ZA 2XD1A 3CZDA 1SHVA 4S2MA 4R3BA 4S2KA 4PMAA 4X53A 3UNWA 5A92A 5EECA 1K54A 4OOMA 5BOHA 3A3JA 2HP6A 4KQQA 3VOYA 4KQOA 4A5RA 3GSGA 4DXBA 3VP2A 3HUNA 4GDNA 3BLSA 4Y7PA 2HP5A 4XXRA 3DWZA 3HLWA 3OPRA 1JTGA 2OSUA 3HLGA 1XA7A 4JXVA 2J7VA 2QZ6A 4KENB 2C6WB 5EVLA 3UN7A 1Q2PA 2J8YA 4S2IA 3PBRA 3PBTA 1NYMA 1NY0A 4U0XA 3VP0A 1VQQA 3M2JA 4EQIA 3VP3A 4DKIA 2Y2LA 3OPPA 5FASA 2EFXA 4R0QA 5HAQA 3ZFZA 5CEDA 3Q07A 1WE4A 1EROA 2ZC3B 4K91A 4X56A 4CJNA 4OH0A 4ZDXA 5IHVA 1KGFA 3N7WA 4XUXA 1LI9A 4P85A 4RA7A 3FZCA 3SOIA 2WKHA 1HTZA 2EX9A 4HBUA 5FI2A 3V3SA 3N4IA 3IH9A 1FQGA 2VGJA 5CEBA 4QU3A 4DDYA 3SS3A 3HREA 3BFDA 5HARA 4OP5A 3PBQA 1CEFA 3WS4A 3MZDA 2WK0A 5FQKA 5FSRA 4Y0TA 4OONA 4Z9QA 4QD4A 1N9BA 2ZQAA 1AXBA 2XGNA 4N9LA 3AGEA 3O88A 5DVAA 4IEDA 3NY4A 2DRWA 4IVIA 4EV4A 1MY8A 1BZAA 1YMXA 1LL5A 3OPHA 4OLGA 5L2FA 1DJBA 4OQ0A 2Y2QA 4PM6A 1IYSA 5HAPA 1K55C 3G35A 5FQJA 4OPRA 5FQIA 5CERA 2XK1A 5GLBA 2P74A 1YLZA 2G2UA 1H8YA 2ZQCA 1NRFA 4OP8A 4MLLA 4DE2A 3TOIA 3PAEA 3V5MA 4UA7A 2Y2PA 2ZC4B 1G6AA 3FV7A 1K4FA 4KZ3A 3ITBA 5U47A 4U3TA 1HD8A 5FATA 3WS1A 3IXHA 5CHJA 1KE0A 4PM8A 2Y91A 4E6WA 2EXBA 3FKWA 1CEGA 1IYQA 1MWSA 2UWXA 4X6TA 5GLCA 1TDLA 4F94A 5A90A 4K0WA 3ZDJA 2HDQA 4RX2A 3D4FA 3IXGA 1KVLA 3E2KA 2PU2A 4IBXA 4KZ5A 2WUQA 3VOZA 1QMEA 1HZOA 3CG5A 2RL3A 4N1XA 3FKVA 4HEFA 1LL9A 2V2FF 4KZ6A 1RGYA 2VGKA 1ZC2A 4P87A 1JVJA 4S2NC 5FQMA 2BLSA 5TR7A 4KZ9A 4ZBEA 4DF6A 1BLCA 1YT4A 2PBYA 3HUMA 1K55A 1YLPA 1E25A 2Z2LB 4UA6A 5DF8A 1ES5A 5HAIA 1CI9A 1ERQA 4WELA 4JF4A 2HPBA 3G2YA 5E2FA 3BEBA 5J8XA 3N8SA 1K25A 3O87A 4E3JA 5EOOA 1Z6FA 5D3OA 1JWPA 4E6XA 5EOEA 5FI7A 4OOLA 4GKUA 5JYOA 1K38A 2ZQ8A 4YINA 1J9MA 5DTKA 5TFQA 1GHIA 3SH7A 2ZMAA 3HLEA 2ZD8A 3NIAA 3PBNA 4R4SA 5KMWA 5DTSA 1WYCA 2DNSA 4JXSA 1ESIA 2WGVA 5FA7A 5TGFA 2HDSA 1XX2A 1IYPA 1KDWA 1MWUA 4P6BA 4WMCA 4S2LA 3HLFA 1PWGA 5M19A 3LCEA 3ZVTA 4CPKA 3MZFA 3AGFA 1N4OA 3WS5A 1PI4A 1VM1A 4N1HA 4S2NA 1IKIA 3MZEA 2V20A 1W7FA 3G32A 5HW3A 1ES3A 1LLBA 3HL9A 1PIOA 5FDHA 5FAQA 2WAEA 4Q8IA 4GD6A 2Q9NA 4M3KA 2ZM0A 5E2HA 4C3QA 3S1YA 2J9OA 3OPLA 3VSKA 3IWOA 1I2WA 4KZ4A 1DY6A 1S6RA 4R23A 5DTTA 5GHZA 3UE0A 4JLFA 4GDBA 3HLCA 4H8RA 3GTCA 4BLMA 4BL3A 3UPNA 2ZM8A 3WS2A 3A3EA 3PBSA 4BENA 2G2WA 1CK3A 3MFDA 4EWFA 2WKIA 1LHYA 4LENA 3W4QA 5M18A 3W8KA 4ZJ1A 1FR6A 2GDNA 2OLUA 5I94A 1YLWA 3GQZA 2H0TA 1EI5A 5KZHA 3MXRA 4RYEA 2OV5A 3NC8A 2HP9A 3A3FA 1W8QA 1BTLA 3Q7ZA 4R4RA 4E3KA 4FH2A 3BRMA 4HESA 4OPZA 2IWBA 3BFGA 3UPOA 4FSFA 1K4EA 2Z2MB 1BLPA 2ZQ7A 3UDIA 2H5SA 4O7DA 4OPQA 5DF7A 4ID4A 5GL9A 3IT9A 4MNRA 4OPYA 3ZG9B 3C4PA 3WRTA 4NETA 1IEMA 1BULA 3EQVA 4IBRA 4UHUA 3GR2A 1NXYA 3VMAA 3NBLA 4GN2A 5HX9A 1TVFA 1BT5A 3Q1FA 1GHPA 3FYZA 4KZ7A 2QPNA 5CHUA 3OC2A 4B88A 1BLHA 2J9PA 4RVAA 2X02A 2JE5A 3O86A 1GA0A 2CC1A 3S22A 4LV0A 4LCMA 3VSLA 4UAAA 2XQZA 4BJPA 1E4DA 1PW8A 3LO7A 4WBGA 3ZNYA 2Y2JA 4EBPA 2Y4AA 2ZC6B 3C5AA 5CGXA 1KDSA 3G4PA 4QJGA 3HUOA 4WZ4A 1IYOA 3BFFA 4FD8A 4EBLA 2WAFA 1W5DA 1PZOA 3GRJA 1K6SA 1YQSA 3B3XA 1GA9A 3O3VA 1KVMA 4OQHA 4OQGA 4P0MA 3W4PA 2R9XA 3VFHA 2R9WA 3DW0A 1L0FA 4E3OA 2ZC7A 2EX6A 1ZKJA 3LY3A 3PBOA 4PM9A 4JF5A 2A49A 5HFOA 1PWDA 1XGIA 2JCHA 3ZNTA 4MBHA 1YLYA 1PWCA 1Y54A 4MBFA 4S2PA 4QY5A 1K56A 4BD1A 1TEMA 3BECA 1S0WA 2P9VA 3AGDA 3EQUA 4GD8A 1PYYA 3NDEA 2IWDA 4ZAMA 3A3IA 4WM9A 4N9KA 2WYXA 4OKPA 2ZQDA 1NZUA 4BL2A 5CRFA 4QB8A 4KZ8A 4MEZA 3GV9A 2XD5A 1SKFA 2P9VB 1XPBA 4JBFA 4JXGA 5GHYA 5AQBA 5GLDA 5A91A 2Q9MA 4HBTA 4XUZA 3ZVWA 3G31A 4GB7A 2PU4A 1ES4A 2OLVA 4EUZA 1ESUA 4PM5A 4Y0OA 3SS4A 2WZZA 2ZLYA 3IF6A 4JKTA 3UY6A 5F1GA 5KSHA 5FI6A 4WMCD 3HBRA 1CI8A 3SH9A 2WADA 4GZBA 4WYYA 5G18A 2Y2NA 2Y59A 5GHXA 1H5XA 3IF6B 2V1ZA 3OCNA 2FFYA 2EX8A 3DTMA 4UA9A 5EE8A 1W8YA 5FAPA 2H0YA 5F1FA 2E8IA 3MKFA 2XFTA 1NZOA 3Q7VB 4D2OA 1L2SA 2BG1A 3IHBA 4K0XA 3HLBA 1QMFA 5FQ9A 3QHYA 3BLMA 4WEJA 1M40A
chains in the Genus database with same CATH superfamily
1FCMA 3QP6A 3BFCA 3ZGAB 1DJCA 2XF3A 4R3JA 4X55A 3NI9A 2HDRA 2K2NA 3GMWA 3CPTB 5CTNA 4NXEA 1DP8A 1MWRA 1IOUA 1KGGA 3VFFA 1PNEA 2IWCA 2M7VA 5L10A 1MWTA 1SDNA 1WA9A 1L3LA 3T12B 5F68A 3JVVA 1RCJA 3Q82A 1W63M 1K57A 3Q81A 1XXMA 3P7NA 4DE0A 3V67A 5CXWA 2I9VA 3MF0A 2HZ5A 2UV0E 3MXSA 4S2JA 3L7HA 5EUAA 4Y0UA 1YAXA 3T4LA 3TG9A 4X69A 1PRQA 4DRTA 3L9KA 2L0WA 4CLCC 1T1BA 3R7WA 3IWQA 1GCEA 1BYWA 2WKEA 3IH8A 3IX8A 1KE3A 2VKSA 5KSCA 2FFFB 1F98A 2L4RA 2OWHA 3N8LA 4WUJA 5HPIA 1K56D 1ODVA 4LV3A 4KQRA 1VB6A 3T4KA 3IQAA 4E3LA 2I72A 3QP2A 2V9AA 4FH4A 3CMZA 3MXQA 5M1AA 1JWVA 1STZA 2BTFP 1L0EA 4C6YA 4PHTA 4CLCD 1FILA 4PKYA 4M4XA 1OT9A 4JXWA 3SS5A 1SCWA 4P6ZM 4WZ5C 5AVFA 3T4QA 3OBFA 1M6KA 2Y2IA 1DJAA 3IHAA 4IVKA 1O7EA 2JBFA 5IU1A 3H9WA 3W4OA 1BLSA 5HSQA 5AQ9A 3UPPA 3BQ8A 1S67L 1YM1A 4N92A 5CGSA 4OOYA 1FSWA 3KYEA 1D06A 1MBLA 2XD1A 3CZDA 4S2KA 3DTEA 3UNWA 3S7QA 3CPTA 2PR6A 1K54A 4OOMA 3A3JA 1XFNA 3VE4A 3VOYA 4I5SA 2O9BA 3GSGA 4WN5A 3TJZC 4GDNA 2D01A 2QJ5A 3LR5A 3KYZA 2J7VA 2C6WB 4WF0A 5EVLA 1Q2PA 2J8YA 4S2IA 1NYMA 2B95A 3VP0A 1OPXA 3OPPA 5HAQA 5CEDA 4E04A 4JGRA 3LEQA 1YPRA 5HPFA 1CJFA 1KGFA 4P85A 3FZCA 1HTZA 3EGDC 3V3SA 1N9OA 3LICA 3D9YA 3C8CA 1OTBA 4OP5A 5FSRA 4JGPA 2ZQAA 1LL5A 1DJBA 3W2ZA 4AFIA 1IYSA 5FQJA 4CLCE 1P0ZA 4OP8A 1IFQA 3V5MA 2ACGA 3FG8A 4EW7A 5J3WA 2Y91A 2EXBA 3FKWA 2UWXA 1TDLA 4EERA 3IXGA 3VOZA 1QMEA 3MQQA 3H82B 3TW8A 3FKVA 4HEFA 4KZ6A 2J3TC 1T1AA 3T4JA 4P87A 2LB9A 4S2NC 5TR7A 3HUMA 1K55A 5HAIA 2K7SA 2HJ9C 4WELA 2HPBA 3G2YA 5J8XA 1JWPA 4E6XA 4LGWA 4OOLA 4GKUA 4YINA 1GHIA 3SH7A 1GSWA 3A0VA 3E4QA 5DTSA 2EWWA 4JXSA 1ESIA 1MKMA 2HJEA 3F1PA 2J3TD 2HDSA 4P6BA 2B02A 4WMCA 5M19A 3AGFA 1N4OA 2ZBBA 1ES3A 4Q8IA 4GD6A 2Q9NA 4HI4A 2ZM0A 4ETZA 3S1YA 2J9OA 1I2WA 4KZ4A 3UE0A 3HLCA 2H28A 1W63Q 3WS2A 4BENA 2G2WA 1P9RA 3LR3A 3MFDA 2WKIA 5M18A 3FC7A 3W8KA 2GDNA 2OLUA 1YLWA 2H0TA 1EI5A 5KZHA 3MXRA 4RYEA 2OV5A 5L07A 1W8QA 1BTLA 4HESA 2IWBA 2H5SA 5GL9A 3IT9A 5HWWA 4ME4A 2A24A 3GR2A 1NXYA 4GN2A 2O99A 5CHUA 1GHPA 3KSHA 3O86A 4BJPA 1PW8A 3LO7A 4GHIB 5DFYA 4MMNA 3ZNYA 2KX6A 4EBPA 2Y4AA 2ZC6B 2FZ0A 4WZ4A 1IYOA 3UB9A 3BJNA 4EBLA 2VV8A 4ARZB 2WAFA 3H82A 3B3XA 1TS8A 3PYPA 3LY3A 1ZKJA 5HFOA 3LIEA 2ZOHA 4XT2A 4QY5A 1K56A 3LYXA 1S0WA 2GNXA 3NDEA 4HH3A 4ZAMA 1OJGA 1NZUA 3LR0A 3VOLA 5TBMA 4MEZA 2CMNA 2KDKA 4CLCA 4XUZA 4EUZA 1ESUA 4GCZA 2ZLYA 5FI6A 1VHMA 5G18A 4WYYA 2Y59A 1OTAA 1H5XA 2EX8A 1W8YA 4GLQA 3MKFA 1NZOA 4D2OA 2BG1A 3IHBA 3HLBA 4LRYC 1QMFA 5FQ9A 3BLMA 2ZMVA 1ACFA 1G28A 4HIAA 3WRZA 2OAP1 2VX8A 1EW0A 3OZHA 4OLDA 3I7JA 4WZ5A 3WS0A 4MBKA 2RCXA 4KG5A 2WZXA 2XEPA 2JKRI 4KG2A 2WKRA 3JVUA 2BASA 3JPUA 1ZG6A 2XR0A 5EV0A 5FAOA 4NK3A 