3CI6A

Crystal structure of the gaf domain from acinetobacter phosphoenolpyruvate-protein phosphotransferase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
167
structure length
158
Chain Sequence
MSNMQLDTLRRIVQEINSSVSLHDSLDIMVNQVADAMKVDVCSIYLLDERNQRYLLMASKGLNPESVGHVSLQLSEGLVGLVGQREEIVNLENASKHERFIYNSFLGVPVMYRRKVMGVLVVQNKQPQDFSEAAESFLVTLCAQLSGVIAHAHAVGNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the GAF domain from Acinetobacter phosphoenolpyruvate-protein phosphotransferase.
rcsb
source organism Acinetobacter sp.
molecule tags Transferase
molecule keywords Phosphoenolpyruvate-protein phosphotransferase
total genus 44
structure length 158
sequence length 167
chains with identical sequence B
ec nomenclature ec 2.7.3.9: Phosphoenolpyruvate--protein phosphotransferase.
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ci6A00
2GX5A 2W3FA 2O0YA 2IA2A 2K2NA 3IBJA 4GW9A 4IJGA 3NHQA 2HGVA 2W1RA 4RQ9A 3S7OA 4LRXC 1TD5A 3D3OA 5DFXA 2W3HA 2XRNA 2B18A 3R4KA 4ME4A 3OBFA 3NOPC 5C5KA 1YSPA 4Y5FA 4LRYC 3S7PA 1YSQA 4ETXA 1MKMA 2VZWA 4MN7A 2QYBA 4CQHA 2W3GA 3VV4A 4Q0HA 3RFBA 3CI6A 2O9BA 5K5BA 5AJGA 4G3WA 4QPRA 4R6LA 2LB5A 3ZQ5A 4Y2FA 3O5YA 4G3VA 3W2ZA 3G6OA 3KSIA 1MC0A 4MDZA 3MF0A 4R70A 2VJWA 2XROA 1STZA 5I5LA 5LBRA 1YKDA 2Y8HA 4O01A 2ZMFA 4PAUA 4YNRA 4EUVA 4GLQA 3OOVA 2O99A 3HCYA 3DBAA 1VHMA 2VEAA 4ZRRA 4E04A 1F5MA 2G7UA 4YOFA 2W3EA 2O9AA 3KO6A 5HPIA 2W1TA 4LRZE 3BJNA 1TF1A 4MMNA 4BWIA 2VKSA 2M7UA 4DN0A 4ETZA 3C2WA 3EEAA 3E98A 2LB9A 4Z1WA 3KSFA 1ZTUA 4EU0A 2KLIA 4IUHA 4MCWA 3TRCA 2W1TB 2KOIA 4O8GA 2K31A 4Q0JA 5TJJA 2M7VA 3E0YA 3KSGA 2XSSA 3S7QA 3CITA 3NOTC 5L8MA 4FOFA 3MMHA 3LFVA 4IUKA 5DFYA 2O9CA 2Y79A 4Q0IA 3S7NA 3K2NA 4G3KA 3KSHA 4Y3IA 5HSQA 4O0PA 2W3DA 2OOLA 3NOUC 4DMZA 5HPFA 5HL6A 3MQ0A 3IBRA
chains in the Genus database with same CATH superfamily
3TJZC 3IHBA 4P0MA 4P87A 4LGWA 3PXPA 1NYYA 2PR5A 4RX2A 1Q2PA 5JYPA 3NHQA 4RYEA 3P01A 4GN2A 4HH3A 4HNBA 5DKLA 4BQMA 1FCNA 1TD5A 3D3OA 5HWWA 3P98A 1MWTA 3PBQA 3R4KA 4O7DA 1OTBA 3RH8B 2JKRI 4KZBA 3QHYA 3IH8A 2EFUA 1MKIA 4ZDXA 4QPRA 1KDSA 2JE5A 3VFHA 2KDKA 3BWLA 5U47A 3IH9A 3NECA 4GDBA 5AVFA 3T1XA 3N6IA 4O01A 4GHIB 3ZHHA 4DXBA 3E2LA 5HAIA 4PKYG 3F1OB 1P0ZA 1HVBA 4ZRRA 1PWCA 4S2MA 5L07A 2G7UA 4K08A 4EW7A 4R1GA 3U4LP 5HPIA 4KZ9A 2QHKA 3T4JA 2EX6A 4OQ0A 2M7UA 3CPTB 3B33A 3M2JA 4X55A 1BYWA 3LGOA 4RX3A 3GR2A 3LR0A 3U2AA 5KZHA 4QD4A 4WL9A 1ODVA 4PMAA 3S7QA 2OWHA 1XGIA 4LV1A 3LEZA 1S1ZA 4KG5A 4EERA 3MQQA 2OOLA 3NOUC 4KZ5A 2Y2JA 4WELA 3EQUA 3B47A 1KE0A 1H8YA 2BLSA 3FG8A 4GW9A 2VLGA 1PI4A 2Y2NA 4JPMA 5E2HA 3HVFA 4U3TA 4UA9A 2ZC7A 1E3UD 3S7OA 2WKHA 2W3HA 4BL2A 2PU4A 1W8YA 4Y5FA 4KZ8A 5FDSA 4WUJA 4R38A 1ES2A 2D02A 3K3CA 1JWZA 3KYZA 2HPBA 1M40A 1FILA 4IEDA 2J3TC 1RGZA 5I5LA 4X1LA 1YKDA 1XP4A 1TDLA 3EOIA 3Q7ZA 3WWXA 1F98A 3Q1FA 4PKYA 4QB8A 4OQGA 5FQ9A 2WZZA 4EXOA 3SS3A 2YKHA 3WS2A 5E2GA 2QZ6A 4CJNA 1AXBA 3V50A 1ESUA 1K54C 5JYOA 4NXEA 4DJ3A 1VEUA 4C6YA 1UWNX 3A3JA 3LIEA 3E4PA 4BBUA 2EFXA 3NIAA 4WBGA 3F1NB 2O9CA 4D2OA 1MXOA 4HY8A 5FI6A 5FAQA 5HSQA 4I39A 3H82B 4PHTA 5GHXA 4ZJ3A 2ZJ9A 1S6RA 4UHUA 3T1QB 4FSFA 5FASA 4IJGA 4EQ1A 1ZG4A 2QJ7A 2PBDP 4K0WA 1OTIA 2ZC6B 3V39A 3FC7A 2V2FF 4WEKA 4HJ4A 1OPXA 5CX7A 4WZ5A 5CHUA 5HZHA 5HWVA 1CJFA 1LSWA 4EUZA 1DP6A 1P9WA 1I5QA 2G2UA 2HJ9C 3IT9A 3LR4A 2WADA 2LB5A 4EESA 4KZ7A 5DJTA 5KSCA 1OTDA 1K25A 2ZLYA 5CGWA 5AQAA 3IX3A 1BT5A 1G6OA 3HCYA 3DBAA 4LLOB 1VHMA 5CHJA 3ZNYA 3C8CA 1H8MA 2BASA 3N4IA 4BD1A 2K7SA 4MN5A 3VOLA 2VKSA 4DN0A 1QMFA 2J3TD 4B88A 1WYCA 3EEAA 1DJAA 2HV1A 2DMWA 4BD0A 1FOFA 2LB9A 3H9WA 5HAQA 4NK3A 4LV0A 4N9KA 4Y7PA 3CG5A 3PBOA 1XA7A 1NXYA 4NKPA 3F1OA 3G32A 3VSKA 1KOUA 2GDNA 3KSGA 3EEHA 1OJ5A 4FCFA 4IVKA 5CXWA 2M1CA 1VETA 4RA7A 2XF3A 4LENA 2A24B 2RCXA 4EQIA 3T4TA 3IF6B 2H0YA 1Q2QA 4O0PA 2W3DA 5HPFA 3MQ0A 2B02A 1FR6A 1LI0A 1JWPA 2ZC5B 2JKFA 4P85A 5HFOA 5IHVA 3MZFA 1C3BA 5DTSA 2ZL1A 3QP1A 3HLWA 3VMAA 3RXXA 1OT9A 4FTXA 4F3LA 3G4PA 1K56D 1UWPX 1EWZA 3BECA 3G35A 1HLUP 1YQSA 1S4SA 1YSQA 2J8YA 2QYBA 4Q0HA 4B9OA 2KX6A 1DRMA 1JTGA 3R7WB 4KZAA 3C4OA 2PRFA 1GSWA 4KQDA 1IYOA 3MF0A 2X01A 1LL5A 4UA6A 2XEPA 3BLMA 1YLYA 1PFLA 4GB7A 3LYXA 4IBRA 1ZHHB 1W5DA 4Q8IA 5DJUA 3O86A 4YFMA 1O07A 4EV4A 4QY5A 4PM8A 3P7NA 2E8JA 2JKGA 5M18A 1TS0A 2Y59A 4MMNA 3KX0X 4MLLA 3E98A 1K56A 4N1XA 1D7EA 2V0UA 4HBTA 3RTYA 1NWZA 3OLOA 4MCWA 3T4LA 3UNWA 2J7VA 1YT4A 4WYYA 1KDWA 3T1SA 1L0GA 5F1GA 3QP4A 5L8MA 1HTZA 3HLEA 2HDQA 4F3LB 5FQJA 1WE4A 1WYBA 4PM9A 2WAFA 1KE3A 2Q0OA 4S2NC 1PWGA 5CRFA 2NUPC 4HJ6A 4I38A 3S1YA 4EBLA 1MPLA 1NZUA 2VA0A 3UB9A 3ITAA 4EEPA 3CZDA 4DKIA 3ZDJA 3VP4A 1VETB 4DDYA 1IKGA 4MNRA 2XK1A 3HLCA 2Z2MB 4IVIA 3LIDA 3N8SA 1XA1A 2Y2KA 1LSVA 4MEZA 1CI9A 2IWDA 3LI9A 1K38A 4Y0UA 5TBMA 