3BJNA

Crystal structure of c-terminal domain of putative transcriptional regulator from vibrio cholerae, targeted domain 79-240
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
162
structure length
162
Chain Sequence
SYETSQHNLDAVEAVLSRLQKQTGEMAAYMVPVGYRALCVSQRESMQALRCSFVQGQSQPLLRGASSKVMLAYMPAARCEKILRYFGEDPTLDKWQSEFEKIRRHGYAVSTSEIDPGVSGISAPVMKGSKLIGAISVMAPAHRVESNKQRIILHVLQAARAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, putative
publication title Crystal structure of C-terminal domain of putative transcriptional regulator from Vibrio cholerae.
rcsb
source organism Vibrio cholerae o1 biovar eltor str. n16961
total genus 48
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2007-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3bjnA00
3RFBA 4EUVA 5L8MA 3TRCA 1TD5A 2W3DA 4ME4A 4Y3IA 4DMZA 2Y8HA 4YNRA 4MMNA 3NOTC 4ETXA 2W1RA 4ETZA 5C5KA 5HPIA 3NHQA 2O9BA 5LBRA 2LB9A 4MCWA 2LB5A 2M7VA 3KO6A 3KSFA 5TJJA 1ZTUA 3KSHA 3BJNA 3O5YA 5AJGA 2W3HA 5HSQA 2VZWA 3HCYA 3ZQ5A 2VJWA 4LRZE 4GW9A 2VKSA 3CITA 4G3WA 4LRXC 2O0YA 2XRNA 4O01A 3K2NA 4Q0IA 3C2WA 2O99A 1YSQA 4G3KA 3IBRA 4Y2FA 3CI6A 3E0YA 3KSIA 2Y79A 3MMHA 5DFXA 5I5LA 2IA2A 4LRYC 1MC0A 3LFVA 3NOUC 2G7UA 2W3GA 3NOPC 4O0PA 3EEAA 3IBJA 4PAUA 1YSPA 2W1TA 3S7NA 2O9AA 4O8GA 3MF0A 4IUKA 4Z1WA 1TF1A 4DN0A 2HGVA 4G3VA 2OOLA 4RQ9A 3S7PA 2W1TB 3E98A 2K31A 3S7OA 4R70A 2VEAA 2M7UA 2O9CA 4EU0A 2ZMFA 3MQ0A 3R4KA 2KLIA 4YOFA 2QYBA 3KSGA 4E04A 3DBAA 1F5MA 4MN7A 2W3FA 4GLQA 3VV4A 2XROA 5DFYA 1STZA 2GX5A 4ZRRA 2W3EA 2XSSA 4R6LA 3OOVA 3OBFA 1VHMA 2KOIA 2K2NA 3G6OA 4IUHA 5HPFA 4BWIA 2B18A 4CQHA 4MDZA 1YKDA 3D3OA 5K5BA 5HL6A 3S7QA 1MKMA 4FOFA 4QPRA 3W2ZA 4Q0HA 4Y5FA 4Q0JA 4IJGA
