3CI6A

Crystal structure of the gaf domain from acinetobacter phosphoenolpyruvate-protein phosphotransferase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
167
structure length
158
Chain Sequence
MSNMQLDTLRRIVQEINSSVSLHDSLDIMVNQVADAMKVDVCSIYLLDERNQRYLLMASKGLNPESVGHVSLQLSEGLVGLVGQREEIVNLENASKHERFIYNSFLGVPVMYRRKVMGVLVVQNKQPQDFSEAAESFLVTLCAQLSGVIAHAHAVGNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the GAF domain from Acinetobacter phosphoenolpyruvate-protein phosphotransferase.
rcsb
source organism Acinetobacter sp.
molecule tags Transferase
molecule keywords Phosphoenolpyruvate-protein phosphotransferase
total genus 44
structure length 158
sequence length 167
chains with identical sequence B
ec nomenclature ec 2.7.3.9: Phosphoenolpyruvate--protein phosphotransferase.
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ci6A00
4MDZA 3O5YA 4YOFA 1YSQA 4EU0A 4ETXA 2W1RA 3S7OA 4EUVA 3CITA 5DFXA 2W3DA 2K2NA 1VHMA 2XRNA 5HSQA 3IBRA 4GW9A 3KSFA 2IA2A 3LFVA 2LB5A 4Q0HA 2LB9A 4LRXC 2VEAA 2W3HA 3KO6A 4Q0JA 3C2WA 3E98A 4LRYC 3W2ZA 4BWIA 4G3VA 1YSPA 1TF1A 3IBJA 3K2NA 5LBRA 5HPFA 4IUKA 2HGVA 2XSSA 2W3FA 2KOIA 4PAUA 1YKDA 3EEAA 4DN0A 2M7UA 4GLQA 4ME4A 5TJJA 2B18A 5HL6A 2GX5A 4IJGA 3NOPC 4O0PA 3NOTC 4RQ9A 4CQHA 2M7VA 4O01A 4Z1WA 4R70A 3ZQ5A 4MN7A 4E04A 3KSIA 5I5LA 1TD5A 2O9CA 4O8GA 3NOUC 3KSHA 2O9BA 3MF0A 4ZRRA 2OOLA 3OBFA 3R4KA 5L8MA 2K31A 3MQ0A 4Y2FA 3S7PA 3G6OA 2KLIA 3DBAA 3CI6A 4ETZA 5AJGA 3BJNA 2QYBA 1ZTUA 2W3GA 4MCWA 1MKMA 1F5MA 5HPIA 4LRZE 4QPRA 2Y8HA 2O99A 4FOFA 3KSGA 2W3EA 4Y3IA 4MMNA 3S7QA 4R6LA 2Y79A 4G3WA 3RFBA 2VJWA 3HCYA 3OOVA 5K5BA 2XROA 3S7NA 4YNRA 2VZWA 2VKSA 4DMZA 2G7UA 2ZMFA 1STZA 4Q0IA 2O9AA 2O0YA 3MMHA 4G3KA 5DFYA 3VV4A 1MC0A 4IUHA 4Y5FA 3NHQA 2W1TA 5C5KA 3D3OA 2W1TB 3TRCA 3E0YA
chains in the Genus database with same CATH superfamily
4XUXA 2PT7A 2ZC7A 1LSXA 3C4PA 2Q9NA 1W79A 2ZC6B 3A3EA 4OPQA 4GNUA 3C5AA 3LCEA 2EXAA 5FAQA 3CPTA 4RX3A 2ZOIA 4WZ4A 5F68A 1NWZA 4S2JA 5GHXA 1DRMA 4IHQA 1MZUA 4GS9B 4KQOA 1ESIA 2MJ6A 5A8BA 3QP1A 2L0WA 1H8MA 4KG2A 1ZC2A 1F98A 4N1HA 3FPWA 1PIOA 1NLZA 1G6AA 3F1OA 1MKIA 1UWPX 1XA7A 5AVFA 2ZC3B 1D7EA 1JVJA 3NI9A 4P85A 1SHVA 2L1MA 3LR4A 4S2NC 4KZAA 2J80A 1K6SA 4WL9A 5KSCA 1P9RA 5EOEA 5AJGA 3LIBA 2XD1A 1NZOA 1CEGA 1SKOA 1T1BA 2X02A 5CHUA 2ZM0A 1DY6A 1S0WA 4F94A 1BTLA 3HVFA 3MQQA 4MMNA 5F1FA 3IXHA 4ZJ1A 2VJWA 1M40A 4HEFA 3TE8A 3IS2A 3T4OA 3K3CA 3SZTA 1LL5A 3BFEA 4DXBA 1L3LA 4R3JA 2HJEA 4OQGA 3G34A 2W1RA 1TS6A 1FCNA 2EWWA 2RL3A 2WKEA 4NXFA 3NDGA 2IA2A 2ZMVA 2EA9A 2EX9A 4BL3A 3C2WA 4BLMA 4EQIA 5D3OA 4G3VA 3FKWA 3NIAA 1YT4A 2XSSA 1L0FA 1GSVA 1D1JA 1QMEA 3F1NB 2PBDP 1TS8A 3S1YA 2HJ9C 4Y7PA 2OWHA 3HLEA 1DP9A 4M4XA 4EEUA 2G2UA 1CF0A 2FH5A 5EVIA 3TOIA 3C7UA 3VOYA 3CLOA 3HLGA 1QMFA 2JN7A 1GCEA 3UB8A 1O7EA 1HLUP 2AVXA 4DXCA 3DBAA 1ODVA 3A0VA 3T4QA 1WE4A 1PZOA 4P6ZS 1NY0A 5CTMA 3UB5P 2O99A 1CEFA 2BTFP 3W4QA 2Z2MB 2ZMAA 4HOIA 1HZOA 1T18A 2Z2LB 2PYPA 2Y59A 2ZMFA 4OQ0A 2I9VA 2WGIA 1OJ5A 5FDSA 4Y5FA 2OV5A 1JTDA 4X1LA 2W1TB 5CGXA 2W3DA 3O5YA 3B47A 3UDFA 4EV4A 4I3AA 3Q82A 3W8KA 4JLFA 4LRXC 3MR0A 3PBTA 4F3LA 1S4RA 3LR0A 3QP5A 2UWXA 3IHBA 2JKGA 3EEHA 3OPPA 1JWZA 4WF0A 5M19A 1YKDA 4YINA 3W4PA 4HESA 3OPHA 2PU2A 1J3WA 3A3DA 1V9ZA 3H7WA 5AQAA 1E3UA 3G35A 3WS2A 3VP2A 1ERQA 2XFSA 3C7VA 5FQQA 3SH8A 3JVUA 3E4PA 1CI8A 2WUQA 4MBFA 5G4YA 4Z9QA 5EUAA 3UB6A 4MNRA 1MWUA 3R4KA 4DJ2A 3U4LP 3V3RA 1YLWA 3G6OA 5I94A 4ETZA 5L2FA 5FATA 1JNUA 4BENA 3A0RA 1Q2PA 1BT5A 1F5MA 3DW0A 3KSGA 4S2NA 3FZCA 2Y79A 5EV0A 3IH9A 3S7NA 2OAP1 2HDRA 4E3LA 1NJ4A 3U2AA 3D9YA 4FH4A 5IHVA 3R7WB 5FQIA 3IS2B 3D4FA 3HREA 5DFYA 2V20A 3KYQA 3EQUA 3LICA 1Z09A 4Y0UA 4P87A 3ZHHA 5FAOA 2XK1A 4KUKA 3E0YA 1P0ZA 4C75A 1YSQA 1X0OA 2P9VB 3WS1A 3IBRA 1ONHA 2X71A 3LY3A 1Y28A 2LB5A 3AGFA 4OVDA 2EWVA 3KO6A 4JXVA 4MBKA 3QP8A 3O88A 1ZG6A 3SW1A 2H0TA 2D01A 3ICYA 5J7EA 1ES2A 4ZJ3A 4B9OA 3R7WA 1YMSA 3RJUA 2VX8A 2HPBA 4MN6A 3N8LA 3UMDA 3NOTC 3LIFA 2R9XA 5DF7A 1PI4A 3NY4A 1EW0A 3GECA 3MZFA 1SZVA 5FI2A 5EVIB 4JGOA 5HDDA 1OJGA 5HARA 3K3DA 3MSHA 1S67L 3GRJA 4UAAA 3S7PA 3P01A 2PYRA 2XFTA 4HIAA 2Y4AA 1V9YA 4B93A 1ZHHB 2BG1A 4MCWA 3D72A 1XJ3A 5HPIA 4PM5A 4QPRA 3E4OA 1RGZA 1KE0A 4X68A 3RFBA 4KG5A 3OLOA 4UA9A 3HJKA 1G5UA 2ZQ9A 2YKFA 4WZ5C 2C5WB 3VE3A 4G3KA 3LI8A 1LLBA 2V0WA 2B02A 4EXOA 2HDSA 2Z6DA 2PU4A 4NXBA 1FSWA 2WKRA 4EBPA 3JYIA 4KQRA 4GW9A 3IWOA 4GHIA 4M3KA 2EFUA 4DJ3A 4Q8IA 4H8RA 4E3JA 4QHCA 2LB9A 3LEZA 4ZAMA 1I5QA 3EGXC 3C8CA 1N9OA 1CI9A 1VETB 3IBJA 5HPFA 4KENB 1A0KA 5TR7A 3MFDA 1PW8A 4LLOB 1KOUA 4HY8A 1PYYA 5HL6A 5EM0A 3SS3A 1BLSA 2HDQA 4BJPA 4Y13A 1S6RA 4HP9A 4CPKA 4Z1WA 4HJ4A 4R4RA 3GR2A 1VQQA 3FKVA 5EM1A 4GD6A 1MBLA 1IKIA 5GLDA 3MQOA 1PWDA 5KSHA 2H10A 4IBXA 2VGLS 3BWLA 