4OVDA 4OLGA 4QWOA 4P6ZS 1E4DA 5HL1A 1MC0A 4X56A 1WA9A 1STZA 2FH5A 4F94A 2A2LA 3ZG9B 1T1CA 3PAGA 2XA7S 4BENA 1VEUB 2W3EA 3SW1A 3BEBA 4Y0OA 5CTMA 4WZ5C 3S4XA 4NXGA 3FKVA 3TRCA 3CWFA 5EVIA 1SCWA 3C38A 4O8GA 5CECA 1W79A 3LICA 4H8RA 5A8BA 1YLZA 2Y2OA 3UPPA 5HW3A 1YMXA 4Q0IA 2ZM0A 2FZ0A 3V3RA 3LY3A 4XUZA 1BSGA 4S2PA 1W63Q 1DJBA 3HLFA 3C5AA 2HZ5A 3IWIA 4A5RA 3IBRA 4DRTA 3EQVA 1TS6A 3JPUA 4KQQA 3MSHA 4ZAMA 4WMCD 2W1RA 2EXAA 2JKRM 5GLDA 3SZTA 5GHYA 2XQZA 2WUQA 3G31A 4OQHA 3L7HA 3CI6A 1MBLA 3VFFA 3FZCA 4OH0A 1F2KA 2XDMA 4LPZA 2E8IA 1J9MA 4JF5A 1NZOA 4XXRA 1ACFA 2Y2QA 2PYRA 3JVVA 2B5RA 2ZC4B 2HDSA 3PBRA 1VM1A 3QP5A 1EROA 2R9XA 4DJ2A 4IBXA 1V9ZA 3UO9A 3G2ZA 2IWCA 2OLVA 4OKPA 4NXFA 1L0FA 2DRWA 2V1BA 3IS2A 2V8CA 4R3BA 5FA7A 4JGOA 1IKIA 3IX8A 4ID4A 4EU0A 1G6AA 4GCZA 2A49A 2UV0E 3DW0A 3IHAA 4GHIA 4R0QA 3CITA 5A92A 3DTIA 1FSYA 3GVBA 4IUKA 1H0MA 3PTEA 3EWKA 3MBZA 3OCNA 3PBTA 3T4OA 4LV2A 4JBFA 5IU1A 2O0YA 1CEGA 4JF6A 2WGWA 4BL3A 2JCHA 1F9IA 3VSLA 5AQ7A 3IWOA 4KENB 3ICYA 3B42A 1K4FA 3G30A 1IYQA 4ETXA 3UDXA 2XD5A 4E3LA 1JTDA 5J7EA 1DY6A 3LR3A 3CPTA 5EFWA 5GLAA 3O5YA 3NCKA 2Y4AA 4PM5A 1YM1A 1PZPA 4X6TA 4I3JA 2XH9A 2VJWA 2XROA 5EVEA 5EVID 2V1AA 3NC8A 1T18A 2A24A 2ZQ8A 4GLQA 3OOVA 1MZUA 1QMEA 1NJ4A 2JKTM 3MQOA 3UE1A 3AGEA 1PZOA 1YLWA 1H5XA 2H28A 2W27A 2W1TA 2Y2IA 1TF1A 5GLCA 2ZM8A 4L0LA 3GRJA 4X25A 3IF5A 2HF6A 3PHYA 5GLBA 4EETB 4MBFA 3FYZA 1LSXA 2ZOHA 2J9OA 1OT6A 4S2JA 3BQAA 3S22A 3V67A 3C4PA 1K57C 1ES5A 1U60A 4S2KA 3CHWP 2XD1A 3WRZA 5CERA 1VB6A 4R23A 1FR1A 1KGGA 4DE1A 5HD3A 2GNXA 2EWWA 2GX5A 3A3FA 4E6XA 1GSXA 1L2SA 4FH2A 1JWVA 1GHIA 5A93A 4HJ3A 1J3WA 4C3QA 3OPLA 5DKKA 5J4EA 1ZC2A 4RVAA 3WRTA 2ZM2A 2PDRA 1DP8A 3UB6A 4CPKA 2OWJA 4UQIM 2O9BA 3UPNA 4X1MA 5AJGA 3BM6A 5EVLA 3MS6A 2JBFA 4UAAA 4KG2A 2V1ZA 4PAUA 4EUVA 3CUEA 3N8LA 1K55C 2OLUA 4X69A 5BOHA 4JLFA 1LI9A 1ONGA 1FCMA 3DTEA 3QNBA 2PR6A 4Z9QA 4WM9A 2OAQ1 1GCEA 2VV6A 5EOEA 3DWKA 3UDFA 4ARZA 4XT2A 1OTEA 1N9NA 3N8RA 1PWDA 3WS1A 4DDSA 4OPRA 3BQ8A 3BY8A 1EI5A 1CEFA 4DE3A 4U0TA 3KYEA 4L9EA 4X53A 1BZAA 2Y79A 5J3WA 3KSHA 4UQIS 4ZJ2A 4EBPA 3GDIA 4C75A 2XR0A 3LR5A 2I9VA 2A3UA 5DF9A 1GSVA 2P08A 5EV0A 2C5WB 4HQAA 5FAPA 2NUTC 2WGIA 5M1AA 1W7FA 5DFXA 3WS5A 1FCOA 3UB7A 3VP1A 5GHZA 2EX9A 1IYSA 2PYPA 4ME4A 3EGXC 2I72A 4K0XA 4X68A 5F68A 1PI5A 3L9KA 2ZD8A 5F6AA 3UE0A 4S2OA 5J8XA 3BYDA 4HEFA 3QNCA 2X02A 3IX4A 3E4OA 4BMWA 3TW8A 3IXDA 3TOIA 1SKOB 2ZBBA 3BY9A 1E25A 4YNRA 1LHYA 3WS4A 2OAP1 1ZG6A 1PW1A 1OTAA 4HESA 5F69A 2OSUA 3ZG0A 1Y4OA 1K0KA 2H5SA 4L9FA 3BFCA 3BW6A 3VOYA 4H6JA 4YWZA 4LFUA 1ES3A 4OLDA 4DE2A 3M6HA 1EW0A 1DP9A 3MFDA 2QKPA 4CLCD 3HUMA 1SKFA 2ZOIA 4QJGA 3SS4A 4Q0JA 4KZ4A 4S2IA 2X71A 1RP5A 5HWTA 4GNUA 5FI7A 1UGUA 3F1PB 2D01A 1FQGA 1K6RA 4AFIA 4E3KA 4UA7A 1O7EA 1N9OA 1G68A 5FL3A 3O3VA 2VV8A 5DTTA 3UN7A 5HARA 2WKEA 1YAXA 2WGWB 5EECA 4BJPA 3T50A 1G5UA 5HDCA 3UB5P 3ZFZA 1AWIA 3VP3A 4OQIA 2PBYA 4WN5A 2Q9MA 4BBVA 4HI4A 3UY6A 4Y17A 4WEJA 3NOPC 4KUOA 4NG2A 4CLCB 1TS8A 3RFBA 5K5BA 1K57A 4HOIA 4NXBA 3HREA 3DTMA 3UE6A 3ZYTA 5G4ZA 4OPYA 4GD6A 4FD8A 1NLYA 4LCLA 3NJAA 4JGPA 5D3OA 2P7JA 5AVEA 3GSGA 2O99A 4HBUA 3SH8A 3KYQA 3LEQA 4I3AA 2VEAA 3LO7A 1D06A 3PAEA 2H0TA 4QU3A 3A0RA 4BWIA 4ETZA 2J80A 1XJ3A 3MR0A 1SDNA 3K3DA 3FV7A 1ZTUA 3QP8A 3G2YA 1TEMA 1W63M 4PM7A 4D60A 2ZC3B 2VV7A 3B3XA 3NDGA 3LUQA 4OP8A 5M19A 3UDIA 4E6WA 1PYYA 1OJGA 2GZAA 5HDDA 5HX9A 1K4EA 1RCJA 4LCMA 5TGFA 4BBTA 1DJCA 1TVFA 3QP6A 1K6SA 4KQRA 3AGDA 3IBJA 3NI9A 1H8ZA 2Y55A 3F1NA 4DE0A 2B18A 3LIFA 5G18A 5EVIB 4LRYC 3S7PA 5FQQA 2WKIA 1S67L 1MKMA 4MN7A 3SH7A 3D4FA 1S66L 2Z6CA 3TSGA 4Y2FA 4G3VA 5EPHA 3VP2A 3GECA 4MDZA 4R70A 3BFGA 1LT0A 3LIAA 4ZTKA 3LCEA 1H3QA 2JC7A 1IYPA 4B4ZA 5AQ9A 5A90A 2CMNA 3C30A 5FSRA 1NRJA 4HHDA 1BLPA 2EWVA 1Y54A 3MZDA 5L2FA 2PT7A 4WLAA 4YOFA 3SS5A 3KO6A 4K91A 1Z6FA 2W0NA 2AVXA 4CLCE 3VP0A 4I3IA 3D9YA 2P74A 4HIAA 5TBMB 3HJKA 3CJMA 3P09A 4IUHA 3OPRA 1KVLA 4WZ4A 3E0YA 3H7WA 3UB8A 5EVIC 2ZQ7A 3A0VA 4FOFA 5DFYA 3R7WA 3M6BA 3DAVA 4Y3IA 1IEMA 3O88A 3HJIA 2FFFB 3VV4A 2ZMVA 4KG6A 3CMZA 1GHMA 1JVJA 2XA7M 3F1PA 2PD8A 2J3WA 2WAEA 3TE8A 1YSPA 5L09A 3HLGA 2W3GA 2Z2LB 3BRMA 4G3WA 3ZVWA 3IF6A 1OMEA 4CLCC 2XFTA 3E2KA 3FPWA 5AQBA 3CUEC 1K54A 2PU2A 2VK3A 3Q81A 3ZG7B 3VE3A 2DNSA 3IXHA 1D1JA 4S2NA 3LI8A 4OOLA 2Y2HA 2GJ3A 3NBLA 1L0EA 4LRZE 1CK3A 2V8FA 3C2WA 2Z6DA 2ZMAA 4DXCA 1NRFA 3ZGAB 1ALQA 1GA0A 2KLIA 5F5YA 2L0WA 1S0WA 3T12B 1RGYA 1G28A 3NOTC 3IXBA 4Y0TA 3LFVA 3HLBA 4L9GA 2VGLS 1HZOA 1XXMA 2WKQA 3OPPA 1L0DA 3ZCZA 2ACGA 2WZXA 5CHMA 5F1FA 1L3LA 3TG9A 3Q82A 3A3DA 2HGVA 1LLBA 1XX2A 4LRXC 5DTKA 1MWSA 4OPZA 3VOZA 2PD7A 2P9VA 3UE3A 1KVMA 2OV5A 4XT2B 4MN6A 4YINA 3W4PA 2V9AA 5EM0A 1BLHA 1LL8A 4Y15A 2Y2MA 3W8KA 4GS9A 2R9WA 1N9BA 3W4QA 1BULA 3BFFA 5A91A 3QP2A 3OZHA 