chains in the Genus database with same CATH superfamily
1F2KA 4PM7A 5CEBA 1PI5A 2HJ9C 1I5QA 4WLAA 4LCLA 1VB6A 4ETXA 5CGSA 4ETZA 2JBFA 3F1PA 3UNWA 3BM6A 4LLOB 4NK3A 3UE0A 2ZD8A 1MXOA 1KVLA 5HW3A 3KYZA 3MZEA 3P98A 4X6TA 5HL1A 3SH8A 5KIZA 3OLOA 4CLCA 4LRZE 3ZHHA 4MBFA 3S4XA 5M1AA 3FG8A 4CJNA 3C2WA 3CI6A 3HLFA 2QJ5A 4S2JA 2G7UA 4JXVA 4KZ6A 2Q9NA 4PAUA 5FAPA 2Y59A 2WK0A 4HJ3A 4QU3A 5TBMB 2X71A 3T1XA 4FUWA 3S7OA 3AGEA 3TJZC 1LI9A 4GNUA 5FEFA 3LCEA 4WZ5C 1SDNA 1PWGA 1PRQA 4HJ6A 1G28A 3T4LA 2EWWA 2HP9A 5HWTA 1FCMA 2VGJA 4YWZA 2JKFA 4EQ1A 3OBFA 4GD8A 4GCZA 5GL9A 4BQMA 2ZL1B 2IWDA 4I5SA 3LO7A 4P6BA 3D3OA 3B3XA 3FWLA 4KZ3A 3ITBA 1NRFA 4Q0HA 1JVJA 1HTZA 1W5DA 1RCJA 5L8MA 1PWDA 4HHDA 2DNSA 5EFWA 2V1ZA 2XGNA 2ZM8A 2J8YA 5BOHA 4EBLA 5CRFA 4DXBA 4R3AA 4GD6A 4I3AA 1KE4A 1L3LA 2X02A 1XGIA 5TJJA 4P87A 4HH2A 2BASA 2JE5A 3EWKA 3BW6A 3C5AA 4BBTA 1FCOA 1VQQA 4LV0A 4JPMA 2EX9A 4E3JA 1XJ6A 2B95A 2J3TD 4KUOA 4KUKA 3B47A 4QB8A 5HAIA 2KDKA 1VETA 1W63M 4PM5A 3IBJA 2VK3A 2WGWB 3TE8A 4HJ4A 1H0MA 1P9WA 4UHUA 2ZOIA 3LIDA 1D7EA 1OTEA 5M18A 4F94A 4HESA 3ITAA 1N4OA 4OPZA 3W8KA 1MPLA 2V0WA 4MN7A 2V1AA 3VP3A 3GMWA 1K57C 5JYPA 4JLFA 2GX5A 1TDGA 1PI4A 2J80A 5DF9A 3V3SA 3OCLA 2RCXA 4CQHA 4XT2B 4HP9A 5TR7A 3S7QA 4WF0A 3W2ZA 3CUEC 5FSRA 4R38A 3PHYA 2G2UA 3LR4A 3LR0A 1K25A 3LR5A 4Y3IA 1NYMA 4ZJ2A 2OWHA 3NHQA 3WRTA 4DF6A 3IXHA 4KZAA 3PR6A 1S66L 2JC7A 5FATA 4YFMA 3SS5A 2AVXA 3HLCA 3QP2A 4FTXA 4OP8A 4S2NA 3S22A 4K0XA 1UGUA 3MKFA 4XUXA 5FI6A 5FL3A 2ZC4B 1ZG6A 4EXOA 1ZKJA 3ZYTA 3DTMA 3BFEA 5FQIA 2HP6A 3LFVA 2W3GA 4KG5A 1YLTA 5F1FA 4ARZB 3ZGAB 5J8XA 2WAFA 4JXSA 1O07A 3B42A 1FR1A 3CMZA 1DRMA 3E98A 2OAQ1 4EU0A 2C6WB 2W0NA 3R4KA 1NJ4A 1DJCA 3LEQA 4EERA 4RVAA 3VE3A 2P04A 3EOIA 1W63Q 4HBUA 3Q7VB 