3BJNA

Crystal structure of c-terminal domain of putative transcriptional regulator from vibrio cholerae, targeted domain 79-240
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
162
structure length
162
Chain Sequence
b'SYETSQHNLDAVEAVLSRLQKQTGEMAAYMVPVGYRALCVSQRESMQALRCSFVQGQSQPLLRGASSKVMLAYMPAARCEKILRYFGEDPTLDKWQSEFEKIRRHGYAVSTSEIDPGVSGISAPVMKGSKLIGAISVMAPAHRVESNKQRIILHVLQAARAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, putative
publication title Crystal structure of C-terminal domain of putative transcriptional regulator from Vibrio cholerae.
rcsb
source organism Vibrio cholerae o1 biovar eltor str. n16961
molecule tags Transcription regulator
total genus 48
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2007-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3bjnA00
1VHMA 2O0YA 2W1TB 2M7VA 3MQ0A 3S7PA 3E98A 4Y3IA 3OBFA 4ETXA 2G7UA 2W3HA 3EEAA 3G6OA 3MF0A 4ME4A 3KSGA 4DN0A 4BWIA 2QYBA 2O9CA 4R70A 4YNRA 3TRCA 3K2NA 4IUKA 5LBRA 3W2ZA 3VV4A 1TF1A 2W3GA 4Y5FA 3DBAA 3S7QA 2XSSA 4Q0IA 2O9AA 4MCWA 4Y2FA 3NOUC 2KOIA 1F5MA 2W1TA 4QPRA 3D3OA 2O99A 1TD5A 2GX5A 2KLIA 4MMNA 2LB9A 2W3DA 3S7NA 4LRXC 4EU0A 1MKMA 4EUVA 3KSFA 3RFBA 3ZQ5A 4O01A 5L8MA 4RQ9A 4LRYC 3KO6A 3MMHA 4CQHA 5AJGA 4R6LA 5HL6A 3LFVA 2W1RA 3NHQA 4ZRRA 3BJNA 4GLQA 1YSPA 5DFXA 2M7UA 1STZA 2LB5A 4FOFA 5TJJA 4IJGA 2IA2A 2HGVA 3E0YA 5HSQA 4E04A 1MC0A 4GW9A 2XROA 4G3KA 5C5KA 2XRNA 4G3WA 4MN7A 3IBJA 2VJWA 4YOFA 4DMZA 3C2WA 5HPIA 1YKDA 3HCYA 4Q0HA 2K31A 4LRZE 3KSIA 4PAUA 2W3EA 2O9BA 4Q0JA 4O0PA 2Y79A 2VEAA 5K5BA 2VKSA 4O8GA 3NOPC 4IUHA 5DFYA 3S7OA 4ETZA 2B18A 1ZTUA 5I5LA 2W3FA 2ZMFA 3CI6A 5HPFA 3IBRA 4G3VA 3NOTC 3OOVA 2VZWA 4Z1WA 2OOLA 3R4KA 3O5YA 2Y8HA 4MDZA 2K2NA 3KSHA 1YSQA 3CITA
chains in the Genus database with same CATH superfamily
1FOFA 1N9LA 4F94A 3HLFA 3RXXA 5CHJA 1GHIA 1ONGA 4BWIA 5MC7A 1XKZA 2NUTC 2V1AA 2PD8A 3C4PA 4LCMA 3TRCA 4E3OA 2A2LA 1YLTA 5HDDA 4Q0IA 4Y2FA 3CZDA 4XT2A 3H7WB 3A3EA 3A0VA 4S2PA 4C3QA 1VB6A 3IHAA 5EECA 5A91A 5GHZA 4KZ7A 3IF6C 1VEUA 2B5RA 2FFFB 1VQQA 4F3LA 4EBPA 3ZQ5A 5G4ZA 1I2WA 4BJPA 4IBXA 3U2AA 1MKIA 3CPTA 4KUOA 4BL2A 4S2NA 2Z2MB 4KQDA 4FOFA 3QP1A 3MFXA 3D4FA 1GSXA 1C3BA 1OTEA 1XA7A 4OVDA 4R4RA 2ZQDA 1TDGA 4Y13A 1HLUP 3JYIA 4OPYA 3NI9A 4IVKA 4LCLA 3FPVA 2EFXA 3UE0A 3T4LA 2VV7A 3CI6A 3BQ8A 1NJ4A 1ACFA 2VK3A 2OOLA 3OPLA 1K0KA 2Y91A 3NULA 1S4SA 4GKUA 3G32A 3Q07A 1BLCA 4DN0A 2JBFA 4PM6A 3D72A 2WGWB 3DTKA 2O9CA 3IXDA 2PYPA 2Y2QA 4AFIA 4IVIA 1XGJA 3K3DA 4EETB 4I39A 1NZUA 2HV1A 2Y2IA 5AQAA 5FSRA 4E3JA 3T50A 4HESA 3BFEA 3Q7VA 3TE8A 3BM6A 4B9OA 1K54A 1N4OA 5F1GA 3N8RA 4CLCB 1P97A 2K7SA 1SKOB 2I72A 3P09A 1ODVA 4QB8A 1Y54A 5E2FA 5EVEA 1L0FA 4HNBA 3LR4A 4RQ9A 1DJBA 4O7DA 4EERA 4S2OA 2WZZA 3AGDA 3LIDA 3MXRA 4CQHA 5U47A 5HL6A 3MKFA 2WADA 3T1SA 2EX2A 4MN6A 4R23A 1A0KA 4GW9A 3SS3A 4X55A 4C75A 4BMWA 4FD8A 1QMFA 4MBKA 3UB7A 3OPPA 5A8BA 3V3RA 2XDMA 3ZDJA 3PTEA 4JXWA 3UO9A 5FA7A 3ZHHA 4ZJ3A 1IKIA 4E3LA 2JE5A 4IUHA 1NXYA 1IYQA 1JWVA 2FH5A 3FPWA 2VZWA 1PNEA 3WWXA 5DTSA 3LYXA 3TJZC 2WKQA 4MDZA 4DJ3A 5E2HA 3PBSA 4N9LA 1VHMA 3MQ0A 2VX8A 3IWQA 2YKHA 1PW8A 2J80A 1G6OA 2INWA 5AQ7A 1YT4A 4R70A 4N1HA 5DJUA 3EQUA 5HAPA 4UEYA 5LBRA 3CUEA 1I2SA 1D7EA 3NCKA 1IELA 2G2UA 4M3KA 4RX3A 4WMCA 1FR6A 4MCWA 5FDHA 3ZVWA 4EUZA 2V2FF 3MZFA 1RP5A 4P85A 1CI9A 2FZ0A 3ZG8B 4HOIA 2VA0A 2VV6A 5TFQA 3BQAA 4XXRA 5KMWA 2PU4A 1PI4A 2QKPA 3VE3A 3BY8A 2DCFA 1RGZA 5AJGA 3GRJA 2EXBA 4BD0A 3V3SA 1S1YA 3KX0X 5HDCA 3E0YA 3VMAA 3CAXA 1O07A 3HUOA 5CGXA 3C2WA 2J9PA 2WK0A 1OMEA 1CEGA 3MXSA 2O9BA 2NUPC 5DKKA 3C7VA 1NRJA 4ZDXA 4O8GA 4FCFA 4QJGA 4IBRA 2W3FA 2W0NA 3BFCA 3MSHA 1NY0A 3QP4A 3HVFA 3UDIA 3IX3A 4B93A 4QWOA 2V1BA 3H82B 3N6IA 1OPXA 3ZNTA 3IX8A 1KE3A 3T4QA 4S2KA 3TOIA 2WZXA 3BEBA 4IUKA 3O86A 4HEFA 1NLZA 4Y5FA 3DTEA 4DE2A 2VGLS 1Z6FA 5FEGA 2L4RA 3NIAA 3G2ZA 3DAVA 3A3DA 3HUNA 3D9YA 5E2EA 5GLDA 3A3FA 4S2LA 2WKPA 5CGSA 4R38A 1WYBA 3QNBA 5CEDA 2P74A 2DMWA 3OCNA 2JHEA 1XX2A 3HLCA 3ULFA 5GL9A 3N4IA 3HLEA 1W8YA 3PBRA 2Z2LB 5L8MA 5FATA 1ZG4A 4HY8A 4RX2A 4EQIA 2JC7A 1ES3A 2V8CA 3LR3A 3NHQA 3UB8A 3H7WA 1PZOA 2R78A 3MJQA 2J3TC 1M6KA 2WAFA 4KZ9A 1MWSA 2XROA 4JF6A 1GA9A 1UWNX 4N9KA 3EEHA 4OH0A 4GN2A 5DF8A 1XPBA 1YKDA 3M6HA 4QY5A 3GQZA 4KZBA 1PRQA 1ZHHB 2ZOHA 4KZ5A 4OP5A 1S1ZA 1NRFA 2RCXA 2K2NA 3C30A 5IU1A 3CHWP 4KZ8A 2Y2PA 2Q9NA 1N9OA 1XGIA 4JGQA 4I3AA 2PRFA 1GSWA 4HBUA 3LUQA 3GSGA 2Y2JA 3PXPA 3G2YA 1FCOA 1XJ2A 3Q81A 5AQBA 3S22A 1K6SA 3DBAA 3FWLA 3LIEA 2ZC6B 5FAOA 2XK1A 3F1NB 3C4OA 5FQMA 4D2OA 1G5UA 2GX5A 5F83A 3WRZA 3L7HA 5DTTA 2WUQA 2WGWA 1FSYA 1F2KA 2EFUA 3T1RA 2JKTM 4OOYA 3SH9A 3VP3A 5HFOA 4EBLA 1KGEA 2JKRI 1SCWA 2PYRA 4R6LA 5HZHA 1LT0A 4QHCA 2ZJ9A 2HF6A 1V9ZA 2OAP1 2M7UA 4II7A 4CLCA 