5E2FA 1XKZA 3PR6A 3IS2B 1NLZA 3T4QA 2VGJA 2P04A 1KGEA 5KMWA 4BLMA 3Q07A 1MWRA 4EEUA 1KE4A 1F5MA 4E3MA 2HP9A 4GZBA 1P97A 2O9AA 3FPVA 5KIZA 3FKWA 3BJNA 5MC7A 2C6WB 4MBKA 1XFNA 4Z1WA 2VGLM 3D72A 1CI8A 3SH9A 1ERMA 2L1MA 2K31A 4HP4A 4B93A 5TFQA 1ONHA 3GTCA 2EA9A 2XGNA 1N4OA 3MMHA 4GDNA 3DWZA 4GOGA 1S1YA 3HLDA 4E3JA 3GMWA 4P6BA 1T1BA 3K2NA 4G3KA 1XJ4A 1FSWA 2UWXA 3LY4A 3BFDA 5E2EA 5L10A 4M3KA 4WF0A 3ZVTA 5FQIA 1NYMA 4QY6A 1XJ6A 4OP5A 3EGDC 3VE4A 1W8QA 3HBRA 4GS9B 2HDUA 1YLTA 2K2NA 1NY0A 2PAVP 4PM6A 1TDGA 3H82A 2JHEA 2EX8A 4QHCA 5F82A 4KUKA 4N92A 3C7UA 3A3IA 3C7VA 4PPRA 1BLCA 1PIOA 5C5KA 2WKRA 3I7JA 1SZVA 1T19A 3T4SA 3Q7VB 5CGXA 4KQOA 4UEYA 2QMIA 5EE8A 4OPQA 4E3NA 1JNUA 4JF4A 3CLOA 2G2WA 1TS7A 2Y2LA 5DF8A 1I2SA 5EUAA 3MFXA 5I94A 5HD5A 3N7WA 5LBRA 5CGSA 3W4OA 1X0OA 2XFSA 2ZMFA 4KZ3A 2QPNA 5FDHA 2INWA 3MKEA 3G34A 3MXSA 4E04A 3ZG5A 1K55A 1N9LA 4S2LA 2ZQCA 2J9PA 3T1RA 3ULFA 5CTNA 2Y2GA 4E3OA 4Y13A 4II7A 5KSHA 4P6ZM 3RJUA 1XPBA 4H6JB 4EWFA 2BTFP 3E4QA 5TJJA 3RXWA 2HP6A 3FWLA 4NETA 1SDEA 4CLCA 4JXWA 3WS0A 1SKOA 5IS1A 3A0SA 5FI2A 3HUOA 5EM1A 5FEGA 1Y28A 4IHQA 2MJ6A 1MY8A 5HL6A 3ISGA 3PBSA 2VX8A 1ESIA 1IOUA 2W3FA 5CEBA 1IFQA 2IA2A 1GA9A 4JXVA 4HP9A 4JXSA 3HL9A 2H10A 2Y91A 3MJQA 2R78A 4JGRA 4RQ9A 3UMEA 3CAXA 1SHVA 4E3IA 4N1HA 2ZL1B 2WYXA 1CF0A 5TR7A 2JN7A 4R3AA 5EOOA 3V5MA 4CQHA 5FQMA 4R6LA 3MXRA 4I5SA 1ZKJA 1YLJA 1YLPA 3W2ZA 2Q9NA 3G6OA 3KSIA 2QWSA 1S4RA 1IELA 1BLSA 2EXBA 2ZQAA 3M2KA 2YKFA 2V0WA 3MZEA 1BTLA 4GKUA 3LIBA 3UPOA 1FIKA 3JYIA 2HDRA 3OPHA 3V3SA 2XLNA 5DVAA 4JXGA 3HUNA 2WKPA 4M4XA 3NULA 4R3JA 2KOIA 5HAPA 3Q7VA 3T4KA 4NEED 2QJ5A 5FATA 3OCLA 5CEDA 2IWBA 5DF7A 1YMSA 3PBNA 2HJEA 4JGQA 3PYPA 3S7NA 2V20A 1XFQA 4DMZA 1BUEA 2FFYA 4LV3A 2CC1A 3IQAA 5GL9A 4JKTA 4B4XA 4OOYA 4EBNA 1PRQA 5FEFA 2VGKA 2P9VB 2WGVA 4ESPA 3ZNTA 1T1AA 1YPRA 3DTKA 1VQQA 4MBHA 1LL9A 3A3EA 4OOMA 4R4RA 4FH4A 4R4SA 1KGFA 1I2WA 2XRNA 1GHPA 3OBFA 5HDSA 3ZG8B 3GV9A 2HP5A 4HH2A 3SOIA 4GD8A 3NDEA 2WK0A 2VZWA 3IF6C 1V9YA 3H7WB 3MKFA 3O87A 3IWQA 1A0KA 3BLSA 4ARZB 3ZQ5A 3OC2A 3AGFA 2ZQDA 2EX2A 1ERQA 4OONA 1E3UA 5IT5A 3IXGA 2Y8HA 1P9RA 2JKTI 5E43A 3GQZA 5F83A 4ZJ1A 4DF6A 5G4YA 1M6KA 4FUWA 1HD8A 1ES4A 1CQAA 1PNEA 1XJ2A 2Y2PA 3KSFA 3JVUA 4GJ4A 4WMCA 1XGJA 2L4RA 2W1TB 2RL3A 3NY4A 5FQKA 2ZQ9A 4ZBEA 3ITBA 2M7VA 2BG1A 2XSSA 2PHYA 1MWUA 4XUXA 3UMDA 3MXQA 2B95A 4U0XA 2DCFA 4N9LA 3BFEA 5FAOA 1Z09A 4KZ6A 1PW8A
chains in the Genus database with same CATH topology
3TJZC 5DF9A 2NUPC 4HJ6A 4I38A 1GSVA 3PXPA 2P08A 2VA0A 3UB9A 4HQAA 2PR5A 3NHQA 4EEPA 3P01A 2HGVA 2NUTC 4HH3A 4HNBA 5DKLA 4LRXC 1TD5A 3D3OA 5DFXA 5HWWA 3UB7A 3PBQA 2PD7A 3UE3A 2PYPA 3R4KA 4ME4A 3EGXC 1OTBA 3RH8B 2JKRI 3LIDA 4XT2B 1LSVA 4MN6A 5F68A 2V9AA 3LI9A 1LL8A 5F6AA 5TBMA 4GS9A 4QPRA 4P6ZS 1MC0A 1WA9A 2KDKA 1STZA 3BWLA 3PR6A 3IS2B 3E4OA 2FH5A 4BMWA 5AVFA 1NLZA 4O01A 3TW8A 4GHIB 2A2LA 3T4QA 2ZBBA 3BY9A 4PKYG 1T1CA 3F1OB 4YNRA 2P04A 2XA7S 1P0ZA 2OAP1 1OTAA 4ZRRA 5F69A 4EEUA 1F5MA 2G7UA 4K08A 4EW7A 4L9FA 2W3EA 3BW6A 1P97A 2O9AA 3SW1A 5HPIA 3FPVA 5KIZA 2QHKA 4H6JA 4YWZA 3T4JA 3BJNA 5MC7A 2M7UA 3B33A 1BYWA 1EW0A 1XFNA 4Z1WA 2VGLM 4NXGA 3D72A 1DP9A 4CLCD 2QKPA 3LR0A 3U2AA 3TRCA 3CWFA 2ZOIA 2L1MA 4WL9A 3C38A 4O8GA 1ODVA 2K31A 4HP4A 4Q0JA 3LICA 4B93A 3S7QA 2OWHA 5A8BA 5HWTA 2EA9A 1S1ZA 3MMHA 1UGUA 3F1PB 2D01A 1S1YA 4AFIA 4Q0IA 4EERA 1T1BA 1N9OA 2FZ0A 3K2NA 4G3KA 5FL3A 1XJ4A 3MQQA 2VV8A 2OOLA 3NOUC 1W63Q 4WF0A 4WELA 1XJ6A 3IBRA 3EQUA 3EGDC 3VE4A 1YAXA 3EQVA 4GS9B 4BJPA 1TS6A 3T50A 3B47A 5HDCA 2K2NA 3FG8A 4GW9A 2VLGA 3H82A 2JHEA 2W1RA 4WN5A 3S7OA 4BBVA 2JKRM 4HI4A 2W3HA 4KUKA 4WEJA 3NOPC 5C5KA 4KUOA 2WKRA 4Y5FA 1T19A 3T4SA 4KQOA 4UEYA 4CLCB 1TS8A 3CI6A 3RFBA 5K5BA 4WUJA 1JNUA 4HOIA 4R38A 3CLOA 2D02A 4NXBA 1TS7A 4LPZA 3UE6A 3ZYTA 5G4ZA 3K3CA 3KYZA 3MFXA 2J3TC 5HD5A 1NLYA 2PYRA 3JVVA 5I5LA 5LBRA 3NJAA 1YKDA 1X0OA 4JGPA 2P7JA 3EOIA 5AVEA 2ZMFA 3PBRA 1F98A 2O99A 4DJ2A 2INWA 1V9ZA 3KYQA 4I3AA 4PKYA 2VEAA 4E04A 1D06A 4NXFA 1N9LA 3A0RA 4EXOA 2V1BA 2YKHA 3ULFA 4BWIA 3IS2A 4ETZA 2J80A 1XJ3A 3MR0A 4JGOA 4II7A 5KSHA 3K3DA 1ZTUA 4EU0A 4P6ZM 4GCZA 4H6JB 1W63M 2VV7A 3E4QA 4NXEA 5TJJA 4GHIA 4DJ3A 4CLCA 3CITA 3LUQA 1UWNX 3LIEA 3E4PA 4BBUA 4IUKA 5IS1A 3F1NB 2O9CA 3A0SA 3EWKA 4HY8A 3OCNA 3PBTA 3T4OA 5HSQA 1OJGA 1Y28A 2GZAA 4IHQA 5HDDA 2MJ6A 5HL6A 3PBSA 4I39A 3H82B 2VX8A 4PHTA 4BBTA 1IOUA 2W3FA 5IU1A 1IFQA 2O0YA 2IA2A 4HP9A 4FSFA 3IBJA 4IJGA 4EQ1A 2QJ7A 3F1NA 3MJQA 2R78A 4JGRA 4RQ9A 3UMEA 3CAXA 1F9IA 1OTIA 3FC7A 3ICYA 2B18A 3LIFA 4WEKA 3B42A 4HJ4A 1OPXA 5CX7A 2JN7A 4R3AA 4LRYC 3S7PA 1S67L 1MKMA 4ETXA 4MN7A 5HWVA 5HZHA 4CQHA 1LSWA 5J7EA 1DP6A 1P9WA 1S66L 2HJ9C 3LR3A 4R6LA 5EFWA 3LR4A 2Z6CA 2LB5A 4I5SA 4EESA 4Y2FA 3O5YA 4G3VA 5DJTA 3W2ZA 3G6OA 3KSIA 1OTDA 