2XEPA 5CXWA 4NXEA 1IKGA 4AFIA 1L0DA 4R1GA 3CPTA 3T4SA 3M2JA 3MXQA 2K7SA 1IFQA 2P9VA 1KDWA 4E3NA 4H6JB 4PKYA 3G30A 5EE8A 1NWZA 3RFBA 1T19A 5EVEA 1EWZA 1YAXA 4LV3A 2W3DA 1Q2PA 4BL2A 4KENB 2ZQ8A 4MMNA 4E3MA 4EBPA 4M3KA 1KOUA 2W1RA 2Y2MA 2HDQA 2H10A 3QNCA 1BT5A 3C38A 3IH8A 2I72A 2W27A 5E2HA 5JYOA 3ZNTA 5J3WA 3IF6A 4JF6A 3A0RA 1JWPA 3W4OA 3KSHA 2EX8A 5CX7A 5HSQA 3NECA 1ALQA 3EGDC 4G3WA 3P09A 3DAVA 4IVKA 4O01A 3UE6A 2A24B 3ZFZA 3QP5A 1VEUA 3F1OB 4WEKA 1HD8A 5EM1A 3G35A 4MN5A 5EPHA 3IF5A 2B5RA 4O0PA 5FEGA 4UA7A 2PU2A 4WEJA 2WZZA 1PW8A 3HLBA 3S7PA 4DJ2A 4P6ZM 1CEGA 2M7UA 1DJBA 3R7WB 3E2KA 4D60A 1LSVA 3BECA 3OCNA 3CAXA 1JTDA 1ERMA 4IEDA 4OQGA 1GHMA 5CHUA 1K55C 5E2GA 4X55A 3T4TA 1Z6FA 1OTIA 3DW0A 2Q9MA 3PBRA 2FZ0A 5F6AA 5FI7A 4C3QA 4IBRA 3H7WA 4K0WA 2HDRA 5EUAA 1IKIA 3UDXA 1OJ5A 1E4DA 5GHYA 5EECA 1HZOA 1DY6A 3VP0A 2VV6A 3T1SA 5FDSA 4P0MA 3FPWA 3UB7A 2ZC3B 3U4LP 2XK1A 5CECA 3LI8A 1L0EA 3V50A 1H3QA 3ZQ5A 2XFSA 1FILA 2DMWA 3MKEA 3HBRA 1MZUA 5EOOA 4OLGA 1V9YA 1KGGA 2V0UA 4G3KA 4EQIA 5A92A 3O86A 2Y2HA 3MMHA 4R4RA 4CPKA 1TEMA 1WA9A 1TS7A 4S2OA 4U0TA 4BBVA 5L2FA 3EEAA 1YSPA 4JGPA 3GDIA 4II7A 3H82B 5F69A 3HL9A 3UB5P 3OPPA 4G3VA 3ZCZA 4WN5A 4E6XA 4B9OA 2JKTM 4GHIA 3UB9A 3MSHA 4R70A 4A5RA 3RH8B 4L9EA 5IT5A 2QYBA 3VOLA 4HOIA 4E04A 5EM0A 1XA1A 4L9GA 4Z9QA 3AGDA 4MNRA 4WZ5A 2FFYA 2Y2QA 3JPUA 3Q82A 1SKOB 3IT9A 1XGJA 1CI8A 4E3OA 5DTTA 2K2NA 1S4RA 3WS5A 5DF7A 3ICYA 1BLPA 4BENA 4MDZA 5J4EA 3GQZA 5GLCA 5HL6A 3A0SA 5F82A 1I2SA 3L7HA 2M1CA 4PPRA 5KSHA 1W7FA 4ESPA 4N92A 3PTEA 1CI9A 1HVBA 3KYQA 3WRZA 2PAVP 4MCWA 1BZAA 3F1PB 1IYQA 4KG2A 3FZCA 1LHYA 3ISGA 4KZ5A 2WKQA 3WS2A 1PFLA 2W3HA 3VSKA 1YLJA 3HCYA 3HUMA 4GW9A 1GCEA 1KE0A 5AQ9A 2WADA 4CLCB 1AWIA 3LIAA 2ZJ9A 