3CI6A

Crystal structure of the gaf domain from acinetobacter phosphoenolpyruvate-protein phosphotransferase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
167
structure length
158
Chain Sequence
MSNMQLDTLRRIVQEINSSVSLHDSLDIMVNQVADAMKVDVCSIYLLDERNQRYLLMASKGLNPESVGHVSLQLSEGLVGLVGQREEIVNLENASKHERFIYNSFLGVPVMYRRKVMGVLVVQNKQPQDFSEAAESFLVTLCAQLSGVIAHAHAVGNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the GAF domain from Acinetobacter phosphoenolpyruvate-protein phosphotransferase.
rcsb
source organism Acinetobacter sp.
molecule tags Transferase
molecule keywords Phosphoenolpyruvate-protein phosphotransferase
total genus 44
structure length 158
sequence length 167
chains with identical sequence B
ec nomenclature ec 2.7.3.9: Phosphoenolpyruvate--protein phosphotransferase.
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ci6A00
4IJGA 4R6LA 1YKDA 3C2WA 3E0YA 4PAUA 2O0YA 3OOVA 2W3HA 3K2NA 3KSIA 3OBFA 2O99A 4MDZA 2XSSA 4RQ9A 3S7OA 4Y3IA 3RFBA 4BWIA 4G3KA 3D3OA 4DMZA 3BJNA 4MMNA 3EEAA 3MMHA 2M7VA 4O0PA 3S7QA 2KOIA 1MKMA 5HSQA 4ZRRA 2W3GA 3MF0A 2KLIA 2ZMFA 2W1TB 4G3WA 4Q0JA 5HL6A 4Y5FA 4O01A 4EU0A 3IBRA 2O9BA 5LBRA 3NHQA 2W1RA 2Y8HA 4YOFA 5HPIA 3NOPC 2VJWA 4O8GA 4FOFA 4GW9A 2VEAA 3S7NA 3CI6A 5DFXA 3CITA 3KSFA 3VV4A 3S7PA 2LB9A 3ZQ5A 3KSHA 3R4KA 4IUKA 4Z1WA 3G6OA 4Q0IA 2XRNA 4G3VA 4LRYC 3IBJA 5L8MA 4ETXA 5AJGA 2K2NA 2G7UA 1F5MA 4R70A 2W3FA 3DBAA 4Q0HA 4EUVA 5TJJA 4GLQA 4MN7A 1MC0A 1ZTUA 4QPRA 5I5LA 1TF1A 1STZA 2M7UA 2IA2A 3NOTC 3KSGA 5K5BA 4Y2FA 2XROA 3TRCA 2HGVA 2W3EA 3NOUC 4ME4A 2O9AA 3MQ0A 3W2ZA 2W3DA 2Y79A 2K31A 3LFVA 4MCWA 1VHMA 4ETZA 4LRZE 4LRXC 2W1TA 3E98A 1TD5A 5DFYA 5HPFA 2QYBA 4YNRA 2LB5A 4E04A 2VKSA 2GX5A 2O9CA 4CQHA 3O5YA 2B18A 2OOLA 4DN0A 3KO6A 3HCYA 1YSQA 1YSPA 5C5KA 2VZWA 4IUHA
chains in the Genus database with same CATH superfamily
3VE4A 3AGEA 3E0YA 2EXBA 2GNXA 3KX0X 4JBFA 3N8LA 5HD5A 3T1QB 1KE3A 2JKTM 3MQQA 1W79A 4OH0A 3BEBA 3R7WB 3CWFA 1FR1A 4PM9A 2V0UA 1SDNA 1W8YA 2ZQAA 1NRFA 1ZG4A 4QD4A 2J8YA 3IXHA 5HWVA 1KGEA 4KZBA 3BRMA 4H8RA 1G5UA 4UA9A 4G3VA 3OCNA 5DVAA 5GLDA 4EEPA 2ZJ9A 4ZJ3A 5HWWA 1VETB 4Y15A 5AQBA 1H8YA 1K54A 1K4EA 5CEDA 3D9YA 2WZXA 4X1LA 1ZTUA 2M7UA 4WLAA 4P6ZS 1YM1A 1YLYA 3MQ0A 2W3DA 2WKQA 3C30A 2Q0OA 4HBTA 1BZAA 3UO9A 3A0RA 1ODVA 2V20A 3IWIA 1PW8A 4CQHA 4IHQA 2B18A 4PPRA 1GA0A 2NUTC 4WZ5A 1TS8A 1KDSA 4D2OA 5J4EA 3UB5P 4PM8A 4QY6A 4IVIA 3F1PA 2W3HA 3IX8A 3KSIA 5GHYA 3CPTB 5GLAA 4IEDA 2K7SA 3IWOA 3IX4A 5CERA 1F2KA 4O0PA 2JCHA 4HIAA 4X1MA 5DKLA 2ZC4B 3ZG7B 5M18A 2ZC7A 2W1TB 1L3LA 3LR4A 5DTKA 1H3QA 3UPNA 2PYRA 1ES4A 4R3BA 1E3UD 1OMEA 3PBOA 2ZD8A 3VFHA 3KSFA 3ZQ5A 5HD3A 1P97A 4AFIA 2V8FA 4S2NA 4R3AA 3IBJA 1FCMA 1FSYA 1F98A 2DCFA 3E2KA 4KUKA 1F5MA 1K56A 2VK3A 3CHWP 2QMIA 3T4QA 1DP6A 3IWQA 1IYPA 5EM0A 1BLPA 1K57C 4GLQA 4PM7A 3T1RA 3MZFA 1CQAA 1EW0A 3BY9A 1H8ZA 1GSVA 5FDSA 2ZM0A 1MKIA 2VV6A 3UMDA 4HY8A 3C4PA 4S2NC 4S2IA 4FCFA 4YINA 3EGDC 1LI0A 4D60A 1DRMA 2VKSA 5E2FA 2OWHA 3IXDA 1WYCA 3HCYA 1DY6A 4LENA 5F1GA 3NULA 1S1ZA 3G2YA 3FZCA 2XLNA 5M1AA 1PFLA 2HPBA 2O0YA 2PAVP 3Q07A 2BLSA 3UE1A 4E6XA 2M7VA 4NXEA 3MXSA 3NDEA 5CGWA 4WZ4A 1MKMA 5FQJA 1CK3A 1TDGA 3OLOA 4MBKA 4CLCC 5KSCA 3O88A 2VGLS 3BQAA 1LSXA 4Y5FA 4EU0A 3E2LA 4WEJA 3LYXA 4BENA 4ZJ1A 4DE2A 2VEAA 2GZAA 3LY3A 2QWSA 3GMWA 4R3JA 4B9OA 4GDBA 3HUNA 5F6AA 2R78A 3H7WB 4RA7A 1IKIA 3DW0A 4KQRA 1FIKA 2WYXA 4GS9A 3G2ZA 1STZA 5FDHA 3D72A 3FPWA 1GA9A 3LGOA 1SDEA 5EUAA 1YT4A 3LFVA 3OCLA 4OQIA 5FL3A 3HLWA 3S22A 3O87A 2PHYA 1XKZA 1ALQA 4KUOA 1PZOA 2A24B 3NI9A 2OLUA 3EGXC 4O7DA 3MKFA 4CPKA 3UPPA 3K3CA 3RXWA 3MXQA 3HL9A 3M6BA 1I5QA 1PRQA 5BOHA 3IS2A 1YLZA 2OLVA 4OLGA 3MFDA 4CLCE 3TOIA 5HAIA 2ZQCA 3HVFA 3P98A 4KZ5A 2QKPA 4PKYG 3D3OA 2GDNA 5HZHA 2OAQ1 2J7VA 2D01A 1QMFA 4ESPA 1OJ5A 1S66L 4MEZA 5TBMA 4M4XA 2ZMFA 4R1GA 3HREA 3IF6A 5U47A 3CJMA 4PM6A 3WS1A 3TW8A 2C5WB 4JGQA 4HNBA 4YOFA 3M2JA 1KDWA 3HJIA 1C3BA 3Q81A 3MKEA 1PW1A 2FH5A 3BFGA 3DTIA 3OPRA 2FZ0A 3SOIA 3R4KA 3V67A 4Q0IA 4EESA 1ES3A 5J7EA 4KZ8A 1AWIA 2DMWA 5CRFA 2P7JA 1JTDA 3UB6A 4ZTKA 3MQOA 3UN7A 5AVFA 4IBRA 2XF3A 1XJ2A 3BFFA 4GNUA 3VP4A 2X01A 3V50A 2D02A 2O9AA 3P7NA 1MXOA 1G6AA 3VP2A 2PD8A 2P08A 3QNBA 3E98A 4EBNA 3UNWA 1TD5A 4K0WA 4BLMA 3ZVWA 3OPLA 4QU3A 3D4FA 5EVLA 3DWKA 2XFSA 3CUEA 5HWTA 3AGDA 1L0DA 3ZG8B 4WF0A 4NETA 4PM5A 1DJAA 4HEFA 3T4TA 1HTZA 3UB8A 3GECA 3OOVA 1IEMA 3UE0A 2PR6A 2IWBA 2YKHA 1YLJA 4BBTA 2PU2A 3T4KA 3R7WA 4YWZA 2I9VA 3RJUA 5CHUA 3M2KA 2HP9A 4S2OA 4GD8A 2KLIA 1S4SA 1W63Q 4E3IA 4Q0JA 3U4LP 3BFEA 2W1RA 2WKRA 3W4OA 2WGWB 1PWGA 3SZTA 4U0XA 5KMWA 1IELA 3KSHA 1NYMA 4IUKA 1SHVA 3VE3A 4XXRA 1PI5A 1OTEA 1CJFA 1VB6A 3T4SA 1W63M 4Y7PA 4LV2A 4S2JA 5KZHA 3LEZA 3T50A 2P9VA 3GV9A 2OSUA 3BLMA 3FKVA 4X6TA 