1PZPA 2ZC5B 1I2SA 3IXDA 1TS0A 3ZHHA 3LEZA 4DDSA 3RTYA 3ZG8B 3P01A 4GHIA 1XP4A 4O8GA 4ETXA 2Y55A 3DBAA 1EWZA 2ZJ9A 1PI5A 1GHMA 2QJ7A 4ARZA 3CJMA 5DF9A 3G30A 2HDUA 3FPVA 5HD3A 3IF6C 5F83A 5EM0A 2W3HA 4UQIM 4ZJ3A 3UE6A 5HWVA 4LV2A 3VP4A 2PYRA 1E3UD 3DWKA 3UDFA 1S1YA 3IWIA 4C75A 3RJUA 1FSYA 1ZG4A 3BFEA 2W27A 1Z09A 3M2KA 2PR5A 3D3OA 1K6RA 1H3QA 4LLOB 3G6OA 1Q2QA 5EVIC 2ZL1B 1YLTA 2PBDP 4EESA 3H7WB 4DXCA 5CTMA 1NJ4A 4DE3A 3UE1A 2W1TB 1L0GA 4L0LA 1OTEA 2VV6A 4S2OA 1N9LA 3CWFA 3N6IA 3ZG0A 2WGWA 4O01A 3HVFA 2ZQ9A 5CECA 3EGXC 2JKGA 4FOFA 2MJ6A 2V8FA 1ERMA 5EVID 1FOFA 2EA9A 1LI0A 3K2NA 4HP4A 1BSGA 4E3MA 1MPLA 4KZBA 1SDEA 4JGQA 3CUEC 2VLGA 2XSSA 4X53A 3SW1A 2VA0A 1DRMA 4DJ3A 3O5YA 4F3LB 4A5RA 3VP2A 3HUNA 4X25A 1JTGA 2OSUA 3HLGA 3KSFA 3UN7A 4HY8A 2M7UA 3RH8B 1FIKA 2WKQA 4B93A 2Y2LA 4R0QA 2JKTI 5G4YA 4OH0A 4ZDXA 3S7OA 4HHDA 2WKHA 2EX9A 2FH5A 3N4IA 1N9NA 5CEBA 4DDYA 3WS4A 3MZDA 5FQKA 4Y0TA 4OONA 2W3DA 2XGNA 4N9LA 4IVIA 4EV4A 3BW6A 1BZAA 1F9IA 3DTKA 2GZAA 2WKPA 3T50A 4PM6A 3CAXA 5CERA 2XK1A 3IX3A 4Q0HA 2G2UA 2ZQCA 2V1BA 1D7EA 2ZL1A 3H7WA 3E98A 2Y2PA 2ZC4B 1K4FA 5U47A 2JKRM 4R38A 5FATA 3WS1A 3IXHA 4E6WA 1KE0A 2W1TA 1CEGA 1IYQA 1S4RA 5GLCA 4K0WA 2HDQA 1NWZA 4RX2A 1KVLA 4KUOA 2WUQA 4KZ5A 2K31A 1LL9A 1UWNX 2V2FF 3KSIA 2BLSA 4DF6A 4P6ZS 5DF8A 4DMZA 1OJ5A 1OTDA 5EOOA 4NXBA 4MN5A 2ZQ8A 4I3IA 4RQ9A 2ZMAA 4ZRRA 4HJ6A 5KMWA 4F3LA 3NHQA 1XX2A 2J3WA 5HWTA 1KDWA 3CITA 3HLFA 3LCEA 3ZVTA 3F1PB 5HD5A 1IKIA 2V20A 3G32A 3QP4A 1ZTUA 3E4PA 2A2LA 1PIOA 5FDHA 5FAQA 5A8BA 3TRCA 4FUWA 3VSKA 3HJKA 4R23A 3ICYA 1P9WA 4BLMA 4BL3A 3A3EA 3T4OA 1J3WA 1FR6A 5FDSA 4GS9A 3LUQA 3QP8A 4OPZA 1KOUA 2Z6DA 3BFGA 3T1XA 3UPOA 2ZQ7A 1BLPA 3C4PA 3WRTA 1IEMA 4IBRA 2Q0OA 3VMAA 5HX9A 1PFLA 4D60A 4KZ7A 4RVAA 2J9PA 2A24B 3S22A 4LCMA 4UAAA 2XQZA 4II7A 4YNRA 5FL3A 2Y2JA 5CGXA 1KDSA 3G4PA 4QJGA 3MQOA 1G5UA 4FD8A 1W5DA 1YQSA 3O3VA 1GA9A 3W4PA 4P0MA 3DW0A 1L0FA 2B18A 2ZC7A 1PWDA 3ZNTA 4KUKA 1YLYA 1GSXA 2JKTM 4BD1A 4I3JA 3BECA 3EWKA 2P9VA 4GD8A 4MN6A 4EQ1A 3A3IA 4WM9A 4XT2B 5EFWA 4N9KA 3LIBA 2O9CA 2ZQDA 4BL2A 1AWIA 3PXPA 4KZ8A 2XD5A 1SKFA 4JXGA 5GHYA 5GLDA 5A91A 2Q9MA 3ZVWA 2PD8A 4EEPA 1ES4A 4BBUA 4PM5A 2V0UA 4B9OA 5TBMB 3IF6A 3UY6A 5KSHA 4CLCB 3HBRA 2WADA 4GZBA 5GHXA 1NLYA 5DJUA 2FFYA 3DTMA 4UA9A 2JHEA 2EWVA 5KIZA 2JKFA 3LIFA 3C2WA 3BYDA 1JWZA 2DCFA 4LCLA 3UDXA 4OVDA 2VGLS 1V9ZA 1BUEA 2EFUA 2X71A 5J4EA 3V39A 2Y2MA 1MZUA 2B5RA 2JC7A 4EUVA 2HGVA 2C5WB 3QNCA 1IELA 3K3CA 2Y2OA 5HL1A 3E2LA 3JYIA 4GOGA 4R3AA 4E3IA 2PYPA 2XA7S 3MBZA 3PAGA 3LY4A 4PAUA 4QY6A 3MJQA 3ZG7B 5HDDA 3C4OA 1S4SA 1KGEA 2ZM2A 1O07A 3WWXA 3RXWA 1YLJA 2IA2A 4EBNA 2EXAA 5JYPA 5F82A 4X1LA 1MXOA 2QMIA 4U0TA 1LSWA 1OTIA 3LI9A 4HQAA 4IJGA 1NYYA 3QNBA 2XH9A 1C3BA 2ZOIA 1YMSA 5A93A 3NJAA 4JPMA 3NCKA 1DP6A 2D02A 4NXFA 4B4XA 1FCOA 3LI8A 1L0DA 2JN7A 1OMEA 1K0KA 2WGIA 1W79A 3G34A 2PHYA 1H8MA 1K54C 1ONHA 3UB5P 2XDMA 4DJ2A 1GSVA 3BM6A 3FWLA 3HLDA 3UE3A 4MDZA 4DE1A 1JTDA 3UO9A 3ITAA 4RX3A 4ZJ2A 3VE3A 3LGOA 4LV1A 1XA1A 1IKGA 2WGWB 3NDGA 1T19A 4WLAA 1RGZA 5F6AA 4B4ZA 4S2MA 4PMAA 3U4LP 1NLZA 2E8JA 3OOVA 5DKLA 2Y8HA 1TD5A 3NOUC 4K08A 4KQQA 4KQOA 1LT0A 4Q0IA 4Y7PA 2HP5A 3NULA 2QZ6A 4PKYG 3ZQ5A 3QP5A 3PBRA 3PBTA 1NY0A 5G4ZA 4U0XA 4EQIA 1T18A 1VQQA 3M2JA 4Y5FA 4LRZE 4BMWA 5FASA 2EFXA 3KX0X 3ZFZA 3Q07A 2VK3A 2ZC3B 4CJNA 5IHVA 4XUXA 1LI9A 3B42A 5FI2A 4HBUA 4EETB 3IH9A 2VGJA 4L9FA 4QU3A 5HARA 3PBQA 1CEFA 2WK0A 3IS2B 4Z9QA 4QD4A 1N9BA 1AXBA 3D72A 5DVAA 2W3EA 5CX7A 2DRWA 1MY8A 1YMXA 4IUHA 3OPHA 2KOIA 2W0NA 3EEHA 2V0WA 2Y2QA 1K55C 5GLBA 2P74A 1YLZA 1T1CA 1H8YA 3TOIA 3VV4A 5DFXA 3NOTC 4JGOA 3FV7A 4LFUA 4IHQA 2V1AA 5CHJA 1H0MA 1MWSA 2J80A 5A90A 2YKFA 2W3FA 3ZDJA 4HNBA 3D4FA 3E2KA 2AVXA 4IBXA 1HZOA 4N1XA 1RGYA 2VGKA 5FQMA 2PDRA 4ZBEA 1YT4A 2PBYA 1YLPA 1E25A 2Z2LB 4UA6A 4G3WA 4YOFA 3U2AA 3E4OA 1ERQA 1DP9A 4JF4A 5E2FA 2NUTC 3IBRA 1K25A 3O87A 4E3JA 3HCYA 5D3OA 1MC0A 3T4TA 5FI7A 5JYOA 1K38A 1J9MA 3CHWP 4Q0JA 3IBJA 3HLEA 3NIAA 2ZD8A 3PBNA 4R4SA 1LSXA 3E0YA 2XRNA 2DNSA 1NRJA 3UB8A 1IYPA 1MWUA 4EU0A 2VJWA 4S2LA 4CPKA 2G7UA 4G3KA 5FEFA 3WS5A 4N1HA 4S2NA 5IT5A 1W7FA 4QWOA 1LSVA 1LLBA 3HL9A 2OWJA 2WAEA 1CQAA 4M3KA 5E2HA 4C3QA 3EEAA 3OPLA 3GDIA 1S6RA 5DTTA 3RFBA 4H8RA 3UPNA 1CK3A 4EWFA 1LHYA 3W4QA 3IS2A 4I3AA 4ZJ1A 5I94A 1F2KA 3NC8A 1UGUA 3A3FA 3Q7ZA 4E3KA 1S66L 3T1RA 4BWIA 4FSFA 4GS9B 1K4EA 1ZHHB 4OPQA 2OOLA 2PT7A 2PD7A 2M1CA 4MNRA 4OPYA 3ZG9B 1BULA 4UHUA 4Y13A 2PRFA 1SKOB 1TVFA 1BT5A 4B88A 4LV0A 3BQAA 3VSLA 5C5KA 1E4DA 4WBGA 3HUOA 3BFFA 4OQHA 1KVMA 4OQGA 2R9XA 4LRXC 3VFHA 3T1QB 4HP9A 3PBOA 5MC7A 4HJ3A 4JF5A 2JCHA 4IUKA 4MBHA 1PWCA 4S2PA 4LPZA 2XROA 1TS6A 3EQUA 2DMWA 2Z6CA 4OKPA 4QB8A 3MFXA 1Y28A 2PAVP 2P9VB 4JBFA 4HJ4A 5AQBA 5L8MA 4HBTA 3G31A 4GB7A 2PU4A 2OLVA 4EXOA 2R78A 3SS4A 2WZZA 3MSHA 1CI8A 3SH9A 3C38A 3B47A 2INWA 3IF6B 2V1ZA 1VEUA 5EE8A 1XFQA 2XFTA 3Q7VB 1L2SA 4Z1WA 1P97A 5FEGA 1M40A 3SH8A 3MR0A 4FCFA 4Y17A 3TSGA 4GNUA 3ZG5A 2QYBA 3VP1A 2LB5A 5EVIB 3OLOA 5AVEA 3IXBA 5E2GA 3LFVA 2A3UA 3IF5A 3PTEA 4X68A 5DKKA 1FR1A 3A3DA 5F5YA 4E3NA 3M6HA 5LBRA 1ALQA 3QP1A 3C7UA 3ULFA 4I38A 4HOIA 3V3RA 1SKOA 5HDSA 4BQMA 1MKIA 5HDCA 3T1SA 2Y2GA 3G2ZA 4ZTKA 4PM7A 3P98A 4UEYA 3MMHA 3M6BA 3F1NB 3C7VA 2VZWA 1PW1A 5CHMA 1XGJA 5FQQA 3RXXA 1I5QA 5E43A 4YFMA 3KYQA 2VV7A 3V50A 5AQAA 1FCNA 2Y2KA 4KG6A 5E2EA 5EPHA 3B33A 4QHCA 1ES2A 3ZYTA 2XLNA 5AQ7A 4JF6A 3SZTA 2HF6A 2Y2HA 3MKEA 2H10A 3GVBA 5DJTA 1E3UA 1D1JA 4WL9A 3A0SA 1SZVA 1G68A 3N8RA 4MN7A 1TDGA 4WEKA 2XFSA 1U60A 3HJIA 1KE4A 5GLAA 3F1OB 1UWPX 5I5LA 3ZCZA 1RP5A 4CQHA 1XKZA 2EX2A 4NEED 3P09A 4PPRA 3Q7VA 5HZHA 1HVBA 3ISGA 2V8CA 4KZAA 2P04A 4R1GA 1WYBA 4BD0A 1H8ZA 4Y2FA 3OCLA 3NOPC 1VETB 4OQIA 1ONGA 5CGWA 3S4XA 4BBTA 3PR6A 1YSPA 2X01A 1K57C 5EVIA 1SHVA 4R3BA 4EEUA 5A92A 5EECA 3KSGA 5EM1A 5BOHA 2HP6A 4DXBA 3BLSA 2P08A 4XXRA 3DWZA 3HLWA 3OPRA 1XA7A 3CLOA 4JXVA 4KENB 2VGLM 4BBVA 4G3VA 5L09A 3EOIA 3VP3A 4DKIA 4GW9A 1WE4A 4QPRA 1EROA 4K91A 3S7NA 4X56A 1HLUP 1F5MA 3N7WA 3CUEA 3F1NA 4RA7A 5TJJA 3SOIA 1FQGA 3C30A 3CI6A 2L1MA 3SS3A 3HREA 3BFDA 1LL8A 3IX4A 2XA7M 2VEAA 3AGEA 3O88A 3UMEA 4IEDA 3NY4A 1Y4OA 4OLGA 5L2FA 3NECA 2GJ3A 1V9YA 4OQ0A 1YSQA 5HAPA 3DTIA 3G35A 4OPRA 5FQIA 4X1MA 3BWLA 2QKPA 1NRFA 4MLLA 4DE2A 3PAEA 4R70A 3T4SA 4UA7A 1G6AA 4MCWA 4KZ3A 3ITBA 4U3TA 1HD8A 3F1OA 4PM8A 3MS6A 4I39A 4X6TA 4F94A 1G6OA 2PU2A 3GECA 3CG5A 2RL3A 1ZC2A 1JVJA 5F69A 4KZ9A 1BLCA 1VETA 3LIAA 2HV1A 1ES5A 3S7PA 1CI9A 3BY8A 3BEBA 3N8SA 1Z6FA 5EOEA 1YKDA 1XJ6A 4Y15A 3R4KA 3BY9A 5DTKA 5TFQA 3LR4A 4KQDA 1WYCA 2WGVA 5FA7A 4H6JB 5TGFA 1PWGA 5HL6A 3MZFA 1PI4A 1VM1A 3MZEA 4Y3IA 5HW3A 4ESPA 2O0YA 1CF0A 1TS7A 3IWOA 2KLIA 5GHZA 4L9EA 1DY6A 4JLFA 4GDBA 5AJGA 3GTCA 2ZM8A 3PBSA 2NUPC 4HH2A 4O0PA 3UB6A 4LENA 1XJ3A 2YKHA 2W1RA 3UMDA 3GQZA 2HP9A 4R4RA 4FH2A 3BRMA 1S1ZA 2Z2MB 2ZMFA 3K3DA 3UDIA 4O7DA 5DF7A 4ID4A 3KO6A 2Y79A 1X0OA 4NETA 1JNUA 3EQVA 1TF1A 3NBLA 2O9AA 3Q1FA 3FYZA 2QPNA 3MQ0A 3OC2A 1BLHA 2W3GA 2X02A 2JE5A 1GA0A 2CC1A 4L9GA 4UQIS 3C5AA 5EVEA 3DAVA 4DN0A 1OT6A 3GRJA 1PZOA 1K6SA 3R7WB 2R9WA 4YWZA 2GX5A 4E3OA 2EX6A 4PM9A 2A49A 1XGIA 4MBFA 1Y54A 4FTXA 2QHKA 2OAQ1 1TEMA 1XJ4A 3AGDA 4GJ4A 1PYYA 2IWDA 4NG2A 2WYXA 5CRFA 3FPWA 3GV9A 1XPBA 4R6LA 3UB7A 2QWSA 4H6JA 4Y0OA 4JKTA 3A0RA 3TE8A 5F1GA 5IS1A 4WMCD 3PHYA 2Y2NA 2P7JA 3OCNA 5FAPA 5F1FA 2H0YA 4NXGA 2E8IA 3LIDA 1XJ2A 4K0XA 4NKPA 3QHYA 5J7EA 1A0KA 4WEJA 1VEUB 5K5BA