2QWSA 3GECA 4MDZA 4R70A 1S4RA 1LT0A 4I3JA 2VJWA 2XROA 3LIAA 2V1AA 1H3QA 1G6OA 1T18A 2A24A 4GLQA 3OOVA 2CMNA 3C30A 1MZUA 3HCYA 2JKTM 3DBAA 2YKFA 4LLOB 3MQOA 1NRJA 1VHMA 4HHDA 2V0WA 2EWVA 3LIBA 2PT7A 4WLAA 4YOFA 3C8CA 1H8MA 3KO6A 2BASA 2H28A 2W27A 2W0NA 2W1TA 2K7SA 4CLCE 1TF1A 4MN5A 3VOLA 4I3IA 4L0LA 2VKSA 4DN0A 2J3TD 3EEAA 2HV1A 2DMWA 4HIAA 5TBMB 2LB9A 2WKPA 3H9WA 3HJKA 4IUHA 4M4XA 3PBOA 2HF6A 2KOIA 3PHYA 4NKPA 3T4KA 3F1OA 4NEED 2QJ5A 1KOUA 3E0YA 3OCLA 3KSGA 4EETB 3EEHA 3H7WA 1OJ5A 1LSXA 3UB8A 2ZOHA 1OT6A 3BQAA 3PBNA 2M1CA 3A0VA 4FOFA 2A24B 3V67A 2HJEA 4JGQA 5DFYA 3PYPA 3T4TA 3S7NA 1XFQA 3R7WA 4Y3IA 4O0PA 2W3DA 4DMZA 3HJIA 5HPFA 1VB6A 3MQ0A 2B02A 3VV4A 5HD3A 2GNXA 2ZMVA 2EWWA 2GX5A 1GSXA 1T1AA 2XA7M 4HJ3A 3F1PA 4OOMA 2PD8A 2J3WA 3TE8A 1OT9A 4F3LA 2XRNA 5DKKA 5J4EA 1UWPX 3OBFA 5HDSA 1YSPA 4HH2A 2PDRA 1DP8A 1S4SA 1YSQA 3UB6A 2VZWA 2QYBA 1V9YA 2W3GA 4Q0HA 3H7WB 2OWJA 4UQIM 2O9BA 4B9OA 2KX6A 5AJGA 4G3WA 1DRMA 3R7WB 4ARZB 4CLCC 3ZQ5A 3OC2A 1GSWA 4KQDA 3FPWA 3MF0A 3CUEC 5IT5A 3LYXA 2Y8HA 1P9RA 1ZHHB 4PAUA 4EUVA 3CUEA 2JKTI 5DJUA 3VE3A 3P7NA 3LI8A 4OOLA 2GJ3A 5G4YA 4LRZE 1TS0A 2PR6A 4MMNA 3KX0X 2OAQ1 3C2WA 2Z6DA 3E98A 1D7EA 1XJ2A 2VV6A 3KSFA 2V0UA 3RTYA 3JVUA 2KLIA 1NWZA 3OLOA 4GJ4A 5F5YA 4MCWA 2L4RA 2W1TB 3T4LA 4ARZA 4XT2A 1OTEA 2L0WA 1N9NA 2M7VA 2XSSA 2PHYA 3BQ8A 1G28A 3NOTC 3BY8A 5L8MA 3LFVA 4L9GA 2VGLS 4L9EA 3UMDA 2Y79A 2WKQA 3MXQA 5J3WA 4F3LB 3KSHA 4UQIS 3GDIA 3LR5A 2I9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GX5 A;  2W3F A;  2O0Y A;  2IA2 A;  2K2N A;  3IBJ A;  4GW9 A;  4IJG A;  3NHQ A;  2HGV A;  2W1R A;  4RQ9 A;  3S7O A;  4LRX C;  1TD5 A;  3D3O A;  5DFX A;  2W3H A;  2XRN A;  2B18 A;  3R4K A;  4ME4 A;  3OBF A;  3NOP C;  5C5K A;  1YSP A;  4Y5F A;  4LRY C;  3S7P A;  1YSQ A;  4ETX A;  1MKM A;  2VZW A;  4MN7 A;  2QYB A;  4CQH A;  2W3G A;  3VV4 A;  4Q0H A;  3RFB A;  3CI6 A;  2O9B A;  5K5B A;  5AJG A;  4G3W A;  4QPR A;  4R6L A;  2LB5 A;  3ZQ5 A;  4Y2F A;  3O5Y A;  4G3V A;  3W2Z A;  3G6O A;  3KSI A;  1MC0 A;  4MDZ A;  3MF0 A;  4R70 A;  2VJW A;  2XRO A;  1STZ A;  5I5L A;  5LBR A;  1YKD A;  2Y8H A;  4O01 A;  2ZMF A;  4PAU A;  4YNR A;  4EUV A;  4GLQ A;  3OOV A;  2O99 A;  3HCY A;  3DBA A;  1VHM A;  2VEA A;  4ZRR A;  4E04 A;  1F5M A;  2G7U A;  4YOF A;  2W3E A;  2O9A A;  3KO6 A;  5HPI A;  2W1T A;  4LRZ E;  3BJN A;  1TF1 A;  4MMN A;  4BWI A;  2VKS A;  2M7U A;  4DN0 A;  4ETZ A;  3C2W A;  3EEA A;  3E98 A;  2LB9 A;  4Z1W A;  3KSF A;  1ZTU A;  4EU0 A;  2KLI A;  4IUH A;  4MCW A;  3TRC A;  2W1T B;  2KOI A;  4O8G A;  2K31 A;  4Q0J A;  5TJJ A;  2M7V A;  3E0Y A;  3KSG A;  2XSS A;  3S7Q A;  3CIT A;  3NOT C;  5L8M A;  4FOF A;  3MMH A;  3LFV A;  4IUK A;  5DFY A;  2O9C A;  2Y79 A;  4Q0I A;  3S7N A;  3K2N A;  4G3K A;  3KSH A;  4Y3I A;  5HSQ A;  4O0P A;  2W3D A;  2OOL A;  3NOU C;  4DMZ A;  5HPF A;  5HL6 A;  3MQ0 A;  3IBR A; 
#chains in the Genus database with same CATH topology
 3TJZ C;  3IHB A;  4P0M A;  4P87 A;  4LGW A;  3PXP A;  1NYY A;  2PR5 A;  4RX2 A;  1Q2P A;  5JYP A;  3NHQ A;  4RYE A;  3P01 A;  4GN2 A;  4HH3 A;  4HNB A;  5DKL A;  4BQM A;  1FCN A;  1TD5 A;  3D3O A;  5HWW A;  3P98 A;  1MWT A;  3PBQ A;  3R4K A;  4O7D A;  1OTB A;  3RH8 B;  2JKR I;  4KZB A;  3QHY A;  3IH8 A;  2EFU A;  1MKI A;  4ZDX A;  4QPR A;  1KDS A;  2JE5 A;  3VFH A;  2KDK A;  3BWL A;  5U47 A;  3IH9 A;  3NEC A;  4GDB A;  5AVF A;  3T1X A;  3N6I A;  4O01 A;  4GHI B;  3ZHH A;  4DXB A;  3E2L A;  5HAI A;  4PKY G;  3F1O B;  1P0Z A;  1HVB A;  4ZRR A;  1PWC A;  4S2M A;  5L07 A;  2G7U A;  4K08 A;  4EW7 A;  4R1G A;  3U4L P;  5HPI A;  4KZ9 A;  2QHK A;  3T4J A;  2EX6 A;  4OQ0 A;  2M7U A;  3CPT B;  3B33 A;  3M2J A;  4X55 A;  1BYW A;  3LGO A;  4RX3 A;  3GR2 A;  3LR0 A;  3U2A A;  5KZH A;  4QD4 A;  4WL9 A;  1ODV A;  4PMA A;  3S7Q A;  2OWH A;  1XGI A;  4LV1 A;  3LEZ A;  1S1Z A;  4KG5 A;  4EER A;  3MQQ A;  2OOL A;  3NOU C;  4KZ5 A;  2Y2J A;  4WEL A;  3EQU A;  3B47 A;  1KE0 A;  1H8Y A;  2BLS A;  3FG8 A;  4GW9 A;  2VLG A;  1PI4 A;  2Y2N A;  4JPM A;  5E2H A;  3HVF A;  4U3T A;  4UA9 A;  2ZC7 A;  1E3U D;  3S7O A;  2WKH A;  2W3H A;  4BL2 A;  2PU4 A;  1W8Y A;  4Y5F A;  4KZ8 A;  5FDS A;  4WUJ A;  4R38 A;  1ES2 A;  2D02 A;  3K3C A;  1JWZ A;  3KYZ A;  2HPB A;  1M40 A;  1FIL A;  4IED A;  2J3T C;  1RGZ A;  5I5L A;  4X1L A;  1YKD A;  1XP4 A;  1TDL A;  3EOI A;  3Q7Z A;  3WWX A;  1F98 A;  3Q1F A;  4PKY A;  4QB8 A;  4OQG A;  5FQ9 A;  2WZZ A;  4EXO A;  3SS3 A;  2YKH A;  3WS2 A;  5E2G A;  2QZ6 A;  4CJN A;  1AXB A;  3V50 A;  1ESU A;  1K54 C;  5JYO A;  4NXE A;  4DJ3 A;  1VEU A;  4C6Y A;  1UWN X;  3A3J A;  3LIE A;  3E4P A;  4BBU A;  2EFX A;  3NIA A;  4WBG A;  3F1N B;  2O9C A;  4D2O A;  1MXO A;  4HY8 A;  