2ZQAA 4I39A 5HWWA 2H28A 4Y7PA 3C7UA 3UB6A 1P97A 2V8FA 4N9LA 3LY4A 5I5LA 2VGLM 4NXBA 4OOLA 4OPRA 3FYZA 3A3IA 3WS1A 4KG6A 3BEBA 1BLCA 3UN7A 1P9RA 2V9AA 4O7DA 1LLBA 4O8GA 4IUKA 1NLZA 4HY8A 2OOLA 4WZ4A 3ZG9B 2K31A 4WMCD 2V2FF 3LUQA 2OLVA 3A0VA 3NI9A 3MXSA 3N7WA 4EBNA 2XDMA 4OOMA 3MFDA 2V20A 3L9KA 1K57A 3G6OA 4OOYA 2VLGA 1KGFA 3C7VA 1J9MA 3PXPA 1JNUA 3OPLA 2ZMAA 2HDSA 1YLZA 3TG9A 3MZDA 5AVEA 1K56A 3QNBA 5DJTA 4DJ3A 3PAGA 4GOGA 3UPNA 4E3KA 5A8BA 3QP8A 2LB5A 1G5UA 4I3IA 4BJPA 1NYYA 1ZTUA 4HIAA 4QY6A 3IQAA 3MQOA 1XKZA 2JHEA 5AQBA 3LI9A 4P6ZS 1UWPX 2Y2NA 2A49A 4ID4A 1YSQA 5A91A 2XA7M 3UE1A 5CTNA 3CHWP 3SS3A 2P08A 1I2WA 2PR5A 2D02A 1M6KA 3ZG8B 4OONA 1YLYA 1YPRA 2EX6A 2ZC6B 1VETB 4N1HA 3C4PA 4FSFA 4S2LA 4DN0A 3BFFA 1AXBA 4WL9A 2PT7A 2XD5A 1GSXA 1LL8A 4HBTA 4UEYA 1CEFA 2OSUA 2WGVA 2PRFA 3NIAA 2HDUA 2XFTA 3SZTA 1A0KA 1MWSA 4U3TA 2EFUA 2KX6A 1O7EA 4ZRRA 5HAQA 3BY8A 1PW1A 1ZG4A 2KOIA 4R4SA 4EW7A 1K54A 1YLWA 2VA0A 3N8LA 1F98A 2J9PA 4ZJ1A 3HUOA 3JYIA 1ONGA 2Y2IA 3RJUA 4R3JA 4Y5FA 1IOUA 4IJGA 1TD5A 3Q81A 2DRWA 2ZM0A 3KYEA 3ZG0A 2P7JA 1L0FA 4OPQA 1BYWA 3IS2B 4X56A 3P7NA 3VP2A 3GTCA 2HF6A 1NZUA 1FCNA 2Y2PA 3BJNA 4C6YA 4NXFA 4JGQA 2QJ7A 4LV2A 1ESUA 4DKIA 1K38A 2V1BA 3U2AA 4LV1A 3BQAA 4LRXC 4UQIM 3LIEA 5G18A 1OTBA 1UWNX 3IBRA 4Y2FA 4PHTA 1Y4OA 2B02A 5HARA 3T1QB 2ZQDA 4LCMA 3NOUC 2GDNA 4EEPA 2ACGA 5GLAA 1T1CA 2PU4A 3S7NA 3T4JA 2I9VA 2WGIA 3UY6A 1Z09A 4RQ9A 4OQHA 3NJAA 1L0GA 1ACFA 3LEZA 3TW8A 2KLIA 5L10A 1M40A 2JKTI 1FR6A 4KZ4A 2ZBBA 3UB8A 3E2LA 3ZVWA 2Y2JA 4X69A 1YMSA 1ODVA 1G6OA 2EXBA 1K55A 3G2ZA 2DCFA 3CPTB 1SKFA 1MKMA 5DKKA 2P9VB 5AJGA 5IS1A 1H8YA 3O88A 2OWJA 3OC2A 3WS0A 2QHKA 1JWVA 1KVMA 5U47A 3MFXA 5HPIA 3BLSA 3AGFA 5GHXA 3DWKA 2VGLS 4GKUA 5E43A 