4Y2FA 2VGLM 5L07A 3ULFA 2G2WA 4EETB 3LY4A 4FD8A 1FQGA 4R0QA 4ETZA 4BMWA 3QP2A 2HF6A 1ERQA 4LRXC 1BLCA 1ACFA 1KVMA 2QYBA 2ZMVA 2LB5A 3SS5A 2Y2QA 3WS4A 2RL3A 5J8XA 3KO6A 5E2EA 5DF8A 5HDDA 5C5KA 4FTXA 2PU4A 3HLBA 3BW6A 1IKGA 2ZQDA 1VM1A 1J9MA 1Y28A 2KDKA 2Y2MA 3PTEA 1Z6FA 4HJ4A 3IT9A 2KOIA 1Q2PA 3LR3A 5EV0A 1PWCA 2H0YA 4NEED 4L9GA 3UDIA 1K6SA 5FASA 2ACGA 4UHUA 1BTLA 3ZHHA 5EVIA 5HL6A 3PHYA 2EX6A 3HLFA 4OKPA 2W0NA 4JLFA 4JXVA 4NXGA 4O8GA 2WGVA 4OP8A 4Y0TA 5HL1A 3WS0A 4KZ4A 2A3UA 3IX3A 4N9KA 3SS3A 1MWUA 3HLGA 5E2GA 3IF5A 3W4QA 3A3EA 1VEUA 3QP5A 4U0TA 3JYIA 5CECA 3UE3A 3QNCA 5EVID 2ZM8A 4GDNA 4Q0HA 3UDXA 3ZCZA 3MJQA 1ZKJA 4WYYA 3PYPA 2EWWA 3BYDA 3PAGA 3IXBA 2Y2HA 2EXAA 4EERA 5K5BA 3E4PA 2W27A 3NOUC 4OLDA 2VLGA 2V1BA 4ZAMA 1YAXA 1H8MA 1T1CA 4LRZE 2WKHA 2WKPA 1GHIA 1GHPA 2HZ5A 4RX3A 3UB7A 2XDMA 3M6HA 1LLBA 5E2HA 4M3KA 2L0WA 1YMXA 2O9CA 3O5YA 2XR0A 4JF6A 3IF6B 1P9WA 2JE5A 2QJ7A 1ESIA 4HJ6A 4B4XA 1LL9A 5AQ7A 2XD1A 4QJGA 4BD1A 3K2NA 3CUEC 3LIDA 2X71A 4ZJ2A 5CGSA 2PBYA 3S7OA 4NKPA 4Y3IA 2WK0A 4JGRA 1XA7A 3FV7A 1N4OA 5HDSA 3IS2B 3UMEA 3G31A 4GS9B 3G34A 4CLCA 4G3WA 1IOUA 4K91A 5LBRA 3NHQA 2Y8HA 2ZBBA 3ZNYA 2BG1A 4DXCA 4GW9A 4WBGA 4UEYA 3CITA 1O7EA 3NJAA 1UWPX 2J9PA 4E3LA 1ERMA 4LRYC 3F1OA 4DKIA 3B33A 2K2NA 2Z2MB 3FYZA 3SW1A 3LIAA 3I7JA 4HP4A 2HDUA 1OTIA 4HOIA 5TBMB 3B3XA 4PMAA 5A93A 4C6YA 5F82A 5I94A 3NOTC 5F1FA 2EFUA 2W3EA 2C6WB 1OTAA 2FFYA 4I3IA 4WM9A 3MR0A 4E3NA 4CJNA 4KQQA 3F1NB 2L4RA 4XUZA 4KZAA 4E3JA 3VP1A 3KYZA 1WYBA 3CZDA 5F5YA 5TGFA 5EFWA 5CHJA 3TSGA 5EVIC 4MLLA 5E43A 2UV0E 2QHKA 4P6ZM 2NUPC 4DXBA 4ZDXA 4KQDA 1TVFA 4DJ2A 1DP9A 3ITBA 1UWNX 3C4OA 4MBFA 2IWDA 3GTCA 2VA0A 1K4FA 3C5AA 3UE6A 3C2WA 5HAQA 1TS7A 4EWFA 1XGJA 3G4PA 1ZHHB 1LL8A 3QP1A 2L1MA 3LUQA 3LR0A 4FSFA 3ZFZA 3JVUA 1F9IA 1CI9A 3LIFA 1D06A 1XX2A 3HBRA 4JF5A 5FQ9A 4GHIA 2HP5A 1M6KA 1Y54A 4I39A 4U3TA 1YPRA 2LB9A 3OPHA 3VP0A 5FAQA 3V5MA 2ZOHA 4GB7A 2V1ZA 2WUQA 5CGXA 4ETXA 5IU1A 4X25A 3LIBA 1RP5A 3C8CA 1ES2A 4EXOA 4K0XA 5AVEA 2P9VB 4KZ3A 1CEGA 1NJ4A 4E6WA 2B5RA 3C7UA 3G32A 1TF1A 3HUOA 4HH2A 1E3UA 2Y2NA 1BUEA 3ZYTA 1H0MA 1ONGA 1TEMA 1IYOA 2EX8A 1N9NA 4MCWA 1VHMA 3GQZA 5L10A 5FAOA 3W4PA 2VGJA 1P9RA 3LCEA 3NY4A 3FWLA 5DFYA 3T4LA 5A90A 4UA7A 4EUZA 4ID4A 3NC8A 4HH3A 2OOLA 4DN0A 4JGOA 3A3FA 4OOLA 2Y2KA 5DKKA 3GSGA 4R6LA 2VV7A 4WZ5C 5G18A 5G4ZA 1PIOA 4KQOA 2Q9NA 3TJZC 2PBDP 1JWVA 3CPTA 2ZMAA 2WGIA 4FH2A 3GDIA 1XA1A 2ZC6B 2RCXA 4NG2A 1N9LA 1A0KA 2WAEA 1GSWA 5IHVA 1X0OA 4YFMA 3BFCA 4HQAA 3NOPC 2JBFA 3DWZA 3PR6A 4R23A 1OT9A 2Z6CA 5F69A 5CX7A 3G6OA 1JWZA 5HX9A 4EW7A 3T12B 2CMNA 4OPRA 5AJGA 2G7UA 4ARZA 4X69A 3ZDJA 2W3FA 4IVKA 5A91A 5DTSA 2FFFB 5IT5A 3PBSA 2VV8A 4B88A 1K54C 5I5LA 3CLOA 1V9YA 4QY5A 1XXMA 2J3WA 4P0MA 2HGVA 2XH9A 4ME4A 1SCWA 4OOMA 4JXGA 5EECA 1TDLA 3W8KA 1J3WA 2KX6A 3IXGA 1NLZA 2ZC5B 3BY8A 5HAPA 4Y13A 3QHYA 4E3MA 1BT5A 2HV1A 1L2SA 4GHIB 5DF7A 1O07A 1FOFA 1YKDA 4KZ7A 1YQSA 3LR5A 2V2FF 4A5RA 1S1YA 2WKIA 4OONA 2JN7A 1G28A 2EA9A 2JC7A 4EBLA 1KGGA 2QPNA 4BD0A 1K57A 3AGFA 3ZG5A 3ITAA 4E3KA 4LCLA 2V8CA 5HPIA 4Y17A 4F94A 3Q7ZA 5HARA 1JNUA 3FC7A 4R4RA 1CI8A 3CI6A 5DFXA 3F1NA 2WKEA 2OAP1 1N9OA 2Z6DA 1XP4A 2PDRA 5JYOA 3OZHA 2Y91A 3CMZA 4KG5A 2R9XA 2A2LA 2E8IA 3IH9A 3BLSA 4FUWA 5TJJA 2JKFA 1E4DA 3HUMA 5GLCA 1IYQA 1K0KA 5HDCA 3B42A 1DJBA 2IA2A 5GLBA 4EQ1A 4MBHA 4L9FA 3HLCA 3TRCA 3PBQA 3ZVTA 1G6OA 1DP8A 4OQHA 4BL2A 1EI5A 5FI6A 4R4SA 5FEFA 1LSWA 5FA7A 4XT2B 1OJGA 4LV0A 4N1XA 1BSGA 5DJTA 1TS0A 3H7WA 3ISGA 4GZBA 1XGIA 3G35A 4BBVA 1YLTA 1YSQA 3F1OB 3IH8A 2J3TD 1MY8A 1I2SA 1JVJA 2EWVA 1XJ3A 3GVBA 2Y2LA 2R9WA 2O99A 4LCMA 4BWIA 4G3KA 1ZG6A 3S7QA 3NIAA 4H6JA 2Y55A 3DTEA 5GHXA 3IBRA 3T1SA 3UY6A 5G4YA 2WADA 3CAXA 4S2MA 1MWRA 4X53A 4EEUA 4NK3A 3VV4A 5M19A 5CTMA 2HP6A 4Z1WA 4L0LA 4RYEA 2J3TC 2ZQ8A 3NBLA 4OP5A 5L8MA 4LV3A 3O3VA 3EQUA 3B47A 5KSHA 3KYQA 3MFXA 4P6BA 2XA7M 4F3LA 3A3IA 4JPMA 2XA7S 4QHCA 3T4JA 1OPXA 2GJ3A 1K56D 4GN2A 1WE4A 1ONHA 4BL3A 3RXXA 4UA6A 4F3LB 4KZ6A 1K55A 3HJKA 3E4QA 4JXWA 4DJ3A 3V3RA 4GCZA 1BULA 4GOGA 1PZPA 3WRTA 2H28A 3O86A 3EQVA 3SH7A 3WRZA 3C7VA 5HPFA 1D7EA 1XJ4A 4P87A 5GL9A 1MWSA 3N8RA 1ES5A 2WAFA 4S2LA 2GX5A 4PKYA 3QP8A 2YKFA 5AQ9A 5FQKA 1ESUA 5EE8A 4OQGA 4R38A 1MWTA 1VEUB 1T19A 3KYEA 3LI8A 1VETA 3V39A 2ZLYA 5TFQA 3F1PB 4DF6A 2HDSA 4N9LA 4RQ9A 4ZBEA 2AVXA 3UB9A 3EEAA 1XFNA 2H0TA 5HSQA 5FSRA 2W3GA 3Q1FA 1HLUP 2X02A 3ZNTA 4E3OA 4O01A 3PBTA 5FI2A 3EEHA 4UQIM 3PBRA 3N6IA 1OTDA 4DRTA 4I3AA 4UAAA 4XT2A 3HLDA 1XPBA 4X55A 2ZL1B 3IQAA 4JF4A 1Y4OA 4DDYA 1KE0A 2JKTI 2Y59A 3MSHA 1W7FA 2Y2PA 2BASA 1MC0A 3Q7VB 4WL9A 1NRJA 4QB8A 2Y4AA 3H82A 1LSVA 3W2ZA 4II7A 3K3DA 2Y79A 4I3JA 2K31A 1HD8A 4ARZB 5CXWA 2OV5A 5EVIB 1HZOA 4HBUA 3VMAA 1XFQA 2V1AA 2ZQ7A 2UWXA 5DTTA 4EBPA 4KENB 5HFOA 3FG8A 