3CI6A

Crystal structure of the gaf domain from acinetobacter phosphoenolpyruvate-protein phosphotransferase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
167
structure length
158
Chain Sequence
MSNMQLDTLRRIVQEINSSVSLHDSLDIMVNQVADAMKVDVCSIYLLDERNQRYLLMASKGLNPESVGHVSLQLSEGLVGLVGQREEIVNLENASKHERFIYNSFLGVPVMYRRKVMGVLVVQNKQPQDFSEAAESFLVTLCAQLSGVIAHAHAVGNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoenolpyruvate-protein phosphotransferase
publication title Crystal structure of the GAF domain from Acinetobacter phosphoenolpyruvate-protein phosphotransferase.
rcsb
source organism Acinetobacter sp.
molecule tags Transferase
total genus 44
structure length 158
sequence length 167
chains with identical sequence B
ec nomenclature ec 2.7.3.9: Phosphoenolpyruvate--protein phosphotransferase.
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ci6A00
4FOFA 5C5KA 3S7NA 4MMNA 4IUKA 2OOLA 3TRCA 2IA2A 4GLQA 4MN7A 3KO6A 2K31A 2XRNA 2B18A 2O9BA 4G3WA 3O5YA 4DMZA 2XROA 4ME4A 2VKSA 2W3DA 3E98A 3E0YA 3KSGA 4G3KA 2G7UA 2VEAA 2ZMFA 4QPRA 1TF1A 4YOFA 3EEAA 4YNRA 4ETZA 3S7OA 1VHMA 4Q0IA 5HSQA 2QYBA 2M7UA 2GX5A 2W3FA 3DBAA 5HPFA 4IUHA 4ETXA 2M7VA 2KLIA 3VV4A 3D3OA 4Y2FA 2W1TA 2LB9A 2W3EA 2HGVA 2W1TB 4E04A 3KSHA 4Q0HA 3CI6A 4EUVA 3OBFA 4RQ9A 2Y8HA 3OOVA 3IBRA 4O8GA 4BWIA 5DFYA 5LBRA 2O9AA 3C2WA 4G3VA 2KOIA 2W1RA 5DFXA 4Q0JA 2W3HA 2O0YA 2K2NA 3KSIA 4Y3IA 2LB5A 4IJGA 3NOPC 3R4KA 1ZTUA 3NOUC 3S7PA 5TJJA 3CITA 5HL6A 4ZRRA 4O01A 3W2ZA 1F5MA 5HPIA 3KSFA 3G6OA 4EU0A 1YSQA 4GW9A 4LRYC 4PAUA 3K2NA 5K5BA 5L8MA 1STZA 3NHQA 4MCWA 4MDZA 2Y79A 4R70A 3BJNA 4LRXC 4Z1WA 4CQHA 2W3GA 2XSSA 3NOTC 2O99A 3MF0A 4DN0A 3MMHA 2O9CA 2VJWA 5I5LA 3LFVA 3ZQ5A 1YKDA 1MC0A 1YSPA 3IBJA 1TD5A 3MQ0A 3S7QA 4Y5FA 4LRZE 4O0PA 4R6LA 2VZWA 5AJGA 1MKMA 3RFBA 3HCYA
chains in the Genus database with same CATH superfamily
4OPRA 5AQ7A 2HP5A 3IXBA 3OPRA 5EUAA 2QZ6A 3ZHHA 2HZ5A 3BM6A 4MN7A 3UDIA 2XDMA 3GMWA 5GHZA 4OPYA 3MBZA 4X69A 2K7SA 1XJ6A 3SOIA 2M1CA 2HP9A 4G3KA 1CJFA 3S4XA 1SKOA 2Q9NA 1D1JA 4MLLA 1Z6FA 3OC2A 5HW3A 5L07A 4QHCA 4IBXA 4GCZA 4LFUA 1JTGA 4LV0A 2V0UA 2PYRA 2JE5A 4EW7A 4JGOA 4BQMA 4JF5A 3MSHA 1JWVA 1PI5A 3UO9A 5HAQA 1S66L 3PYPA 5HL1A 4Q0JA 2QMIA 5FDHA 3W4PA 3V3RA 1FCNA 1QMEA 2JKFA 4IVKA 4YFMA 3ZNYA 3VFHA 1OT6A 1SHVA 3LI8A 2HDQA 1F5MA 1PWGA 4UA9A 1PIOA 3EWKA 1ESIA 1HTZA 1STZA 2HF6A 5EOEA 4PM6A 3LR4A 4GOGA 3MMHA 1S4RA 1Y28A 1ES2A 5HWVA 1A0KA 2MJ6A 2P04A 4QY5A 4BL3A 4OH0A 5TGFA 3Q7VA 1X0OA 5EVEA 4WYYA 5HD3A 2VGLM 1JWPA 5C5KA 1F2KA 2P74A 2PT7A 1W63M 2DNSA 2Y2MA 3WWXA 1VETA 5TBMB 3LCEA 1RGYA 2O9BA 1ZKJA 3IX3A 4MBKA 4DMZA 3H7WB 2VKSA 2W3DA 3C4PA 4R3AA 3HLDA 3ZGAB 3EEAA 4ETZA 1BSGA 3L7HA 1C3BA 1VEUA 4Q8IA 3E2KA 3O88A 2JKRI 2E8JA 5G4YA 3SW1A 5GL9A 1XGIA 2HGVA 4E04A 2Y2QA 4UHUA 4B93A 3P01A 3GQZA 1YMXA 1TDGA 3PHYA 1K6RA 1OJGA 2OLVA 3KSIA 2LB5A 3UY6A 1ZTUA 3N8RA 2EWVA 1JTDA 4MN5A 3N8SA 3NBLA 5BOHA 5HPIA 3G35A 4N9LA 2EXBA 1G68A 5KMWA 3A3IA 4R3JA 5GLAA 4R70A 4S2OA 1FR1A 4KZAA 3F1PB 1SDNA 4PM9A 3IS2B 3M6BA 1LI9A 1T19A 1OTEA 3OPHA 5L09A 2V1AA 1K0KA 4RYEA 1P97A 4Y5FA 3M2KA 4OQ0A 1BLPA 3S22A 4O7DA 5IS1A 4FD8A 1OJ5A 4JF6A 1DP9A 4JGPA 1XFQA 1ONHA 4E3OA 4BLMA 3KO6A 1ES4A 5E2EA 5DKLA 4KENB 4ZTKA 3JPUA 3FWLA 4KZ5A 5A93A 4GDNA 5F82A 4OOYA 4ESPA 3SH9A 1OTAA 3ZG7B 3VP3A 3BEBA 1KE0A 2XA7S 3FPWA 3CZDA 1IEMA 3S7OA 5FAOA 4Q0IA 3TG9A 3G2YA 2OWHA 2NUTC 2AVXA 3HREA 2VK3A 1TS0A 2WYXA 4KZ4A 1N9BA 4WZ4A 3IXHA 4LV3A 4P6ZS 4Y7PA 4CLCE 3ZG9B 2QPNA 4FCFA 1WYCA 1N4OA 3MFXA 5J4EA 3IWOA 3IH8A 4WEKA 5KSHA 4HQAA 3VOZA 5HFOA 4EWFA 3WS0A 4GW9A 5HWTA 2JBFA 1S4SA 4S2MA 4Z1WA 5F1FA 1K54C 4EXOA 3QP6A 3PAEA 3M6HA 3ZG0A 1EWZA 1E3UA 2VZWA 3BFGA 1F9IA 1W8QA 2VGJA 5E43A 5HDCA 4KZ6A 5DTKA 2ZQ9A 4P85A 3LYXA 4B88A 1MPLA 3T50A 2PU4A 4OVDA 1Q2QA 4WELA 1MXOA 5AVEA 3NDGA 2Y4AA 5GLBA 4OKPA 3H7WA 4WMCA 4KG6A 3HUMA 4EETB 3JYIA 4KZ8A 5DJTA 2ZD8A 4S2JA 2NUPC 2L4RA 5HX9A 5EVIA 1WA9A 3Q1FA 3VSKA 1E4DA 1K55C 2ZMVA 1PI4A 1LSVA 2E8IA 1FQGA 1VB6A 4MBHA 1XA7A 4GHIB 4FSFA 4GNUA 4OPZA 1KOUA 4C3QA 1IYQA 2I72A 4EQIA 4EEUA 1O07A 4I3JA 1ACFA 4Y0TA 3DTKA 3MZEA 1GHMA 2XFSA 2QJ7A 1YT4A 4XUXA 3AGEA 2GJ3A 2ZM8A 2XK1A 3NOPC 3UPNA 3H9WA 3NOUC 2P7JA 5HWWA 3VP4A 1K56D 1BT5A 4O01A 3W2ZA 2Y2LA 2J7VA 2Y2OA 4PM7A 3F1PA 2XA7M 1IYSA 5FQMA 3V5MA 4CQHA 3BECA 3SH8A 3UE1A 4U3TA 3FKWA 2IWCA 4S2PA 4D60A 1ONGA 1PFLA 2ZQ8A 1P9RA 3PR6A 2ZC5B 4DRTA 2EXAA 2EX8A 1U60A 2Y2GA 2Y2HA 4I38A 4L9EA 2L0WA 4P6ZM 5CXWA 4X53A 4PM8A 4OOMA 2ZC3B 5EFWA 3UB5P 3T4SA 1JNUA 2H10A 3HLCA 2VV8A 3RTYA 2JCHA 2X71A 4PPRA 4HHDA 5F68A 2OWJA 2R78A 3FKVA 4HH2A 4N1HA 4ZJ2A 4UEYA 2BASA 1GA9A 4C75A 4B4ZA 3T4QA 1FCMA 3PBNA 3MZFA 2IWDA 2GDNA 3CWFA 4DF6A 5CGSA 2W3EA 3O86A 3CUEC 4X55A 3A3DA 4E3KA 4OLGA 