chains in the Genus database with same CATH topology
1FCMA 3SH8A 3WRZA 3BYDA 4FCFA 3TSGA 1JWZA 2DCFA 3BFCA 3OZHA 1DJCA 4GNUA 4OLDA 3ZGAB 3I7JA 3ZG5A 3VP1A 4LCLA 4WZ5A 2XF3A 4R3JA 4X55A 3NI9A 2HDRA 5EVIB 3WS0A 4MBKA 2RCXA 3IXBA 4KG5A 2WZXA 5E2GA 2XEPA 3UDXA 4OVDA 3GMWA 2A3UA 4KG2A 3IF5A 3PTEA 4X68A 5CTNA 1BUEA 2EFUA 2X71A 1FR1A 1MWRA 3A3DA 3V39A 4E3NA 3M6HA 1ZG6A 2XR0A 1KGGA 2Y2MA 3VFFA 1ALQA 2IWCA 3C7UA 5FAOA 4NK3A 1MWTA 1SDNA 2B5RA 1PZPA 3V3RA 2JC7A 2ZC5B 1I2SA 3IXDA 1RCJA 3ZHHA 3LEZA 4BQMA 4DDSA 2C5WB 3Q82A 1K57A 3QNCA 3Q81A 1IELA 1MKIA 1XXMA 4DE0A 2Y2OA 5HL1A 5CXWA 3ZG8B 2Y2GA 3E2LA 3G2ZA 3JYIA 4GOGA 4ZTKA 4E3IA 4PM7A 3P98A 1XP4A 3MXSA 4S2JA 3M6BA 3MBZA 3PAGA 5EUAA 4Y0UA 3LY4A 4QY6A 2Y55A 1EWZA 3ZG7B 3TG9A 3C7VA 2ZJ9A 1PI5A 3C4OA 4X69A 1GHMA 1PW1A 4DRTA 1KGEA 2ZM2A 1O07A 5CHMA 1XGJA 5FQQA 3RXXA 3RXWA 3CJMA 5DF9A 1YLJA 3WWXA 3G30A 1I5QA 5E43A 3IWQA 1GCEA 2HDUA 4YFMA 2WKEA 4EBNA 3IH8A 3V50A 5AQAA 1KE3A 3IF6C 1FCNA 2Y2KA 5F83A 4KG6A 5KSCA 2EXAA 2FFFB 5JYPA 5F82A 5E2EA 1MXOA 2QMIA 4U0TA 5EPHA 4ZJ3A 4QHCA 1NYYA 3N8LA 3QNBA 2XH9A 1ES2A 1C3BA 4LV2A 3VP4A 1K56D 1YMSA 1E3UD 3DWKA 2XLNA 3UDFA 5A93A 5AQ7A 4LV3A 4JPMA 3IWIA 4KQRA 4C75A 3IQAA 4JF6A 1FSYA 3RJUA 4E3LA 3NCKA 1ZG4A 3BFEA 2I72A 2Y2HA 3MKEA 2H10A 4FH4A 3CMZA 3M2KA 3GVBA 5M1AA 1E3UA 1JWVA 1FCOA 4B4XA 1K6RA 1L0DA 1Q2QA 5EVIC 1L0EA 1OMEA 1YLTA 4C6YA 4DXCA 2WGIA 1G68A 1W79A 3G34A 3N8RA 4WEKA 1TDGA 2XFSA 5CTMA 1U60A 4JXWA 1NJ4A 3SS5A 1SCWA 4WZ5C 1KE4A 1K54C 5GLAA 4DE3A 3UE1A 1M6KA 2Y2IA 1DJAA 3IHAA 4IVKA 4L0LA 1O7EA 1L0GA 1ONHA 3ZCZA 4S2OA 1RP5A 2XDMA 2JBFA 3N6IA 1XKZA 2EX2A 3BM6A 3ZG0A 4PPRA 3P09A 3FWLA 3Q7VA 1HVBA 3W4OA 2WGWA 3ISGA 4KZAA 3HLDA 4R1GA 1BLSA 3HVFA 2ZQ9A 3UE3A 4DE1A 1WYBA 4BD0A 5CECA 1H8ZA 1JTDA 5AQ9A 3UO9A 3UPPA 3ITAA 1YM1A 4RX3A 4N92A 4ZJ2A 5CGSA 3OCLA 4LV1A 1ERMA 5EVID 1XA1A 1FOFA 4OQIA 1IKGA 1FSWA 2WGWB 4OOYA 3NDGA 1ONGA 1LI0A 1MBLA 5CGWA 3S4XA 1BSGA 4E3MA 1MPLA 4KZBA 1SDEA 1RGZA 2X01A 1K57C 5EVIA 4B4ZA 2XD1A 3CZDA 1SHVA 4S2MA 4R3BA 4S2KA 4PMAA 4X53A 3UNWA 5A92A 5EECA 1K54A 4OOMA 5BOHA 3A3JA 2HP6A 4KQQA 3VOYA 4KQOA 4A5RA 3GSGA 4DXBA 3VP2A 3HUNA 4GDNA 3BLSA 4Y7PA 2HP5A 4XXRA 3DWZA 3HLWA 3OPRA 1JTGA 2OSUA 3HLGA 1XA7A 4JXVA 2J7VA 2QZ6A 4KENB 2C6WB 5EVLA 3UN7A 1Q2PA 2J8YA 4S2IA 3PBRA 3PBTA 1NYMA 1NY0A 4U0XA 3VP0A 1VQQA 3M2JA 4EQIA 3VP3A 4DKIA 2Y2LA 3OPPA 5FASA 2EFXA 4R0QA 5HAQA 3ZFZA 5CEDA 3Q07A 1WE4A 1EROA 2ZC3B 4K91A 4X56A 4CJNA 4OH0A 4ZDXA 5IHVA 1KGFA 3N7WA 4XUXA 1LI9A 4P85A 4RA7A 3FZCA 3SOIA 2WKHA 1HTZA 2EX9A 4HBUA 5FI2A 3V3SA 3N4IA 3IH9A 1FQGA 2VGJA 5CEBA 4QU3A 4DDYA 3SS3A 3HREA 3BFDA 5HARA 4OP5A 3PBQA 1CEFA 3WS4A 3MZDA 2WK0A 5FQKA 5FSRA 4Y0TA 4OONA 4Z9QA 4QD4A 1N9BA 2ZQAA 1AXBA 2XGNA 4N9LA 3AGEA 3O88A 5DVAA 4IEDA 3NY4A 2DRWA 4IVIA 4EV4A 1MY8A 1BZAA 1YMXA 1LL5A 3OPHA 4OLGA 5L2FA 1DJBA 4OQ0A 2Y2QA 4PM6A 1IYSA 5HAPA 1K55C 3G35A 5FQJA 4OPRA 5FQIA 5CERA 2XK1A 5GLBA 2P74A 1YLZA 2G2UA 1H8YA 2ZQCA 1NRFA 4OP8A 4MLLA 4DE2A 3TOIA 3PAEA 3V5MA 4UA7A 2Y2PA 2ZC4B 1G6AA 3FV7A 1K4FA 4KZ3A 3ITBA 5U47A 4U3TA 1HD8A 5FATA 3WS1A 3IXHA 5CHJA 1KE0A 4PM8A 2Y91A 4E6WA 2EXBA 3FKWA 1CEGA 1IYQA 1MWSA 2UWXA 4X6TA 5GLCA 1TDLA 4F94A 5A90A 4K0WA 3ZDJA 2HDQA 4RX2A 3D4FA 3IXGA 1KVLA 3E2KA 2PU2A 4IBXA 4KZ5A 2WUQA 3VOZA 1QMEA 1HZOA 3CG5A 2RL3A 4N1XA 3FKVA 4HEFA 1LL9A 2V2FF 4KZ6A 1RGYA 2VGKA 1ZC2A 4P87A 1JVJA 4S2NC 5FQMA 2BLSA 5TR7A 4KZ9A 4ZBEA 4DF6A 1BLCA 1YT4A 2PBYA 3HUMA 1K55A 1YLPA 1E25A 2Z2LB 4UA6A 5DF8A 1ES5A 5HAIA 1CI9A 1ERQA 4WELA 4JF4A 2HPBA 3G2YA 5E2FA 3BEBA 5J8XA 3N8SA 1K25A 3O87A 4E3JA 5EOOA 1Z6FA 5D3OA 1JWPA 4E6XA 5EOEA 5FI7A 4OOLA 4GKUA 5JYOA 1K38A 2ZQ8A 4YINA 1J9MA 5DTKA 5TFQA 1GHIA 3SH7A 2ZMAA 3HLEA 2ZD8A 3NIAA 3PBNA 4R4SA 5KMWA 5DTSA 1WYCA 2DNSA 4JXSA 1ESIA 2WGVA 5FA7A 5TGFA 2HDSA 1XX2A 1IYPA 1KDWA 1MWUA 4P6BA 4WMCA 4S2LA 3HLFA 1PWGA 5M19A 3LCEA 3ZVTA 4CPKA 3MZFA 3AGFA 1N4OA 3WS5A 1PI4A 1VM1A 4N1HA 4S2NA 1IKIA 3MZEA 2V20A 1W7FA 3G32A 5HW3A 1ES3A 1LLBA 3HL9A 1PIOA 5FDHA 5FAQA 2WAEA 4Q8IA 4GD6A 2Q9NA 4M3KA 2ZM0A 5E2HA 4C3QA 3S1YA 2J9OA 3OPLA 3VSKA 3IWOA 1I2WA 4KZ4A 1DY6A 1S6RA 4R23A 5DTTA 5GHZA 3UE0A 4JLFA 4GDBA 3HLCA 4H8RA 3GTCA 4BLMA 4BL3A 3UPNA 2ZM8A 3WS2A 3A3EA 3PBSA 4BENA 2G2WA 1CK3A 3MFDA 4EWFA 2WKIA 1LHYA 4LENA 3W4QA 5M18A 3W8KA 4ZJ1A 1FR6A 2GDNA 2OLUA 5I94A 1YLWA 3GQZA 2H0TA 1EI5A 5KZHA 3MXRA 4RYEA 2OV5A 3NC8A 2HP9A 3A3FA 1W8QA 1BTLA 3Q7ZA 4R4RA 4E3KA 4FH2A 3BRMA 4HESA 4OPZA 2IWBA 3BFGA 3UPOA 4FSFA 1K4EA 2Z2MB 1BLPA 2ZQ7A 3UDIA 2H5SA 4O7DA 4OPQA 5DF7A 4ID4A 5GL9A 3IT9A 4MNRA 4OPYA 3ZG9B 3C4PA 3WRTA 4NETA 1IEMA 1BULA 3EQVA 4IBRA 4UHUA 3GR2A 1NXYA 3VMAA 3NBLA 4GN2A 5HX9A 1TVFA 1BT5A 3Q1FA 1GHPA 3FYZA 4KZ7A 2QPNA 5CHUA 3OC2A 4B88A 1BLHA 2J9PA 4RVAA 2X02A 2JE5A 3O86A 1GA0A 2CC1A 3S22A 4LV0A 4LCMA 3VSLA 4UAAA 2XQZA 4BJPA 1E4DA 1PW8A 3LO7A 4WBGA 3ZNYA 2Y2JA 4EBPA 2Y4AA 2ZC6B 3C5AA 5CGXA 1KDSA 3G4PA 4QJGA 3HUOA 4WZ4A 1IYOA 3BFFA 4FD8A 4EBLA 2WAFA 1W5DA 1PZOA 3GRJA 1K6SA 1YQSA 3B3XA 1GA9A 3O3VA 1KVMA 4OQHA 4OQGA 4P0MA 3W4PA 2R9XA 3VFHA 2R9WA 3DW0A 1L0FA 4E3OA 2ZC7A 2EX6A 1ZKJA 3LY3A 3PBOA 4PM9A 4JF5A 2A49A 5HFOA 1PWDA 1XGIA 2JCHA 3ZNTA 4MBHA 1YLYA 1PWCA 1Y54A 4MBFA 4S2PA 4QY5A 1K56A 4BD1A 1TEMA 3BECA 1S0WA 2P9VA 3AGDA 3EQUA 4GD8A 1PYYA 3NDEA 2IWDA 4ZAMA 3A3IA 4WM9A 4N9KA 2WYXA 4OKPA 2ZQDA 1NZUA 4BL2A 5CRFA 4QB8A 4KZ8A 4MEZA 3GV9A 2XD5A 1SKFA 2P9VB 1XPBA 4JBFA 4JXGA 5GHYA 5AQBA 5GLDA 5A91A 2Q9MA 4HBTA 4XUZA 3ZVWA 3G31A 4GB7A 2PU4A 1ES4A 2OLVA 4EUZA 1ESUA 4PM5A 4Y0OA 3SS4A 2WZZA 2ZLYA 3IF6A 4JKTA 3UY6A 5F1GA 5KSHA 5FI6A 4WMCD 3HBRA 1CI8A 3SH9A 2WADA 4GZBA 4WYYA 5G18A 2Y2NA 2Y59A 5GHXA 1H5XA 3IF6B 2V1ZA 3OCNA 2FFYA 2EX8A 3DTMA 4UA9A 5EE8A 1W8YA 5FAPA 