2EX9A 5GHZA 1GCEA 4LPZA 1H5XA 3SS4A 5D3OA 2I72A 3VP3A 1U60A 2J9OA 4OQ0A 1LL5A 1BLSA 3NCKA 4PAUA 4WEKA 1EROA 2Y2OA 1Q2QA 4BQMA 2PRFA 5DJUA 3C38A 3Q82A 3BM6A 1SKOA 3LO7A 5FATA 4ZRRA 4GKUA 3QP4A 3MF0A 2JHEA 3LICA 4WUJA 4KG2A 1MZUA 5J3WA 4P85A 3L9KA 4WMCD 4N1HA 2XEPA 1KVLA 2VJWA 1IYSA 1YLPA 2Z2LB 4IBXA 5AQAA 4Y0UA 1CF0A 3V3SA 5F68A 4N92A 2A49A 5EOEA 1LI9A 4HESA 1YLWA 1M40A 5CHMA 3JVVA 4EV4A 1NXYA 3CG5A 3VSLA 3FKWA 3PAEA 5EPHA 4PHTA 3RTYA 5A92A 1D1JA 1WA9A 4MN7A 4QPRA 3GRJA 2XFTA 2WGWA 3KSGA 1IFQA 4DE0A 2JKRI 4RVAA 3WS2A 4NXBA 2VX8A 3L7HA 1NLYA 3A0SA 1RGYA 3EOIA 3FPVA 1MPLA 4S2PA 4OPZA 3ICYA 5HW3A 4Q8IA 3P09A 5KIZA 1NY0A 2JKRM 3TG9A 1FCOA 2V0WA 3BWLA 4HI4A 4JGPA 2JKGA 3UPOA 1SKOB 3VSKA 2DNSA 2Q9MA 3OPPA 3BFDA 3GR2A 1CEFA 3BECA 4FH4A 2XSSA 3N4IA 2H5SA 1JWPA 1GSXA 4S2KA 4CLCD 2XK1A 1PYYA 1XJ6A 1BLHA 3Q7VA 1LT0A 2A24A 3ZG0A 2IWCA 2ZQ9A 1L0FA 2B02A 1FSWA 1JTGA 4FOFA 3OC2A 3S7NA 5L2FA 1T1BA 3LEQA 1PWDA 1FCNA 3MZDA 4I5SA 1BYWA 4EQIA 3U2AA 3LIEA 4DE3A 5FAPA 5CEBA 4EUVA 1PNEA 4XUXA 4OPQA 1VQQA 3G30A 5L09A 1V9ZA 2OWJA 2PR5A 2MJ6A 1P0ZA 4LGWA 4L9EA 3SH9A 5DF9A 5JYPA 1W8QA 1Z09A 2J80A 4Z9QA 2G2UA 3T4OA 4OVDA 3VOLA 5EM1A 4YNRA 5TR7A 1TS6A 4B93A 5IS1A 2VGKA 3N7WA 1S4RA 3A3DA 5FQQA 2EX2A 1SZVA 3MZEA 4IJGA 2ZM2A 4MN6A 3QP6A 3H82B 3UDFA 5A8BA 4MDZA 5MC7A 2PYPA 3PXPA 4MMNA 3MMHA 5F83A 3VFFA 2ZOIA 3E4OA 1W5DA 2EFXA 2O9BA 2Y2GA 5EOOA 4B4ZA 1K55C 2ZC3B 5FQIA 4X68A 2ZL1A 2HDQA 3DTKA 1KE4A 3S4XA 4OOYA 3VOZA 2P04A 3DTMA 1UGUA 2H10A 1QMEA 3LI9A 4R70A 4JXSA 4LLOB 3VOYA 3WS5A 2QJ5A 4RX2A 4CLCB 3JPUA 1SKFA 2WZZA 1NYYA 1NZOA 4C3QA 2PT7A 1OT6A 4BBUA 2P74A 2Y2IA 2INWA 1KOUA 2HDRA 4MN5A 4GJ4A 4LV1A 4WMCA 4E04A 4HJ3A 4K08A 1OTBA 3RH8B 4WELA 3NECA 4QWOA 2XGNA 1YSPA 3N8SA 5FI7A 4H6JB 2VZWA 1DJCA 3TE8A 4C75A 1YMSA 4UQIS 3OBFA 1HVBA 3H9WA 2Y2JA 2B95A 1AXBA 3PBNA 3RFBA 1S6RA 4DMZA 5FEGA 3BJNA 2HJEA 3T1XA 1FR6A 3S1YA 4LFUA 1T18A 2XQZA 4MNRA 3ZGAB 3ZG9B 4DE1A 5EVEA 2HJ9C 5FQMA 4DDSA 4Y0OA 4OPYA 3MS6A 1S67L 1E25A 1GHMA 2BTFP 3S7PA 3HLEA 1L0GA 2XD5A 4HHDA 2XRNA 1NZUA 3SH8A 1PI4A 4JKTA 3NDGA 2M1CA 1NWZA 1FILA 3WWXA 4GD6A 1K38A 3DBAA 1MBLA 1ZC2A 1K25A 4HP9A 3IHBA 1RCJA 4X56A 1EWZA 3MBZA 1G68A 1LHYA 2XROA 4I38A 4WN5A 5CTNA 2DRWA 1I2WA 2E8JA 2CC1A 1RGZA 1L0EA 2W1TA 1K6RA 4KG6A 1KGFA 2QZ6A 1S0WA 1T1AA 2V9AA 3A3JA 3IHAA 2PD7A 4BJPA 3BQ8A 4NXFA 3P01A 1N9BA 3IF6C 4KZ9A 3EWKA 3DAVA 3MXRA 4IUHA 3A0VA
chains in the Genus database with same CATH topology
4R6LA 3VE4A 3T4TA 2VV7A 3E0YA 3UB8A 2GNXA 4PAUA 3KX0X 3GECA 3OOVA 4WEKA 2PR6A 5G4ZA 5HD5A 2YKHA 2JKTM 3MQQA 4KQOA 4BBTA 3T4KA 3TJZC 5DJUA 3C38A 3R7WB 3R7WA 4YWZA 3GDIA 3CWFA 2I9VA 4ZRRA 2V0UA 3MF0A 1N9LA 2KLIA 1S4SA 1W63Q 2JHEA 3LICA 4WUJA 4Q0JA 1MZUA 1GSWA 5J3WA 1X0OA 5HWVA 2W1RA 4HQAA 2WKRA 2VJWA 3NOPC 3PR6A 1OT9A 2Z6CA 5F69A 3KSHA 5F68A 4IUKA 5CX7A 3G6OA 3VE3A 4G3VA 3OCNA 4EW7A 1OTEA 2CMNA 3JVVA 4EEPA 5AJGA 1VB6A 5HWWA 2G7UA 4ARZA 2W3FA 3T4SA 1W63M 4PHTA 3RTYA 5IT5A 3T50A 3PBSA 1WA9A 2VV8A 4MN7A 1ZTUA 4QPRA 5I5LA 3CLOA 1V9YA 2M7UA 4WLAA 2J3WA 1IFQA 3KSGA 4Y2FA 4P6ZS 2VGLM 2HGVA 3ULFA 2JKRI 4EETB 4ME4A 4NXBA 4OOMA 2VX8A 3MQ0A 1NLYA 3A0SA 2W3DA 2WKQA 3C30A 4ETZA 4BMWA 3FPVA 3EOIA 2HF6A 2KX6A 4LRXC 3ICYA 1NLZA 3BY8A 2QYBA 3A0RA 1ODVA 2ZMVA 2LB5A 5KIZA 4CQHA 4IHQA 2B18A 3KO6A 2JKRM 2NUTC 5HDDA 2HV1A 2V0WA 5C5KA 3BWLA 4HI4A 1TS8A 4JGPA 4GHIB 5J4EA 1YKDA 3F1PA 2W3HA 3KSIA 3BW6A 3LR5A 2K7SA 1Y28A 2KDKA 2XSSA 1S1YA 2JN7A 1G28A 1GSXA 2EA9A 4HJ4A 4O0PA 4HIAA 2KOIA 3LR3A 4NEED 4CLCD 5DKLA 1XJ6A 4L9GA 1LT0A 2W1TB 2A24A 3LR4A 1H3QA 5HL6A 3PHYA 2PYRA 2B02A 2W0NA 4NXGA 5HPIA 4O8GA 4FOFA 3OC2A 1JNUA 3FC7A 3PBOA 3S7NA 3CI6A 5DFXA 3KSFA 3F1NA 1T1BA 3ZQ5A 5HD3A 1P97A 4AFIA 4R3AA 3IBJA 2OAP1 1N9OA 2Z6DA 1F98A 4I5SA 2PDRA 1BYWA 3UE3A 4KUKA 1F5MA 3U2AA 3LIEA 3T4QA 1DP6A 2A2LA 4Q0HA 4EUVA 3MJQA 3PYPA 4GLQA 5TJJA 1V9ZA 2OWJA 2EWWA 2PR5A 2MJ6A 1EW0A 5HDCA 1P0ZA 3B42A 3BY9A 2IA2A 4EQ1A 1GSVA 4EERA 4L9FA 5K5BA 3TRCA 4L9EA 3E4PA 2VV6A 3UMDA 2W27A 3NOUC 3PBQA 5DF9A 2VLGA 4HY8A 2V1BA 1G6OA 1DP8A 1YAXA 1H8MA 1T1CA 2J80A 4LRZE 2WKPA 3T4OA 3EGDC 1LSWA 3UB7A 4XT2B 3VOLA 1OJGA 5DJTA 4YNRA 1DRMA 1TS0A 1TS6A 2VKSA 3H7WA 2OWHA 2L0WA 4B93A 2O9CA 3O5YA 5IS1A 4BBVA 3HCYA 1S4RA 1P9WA 1YSQA 1S1ZA 3F1OB 2J3TD 2QJ7A 4HJ6A 4IJGA 2EWVA 1XJ3A 2O0YA 4MN6A 3K2NA 3CUEC 3LIDA 3H82B 2O99A 5A8BA 4MDZA 5MC7A 3S7OA 4NKPA 4Y3IA 2PYPA 4G3KA 4BWIA 3PXPA 4MMNA 4JGRA 3MMHA 2M7VA 4NXEA 3S7QA 5HDSA 1MKMA 3IS2B 3UMEA 4H6JA 3OLOA 4CLCC 2ZOIA 4GS9B 2VGLS 3BQAA 4G3WA 3E4OA 4CLCA 1IOUA 1LSXA 4Y5FA 4EU0A 3IBRA 2O9BA 4WEJA 5LBRA 5G4YA 3LYXA 3NHQA 2Y8HA 2ZBBA 3CAXA 4GW9A 2VEAA 2GZAA 4UEYA 4EEUA 3CITA 3VV4A 3NJAA 1UWPX 2QWSA 4Z1WA 4L0LA 2J3TC 4LRYC 2P04A 5L8MA 3F1OA 4B9OA 1UGUA 3EQUA 3B33A 3B47A 