5TBMB 4EESA 3LR3A 2W3GA 3G2ZA 3NECA 1NRFA 4KZ4A 2WGVA 3QNBA 2KX6A 1DP6A 3HLFA 4GCZA 5IU1A 4YNRA 5F6AA 1EI5A 3T1RA 1BLCA 5M1AA 2VKSA 5AQ7A 3ITAA 4OP5A 3OPRA 2WKHA 2O0YA 4GDBA 1UWNX 3MMHA 3MFXA 2V1BA 2A3UA 5DKKA 2M1CA 3UN7A 4E3IA 3LR5A 3N7WA 4GKUA 5F5YA 4OPRA 4HQAA 1OTEA 2DNSA 3Q07A 1JWVA 4KQQA 1LI9A 1TDLA 1HTZA 1TVFA 1K56A 3DTIA 4LRYC 4UA7A 2H0YA 5LBRA 1BYWA 1H8YA 2Y2MA 4JXGA 1BSGA 1YPRA 4OLDA 5CERA 4DN0A 4L9GA 2I72A 3ZVWA 2ZD8A 4OPZA 4LFUA 4IJGA 3CWFA 4QY5A 1I2SA 4O01A 4IBRA 1OMEA 2PD8A 3KSHA 3UMEA 5FASA 2O9BA 1IYQA 4R0QA 2K31A 2H5SA 1F9IA 3DWKA 2VA0A 3V67A 4HH2A 3MJQA 3G30A 4OP8A 1W63Q 4HNBA 5DTTA 4WLAA 3C4OA 2CMNA 4EBNA 1K4FA 2WYXA 1OT9A 3CPTB 3HUNA 3TJZC 3SS4A 3BQ8A 2ZQCA 5CHJA 1FR6A 3SOIA 2VZWA 1WA9A 4E3KA 1GSWA 2G7UA 4LCLA 4OOMA 3GDIA 3BFFA 3BRMA 4N1XA 5FI6A 2QKPA 3BECA 5C5KA 3NDEA 2XH9A 3UDIA 4KZ7A 1NYMA 3O3VA 2CC1A 5HAPA 2J9PA 1J9MA 4ID4A 5HSQA 4ARZB 3UB7A 3QP4A 4WEKA 3AGEA 4X55A 3Q1FA 3IHAA 3O87A 3AGDA 1KVLA 1K54A 3KYEA 5DF8A 4DE1A 4LV1A 1N9LA 4HJ3A 1LHYA 1O07A 5AVEA 2WZZA 4I5SA 3ZDJA 5BOHA 4GZBA 1U60A 4ME4A 5TJJA 1P9WA 4FTXA 3KX0X 3M2KA 3ZQ5A 1OTDA 4MN7A 2JKRI 4GB7A 1K25A 3G2YA 1XX2A 5KZHA 3P98A 4RVAA 4KG6A 1MPLA 2Y2PA 1K6RA 4WEJA 3TSGA 4JXWA 3MXRA 4IVIA 2J3TD 1ES3A 1IEMA 2ZLYA 5E2HA 3GQZA 2XLNA 2VV6A 4HBUA 2Z6CA 3Q81A 4L9EA 5CHMA 4LV0A 3DWZA 1IKGA 1Y4OA 4Y3IA 3L7HA 4WYYA 2WADA 4S2MA 1LSVA 3ZCZA 4XUZA 3T4KA 2WKIA 3G32A 3IF6C 4C6YA 3LO7A 2DRWA 2V1AA 1MWTA 5DTSA 1W63M 4Y0TA 1K38A 4Q0IA 1OT6A 2L4RA 4U0TA 4EERA 2Y2LA 5CGSA 2OWJA 4MLLA 2X01A 3VFHA 4ETXA 5DFXA 2JC7A 2ZM2A 3KSFA 1K55A 3SH9A 2ACGA 1H5XA 5GLBA 1K57C 3IF5A 1TS7A 3H82B 4N92A 3PBNA 3P7NA 4Y15A 2FFYA 3IWQA 4JF5A 1PNEA 1L0EA 4KZ6A 5HL1A 3CAXA 4PAUA 3ZVTA 2QHKA 3N4IA 1T1AA 3CMZA 4DDYA 4DDSA 5A92A 4IVKA 4JXSA 3FV7A 3KSIA 3FPVA 2VLGA 3CUEA 3PBSA 3MF0A 4GHIB 4Y0OA 3IQAA 4K0XA 4E3MA 3DTMA 3WS4A 5L10A 3B3XA 4GJ4A 4YFMA 1BLHA 3LIDA 4Y2FA 4JGQA 2PDRA 2V0UA 2XGNA 3V39A 1ZTUA 3S22A 4DF6A 1GHMA 4OPYA 1EWZA 5EVEA 4YWZA 3VP4A 3ZYTA 3TG9A 1MY8A 3S7QA 2QPNA 2FFFB 2EX2A 2OAQ1 4KZBA 5K5BA 5HWWA 4B4XA 1FCOA 2OSUA 3BFDA 4DMZA 1STZA 1K56D 3C38A 4GDNA 1M6KA 1E4DA 2B95A 4EW7A 1KDSA 4UQIS 3TRCA 1ACFA 4EU0A 1H8ZA 1Y54A 1FQGA 3GSGA 3UO9A 1JWPA 4FCFA 4JGRA 3LI9A 4R23A 2A24A 3CG5A 2A49A 1XXMA 3BLMA 3IWIA 1ONGA 1XPBA 3IF6A 4KUOA 1XP4A 4FD8A 4B88A 2B18A 4B4ZA 2J8YA 3QNCA 4L9FA 2Y91A 5J4EA 2JKRM 5IT5A 3MXQA 3OCLA 3NOUC 4LGWA 5AQ9A 4CLCA 1OTAA 5HDSA 5G4ZA 2WKPA 4E6XA 4FSFA 5FQMA 3LY4A 3CI6A 4GD8A 2ZC5B 2V1ZA 5CEDA 2PAVP 1MXOA 1BLPA 2WKQA 5HAQA 3DTKA 3HL9A 3S4XA 1XGIA 4ZTKA 5F1GA 2KDKA 4FUWA 1S4SA 1FILA 3GVBA 4QU3A 4EEPA 4BD1A 1ERMA 3PAGA 1TDGA 3QHYA 4MDZA 2XEPA 3HLCA 3S7OA 2PHYA 2D02A 5J8XA 4BMWA 3VOZA 3MZDA 2VGJA 4A5RA 2R78A 2XQZA 3ZFZA 4MN5A 2QZ6A 3B33A 3HLDA 1WYCA 1CK3A 2EXBA 2W3HA 4P6ZM 1HD8A 2ZQ8A 3SS5A 3ZG7B 3BFGA 1YSPA 2E8IA 4MBHA 4EWFA 3LEQA 2H28A 5HW3A 2W27A 5F83A 1LL9A 4NXGA 4LPZA 5DJTA 4P6BA 3KYZA 2GZAA 5EOOA 3UB9A 2WGWA 3M6HA 3BM6A 4HBTA 5EFWA 4UA6A 4U0XA 5HWTA 2YKHA 4ZRRA 3C30A 1KDWA 1OTIA 4H6JB 1RCJA 4D60A 5HDCA 1IYPA 4JGPA 1IFQA 4S2LA 4CLCE 4X69A 1VB6A 1VM1A 1W8YA 4XXRA 4U3TA 1PWCA 4GN2A 4G3WA 2XROA 3RXWA 4X25A 3T4JA 4ZJ2A 4BBUA 4XT2B 3VV4A 5E43A 3W4OA 4PM6A 1F2KA 3ULFA 3VP3A 4DE0A 4EUVA 4R4SA 4PM9A 3OCNA 5HD5A 4KZ8A 3VSLA 2OLVA 1AWIA 4X1MA 4PKYG 3MKFA 4PM7A 2VEAA 4AFIA 3MS6A 4KZ5A 3B42A 5GHYA 3GMWA 4X53A 4PMAA 4OQIA 4UHUA 1VEUB 3OZHA 2VGLM 3IF6B 2J3TC 3NOPC 3UDXA 1YM1A 2Y2NA 4CQHA 2M7VA 3N8SA 3HBRA 1T19A 3HUOA 3P09A 2WAFA 1TD5A 3CHWP 4O8GA 2WZXA 4N9LA 2IWDA 5F82A 3PHYA 5TGFA 2OOLA 4HHDA 3NJAA 4DE2A 4EUZA 2Y2QA 2HV1A 1EROA 1GHPA 1K57A 2IWBA 3LYXA 3NBLA 1DJAA 1DP8A 4NG2A 1N9BA 2ZJ9A 4P0MA 1GA0A 4QY6A 4LRZE 1JTGA 1FSYA 1PI5A 4OOLA 4OH0A 3HCYA 3LIEA 5DTKA 1S66L 3T12B 2P04A 1YQSA 3A0SA 3ZG9B 5GHZA 5CXWA 4IUHA 5FI7A 4DE3A 2Y2GA 3M6BA 3ZG8B 2VK3A 1SDNA 5IS1A 2P9VA 3PYPA 3WWXA 3PXPA 1K4EA 1VHMA 3A3JA 4GOGA 4CLCB 2Y2IA 3BY9A 3UPPA 2G2WA 5GL9A 2V2FF 4Q0JA 2QJ7A 1Z6FA 5CGWA 1KGFA 5JYOA 1WYBA 3IX3A 4S2KA 3ZNYA 4RX2A 5DF9A 1SCWA 1XJ6A 2QWSA 1FCMA 3WRZA 2VV8A 3VE4A 3T50A 5FSRA 2K7SA 5FQ9A 4NKPA 3MXSA 4K08A 4R70A 4N9KA 3BW6A 1FIKA 2E8JA 3PR6A 5L8MA 3MQ0A 3T1SA 3T4SA 4HJ6A 4EETB 1SKOB 2W0NA 3QP6A 3JPUA 1TS0A 1W5DA 1XJ2A 1RP5A 2WAEA 3G4PA 1RGYA 3N8RA 5AQBA 1C3BA 1CQAA 2Q0OA 3BFCA 3EWKA 2JHEA 5MC7A 2P74A 1BUEA 3BY8A 3IX4A 3VSKA 5J3WA 3UPOA 1YAXA 3IXGA 4S2PA 3F1PB 4BQMA 3Q7VB 2WK0A 2FZ0A 1H3QA 4XT2A 3OPLA 4PHTA 5GLCA 5E2GA 1TEMA 5FA7A 2ZOHA 3E2LA 1NXYA 3OC2A 2DMWA 2HZ5A 4JPMA 4RYEA 2V9AA 2XA7M 5EVID 3E98A 4S2IA 3QP2A 4BWIA 1PRQA 1YLZA 4QJGA 4QB8A 4IUKA 1VETA 4Y17A 2HGVA 5GLAA 5A93A 1YLYA 3EEAA 3ZG5A 2JCHA 4K0WA 4LV2A 5G18A 1LSWA 4GLQA 3LUQA 4X56A 5E2EA 3T4LA 3VMAA 5KIZA 4HH3A 4E04A 2PR6A 