2H0YA 5F1FA 2E8IA 3MKFA 2XFTA 1NZOA 3Q7VB 4D2OA 1L2SA 2BG1A 3IHBA 4K0XA 3HLBA 1QMFA 5FQ9A 3QHYA 3BLMA 4WEJA 1M40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FCM A;  3SH8 A;  3WRZ A;  3BYD A;  4FCF A;  3TSG A;  1JWZ A;  2DCF A;  3BFC A;  3OZH A;  1DJC A;  4GNU A;  4OLD A;  3ZGA B;  3I7J A;  3ZG5 A;  3VP1 A;  4LCL A;  4WZ5 A;  2XF3 A;  4R3J A;  4X55 A;  3NI9 A;  2HDR A;  5EVI B;  3WS0 A;  4MBK A;  2RCX A;  3IXB A;  4KG5 A;  2WZX A;  5E2G A;  2XEP A;  3UDX A;  4OVD A;  3GMW A;  2A3U A;  4KG2 A;  3IF5 A;  3PTE A;  4X68 A;  5CTN A;  1BUE A;  2EFU A;  2X71 A;  1FR1 A;  1MWR A;  3A3D A;  3V39 A;  4E3N A;  3M6H A;  1ZG6 A;  2XR0 A;  1KGG A;  2Y2M A;  3VFF A;  1ALQ A;  2IWC A;  3C7U A;  5FAO A;  4NK3 A;  1MWT A;  1SDN A;  2B5R A;  1PZP A;  3V3R A;  2JC7 A;  2ZC5 B;  1I2S A;  3IXD A;  1RCJ A;  3ZHH A;  3LEZ A;  4BQM A;  4DDS A;  2C5W B;  3Q82 A;  1K57 A;  3QNC A;  3Q81 A;  1IEL A;  1MKI A;  1XXM A;  4DE0 A;  2Y2O A;  5HL1 A;  5CXW A;  3ZG8 B;  2Y2G A;  3E2L A;  3G2Z A;  3JYI A;  4GOG A;  4ZTK A;  4E3I A;  4PM7 A;  3P98 A;  1XP4 A;  3MXS A;  4S2J A;  3M6B A;  3MBZ A;  3PAG A;  5EUA A;  4Y0U A;  3LY4 A;  4QY6 A;  2Y55 A;  1EWZ A;  3ZG7 B;  3TG9 A;  3C7V A;  2ZJ9 A;  1PI5 A;  3C4O A;  4X69 A;  1GHM A;  1PW1 A;  4DRT A;  1KGE A;  2ZM2 A;  1O07 A;  5CHM A;  1XGJ A;  5FQQ A;  3RXX A;  3RXW A;  3CJM A;  5DF9 A;  1YLJ A;  3WWX A;  3G30 A;  1I5Q A;  5E43 A;  3IWQ A;  1GCE A;  2HDU A;  4YFM A;  2WKE A;  4EBN A;  3IH8 A;  3V50 A;  5AQA A;  1KE3 A;  3IF6 C;  1FCN A;  2Y2K A;  5F83 A;  4KG6 A;  5KSC A;  2EXA A;  2FFF B;  5JYP A;  5F82 A;  5E2E A;  1MXO A;  2QMI A;  4U0T A;  5EPH A;  4ZJ3 A;  4QHC A;  1NYY A;  3N8L A;  3QNB A;  2XH9 A;  1ES2 A;  1C3B A;  4LV2 A;  3VP4 A;  1K56 D;  1YMS A;  1E3U D;  3DWK A;  2XLN A;  3UDF A;  5A93 A;  5AQ7 A;  4LV3 A;  4JPM A;  3IWI A;  4KQR A;  4C75 A;  3IQA A;  4JF6 A;  1FSY A;  3RJU A;  4E3L A;  3NCK A;  1ZG4 A;  3BFE A;  2I72 A;  2Y2H A;  3MKE A;  2H10 A;  4FH4 A;  3CMZ A;  3M2K A;  3GVB A;  5M1A A;  1E3U A;  1JWV A;  1FCO A;  4B4X A;  1K6R A;  1L0D A;  1Q2Q A;  5EVI C;  1L0E A;  1OME A;  1YLT A;  4C6Y A;  4DXC A;  2WGI A;  1G68 A;  1W79 A;  3G34 A;  3N8R A;  4WEK A;  1TDG A;  2XFS A;  5CTM A;  1U60 A;  4JXW A;  1NJ4 A;  3SS5 A;  1SCW A;  4WZ5 C;  1KE4 A;  1K54 C;  5GLA A;  4DE3 A;  3UE1 A;  1M6K A;  2Y2I A;  1DJA A;  3IHA A;  4IVK A;  4L0L A;  1O7E A;  1L0G A;  1ONH A;  3ZCZ A;  4S2O A;  1RP5 A;  2XDM A;  2JBF A;  3N6I A;  1XKZ A;  2EX2 A;  3BM6 A;  3ZG0 A;  4PPR A;  3P09 A;  3FWL A;  3Q7V A;  1HVB A;  3W4O A;  2WGW A;  3ISG A;  4KZA A;  3HLD A;  4R1G A;  1BLS A;  3HVF A;  2ZQ9 A;  3UE3 A;  4DE1 A;  1WYB A;  4BD0 A;  5CEC A;  1H8Z A;  1JTD A;  5AQ9 A;  3UO9 A;  3UPP A;  3ITA A;  1YM1 A;  4RX3 A;  4N92 A;  4ZJ2 A;  5CGS A;  3OCL A;  4LV1 A;  1ERM A;  5EVI D;  1XA1 A;  1FOF A;  4OQI A;  1IKG A;  1FSW A;  2WGW B;  4OOY A;  3NDG A;  1ONG A;  1LI0 A;  1MBL A;  5CGW A;  3S4X A;  1BSG A;  4E3M A;  1MPL A;  4KZB A;  1SDE A;  1RGZ A;  2X01 A;  1K57 C;  5EVI A;  4B4Z A;  2XD1 A;  3CZD A;  1SHV A;  4S2M A;  4R3B A;  4S2K A;  4PMA A;  4X53 A;  3UNW A;  5A92 A;  5EEC A;  1K54 A;  4OOM A;  5BOH A;  3A3J A;  2HP6 A;  4KQQ A;  3VOY A;  4KQO A;  4A5R A;  3GSG A;  4DXB A;  3VP2 A;  3HUN A;  4GDN A;  3BLS A;  4Y7P A;  2HP5 A;  4XXR A;  3DWZ A;  3HLW A;  3OPR A;  1JTG A;  2OSU A;  3HLG A;  1XA7 A;  4JXV A;  2J7V A;  2QZ6 A;  4KEN B;  2C6W B;  5EVL A;  3UN7 A;  1Q2P A;  2J8Y A;  4S2I A;  3PBR A;  3PBT A;  1NYM A;  1NY0 A;  4U0X A;  3VP0 A;  1VQQ A;  3M2J A;  4EQI A;  3VP3 A;  4DKI A;  2Y2L A;  3OPP A;  5FAS A;  2EFX A;  4R0Q A;  5HAQ A;  3ZFZ A;  5CED A;  3Q07 A;  1WE4 A;  1ERO A;  2ZC3 B;  4K91 A;  4X56 A;  4CJN A;  4OH0 A;  4ZDX A;  5IHV A;  1KGF A;  3N7W A;  4XUX A;  1LI9 A;  4P85 A;  4RA7 A;  3FZC A;  3SOI A;  2WKH A;  1HTZ A;  2EX9 A;  4HBU A;  5FI2 A;  3V3S A;  3N4I A;  3IH9 A;  1FQG A;  2VGJ A;  5CEB A;  4QU3 A;  4DDY A;  3SS3 A;  3HRE A;  3BFD A;  5HAR A;  4OP5 A;  3PBQ A;  1CEF A;  3WS4 A;  3MZD A;  2WK0 A;  5FQK A;  5FSR A;  4Y0T A;  4OON A;  4Z9Q A;  4QD4 A;  1N9B A;  2ZQA A;  1AXB A;  2XGN A;  4N9L A;  3AGE A;  3O88 A;  5DVA A;  4IED A;  3NY4 A;  2DRW A;  4IVI A;  4EV4 A;  1MY8 A;  1BZA A;  1YMX A;  1LL5 A;  3OPH A;  4OLG A;  5L2F A;  1DJB A;  4OQ0 A;  2Y2Q A;  4PM6 A;  1IYS A;  5HAP A;  1K55 C;  3G35 A;  5FQJ A;  4OPR A;  5FQI A;  5CER A;  2XK1 A;  5GLB A;  2P74 A;  1YLZ A;  2G2U A;  1H8Y A;  2ZQC A;  1NRF A;  4OP8 A;  4MLL A;  4DE2 A;  3TOI A;  3PAE A;  3V5M A;  4UA7 A;  2Y2P A;  2ZC4 B;  1G6A A;  3FV7 A;  1K4F A;  4KZ3 A;  3ITB A;  5U47 A;  4U3T A;  1HD8 A;  5FAT A;  3WS1 A;  3IXH A;  5CHJ A;  1KE0 A;  4PM8 A;  2Y91 A;  4E6W A;  2EXB A;  3FKW A;  1CEG A;  1IYQ A;  1MWS A;  2UWX A;  4X6T A;  5GLC A;  1TDL A;  4F94 A;  5A90 A;  4K0W A;  3ZDJ A;  2HDQ A;  4RX2 A;  3D4F A;  3IXG A;  1KVL A;  3E2K A;  2PU2 A;  4IBX A;  4KZ5 A;  2WUQ A;  3VOZ A;  1QME A;  1HZO A;  3CG5 A;  2RL3 A;  4N1X A;  3FKV A;  4HEF A;  1LL9 A;  2V2F F;  4KZ6 A;  1RGY A;  2VGK A;  1ZC2 A;  4P87 A;  1JVJ A;  4S2N C;  5FQM A;  2BLS A;  5TR7 A;  4KZ9 A;  4ZBE A;  4DF6 A;  1BLC A;  1YT4 A;  2PBY A;  3HUM A;  1K55 A;  1YLP A;  1E25 A;  2Z2L B;  4UA6 A;  5DF8 A;  1ES5 A;  5HAI A;  1CI9 A;  1ERQ A;  4WEL A;  4JF4 A;  2HPB A;  3G2Y A;  5E2F A;  3BEB A;  5J8X A;  3N8S A;  1K25 A;  3O87 A;  4E3J A;  5EOO A;  1Z6F A;  5D3O A;  1JWP A;  4E6X A;  5EOE A;  5FI7 A;  4OOL A;  4GKU A;  5JYO A;  1K38 A;  2ZQ8 A;  4YIN A;  1J9M A;  5DTK A;  5TFQ A;  1GHI A;  3SH7 A;  2ZMA A;  3HLE A;  2ZD8 A;  3NIA A;  3PBN A;  4R4S A;  5KMW A;  5DTS A;  1WYC A;  2DNS A;  4JXS A;  1ESI A;  2WGV A;  5FA7 A;  5TGF A;  2HDS A;  1XX2 A;  1IYP A;  1KDW A;  1MWU A;  4P6B A;  4WMC A;  4S2L A;  3HLF A;  1PWG A;  5M19 A;  3LCE A;  3ZVT A;  4CPK A;  3MZF A;  3AGF A;  1N4O A;  3WS5 A;  1PI4 A;  1VM1 A;  4N1H A;  4S2N A;  1IKI A;  3MZE A;  2V20 A;  1W7F A;  3G32 A;  5HW3 A;  1ES3 A;  1LLB A;  3HL9 A;  1PIO A;  5FDH A;  5FAQ A;  2WAE A;  4Q8I A;  4GD6 A;  2Q9N A;  4M3K A;  2ZM0 A;  5E2H A;  4C3Q A;  3S1Y A;  2J9O A;  3OPL A;  3VSK A;  3IWO A;  1I2W A;  4KZ4 A;  1DY6 A;  1S6R A;  4R23 A;  5DTT A;  5GHZ A;  3UE0 A;  4JLF A;  4GDB A;  3HLC A;  4H8R A;  3GTC A;  4BLM A;  4BL3 A;  3UPN A;  2ZM8 A;  3WS2 A;  3A3E A;  3PBS A;  4BEN A;  2G2W A;  1CK3 A;  3MFD A;  4EWF A;  2WKI A;  1LHY A;  4LEN A;  3W4Q A;  5M18 A;  3W8K A;  4ZJ1 A;  1FR6 A;  2GDN