5KSHA 2K2NA 3KYQA 3LI9A 3MFXA 4R70A 3LIAA 5F6AA 3SW1A 4HP4A 4LLOB 2R78A 2XA7M 4F3LA 3H7WB 1OTIA 2XA7S 4HOIA 3T4JA 1OPXA 2GJ3A 5TBMB 2QJ5A 4CLCB 4F3LB 4GS9A 3HJKA 1STZA 3E4QA 4DJ3A 3NOTC 3D72A 3FPWA 4GCZA 2W3EA 4I3IA 1OTAA 3MR0A 2PT7A 1OT6A 3F1NB 3LFVA 4BBUA 2H28A 3EQVA 3OCLA 2L4RA 2INWA 1KOUA 4MN5A 3KYZA 4GJ4A 5F5YA 5FL3A 5HPFA 5EFWA 1D7EA 2PHYA 1XJ4A 4E04A 4HJ3A 4KUOA 4K08A 2GX5A 2A24B 1OTBA 2QHKA 3EGXC 4P6ZM 4WELA 2NUPC 3RH8B 4PKYA 4KQDA 2YKFA 4DJ2A 4R38A 3K3CA 1DP9A 1YSPA 1UWNX 3MXQA 4H6JB 2VZWA 1T19A 3IS2A 3LI8A 3TE8A 2VA0A 3UE6A 3C2WA 4CLCE 4UQIS 1TS7A 3OBFA 3H9WA 3F1PB 4RQ9A 2QKPA 3PBNA 3RFBA 1ZHHB 1LL8A 3D3OA 4PKYG 3BJNA 4DMZA 2HJEA 3UB9A 2L1MA 3EEAA 5HZHA 2OAQ1 3LUQA 1XFNA 2D01A 3LR0A 5HSQA 4FSFA 2W3GA 3JVUA 1F9IA 1OJ5A 1S66L 5TBMA 1T18A 4M4XA 2ZMFA 3LIFA 1D06A 4O01A 3PBTA 3EEHA 4GHIA 4UQIM 2HJ9C 3PBRA 3TW8A 1OTDA 4JGQA 4HNBA 4I3AA 4I39A 4YOFA 3HJIA 1S67L 4XT2A 3S7PA 2FH5A 2LB9A 2FZ0A 2ZOHA 3R4KA 3V67A 4HHDA 4Q0IA 2XRNA 4EESA 4ETXA 5J7EA 2M1CA 5IU1A 3LIBA 3C8CA 1NWZA 4EXOA 3DBAA 2JKTI 5AVEA 2DMWA 4HP9A 2P7JA 3UB6A 3MQOA 2BASA 1MC0A 5AVFA 1TF1A 1XJ2A 4HH2A 4WL9A 1NRJA 2XROA 4I38A 4WN5A 2D02A 3H82A 2O9AA 3ZYTA 1LSVA 3P7NA 3W2ZA 3K3DA 4I3JA 1N9NA 2K31A 2Y79A 4II7A 1VHMA 4MCWA 4ARZB 2PD8A 2P08A 1P9RA 2W1TA 3E98A 1XFQA 1TD5A 2V1AA 5DFYA 3T4LA 1T1AA 3FG8A 2V9AA 4HH3A 2OOLA 2PD7A 4DN0A 4LPZA 4BJPA 3BQ8A 4JGOA 3CUEA 4NXFA 4OOLA 5HWTA 3P01A 5DKKA 3EWKA 4WF0A 4IUHA 3A0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJG A;  4R6L A;  1YKD A;  3C2W A;  3E0Y A;  4PAU A;  2O0Y A;  3OOV A;  2W3H A;  3K2N A;  3KSI A;  3OBF A;  2O99 A;  4MDZ A;  2XSS A;  4RQ9 A;  3S7O A;  4Y3I A;  3RFB A;  4BWI A;  4G3K A;  3D3O A;  4DMZ A;  3BJN A;  4MMN A;  3EEA A;  3MMH A;  2M7V A;  4O0P A;  3S7Q A;  2KOI A;  1MKM A;  5HSQ A;  4ZRR A;  2W3G A;  3MF0 A;  2KLI A;  2ZMF A;  2W1T B;  4G3W A;  4Q0J A;  5HL6 A;  4Y5F A;  4O01 A;  4EU0 A;  3IBR A;  2O9B A;  5LBR A;  3NHQ A;  2W1R A;  2Y8H A;  4YOF A;  5HPI A;  3NOP C;  2VJW A;  4O8G A;  4FOF A;  4GW9 A;  2VEA A;  3S7N A;  3CI6 A;  5DFX A;  3CIT A;  3KSF A;  3VV4 A;  3S7P A;  2LB9 A;  3ZQ5 A;  3KSH A;  3R4K A;  4IUK A;  4Z1W A;  3G6O A;  4Q0I A;  2XRN A;  4G3V A;  4LRY C;  3IBJ A;  5L8M A;  4ETX A;  5AJG A;  2K2N A;  2G7U A;  1F5M A;  4R70 A;  2W3F A;  3DBA A;  4Q0H A;  4EUV A;  5TJJ A;  4GLQ A;  4MN7 A;  1MC0 A;  1ZTU A;  4QPR A;  5I5L A;  1TF1 A;  1STZ A;  2M7U A;  2IA2 A;  3NOT C;  3KSG A;  5K5B A;  4Y2F A;  2XRO A;  3TRC A;  2HGV A;  2W3E A;  3NOU C;  4ME4 A;  2O9A A;  3MQ0 A;  3W2Z A;  2W3D A;  2Y79 A;  2K31 A;  3LFV A;  4MCW A;  1VHM A;  4ETZ A;  4LRZ E;  4LRX C;  2W1T A;  3E98 A;  1TD5 A;  5DFY A;  5HPF A;  2QYB A;  4YNR A;  2LB5 A;  4E04 A;  2VKS A;  2GX5 A;  2O9C A;  4CQH A;  3O5Y A;  2B18 A;  2OOL A;  4DN0 A;  3KO6 A;  3HCY A;  1YSQ A;  1YSP A;  5C5K A;  2VZW A;  4IUH A; 
#chains in the Genus database with same CATH topology
 3VE4 A;  3AGE A;  3E0Y A;  2EXB A;  2GNX A;  3KX0 X;  4JBF A;  3N8L A;  5HD5 A;  3T1Q B;  1KE3 A;  2JKT M;  3MQQ A;  1W79 A;  4OH0 A;  3BEB A;  3R7W B;  3CWF A;  1FR1 A;  4PM9 A;  2V0U A;  1SDN A;  1W8Y A;  2ZQA A;  1NRF A;  1ZG4 A;  4QD4 A;  2J8Y A;  3IXH A;  5HWV A;  1KGE A;  4KZB A;  3BRM A;  4H8R A;  1G5U A;  4UA9 A;  4G3V A;  3OCN A;  5DVA A;  5GLD A;  4EEP A;  2ZJ9 A;  4ZJ3 A;  5HWW A;  1VET B;  4Y15 A;  5AQB A;  1H8Y A;  1K54 A;  1K4E A;  5CED A;  3D9Y A;  2WZX A;  4X1L A;  1ZTU A;  2M7U A;  4WLA A;  4P6Z S;  1YM1 A;  1YLY A;  3MQ0 A;  2W3D A;  2WKQ A;  3C30 A;  2Q0O A;  4HBT A;  1BZA A;  3UO9 A;  3A0R A;  1ODV A;  2V20 A;  3IWI A;  1PW8 A;  4CQH A;  4IHQ A;  2B18 A;  4PPR A;  1GA0 A;  2NUT C;  4WZ5 A;  1TS8 A;  1KDS A;  4D2O A;  5J4E A;  3UB5 P;  4PM8 A;  4QY6 A;  4IVI A;  3F1P A;  2W3H A;  3IX8 A;  3KSI A;  5GHY A;  3CPT B;  5GLA A;  4IED A;  2K7S A;  3IWO A;  3IX4 A;  5CER A;  1F2K A;  4O0P A;  2JCH A;  4HIA A;  4X1M A;  5DKL A;  2ZC4 B;  3ZG7 B;  5M18 A;  2ZC7 A;  2W1T B;  1L3L A;  3LR4 A;  5DTK A;  1H3Q A;  3UPN A;  2PYR A;  1ES4 A;  4R3B A;  1E3U D;  1OME A;  3PBO A;  2ZD8 A;  3VFH A;  3KSF A;  3ZQ5 A;  5HD3 A;  1P97 A;  4AFI A;  2V8F A;  4S2N A;  4R3A A;  3IBJ A;  1FCM A;  1FSY A;  1F98 A;  2DCF A;  3E2K A;  4KUK A;  1F5M A;  1K56 A;  2VK3 A;  3CHW P;  2QMI A;  3T4Q A;  1DP6 A;  3IWQ A;  1IYP A;  5EM0 A;  1BLP A;  1K57 C;  4GLQ A;  4PM7 A;  3T1R A;  3MZF A;  1CQA A;  1EW0 A;  3BY9 A;  1H8Z A;  1GSV A;  5FDS A;  2ZM0 A;  1MKI A;  2VV6 A;  3UMD A;  4HY8 A;  3C4P A;  4S2N C;  4S2I A;  4FCF A;  4YIN A;  3EGD C;  1LI0 A;  4D60 A;  1DRM A;  2VKS A;  5E2F A;  2OWH A;  3IXD A;  1WYC A;  3HCY A;  1DY6 A;  4LEN A;  5F1G A;  3NUL A;  1S1Z A;  3G2Y A;  3FZC A;  