5F69A 4KZ9A 5I5LA 4NETA 4MEZA 1SDEA 4OKPA 5JYPA 3OBFA 4R3BA 3UNWA 1GSXA 3IT9A 4CJNA 5CTNA 1IELA 1ALQA 3IH8A 2GDNA 2VV7A 1ES5A 2HF6A 1XJ4A 1I2WA 1ZKJA 1NLYA 4RA7A 3MKEA 2Y8HA 2EX6A 4EBLA 4QD4A 5A91A 1FOFA 1PZPA 4KQDA 2BASA 3HUMA 3NC8A 5EVLA 1IYSA 1NRJA 4WZ5A 1XGJA 3HLWA 3NCKA 5CX7A 5DKLA 2QMIA 4R38A 5CECA 3HLBA 5M18A 3NULA 5TFQA 5HWVA 1P97A 2HP9A 3L9KA 4EQ1A 4YOFA 1G6OA 1ZG4A 3UE1A 4QWOA 3WRTA 4OONA 3UY6A 1E3UD 1N9NA 4JF6A 3LFVA 4UQIM 2XF3A 4CLCC 2OLUA 3WS5A 2J7VA 2HP5A 3T1QB 4D2OA 3PTEA 1XKZA 3N6IA 2ZM8A 2ZQ7A 2XD5A 2GJ3A 2W3FA 4UEYA 2M7UA 4WM9A 1K0KA 4RQ9A 5L09A 1IOUA 2INWA 5DVAA 3A3FA 3UPNA 5HX9A 5FDHA 4DRTA 4NEED 4E3OA 3MBZA 2ZL1A 3UE0A 1L0GA 3UE6A 5FQKA 4X6TA 1PW1A 1D06A 1HVBA 2V8FA 1G68A 4WUJA 1N4OA 3I7JA 5E2FA 3DTEA 3FC7A 2KLIA 2PBYA 2Y2KA 3VFFA 4WBGA 3LGOA 1L0DA 2PD7A 4WMCA 4LV3A 1VEUA 3UE3A 1H0MA 2A2LA 4E3NA 1L2SA 4I3IA 2A24B 4CLCD 3T1XA 3ZG0A 3OOVA 5FAPA 4I38A 2Q9MA 4C3QA 3F1NA 2O9AA 1NYYA 3EQVA 3Q7VA 4O7DA 1MC0A 5DJUA 3WS0A 4R3AA 1K54C 2UV0E 4BBTA 5A90A 2RCXA 4WELA 3CITA 4NK3A 4NXEA 1K55C 1KVMA 1MWSA 4ARZA 2K2NA 2P08A 3FYZA 2Y2JA 1KGGA 1OPXA 3VP0A 2R9WA 5EPHA 3CJMA 3A3IA 3JVVA 1G28A 1LI0A 5HAIA 5L07A 3H9WA 2ZBBA 4K91A 1IYOA 1UGUA 1LT0A 1ESUA 5HFOA 3CZDA 1XA1A 2B5RA 1KE3A 4BD0A 2NUTC 1DJBA 1AXBA 3FG8A 1LL8A 3F1PA 4R1GA 3ZNTA 3PBRA 2ZL1B 4DKIA 2WGWB 3LIAA 2C6WB 4KZ3A 4I39A 1KGEA 2JKFA 4FH2A 4WMCD 2VGKA 2Y2OA 5FEFA 4S2OA 2P7JA 2Y55A 3HJIA 3VOLA 2IWCA 4LENA 2QYBA 1YLTA 3E4QA 2J9OA 2Y2HA 2XA7S 3O86A 1MKMA 4BBVA 3EGDC 4FOFA 2W3EA 3V3SA 2HDUA 1PFLA 5FEGA 3FWLA 4L0LA 5HD3A 4LCMA 1GHIA 3PBOA 4BL2A 2EFXA 3H7WB 4PKYA 5U47A 1SKFA 3NHQA 2PR5A 3PAEA 3D3OA 3T4TA 5EE8A 2DCFA 5TBMA 1BULA 3DAVA 3ITBA 4JF4A 2XRNA 3BLSA 2EX8A 2JKTM 3PBQA 4Q0HA 3M2JA 2NUPC 2JBFA 3CUEC 3IXDA 4H6JA 5FL3A 1W7FA 1CJFA 1XFNA 1YLPA 5CEBA 5EVIC 4I3JA 4OOYA 3H82A 2V8CA 4HP4A 3W2ZA 1NZUA 1TF1A 3K2NA 3EOIA 1MWRA 1ES4A 2KOIA 4GS9A 1S1YA 3RH8B 3BQAA 3BEBA 4ESPA 3IXBA 2GX5A 4O0PA 3VP1A 2ZQDA 5CRFA 3TW8A 2XDMA 1E25A 1W8QA 4JKTA 3GV9A 3SH7A 2O9CA 2BLSA 1YMXA 4IEDA 4ZDXA 4OLGA 1GA9A 4E6WA 3GTCA 4WN5A 3E2KA 1KE4A 2JE5A 5FQJA 2JKTI 3V5MA 5EECA 3ISGA 2XR0A 4F3LB 2ZC4B 3Q7ZA 5KMWA 4HI4A 3BJNA 1OTBA 1YLJA 3MZEA 2ZQAA 2GNXA 1DJCA 4R6LA 4PPRA 4ZBEA 1Q2QA 4PM8A 1FR1A 2J3WA 4II7A 1PWGA 2QJ5A 3IX8A 4OQHA 3RXXA 3RTYA 1S1ZA 1BZAA 1T1CA 1XFQA 3G31A 4JBFA 3BYDA 5HZHA 2HP6A 2PRFA 2W1TA 3F1OB 3ZGAB 3V50A
chains in the Genus database with same CATH topology
4EU0A 2Z6DA 2ZOHA 4NXBA 2PT7A 2WKRA 3OC2A 1LSXA 4GW9A 4GHIA 2DMWA 4DJ3A 2LB9A 2V9AA 4JGRA 3LI9A 2XA7M 3EGXC 3E98A 3C8CA 1N9OA 2ZOIA 2A24A 4BWIA 5F68A 1NWZA 3IBJA 5HPFA 4IUKA 1DRMA 4IHQA 2HGVA 1MZUA 4GS9B 4KQOA 2MJ6A 3EEAA 5A8BA 2L0WA 1H8MA 4KUOA 1LSWA 4GLQA 3LUQA 4LLOB 1KOUA 1F98A 4HY8A 2B18A 5HL6A 3FPWA 1NLZA 3T4LA 3F1OA 4BJPA 1UWPX 4L9FA 5AVFA 4HP9A 1D7EA 5KIZA 4Z1WA 5J4EA 4HJ4A 2JKRM 4HH3A 4E04A 5IT5A 2PR6A 5F69A 2L1MA 5I5LA 3MXQA 3OCLA 3LR4A 3NOUC 2J80A 1OTAA 4CLCA 3MQOA 5HDSA 5G4ZA 2WKPA 3OBFA 5KSHA 4WL9A 2VGLS 1GSXA 3BWLA 4FSFA 1P9RA 5TBMB 3CI6A 5AJGA 3LIBA 4EESA 1T1BA 3LR3A 2VV7A 2HF6A 2W3GA 1XJ4A 1NLYA 2Y8HA 2KX6A 2WKQA 1DP6A 3MQQA 4GCZA 4MMNA 2VJWA 4KQDA 2BASA 5IU1A 3TE8A 4YNRA 5F6AA 1NRJA 2KDKA 3IS2A 3T4OA 1S4SA 2VKSA 3K3CA 5CX7A 5DKLA 2O0YA 4R38A 3MMHA 1UWNX 3MFXA 4EEPA 5HWVA 1P97A 2V1BA 5DKKA 2M1CA 2HJEA 4EQ1A 4MDZA 4YOFA 1G6OA 2W1RA 1TS6A 3S7OA 2PHYA 2D02A 3LR5A 2EWWA 4BMWA 1N9NA 4NXFA 5F5YA 2R78A 2IA2A 2ZMVA 4MN5A 2EA9A 3B33A 3LFVA 4HQAA 1OTEA 4UQIM 4CLCC 2W3HA 3C2WA 4P6ZM 4LRYC 4G3VA 1YSPA 5LBRA 1BYWA 2XSSA 2GJ3A 2W3FA 4UEYA 1GSVA 4DN0A 2M7UA 4L9GA 2H28A 3F1NB 1TS8A 2HJ9C 4IJGA 3CWFA 2W27A 4RQ9A 2OWHA 4NXGA 1DP9A 1IOUA 2INWA 4O01A 4M4XA 4LPZA 5DJTA 4EEUA 3KYZA 2GZAA 2FH5A 3UB9A 2PD8A 4NEED 3KSHA 3UMEA 5EFWA 3CLOA 2O9BA 5HWTA 2YKHA 4ZRRA 2JN7A 3UE6A 1D06A 3UB8A 3C30A 4WUJA 1OTIA 4H6JB 2K31A 1F9IA 3FC7A 2KLIA 5HDCA 3DBAA 4JGPA 1ODVA 2VA0A 3A0VA 3V67A 3T4QA 1IFQA 4HH2A 3MJQA 4P6ZS 1W63Q 4HNBA 4CLCE 2PD7A 1VB6A 4WLAA 3UE3A 2O99A 2A2LA 2CMNA 1OT9A 3TJZC 4G3WA 4HOIA 4I3IA 2A24B 4CLCD 3OOVA 2XROA 1T18A 3BQ8A 3T4JA 4BBUA 2VZWA 1WA9A 4I38A 2PYPA 1GSWA 2G7UA 2ZMFA 3F1NA 4OOMA 4XT2B 2O9AA 3EQVA 2I9VA 3GDIA 3VV4A 1MC0A 1OJ5A 5DJUA 4Y5FA 4R3AA 2QKPA 5C5KA 4BBTA 3ULFA 2W1TB 2W3DA 3O5YA 3B47A 4WELA 4EUVA 3CITA 4NXEA 4ARZA 3OCNA 4I3AA 2K2NA 2P08A 5HSQA 5HD5A 4ARZB 1OPXA 3UB7A 4PKYG 4WEKA 3JVVA 4LRXC 3MR0A 2VEAA 3PBTA 4AFIA 4F3LA 1G28A 1S4RA 3LR0A 3H9WA 3B42A 1N9LA 2ZBBA 4HJ3A 3EEHA 5AVEA 4I5SA 1UGUA 4WF0A 1LT0A 1YKDA 2VGLM 4ME4A 5TJJA 1V9ZA 1P9WA 2J3TC 3H7WA 3NOPC 2NUTC 3KX0X 4CQHA 2M7VA 3ZQ5A 1OTDA 1T19A 3FG8A 1LL8A 4MN7A 3JVUA 2JKRI 3F1PA 1TD5A 3PBRA 3E4PA 4O8GA 5G4YA 3PHYA 4WEJA 2OOLA 4HHDA 3NJAA 3UB6A 3LIAA 3R4KA 2HV1A 4DJ2A 