A;  2OLU A;  5I94 A;  1YLW A;  3GQZ A;  2H0T A;  1EI5 A;  5KZH A;  3MXR A;  4RYE A;  2OV5 A;  3NC8 A;  2HP9 A;  3A3F A;  1W8Q A;  1BTL A;  3Q7Z A;  4R4R A;  4E3K A;  4FH2 A;  3BRM A;  4HES A;  4OPZ A;  2IWB A;  3BFG A;  3UPO A;  4FSF A;  1K4E A;  2Z2M B;  1BLP A;  2ZQ7 A;  3UDI A;  2H5S A;  4O7D A;  4OPQ A;  5DF7 A;  4ID4 A;  5GL9 A;  3IT9 A;  4MNR A;  4OPY A;  3ZG9 B;  3C4P A;  3WRT A;  4NET A;  1IEM A;  1BUL A;  3EQV A;  4IBR A;  4UHU A;  3GR2 A;  1NXY A;  3VMA A;  3NBL A;  4GN2 A;  5HX9 A;  1TVF A;  1BT5 A;  3Q1F A;  1GHP A;  3FYZ A;  4KZ7 A;  2QPN A;  5CHU A;  3OC2 A;  4B88 A;  1BLH A;  2J9P A;  4RVA A;  2X02 A;  2JE5 A;  3O86 A;  1GA0 A;  2CC1 A;  3S22 A;  4LV0 A;  4LCM A;  3VSL A;  4UAA A;  2XQZ A;  4BJP A;  1E4D A;  1PW8 A;  3LO7 A;  4WBG A;  3ZNY A;  2Y2J A;  4EBP A;  2Y4A A;  2ZC6 B;  3C5A A;  5CGX A;  1KDS A;  3G4P A;  4QJG A;  3HUO A;  4WZ4 A;  1IYO A;  3BFF A;  4FD8 A;  4EBL A;  2WAF A;  1W5D A;  1PZO A;  3GRJ A;  1K6S A;  1YQS A;  3B3X A;  1GA9 A;  3O3V A;  1KVM A;  4OQH A;  4OQG A;  4P0M A;  3W4P A;  2R9X A;  3VFH A;  2R9W A;  3DW0 A;  1L0F A;  4E3O A;  2ZC7 A;  2EX6 A;  1ZKJ A;  3LY3 A;  3PBO A;  4PM9 A;  4JF5 A;  2A49 A;  5HFO A;  1PWD A;  1XGI A;  2JCH A;  3ZNT A;  4MBH A;  1YLY A;  1PWC A;  1Y54 A;  4MBF A;  4S2P A;  4QY5 A;  1K56 A;  4BD1 A;  1TEM A;  3BEC A;  1S0W A;  2P9V A;  3AGD A;  3EQU A;  4GD8 A;  1PYY A;  3NDE A;  2IWD A;  4ZAM A;  3A3I A;  4WM9 A;  4N9K A;  2WYX A;  4OKP A;  2ZQD A;  1NZU A;  4BL2 A;  5CRF A;  4QB8 A;  4KZ8 A;  4MEZ A;  3GV9 A;  2XD5 A;  1SKF A;  2P9V B;  1XPB A;  4JBF A;  4JXG A;  5GHY A;  5AQB A;  5GLD A;  5A91 A;  2Q9M A;  4HBT A;  4XUZ A;  3ZVW A;  3G31 A;  4GB7 A;  2PU4 A;  1ES4 A;  2OLV A;  4EUZ A;  1ESU A;  4PM5 A;  4Y0O A;  3SS4 A;  2WZZ A;  2ZLY A;  3IF6 A;  4JKT A;  3UY6 A;  5F1G A;  5KSH A;  5FI6 A;  4WMC D;  3HBR A;  1CI8 A;  3SH9 A;  2WAD A;  4GZB A;  4WYY A;  5G18 A;  2Y2N A;  2Y59 A;  5GHX A;  1H5X A;  3IF6 B;  2V1Z A;  3OCN A;  2FFY A;  2EX8 A;  3DTM A;  4UA9 A;  5EE8 A;  1W8Y A;  5FAP A;  2H0Y A;  5F1F A;  2E8I A;  3MKF A;  2XFT A;  1NZO A;  3Q7V B;  4D2O A;  1L2S A;  2BG1 A;  3IHB A;  4K0X A;  3HLB A;  1QMF A;  5FQ9 A;  3QHY A;  3BLM A;  4WEJ A;  1M40 A; 
#chains in the Genus database with same CATH topology
 1FCM A;  3QP6 A;  3BFC A;  3ZGA B;  1DJC A;  2XF3 A;  4R3J A;  4X55 A;  3NI9 A;  2HDR A;  2K2N A;  3GMW A;  3CPT B;  5CTN A;  4NXE A;  1DP8 A;  1MWR A;  1IOU A;  1KGG A;  3VFF A;  1PNE A;  2IWC A;  2M7V A;  5L10 A;  1MWT A;  1SDN A;  1WA9 A;  1L3L A;  3T12 B;  5F68 A;  3JVV A;  1RCJ A;  3Q82 A;  1W63 M;  1K57 A;  3Q81 A;  1XXM A;  3P7N A;  4DE0 A;  3V67 A;  5CXW A;  2I9V A;  3MF0 A;  2HZ5 A;  2UV0 E;  3MXS A;  4S2J A;  3L7H A;  5EUA A;  4Y0U A;  1YAX A;  3T4L A;  3TG9 A;  4X69 A;  1PRQ A;  4DRT A;  3L9K A;  2L0W A;  4CLC C;  1T1B A;  3R7W A;  3IWQ A;  1GCE A;  1BYW A;  2WKE A;  3IH8 A;  3IX8 A;  1KE3 A;  2VKS A;  5KSC A;  2FFF B;  1F98 A;  2L4R A;  2OWH A;  3N8L A;  4WUJ A;  5HPI A;  1K56 D;  1ODV A;  4LV3 A;  4KQR A;  1VB6 A;  3T4K A;  3IQA A;  4E3L A;  2I72 A;  3QP2 A;  2V9A A;  4FH4 A;  3CMZ A;  3MXQ A;  5M1A A;  1JWV A;  1STZ A;  2BTF P;  1L0E A;  4C6Y A;  4PHT A;  4CLC D;  1FIL A;  4PKY A;  4M4X A;  1OT9 A;  4JXW A;  3SS5 A;  1SCW A;  4P6Z M;  4WZ5 C;  5AVF A;  3T4Q A;  3OBF A;  1M6K A;  2Y2I A;  1DJA A;  3IHA A;  4IVK A;  1O7E A;  2JBF A;  5IU1 A;  3H9W A;  3W4O A;  1BLS A;  5HSQ A;  5AQ9 A;  3UPP A;  3BQ8 A;  1S67 L;  1YM1 A;  4N92 A;  5CGS A;  4OOY A;  1FSW A;  3KYE A;  1D06 A;  1MBL A;  2XD1 A;  3CZD A;  4S2K A;  3DTE A;  3UNW A;  3S7Q A;  3CPT A;  2PR6 A;  1K54 A;  4OOM A;  3A3J A;  1XFN A;  3VE4 A;  3VOY A;  4I5S A;  2O9B A;  3GSG A;  4WN5 A;  3TJZ C;  4GDN A;  2D01 A;  2QJ5 A;  3LR5 A;  3KYZ A;  2J7V A;  2C6W B;  4WF0 A;  5EVL A;  1Q2P A;  2J8Y A;  4S2I A;  1NYM A;  2B95 A;  3VP0 A;  1OPX A;  3OPP A;  5HAQ A;  5CED A;  4E04 A;  4JGR A;  3LEQ A;  1YPR A;  5HPF A;  1CJF A;  1KGF A;  4P85 A;  3FZC A;  1HTZ A;  3EGD C;  3V3S A;  1N9O A;  3LIC A;  3D9Y A;  3C8C A;  1OTB A;  4OP5 A;  5FSR A;  4JGP A;  2ZQA A;  1LL5 A;  1DJB A;  3W2Z A;  4AFI A;  1IYS A;  5FQJ A;  4CLC E;  1P0Z A;  4OP8 A;  1IFQ A;  3V5M A;  2ACG A;  3FG8 A;  4EW7 A;  5J3W A;  2Y91 A;  2EXB A;  3FKW A;  2UWX A;  1TDL A;  4EER A;  3IXG A;  3VOZ A;  1QME A;  3MQQ A;  3H82 B;  3TW8 A;  3FKV A;  4HEF A;  4KZ6 A;  2J3T C;  1T1A A;  3T4J A;  4P87 A;  2LB9 A;  4S2N C;  5TR7 A;  3HUM A;  1K55 A;  5HAI A;  2K7S A;  2HJ9 C;  4WEL A;  2HPB A;  3G2Y A;  5J8X A;  1JWP A;  4E6X A;  4LGW A;  4OOL A;  4GKU A;  4YIN A;  1GHI A;  3SH7 A;  1GSW A;  3A0V A;  3E4Q A;  5DTS A;  2EWW A;  4JXS A;  1ESI A;  1MKM A;  2HJE A;  3F1P A;  2J3T D;  2HDS A;  4P6B A;  2B02 A;  4WMC A;  5M19 A;  3AGF A;  1N4O A;  2ZBB A;  1ES3 A;  4Q8I A;  4GD6 A;  2Q9N A;  4HI4 A;  2ZM0 A;  4ETZ A;  3S1Y A;  2J9O A;  1I2W A;  4KZ4 A;  3UE0 A;  3HLC A;  2H28 A;  1W63 Q;  3WS2 A;  4BEN A;  2G2W A;  1P9R A;  3LR3 A;  3MFD A;  2WKI A;  5M18 A;  3FC7 A;  3W8K A;  2GDN A;  2OLU A;  1YLW A;  2H0T A;  1EI5 A;  5KZH A;  3MXR A;  4RYE A;  2OV5 A;  5L07 A;  1W8Q A;  1BTL A;  4HES A;  2IWB A;  2H5S A;  5GL9 A;  3IT9 A;  5HWW A;  4ME4 A;  2A24 A;  3GR2 A;  1NXY A;  4GN2 A;  2O99 A;  5CHU A;  1GHP A;  3KSH A;  3O86 A;  4BJP A;  1PW8 A;  3LO7 A;  4GHI B;  5DFY A;  4MMN A;  3ZNY A;  2KX6 A;  4EBP A;  2Y4A A;  2ZC6 B;  2FZ0 A;  4WZ4 A;  1IYO A;  3UB9 A;  3BJN A;  4EBL A;  2VV8 A;  4ARZ B;  2WAF A;  3H82 A;  3B3X A;  1TS8 A;  3PYP A;  3LY3 A;  1ZKJ A;  5HFO A;  3LIE A;  2ZOH A;  4XT2 A;  4QY5 A;  1K56 A;  3LYX A;  1S0W A;  2GNX A;  3NDE A;  4HH3 A;  4ZAM A;  1OJG A;  1NZU A;  3LR0 A;  3VOL A;  5TBM A;  4MEZ A;  2CMN A;  2KDK A;  4CLC A;  4XUZ A;  4EUZ A;  1ESU A;  4GCZ A;  2ZLY A;  5FI6 A;  1VHM A;  5G18 A;  4WYY A;  2Y59 A;  1OTA A;  1H5X A;  2EX8 A;  1W8Y A;  4GLQ A;  3MKF A;  1NZO A;  4D2O A;  2BG1 A;  3IHB A;  3HLB A;  4LRY C;  1QMF A;  5FQ9 A;  3BLM A;  2ZMV A;  1ACF A;  1G28 A;  4HIA A;  3WRZ A;  2OAP 1;  2VX8 A;  1EW0 A;  3OZH A;  4OLD A;  3I7J A;  4WZ5 A;  3WS0 A;  4MBK A;  2RCX A;  4KG5 A;  2WZX A;  2XEP A;  2JKR I;  4KG2 A;  2WKR A;  3JVU A;  2BAS A;  3JPU A;  1ZG6 A;  2XR0 A;  5EV0 A;  5FAO A;  4NK3 A;  1PZP A;  2ZC5 B;  1I2S A;  3IXD A;  1TS0 A;  3ZHH A;  3LEZ A;  4DDS A;  3RTY A;  3ZG8 B;  3P01 A;  4GHI A;  1XP4 A;  4O8G A;  4ETX A;  2Y55 A;  3DBA A;  1EWZ A;  2ZJ9 A;  1PI5 A;  1GHM A;  2QJ7 