5HSQA 2KX6A 1E3UA 2V8FA 2VJWA 1K4EA 4UQIM 1CQAA 4DMZA 2I9VA 3FKWA 3WRTA 3IF5A 5FQIA 3KYZA 1YQSA 4UA9A 3IF6B 4PKYA 1FQGA 2GNXA 1HZOA 4GOGA 5HW3A 4BBVA 3NOTC 3A3JA 3O5YA 3MXQA 3CITA 2ACGA 5E43A 2XD1A 3OBFA 4ETXA 2ZM0A 4BL3A 3G6OA 1XA1A 1F9IA 2Z6DA 4OOMA 2P7JA 2QJ5A 2XGNA 1K56A 3VV4A 1FIKA 1Q2QA 2KOIA 4KG2A 1TVFA 3VFFA 1VM1A 3SS5A 2Y59A 3I7JA 3ZCZA 4Y0TA 1ZG6A 5EPHA 2PR6A 2OSUA 4OLDA 3QP6A 4X1LA 4PM5A 4PM8A 3T1QB 2VLGA 3UN7A 2HP5A 2HZ5A 3SH8A 2RL3A 2WKHA 3DTMA 4RA7A 3IWOA 4X69A 2GJ3A 5TJJA 3SOIA 1YMSA 2DRWA 1QMEA 4HP4A 3C7UA 3K3CA 4EEUA 4LFUA 4Q0HA 4EWFA 3IX4A 4ESPA 3OLOA 3UMEA 5HAIA 2VV8A 4LV2A 4O0PA 3MQQA 4OLGA 2XD5A 3P01A 1T18A 3S1YA 5EUAA 5EM0A 2QPNA 5I5LA 4E6WA 1LSXA 3ZGAB 1J3WA 4N1XA 3LCEA 4P0MA 4PM7A 1JNUA 3N8SA 2H0YA 2O0YA 3MBZA 2JKGA 3IS2B 1N9BA 5DTKA 1NWZA 1SZVA 1K55C 2W27A 5DF9A 5EVIC 3O87A 5HDSA 1XJ4A 3B33A 4LLOB 3QP5A 5GLAA 5F68A 1YLPA 1GHPA 5FEFA 2PDRA 1D1JA 4GHIB 2ZOIA 2PD7A 4EW7A 3NC8A 2BG1A 4WZ5C 2P9VB 4KZ3A 4R0QA 1T1CA 1ESIA 1LSVA 5GLCA 3H82A 3MZDA 4DXBA 2ZC7A 4OQGA 1BUEA 2Y2OA 3HUMA 2IWDA 4KG6A 2JKFA 4MN5A 4IHQA 3RFBA 2HDRA 5J7EA 4O01A 5AVFA 2PR5A 1TS7A 5FI7A 3UNWA 2Y55A 5FAQA 3E2LA 3G30A 5EVLA 5FQJA 4KZAA 1U60A 5DFXA 4Y0OA 1STZA 3A3IA 3F1PB 1LL9A 2IA2A 2OV5A 1IYSA 2J3WA 4ZTKA 4KZ4A 3UDXA 3IQAA 1T1BA 2ZLYA 1K57C 1KVLA 4Y17A 3IWIA 3JVVA 2CC1A 1SDEA 4L0LA 4Q0JA 4H6JB 3U4LP 3T12B 1DJAA 1PWGA 4YFMA 2ZQ9A 3S7OA 3SZTA 4K0WA 4WMCD 1MWRA 3PAGA 4JF5A 2ZQCA 4P6ZM 3UDFA 4OQ0A 2J8YA 4E3NA 4OONA 2EX6A 2G7UA 4CPKA 1E25A 5CHUA 1K4FA 1W63Q 2HDQA 5L2FA 4Y7PA 2D01A 4DRTA 1PZPA 2HP6A 4LGWA 3RJUA 1TS6A 4ARZB 1PYYA 4OP8A 4M4XA 1AXBA 4U0XA 5HARA 4NXFA 1PI5A 5G18A 3G4PA 3MS6A 2P08A 2Y4AA 4DDYA 4HJ6A 4S2IA 1W79A 4WZ4A 3ZG0A 2HJ9C 3DTIA 5HL1A 4ZAMA 2HPBA 3CJMA 2IWCA 3KO6A 1ERMA 2XA7M 4UA6A 4JXGA 2W1RA 3OCLA 1N9NA 2A3UA 5TR7A 3F1NA 3LI8A 2LB5A 3NY4A 4NG2A 4PMAA 4YWZA 4LV3A 3A0SA 2DNSA 4WEKA 4MN7A 5F6AA 2VGJA 1UGUA 3E2KA 5HPIA 5CXWA 1TEMA 5L07A 4GDBA 1FR1A 3P98A 1ONHA 1L0GA 5K5BA 3HLGA 4WF0A 3LY3A 3VP1A 5FQ9A 3ZG7B 2QMIA 2Y2MA 2W1TB 3GDIA 3F1OB 2W3HA 3EEAA 1KGFA 4ME4A 1V9YA 2OLVA 3OPRA 1OJ5A 5KZHA 3IF6A 2XLNA 2Y2HA 4GS9B 3QP8A 2L1MA 3B47A 5EE8A 5EFWA 2ZBBA 2OLUA 2BLSA 3NDEA 1GA0A 1YLWA 1IYOA 2O9AA 3N8LA 4HP9A 4GNUA 3LR0A 1ZC2A 1TDLA 1JWZA 3T4KA 4MMNA 2EX9A 3V50A 1VETB 3BFDA 3N7WA 3VFHA 1GHMA 3RH8B 1DRMA 4PHTA 1UWPX 4JBFA 4RYEA 2PAVP 3HL9A 1Q2PA 5E2GA 3BYDA 3WS0A 1H8MA 1ES2A 4EXOA 1EWZA 1K55A 1P9WA 1TS8A 5HWTA 2H28A 5EVIA 1J9MA 3BECA 1KVMA 3W8KA 2HJEA 1PFLA 3EWKA 5TBMB 5A90A 1MC0A 2QWSA 5G4YA 2XRNA 3C38A 1AWIA 3PHYA 3LEZA 4PAUA 3LR5A 3VE4A 3HLWA 5JYOA 3IXBA 1HD8A 4S2NC 1K38A 4JGRA 5FQQA 5HAQA 1G68A 4MBFA 4X25A 2C5WB 4XUZA 5HD5A 2ZM8A 2M7VA 4WLAA 4PKYG 4FSFA 3PAEA 5M18A 1YAXA 1LHYA 2J7VA 1FCNA 1BSGA 4GB7A 5M19A 3LICA 2XFSA 3GTCA 2ZD8A 3ITAA 2PT7A 1TF1A 1SKFA 4FH2A 3VOYA 2D02A 5CHMA 5IHVA 1OT6A 4HBTA 3LIAA 4QU3A 4NXBA 4PM9A 4QPRA 1OTDA 4DJ2A 4CLCD 2EXAA 1L0EA 3IS2A 2XEPA 5FASA 2W3DA 1E3UD 3S7NA 1MBLA 1I5QA 1KGGA 1YLZA 3H9WA 3IH9A 4JGPA 2J9OA 3KYEA 1NLYA 2EWVA 4EBNA 4ID4A 4DXCA 3MMHA 4N92A 4GHIA 1JTGA 4S2MA 4MEZA 3WS2A 3A0RA 2A24B 3IXGA 1K54C 4X1MA 4GLQA 2P9VA 1ALQA 1YSPA 2XR0A 3HJKA 3ZVTA 3CLOA 2HGVA 1EROA 4G3KA 1DJCA 3E4QA 1P0ZA 3SS4A 3Q7ZA 4GD6A 5FDSA 2B02A 5EOEA 3GVBA 5DF7A 3BLMA 3C8CA 1K56D 5DFYA 3W4OA 4IEDA 4HI4A 3IBRA 4U0TA 1MZUA 4NK3A 1M40A 2WKRA 5F82A 1FSWA 3F1PA 2PU2A 4WYYA 1LLBA 2PBDP 5FL3A 1XP4A 3S7PA 2H0TA 1DP8A 4UQIS 4QY6A 3MFDA 4K91A 3KSGA 3UE6A 2QYBA 1W63M 1EI5A 4H6JA 2WGIA 3W2ZA 1PIOA 1XJ3A 4BQMA 1O7EA 2E8IA 3O3VA 3S7QA 5GLBA 2XF3A 5CGWA 5EOOA 1KDSA 3M6BA 5EV0A 1L3LA 3CWFA 1X0OA 3NBLA 3UY6A 2EX8A 3BY9A 3T4SA 3MQOA 4OPRA 1CEFA 4H8RA 4BBTA 1IKGA 3CUEC 3EQVA 2V1ZA 2MJ6A 4JGOA 3PBTA 3OZHA 3QP2A 2JN7A 1G6AA 2WYXA 4ARZA 4ZBEA 5EVIB 5AVEA 2X71A 3R7WB 4B4ZA 3AGFA 3LFVA 1RCJA 4L9FA 4UA7A 2Y2NA 4JXSA 1CJFA 2ZM2A 3CG5A 3ZYTA 4A5RA 3WS5A 1KE4A 2QJ7A 2UWXA 3EOIA 5A93A 1BLSA 3P7NA 1FILA 2J3TD 3LO7A 1GSVA 4FTXA 2GDNA 3RXWA 1D06A 5J3WA 3JVUA 2JKRM 4G3VA 4CLCE 4JXVA 4WN5A 4DE0A 5FI6A 3VOZA 2X02A 3HJIA 4KUKA 4Y3IA 3BLSA 4OPQA 1GCEA 4EEPA 4UHUA 1NZOA 1EW0A 3HLBA 4ZJ1A 1IYPA 3LEQA 3G34A 3HBRA 3PBOA 3GECA 4R4SA 4Q8IA 3NECA 4I38A 3CMZA 1H8ZA 3DWKA 2W1TA 1KDWA 3T4OA 3TG9A 3UE1A 3F1OA 1TD5A 1KOUA 3UE3A 2QHKA 3HREA 4B4XA 1ESUA 3IHBA 4KQQA 4GS9A 1BLHA 3FYZA 1S0WA 5HX9A 3DW0A 4LRYC 5CECA 2GZAA 2Z6CA 1MY8A 3E4PA 5CRFA 4ZRRA 2ZQ8A 4GCZA 2EA9A 5DJTA 1XJ6A 4E3IA 4DE1A 1MWTA 2H10A 3FV7A 3PR6A 3VSLA 1VETA 1H0MA 4NXGA 4R3BA 4NEED 4BBUA 5JYPA 1L2SA 1PWDA 2M1CA 2V0UA 3M2JA 1OTIA 5IT5A 3NJAA 1ZKJA 3SH7A 4K08A 2Y2GA 4LV0A 2AVXA 1ZTUA 4WL9A 5HPFA 2ZC4B 4HJ4A 5CERA 5I94A 4I3IA 4CJNA 5TBMA 3IH8A 4JLFA 1LL5A 3E98A 2OWHA 2WKEA 1YM1A 4JPMA 2OAQ1 3IXHA 2Q0OA 