3CI6A

Crystal structure of the gaf domain from acinetobacter phosphoenolpyruvate-protein phosphotransferase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
167
structure length
158
Chain Sequence
MSNMQLDTLRRIVQEINSSVSLHDSLDIMVNQVADAMKVDVCSIYLLDERNQRYLLMASKGLNPESVGHVSLQLSEGLVGLVGQREEIVNLENASKHERFIYNSFLGVPVMYRRKVMGVLVVQNKQPQDFSEAAESFLVTLCAQLSGVIAHAHAVGNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphoenolpyruvate-protein phosphotransferase
publication title Crystal structure of the GAF domain from Acinetobacter phosphoenolpyruvate-protein phosphotransferase.
rcsb
source organism Acinetobacter sp.
total genus 44
structure length 158
sequence length 167
chains with identical sequence B
ec nomenclature ec 2.7.3.9: Phosphoenolpyruvate--protein phosphotransferase.
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ci6A00
4DMZA 3KSFA 1YSPA 4PAUA 2HGVA 4R70A 4Y5FA 3KSHA 4O01A 4EUVA 4LRYC 3TRCA 4IUKA 5C5KA 4Z1WA 2VZWA 3NOPC 4ME4A 3KSGA 2KOIA 3CITA 5HL6A 3EEAA 4MMNA 1MKMA 5HPFA 5DFXA 2W1TB 5K5BA 1VHMA 5I5LA 2W1TA 4G3VA 4GW9A 2KLIA 4G3KA 3HCYA 2LB5A 4CQHA 3ZQ5A 4ETZA 2OOLA 3S7PA 2W3DA 3S7QA 1YSQA 3NHQA 2O9AA 3D3OA 5LBRA 1MC0A 3VV4A 4R6LA 5TJJA 3K2NA 3CI6A 3R4KA 2XRNA 3BJNA 3MF0A 1YKDA 2O0YA 4Y3IA 1TF1A 2W1RA 3IBJA 3MMHA 4G3WA 4LRZE 2G7UA 2M7VA 4LRXC 5AJGA 2W3GA 2ZMFA 3NOTC 2M7UA 2VEAA 3NOUC 3O5YA 4IJGA 4Q0JA 4E04A 5HPIA 5DFYA 4O8GA 4BWIA 2K2NA 3S7NA 1F5MA 3E98A 2VJWA 4Q0HA 4GLQA 2VKSA 4RQ9A 4YOFA 2K31A 2Y79A 3DBAA 4Y2FA 3C2WA 3OOVA 3LFVA 2LB9A 4EU0A 2Y8HA 4MN7A 4ZRRA 4Q0IA 2IA2A 4MCWA 3S7OA 5HSQA 2W3EA 2B18A 4IUHA 3W2ZA 3KO6A 3E0YA 2W3FA 4ETXA 2O99A 3KSIA 4MDZA 2O9BA 1ZTUA 2O9CA 2GX5A 1STZA 3OBFA 4DN0A 3IBRA 2QYBA 3RFBA 4QPRA 2XROA 4FOFA 4YNRA 2XSSA 3G6OA 5L8MA 1TD5A 2W3HA 3MQ0A 4O0PA
chains in the Genus database with same CATH superfamily
2Y2MA 4YWZA 1HLUP 4JGPA 4AFIA 4LV2A 2A24A 3RTYA 4F3LA 3VP1A 4KZ8A 3RXXA 3KSGA 3LI9A 3A3DA 2EX9A 2FFFB 1TDLA 2Y59A 4G3KA 3HCYA 3IWIA 3IF5A 5E2EA 4S2IA 3RJUA 3K3DA 5HWVA 1G6AA 3NECA 1ES4A 1ZG4A 3NIAA 5EOOA 3H82B 3K2NA 1K0KA 4E3JA 2Y2HA 1LI9A 1EWZA 5E2GA 5HZHA 3SS4A 4LV0A 3LR0A 4OQHA 4NXBA 3N7WA 4WMCA 3ITAA 5A92A 3C7UA 3LUQA 5FQJA 5HPIA 4OH0A 3OPRA 1DY6A 4E3KA 5TFQA 2G2UA 3C5AA 1F5MA 4WELA 2JKTI 4WMCD 1N4OA 5TGFA 5F1FA 5FAPA 2WKPA 4FH2A 4U3TA 4UEYA 1JWVA 5GLCA 4DF6A 1CF0A 1Y4OA 1MWTA 3ZGAB 2UWXA 1H0MA 4X68A 2W0NA 4OONA 2Q0OA 2JKFA 1BULA 5AVFA 1KDSA 4UHUA 1K55C 4WZ4A 3UB6A 4LENA 2B95A 3MZFA 1FCNA 3QP4A 4PAUA 3CPTA 3ZFZA 3VOLA 3M6BA 4JLFA 2VZWA 2V2FF 1V9ZA 1BLPA 3G2ZA 4B88A 2WZXA 3R7WB 1Z6FA 2L1MA 1JNUA 3CMZA 2OOLA 3Q7VA 1OTIA 3ZNYA 3VOYA 4LFUA 4E6XA 1MC0A 1CK3A 4N9KA 4FSFA 3BFEA 1ODVA 4KZ7A 4X25A 2W1RA 3P01A 1MKIA 2W3GA 5KIZA 3NOTC 1LSVA 3LO7A 3A0VA 4HNBA 3HLWA 2EX6A 3OCNA 5A91A 5FDHA 4KQRA 3SOIA 1RGZA 3E98A 3LEZA 1S66L 2HDSA 3P7NA 3C8CA 3CZDA 1K6RA 1F98A 4HJ6A 3LY3A 3PBTA 5GL9A 4NXGA 4MCWA 5HSQA 4UA7A 3UB5P 4EQ1A 4QJGA 4NKPA 3GMWA 3KO6A 4WEJA 2W3FA 1OT6A 2C6WB 2ZMVA 5L10A 1PI4A 2GX5A 4S2NA 4UA9A 3EWKA 3JPUA 3TW8A 1NWZA 1QMFA 3F1NB 3I7JA 2XROA 5E2FA 2W3HA 3BFFA 2Z6CA 1ZHHB 1NRFA 5F69A 2QZ6A 1G6OA 4Y5FA 1WYBA 2A24B 3IS2A 4F3LB 4FUWA 2PBYA 3VSKA 1H3QA 4P6BA 3UMDA 5CGSA 4GHIA 3U2AA 1H5XA 1GSWA 2J7VA 4CQHA 2W3DA 5CERA 5I94A 3OCLA 3D3OA 4IVKA 4DRTA 3OC2A 1GSXA 3UPPA 2Q9MA 2BASA 2CMNA 3TOIA 1F2KA 2WZZA 3ICYA 3QP2A 3OPPA 3BECA 1M40A 3SH9A 4WN5A 3LCEA 1S67L 5IHVA 4IBRA 4MBKA 4R3AA 2K2NA 4MEZA 3QP1A 4X6TA 2VKSA 2XD5A 1V9YA 2Y2QA 1RGYA 3OOVA 3LFVA 4Y0TA 5E43A 4ZRRA 4N92A 3S7OA 1CI8A 5FAQA 4FD8A 4WEKA 2V9AA 5F82A 3LIEA 4DXBA 3C4OA 1UWNX 3E2LA 5M18A 4MNRA 3CPTB 1YSPA 3QHYA 4XUXA 1JWZA 3W8KA 4E3LA 1T1AA 3LYXA 4UAAA 4Z1WA 3N8LA 4PKYG 1K57A 4Y17A 4DJ2A 2XF3A 1NY0A 1E25A 1T19A 3D9YA 3MBZA 3P09A 5DFXA 5G4ZA 3Q7VB 1E3UA 4EESA 5IU1A 1J9MA 1YSQA 3QP8A 3E4QA 4EBLA 1OTEA 3FKWA 3IX3A 2PYPA 1E3UD 2XRNA 2ZBBA 3DWZA 2O0YA 4CJNA 1TF1A 3MMHA 5J3WA 4S2MA 3ISGA 2J3WA 3BLSA 3FG8A 5TBMA 4L0LA 4B9OA 1S1YA 3LEQA 4BL2A 3DW0A 3FPWA 4OLGA 3W4PA 3BQ8A 2H28A 3ZCZA 1MWRA 1YLTA 2D02A 3UE6A 3PBQA 3WWXA 1TS8A 1EW0A 1CQAA 1YLYA 2IA2A 1K56A 4IUHA 4QY6A 4OQIA 4JGOA 1JVJA 3B42A 2Y55A 3HREA 2ZM0A 1K56D 4PKYA 2WAFA 2JKTM 1BSGA 2XD1A 2A2LA 1PZOA 4B4XA 2HDQA 3QP5A 1Y28A 3IS2B 4DE1A 4ZBEA 3UB8A 2JE5A 4K08A 4GHIB 2KDKA 2QKPA 2GNXA 3BFCA 3FWLA 4OOYA 4P0MA 5GHZA 2ZQAA 2PHYA 3ZVTA 4LV1A 1PWCA 3IWOA 3MZDA 4CLCA 2WGVA 3NULA 1YMSA 2XFSA 3PAGA 3KYZA 4L9GA 3WS5A 1Q2PA 2J9PA 4CLCD 3OZHA 4EBPA 3P98A 1KVMA 4LCMA 5F6AA 2ZC7A 2Y2NA 1LL9A 2EWVA 1BYWA 1G28A 5DFYA 2OLUA 3W4OA 3BLMA 3LIDA 1PW1A 4UQIM 1IKGA 3EEHA 2Q9NA 3MKEA 3E4PA 4NXFA 1Z09A 2P7JA 1K4EA 2I72A 2IWBA 3SH8A 4OP5A 1FSWA 3F1PA 3RXWA 5DKLA 3LICA 4X53A 3DAVA 1P9WA 3V3RA 3U4LP 2JCHA 3KSIA 5JYOA 