1NZUA 1G6OA 2B5RA 1MWRA 2W3HA 4MEZA 4E3JA 1VEUB 1PWDA 1RP5A 3R4KA 3E4OA 3OCLA 5EM1A 1BTLA 4Y13A 4K91A 1H3QA 4EU0A 1KE3A 1XJ3A 5K5BA 3NHQA 3BJNA 5EVIC 5F1GA 4BJPA 3SS5A 2ZBBA 2O9CA 3FYZA 1XFNA 3ZQ5A 4FUWA 3MQ0A 5EV0A 1KDSA 4HBUA 4OONA 4NXEA 1FOFA 1O7EA 1DRMA 3B3XA 4LPZA 2QKPA 2OAP1 3HUNA 4F3LB 2XRNA 3OPPA 4LCLA 4G3WA 3T1XA 4EUZA 3KSGA 3O87A 1TF1A 1GHIA 3P09A 3V3SA 2B02A 2CC1A 2J9PA 2GX5A 1RGZA 1PNEA 3BW6A 4IUHA 1EROA 4GHIA 4R23A 2G2UA 3UNWA 3H82A 4I39A 4L0LA 3BFCA 1MY8A 2PR6A 3D4FA 3N4IA 1GSVA 2VV6A 5EOOA 4BL2A 3KYQA 3V50A 3IX8A 3OBFA 4HNBA 4KUOA 1OPXA 2Z6DA 3IBRA 1XX2A 3MXQA 4BWIA 5LBRA 3C2WA 5TR7A 2WGVA 4MNRA 3NJAA 4BBTA 2BTFP 3A3JA 3MQOA 2EA9A 4LCMA 1PW1A 4R0QA 1CQAA 2XFTA 3NI9A 4R4RA 3CITA 2XEPA 2OAQ1 1PRQA 1W5DA 3QP2A 3MQQA 1PWCA 5DJUA 4UA6A 4P0MA 2R9WA 3ITAA 3HLGA 4NXFA 3ISGA 2QHKA 2DCFA 4K08A 3VOLA 1W8YA 5GHXA 1GCEA 4WLAA 3MJQA 3GECA 4N1XA 1EI5A 3JVVA 1MKMA 4WUJA 3A3EA 2J3TD 3AGDA 3N7WA 1S6RA 3KX0X 1FSWA 3UMEA 2ZQCA 4K0WA 2WKRA 1IOUA 1BLHA 4QY6A 3SS3A 5FI7A 2I9VA 4RX2A 3PTEA 5HSQA 2HDSA 4LGWA 1GSWA 1YMSA 4B9OA 3ITBA 3TE8A 1DJBA 4Y2FA 2A49A 4FTXA 5F69A 3IQAA 4QD4A 5CEDA 3T4JA 4JLFA 3KSHA 3CI6A 1EW0A 4RA7A 2PDRA 4UQIS 3E4PA 1W63Q 1K54A 4Y15A 4QB8A 3ZVWA 4EQ1A 2WK0A 4KZ3A 5EVIB 2FFFB 3TW8A 2B95A 2PYPA 4JXSA 1Y4OA 1NJ4A 4S2NC 3G6OA 3NULA 4DE2A 5FQIA 2BLSA 4S2IA 3D72A 4LRXC 1KGFA 1YLPA 1BUEA 2JC7A 2XSSA 2O99A 2ZQ7A 4EERA 4X6TA 1TVFA 3GVBA 3LR3A 1MWSA 1M6KA 5KIZA 4HJ6A 2PRFA 3UB7A 4II7A 4WN5A 1T18A 1ZG6A 2EFXA 3FC7A 4F3LA 3G32A 1XGJA 1H5XA 3BRMA 1YLYA 3PBRA 4PKYA 3UDXA 1K55A 1AXBA 4H6JB 1N9NA 3CG5A 3HLWA 2JKGA 1IFQA 3T4OA 1W79A 1FIKA 1VQQA 4CLCC 2VEAA 3EGXC 2ZMFA 2FZ0A 3Q07A 2EX9A 2C6WB 2QYBA 3DBAA 3VP0A 1XXMA 1V9YA 1ZC2A 5L10A 3UE0A 4MN6A 3ZDJA 1H8ZA 3D3OA 4YINA 5EVLA 4BBUA 5J8XA 4WEJA 2HDUA 2W1TB 1CK3A 3NCKA 3TSGA 3EQUA 1K4EA 2BG1A 4ZDXA 5CHUA 1D7EA 2ZL1B 3WRTA 1NLZA 4IEDA 3A0RA 3HLEA 3BY9A 5TJJA 2PD7A 2WKHA 1UWNX 3VP1A 1E3UD 2X02A 2ZOHA 1YSQA 4MCWA 3PBTA 2ZC6B 1YLWA 3Q7ZA 3C7UA 4I3AA 4PMAA 4X56A 1BLSA 1YSPA 4ZBEA 5G4ZA 4WMCD 3EGDC 4N92A 4O0PA 3VOYA 3IHAA 1TEMA 1LL8A 4PKYG 1ESUA 3PBQA 3HLBA 4UA7A 3RH8B 3HUOA 3Q81A 2K31A 3LO7A 4UQIM 4E3MA 2J8YA 3CAXA 5EVID 5FQJA 5D3OA 3N6IA 1YAXA 2B18A 1S1ZA 3DAVA 1MBLA 4GDBA 4WM9A 2WUQA 3S1YA 1ALQA 5FQQA 4X1LA 3CUEA 2X01A 5FEFA 2WGWB 3LIBA 5DF7A 3BQAA 2M7UA 1LT0A 5FQ9A 5HARA 1N9OA 5E2GA 5KSCA 4JXGA 3VV4A 1ES3A 5EM0A 4EBPA 5U47A 5MC7A 3LI9A 2WKPA 3JVUA 2DRWA 3BFFA 4Q0HA 2DMWA 4G3VA 3UPPA 2W1RA 1G28A 1YLJA 3WS4A 4ZJ1A 1SDEA 1L0EA 2Z2MB 3U2AA 3G31A 2VA0A 2PBDP 1TS8A 5EECA 1TS6A 1P9WA 2INWA 5FA7A 2ZJ9A 3H82B 5JYOA 5F6AA 4E3IA 1LL9A 4XXRA 5CERA 1YM1A 1NLYA 3K2NA 4MDZA 2EFUA 3IX4A 4HH3A 1PYYA 3NOTC 4L9GA 3BWLA 4KZBA 1RCJA 2RL3A 1XPBA 4QWOA 2Y55A 4LRZE 3WS2A 2V20A 5HAIA 2H0TA 5IT5A 3RFBA 5M18A 4CLCB 4E3LA 2Q9MA 3MZDA 1I2SA 4JGQA 3SS4A 3TRCA 1NRJA 2Y91A 4H6JA 4DE0A 3HBRA 2CMNA 3ZG5A 1SCWA 5CX7A 1P0ZA 2W27A 3IHBA 1N9LA 1GSXA 2XLNA 1NYMA 4Y0OA 2VLGA 2FH5A 3IWIA 3TOIA 3CPTB 4LV2A 1KE4A 1H8YA 2PR5A 3RXXA 4GS9B 4E6WA 4B4XA 2ZLYA 1DJCA 4WZ5A 3NC8A 4ETXA 3OCNA 4DDYA 4NXGA 2W1TA 2EX2A 4DE3A 1DJAA 5G18A 1NWZA 1MWTA 4P6BA 2Y8HA 2WKEA 5A90A 2ZM2A 1G6AA 5AQAA 4E3NA 4DJ3A 2ZL1A 2OLUA 5IHVA 2O0YA 4X1MA 4EESA 5FI6A 2XD1A 3GRJA 5FQKA 4Y3IA 5FEGA 3P98A 5A92A 4DJ2A 4HBTA 3IF6C 4BD1A 1ERMA 2OSUA 1FCOA 2HDRA 5GHYA 3F1OB 1IYOA 5HD5A 4XUZA 1BLCA 4D2OA 1SKFA 1ZHHB 4S2LA 2W3GA 4HJ3A 1FR6A 1LL5A 1L0FA 1LSXA 2HJEA 2Y59A 3BFDA 1MC0A 3IBJA 3QNBA 1T1BA 4DXCA 3SZTA 4OQHA 1OT9A 4PHTA 2A24A 5F83A 2ZMAA 4CPKA 2EWWA 2OOLA 4GKUA 4N9KA 3VFFA 3CJMA 3LY4A 4BBVA 3V67A 5J7EA 1K4FA 4K0XA 4E6XA 1NXYA 1OTIA 2XROA 5EE8A 2VGLS 2WGWA 3C5AA 1QMFA 3ZG8B 2G7UA 4BMWA 3VE4A 3EOIA 4QPRA 4ZAMA 2KDKA 3Q82A 4YOFA 3C4OA 2Z2LB 1J9MA 4X25A 1VHMA 1YQSA 4GD8A 5HDSA 2JN7A 2KLIA 4BD0A 1YLZA 3HL9A 2ZOIA 5CTMA 4KZ7A 4DDSA 3GR2A 1CF0A 4S2NA 3I7JA 2JKTI 3C38A 3K3DA 3GDIA 5DFXA 3B33A 5CEBA 4R4SA 2YKHA 3G34A 2H0YA 3W4OA 4HEFA 1T1CA 4LENA 2RCXA 3RJUA 3LIEA 4H8RA 1DP6A 2Z6CA 1S1YA 1WYBA 3AGFA 4CJNA 5EPHA 2P9VB 5DKKA 4WZ5C 1KVMA 3GV9A 2A2LA 3BLSA 1CI8A 5E2HA 3MF0A 4DN0A 4M4XA 4KQRA 3LFVA 3MS6A 4WL9A 3C8CA 1YKDA 4CLCA 2QWSA 1LSWA 3UMDA 2H28A 3IH9A 4FOFA 1J3WA 3VE3A 1KGEA 4R38A 3G30A 2IA2A 2V8CA 4GLQA 2W0NA 1AWIA 3DTMA 3NECA 3EQVA 1NRFA 1L2SA 2PHYA 3CPTA 3O5YA 4GS9A 1TS7A 3LEQA 5CHJA 3E0YA 1YPRA 5AQ9A 1KGGA 5FSRA 2QJ5A 3E2LA 4YNRA 4NEED 2XQZA 4HIAA 2XGNA 2KX6A 2W3FA 5HPFA 3R7WB 3A0VA 2R9XA 3T4TA 2ZQDA 2HPBA 3OPLA 5TFQA 2XR0A 3ICYA 4KZ9A 1HZOA 3LY3A 1IELA 4ID4A 1WE4A 4JBFA 4GB7A 4QJGA 1HVBA 4YWZA 4JXWA 3IF6B 5DTSA 4S2KA 3DWZA 3W8KA 2VGKA 4OPQA 4EV4A 1K57C 2K2NA 1CEFA 4XT2B 5KZHA 4C6YA 4M3KA 2VX8A 4NXBA 1ES5A 3F1OA 3LR5A 3UN7A 3EEHA 1PW8A 1Y54A 5HL6A 1CEGA 4KQOA 2FFYA 