3MZEA 4E3KA 1K25A 4YNRA 3K2NA 3C5AA 1MXOA 3Q82A 4L9EA 4GZBA 4R3JA 3ZG9B 2ZL1B 3NOUC 4P6ZS 1HTZA 3FC7A 5BOHA 1F5MA 3AGEA 3UPNA 5KSHA 3RTYA 2LB9A 4BD1A 1G28A 2P04A 2VGKA 3LI9A 3HLDA 2WAEA 3W4PA 3ISGA 3KYQA 4YINA 4KG5A 5FAPA 3ICYA 2R9XA 2BTFP 4R3AA 3L9KA 3VP2A 2Y2KA 4OPZA 4U3TA 1OTBA 2V20A 4PPRA 4WELA 3GV9A 1IOUA 3MKEA 3ZG5A 3ZNYA 3EGXC 2L0WA 4KZ6A 4K0XA 4E04A 5C5KA 2ZMAA 3IBJA 5L10A 4EESA 4Y15A 1ERQA 2EWWA 3W4QA 5CTNA 5GHYA 2E8JA 4LV1A 2FFYA 5HD3A 4WUJA 5L09A 1BULA 2XA7S 3NOPC 2A24A 4FH4A 2BASA 4CLCC 3OOVA 4UAAA 5D3OA 3UB9A 4XT2B 2ZMVA 5TGFA 3O88A 1YPRA 5F1FA 4EV4A 4FUWA 1T19A 1PWCA 1S67L 1BT5A 1NYYA 4D60A 4GJ4A 5FQKA 3LGOA 4HHDA 1NYMA 4MBHA 1VEUB 4HJ3A 1IEMA 1XXMA 2ZC3B 4F3LB 4X68A 3EGDC 3GMWA 3V5MA 3B42A 1KE0A 1JVJA 3B3XA 2UV0E 1S6RA 3BWLA 5DKLA 3CPTB 4EQ1A 3FG8A 5EVID 3D3OA 4JKTA 4BLMA 4WM9A 1BTLA 1OTAA 3TW8A 3E4OA 1ES4A 1MKMA 4EUVA 5M1AA 3QHYA 3G31A 3JPUA 4BENA 1K6RA 4P87A 2V9AA 1S66L 3UPOA 1T1AA 4P6BA 2ZQAA 5F69A 3UMDA 2G2WA 5KSCA 1H8YA 1ES5A 3BJNA 1F98A 4LENA 2Y2LA 4KQOA 1BZAA 1CF0A 3VOLA 4G3WA 4KENB 2JCHA 2K31A 3LY4A 3TSGA 3KSIA 2W3EA 1WYCA 3V39A 4S2JA 2WKIA 5CX7A 4E3MA 2VEAA 3R7WA 1HVBA 1LI9A 3G35A 4GD8A 5F5YA 2WGVA 1MWUA 3Q7VB 4DE3A 3UPPA 2ZC5B 1JTDA 2VGLM 1BYWA 4QD4A 1E4DA 5DVAA 4R1GA 3M2KA 1TS0A 2HP9A 4HIAA 4WZ5A 5FI2A 3T4TA 3BFFA 3T1XA 4RVAA 3PBNA 3Q1FA 4WBGA 2HDSA 2JKTI 4HH2A 1W7FA 4MLLA 3VSKA 2W3GA 4NETA 2IWBA 1XFNA 1DP9A 1S4RA 4KQRA 2Q9MA 4Z9QA 2YKFA 1YLJA 2B95A 2O99A 2C6WB 4LRXC 3VP0A 4HQAA 2XH9A 3KSFA 4OQIA 4DDSA 1CK3A 1K57A 3OPHA 3GR2A 3IT9A 5A92A 3BW6A 1RGYA 2H5SA 4MNRA 2XQZA 4NKPA 3NDGA 1Y28A 4C6YA 1CI8A 3ITBA 4Y0UA 4DF6A 2A49A 2V0WA 4OOLA 4L9GA 1MPLA 1DY6A 1YLYA 1LSWA 1OT9A 5EM1A 2Y79A 2X01A 1PW1A 2VKSA 1Z09A 3S4XA 4DKIA 1WA9A 2HDUA 3QNCA 1XFQA 2ZMFA 4E6XA 1IFQA 1LI0A 5J4EA 3BFGA 3R4KA 4OKPA 3UB5P 4X56A 1W5DA 3PBQA 4X53A 2OWJA 3MF0A 5HWWA 1SHVA 3FZCA 3PYPA 2XFTA 1YMXA 3SW1A 5CEBA 2R9WA 1DP6A 1WE4A 5HWVA 1H5XA 3ZFZA 4JF4A 2XSSA 2PBYA 4WEJA 1W8QA 5J8XA 4OQHA 4GDNA 5KIZA 3DWZA 3FKVA 1P9RA 2KLIA 1H3QA 5IS1A 4I3JA 2PHYA 1OJGA 3BRMA 4EU0A 2ZQ7A 4ZJ2A 1L0DA 1SKOA 3WS1A 3MR0A 1FCMA 2ZL1A 3UB6A 4XUXA 4I5SA 2QZ6A 1LL8A 2CMNA 2KDKA 5AQ9A 3VP4A 4LPZA 4IJGA 4YOFA 3WS4A 3OC2A 4NXEA 1Y4OA 3HCYA 4LRZE 1SDNA 4HH3A 4B88A 3T4JA 3LIBA 4ETZA 4X6TA 2B18A 5GHXA 3V67A 1JWPA 4Z1WA 3LIFA 2Y8HA 3KSHA 1YSQA 5CTMA 1BLPA
chains in the Genus database with same CATH topology
2W1TB 3GDIA 1N9LA 3E98A 3F1OB 2OWHA 2W3HA 1N9OA 4JGQA 3EEAA 4I3AA 4ME4A 1V9YA 4BWIA 5MC7A 2OAQ1 1GSWA 1OJ5A 2NUTC 4GS9B 2V1AA 2PD8A 3LUQA 2L1MA 3B47A 4YNRA 3TRCA 3K2NA 3PXPA 5EFWA 1XJ2A 2A2LA 2ZBBA 4L9EA 3DBAA 5HDDA 3LIEA 4Q0IA 2O9AA 4Y2FA 3NOUC 4P6ZS 4XT2A 3H7WB 3F1NB 3FC7A 4HP9A 3LR0A 3A0VA 1F5MA 1VB6A 3T4KA 2GX5A 5KSHA 4MMNA 3RTYA 2LB9A 1G28A 2P04A 3LI9A 3RH8B 4F3LA 1DRMA 4PHTA 1UWPX 3KYQA 3ZQ5A 5G4ZA 2JKTM 4BJPA 3ICYA 2JKRI 1H8MA 3U2AA 4R3AA 2PYRA 4R6LA 5HZHA 1LT0A 1P9WA 1TS8A 4EXOA 4KUOA 1OTBA 5HWTA 2H28A 1V9ZA 2HF6A 4WELA 4KQDA 1IOUA 2OAP1 2M7UA 3EGXC 4FOFA 4II7A 3MFXA 4CLCA 2L0WA 2HJEA 5HSQA 2KX6A 5TBMB 1GSXA 3EWKA 4E04A 1MC0A 2QWSA 5G4YA 5C5KA 2XRNA 3IBJA 2VJWA 1OTEA 4UQIM 4EESA 4DMZA 3C38A 2I9VA 2EWWA 3PHYA 3KYZA 4PAUA 3LR5A 3VE4A 5HD3A 4PKYA 4WUJA 3FPVA 2XA7S 4JGRA 3NOPC 2A24A 2GNXA 3T4LA 2VV7A 2BASA 3CI6A 4CLCC 4BBVA 3NOTC 3BQ8A 3OOVA 3UB9A 2OOLA 3O5YA 4XT2B 2ZMVA 3MXQA 3CITA 5HD5A 1S4SA 2M7VA 1T19A 1S67L 4WLAA 3OBFA 4PKYG 4ETXA 4GJ4A 3G6OA 4FSFA 4DN0A 4HHDA 1YAXA 3D72A 1F9IA 2O9CA 2Z6DA 4HJ3A 2PYPA 4AFIA 4OOMA 3LICA 4F3LB 2P7JA 3K3DA 4EETB 2QJ5A 4I39A 2HV1A 3EGDC 3VV4A 2PT7A 1TF1A 3B42A 3T50A 2D02A 3BWLA 5DKLA 1OT6A 4EQ1A 2KOIA 3FG8A 3TE8A 4B9OA 3LIAA 4NXBA 4QPRA 1OTDA 3D3OA 4CLCB 4CLCD 4DJ2A 3IS2A 1P97A 2K7SA 2W3DA 3S7NA 1OTAA 3TW8A 3E4OA 1ODVA 2PR6A 1MKMA 4EUVA 3H9WA 4HNBA 4JGPA 1NLYA 3LR4A 4RQ9A 2EWVA 2V9AA 1S66L 4EERA 2VLGA 1T1AA 3MMHA 3LIDA 4CQHA 4GHIA 5F69A 3UMDA 3A0RA 5HL6A 2A24B 3BJNA 4GLQA 1F98A 1YSPA 2GJ3A 3HJKA 4KQOA 4MN6A 3CLOA 5TJJA 2HGVA 4GW9A 4G3KA 3VOLA 4G3WA 4BMWA 4HP4A 3E4QA 1P0ZA 3UB7A 5A8BA 3K3CA 4EEUA 4Q0HA 2K31A 3KSIA 2W3EA 2B02A 3OLOA 3UMEA 2VV8A 4O0PA 3MQQA 5CX7A 3C8CA 2VEAA 3P01A 3R7WA 4IUHA 1T18A 5DFYA 5I5LA 4HI4A 1LSXA 3IBRA 5F5YA 2FH5A 3FPWA 1MZUA 2VZWA 2WKRA 3LYXA 3F1PA 2WKQA 2VGLM 3TJZC 1BYWA 4MDZA 4DJ3A 3PBSA 1JNUA 1VHMA 2O0YA 1TS0A 3MQ0A 4HIAA 2VX8A 5FL3A 3S7PA 1DP8A 2YKHA 3IS2B 4UQIS 3T4TA 2J80A 3KSGA 1G6OA 3PBNA 1NWZA 2W27A 2INWA 3UE6A 5DF9A 2QYBA 2JKTI 4HH2A 4R70A 5DJUA 5HDSA 1W63M 1XJ4A 3EQUA 4H6JA 3B33A 4UEYA 4LLOB 5LBRA 1XJ3A 3W2ZA 3CUEA 5F68A 2W3GA 1D7EA 2PDRA 3S7QA 4GHIB 2ZOIA 2PD7A 1XFNA 4EW7A 4MCWA 1DP9A 1S4RA 2YKFA 3CWFA 1T1CA 1LSVA 1X0OA 3H82A 2O99A 3BY9A 3T4SA 3MQOA 2FZ0A 4LRXC 4HOIA 2VA0A 2VV6A 4HQAA 