3SH7A 5HAQA 1XPBA 3S4XA 3BYDA 1ZG6A 3QP6A 4KZ5A 1XA7A 3MQ0A 5FQKA 3FV7A 5A8BA 3S1YA 3FPVA 2EA9A 4HI4A 3IH9A 4EV4A 3HLGA 2PAVP 5KSCA 1PYYA 1W5DA 3SZTA 1BT5A 4XUZA 2G2WA 3VMAA 5HL6A 4MMNA 4ESPA 1YMXA 3CJMA 2ZQ7A 2PT7A 4OPYA 4OVDA 1XJ6A 1MY8A 1MWSA 4S2NC 4ZAMA 3S7PA 1ZKJA 1YLPA 5FQMA 2BTFP 4RX2A 4ZJ1A 2PDRA 3VP4A 2P74A 4Z9QA 2VX8A 3O3VA 4BMWA 1FIKA 4KQDA 3UE1A 3MSHA 4E04A 4GD8A 1HD8A 2XEPA 3GTCA 1BUEA 4KQQA 1W7FA 1NYYA 4BWIA 4HH2A 3S7NA 4H6JA 3MZEA 5HX9A 3IWQA 4EERA 2ZC5B 2DCFA 1D06A 1L0GA 1VEUA 1DRMA 1RCJA 5CHJA 1DJCA 3A3IA 2JBFA 2L0WA 1LSXA 4MDZA 3ITBA 1FCMA 4BD1A 4HY8A 1XJ2A 4DN0A 5G18A 3MXQA 4GNUA 5FEFA 3M2KA 4JBFA 2OAP1 1CJFA 4XXRA 3HLCA 4N9LA 1N9BA 3A3EA 1L0EA 2HZ5A 4IBXA 5DF8A 1ONHA 1W63M 5K5BA 5BOHA 5D3OA 3NDGA 4FCFA 1SHVA 1ACFA 4ETZA 2J8YA 3NDEA 3BEBA 1MBLA 1O7EA 1KGGA 2FH5A 4GDBA 5DTSA 1IOUA 1S6RA 2GDNA 4JPMA 4DE3A 4DE0A 1X0OA 4KZ4A 1IYSA 3IBJA 3IX4A 1L0FA 3G4PA 1K57C 4S2OA 1H8MA 1NJ4A 4KG2A 5EOEA 3GECA 1PRQA 4EW7A 3HUMA 3IH8A 5HDDA 4WZ5A 3O88A 2ZQ8A 1ESUA 4OP8A 5L2FA 4IHQA 4O8GA 2NUTC 4R4RA 1IYPA 4HBUA 3V67A 4PPRA 4JKTA 3MFDA 2R9WA 1FR1A 3UE0A 1XXMA 1KE4A 4FTXA 1OJGA 3F1PB 3ZYTA 3LY4A 2WYXA 4Y0UA 3EGDC 4FH4A 1BLHA 1PNEA 4K0WA 1QMEA 3MFXA 5EUAA 4RA7A 1YQSA 2XR0A 2O9BA 4E3OA 1Q2QA 2XFTA 2XA7M 1GA9A 1TD5A 4N1XA 3IX8A 2H5SA 2EFUA 2V8FA 3GDIA 5A93A 3AGEA 4YINA 4QWOA 4LPZA 4IUKA 3NOPC 3NY4A 3S22A 3V5MA 4M4XA 4GS9A 3CUEA 2OWJA 2PU4A 5GLAA 5FDSA 1G68A 2EX2A 1IYOA 5EM1A 2WGIA 3NHQA 1LT0A 3PBNA 2V1ZA 2EWWA 3WRZA 4NG2A 4KUKA 3R4KA 2GZAA 1I2SA 4OOMA 5FSRA 2Z2LB 1AWIA 2M1CA 5EFWA 5HW3A 4NEED 1W63Q 2WKQA 4R1GA 2M7UA 4KZ9A 2HJEA 4BL3A 1VB6A 4S2KA 2P9VA 5L09A 1F9IA 4O7DA 4HHDA 2VJWA 3VOZA 1WYCA 3PR6A 2H0TA 5AQ9A 1N9LA 4S2PA 2K31A 5DVAA 1VEUB 1ERQA 5G4YA 4JXGA 2Z2MB 1ZC2A 1PFLA 1GHMA 3CWFA 4KUOA 4LLOB 3N8RA 2Y2PA 3V3SA 4BJPA 4M3KA 5GLBA 2EFXA 1IFQA 4RYEA 3UB7A 3ZG0A 4LCLA 3RFBA 5EECA 3IF6A 2VV6A 4WUJA 4XT2A 2QHKA 2WKIA 5AQAA 1SKOA 5HWTA 1M6KA 1TDGA 3LR3A 1KDWA 3HUNA 5FQIA 2R9XA 5DTKA 4LRYC 3M6HA 2J80A 5HAPA 1S1ZA 2BLSA 1TVFA 3MXSA 4MLLA 2ZC4B 3O87A 4HIAA 3HL9A 4YFMA 1LSWA 2WGWA 2JKRM 3DTKA 1KGEA 4GD6A 2Y2IA 2XH9A 3S7QA 1GHPA 2O9AA 3VV4A 2OAQ1 2ZM8A 1K38A 1O07A 3V39A 2MJ6A 2IWDA 1Y54A 1DP8A 3D72A 3AGFA 4Q8IA 5EE8A 1MZUA 3BQAA 3IHBA 2VGLM 1FSYA 3ZG7B 3PBSA 4GZBA 5CGWA 3SW1A 1E4DA 3EQVA 4L9EA 3GVBA 2XK1A 3KYQA 4E6WA 2J3TD 1NRJA 2ZLYA 1D1JA 3LR4A 4X69A 1YLZA 3C2WA 1ES2A 1NZOA 4P85A 4MN7A 2X71A 1YT4A 3F1OA 2B18A 3NCKA 1VETA 4ETXA 1CI9A 3WS1A 4QPRA 5FI6A 4YNRA 4CLCE 3LI8A 5FI2A 2ZC3B 4WL9A 3UMEA 3IT9A 4UQIS 1HVBA 2WUQA 3ZNTA 4EUVA 5CECA 1VM1A 1MXOA 3TRCA 2HP9A 2WKEA 5CEDA 3LGOA 4JF4A 3E4OA 4EUZA 3VE3A 2VK3A 4GS9B 3VFHA 1XJ3A 3UPOA 4I39A 2ZQCA 2KLIA 2V0WA 2YKFA 5CTNA 2QJ7A 2DRWA 2I9VA 2L4RA 4DXCA 2C5WB 3VE4A 4BBUA 1T1BA 4Y3IA 1K54A 2WK0A 5FA7A 5FASA 2G7UA 4LRXC 5KMWA 2A3UA 2ZMFA 3BRMA 3UB9A 3LIAA 4R3JA 1YLJA 5CGXA 1TS6A 2P9VB 3V50A 4Y0OA 1KE3A 4E3MA 5F83A 1NYMA 5KSHA 5IS1A 4BENA 2HDRA 3DTEA 5FI7A 1TEMA 4JXVA 3T4SA 1XJ4A 1XX2A 3ULFA 3HUOA 4Y2FA 3G32A 4KZBA 4EU0A 3B33A 3Q1FA 4X1MA 1UWPX 2VGJA 2E8JA 5CHMA 3BWLA 2ZL1A 3PAEA 4ZJ2A 3T4JA 4EETB 4PM8A 3WRTA 3PHYA 2HJ9C 1IELA 1UGUA 3HJKA 2UV0E 4WZ5C 4KQOA 5F68A 3A3FA 1SDEA 3IF6B 3L9KA 4XT2B 4OQ0A 1IYQA 3G6OA 2ZC6B 3HLFA 3CLOA 1LHYA 5M19A 4C75A 3UDIA 4O01A 1KE0A 3MQOA 2OLVA 3DTIA 2WADA 1DJAA 4HH3A 2Y2OA 3NJAA 3T1RA 2WGWB 5HPFA 4P6ZM 3RH8B 5HWWA 3IQAA 2PD7A 4DDSA 1RP5A 5HD3A 3QNBA 4GKUA 4Y13A 4P87A 3IXGA 5FQQA 3UE3A 4II7A 4BQMA 5TJJA 4WYYA 3BJNA 1IEMA 3HBRA 4G3WA 4PM6A 4OPRA 4GDNA 1KOUA 3C4PA 2FFYA 4N1HA 4S2JA 3CUEC 4E3IA 3NOUC 4GB7A 5CEBA 4HESA 2ZD8A 1OTAA 5CHUA 3OLOA 2OV5A 4DDYA 4E3NA 1PIOA 5EM0A 5HL1A 1NLYA 5TBMB 2XGNA 1K25A 5M1AA 1DJBA 3HLBA 3FKVA 3F1OB 4DKIA 3T4LA 2W3EA 1VETB 4HBTA 2HDUA 3HLEA 2WKRA 3T1QB 2Y2GA 4H8RA 3G34A 3IBRA 5EPHA 2XSSA 5L8MA 3BFGA 4BLMA 1XGJA 4JXSA 2Y2KA 4R0QA 3EOIA 3T1XA 2RL3A 4C6YA 2PU2A 3FC7A 3A0SA 5EVIA 2EXBA 3VP2A 4A5RA 1NZUA 4S2LA 4ME4A 4I3IA 1TS7A 3QNCA 3WS2A 2Y91A 4JXWA 1PW8A 2B02A 2WKHA 5EVID 2A49A 3MJQA 2LB5A 3MR0A 4ZDXA 3BW6A 2PR5A 2ZQDA 2XA7S 3IF6C 3N6IA 3H7WA 1LL5A 3UO9A 2V1BA 5HAIA 3T50A 3CI6A 1FOFA 5HFOA 3T4QA 4LGWA 3PXPA 5CX7A 1ALQA 4L9FA 2PBDP 3N4IA 4CLCB 1BLCA 3TE8A 4WBGA 3KX0X 4UA6A 3CHWP 4PHTA 2DNSA 1ES5A 3UPNA 2QWSA 3VP0A 4QY5A 5HDCA 4EQIA 2ZJ9A 5HD5A 4Y15A 4ZJ3A 4R4SA 5CTMA 3ZDJA 4R3BA 2OSUA 2ZL1B 4HJ4A 1HTZA 1FR6A 3LIFA 4OPZA 3B3XA 3DWKA 2AVXA 3NI9A 3OBFA 2J3TC 4JF6A 2PR6A 4CPKA 5AQBA 2CC1A 3EGXC 1PWGA 2QPNA 4DMZA 1XGIA 4NETA 2HGVA 4D2OA 4R70A 3KSHA 4QB8A 5DKKA 1WA9A 1FQGA 3JYIA 5FL3A 1SKFA 2OWHA 3G2YA 2QMIA 2KOIA 3JVVA 3WS4A 4ZTKA 2PD8A 1MKMA 1NLZA 3JVUA 2HPBA 2W1TA 2Z6DA 4G3VA 4HP9A 3ZG9B 1I5QA 3HJIA 3ZQ5A 2R78A 5DJTA 1LL8A 3N8SA 3G30A 1J3WA 