3E4QA 2ZC4B 4ARZB 1S67L 4ZJ3A 2EX6A 4PM5A 1G5UA 1LHYA 2WZXA 4R1GA 1M40A 3PBOA 1UWPX 2IWBA 4KG5A 2V8FA 3BYDA 1BZAA 4R6LA 2J9OA 3M2JA 1NYYA 3W4QA 3HCYA 5DTTA 2GZAA 4MMNA 3UB9A 5FDSA 3U4LP 5JYPA 3LGOA 1UGUA 5M19A 3PXPA 4GD6A 1HD8A 3DTEA 4KG2A 4EBLA 3IXDA 3F1NA 5GLCA 3V39A 2JKTM 5A8BA 4R3BA 4LLOB 4ME4A 1NY0A 3D9YA 1KDWA 2HV1A 2J3WA 2XH9A 2XF3A 2Y2JA 3DWKA 5FATA 2GNXA 3NDEA 3HJIA 3CMZA 2ZC7A 1GA0A 4JPMA 3QNCA 4WF0A 4MBFA 2D01A 3T1SA 1BULA 3ZYTA 3NY4A 2KOIA 5CTNA 3A3FA 1BYWA 2UWXA 4DE1A 4OLDA 3PAGA 2P9VA 4FH2A 3LICA 3BY8A 4ZRRA 1L0GA 3MXRA 3G2ZA 4IHQA 2D02A 1W7FA 3QHYA 4NK3A 4DXBA 4JF4A 2Y79A 5HDDA 4WBGA 5CECA 1IKGA 1H0MA 3HLFA 2OV5A 3VSLA 1OMEA 2Y2NA 1LI0A 3DTIA 2H5SA 1NZOA 4NKPA 5AQBA 2G2WA 2WADA 3C30A 3UDFA 2VV7A 3QP1A 1YLTA 1JVJA 3LEZA 1I5QA 5AVFA 3RXWA 1PZOA 4HI4A 1FSYA 1H8MA 4OQGA 1PZPA 3SH7A 3PBSA 4I3IA 3R7WA 2YKFA 3P7NA 2A24B 4A5RA 1K6SA 4Z9QA 4UAAA 4LV1A 3KYEA 3VMAA 2Q0OA 4GN2A 1ODVA 3LIFA 3IF6A 3QP4A 4KQQA 1TDLA 2WAEA 2Y2KA 4KUKA 2J3TC 1LLBA 5E2FA 2PU2A 1MZUA 1E25A 4XT2A 1D06A 1XP4A 3IT9A 3NIAA 3ZNTA 5A91A 4JXVA 2JKRM 4RVAA 1HLUP 1KVLA 3GSGA 4NG2A 4ARZA 3WRZA 2V9AA 2PAVP 3KSFA 3K3CA 2J80A 1DP8A 2L1MA 5L8MA 5TBMA 4X68A 2WGIA 5CHMA 4L9FA 5CRFA 2VJWA 3TJZC 3QP5A 2WKIA 4U0XA 4Y0UA 1XJ4A 4OOLA 3A0SA 4IUKA 5FASA 5DF8A 3FPVA 3LUQA 4KQDA 3FZCA 1JWZA 2HJ9C 1Z09A 3OZHA 2ZQAA 5HAPA 5HZHA 2V2FF 3E98A 3WS5A 4RX3A 3L9KA 3CLOA 5J3WA 1VM1A 4GJ4A 1SKOB 3FG8A 3LR0A 2V1ZA 1XA1A 5CGWA 3G4PA 4GZBA 1Q2PA 3GTCA 2Y2PA 5F5YA 2M7VA 3HJKA 4JGRA 2LB9A 2XD5A 2JHEA 3KYZA 1L3LA 1IYPA 4I5SA 4Y17A 1CI9A 4EBNA 1OTDA 3OOVA 4O8GA 3IS2A 2O9AA 2WAFA 3MXSA 3UB8A 4HP4A 5FAQA 5GLDA 1ERQA 1FILA 4IJGA 4HESA 1MWUA 4BENA 2ACGA 5CGXA 5I94A 5L2FA 3MFDA 3ULFA 4IVIA 2HP6A 3T12B 4HJ4A 4PAUA 3QP8A 5DF9A 3MKEA 2V1BA 3ZCZA 5I5LA 4NETA 1K56A 3N8LA 4HP9A 1IKIA 2A3UA 4FH4A 4OP5A 4AFIA 4HY8A 1DY6A 3HVFA 2WZZA 3MKFA 3FV7A 3S7NA 3O3VA 3Q7VB 1SZVA 2Y2IA 3C7VA 1I2WA 2V0WA 3UB6A 3ZVTA 3WS1A 1VETB 3IF5A 3BLMA 3IWQA 3BFEA 1V9ZA 1XKZA 3T1QB 2WKQA 3IXGA 1K57A 4QU3A 3UE6A 1MKIA 1XJ2A 2C5WB 5FI2A 1ZG4A 3F1NB 1T1AA 2ZM0A 2UV0E 3T4KA 1K38A 3UE3A 5IU1A 4EUVA 4F94A 4RQ9A 1OTBA 5DVAA 5DFYA 3BQ8A 1S0WA 3ZFZA 3UPOA 3MR0A 3LIAA 1K25A 4IBRA 3VP2A 2P08A 3OLOA 1F98A 3B47A 3S7PA 4U0TA 3T4LA 4CLCD 3B42A 3CHWP 4LRYC 5M1AA 3T1RA 4OP8A 5FAPA 2PD8A 4EEPA 1GHPA 4OQIA 4JKTA 2PBYA 3DW0A 3LIDA 3S7QA 1TD5A 4P87A 1L0DA 5FL3A 4DKIA 5AJGA 4HOIA
chains in the Genus database with same CATH topology
2GZAA 4L9EA 4MMNA 2L0WA 3PBQA 4P6ZM 3UB9A 4OOMA 5EFWA 1UGUA 3RH8B 3PXPA 4MN7A 2K31A 4UQIM 3T4SA 3CAXA 1JNUA 3F1NA 2VV8A 1YAXA 2B18A 1S1ZA 2JKTM 3RTYA 5A8BA 4HHDA 4LLOB 4ME4A 5F68A 2K7SA 2OWJA 2R78A 1XJ6A 4HH2A 2M1CA 4PKYG 4G3KA 2HV1A 2J3WA 3CUEA 4UEYA 3LIBA 3BQAA 2BASA 3OC2A 2M7UA 1LT0A 3T4QA 1N9OA 2GNXA 3VV4A 3PBNA 4GCZA 2V0UA 3HJIA 2PYRA 3CWFA 4EW7A 4JGOA 2W3EA 5MC7A 3LI9A 4WF0A 2WKPA 3CUEC 3JVUA 2D01A 4Q0HA 2DMWA 3ZYTA 1S66L 4G3VA 2KOIA 1G6OA 3PYPA 2W1RA 1G28A 1BYWA 4Q0JA 2W3HA 3U2AA 2VA0A 3R4KA 3E4OA 3OCLA 1TS8A 1TS6A 1P9WA 1OT6A 2INWA 3H82B 3LICA 3BY8A 3LI8A 5F6AA 4ZRRA 1H3QA 1F5MA 4IHQA 4EU0A 2D02A 1XJ3A 3EWKA 1NLYA 3K2NA 5K5BA 1STZA 2HF6A 3NHQA 4MDZA 2Y79A 3BJNA 5HDDA 4HH3A 3LR4A 4BJPA 3NOTC 3MMHA 2ZBBA 1S4RA 1Y28A 2O9CA 4L9GA 5HWVA 1XFNA 3BWLA 2MJ6A 3ZQ5A 2P04A 3MQ0A 4LRZE 4NKPA 1X0OA 5IT5A 3RFBA 5HD3A 4NXEA 2VGLM 3C30A 5C5KA 1DRMA 4CLCB 2VV7A 2PT7A 4LPZA 2QKPA 4JGQA 2OAP1 3TRCA 1NRJA 1W63M 4H6JA 2CMNA 5AVFA 5CX7A 4F3LB 2XRNA 1P0ZA 2W27A 5TBMB 4HI4A 1N9LA 2O9BA 1GSXA 4G3WA 2VLGA 4DMZA 1H8MA 3H7WB 2FH5A 2VKSA 2W3DA 3KSGA 3PBSA 4R3AA 2PR5A 1TF1A 4GS9B 4I3IA 3R7WA 3EEAA 4ETZA 2B02A 2YKFA 3P7NA 2GX5A 2A24B 2JKRI 3BW6A 4IUHA 4ETXA 4GHIA 5G4YA 3OCNA 3SW1A 3H82A 4I39A 4L0LA 4NXGA 2PR6A 2W1TA 1ODVA 3LIFA 2HGVA 4E04A 1GSVA 4KUKA 2VV6A 2J3TC 4B93A 3KYQA 3P01A 1NWZA 3OBFA 4HNBA 4KUOA 1OPXA 2Y8HA 2Z6DA 3IBRA 3MXQA 4BWIA 5LBRA 3C2WA 1MZUA 4DJ3A 3PHYA 4XT2A 1OJGA 3NJAA 4BBTA 2O0YA 1D06A 4EESA 3KSIA 3MQOA 2EA9A 4Y3IA 2LB5A 1ZTUA 2EWVA 2JKRM 4DJ2A 4MN5A 4ARZA 3CITA 2V9AA 2OAQ1 5HPIA 3F1OB 3KSFA 5HD5A 3K3CA 2J80A 3MQQA 1DP8A 2L1MA 5DJUA 1ZHHB 5L8MA 4R70A 5TBMA 4NXFA 2W3GA 3F1PB 4HJ3A 2QHKA 3IS2B 4L9FA 4K08A 1LSXA 2VJWA 3VOLA 1T19A 2HJEA 1OTEA 2V1AA 3TJZC 1MC0A 3IBJA 1P97A 1T1BA 4WLAA 4Y5FA 3MJQA 3GECA 1OT9A 4PHTA 3JVVA 1MKMA 1XJ4A 2A24A 4OOLA 3A0SA 5IS1A 1OJ5A 4IUKA 2EWWA 4WUJA 2OOLA 1DP9A 2J3TD 4JGPA 1XFQA 3FPVA 3LUQA 3KX0X 4BBVA 3UMEA 4KQDA 3KO6A 3V67A 5DKLA 5J7EA 2WKRA 1OTIA 2HJ9C 1IOUA 2XROA 1OTAA 2VGLS 5HZHA 3E98A 2G7UA 4BMWA 3VE4A 3EOIA 4QPRA 2KDKA 3CLOA 2XA7S 4YOFA 5J3WA 3FPWA 2I9VA 3S7OA 4GJ4A 1VHMA 3FG8A 3LR0A 4Q0IA 5HSQA 2OWHA 5HDSA 2NUTC 1GSWA 2JN7A 4B9OA 5F5YA 2KLIA 2M7VA 1TS0A 3TE8A 4Y2FA 5F69A 3HJKA 4JGRA 2ZOIA 