2XLN A;  5M1A A;  1PFL A;  2HPB A;  2O0Y A;  2PAV P;  3Q07 A;  2BLS A;  3UE1 A;  4E6X A;  2M7V A;  4NXE A;  3MXS A;  3NDE A;  5CGW A;  4WZ4 A;  1MKM A;  5FQJ A;  1CK3 A;  1TDG A;  3OLO A;  4MBK A;  4CLC C;  5KSC A;  3O88 A;  2VGL S;  3BQA A;  1LSX A;  4Y5F A;  4EU0 A;  3E2L A;  4WEJ A;  3LYX A;  4BEN A;  4ZJ1 A;  4DE2 A;  2VEA A;  2GZA A;  3LY3 A;  2QWS A;  3GMW A;  4R3J A;  4B9O A;  4GDB A;  3HUN A;  5F6A A;  2R78 A;  3H7W B;  4RA7 A;  1IKI A;  3DW0 A;  4KQR A;  1FIK A;  2WYX A;  4GS9 A;  3G2Z A;  1STZ A;  5FDH A;  3D72 A;  3FPW A;  1GA9 A;  3LGO A;  1SDE A;  5EUA A;  1YT4 A;  3LFV A;  3OCL A;  4OQI A;  5FL3 A;  3HLW A;  3S22 A;  3O87 A;  2PHY A;  1XKZ A;  1ALQ A;  4KUO A;  1PZO A;  2A24 B;  3NI9 A;  2OLU A;  3EGX C;  4O7D A;  3MKF A;  4CPK A;  3UPP A;  3K3C A;  3RXW A;  3MXQ A;  3HL9 A;  3M6B A;  1I5Q A;  1PRQ A;  5BOH A;  3IS2 A;  1YLZ A;  2OLV A;  4OLG A;  3MFD A;  4CLC E;  3TOI A;  5HAI A;  2ZQC A;  3HVF A;  3P98 A;  4KZ5 A;  2QKP A;  4PKY G;  3D3O A;  2GDN A;  5HZH A;  2OAQ 1;  2J7V A;  2D01 A;  1QMF A;  4ESP A;  1OJ5 A;  1S66 L;  4MEZ A;  5TBM A;  4M4X A;  2ZMF A;  4R1G A;  3HRE A;  3IF6 A;  5U47 A;  3CJM A;  4PM6 A;  3WS1 A;  3TW8 A;  2C5W B;  4JGQ A;  4HNB A;  4YOF A;  3M2J A;  1KDW A;  3HJI A;  1C3B A;  3Q81 A;  3MKE A;  1PW1 A;  2FH5 A;  3BFG A;  3DTI A;  3OPR A;  2FZ0 A;  3SOI A;  3R4K A;  3V67 A;  4Q0I A;  4EES A;  1ES3 A;  5J7E A;  4KZ8 A;  1AWI A;  2DMW A;  5CRF A;  2P7J A;  1JTD A;  3UB6 A;  4ZTK A;  3MQO A;  3UN7 A;  5AVF A;  4IBR A;  2XF3 A;  1XJ2 A;  3BFF A;  4GNU A;  3VP4 A;  2X01 A;  3V50 A;  2D02 A;  2O9A A;  3P7N A;  1MXO A;  1G6A A;  3VP2 A;  2PD8 A;  2P08 A;  3QNB A;  3E98 A;  4EBN A;  3UNW A;  1TD5 A;  4K0W A;  4BLM A;  3ZVW A;  3OPL A;  4QU3 A;  3D4F A;  5EVL A;  3DWK A;  2XFS A;  3CUE A;  5HWT A;  3AGD A;  1L0D A;  3ZG8 B;  4WF0 A;  4NET A;  4PM5 A;  1DJA A;  4HEF A;  3T4T A;  1HTZ A;  3UB8 A;  3GEC A;  3OOV A;  1IEM A;  3UE0 A;  2PR6 A;  2IWB A;  2YKH A;  1YLJ A;  4BBT A;  2PU2 A;  3T4K A;  3R7W A;  4YWZ A;  2I9V A;  3RJU A;  5CHU A;  3M2K A;  2HP9 A;  4S2O A;  4GD8 A;  2KLI A;  1S4S A;  1W63 Q;  4E3I A;  4Q0J A;  3U4L P;  3BFE A;  2W1R A;  2WKR A;  3W4O A;  2WGW B;  1PWG A;  3SZT A;  4U0X A;  5KMW A;  1IEL A;  3KSH A;  1NYM A;  4IUK A;  1SHV A;  3VE3 A;  4XXR A;  1PI5 A;  1OTE A;  1CJF A;  1VB6 A;  3T4S A;  1W63 M;  4Y7P A;  4LV2 A;  4S2J A;  5KZH A;  3LEZ A;  3T50 A;  2P9V A;  3GV9 A;  2OSU A;  3BLM A;  3FKV A;  4X6T A;  4Y2F A;  2VGL M;  5L07 A;  3ULF A;  2G2W A;  4EET B;  3LY4 A;  4FD8 A;  1FQG A;  4R0Q A;  4ETZ A;  4BMW A;  3QP2 A;  2HF6 A;  1ERQ A;  4LRX C;  1BLC A;  1ACF A;  1KVM A;  2QYB A;  2ZMV A;  2LB5 A;  3SS5 A;  2Y2Q A;  3WS4 A;  2RL3 A;  5J8X A;  3KO6 A;  5E2E A;  5DF8 A;  5HDD A;  5C5K A;  4FTX A;  2PU4 A;  3HLB A;  3BW6 A;  1IKG A;  2ZQD A;  1VM1 A;  1J9M A;  1Y28 A;  2KDK A;  2Y2M A;  3PTE A;  1Z6F A;  4HJ4 A;  3IT9 A;  2KOI A;  1Q2P A;  3LR3 A;  5EV0 A;  1PWC A;  2H0Y A;  4NEE D;  4L9G A;  3UDI A;  1K6S A;  5FAS A;  2ACG A;  4UHU A;  1BTL A;  3ZHH A;  5EVI A;  5HL6 A;  3PHY A;  2EX6 A;  3HLF A;  4OKP A;  2W0N A;  4JLF A;  4JXV A;  4NXG A;  4O8G A;  2WGV A;  4OP8 A;  4Y0T A;  5HL1 A;  3WS0 A;  4KZ4 A;  2A3U A;  3IX3 A;  4N9K A;  3SS3 A;  1MWU A;  3HLG A;  5E2G A;  3IF5 A;  3W4Q A;  3A3E A;  1VEU A;  3QP5 A;  4U0T A;  3JYI A;  5CEC A;  3UE3 A;  3QNC A;  5EVI D;  2ZM8 A;  4GDN A;  4Q0H A;  3UDX A;  3ZCZ A;  3MJQ A;  1ZKJ A;  4WYY A;  3PYP A;  2EWW A;  3BYD A;  3PAG A;  3IXB A;  2Y2H A;  2EXA A;  4EER A;  5K5B A;  3E4P A;  2W27 A;  3NOU C;  4OLD A;  2VLG A;  2V1B A;  4ZAM A;  1YAX A;  1H8M A;  1T1C A;  4LRZ E;  2WKH A;  2WKP A;  1GHI A;  1GHP A;  2HZ5 A;  4RX3 A;  3UB7 A;  2XDM A;  3M6H A;  1LLB A;  5E2H A;  4M3K A;  2L0W A;  1YMX A;  2O9C A;  3O5Y A;  2XR0 A;  4JF6 A;  3IF6 B;  1P9W A;  2JE5 A;  2QJ7 A;  1ESI A;  4HJ6 A;  4B4X A;  1LL9 A;  5AQ7 A;  2XD1 A;  4QJG A;  4BD1 A;  3K2N A;  3CUE C;  3LID A;  2X71 A;  4ZJ2 A;  5CGS A;  2PBY A;  3S7O A;  4NKP A;  4Y3I A;  2WK0 A;  4JGR A;  1XA7 A;  3FV7 A;  1N4O A;  5HDS A;  3IS2 B;  3UME A;  3G31 A;  4GS9 B;  3G34 A;  4CLC A;  4G3W A;  1IOU A;  4K91 A;  5LBR A;  3NHQ A;  2Y8H A;  2ZBB A;  3ZNY A;  2BG1 A;  4DXC A;  4GW9 A;  4WBG A;  4UEY A;  3CIT A;  1O7E A;  3NJA A;  1UWP X;  2J9P A;  4E3L A;  1ERM A;  4LRY C;  3F1O A;  4DKI A;  3B33 A;  2K2N A;  2Z2M B;  3FYZ A;  3SW1 A;  3LIA A;  3I7J A;  4HP4 A;  2HDU A;  1OTI A;  4HOI A;  5TBM B;  3B3X A;  4PMA A;  5A93 A;  4C6Y A;  5F82 A;  5I94 A;  3NOT C;  5F1F A;  2EFU A;  2W3E A;  2C6W B;  1OTA A;  2FFY A;  4I3I A;  4WM9 A;  3MR0 A;  4E3N A;  4CJN A;  4KQQ A;  3F1N B;  2L4R A;  4XUZ A;  4KZA