3GRJA 1S4RA 3NBLA 2DMWA 4BD0A 1W79A 1K6SA 1K4FA 2XDMA 1G5UA 4ARZA 3PBRA 3TG9A 1PZPA 3Q07A 1MPLA 1HZOA 2ZMAA 4IJGA 1GA0A 5CXWA 4WLAA 2XQZA 3SS5A 2HF6A 1SCWA 5GHXA 1P97A 2P04A 2VV7A 3WS0A 4Q0HA 4GLQA 4RQ9A 1YM1A 3CG5A 5EV0A 3DBAA 2GJ3A 1K54C 1OMEA 4Q0IA 5DF9A 5AVEA 3UN7A 1D7EA 3A3JA 5AQ7A 5EVEA 4QHCA 2JHEA 4U0TA 2H0YA 3GV9A 2VGLS 4OKPA 3HVFA 4H6JB 4D60A 1EI5A 1ZTUA 2O9CA 5J4EA 1STZA 3H9WA 1L3LA 5A90A 4CLCC 1OJ5A 2Y2JA 3TSGA 4EEUA 3Q82A 3W4QA 3E2KA 1YPRA 3EQUA 1SZVA 5TR7A 1JTGA 3K3CA 4PM9A 4GCZA 1A0KA 5EVIB 1P9RA 3GQZA 1OPXA 4RX3A 3IHAA 4EEPA 2VGKA 2JC7A 2WAEA 4PM7A 3EEAA 2V0UA 4HEFA 4EWFA 2IWCA 1I2WA 4MBHA 2VA0A 3H7WB 3FZCA 5U47A 1KVLA 1JTDA 5L07A 3SS3A 3NC8A 1OTBA 2ZOIA 1W8QA 4QD4A 4WF0A 5HDSA 5IT5A 1AXBA 3C38A 5FATA 4Y7PA 1XFQA 3B47A 3L7HA 4GN2A 4IVIA 2VEAA 2EXAA 3Q81A 1WE4A 3O5YA 4Q0JA 1T1CA 4KZAA 5KZHA 1BTLA 5FQ9A 3VSLA 1K55A 3TJZC 3HLDA 1LLBA 3CAXA 4YOFA 1SDNA 2Y4AA 4EXOA 2Y79A 4PMAA 4BBVA 1P0ZA 3PBOA 2BG1A 3BM6A 3E0YA 4LV3A 4PM5A 3FYZA 3G35A 4KZ3A 5FAOA 5JYPA 3OPHA 1YLWA 1XA1A 4I5SA 4O0PA 5GLDA 4BBTA 1GHIA 2V8CA 3G31A 3KSFA 3LIBA 4GJ4A 3LR5A 4JGQA 5C5KA 1L0DA 2ZQ9A 3VP3A 3T12B 4X1LA 1ESIA 3KYEA 5DTTA 2HP6A 2W1TB 3DTMA 5I5LA 5J7EA 2QJ5A 2K7SA 3A0RA 1GSVA 1XKZA 4C3QA 5LBRA 4HOIA 3PTEA 2J9OA 4R6LA 4KG5A 2HV1A 1FCOA 3H82A 3MF0A 1XFNA 1YKDA 1OTDA 4HJ3A 2JN7A 4K91A 4KZ6A 5EVIC 2YKHA 1ERMA 1H8ZA 2M7VA 4ARZB 2P08A 1BLSA 2B5RA 3ZHHA 3C30A 2KX6A 4P6ZS 2EX8A 5F5YA 2VLGA 2E8IA 2XLNA 2D01A 3ZG8B 4OLDA 1N9NA 1OT9A 2H10A 2V1AA 2Y8HA 5F1GA 3ZVWA 3MS6A 4ID4A 3UDFA 2JKGA 4NK3A 3W2ZA 1VQQA 3IXHA 5FEGA 4HQAA 1CEGA 3VFFA 2O99A 4KENB 4RVAA 4X55A 5E2HA 4GOGA 4QU3A 4B93A 3AGDA 5EVLA 4DJ3A 4X56A 4FOFA 4KG6A 3BFDA 1GCEA 1KGFA 4IEDA 4B4ZA 4DE2A 5DJUA 4OPQA 3ZG5A 1DP9A 4F94A 3OPLA 2V20A 2ZM2A 1BZAA 4NXEA 1S4SA 4R38A 1H8YA 1CEFA 2W27A 5J8XA 2HP5A 3CITA 5MC7A 1MWUA 3UY6A 3BY8A 4OOLA 2RCXA 1ONGA 1VHMA 4GW9A 3R7WA 3UNWA 3T4OA 2FZ0A 1SKOB 1IKIA 3D4FA 4MN6A 2INWA 4I3JA 5DF7A 1U60A 3MXRA 4OQGA 3BY9A 1NXYA 1ES3A 3T4KA 2NUPC 2X01A 1T18A 2ACGA 5CRFA 4WM9A 4LRZE 3MKFA 1DP6A 4K0XA 1TS0A 5AJGA 3IXDA 4MN5A 1W8YA 4R23A 3O86A 1L2SA 3T1SA 1LI0A 4JF5A 1PWDA 3UDXA 2PYRA 4I38A 3IXBA 1YAXA 5HARA 1S0WA 3GSGA 4HP4A 2JKRI 4U0XA 1C3BA 2Y2LA 3C7VA 3M2JA 3Q7ZA 1PI5A 2LB9A 4MBFA 1EROA 2PRFA 3MQQA 2ZOHA 4JGRA 2VV8A 4EBNA 2X02A 1FILA 1XP4A 2QYBA 1JWPA 3F1NA 3T4TA 4I3AA 3GR2A 5GHYA 1N9OA 3PYPA
chains in the Genus database with same CATH topology
4DMZA 2HGVA 4YWZA 5HWTA 1Y28A 3IS2B 3LR3A 4JGPA 3KSHA 4R70A 3UB8A 4AFIA 5DKKA 2A24A 4LRYC 2J80A 3RTYA 1WA9A 4F3LA 1S1ZA 5FL3A 4K08A 4GHIB 2KDKA 2OWHA 3KSGA 2QKPA 2KOIA 2GNXA 3JVVA 3LI9A 2PD8A 4HIAA 1MKMA 1LSWA 2PHYA 1NLZA 2JKRM 3JVUA 2W1TA 2Z6DA 4G3VA 4HP9A 4G3KA 3HCYA 3HJIA 3ZQ5A 2R78A 3S7QA 5DJTA 4CLCA 2O9AA 1LL8A 3K3DA 5HWVA 3VV4A 2OAQ1 3H82B 3K2NA 3KYZA 4L9GA 4CLCD 2MJ6A 1S4RA 2DMWA 1DP8A 3D72A 5HZHA 1MZUA 3BQAA 3LR0A 4ARZA 3PBRA 4NXBA 5F6AA 2VGLM 3PBSA 4IJGA 3LUQA 2EWVA 5HPIA 1BYWA 1G28A 4WLAA 5DFYA 3SW1A 2HF6A 3EQVA 4L9EA 1F5MA 4WELA 3LIDA 2JKTI 4UQIM 3KYQA 1P97A 2P04A 2VV7A 3EEHA 2J3TD 3E4PA 2WKPA 4Q0HA 4NXFA 1NRJA 4GLQA 4RQ9A 2P7JA 3LR4A 3DBAA 4UEYA 3F1PA 2GJ3A 3C2WA 4MN7A 4Q0IA 5DKLA 3LICA 3F1OA 5DF9A 5AVEA 2B18A 1D7EA 1P9WA 4ETXA 2JHEA 3KSIA 2VGLS 4H6JB 2W0NA 1ZTUA 2O9CA 5J4EA 1STZA 3H9WA 4CLCC 1OJ5A 5AVFA 4QPRA 4EEUA 4YNRA 4CLCE 3LI8A 4WL9A 3UMEA 3UB6A 4UQIS 3MQ0A 3EQUA 4PAUA 5A8BA 3K3CA 3VOLA 4GCZA 3FPVA 4EUVA 1P9RA 2EA9A 1OPXA 4HI4A 3TRCA 2VZWA 4EEPA 3E4OA 3VE3A 1V9ZA 4GS9B 5HL6A 3EEAA 2V0UA 4MMNA 1XJ3A 3R7WB 4I39A 2L1MA 2KLIA 2PT7A 2V0WA 1JNUA 1XJ6A 2YKFA 2QJ7A 2OOLA 2VA0A 3S7PA 3H7WB 1OTIA 2I9VA 2L4RA 1MC0A 1OTBA 2ZOIA 4WF0A 4FSFA 1ODVA 5HDSA 3VE4A 4BBUA 1T1BA 2PDRA 3C38A 4Y3IA 5IT5A 2W1RA 1XFQA 3B47A 3P01A 2G7UA 2VX8A 4LRXC 4BMWA 2W3GA 2ZMFA 5KIZA 3UB9A 3NOTC 1LSVA 3LIAA 3A0VA 4HNBA 2VEAA 3O5YA 4KQDA 4Q0JA 1T1CA 1TS6A 4E04A 3OCNA 4BWIA 4HH2A 3S7NA 4H6JA 3TJZC 3E98A 5KSHA 5IS1A 1S66L 3P7NA 3C8CA 3CAXA 4EERA 4YOFA 3T4SA 1XJ4A 3ULFA 4EXOA 1F98A 4HJ6A 1D06A 2Y79A 4Y2FA 3PBTA 4BBVA 4EU0A 3B33A 1DRMA 1P0ZA 4NXGA 3PBOA 1UWPX 4MCWA 5HSQA 4EQ1A 4NKPA 2L0WA 3BWLA 3KO6A 3E0YA 4WEJA 3T4JA 2W3FA 4EETB 1OT6A 1LSXA 3PHYA 4MDZA 2HJ9C 1UGUA 2ZMVA 3HJKA 4HY8A 1XJ2A 2GX5A 4KQOA 5F68A 4DN0A 3EWKA 3TW8A 1NWZA 2XROA 3F1NB 4XT2B 3G6OA 4I5SA 2W3HA 3MXQA 2Z6CA 4O0PA 1ZHHB 3CLOA 4BBTA 3KSFA 3LIBA 5F69A 4GJ4A 1G6OA 4Y5FA 3LR5A 2OAP1 4O01A 2A24B 3IS2A 4F3LB 4JGQA 3MQOA 5C5KA 4HH3A 1H3QA 3UMDA 4GHIA 3NJAA 5HPFA 2W1TB 4P6ZM 1W63M 5K5BA 5I5LA 3U2AA 5J7EA 3RH8B 2QJ5A 5HWWA 1GSWA 2PD7A 4CQHA 4ETZA 2K7SA 2W3DA 3A0RA 5HD3A 1GSVA 3OCLA 2FH5A 3D3OA 5LBRA 1IOUA 3OC2A 4HOIA 1GSXA 3UE3A 4II7A 4R6LA 5TJJA 2HV1A 1X0OA 3H82A 3BJNA 3MF0A 1XFNA 1YKDA 1OTDA 4HJ3A 