2LB9A 2JHEA 3KYZA 3T4JA 4I5SA 4P6ZS 3KSHA 3CI6A 4CLCE 1EW0A 1OTDA 3OOVA 2JKTI 4O8GA 3IS2A 2O9AA 2PDRA 3C38A 3K3DA 4UQIS 3GDIA 3E4PA 1W63Q 5DFXA 3B33A 3UB8A 4EQ1A 2YKHA 4HP4A 3MFXA 4IJGA 3TW8A 5J4EA 1T1CA 3LIEA 4WEKA 2PYPA 5KSHA 1DP6A 2Z6CA 1S1YA 4HQAA 5DKKA 3ULFA 3G6OA 4GW9A 5HWTA 4HJ4A 4PAUA 1S4SA 3D72A 4Z1WA 4LRXC 5DF9A 2A2LA 4EXOA 2XSSA 2O99A 3MF0A 4DN0A 2V1BA 4EERA 4M4XA 5I5LA 3LFVA 4WL9A 3C8CA 3LR3A 4HP9A 1YKDA 4AFIA 4HY8A 5KIZA 2VZWA 4CLCA 1F9IA 2QWSA 1LSWA 5HDCA 3UMDA 2H28A 4HJ6A 4FOFA 3S7NA 3UB7A 3VE3A 4II7A 4R38A 4WN5A 1T18A 3LYXA 2IA2A 3FC7A 4F3LA 4GLQA 3T50A 2W0NA 4WELA 2V0WA 5AVEA 3UB6A 3PBRA 4PKYA 4H6JB 3EQVA 1N9NA 2PHYA 3H7WA 1IFQA 3T4OA 3O5YA 4EETB 4CLCC 4GS9A 1TS7A 3E0YA 5DJTA 2VEAA 2NUPC 3EGXC 2ZMFA 2L4RA 2FZ0A 1V9ZA 2QJ5A 4YNRA 4NEED 4HIAA 2QYBA 5HPFA 2KX6A 2W3FA 3DBAA 3R7WB 1V9YA 3A0VA 1WA9A 2WKQA 2ZMVA 4MN6A 3T4TA 1LSVA 1VB6A 3D3OA 4GHIB 3ICYA 3UE6A 1XJ2A 4FSFA 3F1NB 1T1AA 4HOIA 4BBUA 4WEJA 3T4KA 2W1TB 1KOUA 3UE3A 4YWZA 5IU1A 4EUVA 4EEUA 4RQ9A 1OTBA 3EQUA 4I3JA 5DFYA 3BQ8A 2QJ7A 3MR0A 3LIAA 2K2NA 1D7EA 2P08A 4XT2B 2GJ3A 3OLOA 3NOPC 1NLZA 2VX8A 3H9WA 3NOUC 2P7JA 1F98A 4NXBA 5HWWA 3F1OA 3A0RA 3LR5A 3EEHA 3B47A 3S7PA 5TJJA 3BY9A 2PD7A 5HL6A 1UWNX 4KQOA 4O01A 3W2ZA 3T4LA 3E4QA 2ZOHA 4ARZB 4CLCD 1S67L 1YSQA 3B42A 4LRYC 3F1PA 2XA7M 4MCWA 4CQHA 3PBTA 2PD8A 4EEPA 3PBOA 4I3AA 1UWPX 3LIDA 1YSPA 5G4ZA 1TD5A 3S7QA 1P9RA 3PR6A 3EGDC 4O0PA 4R6LA 5FL3A 5AJGA 1LL8A 3HCYA 4I38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FOF A;  5C5K A;  3S7N A;  4MMN A;  4IUK A;  2OOL A;  3TRC A;  2IA2 A;  4GLQ A;  4MN7 A;  3KO6 A;  2K31 A;  2XRN A;  2B18 A;  2O9B A;  4G3W A;  3O5Y A;  4DMZ A;  2XRO A;  4ME4 A;  2VKS A;  2W3D A;  3E98 A;  3E0Y A;  3KSG A;  4G3K A;  2G7U A;  2VEA A;  2ZMF A;  4QPR A;  1TF1 A;  4YOF A;  3EEA A;  4YNR A;  4ETZ A;  3S7O A;  1VHM A;  4Q0I A;  5HSQ A;  2QYB A;  2M7U A;  2GX5 A;  2W3F A;  3DBA A;  5HPF A;  4IUH A;  4ETX A;  2M7V A;  2KLI A;  3VV4 A;  3D3O A;  4Y2F A;  2W1T A;  2LB9 A;  2W3E A;  2HGV A;  2W1T B;  4E04 A;  3KSH A;  4Q0H A;  3CI6 A;  4EUV A;  3OBF A;  4RQ9 A;  2Y8H A;  3OOV A;  3IBR A;  4O8G A;  4BWI A;  5DFY A;  5LBR A;  2O9A A;  3C2W A;  4G3V A;  2KOI A;  2W1R A;  5DFX A;  4Q0J A;  2W3H A;  2O0Y A;  2K2N A;  3KSI A;  4Y3I A;  2LB5 A;  4IJG A;  3NOP C;  3R4K A;  1ZTU A;  3NOU C;  3S7P A;  5TJJ A;  3CIT A;  5HL6 A;  4ZRR A;  4O01 A;  3W2Z A;  1F5M A;  5HPI A;  3KSF A;  3G6O A;  4EU0 A;  1YSQ A;  4GW9 A;  4LRY C;  4PAU A;  3K2N A;  5K5B A;  5L8M A;  1STZ A;  3NHQ A;  4MCW A;  4MDZ A;  2Y79 A;  4R70 A;  3BJN A;  4LRX C;  4Z1W A;  4CQH A;  2W3G A;  2XSS A;  3NOT C;  2O99 A;  3MF0 A;  4DN0 A;  3MMH A;  2O9C A;  2VJW A;  5I5L A;  3LFV A;  3ZQ5 A;  1YKD A;  1MC0 A;  1YSP A;  3IBJ A;  1TD5 A;  3MQ0 A;  3S7Q A;  4Y5F A;  4LRZ E;  4O0P A;  4R6L A;  2VZW A;  5AJG A;  1MKM A;  3RFB A;  3HCY A; 
#chains in the Genus database with same CATH topology
 4OPR A;  5AQ7 A;  2HP5 A;  3IXB A;  3OPR A;  5EUA A;  2QZ6 A;  3ZHH A;  2HZ5 A;  3BM6 A;  4MN7 A;  3UDI A;  2XDM A;  3GMW A;  5GHZ A;  4OPY A;  3MBZ A;  4X69 A;  2K7S A;  1XJ6 A;  3SOI A;  2M1C A;  2HP9 A;  4G3K A;  1CJF A;  3S4X A;  1SKO A;  2Q9N A;  1D1J A;  4MLL A;  1Z6F A;  3OC2 A;  5HW3 A;  5L07 A;  4QHC A;  4IBX A;  4GCZ A;  4LFU A;  1JTG A;  4LV0 A;  2V0U A;  2PYR A;  2JE5 A;  4EW7 A;  4JGO A;  4BQM A;  4JF5 A;  3MSH A;  1JWV A;  1PI5 A;  3UO9 A;  5HAQ A;  1S66 L;  3PYP A;  5HL1 A;  4Q0J A;  2QMI A;  5FDH A;  3W4P A;  3V3R A;  1FCN A;  1QME A;  2JKF A;  4IVK A;  4YFM A;  3ZNY A;  3VFH A;  1OT6 A;  1SHV A;  3LI8 A;  2HDQ A;  1F5M A;  1PWG A;  4UA9 A;  1PIO A;  3EWK A;  1ESI A;  1HTZ A;  1STZ A;  2HF6 A;  5EOE A;  4PM6 A;  3LR4 A;  4GOG A;  3MMH A;  1S4R A;  1Y28 A;  1ES2 A;  5HWV A;  1A0K A;  2MJ6 A;  2P04 A;  4QY5 A;  4BL3 A;  4OH0 A;  5TGF A;  3Q7V A;  1X0O A;  5EVE A;  4WYY A;  5HD3 A;  2VGL M;  1JWP A;  5C5K A;  1F2K A;  2P74 A;  2PT7 A;  1W63 M;  2DNS A;  2Y2M A;  3WWX A;  1VET A;  5TBM B;  3LCE A;  1RGY A;  2O9B A;  1ZKJ A;  3IX3 A;  4MBK A;  4DMZ A;  3H7W B;  2VKS A;  2W3D A;  3C4P A;  4R3A A;  3HLD A;  3ZGA B;  3EEA A;  4ETZ A;  1BSG A;  3L7H A;  1C3B A;  1VEU A;  4Q8I A;  3E2K A;  3O88 A;  2JKR I;  2E8J A;  5G4Y A;  3SW1 A;  5GL9 A;  1XGI A;  2HGV A;  4E04 A;  2Y2Q A;  4UHU A;  4B93 A;  3P01 A;  3GQZ A;  1YMX A;  1TDG A;  3PHY A;  1K6R A;  1OJG A;  2OLV A;  3KSI A;  2LB5 A;  3UY6 A;  1ZTU A;  3N8R A;  2EWV A;  1JTD A;  4MN5 A;  3N8S A;  3NBL A;  5BOH A;  5HPI A;  3G35 A;  4N9L A;  2EXB A;  1G68 A;  5KMW A;  3A3I A;  4R3J A;  5GLA A;  4R70 A;  4S2O A;  1FR1 A;  4KZA A;  3F1P B;  1SDN A;  4PM9 A;  3IS2 B;  3M6B A;  1LI9 A;  1T19 A;  1OTE A;  