5FI6 A;  5FAQ A;  5HSQ A;  4I39 A;  3H82 B;  4PHT A;  5GHX A;  4ZJ3 A;  2ZJ9 A;  1S6R A;  4UHU A;  3T1Q B;  4FSF A;  5FAS A;  4IJG A;  4EQ1 A;  1ZG4 A;  2QJ7 A;  2PBD P;  4K0W A;  1OTI A;  2ZC6 B;  3V39 A;  3FC7 A;  2V2F F;  4WEK A;  4HJ4 A;  1OPX A;  5CX7 A;  4WZ5 A;  5CHU A;  5HZH A;  5HWV A;  1CJF A;  1LSW A;  4EUZ A;  1DP6 A;  1P9W A;  1I5Q A;  2G2U A;  2HJ9 C;  3IT9 A;  3LR4 A;  2WAD A;  2LB5 A;  4EES A;  4KZ7 A;  5DJT A;  5KSC A;  1OTD A;  1K25 A;  2ZLY A;  5CGW A;  5AQA A;  3IX3 A;  1BT5 A;  1G6O A;  3HCY A;  3DBA A;  4LLO B;  1VHM A;  5CHJ A;  3ZNY A;  3C8C A;  1H8M A;  2BAS A;  3N4I A;  4BD1 A;  2K7S A;  4MN5 A;  3VOL A;  2VKS A;  4DN0 A;  1QMF A;  2J3T D;  4B88 A;  1WYC A;  3EEA A;  1DJA A;  2HV1 A;  2DMW A;  4BD0 A;  1FOF A;  2LB9 A;  3H9W A;  5HAQ A;  4NK3 A;  4LV0 A;  4N9K A;  4Y7P A;  3CG5 A;  3PBO A;  1XA7 A;  1NXY A;  4NKP A;  3F1O A;  3G32 A;  3VSK A;  1KOU A;  2GDN A;  3KSG A;  3EEH A;  1OJ5 A;  4FCF A;  4IVK A;  5CXW A;  2M1C A;  1VET A;  4RA7 A;  2XF3 A;  4LEN A;  2A24 B;  2RCX A;  4EQI A;  3T4T A;  3IF6 B;  2H0Y A;  1Q2Q A;  4O0P A;  2W3D A;  5HPF A;  3MQ0 A;  2B02 A;  1FR6 A;  1LI0 A;  1JWP A;  2ZC5 B;  2JKF A;  4P85 A;  5HFO A;  5IHV A;  3MZF A;  1C3B A;  5DTS A;  2ZL1 A;  3QP1 A;  3HLW A;  3VMA A;  3RXX A;  1OT9 A;  4FTX A;  4F3L A;  3G4P A;  1K56 D;  1UWP X;  1EWZ A;  3BEC A;  3G35 A;  1HLU P;  1YQS A;  1S4S A;  1YSQ A;  2J8Y A;  2QYB A;  4Q0H A;  4B9O A;  2KX6 A;  1DRM A;  1JTG A;  3R7W B;  4KZA A;  3C4O A;  2PRF A;  1GSW A;  4KQD A;  1IYO A;  3MF0 A;  2X01 A;  1LL5 A;  4UA6 A;  2XEP A;  3BLM A;  1YLY A;  1PFL A;  4GB7 A;  3LYX A;  4IBR A;  1ZHH B;  1W5D A;  4Q8I A;  5DJU A;  3O86 A;  4YFM A;  1O07 A;  4EV4 A;  4QY5 A;  4PM8 A;  3P7N A;  2E8J A;  2JKG A;  5M18 A;  1TS0 A;  2Y59 A;  4MMN A;  3KX0 X;  4MLL A;  3E98 A;  1K56 A;  4N1X A;  1D7E A;  2V0U A;  4HBT A;  3RTY A;  1NWZ A;  3OLO A;  4MCW A;  3T4L A;  3UNW A;  2J7V A;  1YT4 A;  4WYY A;  1KDW A;  3T1S A;  1L0G A;  5F1G A;  3QP4 A;  5L8M A;  1HTZ A;  3HLE A;  2HDQ A;  4F3L B;  5FQJ A;  1WE4 A;  1WYB A;  4PM9 A;  2WAF A;  1KE3 A;  2Q0O A;  4S2N C;  1PWG A;  5CRF A;  2NUP C;  4HJ6 A;  4I38 A;  3S1Y A;  4EBL A;  1MPL A;  1NZU A;  2VA0 A;  3UB9 A;  3ITA A;  4EEP A;  3CZD A;  4DKI A;  3ZDJ A;  3VP4 A;  1VET B;  4DDY A;  1IKG A;  4MNR A;  2XK1 A;  3HLC A;  2Z2M B;  4IVI A;  3LID A;  3N8S A;  1XA1 A;  2Y2K A;  1LSV A;  4MEZ A;  1CI9 A;  2IWD A;  3LI9 A;  1K38 A;  4Y0U A;  5TBM A;  4OVD A;  4OLG A;  4QWO A;  4P6Z S;  1E4D A;  5HL1 A;  1MC0 A;  4X56 A;  1WA9 A;  1STZ A;  2FH5 A;  4F94 A;  2A2L A;  3ZG9 B;  1T1C A;  3PAG A;  2XA7 S;  4BEN A;  1VEU B;  2W3E A;  3SW1 A;  3BEB A;  4Y0O A;  5CTM A;  4WZ5 C;  3S4X A;  4NXG A;  3FKV A;  3TRC A;  3CWF A;  5EVI A;  1SCW A;  3C38 A;  4O8G A;  5CEC A;  1W79 A;  3LIC A;  4H8R A;  5A8B A;  1YLZ A;  2Y2O A;  3UPP A;  5HW3 A;  1YMX A;  4Q0I A;  2ZM0 A;  2FZ0 A;  3V3R A;  3LY3 A;  4XUZ A;  1BSG A;  4S2P A;  1W63 Q;  1DJB A;  3HLF A;  3C5A A;  2HZ5 A;  3IWI A;  4A5R A;  3IBR A;  4DRT A;  3EQV A;  1TS6 A;  3JPU A;  4KQQ A;  3MSH A;  4ZAM A;  4WMC D;  2W1R A;  2EXA A;  2JKR M;  5GLD A;  3SZT A;  5GHY A;  2XQZ A;  2WUQ A;  3G31 A;  4OQH A;  3L7H A;  3CI6 A;  1MBL A;  3VFF A;  3FZC A;  4OH0 A;  1F2K A;  2XDM A;  4LPZ A;  2E8I A;  1J9M A;  4JF5 A;  1NZO A;  4XXR A;  1ACF A;  2Y2Q A;  2PYR A;  3JVV A;  2B5R A;  2ZC4 B;  2HDS A;  3PBR A;  1VM1 A;  3QP5 A;  1ERO A;  2R9X A;  4DJ2 A;  4IBX A;  1V9Z A;  3UO9 A;  3G2Z A;  2IWC A;  2OLV A;  4OKP A;  4NXF A;  1L0F A;  2DRW A;  2V1B A;  3IS2 A;  2V8C A;  4R3B A;  5FA7 A;  4JGO A;  1IKI A;  3IX8 A;  4ID4 A;  4EU0 A;  1G6A A;  4GCZ A;  2A49 A;  2UV0 E;  3DW0 A;  3IHA A;  4GHI A;  4R0Q A;  3CIT A;  5A92 A;  3DTI A;  1FSY A;  3GVB A;  4IUK A;  1H0M A;  3PTE A;  3EWK A;  3MBZ A;  3OCN A;  3PBT A;  3T4O A;  4LV2 A;  4JBF A;  5IU1 A;  2O0Y A;  1CEG A;  4JF6 A;  2WGW A;  4BL3 A;  2JCH A;  1F9I A;  3VSL A;  5AQ7 A;  3IWO A;  4KEN B;  3ICY A;  3B42 A;  1K4F A;  3G30 A;  1IYQ A;  4ETX A;  3UDX A;  2XD5 A;  4E3L A;  1JTD A;  5J7E A;  1DY6 A;  3LR3 A;  3CPT A;  5EFW A;  5GLA A;  3O5Y A;  3NCK A;  2Y4A A;  4PM5 A;  1YM1 A;  1PZP A;  4X6T A;  4I3J A;  2XH9 A;  2VJW A;  2XRO A;  5EVE A;  5EVI D;  2V1A A;  3NC8 A;  1T18 A;  2A24 A;  2ZQ8 A;  4GLQ A;  3OOV A;  1MZU A;  1QME A;  1NJ4 A;  2JKT M;  3MQO A;  3UE1 A;  3AGE A;  1PZO A;  1YLW A;  1H5X A;  2H28 A;  2W27 A;  2W1T A;  2Y2I A;  1TF1 A;  5GLC A;  2ZM8 A;  4L0L A;  3GRJ A;  4X25 A;  3IF5 A;  2HF6 A;  3PHY A;  5GLB A;  4EET B;  4MBF A;  3FYZ A;  1LSX A;  2ZOH A;  2J9O A;  1OT6 A;  4S2J A;  3BQA A;  3S22 A;  3V67 A;  3C4P A;  1K57 C;  1ES5 A;  1U60 