A;  4ARZ A;  3CJM A;  5DF9 A;  3G30 A;  2HDU A;  3FPV A;  5HD3 A;  3IF6 C;  5F83 A;  5EM0 A;  2W3H A;  4UQI M;  4ZJ3 A;  3UE6 A;  5HWV A;  4LV2 A;  3VP4 A;  2PYR A;  1E3U D;  3DWK A;  3UDF A;  1S1Y A;  3IWI A;  4C75 A;  3RJU A;  1FSY A;  1ZG4 A;  3BFE A;  2W27 A;  1Z09 A;  3M2K A;  2PR5 A;  3D3O A;  1K6R A;  1H3Q A;  4LLO B;  3G6O A;  1Q2Q A;  5EVI C;  2ZL1 B;  1YLT A;  2PBD P;  4EES A;  3H7W B;  4DXC A;  5CTM A;  1NJ4 A;  4DE3 A;  3UE1 A;  2W1T B;  1L0G A;  4L0L A;  1OTE A;  2VV6 A;  4S2O A;  1N9L A;  3CWF A;  3N6I A;  3ZG0 A;  2WGW A;  4O01 A;  3HVF A;  2ZQ9 A;  5CEC A;  3EGX C;  2JKG A;  4FOF A;  2MJ6 A;  2V8F A;  1ERM A;  5EVI D;  1FOF A;  2EA9 A;  1LI0 A;  3K2N A;  4HP4 A;  1BSG A;  4E3M A;  1MPL A;  4KZB A;  1SDE A;  4JGQ A;  3CUE C;  2VLG A;  2XSS A;  4X53 A;  3SW1 A;  2VA0 A;  1DRM A;  4DJ3 A;  3O5Y A;  4F3L B;  4A5R A;  3VP2 A;  3HUN A;  4X25 A;  1JTG A;  2OSU A;  3HLG A;  3KSF A;  3UN7 A;  4HY8 A;  2M7U A;  3RH8 B;  1FIK A;  2WKQ A;  4B93 A;  2Y2L A;  4R0Q A;  2JKT I;  5G4Y A;  4OH0 A;  4ZDX A;  3S7O A;  4HHD A;  2WKH A;  2EX9 A;  2FH5 A;  3N4I A;  1N9N A;  5CEB A;  4DDY A;  3WS4 A;  3MZD A;  5FQK A;  4Y0T A;  4OON A;  2W3D A;  2XGN A;  4N9L A;  4IVI A;  4EV4 A;  3BW6 A;  1BZA A;  1F9I A;  3DTK A;  2GZA A;  2WKP A;  3T50 A;  4PM6 A;  3CAX A;  5CER A;  2XK1 A;  3IX3 A;  4Q0H A;  2G2U A;  2ZQC A;  2V1B A;  1D7E A;  2ZL1 A;  3H7W A;  3E98 A;  2Y2P A;  2ZC4 B;  1K4F A;  5U47 A;  2JKR M;  4R38 A;  5FAT A;  3WS1 A;  3IXH A;  4E6W A;  1KE0 A;  2W1T A;  1CEG A;  1IYQ A;  1S4R A;  5GLC A;  4K0W A;  2HDQ A;  1NWZ A;  4RX2 A;  1KVL A;  4KUO A;  2WUQ A;  4KZ5 A;  2K31 A;  1LL9 A;  1UWN X;  2V2F F;  3KSI A;  2BLS A;  4DF6 A;  4P6Z S;  5DF8 A;  4DMZ A;  1OJ5 A;  1OTD A;  5EOO A;  4NXB A;  4MN5 A;  2ZQ8 A;  4I3I A;  4RQ9 A;  2ZMA A;  4ZRR A;  4HJ6 A;  5KMW A;  4F3L A;  3NHQ A;  1XX2 A;  2J3W A;  5HWT A;  1KDW A;  3CIT A;  3HLF A;  3LCE A;  3ZVT A;  3F1P B;  5HD5 A;  1IKI A;  2V20 A;  3G32 A;  3QP4 A;  1ZTU A;  3E4P A;  2A2L A;  1PIO A;  5FDH A;  5FAQ A;  5A8B A;  3TRC A;  4FUW A;  3VSK A;  3HJK A;  4R23 A;  3ICY A;  1P9W A;  4BLM A;  4BL3 A;  3A3E A;  3T4O A;  1J3W A;  1FR6 A;  5FDS A;  4GS9 A;  3LUQ A;  3QP8 A;  4OPZ A;  1KOU A;  2Z6D A;  3BFG A;  3T1X A;  3UPO A;  2ZQ7 A;  1BLP A;  3C4P A;  3WRT A;  1IEM A;  4IBR A;  2Q0O A;  3VMA A;  5HX9 A;  1PFL A;  4D60 A;  4KZ7 A;  4RVA A;  2J9P A;  2A24 B;  3S22 A;  4LCM A;  4UAA A;  2XQZ A;  4II7 A;  4YNR A;  5FL3 A;  2Y2J A;  5CGX A;  1KDS A;  3G4P A;  4QJG A;  3MQO A;  1G5U A;  4FD8 A;  1W5D A;  1YQS A;  3O3V A;  1GA9 A;  3W4P A;  4P0M A;  3DW0 A;  1L0F A;  2B18 A;  2ZC7 A;  1PWD A;  3ZNT A;  4KUK A;  1YLY A;  1GSX A;  2JKT M;  4BD1 A;  4I3J A;  3BEC A;  3EWK A;  2P9V A;  4GD8 A;  4MN6 A;  4EQ1 A;  3A3I A;  4WM9 A;  4XT2 B;  5EFW A;  4N9K A;  3LIB A;  2O9C A;  2ZQD A;  4BL2 A;  1AWI A;  3PXP A;  4KZ8 A;  2XD5 A;  1SKF A;  4JXG A;  5GHY A;  5GLD A;  5A91 A;  2Q9M A;  3ZVW A;  2PD8 A;  4EEP A;  1ES4 A;  4BBU A;  4PM5 A;  2V0U A;  4B9O A;  5TBM B;  3IF6 A;  3UY6 A;  5KSH A;  4CLC B;  3HBR A;  2WAD A;  4GZB A;  5GHX A;  1NLY A;  5DJU A;  2FFY A;  3DTM A;  4UA9 A;  2JHE A;  2EWV A;  5KIZ A;  2JKF A;  3LIF A;  3C2W A;  3BYD A;  1JWZ A;  2DCF A;  4LCL A;  3UDX A;  4OVD A;  2VGL S;  1V9Z A;  1BUE A;  2EFU A;  2X71 A;  5J4E A;  3V39 A;  2Y2M A;  1MZU A;  2B5R A;  2JC7 A;  4EUV A;  2HGV A;  2C5W B;  3QNC A;  1IEL A;  3K3C A;  2Y2O A;  5HL1 A;  3E2L A;  3JYI A;  4GOG A;  4R3A A;  4E3I A;  2PYP A;  2XA7 S;  3MBZ A;  3PAG A;  3LY4 A;  4PAU A;  4QY6 A;  3MJQ A;  3ZG7 B;  5HDD A;  3C4O A;  1S4S A;  1KGE A;  2ZM2 A;  1O07 A;  3WWX A;  3RXW A;  1YLJ A;  2IA2 A;  4EBN A;  2EXA A;  5JYP A;  5F82 A;  4X1L A;  1MXO A;  2QMI A;  4U0T A;  1LSW A;  1OTI A;  3LI9 A;  4HQA A;  4IJG A;  1NYY A;  3QNB A;  2XH9 A;  1C3B A;  2ZOI A;  1YMS A;  5A93 A;  3NJA A;  4JPM A;  3NCK A;  1DP6 A;  2D02 A;  4NXF A;  4B4X A;  1FCO A;  3LI8 A;  1L0D A;  2JN7 A;  1OME A;  1K0K A;  2WGI A;  1W79 A;  3G34 A;  2PHY A;  1H8M A;  1K54 C;  1ONH A;  3UB5 P;  2XDM A;  4DJ2 A;  1GSV A;  3BM6 A;  3FWL A;  3HLD A;  3UE3 A;  4MDZ A;  4DE1 A;  1JTD A;  3UO9 A;  3ITA A;  4RX3 A;  4ZJ2 A;  3VE3 A;  3LGO A;  4LV1 A;  1XA1 A;  1IKG A;  2WGW B;  3NDG A;  1T19 A;  4WLA A;  1RGZ A;  5F6A A;  4B4Z A;  4S2M A;  4PMA A;  3U4L P;  1NLZ A;  2E8J A;  3OOV A;  5DKL A;  2Y8H A;  1TD5 A;  3NOU C;  4K08 A;  4KQQ A;  4KQO A;  1LT0 A;  4Q0I A;  4Y7P A;  2HP5 A;  3NUL A;  2QZ6 A;  4PKY G;  3ZQ5 A;  3QP5 A;  3PBR A;  3PBT A;  1NY0 A;  5G4Z A;  4U0X A;  4EQI A;  1T18 A;  1VQQ A;  3M2J A;  4Y5F A;  4LRZ E;  4BMW A;  5FAS A;  2EFX A;  3KX0 X;  3ZFZ A;  3Q07 A;  2VK3 A;  2ZC3 B;  4CJN A;  5IHV A;  4XUX A;  1LI9 A;  3B42 A;  5FI2 A;  4HBU A;  4EET B;  3IH9 A;  2VGJ A;  4L9F A;  4QU3 A;  5HAR A;  3PBQ A;  1CEF A;  2WK0 A;  3IS2 B;  4Z9Q A;  4QD4 A;  1N9B A;  1AXB A;  3D72 A;  5DVA A;  2W3E A;  5CX7 A;  2DRW A;  1MY8 A;  1YMX A;  4IUH A;  3OPH A;  2KOI A;  2W0N A;  3EEH A;  2V0W A;  2Y2Q A;  1K55 C;  5GLB A;  2P74 A;  1YLZ A;  1T1C A;  1H8Y A;  3TOI A;  3VV4 A;  5DFX A;  3NOT C;  4JGO A;  3FV7 A;  4LFU A;  4IHQ A;  2V1A A;  5CHJ A;  1H0M A;  1MWS A;  2J80 A;  5A90 A;  2YKF A;  2W3F A;  3ZDJ A;  4HNB A;  3D4F A;  3E2K A;  2AVX A;  4IBX A;  1HZO A;  4N1X A;  1RGY A;  2VGK A;  5FQM A;  2PDR A;  4ZBE A;  1YT4 A;  2PBY A;  1YLP A;  1E25 A;  2Z2L B;  4UA6 A;  4G3W A;  4YOF A;  3U2A A;  3E4O A;  1ERQ A;  1DP9 A;  4JF4 A;  5E2F A;  2NUT C;  3IBR A;  1K25 A;  3O87 A;  4E3J A;  3HCY A;  5D3O A;  1MC0 A;  3T4T A;  5FI7 A;  5JYO A;  1K38 A;  1J9M A;  3CHW P;  4Q0J A;  3IBJ A;  3HLE A;  3NIA A;  2ZD8 A;  3PBN A;  4R4S A;  1LSX A;  3E0Y A;  2XRN A;  2DNS A;  1NRJ A;  3UB8 A;  1IYP A;  1MWU A;  4EU0 A;  2VJW A;  4S2L A;  4CPK A;  2G7U A;  4G3K A;  5FEF A;  3WS5 A;  4N1H A;  4S2N A;  5IT5 A;  1W7F A;  4QWO A;  1LSV A;  1LLB A;  3HL9 A;  2OWJ A;  2WAE A;  1CQA A;  4M3K A;  5E2H A;  4C3Q A;  3EEA A;  3OPL A;  3GDI A;  1S6R A;  5DTT A;  3RFB A;  4H8R A;  3UPN A;  1CK3 A;  4EWF A;  1LHY A;  3W4Q A;  3IS2 A;  4I3A A;  4ZJ1 A;  5I94 A;  1F2K A;  3NC8 A;  1UGU A;  3A3F A;  3Q7Z A;  4E3K A;  1S66 L;  3T1R A;  4BWI A;  4FSF A;  4GS9 B;  1K4E A;  1ZHH B;  4OPQ A;  2OOL A;  2PT7 A;  2PD7 A;  2M1C A;  4MNR A;  4OPY A;  3ZG9 B;  1BUL A;  4UHU A;  4Y13 A;  2PRF A;  1SKO B;  1TVF A;  1BT5 A;  4B88 A;  4LV0 A;  3BQA A;  3VSL A;  5C5K A;  1E4D A;  