4BBTA 3BQAA 3CUEC 4MN5A 3EQVA 3KSFA 4IHQA 2MJ6A 4JGOA 3PBTA 3RFBA 5J7EA 4O01A 5AVFA 2PR5A 1TS7A 2JN7A 2QKPA 3VE3A 3BY8A 4ARZA 5AVEA 5AJGA 3R7WB 3BW6A 3LFVA 4L9FA 5DFXA 1STZA 4NKPA 3F1PB 1Y28A 1S1YA 2IA2A 3KX0X 5HDCA 3E0YA 3ZYTA 3CAXA 2J3WA 1T1BA 2V0WA 3C2WA 2QJ7A 4OOLA 3EOIA 4L9GA 3JVVA 3P7NA 2O9BA 4L0LA 4Q0JA 1LSWA 1OT9A 2J3TD 2NUPC 4H6JB 1GSVA 2Y79A 5DKKA 2VKSA 1NRJA 4O8GA 3S7OA 1D06A 5J3WA 1WA9A 3JVUA 1XFQA 2JKRM 2W0NA 2W3FA 2ZMFA 4G3VA 1IFQA 5J4EA 4CLCE 3R4KA 4P6ZM 4WN5A 4B93A 2V1BA 3PBQA 3H82B 3HJIA 2OWJA 4KUKA 4Y3IA 2G7UA 3MF0A 5HWWA 3PYPA 1W63Q 4EEPA 1OPXA 3SW1A 3T4QA 2D01A 1DP6A 1EW0A 4IUKA 1NLZA 4Y5FA 5HWVA 1TS6A 4ARZB 2XSSA 3PBOA 3GECA 4M4XA 2VGLS 2L4RA 4I38A 4WEJA 2W1TA 4NXFA 5TBMA 3T4OA 2WKPA 5KIZA 4R38A 3F1OA 1TD5A 1P9RA 2KLIA 1H3QA 1KOUA 5IS1A 2P08A 3UE3A 4I3JA 2QHKA 2DMWA 2PHYA 1OJGA 4EU0A 3OCNA 2JHEA 4HJ6A 3ULFA 4GS9A 2HJ9C 3MR0A 3PBRA 5L8MA 4LRYC 2GZAA 2Z6CA 3KO6A 4HY8A 3E4PA 3UB6A 2XA7M 2W1RA 3LR3A 3NHQA 3OCLA 4ZRRA 4I5SA 3UB8A 1N9NA 3H7WA 4GCZA 3F1NA 1LL8A 3LI8A 2EA9A 5DJTA 2CMNA 1XJ6A 2KDKA 2LB5A 4YWZA 2R78A 3MJQA 3A0SA 4LPZA 2J3TC 4IJGA 3PR6A 2XROA 4WEKA 1UWNX 4MN7A 3EEHA 5F6AA 4NXGA 4YOFA 1UGUA 4NEED 5HPIA 4BBUA 3OC2A 4NXEA 1YKDA 3HCYA 2M1CA 2V0UA 4LRZE 1OTIA 4HH3A 5IT5A 3NJAA 3T4JA 3LIBA 4K08A 5K5BA 4WF0A 4ETZA 1ZHHB 2B18A 1ZTUA 2ZOHA 4WL9A 5HPFA 3V67A 4HJ4A 4Z1WA 1S1ZA 3LIFA 4I3IA 2Y8HA 2K2NA 3KSHA 1YSQA 3C30A 5IU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VHM A;  2O0Y A;  2W1T B;  2M7V A;  3MQ0 A;  3S7P A;  3E98 A;  4Y3I A;  3OBF A;  4ETX A;  2G7U A;  2W3H A;  3EEA A;  3G6O A;  3MF0 A;  4ME4 A;  3KSG A;  4DN0 A;  4BWI A;  2QYB A;  2O9C A;  4R70 A;  4YNR A;  3TRC A;  3K2N A;  4IUK A;  5LBR A;  3W2Z A;  3VV4 A;  1TF1 A;  2W3G A;  4Y5F A;  3DBA A;  3S7Q A;  2XSS A;  4Q0I A;  2O9A A;  4MCW A;  4Y2F A;  3NOU C;  2KOI A;  1F5M A;  2W1T A;  4QPR A;  3D3O A;  2O99 A;  1TD5 A;  2GX5 A;  2KLI A;  4MMN A;  2LB9 A;  2W3D A;  3S7N A;  4LRX C;  4EU0 A;  1MKM A;  4EUV A;  3KSF A;  3RFB A;  3ZQ5 A;  4O01 A;  5L8M A;  4RQ9 A;  4LRY C;  3KO6 A;  3MMH A;  4CQH A;  5AJG A;  4R6L A;  5HL6 A;  3LFV A;  2W1R A;  3NHQ A;  4ZRR A;  3BJN A;  4GLQ A;  1YSP A;  5DFX A;  2M7U A;  1STZ A;  2LB5 A;  4FOF A;  5TJJ A;  4IJG A;  2IA2 A;  2HGV A;  3E0Y A;  5HSQ A;  4E04 A;  1MC0 A;  4GW9 A;  2XRO A;  4G3K A;  5C5K A;  2XRN A;  4G3W A;  4MN7 A;  3IBJ A;  2VJW A;  4YOF A;  4DMZ A;  3C2W A;  5HPI A;  1YKD A;  3HCY A;  4Q0H A;  2K31 A;  4LRZ E;  3KSI A;  4PAU A;  2W3E A;  2O9B A;  4Q0J A;  4O0P A;  2Y79 A;  2VEA A;  5K5B A;  2VKS A;  4O8G A;  3NOP C;  4IUH A;  5DFY A;  3S7O A;  4ETZ A;  2B18 A;  1ZTU A;  5I5L A;  2W3F A;  2ZMF A;  3CI6 A;  5HPF A;  3IBR A;  4G3V A;  3NOT C;  3OOV A;  2VZW A;  4Z1W A;  2OOL A;  3R4K A;  3O5Y A;  2Y8H A;  4MDZ A;  2K2N A;  3KSH A;  1YSQ A;  3CIT A; 
#chains in the Genus database with same CATH topology
 1FOF A;  1N9L A;  4F94 A;  3HLF A;  3RXX A;  5CHJ A;  1GHI A;  1ONG A;  4BWI A;  5MC7 A;  1XKZ A;  2NUT C;  2V1A A;  2PD8 A;  3C4P A;  4LCM A;  3TRC A;  4E3O A;  2A2L A;  1YLT A;  5HDD A;  4Q0I A;  4Y2F A;  3CZD A;  4XT2 A;  3H7W B;  3A3E A;  3A0V A;  4S2P A;  4C3Q A;  1VB6 A;  3IHA A;  5EEC A;  5A91 A;  5GHZ A;  4KZ7 A;  3IF6 C;  1VEU A;  2B5R A;  2FFF B;  1VQQ A;  4F3L A;  4EBP A;  3ZQ5 A;  5G4Z A;  1I2W A;  4BJP A;  4IBX A;  3U2A A;  1MKI A;  3CPT A;  4KUO A;  4BL2 A;  4S2N A;  2Z2M B;  4KQD A;  4FOF A;  3QP1 A;  3MFX A;  3D4F A;  1GSX A;  1C3B A;  1OTE A;  1XA7 A;  4OVD A;  4R4R A;  2ZQD A;  1TDG A;  4Y13 A;  1HLU P;  3JYI A;  4OPY A;  3NI9 A;  4IVK A;  4LCL A;  3FPV A;  2EFX A;  3UE0 A;  3T4L A;  2VV7 A;  3CI6 A;  3BQ8 A;  1NJ4 A;  1ACF A;  2VK3 A;  2OOL A;  3OPL A;  1K0K A;  2Y91 A;  3NUL A;  1S4S A;  4GKU A;  3G32 A;  3Q07 A;  1BLC A;  4DN0 A;  2JBF A;  4PM6 A;  3D72 A;  2WGW B;  3DTK A;  2O9C A;  3IXD A;  2PYP A;  2Y2Q A;  4AFI A;  4IVI A;  1XGJ A;  3K3D A;  4EET B;  4I39 A;  1NZU A;  2HV1 A;  2Y2I A;  5AQA A;  5FSR A;  4E3J A;  3T50 A;  4HES A;  3BFE A;  3Q7V A;  3TE8 A;  3BM6 A;  4B9O A;  1K54 A;  1N4O A;  5F1G A;  3N8R A;  4CLC B;  1P97 A;  2K7S A;  1SKO B;  2I72 A;  3P09 A;  1ODV A;  4QB8 A;  1Y54 A;  5E2F A;  5EVE A;  1L0F A;  4HNB A;  3LR4 A;  4RQ9 A;  1DJB A;  4O7D A;  4EER A;  4S2O A;  2WZZ A;  3AGD A;  3LID A;  3MXR A;  4CQH A;  5U47 A;  5HL6 A;  3MKF A;  2WAD A;  3T1S A;  2EX2 A;  4MN6 A;  4R23 A;  1A0K A;  4GW9 A;  3SS3 A;  4X55 A;  4C75 A;  4BMW A;  4FD8 A;  1QMF A;  4MBK A;  3UB7 A;  3OPP A;  5A8B A;  3V3R A;  2XDM A;  3ZDJ A;  3PTE A;  4JXW A;  3UO9 A;  5FA7 A;  3ZHH A;  4ZJ3 A;  1IKI A;  4E3L A;  2JE5 A;  4IUH A;  1NXY A;  1IYQ A;  1JWV A;  2FH5 A;  3FPW A;  2VZW