A;  4S2K A;  3CHW P;  2XD1 A;  3WRZ A;  5CER A;  1VB6 A;  4R23 A;  1FR1 A;  1KGG A;  4DE1 A;  5HD3 A;  2GNX A;  2EWW A;  2GX5 A;  3A3F A;  4E6X A;  1GSX A;  1L2S A;  4FH2 A;  1JWV A;  1GHI A;  5A93 A;  4HJ3 A;  1J3W A;  4C3Q A;  3OPL A;  5DKK A;  5J4E A;  1ZC2 A;  4RVA A;  3WRT A;  2ZM2 A;  2PDR A;  1DP8 A;  3UB6 A;  4CPK A;  2OWJ A;  4UQI M;  2O9B A;  3UPN A;  4X1M A;  5AJG A;  3BM6 A;  5EVL A;  3MS6 A;  2JBF A;  4UAA A;  4KG2 A;  2V1Z A;  4PAU A;  4EUV A;  3CUE A;  3N8L A;  1K55 C;  2OLU A;  4X69 A;  5BOH A;  4JLF A;  1LI9 A;  1ONG A;  1FCM A;  3DTE A;  3QNB A;  2PR6 A;  4Z9Q A;  4WM9 A;  2OAQ 1;  1GCE A;  2VV6 A;  5EOE A;  3DWK A;  3UDF A;  4ARZ A;  4XT2 A;  1OTE A;  1N9N A;  3N8R A;  1PWD A;  3WS1 A;  4DDS A;  4OPR A;  3BQ8 A;  3BY8 A;  1EI5 A;  1CEF A;  4DE3 A;  4U0T A;  3KYE A;  4L9E A;  4X53 A;  1BZA A;  2Y79 A;  5J3W A;  3KSH A;  4UQI S;  4ZJ2 A;  4EBP A;  3GDI A;  4C75 A;  2XR0 A;  3LR5 A;  2I9V A;  2A3U A;  5DF9 A;  1GSV A;  2P08 A;  5EV0 A;  2C5W B;  4HQA A;  5FAP A;  2NUT C;  2WGI A;  5M1A A;  1W7F A;  5DFX A;  3WS5 A;  1FCO A;  3UB7 A;  3VP1 A;  5GHZ A;  2EX9 A;  1IYS A;  2PYP A;  4ME4 A;  3EGX C;  2I72 A;  4K0X A;  4X68 A;  5F68 A;  1PI5 A;  3L9K A;  2ZD8 A;  5F6A A;  3UE0 A;  4S2O A;  5J8X A;  3BYD A;  4HEF A;  3QNC A;  2X02 A;  3IX4 A;  3E4O A;  4BMW A;  3TW8 A;  3IXD A;  3TOI A;  1SKO B;  2ZBB A;  3BY9 A;  1E25 A;  4YNR A;  1LHY A;  3WS4 A;  2OAP 1;  1ZG6 A;  1PW1 A;  1OTA A;  4HES A;  5F69 A;  2OSU A;  3ZG0 A;  1Y4O A;  1K0K A;  2H5S A;  4L9F A;  3BFC A;  3BW6 A;  3VOY A;  4H6J A;  4YWZ A;  4LFU A;  1ES3 A;  4OLD A;  4DE2 A;  3M6H A;  1EW0 A;  1DP9 A;  3MFD A;  2QKP A;  4CLC D;  3HUM A;  1SKF A;  2ZOI A;  4QJG A;  3SS4 A;  4Q0J A;  4KZ4 A;  4S2I A;  2X71 A;  1RP5 A;  5HWT A;  4GNU A;  5FI7 A;  1UGU A;  3F1P B;  2D01 A;  1FQG A;  1K6R A;  4AFI A;  4E3K A;  4UA7 A;  1O7E A;  1N9O A;  1G68 A;  5FL3 A;  3O3V A;  2VV8 A;  5DTT A;  3UN7 A;  5HAR A;  2WKE A;  1YAX A;  2WGW B;  5EEC A;  4BJP A;  3T50 A;  1G5U A;  5HDC A;  3UB5 P;  3ZFZ A;  1AWI A;  3VP3 A;  4OQI A;  2PBY A;  4WN5 A;  2Q9M A;  4BBV A;  4HI4 A;  3UY6 A;  4Y17 A;  4WEJ A;  3NOP C;  4KUO A;  4NG2 A;  4CLC B;  1TS8 A;  3RFB A;  5K5B A;  1K57 A;  4HOI A;  4NXB A;  3HRE A;  3DTM A;  3UE6 A;  3ZYT A;  5G4Z A;  4OPY A;  4GD6 A;  4FD8 A;  1NLY A;  4LCL A;  3NJA A;  4JGP A;  5D3O A;  2P7J A;  5AVE A;  3GSG A;  2O99 A;  4HBU A;  3SH8 A;  3KYQ A;  3LEQ A;  4I3A A;  2VEA A;  3LO7 A;  1D06 A;  3PAE A;  2H0T A;  4QU3 A;  3A0R A;  4BWI A;  4ETZ A;  2J80 A;  1XJ3 A;  3MR0 A;  1SDN A;  3K3D A;  3FV7 A;  1ZTU A;  3QP8 A;  3G2Y A;  1TEM A;  1W63 M;  4PM7 A;  4D60 A;  2ZC3 B;  2VV7 A;  3B3X A;  3NDG A;  3LUQ A;  4OP8 A;  5M19 A;  3UDI A;  4E6W A;  1PYY A;  1OJG A;  2GZA A;  5HDD A;  5HX9 A;  1K4E A;  1RCJ A;  4LCM A;  5TGF A;  4BBT A;  1DJC A;  1TVF A;  3QP6 A;  1K6S A;  4KQR A;  3AGD A;  3IBJ A;  3NI9 A;  1H8Z A;  2Y55 A;  3F1N A;  4DE0 A;  2B18 A;  3LIF A;  5G18 A;  5EVI B;  4LRY C;  3S7P A;  5FQQ A;  2WKI A;  1S67 L;  1MKM A;  4MN7 A;  3SH7 A;  3D4F A;  1S66 L;  2Z6C A;  3TSG A;  4Y2F A;  4G3V A;  5EPH A;  3VP2 A;  3GEC A;  4MDZ A;  4R70 A;  3BFG A;  1LT0 A;  3LIA A;  4ZTK A;  3LCE A;  1H3Q A;  2JC7 A;  1IYP A;  4B4Z A;  5AQ9 A;  5A90 A;  2CMN A;  3C30 A;  5FSR A;  1NRJ A;  4HHD A;  1BLP A;  2EWV A;  1Y54 A;  3MZD A;  5L2F A;  2PT7 A;  4WLA A;  4YOF A;  3SS5 A;  3KO6 A;  4K91 A;  1Z6F A;  2W0N A;  2AVX A;  4CLC E;  3VP0 A;  4I3I A;  3D9Y A;  2P74 A;  4HIA A;  5TBM B;  3HJK A;  3CJM A;  3P09 A;  4IUH A;  3OPR A;  1KVL A;  4WZ4 A;  3E0Y A;  3H7W A;  3UB8 A;  5EVI C;  2ZQ7 A;  3A0V A;  4FOF A;  5DFY A;  3R7W A;  3M6B A;  3DAV A;  4Y3I A;  1IEM A;  3O88 A;  3HJI A;  2FFF B;  3VV4 A;  2ZMV A;  4KG6 A;  3CMZ A;  1GHM A;  1JVJ A;  2XA7 M;  3F1P A;  2PD8 A;  2J3W A;  2WAE A;  3TE8 A;  1YSP A;  5L09 A;  3HLG A;  2W3G A;  2Z2L B;  3BRM A;  4G3W A;  3ZVW A;  3IF6 A;  1OME A;  4CLC C;  2XFT A;  3E2K A;  3FPW A;  5AQB A;  3CUE C;  1K54 A;  2PU2 A;  2VK3 A;  3Q81 A;  3ZG7 B;  3VE3 A;  2DNS A;  3IXH A;  1D1J A;  4S2N A;  3LI8 A;  4OOL A;  2Y2H A;  2GJ3 A;  3NBL A;  1L0E A;  4LRZ E;  1CK3 A;  2V8F A;  3C2W A;  2Z6D A;  2ZMA A;  4DXC A;  1NRF A;  3ZGA B;  1ALQ A;  1GA0 A;  2KLI A;  5F5Y A;  2L0W A;  1S0W A;  3T12 B;  1RGY A;  1G28 A;  3NOT C;  3IXB A;  4Y0T A;  3LFV A;  3HLB A;  4L9G A;  2VGL S;  1HZO A;  1XXM A;  2WKQ A;  3OPP A;  1L0D A;  3ZCZ A;  2ACG A;  2WZX A;  5CHM A;  5F1F A;  1L3L A;  3TG9 A;  3Q82 A;  3A3D A;  2HGV A;  1LLB A;  1XX2 A;  4LRX C;  5DTK A;  1MWS A;  4OPZ A;  3VOZ A;  2PD7 A;  2P9V A;  3UE3 A;  1KVM A;  2OV5 A;  4XT2 B;  4MN6 A;  4YIN A;  3W4P A;  2V9A A;  