1OPXA 3O5YA 3IF6B 2J9OA 5KSCA 4R0QA 1LT0A 1VM1A 2ZMVA 2P74A 3FV7A 2ZM2A 2XRNA 3K2NA 3T1RA 1FOFA 4WUJA 3LICA 3NDGA 4EWFA 4X1MA 4KZ7A 4F3LA 1SCWA 3HJKA 4I3JA 2R9WA 1IELA 3A3FA 4XXRA 1VEUB 3CJMA 5CHJA 1ES3A 4KZ8A 4B4ZA 4IHQA 1K6RA 4Z1WA 5HZHA 3RXXA 3BFCA 3FKWA 3IHAA 5J7EA 3MQ0A 1FIKA 3IXBA 4WM9A 4MBHA 3P01A 4DDSA 2W3FA 3VV4A 5MC7A 2XROA 5TGFA 1ZHHB 5EVIB 3JVUA 3VP4A 1XPBA 1BLSA 1GHPA 3ULFA 1SHVA 3D9YA 3QP1A 1E3UD 5KMWA 4S2NC 1GHIA 1OMEA 4Y17A 5FQQA 5EVLA 2ZLYA 4Y0OA 1MWTA 4NETA 4EUVA 3H7WB 3DTKA 4YNRA 4MN6A 1YLPA 4ZTKA 1MBLA 2XA7S 2A24A 5C5KA 1PIOA 4S2IA 4DE1A 4K91A 5L07A 1CF0A 3UPPA 2GZAA 2JN7A 1BUEA 3LIFA 3LR3A 1LL9A 3HLEA 2ZQ9A 3A3JA 2L0WA 1NZOA 3FC7A 2VJWA 4PMAA 3GV9A 1K0KA 4JXGA 5FASA 1LL5A 2WAEA 5I94A 1S1YA 2Z6CA 3IWOA 1CK3A 2PHYA 3F1NA 4FH2A 1NLYA 3KSIA 2XF3A 2Y79A 5G4ZA 4GS9A 5M19A 1G6AA 1X0OA 5A93A 2W1TA 5FA7A 5IU1A 4OQ0A 1YT4A 3JVVA 1XA7A 3NCKA 2PBYA 3S1YA 3GRJA 4GHIB 3E4QA 1QMEA 4EETB 1N9BA 3UE3A 1WYCA 5GLBA 3Q1FA 4S2KA 1ERQA 4HI4A 2E8IA 2WUQA 2QWSA 4X68A 4LFUA 2JKRM 3IXDA 5FQJA 5FQMA 4RA7A 4UAAA 1WYBA 2EA9A 3MBZA 1T18A 2YKHA 1OT9A 3W4QA 3UMDA 4KQOA 3MXRA 3BFGA 2EWVA 4Y0UA 4DE0A 4HNBA 4UQIS 1FQGA 2Y8HA 1F9IA 2NUTC 3D4FA 5DTKA 3BLMA 2L1MA 5F5YA 3M6BA 4I38A 3KX0X 4Y0TA 4NG2A 1GA9A 1KGEA 3KSFA 5DJUA 3H82A 1LSXA 3IX4A 2J7VA 4B93A 1PZPA 3E4PA 2VZWA 3O87A 1Y28A 2PYPA 1MWUA 3N6IA 1N9LA 5EVIC 1RGZA 5FQKA 1PWCA 5GHZA 4EV4A 5DFXA 1MC0A 4M4XA 3VSLA 3HLGA 4GJ4A 4KZ9A 4EUZA 3OPHA 2HP5A 2O9AA 3VOYA 2J3WA 5AQ7A 3DWZA 2EXAA 3BFDA 4R23A 1K6SA 2X01A 2WKHA 3UDIA 3Q07A 4B88A 4N9KA 3DBAA 3OPRA 2Z2MB 2Z2LB 2WKPA 5FQ9A 3IX3A 2OLUA 3TSGA 1TS8A 2W3EA 4U0XA 3HLWA 5KZHA 3CZDA 3QP6A 4BWIA 2EX2A 4RX2A 1SDEA 2Z6DA 4EEUA 3N8SA 4FH4A 5HD3A 2HJEA 1W8QA 