3IBJA 2JN7A 4G3WA 2BASA 2CMNA 2YKHA 2M7VA 4ARZB 2P08A 3ICYA 1H8MA 1KOUA 3C30A 3GECA 2KX6A 4EW7A 3CUEC 3NOUC 4WN5A 4P6ZS 5HDDA 1S67L 5F5YA 1OTAA 3OLOA 4R3AA 4IHQA 2VLGA 2NUTC 4O8GA 2K2NA 3V67A 2D01A 2VKSA 1N9NA 1NLYA 5TBMB 1OT9A 1OJGA 3F1PB 1V9YA 3ZYTA 2V1AA 3OOVA 3LFVA 2Y8HA 3F1OB 4ZRRA 3T4LA 3S7OA 3EGDC 2W3EA 3W2ZA 3MFXA 4HQAA 2O99A 4WEKA 2O9BA 2WKRA 2V9AA 3LIEA 4B93A 3IBRA 4DJ3A 2XA7M 4FOFA 1UWNX 2XSSA 5L8MA 1TD5A 5DJUA 1YSPA 3EOIA 1DP9A 3GDIA 3FC7A 4NXEA 1S4SA 3A0SA 4R38A 1T1AA 3LYXA 4LPZA 4IUKA 4Z1WA 4PKYG 3NOPC 4ME4A 4I3IA 1TS7A 2W27A 4DJ2A 3CITA 4M4XA 2B02A 5MC7A 4GS9A 1T19A 2OWJA 3CUEA 3BY8A 4OOLA 5DFXA 1VHMA 4GW9A 3R7WA 5G4ZA 3MJQA 2LB5A 3MR0A 3BW6A 2PR5A 3T4OA 2FZ0A 4EESA 5IU1A 4MN6A 2XA7S 1YSQA 3NHQA 1LT0A 3H7WA 3PBNA 3E4QA 2INWA 4I3JA 2V1BA 1OTEA 2EWWA 3BY9A 4KUKA 2PYPA 3T50A 3CI6A 3R4KA 2GZAA 2XRNA 3T4KA 2ZBBA 2NUPC 4OOMA 2O0YA 1TF1A 3MMHA 5J3WA 1T18A 3T4QA 2J3WA 3PXPA 2M1CA 4LRZE 5EFWA 3FG8A 5TBMA 1DP6A 1TS0A 4NEED 4L0LA 5AJGA 5CX7A 4B9OA 1W63Q 2WKQA 4MN5A 1S1YA 2M7UA 4L9FA 2HJEA 4CLCB 3TE8A 3KX0X 1VB6A 3FPWA 4PHTA 2QWSA 3BQ8A 2PYRA 4I38A 1F9IA 5HDCA 4HHDA 2H28A 1YAXA 2VJWA 5HD5A 4HP4A 2D02A 2JKRI 3UE6A 3PR6A 3PBQA 1N9LA 2K31A 1TS8A 1EW0A 5G4YA 2LB9A 2IA2A 4IUHA 3CWFA 4KUOA 3MQQA 4LLOB 2ZOHA 4JGRA 2VV8A 4HJ4A 4JGOA 4BJPA 3LIFA 3B42A 4PKYA 1IFQA 2JKTM 3UB7A 3OBFA 2J3TC 2PR6A 2QYBA 3RFBA 2A2LA 3F1NA 3T4TA 3EGXC 2VV6A 4WUJA 4I3AA 4XT2A 2QHKA 1N9OA 3PYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DMZ A;  3KSF A;  1YSP A;  4PAU A;  2HGV A;  4R70 A;  4Y5F A;  3KSH A;  4O01 A;  4EUV A;  4LRY C;  3TRC A;  4IUK A;  5C5K A;  4Z1W A;  2VZW A;  3NOP C;  4ME4 A;  3KSG A;  2KOI A;  3CIT A;  5HL6 A;  3EEA A;  4MMN A;  1MKM A;  5HPF A;  5DFX A;  2W1T B;  5K5B A;  1VHM A;  5I5L A;  2W1T A;  4G3V A;  4GW9 A;  2KLI A;  4G3K A;  3HCY A;  2LB5 A;  4CQH A;  3ZQ5 A;  4ETZ A;  2OOL A;  3S7P A;  2W3D A;  3S7Q A;  1YSQ A;  3NHQ A;  2O9A A;  3D3O A;  5LBR A;  1MC0 A;  3VV4 A;  4R6L A;  5TJJ A;  3K2N A;  3CI6 A;  3R4K A;  2XRN A;  3BJN A;  3MF0 A;  1YKD A;  2O0Y A;  4Y3I A;  1TF1 A;  2W1R A;  3IBJ A;  3MMH A;  4G3W A;  4LRZ E;  2G7U A;  2M7V A;  4LRX C;  5AJG A;  2W3G A;  2ZMF A;  3NOT C;  2M7U A;  2VEA A;  3NOU C;  3O5Y A;  4IJG A;  4Q0J A;  4E04 A;  5HPI A;  5DFY A;  4O8G A;  4BWI A;  2K2N A;  3S7N A;  1F5M A;  3E98 A;  2VJW A;  4Q0H A;  4GLQ A;  2VKS A;  4RQ9 A;  4YOF A;  2K31 A;  2Y79 A;  3DBA A;  4Y2F A;  3C2W A;  3OOV A;  3LFV A;  2LB9 A;  4EU0 A;  2Y8H A;  4MN7 A;  4ZRR A;  4Q0I A;  2IA2 A;  4MCW A;  3S7O A;  5HSQ A;  2W3E A;  2B18 A;  4IUH A;  3W2Z A;  3KO6 A;  3E0Y A;  2W3F A;  4ETX A;  2O99 A;  3KSI A;  4MDZ A;  2O9B A;  1ZTU A;  2O9C A;  2GX5 A;  1STZ A;  3OBF A;  4DN0 A;  3IBR A;  2QYB A;  3RFB A;  4QPR A;  2XRO A;  4FOF A;  4YNR A;  2XSS A;  3G6O A;  5L8M A;  1TD5 A;  2W3H A;  3MQ0 A;  4O0P A; 
#chains in the Genus database with same CATH topology
 2Y2M A;  4YWZ A;  1HLU P;  4JGP A;  4AFI A;  4LV2 A;  2A24 A;  3RTY A;  4F3L A;  3VP1 A;  4KZ8 A;  3RXX A;  3KSG A;  3LI9 A;  3A3D A;  2EX9 A;  2FFF B;  1TDL A;  2Y59 A;  4G3K A;  3HCY A;  3IWI A;  3IF5 A;  5E2E A;  4S2I A;  3RJU A;  3K3D A;  5HWV A;  1G6A A;  3NEC A;  1ES4 A;  1ZG4 A;  3NIA A;  5EOO A;  3H82 B;  3K2N A;  1K0K A;  4E3J A;  2Y2H A;  1LI9 A;  1EWZ A;  5E2G A;  5HZH A;  3SS4 A;  4LV0 A;  3LR0 A;  4OQH A;  4NXB A;  3N7W A;  4WMC A;  3ITA A;  5A92 A;  3C7U A;  3LUQ A;  5FQJ A;  5HPI A;  4OH0 A;  3OPR A;  1DY6 A;  4E3K A;  5TFQ A;  2G2U A;  3C5A A;  1F5M A;  4WEL A;  2JKT I;  4WMC D;  1N4O A;  5TGF A;  5F1F A;  5FAP A;  2WKP A;  4FH2 A;  4U3T A;  4UEY A;  1JWV A;  5GLC A;  4DF6 A;  1CF0 A;  1Y4O A;  1MWT A;  3ZGA B;  2UWX A;  1H0M A;  4X68 A;  2W0N A;  4OON A;  2Q0O A;  2JKF A;  1BUL A;  5AVF A;  1KDS A;  4UHU A;  1K55 C;  4WZ4 A;  3UB6 A;  4LEN A;  2B95 A;  3MZF A;  1FCN A;  3QP4 A;  4PAU A;  3CPT A;  3ZFZ A;  3VOL A;  3M6B A;  4JLF A;  2VZW A;  2V2F F;  1V9Z A;  1BLP A;  3G2Z A;  4B88 A;  2WZX A;  3R7W B;  1Z6F A;  2L1M A;  1JNU A;  3CMZ A;  2OOL A;  3Q7V A;  1OTI A;  3ZNY A;  3VOY A;  4LFU A;  4E6X A;  1MC0 A;  1CK3 A;  4N9K A;  4FSF A;  3BFE A;  1ODV A;  4KZ7 A;  4X25 A;  2W1R A;  3P01 A;  1MKI A;  2W3G A;  5KIZ A;  3NOT C;  1LSV A;  3LO7 A;  3A0V A;  4HNB A;  3HLW A;  2EX6 A;  3OCN A;  5A91 A;  5FDH A;  4KQR A;  3SOI A;  1RGZ A;  3E98 A;  3LEZ A;  1S66 L;  2HDS A;  3P7N A;  3C8C A;  3CZD A;  1K6R A;  1F98 A;  4HJ6 A;  3LY3 A;  3PBT A;  5GL9 A;  4NXG A;  4MCW A;  5HSQ A;  4UA7 A;  3UB5 P;  4EQ1 A;  4QJG A;  4NKP A;  3GMW A;  3KO6 A;  4WEJ A;  2W3F A;  1OT6 A;  2C6W B;  2ZMV A;  5L10 A;  1PI4 A;  2GX5 A;  4S2N A;  4UA9 A;  3EWK A;  3JPU A;  3TW8 A;  1NWZ A;  1QMF A;  3F1N B;  3I7J A;  2XRO A;  5E2F A;  2W3H A;  3BFF A;  2Z6C A;  1ZHH B;  1NRF A;  5F69 A;  2QZ6 A;  1G6O A;  4Y5F A;  1WYB A;  2A24 B;  3IS2 A;  4F3L B;  4FUW A;  2PBY A;  3VSK A;  1H3Q A;  4P6B A;  3UMD A;  5CGS A;  4GHI A;  3U2A A;  1H5X A;  1GSW A;  2J7V A;  4CQH A;  2W3D A;  5CER A;  5I94 A;  3OCL A;  3D3O A;  4IVK A;  4DRT A;  3OC2 A;  1GSX A;  3UPP A;  2Q9M A;  2BAS A;  2CMN A;  3TOI A;  1F2K A;  2WZZ A;  3ICY A;  3QP2 A;  3OPP A;  3BEC A;  1M40 A;  3SH9 A;  4WN5 A;  3LCE A;  1S67 L;  5IHV A;  4IBR A;  4MBK A;  4R3A A;  2K2N A;  4MEZ A;  3QP1 A;  4X6T A;  2VKS A;  2XD5 A;  1V9Y A;  2Y2Q A;  1RGY A;  3OOV A;  3LFV A;  4Y0T A;  5E43 A;  4ZRR A;  4N92 A;  3S7O A;  1CI8 A;  5FAQ A;  4FD8 A;  4WEK A;  2V9A A;  5F82 A;  3LIE A;  4DXB A;  3C4O A;  1UWN X;  3E2L A;  5M18 A;  4MNR A;  3CPT B;  1YSP A;  3QHY A;  4XUX A;  1JWZ A;  3W8K A;  4E3L A;  1T1A A;  3LYX A;  4UAA A;  4Z1W A;  3N8L A;  4PKY G;  1K57 A;  4Y17 A;  4DJ2 A;  2XF3 A;  1NY0 A;  1E25 A;  1T19 A;  3D9Y A;  3MBZ A;  3P09 A;  5DFX A;  5G4Z A;  3Q7V B;  1E3U A;  4EES A;  5IU1 A;  1J9M A;  1YSQ A;  3QP8 A;  3E4Q A;  4EBL A;  1OTE A;  3FKW A;  3IX3 A;  2PYP A;  1E3U D;  2XRN A;  2ZBB A;  3DWZ A;  2O0Y A;  4CJN A;  1TF1 A;  3MMH A;  5J3W A;  4S2M A;  3ISG A;  2J3W A;  3BLS A;  3FG8 A;  5TBM A;  4L0L A;  4B9O A;  1S1Y A;  3LEQ A;  4BL2 A;  3DW0 A;  3FPW A;  4OLG A;  3W4P A;  3BQ8 A;  2H28 A;  3ZCZ A;  1MWR A;  1YLT A;  2D02 A;  3UE6 A;  3PBQ A;  3WWX A;  1TS8 A;  1EW0 A;  1CQA A;  1YLY A;  2IA2 A;  1K56 A;  4IUH A;  4QY6 A;  4OQI A;  4JGO A;  1JVJ A;  3B42 A;  2Y55 A;  3HRE A;  2ZM0 A;  1K56 D;  4PKY A;  2WAF A;  2JKT M;  1BSG A;  2XD1 A;  2A2L A;  1PZO A;  4B4X A;  2HDQ A;  3QP5 A;  1Y28 A;  3IS2 B;  4DE1 A;  4ZBE A;  3UB8 A;  2JE5 A;  4K08 A;  4GHI B;  2KDK A;  2QKP A;  2GNX A;  3BFC A;  3FWL A;  4OOY A;  4P0M A;  5GHZ A;  2ZQA A;  2PHY A;  3ZVT A;  4LV1 A;  1PWC A;  3IWO A;  3MZD A;  4CLC A;  2WGV A;  3NUL A;  1YMS A;  2XFS A;  3PAG A;  3KYZ A;  4L9G A;  3WS5 A;  1Q2P A;  2J9P A;  4CLC D;  3OZH A;  4EBP A;  3P98 A;  1KVM A;  4LCM A;  5F6A A;  2ZC7 A;  2Y2N A;  1LL9 A;  2EWV A;  1BYW A;  1G28 A;  5DFY A;  2OLU A;  3W4O A;  3BLM A;  3LID A;  1PW1 A;  4UQI M;  1IKG A;  3EEH A;  2Q9N A;  3MKE A;  3E4P A;  4NXF A;  1Z09 A;  2P7J A;  1K4E A;  2I72 A;  2IWB A;  3SH8 A;  4OP5 A;  1FSW A;  3F1P A;  3RXW A;  5DKL A;  3LIC A;  4X53 A;  3DAV A;  1P9W A;  3V3R A;  3U4L P;  2JCH A;  3KSI A;  5JYO A;  3SH7 A;  5HAQ A;  1XPB A;  3S4X A;  3BYD A;  1ZG6 A;  3QP6 A;  4KZ5 A;  1XA7 A;  3MQ0 A;  5FQK A;  3FV7 A;  5A8B A;  3S1Y A;  3FPV A;  2EA9 A;  4HI4 A;  3IH9 A;  4EV4 A;  3HLG A;  2PAV P;  5KSC A;  1PYY A;  1W5D A;  3SZT A;  1BT5 A;  4XUZ A;  2G2W A;  3VMA A;  5HL6 A;  4MMN A;  4ESP A;  1YMX A;  3CJM A;  2ZQ7 A;  2PT7 A;  4OPY A;  4OVD A;  1XJ6 A;  1MY8 A;  1MWS A;  4S2N C;  4ZAM A;  3S7P A;  1ZKJ A;  1YLP A;  5FQM A;  2BTF P;  4RX2 A;  4ZJ1 A;  2PDR A;  3VP4 A;  2P74 A;  4Z9Q A;  2VX8 A;  3O3V A;  4BMW A;  1FIK A;  4KQD A;  3UE1 A;  3MSH A;  4E04 A;  4GD8 A;  1HD8 A;  2XEP A;  3GTC A;  1BUE A;  4KQQ A;  1W7F A;  1NYY A;  4BWI A;  4HH2 A;  3S7N A;  4H6J A;  3MZE A;  5HX9 A;  3IWQ A;  4EER A;  2ZC5 B;  2DCF A;  1D06 A;  1L0G A;  1VEU A;  1DRM A;  1RCJ A;  5CHJ A;  1DJC A;  3A3I A;  2JBF A;  2L0W A;  1LSX A;  4MDZ A;  3ITB A;  1FCM A;  4BD1 A;  4HY8 A;  1XJ2 A;  4DN0 A;  5G18 A;  3MXQ A;  4GNU A;  5FEF A;  3M2K A;  4JBF A;  2OAP 1;  1CJF A;  4XXR A;  3HLC A;  4N9L A;  1N9B A;  3A3E A;  1L0E A;  2HZ5 A;  4IBX A;  5DF8 A;  1ONH A;  1W63 M;  5K5B A;  5BOH A;  5D3O A;  3NDG A;  4FCF A;  1SHV A;  1ACF A;  4ETZ A;  2J8Y A;  3NDE A;  3BEB A;  1MBL A;  1O7E A;  1KGG A;  2FH5 A;  4GDB A;  5DTS A;  1IOU A;  1S6R A;  2GDN A;  4JPM A;  4DE3 A;  4DE0 A;  1X0O A;  4KZ4 A;  1IYS A;  3IBJ A;  3IX4 A;  1L0F A;  3G4P A;  1K57 C;  4S2O A;  1H8M A;  1NJ4 A;  4KG2 A;  5EOE A;  3GEC A;  1PRQ A;  4EW7 A;  3HUM A;  3IH8 A;  5HDD A;  4WZ5 A;  3O88 A;  2ZQ8 A;  1ESU A;  4OP8 A;  5L2F A;  4IHQ A;  4O8G A;  2NUT C;  4R4R A;  1IYP A;  4HBU A;  3V67 A;  4PPR A;  4JKT A;  3MFD A;  2R9W A;  1FR1 A;  3UE0 A;  1XXM A;  1KE4 A;  4FTX A;  1OJG A;  3F1P B;  3ZYT A;  3LY4 A;  2WYX A;  4Y0U A;  3EGD C;  4FH4 A;  1BLH A;  1PNE A;  4K0W A;  1QME A;  3MFX A;  5EUA A;  4RA7 A;  1YQS A;  2XR0 A;  2O9B A;  4E3O A;  1Q2Q A;  2XFT A;  2XA7 M;  1GA9 A;  1TD5 A;  4N1X A;  3IX8 A;  2H5S A;  2EFU A;  2V8F A;  3GDI A;  5A93 A;  3AGE A;  4YIN A;  4QWO A;  4LPZ A;  4IUK A;  3NOP C;  3NY4 A;  3S22 A;  3V5M A;  4M4X A;  4GS9 A;  3CUE A;  2OWJ A;  2PU4 A;  5GLA A;  5FDS A;  1G68 A;  2EX2 A;  1IYO A;  5EM1 A;  2WGI A;  3NHQ A;  