5EM0 A;  1BLH A;  1LL8 A;  4Y15 A;  2Y2M A;  3W8K A;  4GS9 A;  2R9W A;  1N9B A;  3W4Q A;  1BUL A;  3BFF A;  5A91 A;  3QP2 A;  3OZH A;  5E2F A;  1XKZ A;  3PR6 A;  3IS2 B;  1NLZ A;  3T4Q A;  2VGJ A;  2P04 A;  1KGE A;  5KMW A;  4BLM A;  3Q07 A;  1MWR A;  4EEU A;  1KE4 A;  1F5M A;  4E3M A;  2HP9 A;  4GZB A;  1P97 A;  2O9A A;  3FPV A;  5KIZ A;  3FKW A;  3BJN A;  5MC7 A;  2C6W B;  4MBK A;  1XFN A;  4Z1W A;  2VGL M;  3D72 A;  1CI8 A;  3SH9 A;  1ERM A;  2L1M A;  2K31 A;  4HP4 A;  4B93 A;  5TFQ A;  1ONH A;  3GTC A;  2EA9 A;  2XGN A;  1N4O A;  3MMH A;  4GDN A;  3DWZ A;  4GOG A;  1S1Y A;  3HLD A;  4E3J A;  3GMW A;  4P6B A;  1T1B A;  3K2N A;  4G3K A;  1XJ4 A;  1FSW A;  2UWX A;  3LY4 A;  3BFD A;  5E2E A;  5L10 A;  4M3K A;  4WF0 A;  3ZVT A;  5FQI A;  1NYM A;  4QY6 A;  1XJ6 A;  4OP5 A;  3EGD C;  3VE4 A;  1W8Q A;  3HBR A;  4GS9 B;  2HDU A;  1YLT A;  2K2N A;  1NY0 A;  2PAV P;  4PM6 A;  1TDG A;  3H82 A;  2JHE A;  2EX8 A;  4QHC A;  5F82 A;  4KUK A;  4N92 A;  3C7U A;  3A3I A;  3C7V A;  4PPR A;  1BLC A;  1PIO A;  5C5K A;  2WKR A;  3I7J A;  1SZV A;  1T19 A;  3T4S A;  3Q7V B;  5CGX A;  4KQO A;  4UEY A;  2QMI A;  5EE8 A;  4OPQ A;  4E3N A;  1JNU A;  4JF4 A;  3CLO A;  2G2W A;  1TS7 A;  2Y2L A;  5DF8 A;  1I2S A;  5EUA A;  3MFX A;  5I94 A;  5HD5 A;  3N7W A;  5LBR A;  5CGS A;  3W4O A;  1X0O A;  2XFS A;  2ZMF A;  4KZ3 A;  2QPN A;  5FDH A;  2INW A;  3MKE A;  3G34 A;  3MXS A;  4E04 A;  3ZG5 A;  1K55 A;  1N9L A;  4S2L A;  2ZQC A;  2J9P A;  3T1R A;  3ULF A;  5CTN A;  2Y2G A;  4E3O A;  4Y13 A;  4II7 A;  5KSH A;  4P6Z M;  3RJU A;  1XPB A;  4H6J B;  4EWF A;  2BTF P;  3E4Q A;  5TJJ A;  3RXW A;  2HP6 A;  3FWL A;  4NET A;  1SDE A;  4CLC A;  4JXW A;  3WS0 A;  1SKO A;  5IS1 A;  3A0S A;  5FI2 A;  3HUO A;  5EM1 A;  5FEG A;  1Y28 A;  4IHQ A;  2MJ6 A;  1MY8 A;  5HL6 A;  3ISG A;  3PBS A;  2VX8 A;  1ESI A;  1IOU A;  2W3F A;  5CEB A;  1IFQ A;  2IA2 A;  1GA9 A;  4JXV A;  4HP9 A;  4JXS A;  3HL9 A;  2H10 A;  2Y91 A;  3MJQ A;  2R78 A;  4JGR A;  4RQ9 A;  3UME A;  3CAX A;  1SHV A;  4E3I A;  4N1H A;  2ZL1 B;  2WYX A;  1CF0 A;  5TR7 A;  2JN7 A;  4R3A A;  5EOO A;  3V5M A;  4CQH A;  5FQM A;  4R6L A;  3MXR A;  4I5S A;  1ZKJ A;  1YLJ A;  1YLP A;  3W2Z A;  2Q9N A;  3G6O A;  3KSI A;  2QWS A;  1S4R A;  1IEL A;  1BLS A;  2EXB A;  2ZQA A;  3M2K A;  2YKF A;  2V0W A;  3MZE A;  1BTL A;  4GKU A;  3LIB A;  3UPO A;  1FIK A;  3JYI A;  2HDR A;  3OPH A;  3V3S A;  2XLN A;  5DVA A;  4JXG A;  3HUN A;  2WKP A;  4M4X A;  3NUL A;  4R3J A;  2KOI A;  5HAP A;  3Q7V A;  3T4K A;  4NEE D;  2QJ5 A;  5FAT A;  3OCL A;  5CED A;  2IWB A;  5DF7 A;  1YMS A;  3PBN A;  2HJE A;  4JGQ A;  3PYP A;  3S7N A;  2V20 A;  1XFQ A;  4DMZ A;  1BUE A;  2FFY A;  4LV3 A;  2CC1 A;  3IQA A;  5GL9 A;  4JKT A;  4B4X A;  4OOY A;  4EBN A;  1PRQ A;  5FEF A;  2VGK A;  2P9V B;  2WGV A;  4ESP A;  3ZNT A;  1T1A A;  1YPR A;  3DTK A;  1VQQ A;  4MBH A;  1LL9 A;  3A3E A;  4OOM A;  4R4R A;  4FH4 A;  4R4S A;  1KGF A;  1I2W A;  2XRN A;  1GHP A;  3OBF A;  5HDS A;  3ZG8 B;  3GV9 A;  2HP5 A;  4HH2 A;  3SOI A;  4GD8 A;  3NDE A;  2WK0 A;  2VZW A;  3IF6 C;  1V9Y A;  3H7W B;  3MKF A;  3O87 A;  3IWQ A;  1A0K A;  3BLS A;  4ARZ B;  3ZQ5 A;  3OC2 A;  3AGF A;  2ZQD A;  2EX2 A;  1ERQ A;  4OON A;  1E3U A;  5IT5 A;  3IXG A;  2Y8H A;  1P9R A;  2JKT I;  5E43 A;  3GQZ A;  5F83 A;  4ZJ1 A;  4DF6 A;  5G4Y A;  1M6K A;  4FUW A;  1HD8 A;  1ES4 A;  1CQA A;  1PNE A;  1XJ2 A;  2Y2P A;  3KSF A;  3JVU A;  4GJ4 A;  4WMC A;  1XGJ A;  2L4R A;  2W1T B;  2RL3 A;  3NY4 A;  5FQK A;  2ZQ9 A;  4ZBE A;  3ITB A;  2M7V A;  2BG1 A;  2XSS A;  2PHY A;  1MWU A;  4XUX A;  3UMD A;  3MXQ A;  2B95 A;  4U0X A;  2DCF A;  4N9L A;  3BFE A;  5FAO A;  1Z09 A;  4KZ6 A;  1PW8 A; 
#chains in the Genus database with same CATH homology
 3TJZ C;  5DF9 A;  2NUP C;  4HJ6 A;  4I38 A;  1GSV A;  3PXP A;  2P08 A;  2VA0 A;  3UB9 A;  4HQA A;  2PR5 A;  3NHQ A;  4EEP A;  3P01 A;  2HGV A;  2NUT C;  4HH3 A;  4HNB A;  5DKL A;  4LRX C;  1TD5 A;  3D3O A;  5DFX A;  5HWW A;  3UB7 A;  3PBQ A;  2PD7 A;  3UE3 A;  2PYP A;  3R4K A;  4ME4 A;  3EGX C;  1OTB A;  3RH8 B;  2JKR I;  3LID A;  4XT2 B;  1LSV A;  4MN6 A;  5F68 A;  2V9A A;  3LI9 A;  1LL8 A;  5F6A A;  5TBM A;  4GS9 A;  4QPR A;  4P6Z S;  1MC0 A;  1WA9 A;  2KDK A;  1STZ A;  3BWL A;  3PR6 A;  3IS2 B;  3E4O A;  2FH5 A;  4BMW A;  5AVF A;  1NLZ A;  4O01 A;  3TW8 A;  4GHI B;  2A2L A;  3T4Q A;  2ZBB A;  3BY9 A;  4PKY G;  1T1C A;  3F1O B;  4YNR A;  2P04 A;  2XA7 S;  1P0Z A;  2OAP 1;  1OTA A;  4ZRR A;  5F69 A;  4EEU A;  1F5M A;  2G7U A;  4K08 A;  4EW7 A;  4L9F A;  2W3E A;  3BW6 A;  1P97 A;  2O9A A;  3SW1 A;  5HPI A;  3FPV A;  5KIZ A;  2QHK A;  4H6J A;  4YWZ A;  3T4J A;  3BJN A;  