4I39A 2J3TD 3LYXA 3G6OA 4ETZA 2P7JA 3HJIA 1DP8A 3VOLA 2QYBA 2VV6A 1JNUA 3E4QA 2Z6CA 2XA7S 4L9EA 3A0RA 1MKMA 4BBVA 1F5MA 4LRZE 3EGDC 4FOFA 4OOLA 3KSGA 2W3EA 4Y3IA 2Y79A 3HCYA 1LSVA 3LIEA 3T4KA 3S7NA 2OAP1 4L0LA 3U2AA 1S66L 5HD3A 2P04A 3R7WB 3A0SA 2V1AA 1W63M 3IS2B 4Q0IA 3PBOA 1OT6A 2L4RA 5DFYA 3H7WB 4IUHA 4EERA 3KYQA 2OWJA 4PKYA 3NHQA 2PR5A 3EQUA 3LICA 3D3OA 3T4TA 4KUKA 3E0YA 1P0ZA 1YSQA 4ETXA 1X0OA 5IS1A 3PYPA 5DFXA 5TBMA 3PXPA 1VHMA 2XRNA 3IBRA 2JKTM 3KSFA 4CLCB 3PBQA 3BY9A 1Y28A 2LB5A 4Q0HA 2NUPC 3CUEC 5FL3A 4H6JA 2EWVA 3KO6A 4Q0JA 1TS7A 2QJ7A 1XFNA 3H82B 3PBNA 4I3JA 3SW1A 3P7NA 2D01A 3H82A 3W2ZA 4HP4A 1TF1A 3K2NA 3EOIA 3ICYA 5DF9A 1XJ6A 2QWSA 5J7EA 2VV8A 3CAXA 3VE4A 2KOIA 4PAUA 4B9OA 4GS9A 1S1YA 3RH8B 3R7WA 3T50A 3BQAA 2QHKA 2VX8A 4MN6A 2GX5A 2K7SA 1T1AA 3UMDA 4O0PA 3NOTC 3LIFA 4NKPA 4K08A 4R70A 3TW8A 1EW0A 3GECA 3KSIA 2O9CA 3BW6A 3FPVA 2VLGA 4JGOA 3CUEA 5HDDA 3PBSA 1OJGA 3K3DA 3MF0A 4GHIB 4WN5A 1S67L 2JKTI 4GJ4A 3PR6A 5L8MA 4F3LB 3LIDA 3MQ0A 4Y2FA 3S7PA 4JGQA 3P01A 2PYRA 3T4SA 4HIAA 4HJ6A 2PDRA 2V0UA 4HI4A 4EETB 1V9YA 4B93A 2W0NA 3BJNA 1OTBA 1ZHHB 1ZTUA 1TS0A 1XJ2A 4MCWA 3D72A 1XJ3A 5HPIA 2GNXA 4QPRA 3E4OA 3EWKA 4YWZA 2JHEA 3ZYTA 5MC7A 3BY8A 4R6LA 3S7QA 3RFBA 2OAQ1 5K5BA 5HWWA 3OLOA 2J3WA 4II7A 3HJKA 2QJ5A 5J3WA 1YAXA 3F1PB 3RTYA 4DMZA 1S1ZA 2YKFA 1STZA 1T1CA 1XFQA 3C38A 3VE3A 4G3KA 2FZ0A 1H3QA 3LI8A 5HZHA 4XT2A 4PHTA 2W1TA 2V0WA 3F1OB 4EW7A 4UQIS 2B02A 4EXOA 3TRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MDZ A;  3O5Y A;  4YOF A;  1YSQ A;  4EU0 A;  4ETX A;  2W1R A;  3S7O A;  4EUV A;  3CIT A;  5DFX A;  2W3D A;  2K2N A;  1VHM A;  2XRN A;  5HSQ A;  3IBR A;  4GW9 A;  3KSF A;  2IA2 A;  3LFV A;  2LB5 A;  4Q0H A;  2LB9 A;  4LRX C;  2VEA A;  2W3H A;  3KO6 A;  4Q0J A;  3C2W A;  3E98 A;  4LRY C;  3W2Z A;  4BWI A;  4G3V A;  1YSP A;  1TF1 A;  3IBJ A;  3K2N A;  5LBR A;  5HPF A;  4IUK A;  2HGV A;  2XSS A;  2W3F A;  2KOI A;  4PAU A;  1YKD A;  3EEA A;  4DN0 A;  2M7U A;  4GLQ A;  4ME4 A;  5TJJ A;  2B18 A;  5HL6 A;  2GX5 A;  4IJG A;  3NOP C;  4O0P A;  3NOT C;  4RQ9 A;  4CQH A;  2M7V A;  4O01 A;  4Z1W A;  4R70 A;  3ZQ5 A;  4MN7 A;  4E04 A;  3KSI A;  5I5L A;  1TD5 A;  2O9C A;  4O8G A;  3NOU C;  3KSH A;  2O9B A;  3MF0 A;  4ZRR A;  2OOL A;  3OBF A;  3R4K A;  5L8M A;  2K31 A;  3MQ0 A;  4Y2F A;  3S7P A;  3G6O A;  2KLI A;  3DBA A;  3CI6 A;  4ETZ A;  5AJG A;  3BJN A;  2QYB A;  1ZTU A;  2W3G A;  4MCW A;  1MKM A;  1F5M A;  5HPI A;  4LRZ E;  4QPR A;  2Y8H A;  2O99 A;  4FOF A;  3KSG A;  2W3E A;  4Y3I A;  4MMN A;  3S7Q A;  4R6L A;  2Y79 A;  4G3W A;  3RFB A;  2VJW A;  3HCY A;  3OOV A;  5K5B A;  2XRO A;  3S7N A;  4YNR A;  2VZW A;  2VKS A;  4DMZ A;  2G7U A;  2ZMF A;  1STZ A;  4Q0I A;  2O9A A;  2O0Y A;  3MMH A;  4G3K A;  5DFY A;  3VV4 A;  1MC0 A;  4IUH A;  4Y5F A;  3NHQ A;  2W1T A;  5C5K A;  3D3O A;  2W1T B;  3TRC A;  3E0Y A; 
#chains in the Genus database with same CATH topology
 4XUX A;  2PT7 A;  2ZC7 A;  1LSX A;  3C4P A;  2Q9N A;  1W79 A;  2ZC6 B;  3A3E A;  4OPQ A;  4GNU A;  3C5A A;  3LCE A;  2EXA A;  5FAQ A;  3CPT A;  4RX3 A;  2ZOI A;  4WZ4 A;  5F68 A;  1NWZ A;  4S2J A;  5GHX A;  1DRM A;  4IHQ A;  1MZU A;  4GS9 B;  4KQO A;  1ESI A;  2MJ6 A;  5A8B A;  3QP1 A;  2L0W A;  1H8M A;  4KG2 A;  1ZC2 A;  1F98 A;  4N1H A;  3FPW A;  1PIO A;  1NLZ A;  1G6A A;  3F1O A;  1MKI A;  1UWP X;  1XA7 A;  5AVF A;  2ZC3 B;  1D7E A;  1JVJ A;  3NI9 A;  4P85 A;  1SHV A;  2L1M A;  3LR4 A;  4S2N C;  4KZA A;  2J80 A;  1K6S A;  4WL9 A;  5KSC A;  1P9R A;  5EOE A;  5AJG A;  3LIB A;  2XD1 A;  1NZO A;  1CEG A;  1SKO A;  1T1B A;  2X02 A;  5CHU A;  2ZM0 A;  1DY6 A;  1S0W A;  4F94 A;  1BTL A;  3HVF A;  3MQQ A;  4MMN A;  5F1F A;  3IXH A;  4ZJ1 A;  2VJW A;  1M40 A;  4HEF A;  3TE8 A;  3IS2 A;  3T4O A;  3K3C A;  3SZT A;  1LL5 A;  3BFE A;  4DXB A;  1L3L A;  4R3J A;  2HJE A;  4OQG A;  3G34 A;  2W1R A;  1TS6 A;  1FCN A;  2EWW A;  2RL3 A;  2WKE A;  4NXF A;  3NDG A;  2IA2 A;  2ZMV A;  2EA9 A;  2EX9 A;  4BL3 A;  3C2W A;  4BLM A;  4EQI A;  5D3O A;  4G3V A;  3FKW A;  3NIA A;  1YT4 A;  2XSS A;  1L0F A;  1GSV A;  1D1J A;  1QME A;  3F1N B;  2PBD P;  1TS8 A;  3S1Y A;  2HJ9 C;  4Y7P A;  2OWH A;  3HLE A;  1DP9 A;  4M4X A;  4EEU A;  2G2U A;  1CF0 A;  2FH5 A;  5EVI A;  3TOI A;  3C7U A;  3VOY A;  3CLO A;  3HLG A;  1QMF A;  2JN7 A;  1GCE A;  3UB8 A;  1O7E A;  1HLU P;  2AVX A;  4DXC A;  3DBA A;  1ODV A;  3A0V A;  3T4Q A;  1WE4 A;  1PZO A;  4P6Z S;  1NY0 A;  5CTM A;  3UB5 P;  2O99 A;  1CEF A;  2BTF P;  3W4Q A;  2Z2M B;  2ZMA A;  4HOI A;  1HZO A;  1T18 A;  2Z2L B;  2PYP A;  2Y59 A;  2ZMF A;  4OQ0 A;  2I9V A;  2WGI A;  1OJ5 A;  5FDS A;  4Y5F A;  2OV5 A;  1JTD A;  4X1L A;  2W1T B;  5CGX A;  2W3D A;  