4WBG A;  3HUO A;  3BFF A;  4OQH A;  1KVM A;  4OQG A;  2R9X A;  4LRX C;  3VFH A;  3T1Q B;  4HP9 A;  3PBO A;  5MC7 A;  4HJ3 A;  4JF5 A;  2JCH A;  4IUK A;  4MBH A;  1PWC A;  4S2P A;  4LPZ A;  2XRO A;  1TS6 A;  3EQU A;  2DMW A;  2Z6C A;  4OKP A;  4QB8 A;  3MFX A;  1Y28 A;  2PAV P;  2P9V B;  4JBF A;  4HJ4 A;  5AQB A;  5L8M A;  4HBT A;  3G31 A;  4GB7 A;  2PU4 A;  2OLV A;  4EXO A;  2R78 A;  3SS4 A;  2WZZ A;  3MSH A;  1CI8 A;  3SH9 A;  3C38 A;  3B47 A;  2INW A;  3IF6 B;  2V1Z A;  1VEU A;  5EE8 A;  1XFQ A;  2XFT A;  3Q7V B;  1L2S A;  4Z1W A;  1P97 A;  5FEG A;  1M40 A;  3SH8 A;  3MR0 A;  4FCF A;  4Y17 A;  3TSG A;  4GNU A;  3ZG5 A;  2QYB A;  3VP1 A;  2LB5 A;  5EVI B;  3OLO A;  5AVE A;  3IXB A;  5E2G A;  3LFV A;  2A3U A;  3IF5 A;  3PTE A;  4X68 A;  5DKK A;  1FR1 A;  3A3D A;  5F5Y A;  4E3N A;  3M6H A;  5LBR A;  1ALQ A;  3QP1 A;  3C7U A;  3ULF A;  4I38 A;  4HOI A;  3V3R A;  1SKO A;  5HDS A;  4BQM A;  1MKI A;  5HDC A;  3T1S A;  2Y2G A;  3G2Z A;  4ZTK A;  4PM7 A;  3P98 A;  4UEY A;  3MMH A;  3M6B A;  3F1N B;  3C7V A;  2VZW A;  1PW1 A;  5CHM A;  1XGJ A;  5FQQ A;  3RXX A;  1I5Q A;  5E43 A;  4YFM A;  3KYQ A;  2VV7 A;  3V50 A;  5AQA A;  1FCN A;  2Y2K A;  4KG6 A;  5E2E A;  5EPH A;  3B33 A;  4QHC A;  1ES2 A;  3ZYT A;  2XLN A;  5AQ7 A;  4JF6 A;  3SZT A;  2HF6 A;  2Y2H A;  3MKE A;  2H10 A;  3GVB A;  5DJT A;  1E3U A;  1D1J A;  4WL9 A;  3A0S A;  1SZV A;  1G68 A;  3N8R A;  4MN7 A;  1TDG A;  4WEK A;  2XFS A;  1U60 A;  3HJI A;  1KE4 A;  5GLA A;  3F1O B;  1UWP X;  5I5L A;  3ZCZ A;  1RP5 A;  4CQH A;  1XKZ A;  2EX2 A;  4NEE D;  3P09 A;  4PPR A;  3Q7V A;  5HZH A;  1HVB A;  3ISG A;  2V8C A;  4KZA A;  2P04 A;  4R1G A;  1WYB A;  4BD0 A;  1H8Z A;  4Y2F A;  3OCL A;  3NOP C;  1VET B;  4OQI A;  1ONG A;  5CGW A;  3S4X A;  4BBT A;  3PR6 A;  1YSP A;  2X01 A;  1K57 C;  5EVI A;  1SHV A;  4R3B A;  4EEU A;  5A92 A;  5EEC A;  3KSG A;  5EM1 A;  5BOH A;  2HP6 A;  4DXB A;  3BLS A;  2P08 A;  4XXR A;  3DWZ A;  3HLW A;  3OPR A;  1XA7 A;  3CLO A;  4JXV A;  4KEN B;  2VGL M;  4BBV A;  4G3V A;  5L09 A;  3EOI A;  3VP3 A;  4DKI A;  4GW9 A;  1WE4 A;  4QPR A;  1ERO A;  4K91 A;  3S7N A;  4X56 A;  1HLU P;  1F5M A;  3N7W A;  3CUE A;  3F1N A;  4RA7 A;  5TJJ A;  3SOI A;  1FQG A;  3C30 A;  3CI6 A;  2L1M A;  3SS3 A;  3HRE A;  3BFD A;  1LL8 A;  3IX4 A;  2XA7 M;  2VEA A;  3AGE A;  3O88 A;  3UME A;  4IED A;  3NY4 A;  1Y4O A;  4OLG A;  5L2F A;  3NEC A;  2GJ3 A;  1V9Y A;  4OQ0 A;  1YSQ A;  5HAP A;  3DTI A;  3G35 A;  4OPR A;  5FQI A;  4X1M A;  3BWL A;  2QKP A;  1NRF A;  4MLL A;  4DE2 A;  3PAE A;  4R70 A;  3T4S A;  4UA7 A;  1G6A A;  4MCW A;  4KZ3 A;  3ITB A;  4U3T A;  1HD8 A;  3F1O A;  4PM8 A;  3MS6 A;  4I39 A;  4X6T A;  4F94 A;  1G6O A;  2PU2 A;  3GEC A;  3CG5 A;  2RL3 A;  1ZC2 A;  1JVJ A;  5F69 A;  4KZ9 A;  1BLC A;  1VET A;  3LIA A;  2HV1 A;  1ES5 A;  3S7P A;  1CI9 A;  3BY8 A;  3BEB A;  3N8S A;  1Z6F A;  5EOE A;  1YKD A;  1XJ6 A;  4Y15 A;  3R4K A;  3BY9 A;  5DTK A;  5TFQ A;  3LR4 A;  4KQD A;  1WYC A;  2WGV A;  5FA7 A;  4H6J B;  5TGF A;  1PWG A;  5HL6 A;  3MZF A;  1PI4 A;  1VM1 A;  3MZE A;  4Y3I A;  5HW3 A;  4ESP A;  2O0Y A;  1CF0 A;  1TS7 A;  3IWO A;  2KLI A;  5GHZ A;  4L9E A;  1DY6 A;  4JLF A;  4GDB A;  5AJG A;  3GTC A;  2ZM8 A;  3PBS A;  2NUP C;  4HH2 A;  4O0P A;  3UB6 A;  4LEN A;  1XJ3 A;  2YKH A;  2W1R A;  3UMD A;  3GQZ A;  2HP9 A;  4R4R A;  4FH2 A;  3BRM A;  1S1Z A;  2Z2M B;  2ZMF A;  3K3D A;  3UDI A;  4O7D A;  5DF7 A;  4ID4 A;  3KO6 A;  2Y79 A;  1X0O A;  4NET A;  1JNU A;  3EQV A;  1TF1 A;  3NBL A;  2O9A A;  3Q1F A;  3FYZ A;  2QPN A;  3MQ0 A;  3OC2 A;  1BLH A;  2W3G A;  2X02 A;  2JE5 A;  1GA0 A;  2CC1 A;  4L9G A;  4UQI S;  3C5A A;  5EVE A;  3DAV A;  4DN0 A;  1OT6 A;  3GRJ A;  1PZO A;  1K6S A;  3R7W B;  2R9W A;  4YWZ A;  2GX5 A;  4E3O A;  2EX6 A;  4PM9 A;  2A49 A;  1XGI A;  4MBF A;  1Y54 A;  4FTX A;  2QHK A;  2OAQ 1;  1TEM A;  1XJ4 A;  3AGD A;  4GJ4 A;  1PYY A;  2IWD A;  4NG2 A;  2WYX A;  5CRF A;  3FPW A;  3GV9 A;  1XPB A;  4R6L A;  3UB7 A;  2QWS A;  4H6J A;  4Y0O A;  4JKT A;  3A0R A;  3TE8 A;  5F1G A;  5IS1 A;  4WMC D;  3PHY A;  2Y2N A;  2P7J A;  3OCN A;  5FAP A;  5F1F A;  2H0Y A;  4NXG A;  2E8I A;  3LID A;  1XJ2 A;  4K0X A;  4NKP A;  3QHY A;  5J7E A;  1A0K A;  4WEJ A;  1VEU B;  5K5B A; 
#chains in the Genus database with same CATH homology
 1FCM A;  3SH8 A;  3WRZ A;  3BYD A;  4FCF A;  3TSG A;  1JWZ A;  2DCF A;  3BFC A;  3OZH A;  1DJC A;  4GNU A;  4OLD A;  3ZGA B;  3I7J A;  3ZG5 A;  3VP1 A;  4LCL A;  4WZ5 A;  2XF3 A;  4R3J A;  4X55 A;  3NI9 A;  2HDR A;  5EVI B;  3WS0 A;  4MBK A;  2RCX A;  3IXB A;  4KG5 A;  2WZX A;  5E2G A;  2XEP A;  3UDX A;  4OVD A;  3GMW A;  2A3U A;  4KG2 A;  3IF5 A;  3PTE A;  4X68 A;  5CTN A;  1BUE A;  2EFU A;  2X71 A;  1FR1 A;  1MWR A;  3A3D A;  3V39 A;  4E3N A;  3M6H A;  1ZG6 A;  2XR0 A;  1KGG A;  2Y2M A;  3VFF A;  1ALQ A;  2IWC A;  3C7U A;  5FAO A;  4NK3 A;  1MWT A;  1SDN A;  2B5R A;  1PZP A;  3V3R A;  2JC7 A;  2ZC5 B;  1I2S A;  3IXD A;  1RCJ A;  3ZHH A;  3LEZ A;  4BQM A;  4DDS A;  2C5W B;  3Q82 A;  1K57 A;  3QNC A;  3Q81 A;  1IEL A;  1MKI A;  1XXM A;  4DE0 A;  2Y2O A;  5HL1 A;  5CXW A;  3ZG8 B;  2Y2G A;  3E2L A;  3G2Z A;  3JYI A;  4GOG A;  4ZTK A;  4E3I A;  4PM7 A;  3P98 A;  1XP4 A;  3MXS A;  4S2J A;  3M6B A;  3MBZ A;  3PAG A;  5EUA A;  4Y0U A;  3LY4 A;  4QY6 A;  2Y55 A;  1EWZ A;  3ZG7 B;  3TG9 A;  3C7V A;  2ZJ9 A;  1PI5 A;  3C4O A;  4X69 A;  1GHM A;  1PW1 A;  4DRT A;  1KGE A;  2ZM2 A;  1O07 A;  5CHM A;  1XGJ A;  5FQQ A;  3RXX A;  3RXW A;  3CJM A;  5DF9 A;  1YLJ A;  3WWX A;  3G30 A;  1I5Q A;  5E43 A;  3IWQ A;  1GCE A;  2HDU A;  4YFM A;  2WKE A;  4EBN A;  3IH8 A;  3V50 A;  5AQA A;  1KE3 A;  3IF6 C;  1FCN A;  2Y2K A;  5F83 A;  4KG6 A;  5KSC A;  2EXA A;  2FFF B;  5JYP A;  5F82 A;  5E2E A;  1MXO A;  2QMI A;  4U0T A;  5EPH A;  4ZJ3 A;  4QHC A;  1NYY A;  3N8L A;  3QNB A;  2XH9 A;  1ES2 A;  1C3B A;  4LV2 A;  3VP4 A;  1K56 D;  1YMS A;  1E3U D;  3DWK A;  2XLN A;  3UDF A;  5A93 A;  5AQ7 A;  4LV3 A;  4JPM A;  3IWI A;  4KQR A;  4C75 A;  3IQA A;  4JF6 A;  1FSY A;  3RJU A;  4E3L A;  3NCK A;  1ZG4 A;  3BFE A;  2I72 A;  2Y2H A;  3MKE A;  2H10 A;  4FH4 A;  3CMZ A;  3M2K A;  3GVB A;  5M1A A;  1E3U A;  1JWV A;  1FCO A;  4B4X A;  1K6R A;  1L0D A;  1Q2Q A;  5EVI C;  1L0E A;  1OME A;  1YLT A;  4C6Y A;  4DXC A;  2WGI A;  1G68 A;  1W79 A;  3G34 A;  3N8R A;  4WEK A;  1TDG A;  2XFS A;  5CTM A;  1U60 A;  4JXW A;  1NJ4 A;  3SS5 A;  1SCW A;  4WZ5 C;  