A;  1PNE A;  3WWX A;  5DTS A;  3LYX A;  3TJZ C;  2WKQ A;  4MDZ A;  4DJ3 A;  5E2H A;  3PBS A;  4N9L A;  1VHM A;  3MQ0 A;  2VX8 A;  3IWQ A;  2YKH A;  1PW8 A;  2J80 A;  1G6O A;  2INW A;  5AQ7 A;  1YT4 A;  4R70 A;  4N1H A;  5DJU A;  3EQU A;  5HAP A;  4UEY A;  5LBR A;  3CUE A;  1I2S A;  1D7E A;  3NCK A;  1IEL A;  2G2U A;  4M3K A;  4RX3 A;  4WMC A;  1FR6 A;  4MCW A;  5FDH A;  3ZVW A;  4EUZ A;  2V2F F;  3MZF A;  1RP5 A;  4P85 A;  1CI9 A;  2FZ0 A;  3ZG8 B;  4HOI A;  2VA0 A;  2VV6 A;  5TFQ A;  3BQA A;  4XXR A;  5KMW A;  2PU4 A;  1PI4 A;  2QKP A;  3VE3 A;  3BY8 A;  2DCF A;  1RGZ A;  5AJG A;  3GRJ A;  2EXB A;  4BD0 A;  3V3S A;  1S1Y A;  3KX0 X;  5HDC A;  3E0Y A;  3VMA A;  3CAX A;  1O07 A;  3HUO A;  5CGX A;  3C2W A;  2J9P A;  2WK0 A;  1OME A;  1CEG A;  3MXS A;  2O9B A;  2NUP C;  5DKK A;  3C7V A;  1NRJ A;  4ZDX A;  4O8G A;  4FCF A;  4QJG A;  4IBR A;  2W3F A;  2W0N A;  3BFC A;  3MSH A;  1NY0 A;  3QP4 A;  3HVF A;  3UDI A;  3IX3 A;  4B93 A;  4QWO A;  2V1B A;  3H82 B;  3N6I A;  1OPX A;  3ZNT A;  3IX8 A;  1KE3 A;  3T4Q A;  4S2K A;  3TOI A;  2WZX A;  3BEB A;  4IUK A;  3O86 A;  4HEF A;  1NLZ A;  4Y5F A;  3DTE A;  4DE2 A;  2VGL S;  1Z6F A;  5FEG A;  2L4R A;  3NIA A;  3G2Z A;  3DAV A;  3A3D A;  3HUN A;  3D9Y A;  5E2E A;  5GLD A;  3A3F A;  4S2L A;  2WKP A;  5CGS A;  4R38 A;  1WYB A;  3QNB A;  5CED A;  2P74 A;  2DMW A;  3OCN A;  2JHE A;  1XX2 A;  3HLC A;  3ULF A;  5GL9 A;  3N4I A;  3HLE A;  1W8Y A;  3PBR A;  2Z2L B;  5L8M A;  5FAT A;  1ZG4 A;  4HY8 A;  4RX2 A;  4EQI A;  2JC7 A;  1ES3 A;  2V8C A;  3LR3 A;  3NHQ A;  3UB8 A;  3H7W A;  1PZO A;  2R78 A;  3MJQ A;  2J3T C;  1M6K A;  2WAF A;  4KZ9 A;  1MWS A;  2XRO A;  4JF6 A;  1GA9 A;  1UWN X;  4N9K A;  3EEH A;  4OH0 A;  4GN2 A;  5DF8 A;  1XPB A;  1YKD A;  3M6H A;  4QY5 A;  3GQZ A;  4KZB A;  1PRQ A;  1ZHH B;  2ZOH A;  4KZ5 A;  4OP5 A;  1S1Z A;  1NRF A;  2RCX A;  2K2N A;  3C30 A;  5IU1 A;  3CHW P;  4KZ8 A;  2Y2P A;  2Q9N A;  1N9O A;  1XGI A;  4JGQ A;  4I3A A;  2PRF A;  1GSW A;  4HBU A;  3LUQ A;  3GSG A;  2Y2J A;  3PXP A;  3G2Y A;  1FCO A;  1XJ2 A;  3Q81 A;  5AQB A;  3S22 A;  1K6S A;  3DBA A;  3FWL A;  3LIE A;  2ZC6 B;  5FAO A;  2XK1 A;  3F1N B;  3C4O A;  5FQM A;  4D2O A;  1G5U A;  2GX5 A;  5F83 A;  3WRZ A;  3L7H A;  5DTT A;  2WUQ A;  2WGW A;  1FSY A;  1F2K A;  2EFU A;  3T1R A;  2JKT M;  4OOY A;  3SH9 A;  3VP3 A;  5HFO A;  4EBL A;  1KGE A;  2JKR I;  1SCW A;  2PYR A;  4R6L A;  5HZH A;  1LT0 A;  4QHC A;  2ZJ9 A;  2HF6 A;  1V9Z A;  2OAP 1;  2M7U A;  4II7 A;  4CLC A;  5HSQ A;  2KX6 A;  1E3U A;  2V8F A;  2VJW A;  1K4E A;  4UQI M;  1CQA A;  4DMZ A;  2I9V A;  3FKW A;  3WRT A;  3IF5 A;  5FQI A;  3KYZ A;  1YQS A;  4UA9 A;  3IF6 B;  4PKY A;  1FQG A;  2GNX A;  1HZO A;  4GOG A;  5HW3 A;  4BBV A;  3NOT C;  3A3J A;  3O5Y A;  3MXQ A;  3CIT A;  2ACG A;  5E43 A;  2XD1 A;  3OBF A;  4ETX A;  2ZM0 A;  4BL3 A;  3G6O A;  1XA1 A;  1F9I A;  2Z6D A;  4OOM A;  2P7J A;  2QJ5 A;  2XGN A;  1K56 A;  3VV4 A;  1FIK A;  1Q2Q A;  2KOI A;  4KG2 A;  1TVF A;  3VFF A;  1VM1 A;  3SS5 A;  2Y59 A;  3I7J A;  3ZCZ A;  4Y0T A;  1ZG6 A;  5EPH A;  2PR6 A;  2OSU A;  4OLD A;  3QP6 A;  4X1L A;  4PM5 A;  4PM8 A;  3T1Q B;  2VLG A;  3UN7 A;  2HP5 A;  2HZ5 A;  3SH8 A;  2RL3 A;  2WKH A;  3DTM A;  4RA7 A;  3IWO A;  4X69 A;  2GJ3 A;  5TJJ A;  3SOI A;  1YMS A;  2DRW A;  1QME A;  4HP4 A;  3C7U A;  3K3C A;  4EEU A;  4LFU A;  4Q0H A;  4EWF A;  3IX4 A;  4ESP A;  3OLO A;  3UME A;  5HAI A;  2VV8 A;  4LV2 A;  4O0P A;  3MQQ A;  4OLG A;  2XD5 A;  3P01 A;  1T18 A;  3S1Y A;  5EUA A;  5EM0 A;  2QPN A;  5I5L A;  4E6W A;  1LSX A;  3ZGA B;  1J3W A;  4N1X A;  3LCE A;  4P0M A;  4PM7 A;  1JNU A;  3N8S A;  2H0Y A;  2O0Y A;  3MBZ A;  2JKG A;  3IS2 B;  1N9B A;  5DTK A;  1NWZ A;  1SZV A;  1K55 C;  2W27 A;  5DF9 A;  5EVI C;  3O87 A;  5HDS A;  1XJ4 A;  3B33 A;  4LLO B;  3QP5 A;  5GLA A;  5F68 A;  1YLP A;  1GHP A;  5FEF A;  2PDR A;  1D1J A;  4GHI B;  2ZOI A;  2PD7 A;  4EW7 A;  3NC8 A;  2BG1 A;  4WZ5 C;  2P9V B;  4KZ3 A;  4R0Q A;  1T1C A;  1ESI A;  1LSV A;  5GLC A;  3H82 A;  3MZD A;  4DXB A;  2ZC7 A;  4OQG A;  1BUE A;  2Y2O A;  3HUM A;  2IWD A;  4KG6 A;  2JKF A;  4MN5 A;  4IHQ A;  3RFB A;  2HDR A;  5J7E A;  4O01 A;  5AVF A;  2PR5 A;  1TS7 A;  5FI7 A;  3UNW A;  2Y55 A;  5FAQ A;  3E2L A;  3G30 A;  5EVL A;  5FQJ A;  4KZA A;  1U60 A;  5DFX A;  4Y0O A;  1STZ A;  3A3I A;  3F1P B;  1LL9 A;  2IA2 A;  2OV5 A;  1IYS A;  2J3W A;  4ZTK A;  4KZ4 A;  3UDX A;  3IQA A;  1T1B A;  2ZLY A;  1K57 C;  1KVL A;  4Y17 A;  3IWI A;  3JVV A;  2CC1 A;  1SDE A;  4L0L A;  4Q0J A;  4H6J B;  3U4L P;  3T12 B;  1DJA A;  1PWG A;  4YFM A;  2ZQ9 A;  3S7O A;  3SZT A;  4K0W A;  4WMC D;  1MWR A;  3PAG A;  4JF5 A;  2ZQC