3O5Y A;  3B47 A;  3UDF A;  4EV4 A;  4I3A A;  3Q82 A;  3W8K A;  4JLF A;  4LRX C;  3MR0 A;  3PBT A;  4F3L A;  1S4R A;  3LR0 A;  3QP5 A;  2UWX A;  3IHB A;  2JKG A;  3EEH A;  3OPP A;  1JWZ A;  4WF0 A;  5M19 A;  1YKD A;  4YIN A;  3W4P A;  4HES A;  3OPH A;  2PU2 A;  1J3W A;  3A3D A;  1V9Z A;  3H7W A;  5AQA A;  1E3U A;  3G35 A;  3WS2 A;  3VP2 A;  1ERQ A;  2XFS A;  3C7V A;  5FQQ A;  3SH8 A;  3JVU A;  3E4P A;  1CI8 A;  2WUQ A;  4MBF A;  5G4Y A;  4Z9Q A;  5EUA A;  3UB6 A;  4MNR A;  1MWU A;  3R4K A;  4DJ2 A;  3U4L P;  3V3R A;  1YLW A;  3G6O A;  5I94 A;  4ETZ A;  5L2F A;  5FAT A;  1JNU A;  4BEN A;  3A0R A;  1Q2P A;  1BT5 A;  1F5M A;  3DW0 A;  3KSG A;  4S2N A;  3FZC A;  2Y79 A;  5EV0 A;  3IH9 A;  3S7N A;  2OAP 1;  2HDR A;  4E3L A;  1NJ4 A;  3U2A A;  3D9Y A;  4FH4 A;  5IHV A;  3R7W B;  5FQI A;  3IS2 B;  3D4F A;  3HRE A;  5DFY A;  2V20 A;  3KYQ A;  3EQU A;  3LIC A;  1Z09 A;  4Y0U A;  4P87 A;  3ZHH A;  5FAO A;  2XK1 A;  4KUK A;  3E0Y A;  1P0Z A;  4C75 A;  1YSQ A;  1X0O A;  2P9V B;  3WS1 A;  3IBR A;  1ONH A;  2X71 A;  3LY3 A;  1Y28 A;  2LB5 A;  3AGF A;  4OVD A;  2EWV A;  3KO6 A;  4JXV A;  4MBK A;  3QP8 A;  3O88 A;  1ZG6 A;  3SW1 A;  2H0T A;  2D01 A;  3ICY A;  5J7E A;  1ES2 A;  4ZJ3 A;  4B9O A;  3R7W A;  1YMS A;  3RJU A;  2VX8 A;  2HPB A;  4MN6 A;  3N8L A;  3UMD A;  3NOT C;  3LIF A;  2R9X A;  5DF7 A;  1PI4 A;  3NY4 A;  1EW0 A;  3GEC A;  3MZF A;  1SZV A;  5FI2 A;  5EVI B;  4JGO A;  5HDD A;  1OJG A;  5HAR A;  3K3D A;  3MSH A;  1S67 L;  3GRJ A;  4UAA A;  3S7P A;  3P01 A;  2PYR A;  2XFT A;  4HIA A;  2Y4A A;  1V9Y A;  4B93 A;  1ZHH B;  2BG1 A;  4MCW A;  3D72 A;  1XJ3 A;  5HPI A;  4PM5 A;  4QPR A;  3E4O A;  1RGZ A;  1KE0 A;  4X68 A;  3RFB A;  4KG5 A;  3OLO A;  4UA9 A;  3HJK A;  1G5U A;  2ZQ9 A;  2YKF A;  4WZ5 C;  2C5W B;  3VE3 A;  4G3K A;  3LI8 A;  1LLB A;  2V0W A;  2B02 A;  4EXO A;  2HDS A;  2Z6D A;  2PU4 A;  4NXB A;  1FSW A;  2WKR A;  4EBP A;  3JYI A;  4KQR A;  4GW9 A;  3IWO A;  4GHI A;  4M3K A;  2EFU A;  4DJ3 A;  4Q8I A;  4H8R A;  4E3J A;  4QHC A;  2LB9 A;  3LEZ A;  4ZAM A;  1I5Q A;  3EGX C;  3C8C A;  1N9O A;  1CI9 A;  1VET B;  3IBJ A;  5HPF A;  4KEN B;  1A0K A;  5TR7 A;  3MFD A;  1PW8 A;  4LLO B;  1KOU A;  4HY8 A;  1PYY A;  5HL6 A;  5EM0 A;  3SS3 A;  1BLS A;  2HDQ A;  4BJP A;  4Y13 A;  1S6R A;  4HP9 A;  4CPK A;  4Z1W A;  4HJ4 A;  4R4R A;  3GR2 A;  1VQQ A;  3FKV A;  5EM1 A;  4GD6 A;  1MBL A;  1IKI A;  5GLD A;  3MQO A;  1PWD A;  5KSH A;  2H10 A;  4IBX A;  2VGL S;  3BWL A;  5TBM B;  4EES A;  3LR3 A;  2W3G A;  3G2Z A;  3NEC A;  1NRF A;  4KZ4 A;  2WGV A;  3QNB A;  2KX6 A;  1DP6 A;  3HLF A;  4GCZ A;  5IU1 A;  4YNR A;  5F6A A;  1EI5 A;  3T1R A;  1BLC A;  5M1A A;  2VKS A;  5AQ7 A;  3ITA A;  4OP5 A;  3OPR A;  2WKH A;  2O0Y A;  4GDB A;  1UWN X;  3MMH A;  3MFX A;  2V1B A;  2A3U A;  5DKK A;  2M1C A;  3UN7 A;  4E3I A;  3LR5 A;  3N7W A;  4GKU A;  5F5Y A;  4OPR A;  4HQA A;  1OTE A;  2DNS A;  3Q07 A;  1JWV A;  4KQQ A;  1LI9 A;  1TDL A;  1HTZ A;  1TVF A;  1K56 A;  3DTI A;  4LRY C;  4UA7 A;  2H0Y A;  5LBR A;  1BYW A;  1H8Y A;  2Y2M A;  4JXG A;  1BSG A;  1YPR A;  4OLD A;  5CER A;  4DN0 A;  4L9G A;  2I72 A;  3ZVW A;  2ZD8 A;  4OPZ A;  4LFU A;  4IJG A;  3CWF A;  4QY5 A;  1I2S A;  4O01 A;  4IBR A;  1OME A;  2PD8 A;  3KSH A;  3UME A;  5FAS A;  2O9B A;  1IYQ A;  4R0Q A;  2K31 A;  2H5S A;  1F9I A;  3DWK A;  2VA0 A;  3V67 A;  4HH2 A;  3MJQ A;  3G30 A;  4OP8 A;  1W63 Q;  4HNB A;  5DTT A;  4WLA A;  3C4O A;  2CMN A;  4EBN A;  1K4F A;  2WYX A;  1OT9 A;  3CPT B;  3HUN A;  3TJZ C;  3SS4 A;  3BQ8 A;  2ZQC A;  5CHJ A;  1FR6 A;  3SOI A;  2VZW A;  1WA9 A;  4E3K A;  1GSW A;  2G7U A;  4LCL A;  4OOM A;  3GDI A;  3BFF A;  3BRM A;  4N1X A;  5FI6 A;  2QKP A;  3BEC A;  5C5K A;  3NDE A;  2XH9 A;  3UDI A;  4KZ7 A;  1NYM A;  3O3V A;  2CC1 A;  5HAP A;  2J9P A;  1J9M A;  4ID4 A;  5HSQ A;  4ARZ B;  3UB7 A;  3QP4 A;  4WEK A;  3AGE A;  4X55 A;  3Q1F A;  3IHA A;  3O87 A;  3AGD A;  1KVL A;  1K54 A;  3KYE A;  5DF8 A;  4DE1 A;  4LV1 A;  1N9L A;  4HJ3 A;  1LHY A;  1O07 A;  5AVE A;  2WZZ A;  4I5S A;  3ZDJ A;  5BOH A;  4GZB A;  1U60 A;  4ME4 A;  5TJJ A;  1P9W A;  4FTX A;  3KX0 X;  3M2K A;  3ZQ5 A;  1OTD A;  4MN7 A;  2JKR I;  4GB7 A;  1K25 A;  3G2Y A;  1XX2 A;  5KZH A;  3P98 A;  4RVA A;  4KG6 A;  1MPL A;  2Y2P A;  1K6R A;  4WEJ A;  3TSG A;  4JXW A;  3MXR A;  4IVI A;  2J3T D;  1ES3 A;  1IEM A;  2ZLY A;  5E2H A;  3GQZ A;  2XLN A;  2VV6 A;  4HBU A;  2Z6C A;  3Q81 A;  4L9E A;  5CHM A;  4LV0 A;  3DWZ A;  1IKG A;  1Y4O A;  4Y3I A;  3L7H A;  4WYY A;  2WAD A;  4S2M A;  1LSV A;  3ZCZ A;  4XUZ A;  3T4K A;  2WKI A;  3G32 A;  3IF6 C;  4C6Y A;  3LO7 A;  2DRW A;  2V1A A;  1MWT A;  5DTS A;  1W63 M;  4Y0T A;  1K38 