3OPH A;  5L09 A;  2V1A A;  1K0K A;  4RYE A;  1P97 A;  4Y5F A;  3M2K A;  4OQ0 A;  1BLP A;  3S22 A;  4O7D A;  5IS1 A;  4FD8 A;  1OJ5 A;  4JF6 A;  1DP9 A;  4JGP A;  1XFQ A;  1ONH A;  4E3O A;  4BLM A;  3KO6 A;  1ES4 A;  5E2E A;  5DKL A;  4KEN B;  4ZTK A;  3JPU A;  3FWL A;  4KZ5 A;  5A93 A;  4GDN A;  5F82 A;  4OOY A;  4ESP A;  3SH9 A;  1OTA A;  3ZG7 B;  3VP3 A;  3BEB A;  1KE0 A;  2XA7 S;  3FPW A;  3CZD A;  1IEM A;  3S7O A;  5FAO A;  4Q0I A;  3TG9 A;  3G2Y A;  2OWH A;  2NUT C;  2AVX A;  3HRE A;  2VK3 A;  1TS0 A;  2WYX A;  4KZ4 A;  1N9B A;  4WZ4 A;  3IXH A;  4LV3 A;  4P6Z S;  4Y7P A;  4CLC E;  3ZG9 B;  2QPN A;  4FCF A;  1WYC A;  1N4O A;  3MFX A;  5J4E A;  3IWO A;  3IH8 A;  4WEK A;  5KSH A;  4HQA A;  3VOZ A;  5HFO A;  4EWF A;  3WS0 A;  4GW9 A;  5HWT A;  2JBF A;  1S4S A;  4S2M A;  4Z1W A;  5F1F A;  1K54 C;  4EXO A;  3QP6 A;  3PAE A;  3M6H A;  3ZG0 A;  1EWZ A;  1E3U A;  2VZW A;  3BFG A;  1F9I A;  1W8Q A;  2VGJ A;  5E43 A;  5HDC A;  4KZ6 A;  5DTK A;  2ZQ9 A;  4P85 A;  3LYX A;  4B88 A;  1MPL A;  3T50 A;  2PU4 A;  4OVD A;  1Q2Q A;  4WEL A;  1MXO A;  5AVE A;  3NDG A;  2Y4A A;  5GLB A;  4OKP A;  3H7W A;  4WMC A;  4KG6 A;  3HUM A;  4EET B;  3JYI A;  4KZ8 A;  5DJT A;  2ZD8 A;  4S2J A;  2NUP C;  2L4R A;  5HX9 A;  5EVI A;  1WA9 A;  3Q1F A;  3VSK A;  1E4D A;  1K55 C;  2ZMV A;  1PI4 A;  1LSV A;  2E8I A;  1FQG A;  1VB6 A;  4MBH A;  1XA7 A;  4GHI B;  4FSF A;  4GNU A;  4OPZ A;  1KOU A;  4C3Q A;  1IYQ A;  2I72 A;  4EQI A;  4EEU A;  1O07 A;  4I3J A;  1ACF A;  4Y0T A;  3DTK A;  3MZE A;  1GHM A;  2XFS A;  2QJ7 A;  1YT4 A;  4XUX A;  3AGE A;  2GJ3 A;  2ZM8 A;  2XK1 A;  3NOP C;  3UPN A;  3H9W A;  3NOU C;  2P7J A;  5HWW A;  3VP4 A;  1K56 D;  1BT5 A;  4O01 A;  3W2Z A;  2Y2L A;  2J7V A;  2Y2O A;  4PM7 A;  3F1P A;  2XA7 M;  1IYS A;  5FQM A;  3V5M A;  4CQH A;  3BEC A;  3SH8 A;  3UE1 A;  4U3T A;  3FKW A;  2IWC A;  4S2P A;  4D60 A;  1ONG A;  1PFL A;  2ZQ8 A;  1P9R A;  3PR6 A;  2ZC5 B;  4DRT A;  2EXA A;  2EX8 A;  1U60 A;  2Y2G A;  2Y2H A;  4I38 A;  4L9E A;  2L0W A;  4P6Z M;  5CXW A;  4X53 A;  4PM8 A;  4OOM A;  2ZC3 B;  5EFW A;  3UB5 P;  3T4S A;  1JNU A;  2H10 A;  3HLC A;  2VV8 A;  3RTY A;  2JCH A;  2X71 A;  4PPR A;  4HHD A;  5F68 A;  2OWJ A;  2R78 A;  3FKV A;  4HH2 A;  4N1H A;  4ZJ2 A;  4UEY A;  2BAS A;  1GA9 A;  4C75 A;  4B4Z A;  3T4Q A;  1FCM A;  3PBN A;  3MZF A;  2IWD A;  2GDN A;  3CWF A;  4DF6 A;  5CGS A;  2W3E A;  3O86 A;  3CUE C;  4X55 A;  3A3D A;  4E3K A;  4OLG A;  1NZU A;  1G6O A;  2B5R A;  1MWR A;  2W3H A;  4MEZ A;  4E3J A;  1VEU B;  1PWD A;  1RP5 A;  3R4K A;  3E4O A;  3OCL A;  5EM1 A;  1BTL A;  4Y13 A;  4K91 A;  1H3Q A;  4EU0 A;  1KE3 A;  1XJ3 A;  5K5B A;  3NHQ A;  3BJN A;  5EVI C;  5F1G A;  4BJP A;  3SS5 A;  2ZBB A;  2O9C A;  3FYZ A;  1XFN A;  3ZQ5 A;  4FUW A;  3MQ0 A;  5EV0 A;  1KDS A;  4HBU A;  4OON A;  4NXE A;  1FOF A;  1O7E A;  1DRM A;  3B3X A;  4LPZ A;  2QKP A;  2OAP 1;  3HUN A;  4F3L B;  2XRN A;  3OPP A;  4LCL A;  4G3W A;  3T1X A;  4EUZ A;  3KSG A;  3O87 A;  1TF1 A;  1GHI A;  3P09 A;  3V3S A;  2B02 A;  2CC1 A;  2J9P A;  2GX5 A;  1RGZ A;  1PNE A;  3BW6 A;  4IUH A;  1ERO A;  4GHI A;  4R23 A;  2G2U A;  3UNW A;  3H82 A;  4I39 A;  4L0L A;  3BFC A;  1MY8 A;  2PR6 A;  3D4F A;  3N4I A;  1GSV A;  2VV6 A;  5EOO A;  4BL2 A;  3KYQ A;  3V50 A;  3IX8 A;  3OBF A;  4HNB A;  4KUO A;  1OPX A;  2Z6D A;  3IBR A;  1XX2 A;  3MXQ A;  4BWI A;  5LBR A;  3C2W A;  5TR7 A;  2WGV A;  4MNR A;  3NJA A;  4BBT A;  2BTF P;  3A3J A;  3MQO A;  2EA9 A;  4LCM A;  1PW1 A;  4R0Q A;  1CQA A;  2XFT A;  3NI9 A;  4R4R A;  3CIT A;  2XEP A;  2OAQ 1;  1PRQ A;  1W5D A;  3QP2 A;  3MQQ A;  1PWC A;  5DJU A;  4UA6 A;  4P0M A;  2R9W A;  3ITA A;  3HLG A;  4NXF A;  3ISG A;  2QHK A;  2DCF A;  4K08 A;  3VOL A;  1W8Y A;  5GHX A;  1GCE A;  4WLA A;  3MJQ A;  3GEC A;  4N1X A;  1EI5 A;  3JVV A;  1MKM A;  4WUJ A;  3A3E A;  2J3T D;  3AGD A;  3N7W A;  1S6R A;  3KX0 X;  1FSW A;  3UME A;  2ZQC A;  4K0W A;  2WKR A;  1IOU A;  1BLH A;  4QY6 A;  3SS3 A;  5FI7 A;  2I9V A;  4RX2 A;  3PTE A;  5HSQ A;  2HDS A;  4LGW A;  1GSW A;  1YMS A;  4B9O A;  3ITB A;  3TE8 A;  1DJB A;  4Y2F A;  2A49 A;  4FTX A;  5F69 A;  3IQA A;  4QD4 A;  5CED A;  3T4J A;  4JLF A;  3KSH A;  3CI6 A;  1EW0 A;  4RA7 A;  2PDR A;  4UQI S;  3E4P A;  1W63 Q;  1K54 A;  4Y15 A;  4QB8 A;  3ZVW A;  4EQ1 A;  2WK0 A;  4KZ3 A;  5EVI B;  2FFF B;  3TW8 A;  2B95 A;  2PYP A;  4JXS A;  1Y4O A;  1NJ4 A;  4S2N C;  3G6O A;  3NUL A;  4DE2 A;  5FQI A;  2BLS A;  4S2I A;  3D72 A;  4LRX C;  1KGF A;  1YLP A;  1BUE A;  2JC7 A;  2XSS A;  2O99 A;  2ZQ7 A;  4EER A;  4X6T A;  1TVF A;  3GVB A;  3LR3 A;  1MWS A;  1M6K A;  5KIZ A;  4HJ6 A;  2PRF A;  3UB7 A;  4II7 A;  4WN5 A;  1T18 A;  