1LT0 A;  3PBN A;  2V1Z A;  2EWW A;  3WRZ A;  4NG2 A;  4KUK A;  3R4K A;  2GZA A;  1I2S A;  4OOM A;  5FSR A;  2Z2L B;  1AWI A;  2M1C A;  5EFW A;  5HW3 A;  4NEE D;  1W63 Q;  2WKQ A;  4R1G A;  2M7U A;  4KZ9 A;  2HJE A;  4BL3 A;  1VB6 A;  4S2K A;  2P9V A;  5L09 A;  1F9I A;  4O7D A;  4HHD A;  2VJW A;  3VOZ A;  1WYC A;  3PR6 A;  2H0T A;  5AQ9 A;  1N9L A;  4S2P A;  2K31 A;  5DVA A;  1VEU B;  1ERQ A;  5G4Y A;  4JXG A;  2Z2M B;  1ZC2 A;  1PFL A;  1GHM A;  3CWF A;  4KUO A;  4LLO B;  3N8R A;  2Y2P A;  3V3S A;  4BJP A;  4M3K A;  5GLB A;  2EFX A;  1IFQ A;  4RYE A;  3UB7 A;  3ZG0 A;  4LCL A;  3RFB A;  5EEC A;  3IF6 A;  2VV6 A;  4WUJ A;  4XT2 A;  2QHK A;  2WKI A;  5AQA A;  1SKO A;  5HWT A;  1M6K A;  1TDG A;  3LR3 A;  1KDW A;  3HUN A;  5FQI A;  2R9X A;  5DTK A;  4LRY C;  3M6H A;  2J80 A;  5HAP A;  1S1Z A;  2BLS A;  1TVF A;  3MXS A;  4MLL A;  2ZC4 B;  3O87 A;  4HIA A;  3HL9 A;  4YFM A;  1LSW A;  2WGW A;  2JKR M;  3DTK A;  1KGE A;  4GD6 A;  2Y2I A;  2XH9 A;  3S7Q A;  1GHP A;  2O9A A;  3VV4 A;  2OAQ 1;  2ZM8 A;  1K38 A;  1O07 A;  3V39 A;  2MJ6 A;  2IWD A;  1Y54 A;  1DP8 A;  3D72 A;  3AGF A;  4Q8I A;  5EE8 A;  1MZU A;  3BQA A;  3IHB A;  2VGL M;  1FSY A;  3ZG7 B;  3PBS A;  4GZB A;  5CGW A;  3SW1 A;  1E4D A;  3EQV A;  4L9E A;  3GVB A;  2XK1 A;  3KYQ A;  4E6W A;  2J3T D;  1NRJ A;  2ZLY A;  1D1J A;  3LR4 A;  4X69 A;  1YLZ A;  3C2W A;  1ES2 A;  1NZO A;  4P85 A;  4MN7 A;  2X71 A;  1YT4 A;  3F1O A;  2B18 A;  3NCK A;  1VET A;  4ETX A;  1CI9 A;  3WS1 A;  4QPR A;  5FI6 A;  4YNR A;  4CLC E;  3LI8 A;  5FI2 A;  2ZC3 B;  4WL9 A;  3UME A;  3IT9 A;  4UQI S;  1HVB A;  2WUQ A;  3ZNT A;  4EUV A;  5CEC A;  1VM1 A;  1MXO A;  3TRC A;  2HP9 A;  2WKE A;  5CED A;  3LGO A;  4JF4 A;  3E4O A;  4EUZ A;  3VE3 A;  2VK3 A;  4GS9 B;  3VFH A;  1XJ3 A;  3UPO A;  4I39 A;  2ZQC A;  2KLI A;  2V0W A;  2YKF A;  5CTN A;  2QJ7 A;  2DRW A;  2I9V A;  2L4R A;  4DXC A;  2C5W B;  3VE4 A;  4BBU A;  1T1B A;  4Y3I A;  1K54 A;  2WK0 A;  5FA7 A;  5FAS A;  2G7U A;  4LRX C;  5KMW A;  2A3U A;  2ZMF A;  3BRM A;  3UB9 A;  3LIA A;  4R3J A;  1YLJ A;  5CGX A;  1TS6 A;  2P9V B;  3V50 A;  4Y0O A;  1KE3 A;  4E3M A;  5F83 A;  1NYM A;  5KSH A;  5IS1 A;  4BEN A;  2HDR A;  3DTE A;  5FI7 A;  1TEM A;  4JXV A;  3T4S A;  1XJ4 A;  1XX2 A;  3ULF A;  3HUO A;  4Y2F A;  3G32 A;  4KZB A;  4EU0 A;  3B33 A;  3Q1F A;  4X1M A;  1UWP X;  2VGJ A;  2E8J A;  5CHM A;  3BWL A;  2ZL1 A;  3PAE A;  4ZJ2 A;  3T4J A;  4EET B;  4PM8 A;  3WRT A;  3PHY A;  2HJ9 C;  1IEL A;  1UGU A;  3HJK A;  2UV0 E;  4WZ5 C;  4KQO A;  5F68 A;  3A3F A;  1SDE A;  3IF6 B;  3L9K A;  4XT2 B;  4OQ0 A;  1IYQ A;  3G6O A;  2ZC6 B;  3HLF A;  3CLO A;  1LHY A;  5M19 A;  4C75 A;  3UDI A;  4O01 A;  1KE0 A;  3MQO A;  2OLV A;  3DTI A;  2WAD A;  1DJA A;  4HH3 A;  2Y2O A;  3NJA A;  3T1R A;  2WGW B;  5HPF A;  4P6Z M;  3RH8 B;  5HWW A;  3IQA A;  2PD7 A;  4DDS A;  1RP5 A;  5HD3 A;  3QNB A;  4GKU A;  4Y13 A;  4P87 A;  3IXG A;  5FQQ A;  3UE3 A;  4II7 A;  4BQM A;  5TJJ A;  4WYY A;  3BJN A;  1IEM A;  3HBR A;  4G3W A;  4PM6 A;  4OPR A;  4GDN A;  1KOU A;  3C4P A;  2FFY A;  4N1H A;  4S2J A;  3CUE C;  4E3I A;  3NOU C;  4GB7 A;  5CEB A;  4HES A;  2ZD8 A;  1OTA A;  5CHU A;  3OLO A;  2OV5 A;  4DDY A;  4E3N A;  1PIO A;  5EM0 A;  5HL1 A;  1NLY A;  5TBM B;  2XGN A;  1K25 A;  5M1A A;  1DJB A;  3HLB A;  3FKV A;  3F1O B;  4DKI A;  3T4L A;  2W3E A;  1VET B;  4HBT A;  2HDU A;  3HLE A;  2WKR A;  3T1Q B;  2Y2G A;  4H8R A;  3G34 A;  3IBR A;  5EPH A;  2XSS A;  5L8M A;  3BFG A;  4BLM A;  1XGJ A;  4JXS A;  2Y2K A;  4R0Q A;  3EOI A;  3T1X A;  2RL3 A;  4C6Y A;  2PU2 A;  3FC7 A;  3A0S A;  5EVI A;  2EXB A;  3VP2 A;  4A5R A;  1NZU A;  4S2L A;  4ME4 A;  4I3I A;  1TS7 A;  3QNC A;  3WS2 A;  2Y91 A;  4JXW A;  1PW8 A;  2B02 A;  2WKH A;  5EVI D;  2A49 A;  3MJQ A;  2LB5 A;  3MR0 A;  4ZDX A;  3BW6 A;  2PR5 A;  2ZQD A;  2XA7 S;  3IF6 C;  3N6I A;  3H7W A;  1LL5 A;  3UO9 A;  2V1B A;  5HAI A;  3T50 A;  3CI6 A;  1FOF A;  5HFO A;  3T4Q A;  4LGW A;  3PXP A;  5CX7 A;  1ALQ A;  4L9F A;  2PBD P;  3N4I A;  4CLC B;  1BLC A;  3TE8 A;  4WBG A;  3KX0 X;  4UA6 A;  3CHW P;  4PHT A;  2DNS A;  1ES5 A;  3UPN A;  2QWS A;  3VP0 A;  4QY5 A;  5HDC A;  4EQI A;  2ZJ9 A;  5HD5 A;  4Y15 A;  4ZJ3 A;  4R4S A;  5CTM A;  3ZDJ A;  4R3B A;  2OSU A;  2ZL1 B;  4HJ4 A;  1HTZ A;  1FR6 A;  3LIF A;  4OPZ A;  3B3X A;  3DWK A;  2AVX A;  3NI9 A;  3OBF A;  2J3T C;  4JF6 A;  2PR6 A;  4CPK A;  5AQB A;  2CC1 A;  3EGX C;  1PWG A;  2QPN A;  4DMZ A;  1XGI A;  4NET A;  2HGV A;  4D2O A;  4R70 A;  3KSH A;  4QB8 A;  5DKK A;  1WA9 A;  1FQG A;  3JYI A;  5FL3 A;  1SKF A;  2OWH A;  3G2Y A;  2QMI A;  2KOI A;  3JVV A;  3WS4 A;  4ZTK A;  2PD8 A;  1MKM A;  1NLZ A;  