A;  4Q0I A;  1OT6 A;  2L4R A;  4U0T A;  4EER A;  2Y2L A;  5CGS A;  2OWJ A;  4MLL A;  2X01 A;  3VFH A;  4ETX A;  5DFX A;  2JC7 A;  2ZM2 A;  3KSF A;  1K55 A;  3SH9 A;  2ACG A;  1H5X A;  5GLB A;  1K57 C;  3IF5 A;  1TS7 A;  3H82 B;  4N92 A;  3PBN A;  3P7N A;  4Y15 A;  2FFY A;  3IWQ A;  4JF5 A;  1PNE A;  1L0E A;  4KZ6 A;  5HL1 A;  3CAX A;  4PAU A;  3ZVT A;  2QHK A;  3N4I A;  1T1A A;  3CMZ A;  4DDY A;  4DDS A;  5A92 A;  4IVK A;  4JXS A;  3FV7 A;  3KSI A;  3FPV A;  2VLG A;  3CUE A;  3PBS A;  3MF0 A;  4GHI B;  4Y0O A;  3IQA A;  4K0X A;  4E3M A;  3DTM A;  3WS4 A;  5L10 A;  3B3X A;  4GJ4 A;  4YFM A;  1BLH A;  3LID A;  4Y2F A;  4JGQ A;  2PDR A;  2V0U A;  2XGN A;  3V39 A;  1ZTU A;  3S22 A;  4DF6 A;  1GHM A;  4OPY A;  1EWZ A;  5EVE A;  4YWZ A;  3VP4 A;  3ZYT A;  3TG9 A;  1MY8 A;  3S7Q A;  2QPN A;  2FFF B;  2EX2 A;  2OAQ 1;  4KZB A;  5K5B A;  5HWW A;  4B4X A;  1FCO A;  2OSU A;  3BFD A;  4DMZ A;  1STZ A;  1K56 D;  3C38 A;  4GDN A;  1M6K A;  1E4D A;  2B95 A;  4EW7 A;  1KDS A;  4UQI S;  3TRC A;  1ACF A;  4EU0 A;  1H8Z A;  1Y54 A;  1FQG A;  3GSG A;  3UO9 A;  1JWP A;  4FCF A;  4JGR A;  3LI9 A;  4R23 A;  2A24 A;  3CG5 A;  2A49 A;  1XXM A;  3BLM A;  3IWI A;  1ONG A;  1XPB A;  3IF6 A;  4KUO A;  1XP4 A;  4FD8 A;  4B88 A;  2B18 A;  4B4Z A;  2J8Y A;  3QNC A;  4L9F A;  2Y91 A;  5J4E A;  2JKR M;  5IT5 A;  3MXQ A;  3OCL A;  3NOU C;  4LGW A;  5AQ9 A;  4CLC A;  1OTA A;  5HDS A;  5G4Z A;  2WKP A;  4E6X A;  4FSF A;  5FQM A;  3LY4 A;  3CI6 A;  4GD8 A;  2ZC5 B;  2V1Z A;  5CED A;  2PAV P;  1MXO A;  1BLP A;  2WKQ A;  5HAQ A;  3DTK A;  3HL9 A;  3S4X A;  1XGI A;  4ZTK A;  5F1G A;  2KDK A;  4FUW A;  1S4S A;  1FIL A;  3GVB A;  4QU3 A;  4EEP A;  4BD1 A;  1ERM A;  3PAG A;  1TDG A;  3QHY A;  4MDZ A;  2XEP A;  3HLC A;  3S7O A;  2PHY A;  2D02 A;  5J8X A;  4BMW A;  3VOZ A;  3MZD A;  2VGJ A;  4A5R A;  2R78 A;  2XQZ A;  3ZFZ A;  4MN5 A;  2QZ6 A;  3B33 A;  3HLD A;  1WYC A;  1CK3 A;  2EXB A;  2W3H A;  4P6Z M;  1HD8 A;  2ZQ8 A;  3SS5 A;  3ZG7 B;  3BFG A;  1YSP A;  2E8I A;  4MBH A;  4EWF A;  3LEQ A;  2H28 A;  5HW3 A;  2W27 A;  5F83 A;  1LL9 A;  4NXG A;  4LPZ A;  5DJT A;  4P6B A;  3KYZ A;  2GZA A;  5EOO A;  3UB9 A;  2WGW A;  3M6H A;  3BM6 A;  4HBT A;  5EFW A;  4UA6 A;  4U0X A;  5HWT A;  2YKH A;  4ZRR A;  3C30 A;  1KDW A;  1OTI A;  4H6J B;  1RCJ A;  4D60 A;  5HDC A;  1IYP A;  4JGP A;  1IFQ A;  4S2L A;  4CLC E;  4X69 A;  1VB6 A;  1VM1 A;  1W8Y A;  4XXR A;  4U3T A;  1PWC A;  4GN2 A;  4G3W A;  2XRO A;  3RXW A;  4X25 A;  3T4J A;  4ZJ2 A;  4BBU A;  4XT2 B;  3VV4 A;  5E43 A;  3W4O A;  4PM6 A;  1F2K A;  3ULF A;  3VP3 A;  4DE0 A;  4EUV A;  4R4S A;  4PM9 A;  3OCN A;  5HD5 A;  4KZ8 A;  3VSL A;  2OLV A;  1AWI A;  4X1M A;  4PKY G;  3MKF A;  4PM7 A;  2VEA A;  4AFI A;  3MS6 A;  4KZ5 A;  3B42 A;  5GHY A;  3GMW A;  4X53 A;  4PMA A;  4OQI A;  4UHU A;  1VEU B;  3OZH A;  2VGL M;  3IF6 B;  2J3T C;  3NOP C;  3UDX A;  1YM1 A;  2Y2N A;  4CQH A;  2M7V A;  3N8S A;  3HBR A;  1T19 A;  3HUO A;  3P09 A;  2WAF A;  1TD5 A;  3CHW P;  4O8G A;  2WZX A;  4N9L A;  2IWD A;  5F82 A;  3PHY A;  5TGF A;  2OOL A;  4HHD A;  3NJA A;  4DE2 A;  4EUZ A;  2Y2Q A;  2HV1 A;  1ERO A;  1GHP A;  1K57 A;  2IWB A;  3LYX A;  3NBL A;  1DJA A;  1DP8 A;  4NG2 A;  1N9B A;  2ZJ9 A;  4P0M A;  1GA0 A;  4QY6 A;  4LRZ E;  1JTG A;  1FSY A;  1PI5 A;  4OOL A;  4OH0 A;  3HCY A;  3LIE A;  5DTK A;  1S66 L;  3T12 B;  2P04 A;  1YQS A;  3A0S A;  3ZG9 B;  5GHZ A;  5CXW A;  4IUH A;  5FI7 A;  4DE3 A;  2Y2G A;  3M6B A;  3ZG8 B;  2VK3 A;  1SDN A;  5IS1 A;  2P9V A;  3PYP A;  3WWX A;  3PXP A;  1K4E A;  1VHM A;  3A3J A;  4GOG A;  4CLC B;  2Y2I A;  3BY9 A;  3UPP A;  2G2W A;  5GL9 A;  2V2F F;  4Q0J A;  2QJ7 A;  1Z6F A;  5CGW A;  1KGF A;  5JYO A;  1WYB A;  3IX3 A;  4S2K A;  3ZNY A;  4RX2 A;  5DF9 A;  1SCW A;  1XJ6 A;  2QWS A;  1FCM A;  3WRZ A;  2VV8 A;  3VE4 A;  3T50 A;  5FSR A;  2K7S A;  5FQ9 A;  4NKP A;  3MXS A;  4K08 A;  4R70 A;  4N9K A;  3BW6 A;  1FIK A;  2E8J A;  3PR6 A;  5L8M A;  3MQ0 A;  3T1S A;  3T4S A;  4HJ6 A;  4EET B;  1SKO B;  2W0N A;  3QP6 A;  3JPU A;  1TS0 A;  1W5D A;  1XJ2 A;  1RP5 A;  2WAE A;  3G4P A;  1RGY A;  3N8R A;  5AQB A;  1C3B A;  1CQA A;  2Q0O A;  3BFC A;  3EWK A;  2JHE A;  5MC7 A;  2P74 A;  1BUE A;  3BY8 A;  3IX4 A;  3VSK A;  5J3W A;  3UPO A;  1YAX A;  3IXG A;  4S2P A;  3F1P B;  4BQM A;  3Q7V B;  2WK0 A;  2FZ0 A;  1H3Q A;  4XT2 A;  3OPL A;  4PHT A;  5GLC A;  5E2G A;  1TEM A;  5FA7 A;  2ZOH A;  3E2L A;  1NXY A;  3OC2 A;  2DMW A;  2HZ5 A;  4JPM A;  4RYE A;  2V9A A;  2XA7 M;  5EVI D;  3E98 A;  4S2I A;  3QP2 A;  4BWI A;  1PRQ A;  1YLZ A;  4QJG A;  4QB8 A;  4IUK A;  1VET A;  4Y17 A;  2HGV A;  5GLA A;  5A93 A;  1YLY A;  3EEA A;  3ZG5 A;  2JCH A;  4K0W A;  4LV2 A;  5G18 A;  1LSW A;  4GLQ A;  3LUQ A;  4X56 A;  5E2E A;  3T4L A;  3VMA A;  5KIZ A;  4HH3 A;  4E04 A;  2PR6 A;  5F69 A;  4KZ9 A;  5I5L A;  4NET A;  4MEZ A;  1SDE A;  4OKP A;  5JYP A;  3OBF A;  4R3B A;  3UNW A;  1GSX A;  3IT9 A;  4CJN A;  5CTN A;  1IEL A;  1ALQ A;  3IH8 A;  2GDN A;  2VV7 A;  1ES5 A;  2HF6 A;  1XJ4 A;  1I2W A;  1ZKJ A;  1NLY A;  4RA7 A;  3MKE A;  2Y8H A;  2EX6 A;  4EBL A;  4QD4 A;  5A91 A;  1FOF A;  1PZP A;  4KQD A;  2BAS A;  3HUM A;  3NC8 A;  5EVL A;  1IYS A;  1NRJ A;  4WZ5 A;  1XGJ A;  3HLW A;  3NCK A;  5CX7 A;  5DKL A;  2QMI A;  4R38 A;  5CEC A;  3HLB A;  5M18 A;  3NUL A;  5TFQ A;  5HWV A;  1P97 A;  2HP9 A;  3L9K A;  4EQ1 A;  4YOF A;  1G6O A;  1ZG4 A;  3UE1 A;  4QWO A;  3WRT A;  4OON A;  3UY6 A;  1E3U D;  1N9N A;  4JF6 A;  3LFV A;  4UQI M;  2XF3 A;  4CLC C;  2OLU A;  3WS5 A;  2J7V A;  2HP5 A;  3T1Q B;  4D2O A;  3PTE A;  1XKZ A;  3N6I A;  2ZM8 A;  2ZQ7 A;  2XD5 A;  2GJ3 A;  2W3F A;  4UEY A;  2M7U A;  4WM9 A;  1K0K A;  4RQ9 A;  5L09 A;  1IOU A;  2INW A;  5DVA A;  3A3F A;  3UPN A;  5HX9 A;  5FDH A;  4DRT A;  4NEE D;  4E3O A;  3MBZ A;  2ZL1 A;  3UE0 A;  1L0G A;  3UE6 A;  5FQK A;  4X6T A;  1PW1 A;  1D06 A;  1HVB A;  2V8F A;  1G68 A;  4WUJ A;  1N4O A;  3I7J A;  5E2F A;  3DTE A;  3FC7 A;  2KLI A;  2PBY A;  2Y2K A;  3VFF A;  4WBG A;  3LGO A;  1L0D A;  2PD7 A;  4WMC A;  4LV3 A;  1VEU A;  3UE3 A;  1H0M A;  2A2L A;  4E3N A;  1L2S A;  4I3I A;  2A24 B;  4CLC D;  3T1X A;  3ZG0 A;  3OOV A;  5FAP A;  4I38 A;  2Q9M A;  4C3Q A;  3F1N A;  2O9A A;  1NYY A;  3EQV A;  3Q7V A;  4O7D A;  1MC0 A;  5DJU A;  3WS0 A;  4R3A A;  1K54 C;  2UV0 E;  4BBT A;  5A90 A;  2RCX A;  4WEL A;  3CIT A;  4NK3 A;  4NXE A;  1K55 C;  1KVM A;  1MWS A;  4ARZ A;  2K2N A;  2P08 A;  3FYZ A;  2Y2J A;  1KGG A;  1OPX A;  3VP0 A;  2R9W A;  5EPH A;  3CJM A;  3A3I A;  3JVV A;  1G28 A;  1LI0 A;  5HAI A;  5L07 A;  3H9W A;  2ZBB A;  4K91 A;  1IYO A;  1UGU A;  1LT0 A;  1ESU A;  5HFO A;  3CZD A;  1XA1 A;  2B5R A;  1KE3 A;  4BD0 A;  2NUT C;  1DJB A;  1AXB A;  3FG8 A;  1LL8 A;  3F1P A;  4R1G A;  3ZNT A;  3PBR A;  2ZL1 B;  4DKI A;  2WGW B;  3LIA A;  2C6W B;  4KZ3 A;  4I39 A;  1KGE A;  2JKF A;  4FH2 A;  4WMC D;  2VGK A;  2Y2O A;  5FEF A;  4S2O A;  2P7J A;  2Y55 A;  3HJI A;  3VOL A;  2IWC A;  4LEN A;  2QYB A;  1YLT A;  3E4Q A;  2J9O A;  2Y2H A;  2XA7 S;  3O86 A;  1MKM A;  4BBV A;  3EGD C;  4FOF A;  2W3E A;  3V3S A;  2HDU A;  1PFL A;  5FEG A;  3FWL A;  4L0L A;  5HD3 A;  4LCM A;  1GHI A;  3PBO A;  4BL2 A;  2EFX A;  3H7W B;  4PKY A;  5U47 A;  1SKF A;  3NHQ A;  2PR5 A;  3PAE A;  3D3O A;  3T4T A;  5EE8 A;  2DCF A;  5TBM A;  1BUL A;  3DAV A;  3ITB A;  4JF4 A;  2XRN A;  3BLS A;  2EX8 A;  2JKT M;  3PBQ A;  4Q0H A;  3M2J A;  2NUP C;  2JBF A;  3CUE C;  3IXD A;  4H6J A;  5FL3 A;  1W7F A;  1CJF A;  1XFN A;  1YLP A;  5CEB A;  5EVI C;  4I3J A;  4OOY A;  3H82 A;  2V8C A;  4HP4 A;  3W2Z A;  1NZU A;  1TF1 A;  3K2N A;  3EOI A;  1MWR A;  1ES4 A;  2KOI A;  4GS9 A;  1S1Y A;  3RH8 B;  3BQA A;  3BEB A;  4ESP A;  3IXB A;  2GX5 A;  4O0P A;  3VP1 A;  2ZQD A;  5CRF A;  3TW8 A;  2XDM A;  1E25 A;  1W8Q A;  4JKT A;  3GV9 A;  3SH7 A;  2O9C A;  2BLS A;  1YMX A;  4IED A;  4ZDX A;  4OLG A;  1GA9 A;  4E6W A;  3GTC A;  4WN5 A;  3E2K A;  1KE4 A;  2JE5 A;  5FQJ A;  2JKT I;  3V5M A;  5EEC A;  3ISG A;  2XR0 A;  4F3L B;  2ZC4 B;  3Q7Z A;  5KMW A;  4HI4 A;  3BJN A;  1OTB A;  1YLJ A;  3MZE A;  2ZQA A;  2GNX A;  1DJC A;  4R6L A;  4PPR A;  4ZBE A;  1Q2Q A;  4PM8 A;  1FR1 A;  2J3W A;  4II7 A;  1PWG A;  2QJ5 A;  3IX8 A;  4OQH A;  3RXX A;  3RTY A;  1S1Z A;  1BZA A;  1T1C A;  1XFQ A;  3G31 A;  4JBF A;  3BYD A;  5HZH A;  2HP6 A;  2PRF A;  2W1T A;  3F1O B;  3ZGA B;  3V50 A; 
#chains in the Genus database with same CATH homology
 4EU0 A;  2Z6D A;  2ZOH A;  4NXB A;  2PT7 A;  2WKR A;  3OC2 A;  1LSX A;  4GW9 A;  4GHI A;  2DMW A;  4DJ3 A;  2LB9 A;  2V9A A;  4JGR A;  3LI9 A;  2XA7 M;  3EGX C;  3E98 A;  3C8C A;  1N9O A;  2ZOI A;  2A24 A;  4BWI A;  5F68 A;  1NWZ A;  3IBJ A;  5HPF A;  4IUK A;  1DRM A;  4IHQ A;  2HGV A;  1MZU A;  4GS9 B;  4KQO A;  2MJ6 A;  3EEA A;  5A8B A;  2L0W A;  1H8M A;  4KUO A;  1LSW A;  4GLQ A;  3LUQ A;  4LLO B;  1KOU A;  1F98 A;  4HY8 A;  2B18 A;  5HL6 A;  3FPW A;  1NLZ A;  3T4L A;  3F1O A;  4BJP A;  1UWP X;  4L9F A;  5AVF A;  4HP9 A;  1D7E A;  5KIZ A;  4Z1W A;  5J4E A;  4HJ4 A;  2JKR M;  4HH3 A;  4E04 A;  5IT5 A;  2PR6 A;  5F69 A;  2L1M A;  5I5L A;  3MXQ A;  3OCL A;  3LR4 A;  3NOU C;  2J80 A;  1OTA A;  4CLC A;  3MQO A;  5HDS A;  5G4Z A;  2WKP A;  3OBF A;  5KSH A;  4WL9 A;  2VGL S;  1GSX A;  3BWL A;  4FSF A;  1P9R A;  5TBM B;  3CI6 A;  5AJG A;  3LIB A;  4EES A;  1T1B A;  3LR3 A;  