A;  4E3J A;  3VP1 A;  3KYZ A;  1WYB A;  3CZD A;  5F5Y A;  5TGF A;  5EFW A;  5CHJ A;  3TSG A;  5EVI C;  4MLL A;  5E43 A;  2UV0 E;  2QHK A;  4P6Z M;  2NUP C;  4DXB A;  4ZDX A;  4KQD A;  1TVF A;  4DJ2 A;  1DP9 A;  3ITB A;  1UWN X;  3C4O A;  4MBF A;  2IWD A;  3GTC A;  2VA0 A;  1K4F A;  3C5A A;  3UE6 A;  3C2W A;  5HAQ A;  1TS7 A;  4EWF A;  1XGJ A;  3G4P A;  1ZHH B;  1LL8 A;  3QP1 A;  2L1M A;  3LUQ A;  3LR0 A;  4FSF A;  3ZFZ A;  3JVU A;  1F9I A;  1CI9 A;  3LIF A;  1D06 A;  1XX2 A;  3HBR A;  4JF5 A;  5FQ9 A;  4GHI A;  2HP5 A;  1M6K A;  1Y54 A;  4I39 A;  4U3T A;  1YPR A;  2LB9 A;  3OPH A;  3VP0 A;  5FAQ A;  3V5M A;  2ZOH A;  4GB7 A;  2V1Z A;  2WUQ A;  5CGX A;  4ETX A;  5IU1 A;  4X25 A;  3LIB A;  1RP5 A;  3C8C A;  1ES2 A;  4EXO A;  4K0X A;  5AVE A;  2P9V B;  4KZ3 A;  1CEG A;  1NJ4 A;  4E6W A;  2B5R A;  3C7U A;  3G32 A;  1TF1 A;  3HUO A;  4HH2 A;  1E3U A;  2Y2N A;  1BUE A;  3ZYT A;  1H0M A;  1ONG A;  1TEM A;  1IYO A;  2EX8 A;  1N9N A;  4MCW A;  1VHM A;  3GQZ A;  5L10 A;  5FAO A;  3W4P A;  2VGJ A;  1P9R A;  3LCE A;  3NY4 A;  3FWL A;  5DFY A;  3T4L A;  5A90 A;  4UA7 A;  4EUZ A;  4ID4 A;  3NC8 A;  4HH3 A;  2OOL A;  4DN0 A;  4JGO A;  3A3F A;  4OOL A;  2Y2K A;  5DKK A;  3GSG A;  4R6L A;  2VV7 A;  4WZ5 C;  5G18 A;  5G4Z A;  1PIO A;  4KQO A;  2Q9N A;  3TJZ C;  2PBD P;  1JWV A;  3CPT A;  2ZMA A;  2WGI A;  4FH2 A;  3GDI A;  1XA1 A;  2ZC6 B;  2RCX A;  4NG2 A;  1N9L A;  1A0K A;  2WAE A;  1GSW A;  5IHV A;  1X0O A;  4YFM A;  3BFC A;  4HQA A;  3NOP C;  2JBF A;  3DWZ A;  3PR6 A;  4R23 A;  1OT9 A;  2Z6C A;  5F69 A;  5CX7 A;  3G6O A;  1JWZ A;  5HX9 A;  4EW7 A;  3T12 B;  2CMN A;  4OPR A;  5AJG A;  2G7U A;  4ARZ A;  4X69 A;  3ZDJ A;  2W3F A;  4IVK A;  5A91 A;  5DTS A;  2FFF B;  5IT5 A;  3PBS A;  2VV8 A;  4B88 A;  1K54 C;  5I5L A;  3CLO A;  1V9Y A;  4QY5 A;  1XXM A;  2J3W A;  4P0M A;  2HGV A;  2XH9 A;  4ME4 A;  1SCW A;  4OOM A;  4JXG A;  5EEC A;  1TDL A;  3W8K A;  1J3W A;  2KX6 A;  3IXG A;  1NLZ A;  2ZC5 B;  3BY8 A;  5HAP A;  4Y13 A;  3QHY A;  4E3M A;  1BT5 A;  2HV1 A;  1L2S A;  4GHI B;  5DF7 A;  1O07 A;  1FOF A;  1YKD A;  4KZ7 A;  1YQS A;  3LR5 A;  2V2F F;  4A5R A;  1S1Y A;  2WKI A;  4OON A;  2JN7 A;  1G28 A;  2EA9 A;  2JC7 A;  4EBL A;  1KGG A;  2QPN A;  4BD0 A;  1K57 A;  3AGF A;  3ZG5 A;  3ITA A;  4E3K A;  4LCL A;  2V8C A;  5HPI A;  4Y17 A;  4F94 A;  3Q7Z A;  5HAR A;  1JNU A;  3FC7 A;  4R4R A;  1CI8 A;  3CI6 A;  5DFX A;  3F1N A;  2WKE A;  2OAP 1;  1N9O A;  2Z6D A;  1XP4 A;  2PDR A;  5JYO A;  3OZH A;  2Y91 A;  3CMZ A;  4KG5 A;  2R9X A;  2A2L A;  2E8I A;  3IH9 A;  3BLS A;  4FUW A;  5TJJ A;  2JKF A;  1E4D A;  3HUM A;  5GLC A;  1IYQ A;  1K0K A;  5HDC A;  3B42 A;  1DJB A;  2IA2 A;  5GLB A;  4EQ1 A;  4MBH A;  4L9F A;  3HLC A;  3TRC A;  3PBQ A;  3ZVT A;  1G6O A;  1DP8 A;  4OQH A;  4BL2 A;  1EI5 A;  5FI6 A;  4R4S A;  5FEF A;  1LSW A;  5FA7 A;  4XT2 B;  1OJG A;  4LV0 A;  4N1X A;  1BSG A;  5DJT A;  1TS0 A;  3H7W A;  3ISG A;  4GZB A;  1XGI A;  3G35 A;  4BBV A;  1YLT A;  1YSQ A;  3F1O B;  3IH8 A;  2J3T D;  1MY8 A;  1I2S A;  1JVJ A;  2EWV A;  1XJ3 A;  3GVB A;  2Y2L A;  2R9W A;  2O99 A;  4LCM A;  4BWI A;  4G3K A;  1ZG6 A;  3S7Q A;  3NIA A;  4H6J A;  2Y55 A;  3DTE A;  5GHX A;  3IBR A;  3T1S A;  3UY6 A;  5G4Y A;  2WAD A;  3CAX A;  4S2M A;  1MWR A;  4X53 A;  4EEU A;  4NK3 A;  3VV4 A;  5M19 A;  5CTM A;  2HP6 A;  4Z1W A;  4L0L A;  4RYE A;  2J3T C;  2ZQ8 A;  3NBL A;  4OP5 A;  5L8M A;  4LV3 A;  3O3V A;  3EQU A;  3B47 A;  5KSH A;  3KYQ A;  3MFX A;  4P6B A;  2XA7 M;  4F3L A;  3A3I A;  4JPM A;  2XA7 S;  4QHC A;  3T4J A;  1OPX A;  2GJ3 A;  1K56 D;  4GN2 A;  1WE4 A;  1ONH A;  4BL3 A;  3RXX A;  4UA6 A;  4F3L B;  4KZ6 A;  1K55 A;  3HJK A;  3E4Q A;  4JXW A;  4DJ3 A;  3V3R A;  4GCZ A;  1BUL A;  4GOG A;  1PZP A;  3WRT A;  2H28 A;  3O86 A;  3EQV A;  3SH7 A;  3WRZ A;  3C7V A;  5HPF A;  1D7E A;  1XJ4 A;  4P87 A;  5GL9 A;  1MWS A;  3N8R A;  1ES5 A;  2WAF A;  4S2L A;  2GX5 A;  4PKY A;  3QP8 A;  2YKF A;  5AQ9 A;  5FQK A;  1ESU A;  5EE8 A;  4OQG A;  4R38 A;  1MWT A;  1VEU B;  1T19 A;  3KYE A;  3LI8 A;  1VET A;  3V39 A;  2ZLY A;  5TFQ A;  3F1P B;  4DF6 A;  2HDS A;  4N9L A;  4RQ9 A;  4ZBE A;  2AVX A;  3UB9 A;  3EEA A;  1XFN A;  2H0T A;  5HSQ A;  5FSR A;  2W3G A;  3Q1F A;  1HLU P;  2X02 A;  3ZNT A;  4E3O A;  4O01 A;  3PBT A;  5FI2 A;  3EEH A;  4UQI M;  3PBR A;  3N6I A;  1OTD A;  4DRT A;  4I3A A;  4UAA A;  4XT2 A;  3HLD A;  1XPB A;  4X55 A;  2ZL1 B;  3IQA A;  4JF4 A;  1Y4O A;  4DDY A;  1KE0 A;  2JKT I;  2Y59 A;  3MSH A;  1W7F A;  2Y2P A;  2BAS A;  1MC0 A;  3Q7V B;  4WL9 A;  1NRJ A;  4QB8 A;  2Y4A A;  3H82 A;  1LSV A;  3W2Z A;  4II7 A;  3K3D A;  2Y79 A;  4I3J A;  2K31 A;  1HD8 A;  4ARZ B;  