3JVU A;  2HPB A;  2W1T A;  2Z6D A;  4G3V A;  4HP9 A;  3ZG9 B;  1I5Q A;  3HJI A;  3ZQ5 A;  2R78 A;  5DJT A;  1LL8 A;  3N8S A;  3G30 A;  1J3W A;  3GRJ A;  1S4R A;  3NBL A;  2DMW A;  4BD0 A;  1W79 A;  1K6S A;  1K4F A;  2XDM A;  1G5U A;  4ARZ A;  3PBR A;  3TG9 A;  1PZP A;  3Q07 A;  1MPL A;  1HZO A;  2ZMA A;  4IJG A;  1GA0 A;  5CXW A;  4WLA A;  2XQZ A;  3SS5 A;  2HF6 A;  1SCW A;  5GHX A;  1P97 A;  2P04 A;  2VV7 A;  3WS0 A;  4Q0H A;  4GLQ A;  4RQ9 A;  1YM1 A;  3CG5 A;  5EV0 A;  3DBA A;  2GJ3 A;  1K54 C;  1OME A;  4Q0I A;  5DF9 A;  5AVE A;  3UN7 A;  1D7E A;  3A3J A;  5AQ7 A;  5EVE A;  4QHC A;  2JHE A;  4U0T A;  2H0Y A;  3GV9 A;  2VGL S;  4OKP A;  3HVF A;  4H6J B;  4D60 A;  1EI5 A;  1ZTU A;  2O9C A;  5J4E A;  1STZ A;  3H9W A;  1L3L A;  5A90 A;  4CLC C;  1OJ5 A;  2Y2J A;  3TSG A;  4EEU A;  3Q82 A;  3W4Q A;  3E2K A;  1YPR A;  3EQU A;  1SZV A;  5TR7 A;  1JTG A;  3K3C A;  4PM9 A;  4GCZ A;  1A0K A;  5EVI B;  1P9R A;  3GQZ A;  1OPX A;  4RX3 A;  3IHA A;  4EEP A;  2VGK A;  2JC7 A;  2WAE A;  4PM7 A;  3EEA A;  2V0U A;  4HEF A;  4EWF A;  2IWC A;  1I2W A;  4MBH A;  2VA0 A;  3H7W B;  3FZC A;  5U47 A;  1KVL A;  1JTD A;  5L07 A;  3SS3 A;  3NC8 A;  1OTB A;  2ZOI A;  1W8Q A;  4QD4 A;  4WF0 A;  5HDS A;  5IT5 A;  1AXB A;  3C38 A;  5FAT A;  4Y7P A;  1XFQ A;  3B47 A;  3L7H A;  4GN2 A;  4IVI A;  2VEA A;  2EXA A;  3Q81 A;  1WE4 A;  3O5Y A;  4Q0J A;  1T1C A;  4KZA A;  5KZH A;  1BTL A;  5FQ9 A;  3VSL A;  1K55 A;  3TJZ C;  3HLD A;  1LLB A;  3CAX A;  4YOF A;  1SDN A;  2Y4A A;  4EXO A;  2Y79 A;  4PMA A;  4BBV A;  1P0Z A;  3PBO A;  2BG1 A;  3BM6 A;  3E0Y A;  4LV3 A;  4PM5 A;  3FYZ A;  3G35 A;  4KZ3 A;  5FAO A;  5JYP A;  3OPH A;  1YLW A;  1XA1 A;  4I5S A;  4O0P A;  5GLD A;  4BBT A;  1GHI A;  2V8C A;  3G31 A;  3KSF A;  3LIB A;  4GJ4 A;  3LR5 A;  4JGQ A;  5C5K A;  1L0D A;  2ZQ9 A;  3VP3 A;  3T12 B;  4X1L A;  1ESI A;  3KYE A;  5DTT A;  2HP6 A;  2W1T B;  3DTM A;  5I5L A;  5J7E A;  2QJ5 A;  2K7S A;  3A0R A;  1GSV A;  1XKZ A;  4C3Q A;  5LBR A;  4HOI A;  3PTE A;  2J9O A;  4R6L A;  4KG5 A;  2HV1 A;  1FCO A;  3H82 A;  3MF0 A;  1XFN A;  1YKD A;  1OTD A;  4HJ3 A;  2JN7 A;  4K91 A;  4KZ6 A;  5EVI C;  2YKH A;  1ERM A;  1H8Z A;  2M7V A;  4ARZ B;  2P08 A;  1BLS A;  2B5R A;  3ZHH A;  3C30 A;  2KX6 A;  4P6Z S;  2EX8 A;  5F5Y A;  2VLG A;  2E8I A;  2XLN A;  2D01 A;  3ZG8 B;  4OLD A;  1N9N A;  1OT9 A;  2H10 A;  2V1A A;  2Y8H A;  5F1G A;  3ZVW A;  3MS6 A;  4ID4 A;  3UDF A;  2JKG A;  4NK3 A;  3W2Z A;  1VQQ A;  3IXH A;  5FEG A;  4HQA A;  1CEG A;  3VFF A;  2O99 A;  4KEN B;  4RVA A;  4X55 A;  5E2H A;  4GOG A;  4QU3 A;  4B93 A;  3AGD A;  5EVL A;  4DJ3 A;  4X56 A;  4FOF A;  4KG6 A;  3BFD A;  1GCE A;  1KGF A;  4IED A;  4B4Z A;  4DE2 A;  5DJU A;  4OPQ A;  3ZG5 A;  1DP9 A;  4F94 A;  3OPL A;  2V20 A;  2ZM2 A;  1BZA A;  4NXE A;  1S4S A;  4R38 A;  1H8Y A;  1CEF A;  2W27 A;  5J8X A;  2HP5 A;  3CIT A;  5MC7 A;  1MWU A;  3UY6 A;  3BY8 A;  4OOL A;  2RCX A;  1ONG A;  1VHM A;  4GW9 A;  3R7W A;  3UNW A;  3T4O A;  2FZ0 A;  1SKO B;  1IKI A;  3D4F A;  4MN6 A;  2INW A;  4I3J A;  5DF7 A;  1U60 A;  3MXR A;  4OQG A;  3BY9 A;  1NXY A;  1ES3 A;  3T4K A;  2NUP C;  2X01 A;  1T18 A;  2ACG A;  5CRF A;  4WM9 A;  4LRZ E;  3MKF A;  1DP6 A;  4K0X A;  1TS0 A;  5AJG A;  3IXD A;  4MN5 A;  1W8Y A;  4R23 A;  3O86 A;  1L2S A;  3T1S A;  1LI0 A;  4JF5 A;  1PWD A;  3UDX A;  2PYR A;  4I38 A;  3IXB A;  1YAX A;  5HAR A;  1S0W A;  3GSG A;  4HP4 A;  2JKR I;  4U0X A;  1C3B A;  2Y2L A;  3C7V A;  3M2J A;  3Q7Z A;  1PI5 A;  2LB9 A;  4MBF A;  1ERO A;  2PRF A;  3MQQ A;  2ZOH A;  4JGR A;  2VV8 A;  4EBN A;  2X02 A;  1FIL A;  1XP4 A;  2QYB A;  1JWP A;  3F1N A;  3T4T A;  4I3A A;  3GR2 A;  5GHY A;  1N9O A;  3PYP A; 
#chains in the Genus database with same CATH homology
 4DMZ A;  2HGV A;  4YWZ A;  5HWT A;  1Y28 A;  3IS2 B;  3LR3 A;  4JGP A;  3KSH A;  4R70 A;  3UB8 A;  4AFI A;  5DKK A;  2A24 A;  4LRY C;  2J80 A;  3RTY A;  1WA9 A;  4F3L A;  1S1Z A;  5FL3 A;  4K08 A;  4GHI B;  2KDK A;  2OWH A;  3KSG A;  2QKP A;  2KOI A;  2GNX A;  3JVV A;  3LI9 A;  2PD8 A;  4HIA A;  1MKM A;  1LSW A;  2PHY A;  1NLZ A;  2JKR M;  3JVU A;  2W1T A;  2Z6D A;  4G3V A;  4HP9 A;  4G3K A;  3HCY A;  3HJI A;  3ZQ5 A;  2R78 A;  3S7Q A;  5DJT A;  4CLC A;  2O9A A;  1LL8 A;  3K3D A;  5HWV A;  3VV4 A;  2OAQ 1;  3H82 B;  3K2N A;  3KYZ A;  4L9G A;  4CLC D;  2MJ6 A;  1S4R A;  2DMW A;  1DP8 A;  3D72 A;  5HZH A;  1MZU A;  3BQA A;  3LR0 A;  4ARZ A;  3PBR A;  4NXB A;  5F6A A;  2VGL M;  3PBS A;  4IJG A;  3LUQ A;  2EWV A;  5HPI A;  1BYW A;  1G28 A;  4WLA A;  5DFY A;  3SW1 A;  2HF6 A;  3EQV A;  4L9E A;  1F5M A;  4WEL A;  3LID A;  2JKT I;  4UQI M;  3KYQ A;  1P97 A;  2P04 A;  2VV7 A;  3EEH