5MC7 A;  2M7U A;  3B33 A;  1BYW A;  1EW0 A;  1XFN A;  4Z1W A;  2VGL M;  4NXG A;  3D72 A;  1DP9 A;  4CLC D;  2QKP A;  3LR0 A;  3U2A A;  3TRC A;  3CWF A;  2ZOI A;  2L1M A;  4WL9 A;  3C38 A;  4O8G A;  1ODV A;  2K31 A;  4HP4 A;  4Q0J A;  3LIC A;  4B93 A;  3S7Q A;  2OWH A;  5A8B A;  5HWT A;  2EA9 A;  1S1Z A;  3MMH A;  1UGU A;  3F1P B;  2D01 A;  1S1Y A;  4AFI A;  4Q0I A;  4EER A;  1T1B A;  1N9O A;  2FZ0 A;  3K2N A;  4G3K A;  5FL3 A;  1XJ4 A;  3MQQ A;  2VV8 A;  2OOL A;  3NOU C;  1W63 Q;  4WF0 A;  4WEL A;  1XJ6 A;  3IBR A;  3EQU A;  3EGD C;  3VE4 A;  1YAX A;  3EQV A;  4GS9 B;  4BJP A;  1TS6 A;  3T50 A;  3B47 A;  5HDC A;  2K2N A;  3FG8 A;  4GW9 A;  2VLG A;  3H82 A;  2JHE A;  2W1R A;  4WN5 A;  3S7O A;  4BBV A;  2JKR M;  4HI4 A;  2W3H A;  4KUK A;  4WEJ A;  3NOP C;  5C5K A;  4KUO A;  2WKR A;  4Y5F A;  1T19 A;  3T4S A;  4KQO A;  4UEY A;  4CLC B;  1TS8 A;  3CI6 A;  3RFB A;  5K5B A;  4WUJ A;  1JNU A;  4HOI A;  4R38 A;  3CLO A;  2D02 A;  4NXB A;  1TS7 A;  4LPZ A;  3UE6 A;  3ZYT A;  5G4Z A;  3K3C A;  3KYZ A;  3MFX A;  2J3T C;  5HD5 A;  1NLY A;  2PYR A;  3JVV A;  5I5L A;  5LBR A;  3NJA A;  1YKD A;  1X0O A;  4JGP A;  2P7J A;  3EOI A;  5AVE A;  2ZMF A;  3PBR A;  1F98 A;  2O99 A;  4DJ2 A;  2INW A;  1V9Z A;  3KYQ A;  4I3A A;  4PKY A;  2VEA A;  4E04 A;  1D06 A;  4NXF A;  1N9L A;  3A0R A;  4EXO A;  2V1B A;  2YKH A;  3ULF A;  4BWI A;  3IS2 A;  4ETZ A;  2J80 A;  1XJ3 A;  3MR0 A;  4JGO A;  4II7 A;  5KSH A;  3K3D A;  1ZTU A;  4EU0 A;  4P6Z M;  4GCZ A;  4H6J B;  1W63 M;  2VV7 A;  3E4Q A;  4NXE A;  5TJJ A;  4GHI A;  4DJ3 A;  4CLC A;  3CIT A;  3LUQ A;  1UWN X;  3LIE A;  3E4P A;  4BBU A;  4IUK A;  5IS1 A;  3F1N B;  2O9C A;  3A0S A;  3EWK A;  4HY8 A;  3OCN A;  3PBT A;  3T4O A;  5HSQ A;  1OJG A;  1Y28 A;  2GZA A;  4IHQ A;  5HDD A;  2MJ6 A;  5HL6 A;  3PBS A;  4I39 A;  3H82 B;  2VX8 A;  4PHT A;  4BBT A;  1IOU A;  2W3F A;  5IU1 A;  1IFQ A;  2O0Y A;  2IA2 A;  4HP9 A;  4FSF A;  3IBJ A;  4IJG A;  4EQ1 A;  2QJ7 A;  3F1N A;  3MJQ A;  2R78 A;  4JGR A;  4RQ9 A;  3UME A;  3CAX A;  1F9I A;  1OTI A;  3FC7 A;  3ICY A;  2B18 A;  3LIF A;  4WEK A;  3B42 A;  4HJ4 A;  1OPX A;  5CX7 A;  2JN7 A;  4R3A A;  4LRY C;  3S7P A;  1S67 L;  1MKM A;  4ETX A;  4MN7 A;  5HWV A;  5HZH A;  4CQH A;  1LSW A;  5J7E A;  1DP6 A;  1P9W A;  1S66 L;  2HJ9 C;  3LR3 A;  4R6L A;  5EFW A;  3LR4 A;  2Z6C A;  2LB5 A;  4I5S A;  4EES A;  4Y2F A;  3O5Y A;  4G3V A;  5DJT A;  3W2Z A;  3G6O A;  3KSI A;  1OTD A;  2QWS A;  3GEC A;  4MDZ A;  4R70 A;  1S4R A;  1LT0 A;  4I3J A;  2VJW A;  2XRO A;  3LIA A;  2V1A A;  1H3Q A;  1G6O A;  1T18 A;  2A24 A;  4GLQ A;  3OOV A;  2CMN A;  3C30 A;  1MZU A;  3HCY A;  2JKT M;  3DBA A;  2YKF A;  4LLO B;  3MQO A;  1NRJ A;  1VHM A;  4HHD A;  2V0W A;  2EWV A;  3LIB A;  2PT7 A;  4WLA A;  4YOF A;  3C8C A;  1H8M A;  3KO6 A;  2BAS A;  2H28 A;  2W27 A;  2W0N A;  2W1T A;  2K7S A;  4CLC E;  1TF1 A;  4MN5 A;  3VOL A;  4I3I A;  4L0L A;  2VKS A;  4DN0 A;  2J3T D;  3EEA A;  2HV1 A;  2DMW A;  4HIA A;  5TBM B;  2LB9 A;  2WKP A;  3H9W A;  3HJK A;  4IUH A;  4M4X A;  3PBO A;  2HF6 A;  2KOI A;  3PHY A;  4NKP A;  3T4K A;  3F1O A;  4NEE D;  2QJ5 A;  1KOU A;  3E0Y A;  3OCL A;  3KSG A;  4EET B;  3EEH A;  3H7W A;  1OJ5 A;  1LSX A;  3UB8 A;  2ZOH A;  1OT6 A;  3BQA A;  3PBN A;  2M1C A;  3A0V A;  4FOF A;  2A24 B;  3V67 A;  2HJE A;  4JGQ A;  5DFY A;  3PYP A;  3T4T A;  3S7N A;  1XFQ A;  3R7W A;  4Y3I A;  4O0P A;  2W3D A;  4DMZ A;  3HJI A;  5HPF A;  1VB6 A;  3MQ0 A;  2B02 A;  3VV4 A;  5HD3 A;  2GNX A;  2ZMV A;  2EWW A;  2GX5 A;  1GSX A;  1T1A A;  2XA7 M;  4HJ3 A;  3F1P A;  4OOM A;  2PD8 A;  2J3W A;  3TE8 A;  1OT9 A;  4F3L A;  2XRN A;  5DKK A;  5J4E A;  1UWP X;  3OBF A;  5HDS A;  1YSP A;  4HH2 A;  2PDR A;  1DP8 A;  1S4S A;  1YSQ A;  3UB6 A;  2VZW A;  2QYB A;  1V9Y A;  2W3G A;  4Q0H A;  3H7W B;  2OWJ A;  4UQI M;  2O9B A;  4B9O A;  2KX6 A;  5AJG A;  4G3W A;  1DRM A;  3R7W B;  4ARZ B;  4CLC C;  3ZQ5 A;  3OC2 A;  1GSW A;  4KQD A;  3FPW A;  3MF0 A;  3CUE C;  5IT5 A;  3LYX A;  2Y8H A;  1P9R A;  1ZHH B;  4PAU A;  4EUV A;  3CUE A;  2JKT I;  5DJU A;  3VE3 A;  3P7N A;  3LI8 A;  4OOL A;  2GJ3 A;  5G4Y A;  4LRZ E;  1TS0 A;  2PR6 A;  4MMN A;  3KX0 X;  2OAQ 1;  3C2W A;  2Z6D A;  3E98 A;  1D7E A;  1XJ2 A;  2VV6 A;  3KSF A;  2V0U A;  3RTY A;  3JVU A;  2KLI A;  1NWZ A;  3OLO A;  4GJ4 A;  5F5Y A;  4MCW A;  2L4R A;  2W1T B;  3T4L A;  4ARZ A;  4XT2 A;  1OTE A;  2L0W A;  1N9N A;  2M7V A;  2XSS A;  2PHY A;  3BQ8 A;  1G28 A;  3NOT C;  3BY8 A;  5L8M A;  3LFV A;  4L9G A;  2VGL S;  4L9E A;  3UMD A;  2Y79 A;  2WKQ A;  3MXQ A;  5J3W A;  4F3L B;  3KSH A;  4UQI S;  3GDI A;  3LR5 A;  2I9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...