1KE4 A;  1K54 C;  5GLA A;  4DE3 A;  3UE1 A;  1M6K A;  2Y2I A;  1DJA A;  3IHA A;  4IVK A;  4L0L A;  1O7E A;  1L0G A;  1ONH A;  3ZCZ A;  4S2O A;  1RP5 A;  2XDM A;  2JBF A;  3N6I A;  1XKZ A;  2EX2 A;  3BM6 A;  3ZG0 A;  4PPR A;  3P09 A;  3FWL A;  3Q7V A;  1HVB A;  3W4O A;  2WGW A;  3ISG A;  4KZA A;  3HLD A;  4R1G A;  1BLS A;  3HVF A;  2ZQ9 A;  3UE3 A;  4DE1 A;  1WYB A;  4BD0 A;  5CEC A;  1H8Z A;  1JTD A;  5AQ9 A;  3UO9 A;  3UPP A;  3ITA A;  1YM1 A;  4RX3 A;  4N92 A;  4ZJ2 A;  5CGS A;  3OCL A;  4LV1 A;  1ERM A;  5EVI D;  1XA1 A;  1FOF A;  4OQI A;  1IKG A;  1FSW A;  2WGW B;  4OOY A;  3NDG A;  1ONG A;  1LI0 A;  1MBL A;  5CGW A;  3S4X A;  1BSG A;  4E3M A;  1MPL A;  4KZB A;  1SDE A;  1RGZ A;  2X01 A;  1K57 C;  5EVI A;  4B4Z A;  2XD1 A;  3CZD A;  1SHV A;  4S2M A;  4R3B A;  4S2K A;  4PMA A;  4X53 A;  3UNW A;  5A92 A;  5EEC A;  1K54 A;  4OOM A;  5BOH A;  3A3J A;  2HP6 A;  4KQQ A;  3VOY A;  4KQO A;  4A5R A;  3GSG A;  4DXB A;  3VP2 A;  3HUN A;  4GDN A;  3BLS A;  4Y7P A;  2HP5 A;  4XXR A;  3DWZ A;  3HLW A;  3OPR A;  1JTG A;  2OSU A;  3HLG A;  1XA7 A;  4JXV A;  2J7V A;  2QZ6 A;  4KEN B;  2C6W B;  5EVL A;  3UN7 A;  1Q2P A;  2J8Y A;  4S2I A;  3PBR A;  3PBT A;  1NYM A;  1NY0 A;  4U0X A;  3VP0 A;  1VQQ A;  3M2J A;  4EQI A;  3VP3 A;  4DKI A;  2Y2L A;  3OPP A;  5FAS A;  2EFX A;  4R0Q A;  5HAQ A;  3ZFZ A;  5CED A;  3Q07 A;  1WE4 A;  1ERO A;  2ZC3 B;  4K91 A;  4X56 A;  4CJN A;  4OH0 A;  4ZDX A;  5IHV A;  1KGF A;  3N7W A;  4XUX A;  1LI9 A;  4P85 A;  4RA7 A;  3FZC A;  3SOI A;  2WKH A;  1HTZ A;  2EX9 A;  4HBU A;  5FI2 A;  3V3S A;  3N4I A;  3IH9 A;  1FQG A;  2VGJ A;  5CEB A;  4QU3 A;  4DDY A;  3SS3 A;  3HRE A;  3BFD A;  5HAR A;  4OP5 A;  3PBQ A;  1CEF A;  3WS4 A;  3MZD A;  2WK0 A;  5FQK A;  5FSR A;  4Y0T A;  4OON A;  4Z9Q A;  4QD4 A;  1N9B A;  2ZQA A;  1AXB A;  2XGN A;  4N9L A;  3AGE A;  3O88 A;  5DVA A;  4IED A;  3NY4 A;  2DRW A;  4IVI A;  4EV4 A;  1MY8 A;  1BZA A;  1YMX A;  1LL5 A;  3OPH A;  4OLG A;  5L2F A;  1DJB A;  4OQ0 A;  2Y2Q A;  4PM6 A;  1IYS A;  5HAP A;  1K55 C;  3G35 A;  5FQJ A;  4OPR A;  5FQI A;  5CER A;  2XK1 A;  5GLB A;  2P74 A;  1YLZ A;  2G2U A;  1H8Y A;  2ZQC A;  1NRF A;  4OP8 A;  4MLL A;  4DE2 A;  3TOI A;  3PAE A;  3V5M A;  4UA7 A;  2Y2P A;  2ZC4 B;  1G6A A;  3FV7 A;  1K4F A;  4KZ3 A;  3ITB A;  5U47 A;  4U3T A;  1HD8 A;  5FAT A;  3WS1 A;  3IXH A;  5CHJ A;  1KE0 A;  4PM8 A;  2Y91 A;  4E6W A;  2EXB A;  3FKW A;  1CEG A;  1IYQ A;  1MWS A;  2UWX A;  4X6T A;  5GLC A;  1TDL A;  4F94 A;  5A90 A;  4K0W A;  3ZDJ A;  2HDQ A;  4RX2 A;  3D4F A;  3IXG A;  1KVL A;  3E2K A;  2PU2 A;  4IBX A;  4KZ5 A;  2WUQ A;  3VOZ A;  1QME A;  1HZO A;  3CG5 A;  2RL3 A;  4N1X A;  3FKV A;  4HEF A;  1LL9 A;  2V2F F;  4KZ6 A;  1RGY A;  2VGK A;  1ZC2 A;  4P87 A;  1JVJ A;  4S2N C;  5FQM A;  2BLS A;  5TR7 A;  4KZ9 A;  4ZBE A;  4DF6 A;  1BLC A;  1YT4 A;  2PBY A;  3HUM A;  1K55 A;  1YLP A;  1E25 A;  2Z2L B;  4UA6 A;  5DF8 A;  1ES5 A;  5HAI A;  1CI9 A;  1ERQ A;  4WEL A;  4JF4 A;  2HPB A;  3G2Y A;  5E2F A;  3BEB A;  5J8X A;  3N8S A;  1K25 A;  3O87 A;  4E3J A;  5EOO A;  1Z6F A;  5D3O A;  1JWP A;  4E6X A;  5EOE A;  5FI7 A;  4OOL A;  4GKU A;  5JYO A;  1K38 A;  2ZQ8 A;  4YIN A;  1J9M A;  5DTK A;  5TFQ A;  1GHI A;  3SH7 A;  2ZMA A;  3HLE A;  2ZD8 A;  3NIA A;  3PBN A;  4R4S A;  5KMW A;  5DTS A;  1WYC A;  2DNS A;  4JXS A;  1ESI A;  2WGV A;  5FA7 A;  5TGF A;  2HDS A;  1XX2 A;  1IYP A;  1KDW A;  1MWU A;  4P6B A;  4WMC A;  4S2L A;  3HLF A;  1PWG A;  5M19 A;  3LCE A;  3ZVT A;  4CPK A;  3MZF A;  3AGF A;  1N4O A;  3WS5 A;  1PI4 A;  1VM1 A;  4N1H A;  4S2N A;  1IKI A;  3MZE A;  2V20 A;  1W7F A;  3G32 A;  5HW3 A;  1ES3 A;  1LLB A;  3HL9 A;  1PIO A;  5FDH A;  5FAQ A;  2WAE A;  4Q8I A;  4GD6 A;  2Q9N A;  4M3K A;  2ZM0 A;  5E2H A;  4C3Q A;  3S1Y A;  2J9O A;  3OPL A;  3VSK A;  3IWO A;  1I2W A;  4KZ4 A;  1DY6 A;  1S6R A;  4R23 A;  5DTT A;  5GHZ A;  3UE0 A;  4JLF A;  4GDB A;  3HLC A;  4H8R A;  3GTC A;  4BLM A;  4BL3 A;  3UPN A;  2ZM8 A;  3WS2 A;  3A3E A;  3PBS A;  4BEN A;  2G2W A;  1CK3 A;  3MFD A;  4EWF A;  2WKI A;  1LHY A;  4LEN A;  3W4Q A;  5M18 A;  3W8K A;  4ZJ1 A;  1FR6 A;  2GDN A;  2OLU A;  5I94 A;  1YLW A;  3GQZ A;  2H0T A;  1EI5 A;  5KZH A;  3MXR A;  4RYE A;  2OV5 A;  3NC8 A;  2HP9 A;  3A3F A;  1W8Q A;  1BTL A;  3Q7Z A;  4R4R A;  4E3K A;  4FH2 A;  3BRM A;  4HES A;  4OPZ A;  2IWB A;  3BFG A;  3UPO A;  4FSF A;  1K4E A;  2Z2M B;  1BLP A;  2ZQ7 A;  3UDI A;  2H5S A;  4O7D A;  4OPQ A;  5DF7 A;  4ID4 A;  5GL9 A;  3IT9 A;  4MNR A;  4OPY A;  3ZG9 B;  3C4P A;  3WRT A;  4NET A;  1IEM A;  1BUL A;  3EQV A;  4IBR A;  4UHU A;  3GR2 A;  1NXY A;  3VMA A;  3NBL A;  4GN2 A;  5HX9 A;  1TVF A;  1BT5 A;  3Q1F A;  1GHP A;  3FYZ A;  4KZ7 A;  2QPN A;  5CHU A;  3OC2 A;  4B88 A;  1BLH A;  2J9P A;  4RVA A;  2X02 A;  2JE5 A;  3O86 A;  1GA0 A;  2CC1 A;  3S22 A;  4LV0 A;  4LCM A;  3VSL A;  4UAA A;  2XQZ A;  4BJP A;  1E4D A;  1PW8 A;  3LO7 A;  4WBG A;  3ZNY A;  2Y2J A;  4EBP A;  2Y4A A;  2ZC6 B;  3C5A A;  5CGX A;  1KDS A;  3G4P A;  4QJG A;  3HUO A;  4WZ4 A;  1IYO A;  3BFF A;  4FD8 A;  4EBL A;  2WAF A;  1W5D A;  1PZO A;  3GRJ A;  1K6S A;  1YQS A;  3B3X A;  1GA9 A;  3O3V A;  1KVM A;  4OQH A;  4OQG A;  4P0M A;  3W4P A;  2R9X A;  3VFH A;  2R9W A;  3DW0 A;  1L0F A;  4E3O A;  2ZC7 A;  2EX6 A;  1ZKJ A;  3LY3 A;  3PBO A;  4PM9 A;  4JF5 A;  2A49 A;  5HFO A;  1PWD A;  1XGI A;  2JCH A;  3ZNT A;  4MBH A;  1YLY A;  1PWC A;  1Y54 A;  4MBF A;  4S2P A;  4QY5 A;  1K56 A;  4BD1 A;  1TEM A;  3BEC A;  1S0W A;  2P9V A;  3AGD A;  3EQU A;  4GD8 A;  1PYY A;  3NDE A;  2IWD A;  4ZAM A;  3A3I A;  4WM9 A;  4N9K A;  2WYX A;  4OKP A;  2ZQD A;  1NZU A;  4BL2 A;  5CRF A;  4QB8 A;  4KZ8 A;  4MEZ A;  3GV9 A;  2XD5 A;  1SKF A;  2P9V B;  1XPB A;  4JBF A;  4JXG A;  5GHY A;  5AQB A;  5GLD A;  5A91 A;  2Q9M A;  4HBT A;  4XUZ A;  3ZVW A;  3G31 A;  4GB7 A;  2PU4 A;  1ES4 A;  2OLV A;  4EUZ A;  1ESU A;  4PM5 A;  4Y0O A;  3SS4 A;  2WZZ A;  2ZLY A;  3IF6 A;  4JKT A;  3UY6 A;  5F1G A;  5KSH A;  5FI6 A;  4WMC D;  3HBR A;  1CI8 A;  3SH9 A;  2WAD A;  4GZB A;  4WYY A;  5G18 A;  2Y2N A;  2Y59 A;  5GHX A;  1H5X A;  3IF6 B;  2V1Z A;  3OCN A;  2FFY A;  2EX8 A;  3DTM A;  4UA9 A;  5EE8 A;  1W8Y A;  5FAP A;  2H0Y A;  5F1F A;  2E8I A;  3MKF A;  2XFT A;  1NZO A;  3Q7V B;  4D2O A;  1L2S A;  2BG1 A;  3IHB A;  4K0X A;  3HLB A;  1QMF A;  5FQ9 A;  3QHY A;  3BLM A;  4WEJ A;  1M40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...