1ZG6 A;  2EFX A;  3FC7 A;  4F3L A;  3G32 A;  1XGJ A;  1H5X A;  3BRM A;  1YLY A;  3PBR A;  4PKY A;  3UDX A;  1K55 A;  1AXB A;  4H6J B;  1N9N A;  3CG5 A;  3HLW A;  2JKG A;  1IFQ A;  3T4O A;  1W79 A;  1FIK A;  1VQQ A;  4CLC C;  2VEA A;  3EGX C;  2ZMF A;  2FZ0 A;  3Q07 A;  2EX9 A;  2C6W B;  2QYB A;  3DBA A;  3VP0 A;  1XXM A;  1V9Y A;  1ZC2 A;  5L10 A;  3UE0 A;  4MN6 A;  3ZDJ A;  1H8Z A;  3D3O A;  4YIN A;  5EVL A;  4BBU A;  5J8X A;  4WEJ A;  2HDU A;  2W1T B;  1CK3 A;  3NCK A;  3TSG A;  3EQU A;  1K4E A;  2BG1 A;  4ZDX A;  5CHU A;  1D7E A;  2ZL1 B;  3WRT A;  1NLZ A;  4IED A;  3A0R A;  3HLE A;  3BY9 A;  5TJJ A;  2PD7 A;  2WKH A;  1UWN X;  3VP1 A;  1E3U D;  2X02 A;  2ZOH A;  1YSQ A;  4MCW A;  3PBT A;  2ZC6 B;  1YLW A;  3Q7Z A;  3C7U A;  4I3A A;  4PMA A;  4X56 A;  1BLS A;  1YSP A;  4ZBE A;  5G4Z A;  4WMC D;  3EGD C;  4N92 A;  4O0P A;  3VOY A;  3IHA A;  1TEM A;  1LL8 A;  4PKY G;  1ESU A;  3PBQ A;  3HLB A;  4UA7 A;  3RH8 B;  3HUO A;  3Q81 A;  2K31 A;  3LO7 A;  4UQI M;  4E3M A;  2J8Y A;  3CAX A;  5EVI D;  5FQJ A;  5D3O A;  3N6I A;  1YAX A;  2B18 A;  1S1Z A;  3DAV A;  1MBL A;  4GDB A;  4WM9 A;  2WUQ A;  3S1Y A;  1ALQ A;  5FQQ A;  4X1L A;  3CUE A;  2X01 A;  5FEF A;  2WGW B;  3LIB A;  5DF7 A;  3BQA A;  2M7U A;  1LT0 A;  5FQ9 A;  5HAR A;  1N9O A;  5E2G A;  5KSC A;  4JXG A;  3VV4 A;  1ES3 A;  5EM0 A;  4EBP A;  5U47 A;  5MC7 A;  3LI9 A;  2WKP A;  3JVU A;  2DRW A;  3BFF A;  4Q0H A;  2DMW A;  4G3V A;  3UPP A;  2W1R A;  1G28 A;  1YLJ A;  3WS4 A;  4ZJ1 A;  1SDE A;  1L0E A;  2Z2M B;  3U2A A;  3G31 A;  2VA0 A;  2PBD P;  1TS8 A;  5EEC A;  1TS6 A;  1P9W A;  2INW A;  5FA7 A;  2ZJ9 A;  3H82 B;  5JYO A;  5F6A A;  4E3I A;  1LL9 A;  4XXR A;  5CER A;  1YM1 A;  1NLY A;  3K2N A;  4MDZ A;  2EFU A;  3IX4 A;  4HH3 A;  1PYY A;  3NOT C;  4L9G A;  3BWL A;  4KZB A;  1RCJ A;  2RL3 A;  1XPB A;  4QWO A;  2Y55 A;  4LRZ E;  3WS2 A;  2V20 A;  5HAI A;  2H0T A;  5IT5 A;  3RFB A;  5M18 A;  4CLC B;  4E3L A;  2Q9M A;  3MZD A;  1I2S A;  4JGQ A;  3SS4 A;  3TRC A;  1NRJ A;  2Y91 A;  4H6J A;  4DE0 A;  3HBR A;  2CMN A;  3ZG5 A;  1SCW A;  5CX7 A;  1P0Z A;  2W27 A;  3IHB A;  1N9L A;  1GSX A;  2XLN A;  1NYM A;  4Y0O A;  2VLG A;  2FH5 A;  3IWI A;  3TOI A;  3CPT B;  4LV2 A;  1KE4 A;  1H8Y A;  2PR5 A;  3RXX A;  4GS9 B;  4E6W A;  4B4X A;  2ZLY A;  1DJC A;  4WZ5 A;  3NC8 A;  4ETX A;  3OCN A;  4DDY A;  4NXG A;  2W1T A;  2EX2 A;  4DE3 A;  1DJA A;  5G18 A;  1NWZ A;  1MWT A;  4P6B A;  2Y8H A;  2WKE A;  5A90 A;  2ZM2 A;  1G6A A;  5AQA A;  4E3N A;  4DJ3 A;  2ZL1 A;  2OLU A;  5IHV A;  2O0Y A;  4X1M A;  4EES A;  5FI6 A;  2XD1 A;  3GRJ A;  5FQK A;  4Y3I A;  5FEG A;  3P98 A;  5A92 A;  4DJ2 A;  4HBT A;  3IF6 C;  4BD1 A;  1ERM A;  2OSU A;  1FCO A;  2HDR A;  5GHY A;  3F1O B;  1IYO A;  5HD5 A;  4XUZ A;  1BLC A;  4D2O A;  1SKF A;  1ZHH B;  4S2L A;  2W3G A;  4HJ3 A;  1FR6 A;  1LL5 A;  1L0F A;  1LSX A;  2HJE A;  2Y59 A;  3BFD A;  1MC0 A;  3IBJ A;  3QNB A;  1T1B A;  4DXC A;  3SZT A;  4OQH A;  1OT9 A;  4PHT A;  2A24 A;  5F83 A;  2ZMA A;  4CPK A;  2EWW A;  2OOL A;  4GKU A;  4N9K A;  3VFF A;  3CJM A;  3LY4 A;  4BBV A;  3V67 A;  5J7E A;  1K4F A;  4K0X A;  4E6X A;  1NXY A;  1OTI A;  2XRO A;  5EE8 A;  2VGL S;  2WGW A;  3C5A A;  1QMF A;  3ZG8 B;  2G7U A;  4BMW A;  3VE4 A;  3EOI A;  4QPR A;  4ZAM A;  2KDK A;  3Q82 A;  4YOF A;  3C4O A;  2Z2L B;  1J9M A;  4X25 A;  1VHM A;  1YQS A;  4GD8 A;  5HDS A;  2JN7 A;  2KLI A;  4BD0 A;  1YLZ A;  3HL9 A;  2ZOI A;  5CTM A;  4KZ7 A;  4DDS A;  3GR2 A;  1CF0 A;  4S2N A;  3I7J A;  2JKT I;  3C38 A;  3K3D A;  3GDI A;  5DFX A;  3B33 A;  5CEB A;  4R4S A;  2YKH A;  3G34 A;  2H0Y A;  3W4O A;  4HEF A;  1T1C A;  4LEN A;  2RCX A;  3RJU A;  3LIE A;  4H8R A;  1DP6 A;  2Z6C A;  1S1Y A;  1WYB A;  3AGF A;  4CJN A;  5EPH A;  2P9V B;  5DKK A;  4WZ5 C;  1KVM A;  3GV9 A;  2A2L A;  3BLS A;  1CI8 A;  5E2H A;  3MF0 A;  4DN0 A;  4M4X A;  4KQR A;  3LFV A;  3MS6 A;  4WL9 A;  3C8C A;  1YKD A;  4CLC A;  2QWS A;  1LSW A;  3UMD A;  2H28 A;  3IH9 A;  4FOF A;  1J3W A;  3VE3 A;  1KGE A;  4R38 A;  3G30 A;  2IA2 A;  2V8C A;  4GLQ A;  2W0N A;  1AWI A;  3DTM A;  3NEC A;  3EQV A;  1NRF A;  1L2S A;  2PHY A;  3CPT A;  3O5Y A;  4GS9 A;  1TS7 A;  3LEQ A;  5CHJ A;  3E0Y A;  1YPR A;  5AQ9 A;  1KGG A;  5FSR A;  2QJ5 A;  3E2L A;  4YNR A;  4NEE D;  2XQZ A;  4HIA A;  2XGN A;  2KX6 A;  2W3F A;  5HPF A;  3R7W B;  3A0V A;  2R9X A;  3T4T A;  2ZQD A;  2HPB A;  3OPL A;  5TFQ A;  2XR0 A;  3ICY A;  4KZ9 A;  1HZO A;  3LY3 A;  1IEL A;  4ID4 A;  1WE4 A;  4JBF A;  4GB7 A;  4QJG A;  1HVB A;  4YWZ A;  4JXW A;  3IF6 B;  5DTS A;  4S2K A;  3DWZ A;  3W8K A;  2VGK A;  4OPQ A;  4EV4 A;  1K57 C;  2K2N A;  1CEF A;  4XT2 B;  5KZH A;  4C6Y A;  4M3K