A;  4P6Z M;  3UDF A;  4OQ0 A;  2J8Y A;  4E3N A;  4OON A;  2EX6 A;  2G7U A;  4CPK A;  1E25 A;  5CHU A;  1K4F A;  1W63 Q;  2HDQ A;  5L2F A;  4Y7P A;  2D01 A;  4DRT A;  1PZP A;  2HP6 A;  4LGW A;  3RJU A;  1TS6 A;  4ARZ B;  1PYY A;  4OP8 A;  4M4X A;  1AXB A;  4U0X A;  5HAR A;  4NXF A;  1PI5 A;  5G18 A;  3G4P A;  3MS6 A;  2P08 A;  2Y4A A;  4DDY A;  4HJ6 A;  4S2I A;  1W79 A;  4WZ4 A;  3ZG0 A;  2HJ9 C;  3DTI A;  5HL1 A;  4ZAM A;  2HPB A;  3CJM A;  2IWC A;  3KO6 A;  1ERM A;  2XA7 M;  4UA6 A;  4JXG A;  2W1R A;  3OCL A;  1N9N A;  2A3U A;  5TR7 A;  3F1N A;  3LI8 A;  2LB5 A;  3NY4 A;  4NG2 A;  4PMA A;  4YWZ A;  4LV3 A;  3A0S A;  2DNS A;  4WEK A;  4MN7 A;  5F6A A;  2VGJ A;  1UGU A;  3E2K A;  5HPI A;  5CXW A;  1TEM A;  5L07 A;  4GDB A;  1FR1 A;  3P98 A;  1ONH A;  1L0G A;  5K5B A;  3HLG A;  4WF0 A;  3LY3 A;  3VP1 A;  5FQ9 A;  3ZG7 B;  2QMI A;  2Y2M A;  2W1T B;  3GDI A;  3F1O B;  2W3H A;  3EEA A;  1KGF A;  4ME4 A;  1V9Y A;  2OLV A;  3OPR A;  1OJ5 A;  5KZH A;  3IF6 A;  2XLN A;  2Y2H A;  4GS9 B;  3QP8 A;  2L1M A;  3B47 A;  5EE8 A;  5EFW A;  2ZBB A;  2OLU A;  2BLS A;  3NDE A;  1GA0 A;  1YLW A;  1IYO A;  2O9A A;  3N8L A;  4HP9 A;  4GNU A;  3LR0 A;  1ZC2 A;  1TDL A;  1JWZ A;  3T4K A;  4MMN A;  2EX9 A;  3V50 A;  1VET B;  3BFD A;  3N7W A;  3VFH A;  1GHM A;  3RH8 B;  1DRM A;  4PHT A;  1UWP X;  4JBF A;  4RYE A;  2PAV P;  3HL9 A;  1Q2P A;  5E2G A;  3BYD A;  3WS0 A;  1H8M A;  1ES2 A;  4EXO A;  1EWZ A;  1K55 A;  1P9W A;  1TS8 A;  5HWT A;  2H28 A;  5EVI A;  1J9M A;  3BEC A;  1KVM A;  3W8K A;  2HJE A;  1PFL A;  3EWK A;  5TBM B;  5A90 A;  1MC0 A;  2QWS A;  5G4Y A;  2XRN A;  3C38 A;  1AWI A;  3PHY A;  3LEZ A;  4PAU A;  3LR5 A;  3VE4 A;  3HLW A;  5JYO A;  3IXB A;  1HD8 A;  4S2N C;  1K38 A;  4JGR A;  5FQQ A;  5HAQ A;  1G68 A;  4MBF A;  4X25 A;  2C5W B;  4XUZ A;  5HD5 A;  2ZM8 A;  2M7V A;  4WLA A;  4PKY G;  4FSF A;  3PAE A;  5M18 A;  1YAX A;  1LHY A;  2J7V A;  1FCN A;  1BSG A;  4GB7 A;  5M19 A;  3LIC A;  2XFS A;  3GTC A;  2ZD8 A;  3ITA A;  2PT7 A;  1TF1 A;  1SKF A;  4FH2 A;  3VOY A;  2D02 A;  5CHM A;  5IHV A;  1OT6 A;  4HBT A;  3LIA A;  4QU3 A;  4NXB A;  4PM9 A;  4QPR A;  1OTD A;  4DJ2 A;  4CLC D;  2EXA A;  1L0E A;  3IS2 A;  2XEP A;  5FAS A;  2W3D A;  1E3U D;  3S7N A;  1MBL A;  1I5Q A;  1KGG A;  1YLZ A;  3H9W A;  3IH9 A;  4JGP A;  2J9O A;  3KYE A;  1NLY A;  2EWV A;  4EBN A;  4ID4 A;  4DXC A;  3MMH A;  4N92 A;  4GHI A;  1JTG A;  4S2M A;  4MEZ A;  3WS2 A;  3A0R A;  2A24 B;  3IXG A;  1K54 C;  4X1M A;  4GLQ A;  2P9V A;  1ALQ A;  1YSP A;  2XR0 A;  3HJK A;  3ZVT A;  3CLO A;  2HGV A;  1ERO A;  4G3K A;  1DJC A;  3E4Q A;  1P0Z A;  3SS4 A;  3Q7Z A;  4GD6 A;  5FDS A;  2B02 A;  5EOE A;  3GVB A;  5DF7 A;  3BLM A;  3C8C A;  1K56 D;  5DFY A;  3W4O A;  4IED A;  4HI4 A;  3IBR A;  4U0T A;  1MZU A;  4NK3 A;  1M40 A;  2WKR A;  5F82 A;  1FSW A;  3F1P A;  2PU2 A;  4WYY A;  1LLB A;  2PBD P;  5FL3 A;  1XP4 A;  3S7P A;  2H0T A;  1DP8 A;  4UQI S;  4QY6 A;  3MFD A;  4K91 A;  3KSG A;  3UE6 A;  2QYB A;  1W63 M;  1EI5 A;  4H6J A;  2WGI A;  3W2Z A;  1PIO A;  1XJ3 A;  4BQM A;  1O7E A;  2E8I A;  3O3V A;  3S7Q A;  5GLB A;  2XF3 A;  5CGW A;  5EOO A;  1KDS A;  3M6B A;  5EV0 A;  1L3L A;  3CWF A;  1X0O A;  3NBL A;  3UY6 A;  2EX8 A;  3BY9 A;  3T4S A;  3MQO A;  4OPR A;  1CEF A;  4H8R A;  4BBT A;  1IKG A;  3CUE C;  3EQV A;  2V1Z A;  2MJ6 A;  4JGO A;  3PBT A;  3OZH A;  3QP2 A;  2JN7 A;  1G6A A;  2WYX A;  4ARZ A;  4ZBE A;  5EVI B;  5AVE A;  2X71 A;  3R7W B;  4B4Z A;  3AGF A;  3LFV A;  1RCJ A;  4L9F A;  4UA7 A;  2Y2N A;  4JXS A;  1CJF A;  2ZM2 A;  3CG5 A;  3ZYT A;  4A5R A;  3WS5 A;  1KE4 A;  2QJ7 A;  2UWX A;  3EOI A;  5A93 A;  1BLS A;  3P7N A;  1FIL A;  2J3T D;  3LO7 A;  1GSV A;  4FTX A;  2GDN A;  3RXW A;  1D06 A;  5J3W A;  3JVU A;  2JKR M;  4G3V A;  4CLC E;  4JXV A;  4WN5 A;  4DE0 A;  5FI6 A;  3VOZ A;  2X02 A;  3HJI A;  4KUK A;  4Y3I A;  3BLS A;  4OPQ A;  1GCE A;  4EEP A;  4UHU A;  1NZO A;  1EW0 A;  3HLB A;  4ZJ1 A;  1IYP A;  3LEQ A;  3G34 A;  3HBR A;  3PBO A;  3GEC A;  4R4S A;  4Q8I A;  3NEC A;  4I38 A;  3CMZ A;  1H8Z A;  3DWK A;  2W1T A;  1KDW A;  3T4O A;  3TG9 A;  3UE1 A;  3F1O A;  1TD5 A;  1KOU A;  3UE3 A;  2QHK A;  3HRE A;  4B4X A;  1ESU A;  3IHB A;  4KQQ A;  4GS9 A;  1BLH A;  3FYZ A;  1S0W A;  5HX9 A;  3DW0 A;  4LRY C;  5CEC A;  2GZA A;  2Z6C A;  1MY8 A;  3E4P A;  5CRF A;  4ZRR A;  2ZQ8 A;  4GCZ A;  2EA9 A;  5DJT A;  1XJ6 A;  4E3I A;  4DE1 A;  1MWT A;  2H10 A;  3FV7 A;  3PR6 A;  3VSL A;  1VET A;  1H0M A;  4NXG A;  4R3B A;  4NEE D;  4BBU A;  5JYP A;  1L2S A;  1PWD A;  2M1C A;  2V0U A;  3M2J A;  1OTI A;  5IT5 A;  3NJA A;  1ZKJ A;  3SH7 A;  4K08 A;  2Y2G A;  4LV0 A;  2AVX A;  1ZTU A;  