5CXW A;  2OV5 A;  5EVI B;  1HZO A;  4HBU A;  3VMA A;  1XFQ A;  2V1A A;  2ZQ7 A;  2UWX A;  5DTT A;  4EBP A;  4KEN B;  5HFO A;  3FG8 A;  2EX9 A;  5GHZ A;  1GCE A;  4LPZ A;  1H5X A;  3SS4 A;  5D3O A;  2I72 A;  3VP3 A;  1U60 A;  2J9O A;  4OQ0 A;  1LL5 A;  1BLS A;  3NCK A;  4PAU A;  4WEK A;  1ERO A;  2Y2O A;  1Q2Q A;  4BQM A;  2PRF A;  5DJU A;  3C38 A;  3Q82 A;  3BM6 A;  1SKO A;  3LO7 A;  5FAT A;  4ZRR A;  4GKU A;  3QP4 A;  3MF0 A;  2JHE A;  3LIC A;  4WUJ A;  4KG2 A;  1MZU A;  5J3W A;  4P85 A;  3L9K A;  4WMC D;  4N1H A;  2XEP A;  1KVL A;  2VJW A;  1IYS A;  1YLP A;  2Z2L B;  4IBX A;  5AQA A;  4Y0U A;  1CF0 A;  3V3S A;  5F68 A;  4N92 A;  2A49 A;  5EOE A;  1LI9 A;  4HES A;  1YLW A;  1M40 A;  5CHM A;  3JVV A;  4EV4 A;  1NXY A;  3CG5 A;  3VSL A;  3FKW A;  3PAE A;  5EPH A;  4PHT A;  3RTY A;  5A92 A;  1D1J A;  1WA9 A;  4MN7 A;  4QPR A;  3GRJ A;  2XFT A;  2WGW A;  3KSG A;  1IFQ A;  4DE0 A;  2JKR I;  4RVA A;  3WS2 A;  4NXB A;  2VX8 A;  3L7H A;  1NLY A;  3A0S A;  1RGY A;  3EOI A;  3FPV A;  1MPL A;  4S2P A;  4OPZ A;  3ICY A;  5HW3 A;  4Q8I A;  3P09 A;  5KIZ A;  1NY0 A;  2JKR M;  3TG9 A;  1FCO A;  2V0W A;  3BWL A;  4HI4 A;  4JGP A;  2JKG A;  3UPO A;  1SKO B;  3VSK A;  2DNS A;  2Q9M A;  3OPP A;  3BFD A;  3GR2 A;  1CEF A;  3BEC A;  4FH4 A;  2XSS A;  3N4I A;  2H5S A;  1JWP A;  1GSX A;  4S2K A;  4CLC D;  2XK1 A;  1PYY A;  1XJ6 A;  1BLH A;  3Q7V A;  1LT0 A;  2A24 A;  3ZG0 A;  2IWC A;  2ZQ9 A;  1L0F A;  2B02 A;  1FSW A;  1JTG A;  4FOF A;  3OC2 A;  3S7N A;  5L2F A;  1T1B A;  3LEQ A;  1PWD A;  1FCN A;  3MZD A;  4I5S A;  1BYW A;  4EQI A;  3U2A A;  3LIE A;  4DE3 A;  5FAP A;  5CEB A;  4EUV A;  1PNE A;  4XUX A;  4OPQ A;  1VQQ A;  3G30 A;  5L09 A;  1V9Z A;  2OWJ A;  2PR5 A;  2MJ6 A;  1P0Z A;  4LGW A;  4L9E A;  3SH9 A;  5DF9 A;  5JYP A;  1W8Q A;  1Z09 A;  2J80 A;  4Z9Q A;  2G2U A;  3T4O A;  4OVD A;  3VOL A;  5EM1 A;  4YNR A;  5TR7 A;  1TS6 A;  4B93 A;  5IS1 A;  2VGK A;  3N7W A;  1S4R A;  3A3D A;  5FQQ A;  2EX2 A;  1SZV A;  3MZE A;  4IJG A;  2ZM2 A;  4MN6 A;  3QP6 A;  3H82 B;  3UDF A;  5A8B A;  4MDZ A;  5MC7 A;  2PYP A;  3PXP A;  4MMN A;  3MMH A;  5F83 A;  3VFF A;  2ZOI A;  3E4O A;  1W5D A;  2EFX A;  2O9B A;  2Y2G A;  5EOO A;  4B4Z A;  1K55 C;  2ZC3 B;  5FQI A;  4X68 A;  2ZL1 A;  2HDQ A;  3DTK A;  1KE4 A;  3S4X A;  4OOY A;  3VOZ A;  2P04 A;  3DTM A;  1UGU A;  2H10 A;  1QME A;  3LI9 A;  4R70 A;  4JXS A;  4LLO B;  3VOY A;  3WS5 A;  2QJ5 A;  4RX2 A;  4CLC B;  3JPU A;  1SKF A;  2WZZ A;  1NYY A;  1NZO A;  4C3Q A;  2PT7 A;  1OT6 A;  4BBU A;  2P74 A;  2Y2I A;  2INW A;  1KOU A;  2HDR A;  4MN5 A;  4GJ4 A;  4LV1 A;  4WMC A;  4E04 A;  4HJ3 A;  4K08 A;  1OTB A;  3RH8 B;  4WEL A;  3NEC A;  4QWO A;  2XGN A;  1YSP A;  3N8S A;  5FI7 A;  4H6J B;  2VZW A;  1DJC A;  3TE8 A;  4C75 A;  1YMS A;  4UQI S;  3OBF A;  1HVB A;  3H9W A;  2Y2J A;  2B95 A;  1AXB A;  3PBN A;  3RFB A;  1S6R A;  4DMZ A;  5FEG A;  3BJN A;  2HJE A;  3T1X A;  1FR6 A;  3S1Y A;  4LFU A;  1T18 A;  2XQZ A;  4MNR A;  3ZGA B;  3ZG9 B;  4DE1 A;  5EVE A;  2HJ9 C;  5FQM A;  4DDS A;  4Y0O A;  4OPY A;  3MS6 A;  1S67 L;  1E25 A;  1GHM A;  2BTF P;  3S7P A;  3HLE A;  1L0G A;  2XD5 A;  4HHD A;  2XRN A;  1NZU A;  3SH8 A;  1PI4 A;  4JKT A;  3NDG A;  2M1C A;  1NWZ A;  1FIL A;  3WWX A;  4GD6 A;  1K38 A;  3DBA A;  1MBL A;  1ZC2 A;  1K25 A;  4HP9 A;  3IHB A;  1RCJ A;  4X56 A;  1EWZ A;  3MBZ A;  1G68 A;  1LHY A;  2XRO A;  4I38 A;  4WN5 A;  5CTN A;  2DRW A;  1I2W A;  2E8J A;  2CC1 A;  1RGZ A;  1L0E A;  2W1T A;  1K6R A;  4KG6 A;  1KGF A;  2QZ6 A;  1S0W A;  1T1A A;  2V9A A;  3A3J A;  3IHA A;  2PD7 A;  4BJP A;  3BQ8 A;  4NXF A;  3P01 A;  1N9B A;  3IF6 C;  4KZ9 A;  3EWK A;  3DAV A;  3MXR A;  4IUH A;  3A0V A; 
#chains in the Genus database with same CATH homology
 4R6L A;  3VE4 A;  3T4T A;  2VV7 A;  3E0Y A;  3UB8 A;  2GNX A;  4PAU A;  3KX0 X;  3GEC A;  3OOV A;  4WEK A;  2PR6 A;  5G4Z A;  5HD5 A;  2YKH A;  2JKT M;  3MQQ A;  4KQO A;  4BBT A;  3T4K A;  3TJZ C;  5DJU A;  3C38 A;  3R7W B;  3R7W A;  4YWZ A;  3GDI A;  3CWF A;  2I9V A;  4ZRR A;  2V0U A;  3MF0 A;  1N9L A;  2KLI A;  1S4S A;  1W63 Q;  2JHE A;  3LIC A;  4WUJ A;  4Q0J A;  1MZU A;  1GSW A;  5J3W A;  1X0O A;  5HWV A;  2W1R A;  4HQA A;  2WKR A;  2VJW A;  3NOP C;  3PR6 A;  1OT9 A;  2Z6C A;  5F69 A;  3KSH A;  5F68 A;  4IUK A;  5CX7 A;  3G6O A;  3VE3 A;  4G3V A;  3OCN A;  4EW7 A;  1OTE A;  2CMN A;  3JVV A;  4EEP A;  5AJG A;  1VB6 A;  5HWW A;  2G7U A;  4ARZ A;  2W3F A;  3T4S A;  1W63 M;  4PHT A;  3RTY A;  5IT5 A;  3T50 A;  3PBS A;  1WA9 A;  2VV8 A;  4MN7 A;  1ZTU A;  4QPR A;  5I5L A;  3CLO A;  1V9Y A;  2M7U A;  4WLA A;  2J3W A;  1IFQ A;  3KSG A;  4Y2F A;  4P6Z S;  2VGL M;  2HGV A;  