2VV7 A;  2HF6 A;  2W3G A;  1XJ4 A;  1NLY A;  2Y8H A;  2KX6 A;  2WKQ A;  1DP6 A;  3MQQ A;  4GCZ A;  4MMN A;  2VJW A;  4KQD A;  2BAS A;  5IU1 A;  3TE8 A;  4YNR A;  5F6A A;  1NRJ A;  2KDK A;  3IS2 A;  3T4O A;  1S4S A;  2VKS A;  3K3C A;  5CX7 A;  5DKL A;  2O0Y A;  4R38 A;  3MMH A;  1UWN X;  3MFX A;  4EEP A;  5HWV A;  1P97 A;  2V1B A;  5DKK A;  2M1C A;  2HJE A;  4EQ1 A;  4MDZ A;  4YOF A;  1G6O A;  2W1R A;  1TS6 A;  3S7O A;  2PHY A;  2D02 A;  3LR5 A;  2EWW A;  4BMW A;  1N9N A;  4NXF A;  5F5Y A;  2R78 A;  2IA2 A;  2ZMV A;  4MN5 A;  2EA9 A;  3B33 A;  3LFV A;  4HQA A;  1OTE A;  4UQI M;  4CLC C;  2W3H A;  3C2W A;  4P6Z M;  4LRY C;  4G3V A;  1YSP A;  5LBR A;  1BYW A;  2XSS A;  2GJ3 A;  2W3F A;  4UEY A;  1GSV A;  4DN0 A;  2M7U A;  4L9G A;  2H28 A;  3F1N B;  1TS8 A;  2HJ9 C;  4IJG A;  3CWF A;  2W27 A;  4RQ9 A;  2OWH A;  4NXG A;  1DP9 A;  1IOU A;  2INW A;  4O01 A;  4M4X A;  4LPZ A;  5DJT A;  4EEU A;  3KYZ A;  2GZA A;  2FH5 A;  3UB9 A;  2PD8 A;  4NEE D;  3KSH A;  3UME A;  5EFW A;  3CLO A;  2O9B A;  5HWT A;  2YKH A;  4ZRR A;  2JN7 A;  3UE6 A;  1D06 A;  3UB8 A;  3C30 A;  4WUJ A;  1OTI A;  4H6J B;  2K31 A;  1F9I A;  3FC7 A;  2KLI A;  5HDC A;  3DBA A;  4JGP A;  1ODV A;  2VA0 A;  3A0V A;  3V67 A;  3T4Q A;  1IFQ A;  4HH2 A;  3MJQ A;  4P6Z S;  1W63 Q;  4HNB A;  4CLC E;  2PD7 A;  1VB6 A;  4WLA A;  3UE3 A;  2O99 A;  2A2L A;  2CMN A;  1OT9 A;  3TJZ C;  4G3W A;  4HOI A;  4I3I A;  2A24 B;  4CLC D;  3OOV A;  2XRO A;  1T18 A;  3BQ8 A;  3T4J A;  4BBU A;  2VZW A;  1WA9 A;  4I38 A;  2PYP A;  1GSW A;  2G7U A;  2ZMF A;  3F1N A;  4OOM A;  4XT2 B;  2O9A A;  3EQV A;  2I9V A;  3GDI A;  3VV4 A;  1MC0 A;  1OJ5 A;  5DJU A;  4Y5F A;  4R3A A;  2QKP A;  5C5K A;  4BBT A;  3ULF A;  2W1T B;  2W3D A;  3O5Y A;  3B47 A;  4WEL A;  4EUV A;  3CIT A;  4NXE A;  4ARZ A;  3OCN A;  4I3A A;  2K2N A;  2P08 A;  5HSQ A;  5HD5 A;  4ARZ B;  1OPX A;  3UB7 A;  4PKY G;  4WEK A;  3JVV A;  4LRX C;  3MR0 A;  2VEA A;  3PBT A;  4AFI A;  4F3L A;  1G28 A;  1S4R A;  3LR0 A;  3H9W A;  3B42 A;  1N9L A;  2ZBB A;  4HJ3 A;  3EEH A;  5AVE A;  4I5S A;  1UGU A;  4WF0 A;  1LT0 A;  1YKD A;  2VGL M;  4ME4 A;  5TJJ A;  1V9Z A;  1P9W A;  2J3T C;  3H7W A;  3NOP C;  2NUT C;  3KX0 X;  4CQH A;  2M7V A;  3ZQ5 A;  1OTD A;  1T19 A;  3FG8 A;  1LL8 A;  4MN7 A;  3JVU A;  2JKR I;  3F1P A;  1TD5 A;  3PBR A;  3E4P A;  4O8G A;  5G4Y A;  3PHY A;  4WEJ A;  2OOL A;  4HHD A;  3NJA A;  3UB6 A;  3LIA A;  3R4K A;  2HV1 A;  4DJ2 A;  4I39 A;  2J3T D;  3LYX A;  3G6O A;  4ETZ A;  2P7J A;  3HJI A;  1DP8 A;  3VOL A;  2QYB A;  2VV6 A;  1JNU A;  3E4Q A;  2Z6C A;  2XA7 S;  4L9E A;  3A0R A;  1MKM A;  4BBV A;  1F5M A;  4LRZ E;  3EGD C;  4FOF A;  4OOL A;  3KSG A;  2W3E A;  4Y3I A;  2Y79 A;  3HCY A;  1LSV A;  3LIE A;  3T4K A;  3S7N A;  2OAP 1;  4L0L A;  3U2A A;  1S66 L;  5HD3 A;  2P04 A;  3R7W B;  3A0S A;  2V1A A;  1W63 M;  3IS2 B;  4Q0I A;  3PBO A;  1OT6 A;  2L4R A;  5DFY A;  3H7W B;  4IUH A;  4EER A;  3KYQ A;  2OWJ A;  4PKY A;  3NHQ A;  2PR5 A;  3EQU A;  3LIC A;  3D3O A;  3T4T A;  4KUK A;  3E0Y A;  1P0Z A;  1YSQ A;  4ETX A;  1X0O A;  5IS1 A;  3PYP A;  5DFX A;  5TBM A;  3PXP A;  1VHM A;  2XRN A;  3IBR A;  2JKT M;  3KSF A;  4CLC B;  3PBQ A;  3BY9 A;  1Y28 A;  2LB5 A;  4Q0H A;  2NUP C;  3CUE C;  5FL3 A;  4H6J A;  2EWV A;  3KO6 A;  4Q0J A;  1TS7 A;  2QJ7 A;  1XFN A;  3H82 B;  3PBN A;  4I3J A;  3SW1 A;  3P7N A;  2D01 A;  3H82 A;  3W2Z A;  4HP4 A;  1TF1 A;  3K2N A;  3EOI A;  3ICY A;  5DF9 A;  1XJ6 A;  2QWS A;  5J7E A;  2VV8 A;  3CAX A;  3VE4 A;  2KOI A;  4PAU A;  4B9O A;  4GS9 A;  1S1Y A;  3RH8 B;  3R7W A;  3T50 A;  3BQA A;  2QHK A;  2VX8 A;  4MN6 A;  2GX5 A;  2K7S A;  1T1A A;  3UMD A;  4O0P A;  3NOT C;  3LIF A;  4NKP A;  4K08 A;  4R70 A;  3TW8 A;  1EW0 A;  3GEC A;  3KSI A;  2O9C A;  3BW6 A;  3FPV A;  2VLG A;  4JGO A;  3CUE A;  5HDD A;  3PBS A;  1OJG A;  3K3D A;  3MF0 A;  4GHI B;  4WN5 A;  1S67 L;  2JKT I;  4GJ4 A;  3PR6 A;  5L8M A;  4F3L B;  3LID A;  3MQ0 A;  4Y2F A;  3S7P A;  4JGQ A;  3P01 A;  2PYR A;  3T4S A;  4HIA A;  4HJ6 A;  2PDR A;  2V0U A;  4HI4 A;  4EET B;  1V9Y A;  4B93 A;  2W0N A;  3BJN A;  1OTB A;  1ZHH B;  1ZTU A;  1TS0 A;  1XJ2 A;  4MCW A;  3D72 A;  1XJ3 A;  5HPI A;  2GNX A;  4QPR A;  3E4O A;  3EWK A;  4YWZ A;  2JHE A;  3ZYT A;  5MC7 A;  3BY8 A;  4R6L A;  3S7Q A;  3RFB A;  2OAQ 1;  5K5B A;  5HWW A;  3OLO A;  2J3W A;  4II7 A;  3HJK A;  2QJ5 A;  5J3W A;  1YAX A;  3F1P B;  3RTY A;  4DMZ A;  1S1Z A;  2YKF A;  1STZ A;  1T1C A;  1XFQ A;  3C38 A;  3VE3 A;  4G3K A;  2FZ0 A;  1H3Q A;  3LI8 A;  5HZH A;  4XT2 A;  4PHT A;  2W1T A;  2V0W A;  3F1O B;  4EW7 A;  4UQI S;  2B02 A;  4EXO A;  3TRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...