4WL9 A;  5HPF A;  2ZC4 B;  4HJ4 A;  5CER A;  5I94 A;  4I3I A;  4CJN A;  5TBM A;  3IH8 A;  4JLF A;  1LL5 A;  3E98 A;  2OWH A;  2WKE A;  1YM1 A;  4JPM A;  2OAQ 1;  3IXH A;  2Q0O A;  3MZE A;  4E3K A;  1K25 A;  4YNR A;  3K2N A;  3C5A A;  1MXO A;  3Q82 A;  4L9E A;  4GZB A;  4R3J A;  3ZG9 B;  2ZL1 B;  3NOU C;  4P6Z S;  1HTZ A;  3FC7 A;  5BOH A;  1F5M A;  3AGE A;  3UPN A;  5KSH A;  3RTY A;  2LB9 A;  4BD1 A;  1G28 A;  2P04 A;  2VGK A;  3LI9 A;  3HLD A;  2WAE A;  3W4P A;  3ISG A;  3KYQ A;  4YIN A;  4KG5 A;  5FAP A;  3ICY A;  2R9X A;  2BTF P;  4R3A A;  3L9K A;  3VP2 A;  2Y2K A;  4OPZ A;  4U3T A;  1OTB A;  2V20 A;  4PPR A;  4WEL A;  3GV9 A;  1IOU A;  3MKE A;  3ZG5 A;  3ZNY A;  3EGX C;  2L0W A;  4KZ6 A;  4K0X A;  4E04 A;  5C5K A;  2ZMA A;  3IBJ A;  5L10 A;  4EES A;  4Y15 A;  1ERQ A;  2EWW A;  3W4Q A;  5CTN A;  5GHY A;  2E8J A;  4LV1 A;  2FFY A;  5HD3 A;  4WUJ A;  5L09 A;  1BUL A;  2XA7 S;  3NOP C;  2A24 A;  4FH4 A;  2BAS A;  4CLC C;  3OOV A;  4UAA A;  5D3O A;  3UB9 A;  4XT2 B;  2ZMV A;  5TGF A;  3O88 A;  1YPR A;  5F1F A;  4EV4 A;  4FUW A;  1T19 A;  1PWC A;  1S67 L;  1BT5 A;  1NYY A;  4D60 A;  4GJ4 A;  5FQK A;  3LGO A;  4HHD A;  1NYM A;  4MBH A;  1VEU B;  4HJ3 A;  1IEM A;  1XXM A;  2ZC3 B;  4F3L B;  4X68 A;  3EGD C;  3GMW A;  3V5M A;  3B42 A;  1KE0 A;  1JVJ A;  3B3X A;  2UV0 E;  1S6R A;  3BWL A;  5DKL A;  3CPT B;  4EQ1 A;  3FG8 A;  5EVI D;  3D3O A;  4JKT A;  4BLM A;  4WM9 A;  1BTL A;  1OTA A;  3TW8 A;  3E4O A;  1ES4 A;  1MKM A;  4EUV A;  5M1A A;  3QHY A;  3G31 A;  3JPU A;  4BEN A;  1K6R A;  4P87 A;  2V9A A;  1S66 L;  3UPO A;  1T1A A;  4P6B A;  2ZQA A;  5F69 A;  3UMD A;  2G2W A;  5KSC A;  1H8Y A;  1ES5 A;  3BJN A;  1F98 A;  4LEN A;  2Y2L A;  4KQO A;  1BZA A;  1CF0 A;  3VOL A;  4G3W A;  4KEN B;  2JCH A;  2K31 A;  3LY4 A;  3TSG A;  3KSI A;  2W3E A;  1WYC A;  3V39 A;  4S2J A;  2WKI A;  5CX7 A;  4E3M A;  2VEA A;  3R7W A;  1HVB A;  1LI9 A;  3G35 A;  4GD8 A;  5F5Y A;  2WGV A;  1MWU A;  3Q7V B;  4DE3 A;  3UPP A;  2ZC5 B;  1JTD A;  2VGL M;  1BYW A;  4QD4 A;  1E4D A;  5DVA A;  4R1G A;  3M2K A;  1TS0 A;  2HP9 A;  4HIA A;  4WZ5 A;  5FI2 A;  3T4T A;  3BFF A;  3T1X A;  4RVA A;  3PBN A;  3Q1F A;  4WBG A;  2HDS A;  2JKT I;  4HH2 A;  1W7F A;  4MLL A;  3VSK A;  2W3G A;  4NET A;  2IWB A;  1XFN A;  1DP9 A;  1S4R A;  4KQR A;  2Q9M A;  4Z9Q A;  2YKF A;  1YLJ A;  2B95 A;  2O99 A;  2C6W B;  4LRX C;  3VP0 A;  4HQA A;  2XH9 A;  3KSF A;  4OQI A;  4DDS A;  1CK3 A;  1K57 A;  3OPH A;  3GR2 A;  3IT9 A;  5A92 A;  3BW6 A;  1RGY A;  2H5S A;  4MNR A;  2XQZ A;  4NKP A;  3NDG A;  1Y28 A;  4C6Y A;  1CI8 A;  3ITB A;  4Y0U A;  4DF6 A;  2A49 A;  2V0W A;  4OOL A;  4L9G A;  1MPL A;  1DY6 A;  1YLY A;  1LSW A;  1OT9 A;  5EM1 A;  2Y79 A;  2X01 A;  1PW1 A;  2VKS A;  1Z09 A;  3S4X A;  4DKI A;  1WA9 A;  2HDU A;  3QNC A;  1XFQ A;  2ZMF A;  4E6X A;  1IFQ A;  1LI0 A;  5J4E A;  3BFG A;  3R4K A;  4OKP A;  3UB5 P;  4X56 A;  1W5D A;  3PBQ A;  4X53 A;  2OWJ A;  3MF0 A;  5HWW A;  1SHV A;  3FZC A;  3PYP A;  2XFT A;  1YMX A;  3SW1 A;  5CEB A;  2R9W A;  1DP6 A;  1WE4 A;  5HWV A;  1H5X A;  3ZFZ A;  4JF4 A;  2XSS A;  2PBY A;  4WEJ A;  1W8Q A;  5J8X A;  4OQH A;  4GDN A;  5KIZ A;  3DWZ A;  3FKV A;  1P9R A;  2KLI A;  1H3Q A;  5IS1 A;  4I3J A;  2PHY A;  1OJG A;  3BRM A;  4EU0 A;  2ZQ7 A;  4ZJ2 A;  1L0D A;  1SKO A;  3WS1 A;  3MR0 A;  1FCM A;  2ZL1 A;  3UB6 A;  4XUX A;  4I5S A;  2QZ6 A;  1LL8 A;  2CMN A;  2KDK A;  5AQ9 A;  3VP4 A;  4LPZ A;  4IJG A;  4YOF A;  3WS4 A;  3OC2 A;  4NXE A;  1Y4O A;  3HCY A;  4LRZ E;  1SDN A;  4HH3 A;  4B88 A;  3T4J A;  3LIB A;  4ETZ A;  4X6T A;  2B18 A;  5GHX A;  3V67 A;  1JWP A;  4Z1W A;  3LIF A;  2Y8H A;  3KSH A;  1YSQ A;  5CTM A;  1BLP A; 
#chains in the Genus database with same CATH homology
 2W1T B;  3GDI A;  1N9L A;  3E98 A;  3F1O B;  2OWH A;  2W3H A;  1N9O A;  4JGQ A;  3EEA A;  4I3A A;  4ME4 A;  1V9Y A;  4BWI A;  5MC7 A;  2OAQ 1;  1GSW A;  1OJ5 A;  2NUT C;  4GS9 B;  2V1A A;  2PD8 A;  3LUQ A;  2L1M A;  3B47 A;  4YNR A;  3TRC A;  3K2N A;  3PXP A;  5EFW A;  1XJ2 A;  2A2L A;  2ZBB A;  4L9E A;  3DBA A;  5HDD A;  3LIE A;  4Q0I A;  2O9A A;  4Y2F A;  3NOU C;  4P6Z S;  4XT2 A;  3H7W B;  3F1N B;  3FC7 A;  4HP9 A;  3LR0 A;  3A0V A;  1F5M A;  1VB6 A;  3T4K A;  2GX5 A;  5KSH A;  4MMN A;  3RTY A;  2LB9 A;  1G28 A;  2P04 A;  3LI9 A;  3RH8 B;  4F3L A;  1DRM A;  4PHT A;  1UWP X;  3KYQ A;  3ZQ5 A;  5G4Z A;  2JKT M;  4BJP A;  3ICY A;  2JKR I;  1H8M A;  3U2A A;  4R3A A;  2PYR A;  4R6L A;  5HZH A;  1LT0 A;  1P9W A;  1TS8 A;  4EXO A;  4KUO A;  1OTB A;  5HWT A;  2H28 A;  1V9Z A;  2HF6 A;  4WEL A;  4KQD A;  1IOU A;  2OAP 1;  2M7U A;  3EGX C;  4FOF A;  4II7 A;  3MFX A;  4CLC A;  2L0W A;  