A;  2VX8 A;  4NXB A;  1ES5 A;  3F1O A;  3LR5 A;  3UN7 A;  3EEH A;  1PW8 A;  1Y54 A;  5HL6 A;  1CEG A;  4KQO A;  2FFY A;  3E4Q A;  2ZC4 B;  4ARZ B;  1S67 L;  4ZJ3 A;  2EX6 A;  4PM5 A;  1G5U A;  1LHY A;  2WZX A;  4R1G A;  1M40 A;  3PBO A;  1UWP X;  2IWB A;  4KG5 A;  2V8F A;  3BYD A;  1BZA A;  4R6L A;  2J9O A;  3M2J A;  1NYY A;  3W4Q A;  3HCY A;  5DTT A;  2GZA A;  4MMN A;  3UB9 A;  5FDS A;  3U4L P;  5JYP A;  3LGO A;  1UGU A;  5M19 A;  3PXP A;  4GD6 A;  1HD8 A;  3DTE A;  4KG2 A;  4EBL A;  3IXD A;  3F1N A;  5GLC A;  3V39 A;  2JKT M;  5A8B A;  4R3B A;  4LLO B;  4ME4 A;  1NY0 A;  3D9Y A;  1KDW A;  2HV1 A;  2J3W A;  2XH9 A;  2XF3 A;  2Y2J A;  3DWK A;  5FAT A;  2GNX A;  3NDE A;  3HJI A;  3CMZ A;  2ZC7 A;  1GA0 A;  4JPM A;  3QNC A;  4WF0 A;  4MBF A;  2D01 A;  3T1S A;  1BUL A;  3ZYT A;  3NY4 A;  2KOI A;  5CTN A;  3A3F A;  1BYW A;  2UWX A;  4DE1 A;  4OLD A;  3PAG A;  2P9V A;  4FH2 A;  3LIC A;  3BY8 A;  4ZRR A;  1L0G A;  3MXR A;  3G2Z A;  4IHQ A;  2D02 A;  1W7F A;  3QHY A;  4NK3 A;  4DXB A;  4JF4 A;  2Y79 A;  5HDD A;  4WBG A;  5CEC A;  1IKG A;  1H0M A;  3HLF A;  2OV5 A;  3VSL A;  1OME A;  2Y2N A;  1LI0 A;  3DTI A;  2H5S A;  1NZO A;  4NKP A;  5AQB A;  2G2W A;  2WAD A;  3C30 A;  3UDF A;  2VV7 A;  3QP1 A;  1YLT A;  1JVJ A;  3LEZ A;  1I5Q A;  5AVF A;  3RXW A;  1PZO A;  4HI4 A;  1FSY A;  1H8M A;  4OQG A;  1PZP A;  3SH7 A;  3PBS A;  4I3I A;  3R7W A;  2YKF A;  3P7N A;  2A24 B;  4A5R A;  1K6S A;  4Z9Q A;  4UAA A;  4LV1 A;  3KYE A;  3VMA A;  2Q0O A;  4GN2 A;  1ODV A;  3LIF A;  3IF6 A;  3QP4 A;  4KQQ A;  1TDL A;  2WAE A;  2Y2K A;  4KUK A;  2J3T C;  1LLB A;  5E2F A;  2PU2 A;  1MZU A;  1E25 A;  4XT2 A;  1D06 A;  1XP4 A;  3IT9 A;  3NIA A;  3ZNT A;  5A91 A;  4JXV A;  2JKR M;  4RVA A;  1HLU P;  1KVL A;  3GSG A;  4NG2 A;  4ARZ A;  3WRZ A;  2V9A A;  2PAV P;  3KSF A;  3K3C A;  2J80 A;  1DP8 A;  2L1M A;  5L8M A;  5TBM A;  4X68 A;  2WGI A;  5CHM A;  4L9F A;  5CRF A;  2VJW A;  3TJZ C;  3QP5 A;  2WKI A;  4U0X A;  4Y0U A;  1XJ4 A;  4OOL A;  3A0S A;  4IUK A;  5FAS A;  5DF8 A;  3FPV A;  3LUQ A;  4KQD A;  3FZC A;  1JWZ A;  2HJ9 C;  1Z09 A;  3OZH A;  2ZQA A;  5HAP A;  5HZH A;  2V2F F;  3E98 A;  3WS5 A;  4RX3 A;  3L9K A;  3CLO A;  5J3W A;  1VM1 A;  4GJ4 A;  1SKO B;  3FG8 A;  3LR0 A;  2V1Z A;  1XA1 A;  5CGW A;  3G4P A;  4GZB A;  1Q2P A;  3GTC A;  2Y2P A;  5F5Y A;  2M7V A;  3HJK A;  4JGR A;  2LB9 A;  2XD5 A;  2JHE A;  3KYZ A;  1L3L A;  1IYP A;  4I5S A;  4Y17 A;  1CI9 A;  4EBN A;  1OTD A;  3OOV A;  4O8G A;  3IS2 A;  2O9A A;  2WAF A;  3MXS A;  3UB8 A;  4HP4 A;  5FAQ A;  5GLD A;  1ERQ A;  1FIL A;  4IJG A;  4HES A;  1MWU A;  4BEN A;  2ACG A;  5CGX A;  5I94 A;  5L2F A;  3MFD A;  3ULF A;  4IVI A;  2HP6 A;  3T12 B;  4HJ4 A;  4PAU A;  3QP8 A;  5DF9 A;  3MKE A;  2V1B A;  3ZCZ A;  5I5L A;  4NET A;  1K56 A;  3N8L A;  4HP9 A;  1IKI A;  2A3U A;  4FH4 A;  4OP5 A;  4AFI A;  4HY8 A;  1DY6 A;  3HVF A;  2WZZ A;  3MKF A;  3FV7 A;  3S7N A;  3O3V A;  3Q7V B;  1SZV A;  2Y2I A;  3C7V A;  1I2W A;  2V0W A;  3UB6 A;  3ZVT A;  3WS1 A;  1VET B;  3IF5 A;  3BLM A;  3IWQ A;  3BFE A;  1V9Z A;  1XKZ A;  3T1Q B;  2WKQ A;  3IXG A;  1K57 A;  4QU3 A;  3UE6 A;  1MKI A;  1XJ2 A;  2C5W B;  5FI2 A;  1ZG4 A;  3F1N B;  1T1A A;  2ZM0 A;  2UV0 E;  3T4K A;  1K38 A;  3UE3 A;  5IU1 A;  4EUV A;  4F94 A;  4RQ9 A;  1OTB A;  5DVA A;  5DFY A;  3BQ8 A;  1S0W A;  3ZFZ A;  3UPO A;  3MR0 A;  3LIA A;  1K25 A;  4IBR A;  3VP2 A;  2P08 A;  3OLO A;  1F98 A;  3B47 A;  3S7P A;  4U0T A;  3T4L A;  4CLC D;  3B42 A;  3CHW P;  4LRY C;  5M1A A;  3T1R A;  4OP8 A;  5FAP A;  2PD8 A;  4EEP A;  1GHP A;  4OQI A;  4JKT A;  2PBY A;  3DW0 A;  3LID A;  3S7Q A;  1TD5 A;  4P87 A;  1L0D A;  5FL3 A;  4DKI A;  5AJG A;  4HOI A; 
#chains in the Genus database with same CATH homology
 2GZA A;  4L9E A;  4MMN A;  2L0W A;  3PBQ A;  4P6Z M;  3UB9 A;  4OOM A;  5EFW A;  1UGU A;  3RH8 B;  3PXP A;  4MN7 A;  2K31 A;  4UQI M;  3T4S A;  3CAX A;  1JNU A;  3F1N A;  2VV8 A;  1YAX A;  2B18 A;  1S1Z A;  2JKT M;  3RTY A;  5A8B A;  4HHD A;  4LLO B;  4ME4 A;  5F68 A;  2K7S A;  2OWJ A;  2R78 A;  1XJ6 A;  4HH2 A;  2M1C A;  4PKY G;  4G3K A;  2HV1 A;  2J3W A;  3CUE A;  4UEY A;  3LIB A;  3BQA A;  2BAS A;  3OC2 A;  2M7U A;  1LT0 A;  3T4Q A;  1N9O A;  2GNX A;  3VV4 A;  3PBN A;  4GCZ A;  2V0U A;  3HJI A;  2PYR A;  3CWF A;  4EW7 A;  4JGO A;  2W3E A;  5MC7 A;  3LI9 A;  4WF0 A;  2WKP A;  3CUE C;  3JVU A;  2D01 A;  4Q0H A;  2DMW A;  3ZYT A;  1S66 L;  4G3V A;  2KOI A;  1G6O A;  3PYP A;  2W1R A;  1G28 A;  1BYW A;  4Q0J A;  2W3H A;  3U2A A;  2VA0 A;  3R4K A;  3E4O A;  3OCL A;  1TS8 A;  1TS6 A;  1P9W A;  1OT6 A;  2INW A;  3H82 B;  3LIC A;  3BY8 A;  3LI8 A;  5F6A A;  4ZRR A;  1H3Q A;  