3ULF A;  2JKR I;  4EET B;  4ME4 A;  4NXB A;  4OOM A;  2VX8 A;  3MQ0 A;  1NLY A;  3A0S A;  2W3D A;  2WKQ A;  3C30 A;  4ETZ A;  4BMW A;  3FPV A;  3EOI A;  2HF6 A;  2KX6 A;  4LRX C;  3ICY A;  1NLZ A;  3BY8 A;  2QYB A;  3A0R A;  1ODV A;  2ZMV A;  2LB5 A;  5KIZ A;  4CQH A;  4IHQ A;  2B18 A;  3KO6 A;  2JKR M;  2NUT C;  5HDD A;  2HV1 A;  2V0W A;  5C5K A;  3BWL A;  4HI4 A;  1TS8 A;  4JGP A;  4GHI B;  5J4E A;  1YKD A;  3F1P A;  2W3H A;  3KSI A;  3BW6 A;  3LR5 A;  2K7S A;  1Y28 A;  2KDK A;  2XSS A;  1S1Y A;  2JN7 A;  1G28 A;  1GSX A;  2EA9 A;  4HJ4 A;  4O0P A;  4HIA A;  2KOI A;  3LR3 A;  4NEE D;  4CLC D;  5DKL A;  1XJ6 A;  4L9G A;  1LT0 A;  2W1T B;  2A24 A;  3LR4 A;  1H3Q A;  5HL6 A;  3PHY A;  2PYR A;  2B02 A;  2W0N A;  4NXG A;  5HPI A;  4O8G A;  4FOF A;  3OC2 A;  1JNU A;  3FC7 A;  3PBO A;  3S7N A;  3CI6 A;  5DFX A;  3KSF A;  3F1N A;  1T1B A;  3ZQ5 A;  5HD3 A;  1P97 A;  4AFI A;  4R3A A;  3IBJ A;  2OAP 1;  1N9O A;  2Z6D A;  1F98 A;  4I5S A;  2PDR A;  1BYW A;  3UE3 A;  4KUK A;  1F5M A;  3U2A A;  3LIE A;  3T4Q A;  1DP6 A;  2A2L A;  4Q0H A;  4EUV A;  3MJQ A;  3PYP A;  4GLQ A;  5TJJ A;  1V9Z A;  2OWJ A;  2EWW A;  2PR5 A;  2MJ6 A;  1EW0 A;  5HDC A;  1P0Z A;  3B42 A;  3BY9 A;  2IA2 A;  4EQ1 A;  1GSV A;  4EER A;  4L9F A;  5K5B A;  3TRC A;  4L9E A;  3E4P A;  2VV6 A;  3UMD A;  2W27 A;  3NOU C;  3PBQ A;  5DF9 A;  2VLG A;  4HY8 A;  2V1B A;  1G6O A;  1DP8 A;  1YAX A;  1H8M A;  1T1C A;  2J80 A;  4LRZ E;  2WKP A;  3T4O A;  3EGD C;  1LSW A;  3UB7 A;  4XT2 B;  3VOL A;  1OJG A;  5DJT A;  4YNR A;  1DRM A;  1TS0 A;  1TS6 A;  2VKS A;  3H7W A;  2OWH A;  2L0W A;  4B93 A;  2O9C A;  3O5Y A;  5IS1 A;  4BBV A;  3HCY A;  1S4R A;  1P9W A;  1YSQ A;  1S1Z A;  3F1O B;  2J3T D;  2QJ7 A;  4HJ6 A;  4IJG A;  2EWV A;  1XJ3 A;  2O0Y A;  4MN6 A;  3K2N A;  3CUE C;  3LID A;  3H82 B;  2O99 A;  5A8B A;  4MDZ A;  5MC7 A;  3S7O A;  4NKP A;  4Y3I A;  2PYP A;  4G3K A;  4BWI A;  3PXP A;  4MMN A;  4JGR A;  3MMH A;  2M7V A;  4NXE A;  3S7Q A;  5HDS A;  1MKM A;  3IS2 B;  3UME A;  4H6J A;  3OLO A;  4CLC C;  2ZOI A;  4GS9 B;  2VGL S;  3BQA A;  4G3W A;  3E4O A;  4CLC A;  1IOU A;  1LSX A;  4Y5F A;  4EU0 A;  3IBR A;  2O9B A;  4WEJ A;  5LBR A;  5G4Y A;  3LYX A;  3NHQ A;  2Y8H A;  2ZBB A;  3CAX A;  4GW9 A;  2VEA A;  2GZA A;  4UEY A;  4EEU A;  3CIT A;  3VV4 A;  3NJA A;  1UWP X;  2QWS A;  4Z1W A;  4L0L A;  2J3T C;  4LRY C;  2P04 A;  5L8M A;  3F1O A;  4B9O A;  1UGU A;  3EQU A;  3B33 A;  3B47 A;  5KSH A;  2K2N A;  3KYQ A;  3LI9 A;  3MFX A;  4R70 A;  3LIA A;  5F6A A;  3SW1 A;  4HP4 A;  4LLO B;  2R78 A;  2XA7 M;  4F3L A;  3H7W B;  1OTI A;  2XA7 S;  4HOI A;  3T4J A;  1OPX A;  2GJ3 A;  5TBM B;  2QJ5 A;  4CLC B;  4F3L B;  4GS9 A;  3HJK A;  1STZ A;  3E4Q A;  4DJ3 A;  3NOT C;  3D72 A;  3FPW A;  4GCZ A;  2W3E A;  4I3I A;  1OTA A;  3MR0 A;  2PT7 A;  1OT6 A;  3F1N B;  3LFV A;  4BBU A;  2H28 A;  3EQV A;  3OCL A;  2L4R A;  2INW A;  1KOU A;  4MN5 A;  3KYZ A;  4GJ4 A;  5F5Y A;  5FL3 A;  5HPF A;  5EFW A;  1D7E A;  2PHY A;  1XJ4 A;  4E04 A;  4HJ3 A;  4KUO A;  4K08 A;  2GX5 A;  2A24 B;  1OTB A;  2QHK A;  3EGX C;  4P6Z M;  4WEL A;  2NUP C;  3RH8 B;  4PKY A;  4KQD A;  2YKF A;  4DJ2 A;  4R38 A;  3K3C A;  1DP9 A;  1YSP A;  1UWN X;  3MXQ A;  4H6J B;  2VZW A;  1T19 A;  3IS2 A;  3LI8 A;  3TE8 A;  2VA0 A;  3UE6 A;  3C2W A;  4CLC E;  4UQI S;  1TS7 A;  3OBF A;  3H9W A;  3F1P B;  4RQ9 A;  2QKP A;  3PBN A;  3RFB A;  1ZHH B;  1LL8 A;  3D3O A;  4PKY G;  3BJN A;  4DMZ A;  2HJE A;  3UB9 A;  2L1M A;  3EEA A;  5HZH A;  2OAQ 1;  3LUQ A;  1XFN A;  2D01 A;  3LR0 A;  5HSQ A;  4FSF A;  2W3G A;  3JVU A;  1F9I A;  1OJ5 A;  1S66 L;  5TBM A;  1T18 A;  4M4X A;  2ZMF A;  3LIF A;  1D06 A;  4O01 A;  3PBT A;  3EEH A;  4GHI A;  4UQI M;  2HJ9 C;  3PBR A;  3TW8 A;  1OTD A;  4JGQ A;  4HNB A;  4I3A A;  4I39 A;  4YOF A;  3HJI A;  1S67 L;  4XT2 A;  3S7P A;  2FH5 A;  2LB9 A;  2FZ0 A;  2ZOH A;  3R4K A;  3V67 A;  4HHD A;  4Q0I A;  2XRN A;  4EES A;  4ETX A;  5J7E A;  2M1C A;  5IU1 A;  3LIB A;  3C8C A;  1NWZ A;  4EXO A;  3DBA A;  2JKT I;  5AVE A;  2DMW A;  4HP9 A;  2P7J A;  3UB6 A;  3MQO A;  2BAS A;  1MC0 A;  5AVF A;  1TF1 A;  1XJ2 A;  4HH2 A;  4WL9 A;  1NRJ A;  2XRO A;  4I38 A;  4WN5 A;  2D02 A;  3H82 A;  2O9A A;  3ZYT A;  1LSV A;  3P7N A;  3W2Z A;  3K3D A;  4I3J A;  1N9N A;  2K31 A;  2Y79 A;  4II7 A;  1VHM A;  4MCW A;  4ARZ B;  2PD8 A;  2P08 A;  1P9R A;  2W1T A;  3E98 A;  1XFQ A;  1TD5 A;  2V1A A;  5DFY A;  3T4L A;  1T1A A;  3FG8 A;  2V9A A;  4HH3 A;  2OOL A;  2PD7 A;  4DN0 A;  4LPZ A;  4BJP A;  3BQ8 A;  4JGO A;  3CUE A;  4NXF A;  4OOL A;  5HWT A;  3P01 A;  5DKK A;  3EWK A;  4WF0 A;  4IUH A;  3A0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...