2HJE A;  5HSQ A;  2KX6 A;  5TBM B;  1GSX A;  3EWK A;  4E04 A;  1MC0 A;  2QWS A;  5G4Y A;  5C5K A;  2XRN A;  3IBJ A;  2VJW A;  1OTE A;  4UQI M;  4EES A;  4DMZ A;  3C38 A;  2I9V A;  2EWW A;  3PHY A;  3KYZ A;  4PAU A;  3LR5 A;  3VE4 A;  5HD3 A;  4PKY A;  4WUJ A;  3FPV A;  2XA7 S;  4JGR A;  3NOP C;  2A24 A;  2GNX A;  3T4L A;  2VV7 A;  2BAS A;  3CI6 A;  4CLC C;  4BBV A;  3NOT C;  3BQ8 A;  3OOV A;  3UB9 A;  2OOL A;  3O5Y A;  4XT2 B;  2ZMV A;  3MXQ A;  3CIT A;  5HD5 A;  1S4S A;  2M7V A;  1T19 A;  1S67 L;  4WLA A;  3OBF A;  4PKY G;  4ETX A;  4GJ4 A;  3G6O A;  4FSF A;  4DN0 A;  4HHD A;  1YAX A;  3D72 A;  1F9I A;  2O9C A;  2Z6D A;  4HJ3 A;  2PYP A;  4AFI A;  4OOM A;  3LIC A;  4F3L B;  2P7J A;  3K3D A;  4EET B;  2QJ5 A;  4I39 A;  2HV1 A;  3EGD C;  3VV4 A;  2PT7 A;  1TF1 A;  3B42 A;  3T50 A;  2D02 A;  3BWL A;  5DKL A;  1OT6 A;  4EQ1 A;  2KOI A;  3FG8 A;  3TE8 A;  4B9O A;  3LIA A;  4NXB A;  4QPR A;  1OTD A;  3D3O A;  4CLC B;  4CLC D;  4DJ2 A;  3IS2 A;  1P97 A;  2K7S A;  2W3D A;  3S7N A;  1OTA A;  3TW8 A;  3E4O A;  1ODV A;  2PR6 A;  1MKM A;  4EUV A;  3H9W A;  4HNB A;  4JGP A;  1NLY A;  3LR4 A;  4RQ9 A;  2EWV A;  2V9A A;  1S66 L;  4EER A;  2VLG A;  1T1A A;  3MMH A;  3LID A;  4CQH A;  4GHI A;  5F69 A;  3UMD A;  3A0R A;  5HL6 A;  2A24 B;  3BJN A;  4GLQ A;  1F98 A;  1YSP A;  2GJ3 A;  3HJK A;  4KQO A;  4MN6 A;  3CLO A;  5TJJ A;  2HGV A;  4GW9 A;  4G3K A;  3VOL A;  4G3W A;  4BMW A;  4HP4 A;  3E4Q A;  1P0Z A;  3UB7 A;  5A8B A;  3K3C A;  4EEU A;  4Q0H A;  2K31 A;  3KSI A;  2W3E A;  2B02 A;  3OLO A;  3UME A;  2VV8 A;  4O0P A;  3MQQ A;  5CX7 A;  3C8C A;  2VEA A;  3P01 A;  3R7W A;  4IUH A;  1T18 A;  5DFY A;  5I5L A;  4HI4 A;  1LSX A;  3IBR A;  5F5Y A;  2FH5 A;  3FPW A;  1MZU A;  2VZW A;  2WKR A;  3LYX A;  3F1P A;  2WKQ A;  2VGL M;  3TJZ C;  1BYW A;  4MDZ A;  4DJ3 A;  3PBS A;  1JNU A;  1VHM A;  2O0Y A;  1TS0 A;  3MQ0 A;  4HIA A;  2VX8 A;  5FL3 A;  3S7P A;  1DP8 A;  2YKH A;  3IS2 B;  4UQI S;  3T4T A;  2J80 A;  3KSG A;  1G6O A;  3PBN A;  1NWZ A;  2W27 A;  2INW A;  3UE6 A;  5DF9 A;  2QYB A;  2JKT I;  4HH2 A;  4R70 A;  5DJU A;  5HDS A;  1W63 M;  1XJ4 A;  3EQU A;  4H6J A;  3B33 A;  4UEY A;  4LLO B;  5LBR A;  1XJ3 A;  3W2Z A;  3CUE A;  5F68 A;  2W3G A;  1D7E A;  2PDR A;  3S7Q A;  4GHI B;  2ZOI A;  2PD7 A;  1XFN A;  4EW7 A;  4MCW A;  1DP9 A;  1S4R A;  2YKF A;  3CWF A;  1T1C A;  1LSV A;  1X0O A;  3H82 A;  2O99 A;  3BY9 A;  3T4S A;  3MQO A;  2FZ0 A;  4LRX C;  4HOI A;  2VA0 A;  2VV6 A;  4HQA A;  4BBT A;  3BQA A;  3CUE C;  4MN5 A;  3EQV A;  3KSF A;  4IHQ A;  2MJ6 A;  4JGO A;  3PBT A;  3RFB A;  5J7E A;  4O01 A;  5AVF A;  2PR5 A;  1TS7 A;  2JN7 A;  2QKP A;  3VE3 A;  3BY8 A;  4ARZ A;  5AVE A;  5AJG A;  3R7W B;  3BW6 A;  3LFV A;  4L9F A;  5DFX A;  1STZ A;  4NKP A;  3F1P B;  1Y28 A;  1S1Y A;  2IA2 A;  3KX0 X;  5HDC A;  3E0Y A;  3ZYT A;  3CAX A;  2J3W A;  1T1B A;  2V0W A;  3C2W A;  2QJ7 A;  4OOL A;  3EOI A;  4L9G A;  3JVV A;  3P7N A;  2O9B A;  4L0L A;  4Q0J A;  1LSW A;  1OT9 A;  2J3T D;  2NUP C;  4H6J B;  1GSV A;  2Y79 A;  5DKK A;  2VKS A;  1NRJ A;  4O8G A;  3S7O A;  1D06 A;  5J3W A;  1WA9 A;  3JVU A;  1XFQ A;  2JKR M;  2W0N A;  2W3F A;  2ZMF A;  4G3V A;  1IFQ A;  5J4E A;  4CLC E;  3R4K A;  4P6Z M;  4WN5 A;  4B93 A;  2V1B A;  3PBQ A;  3H82 B;  3HJI A;  2OWJ A;  4KUK A;  4Y3I A;  2G7U A;  3MF0 A;  5HWW A;  3PYP A;  1W63 Q;  4EEP A;  1OPX A;  3SW1 A;  3T4Q A;  2D01 A;  1DP6 A;  1EW0 A;  4IUK A;  1NLZ A;  4Y5F A;  5HWV A;  1TS6 A;  4ARZ B;  2XSS A;  3PBO A;  3GEC A;  4M4X A;  2VGL S;  2L4R A;  4I38 A;  4WEJ A;  2W1T A;  4NXF A;  5TBM A;  3T4O A;  2WKP A;  5KIZ A;  4R38 A;  3F1O A;  1TD5 A;  1P9R A;  2KLI A;  1H3Q A;  1KOU A;  5IS1 A;  2P08 A;  3UE3 A;  4I3J A;  2QHK A;  2DMW A;  2PHY A;  1OJG A;  4EU0 A;  3OCN A;  2JHE A;  4HJ6 A;  3ULF A;  4GS9 A;  2HJ9 C;  3MR0 A;  3PBR A;  5L8M A;  4LRY C;  2GZA A;  2Z6C A;  3KO6 A;  4HY8 A;  3E4P A;  3UB6 A;  2XA7 M;  2W1R A;  3LR3 A;  3NHQ A;  3OCL A;  4ZRR A;  4I5S A;  3UB8 A;  1N9N A;  3H7W A;  4GCZ A;  3F1N A;  1LL8 A;  3LI8 A;  2EA9 A;  5DJT A;  2CMN A;  1XJ6 A;  2KDK A;  2LB5 A;  4YWZ A;  2R78 A;  3MJQ A;  3A0S A;  4LPZ A;  2J3T C;  4IJG A;  3PR6 A;  2XRO A;  4WEK A;  1UWN X;  4MN7 A;  3EEH A;  5F6A A;  4NXG A;  4YOF A;  1UGU A;  4NEE D;  5HPI A;  4BBU A;  3OC2 A;  4NXE A;  1YKD A;  3HCY A;  2M1C A;  2V0U A;  4LRZ E;  1OTI A;  4HH3 A;  5IT5 A;  3NJA A;  3T4J A;  3LIB A;  4K08 A;  5K5B A;  4WF0 A;  4ETZ A;  1ZHH B;  2B18 A;  1ZTU A;  2ZOH A;  4WL9 A;  5HPF A;  3V67 A;  4HJ4 A;  4Z1W A;  1S1Z A;  3LIF A;  4I3I A;  2Y8H A;  2K2N A;  3KSH A;  1YSQ A;  3C30 A;  5IU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...