A;  2J3T D;  3E4P A;  2WKP A;  4Q0H A;  4NXF A;  1NRJ A;  4GLQ A;  4RQ9 A;  2P7J A;  3LR4 A;  3DBA A;  4UEY A;  3F1P A;  2GJ3 A;  3C2W A;  4MN7 A;  4Q0I A;  5DKL A;  3LIC A;  3F1O A;  5DF9 A;  5AVE A;  2B18 A;  1D7E A;  1P9W A;  4ETX A;  2JHE A;  3KSI A;  2VGL S;  4H6J B;  2W0N A;  1ZTU A;  2O9C A;  5J4E A;  1STZ A;  3H9W A;  4CLC C;  1OJ5 A;  5AVF A;  4QPR A;  4EEU A;  4YNR A;  4CLC E;  3LI8 A;  4WL9 A;  3UME A;  3UB6 A;  4UQI S;  3MQ0 A;  3EQU A;  4PAU A;  5A8B A;  3K3C A;  3VOL A;  4GCZ A;  3FPV A;  4EUV A;  1P9R A;  2EA9 A;  1OPX A;  4HI4 A;  3TRC A;  2VZW A;  4EEP A;  3E4O A;  3VE3 A;  1V9Z A;  4GS9 B;  5HL6 A;  3EEA A;  2V0U A;  4MMN A;  1XJ3 A;  3R7W B;  4I39 A;  2L1M A;  2KLI A;  2PT7 A;  2V0W A;  1JNU A;  1XJ6 A;  2YKF A;  2QJ7 A;  2OOL A;  2VA0 A;  3S7P A;  3H7W B;  1OTI A;  2I9V A;  2L4R A;  1MC0 A;  1OTB A;  2ZOI A;  4WF0 A;  4FSF A;  1ODV A;  5HDS A;  3VE4 A;  4BBU A;  1T1B A;  2PDR A;  3C38 A;  4Y3I A;  5IT5 A;  2W1R A;  1XFQ A;  3B47 A;  3P01 A;  2G7U A;  2VX8 A;  4LRX C;  4BMW A;  2W3G A;  2ZMF A;  5KIZ A;  3UB9 A;  3NOT C;  1LSV A;  3LIA A;  3A0V A;  4HNB A;  2VEA A;  3O5Y A;  4KQD A;  4Q0J A;  1T1C A;  1TS6 A;  4E04 A;  3OCN A;  4BWI A;  4HH2 A;  3S7N A;  4H6J A;  3TJZ C;  3E98 A;  5KSH A;  5IS1 A;  1S66 L;  3P7N A;  3C8C A;  3CAX A;  4EER A;  4YOF A;  3T4S A;  1XJ4 A;  3ULF A;  4EXO A;  1F98 A;  4HJ6 A;  1D06 A;  2Y79 A;  4Y2F A;  3PBT A;  4BBV A;  4EU0 A;  3B33 A;  1DRM A;  1P0Z A;  4NXG A;  3PBO A;  1UWP X;  4MCW A;  5HSQ A;  4EQ1 A;  4NKP A;  2L0W A;  3BWL A;  3KO6 A;  3E0Y A;  4WEJ A;  3T4J A;  2W3F A;  4EET B;  1OT6 A;  1LSX A;  3PHY A;  4MDZ A;  2HJ9 C;  1UGU A;  2ZMV A;  3HJK A;  4HY8 A;  1XJ2 A;  2GX5 A;  4KQO A;  5F68 A;  4DN0 A;  3EWK A;  3TW8 A;  1NWZ A;  2XRO A;  3F1N B;  4XT2 B;  3G6O A;  4I5S A;  2W3H A;  3MXQ A;  2Z6C A;  4O0P A;  1ZHH B;  3CLO A;  4BBT A;  3KSF A;  3LIB A;  5F69 A;  4GJ4 A;  1G6O A;  4Y5F A;  3LR5 A;  2OAP 1;  4O01 A;  2A24 B;  3IS2 A;  4F3L B;  4JGQ A;  3MQO A;  5C5K A;  4HH3 A;  1H3Q A;  3UMD A;  4GHI A;  3NJA A;  5HPF A;  2W1T B;  4P6Z M;  1W63 M;  5K5B A;  5I5L A;  3U2A A;  5J7E A;  3RH8 B;  2QJ5 A;  5HWW A;  1GSW A;  2PD7 A;  4CQH A;  4ETZ A;  2K7S A;  2W3D A;  3A0R A;  5HD3 A;  1GSV A;  3OCL A;  2FH5 A;  3D3O A;  5LBR A;  1IOU A;  3OC2 A;  4HOI A;  1GSX A;  3UE3 A;  4II7 A;  4R6L A;  5TJJ A;  2HV1 A;  1X0O A;  3H82 A;  3BJN A;  3MF0 A;  1XFN A;  1YKD A;  1OTD A;  4HJ3 A;  3IBJ A;  2JN7 A;  4G3W A;  2BAS A;  2CMN A;  2YKH A;  2M7V A;  4ARZ B;  2P08 A;  3ICY A;  1H8M A;  1KOU A;  3C30 A;  3GEC A;  2KX6 A;  4EW7 A;  3CUE C;  3NOU C;  4WN5 A;  4P6Z S;  5HDD A;  1S67 L;  5F5Y A;  1OTA A;  3OLO A;  4R3A A;  4IHQ A;  2VLG A;  2NUT C;  4O8G A;  2K2N A;  3V67 A;  2D01 A;  2VKS A;  1N9N A;  1NLY A;  5TBM B;  1OT9 A;  1OJG A;  3F1P B;  1V9Y A;  3ZYT A;  2V1A A;  3OOV A;  3LFV A;  2Y8H A;  3F1O B;  4ZRR A;  3T4L A;  3S7O A;  3EGD C;  2W3E A;  3W2Z A;  3MFX A;  4HQA A;  2O99 A;  4WEK A;  2O9B A;  2WKR A;  2V9A A;  3LIE A;  4B93 A;  3IBR A;  4DJ3 A;  2XA7 M;  4FOF A;  1UWN X;  2XSS A;  5L8M A;  1TD5 A;  5DJU A;  1YSP A;  3EOI A;  1DP9 A;  3GDI A;  3FC7 A;  4NXE A;  1S4S A;  3A0S A;  4R38 A;  1T1A A;  3LYX A;  4LPZ A;  4IUK A;  4Z1W A;  4PKY G;  3NOP C;  4ME4 A;  4I3I A;  1TS7 A;  2W27 A;  4DJ2 A;  3CIT A;  4M4X A;  2B02 A;  5MC7 A;  4GS9 A;  1T19 A;  2OWJ A;  3CUE A;  3BY8 A;  4OOL A;  5DFX A;  1VHM A;  4GW9 A;  3R7W A;  5G4Z A;  3MJQ A;  2LB5 A;  3MR0 A;  3BW6 A;  2PR5 A;  3T4O A;  2FZ0 A;  4EES A;  5IU1 A;  4MN6 A;  2XA7 S;  1YSQ A;  3NHQ A;  1LT0 A;  3H7W A;  3PBN A;  3E4Q A;  2INW A;  4I3J A;  2V1B A;  1OTE A;  2EWW A;  3BY9 A;  4KUK A;  2PYP A;  3T50 A;  3CI6 A;  3R4K A;  2GZA A;  2XRN A;  3T4K A;  2ZBB A;  2NUP C;  4OOM A;  2O0Y A;  1TF1 A;  3MMH A;  5J3W A;  1T18 A;  3T4Q A;  2J3W A;  3PXP A;  2M1C A;  4LRZ E;  5EFW A;  3FG8 A;  5TBM A;  1DP6 A;  1TS0 A;  4NEE D;  4L0L A;  5AJG A;  5CX7 A;  4B9O A;  1W63 Q;  2WKQ A;  4MN5 A;  1S1Y A;  2M7U A;  4L9F A;  2HJE A;  4CLC B;  3TE8 A;  3KX0 X;  1VB6 A;  3FPW A;  4PHT A;  2QWS A;  3BQ8 A;  2PYR A;  4I38 A;  1F9I A;  5HDC A;  4HHD A;  2H28 A;  1YAX A;  2VJW A;  5HD5 A;  4HP4 A;  2D02 A;  2JKR I;  3UE6 A;  3PR6 A;  3PBQ A;  1N9L A;  2K31 A;  1TS8 A;  1EW0 A;  5G4Y A;  2LB9 A;  2IA2 A;  4IUH A;  3CWF A;  4KUO A;  3MQQ A;  4LLO B;  2ZOH A;  4JGR A;  2VV8 A;  4HJ4 A;  4JGO A;  4BJP A;  3LIF A;  3B42 A;  4PKY A;  1IFQ A;  2JKT M;  3UB7 A;  3OBF A;  2J3T C;  2PR6 A;  2QYB A;  3RFB A;  2A2L A;  3F1N A;  3T4T A;  3EGX C;  2VV6 A;  4WUJ A;  4I3A A;  4XT2 A;  2QHK A;  1N9O A;  3PYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...