1F5M A;  4IHQ A;  4EU0 A;  2D02 A;  1XJ3 A;  3EWK A;  1NLY A;  3K2N A;  5K5B A;  1STZ A;  2HF6 A;  3NHQ A;  4MDZ A;  2Y79 A;  3BJN A;  5HDD A;  4HH3 A;  3LR4 A;  4BJP A;  3NOT C;  3MMH A;  2ZBB A;  1S4R A;  1Y28 A;  2O9C A;  4L9G A;  5HWV A;  1XFN A;  3BWL A;  2MJ6 A;  3ZQ5 A;  2P04 A;  3MQ0 A;  4LRZ E;  4NKP A;  1X0O A;  5IT5 A;  3RFB A;  5HD3 A;  4NXE A;  2VGL M;  3C30 A;  5C5K A;  1DRM A;  4CLC B;  2VV7 A;  2PT7 A;  4LPZ A;  2QKP A;  4JGQ A;  2OAP 1;  3TRC A;  1NRJ A;  1W63 M;  4H6J A;  2CMN A;  5AVF A;  5CX7 A;  4F3L B;  2XRN A;  1P0Z A;  2W27 A;  5TBM B;  4HI4 A;  1N9L A;  2O9B A;  1GSX A;  4G3W A;  2VLG A;  4DMZ A;  1H8M A;  3H7W B;  2FH5 A;  2VKS A;  2W3D A;  3KSG A;  3PBS A;  4R3A A;  2PR5 A;  1TF1 A;  4GS9 B;  4I3I A;  3R7W A;  3EEA A;  4ETZ A;  2B02 A;  2YKF A;  3P7N A;  2GX5 A;  2A24 B;  2JKR I;  3BW6 A;  4IUH A;  4ETX A;  4GHI A;  5G4Y A;  3OCN A;  3SW1 A;  3H82 A;  4I39 A;  4L0L A;  4NXG A;  2PR6 A;  2W1T A;  1ODV A;  3LIF A;  2HGV A;  4E04 A;  1GSV A;  4KUK A;  2VV6 A;  2J3T C;  4B93 A;  3KYQ A;  3P01 A;  1NWZ A;  3OBF A;  4HNB A;  4KUO A;  1OPX A;  2Y8H A;  2Z6D A;  3IBR A;  3MXQ A;  4BWI A;  5LBR A;  3C2W A;  1MZU A;  4DJ3 A;  3PHY A;  4XT2 A;  1OJG A;  3NJA A;  4BBT A;  2O0Y A;  1D06 A;  4EES A;  3KSI A;  3MQO A;  2EA9 A;  4Y3I A;  2LB5 A;  1ZTU A;  2EWV A;  2JKR M;  4DJ2 A;  4MN5 A;  4ARZ A;  3CIT A;  2V9A A;  2OAQ 1;  5HPI A;  3F1O B;  3KSF A;  5HD5 A;  3K3C A;  2J80 A;  3MQQ A;  1DP8 A;  2L1M A;  5DJU A;  1ZHH B;  5L8M A;  4R70 A;  5TBM A;  4NXF A;  2W3G A;  3F1P B;  4HJ3 A;  2QHK A;  3IS2 B;  4L9F A;  4K08 A;  1LSX A;  2VJW A;  3VOL A;  1T19 A;  2HJE A;  1OTE A;  2V1A A;  3TJZ C;  1MC0 A;  3IBJ A;  1P97 A;  1T1B A;  4WLA A;  4Y5F A;  3MJQ A;  3GEC A;  1OT9 A;  4PHT A;  3JVV A;  1MKM A;  1XJ4 A;  2A24 A;  4OOL A;  3A0S A;  5IS1 A;  1OJ5 A;  4IUK A;  2EWW A;  4WUJ A;  2OOL A;  1DP9 A;  2J3T D;  4JGP A;  1XFQ A;  3FPV A;  3LUQ A;  3KX0 X;  4BBV A;  3UME A;  4KQD A;  3KO6 A;  3V67 A;  5DKL A;  5J7E A;  2WKR A;  1OTI A;  2HJ9 C;  1IOU A;  2XRO A;  1OTA A;  2VGL S;  5HZH A;  3E98 A;  2G7U A;  4BMW A;  3VE4 A;  3EOI A;  4QPR A;  2KDK A;  3CLO A;  2XA7 S;  4YOF A;  5J3W A;  3FPW A;  2I9V A;  3S7O A;  4GJ4 A;  1VHM A;  3FG8 A;  3LR0 A;  4Q0I A;  5HSQ A;  2OWH A;  5HDS A;  2NUT C;  1GSW A;  2JN7 A;  4B9O A;  5F5Y A;  2KLI A;  2M7V A;  1TS0 A;  3TE8 A;  4Y2F A;  5F69 A;  3HJK A;  4JGR A;  2ZOI A;  2LB9 A;  2JHE A;  3KYZ A;  3T4J A;  4I5S A;  4P6Z S;  3KSH A;  3CI6 A;  4CLC E;  1EW0 A;  1OTD A;  3OOV A;  2JKT I;  4O8G A;  3IS2 A;  2O9A A;  2PDR A;  3C38 A;  3K3D A;  4UQI S;  3GDI A;  3E4P A;  1W63 Q;  5DFX A;  3B33 A;  3UB8 A;  4EQ1 A;  2YKH A;  4HP4 A;  3MFX A;  4IJG A;  3TW8 A;  5J4E A;  1T1C A;  3LIE A;  4WEK A;  2PYP A;  5KSH A;  1DP6 A;  2Z6C A;  1S1Y A;  4HQA A;  5DKK A;  3ULF A;  3G6O A;  4GW9 A;  5HWT A;  4HJ4 A;  4PAU A;  1S4S A;  3D72 A;  4Z1W A;  4LRX C;  5DF9 A;  2A2L A;  4EXO A;  2XSS A;  2O99 A;  3MF0 A;  4DN0 A;  2V1B A;  4EER A;  4M4X A;  5I5L A;  3LFV A;  4WL9 A;  3C8C A;  3LR3 A;  4HP9 A;  1YKD A;  4AFI A;  4HY8 A;  5KIZ A;  2VZW A;  4CLC A;  1F9I A;  2QWS A;  1LSW A;  5HDC A;  3UMD A;  2H28 A;  4HJ6 A;  4FOF A;  3S7N A;  3UB7 A;  3VE3 A;  4II7 A;  4R38 A;  4WN5 A;  1T18 A;  3LYX A;  2IA2 A;  3FC7 A;  4F3L A;  4GLQ A;  3T50 A;  2W0N A;  4WEL A;  2V0W A;  5AVE A;  3UB6 A;  3PBR A;  4PKY A;  4H6J B;  3EQV A;  1N9N A;  2PHY A;  3H7W A;  1IFQ A;  3T4O A;  3O5Y A;  4EET B;  4CLC C;  4GS9 A;  1TS7 A;  3E0Y A;  5DJT A;  2VEA A;  2NUP C;  3EGX C;  2ZMF A;  2L4R A;  2FZ0 A;  1V9Z A;  2QJ5 A;  4YNR A;  4NEE D;  4HIA A;  2QYB A;  5HPF A;  2KX6 A;  2W3F A;  3DBA A;  3R7W B;  1V9Y A;  3A0V A;  1WA9 A;  2WKQ A;  2ZMV A;  4MN6 A;  3T4T A;  1LSV A;  1VB6 A;  3D3O A;  4GHI B;  3ICY A;  3UE6 A;  1XJ2 A;  4FSF A;  3F1N B;  1T1A A;  4HOI A;  4BBU A;  4WEJ A;  3T4K A;  2W1T B;  1KOU A;  3UE3 A;  4YWZ A;  5IU1 A;  4EUV A;  4EEU A;  4RQ9 A;  1OTB A;  3EQU A;  4I3J A;  5DFY A;  3BQ8 A;  2QJ7 A;  3MR0 A;  3LIA A;  2K2N A;  1D7E A;  2P08 A;  4XT2 B;  2GJ3 A;  3OLO A;  3NOP C;  1NLZ A;  2VX8 A;  3H9W A;  3NOU C;  2P7J A;  1F98 A;  4NXB A;  5HWW A;  3F1O A;  3A0R A;  3LR5 A;  3EEH A;  3B47 A;  3S7P A;  5TJJ A;  3BY9 A;  2PD7 A;  5HL6 A;  1UWN X;  4KQO A;  4O01 A;  3W2Z A;  3T4L A;  3E4Q A;  2ZOH A;  4ARZ B;  4CLC D;  1S67 L;  1YSQ A;  3B42 A;  4LRY C;  3F1P A;  2XA7 M;  4MCW A;  4CQH A;  3PBT A;  2PD8 A;  4EEP A;  3PBO A;  4I3A A;  1UWP X;  3LID A;  1YSP A;  5G4Z A;  1TD5 A;  3S7Q A;  1P9R A;  3PR6 A;  3EGD C;  4O0P A;  4R6L A;  5FL3 A;  5AJG A;  1LL8 A;  3HCY A;  4I38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...