2XR0A 3GSGA 3A3EA 1GSVA 1Q2QA 3VFFA 4PKYG 1OT6A 4UA6A 1XFNA 3H9WA 2INWA 1EI5A 3UMEA 4BMWA 2LB9A 4ZAMA 3VMAA 3PBNA 4OLDA 3T4KA 2IWBA 4MBKA 5TFQA 1BTLA 3PBSA 4X1LA 4GN2A 1JTGA 1BSGA 3BQ8A 4FCFA 3I7JA 5CHMA 5HDCA 4WELA 3CUEA 2Y2GA 4NKPA 4JF4A 1G68A 4H8RA 1S1ZA 3IWIA 3E0YA 2VV8A 2IA2A 4D2OA 4LRYC 4KQQA 1P0ZA 4LENA 3EQUA 2D01A 3T4QA 1PZOA 1NXYA 5TBMA 3OZHA 4JXWA 1GSWA 3PAEA 1TF1A 3IXGA 4JKTA 2HGVA 3MQQA 3W4PA 3IHBA 1IEMA 2GJ3A 3UO9A 4GB7A 3C4OA 1KE3A 5E2EA 3B33A 4ZDXA 5DFYA 2ZL1A 4HQAA 3SOIA 3EQVA 4JF5A 1VHMA 2FH5A 5F68A 5IHVA 1MWRA 4S2MA 2ZQ7A 3FKVA 5L09A 1MKIA 2JKGA 3DTIA 2B18A 1L2SA 3VE4A 4XUZA 1S6RA 4Y15A 1NRJA 3M2KA 2QZ6A 3A3DA 4FOFA 2OAP1 4Q0JA 2OV5A 4PM8A 3NDEA 2PDRA 4LPZA 1V9ZA 1D06A 4RYEA 5FI2A 4HP4A 2G2WA 2MJ6A 5DVAA 4CLCC 3MZFA 4R3BA 4EESA 1IYOA 1H5XA 2ZC7A 4WMCA 5DKLA 4DDYA 1OTDA 2PYRA 4BL3A 2WKRA 2A3UA 3K3DA 1C3BA 3SH9A 1YQSA 2YKFA 4JGOA 2O0YA 4Q0IA 2CMNA 5HAPA 2HV1A 2WGWA 2JCHA 2UWXA 2WKEA 4KQRA 4GDBA 3HREA 4OPYA 3VFHA 3SH7A 2PD8A 3Q7ZA 1S67L 1ES4A 3M6HA 3MS6A 2PD7A 1GA0A 2BG1A 1SZVA 2O9CA 5CERA 4L9FA 2VGKA 3HVFA 5A90A 2XQZA 1XX2A 5FAQA 2RL3A 3QP4A 3EGXC 2XLNA 2FFFB 1STZA 3IS2A 1N9OA 1ONHA 5DF8A 4XT2A 4PM9A 4DXCA 5GLDA 2VX8A 2E8JA 4HEFA 1W8YA 5K5BA 4QPRA 2Y91A 3BRMA 1T1AA 2C5WB 2H0YA 2JKRI 2Y55A 3VOZA 4ME4A 2GNXA 4QD4A 2Q0OA 5DTSA 1TS6A 4E3IA 5FAOA 5EVID 3G2YA 2CC1A 1TDLA 4OVDA 3HJIA 3ZNYA 2M7VA 1WE4A 4B4XA 2ZC5B 3GECA 3N8RA 3MJQA 5HDSA 4X25A 1K4FA 4CLCE 5D3OA 3G34A 1XP4A 1J3WA 3E4OA 3NBLA 1LSWA 3DTEA 4S2PA 2R9XA 1Y54A 4OKPA 4IVIA 4PM6A 2H5SA 2Y4AA 4ARZA 4F3LB 1EW0A 3G4PA 3SS4A 3SW1A 3NOPC 3PYPA 1BULA 3NC8A 1K54C 2Y2OA 3GVBA 3HLDA 3TOIA 3G32A 3PBOA 4IBXA 4DE2A 1RP5A 2R78A 1CQAA 3LY3A 2QMIA 3QHYA 2ZMFA 4YOFA 5HFOA 3Q7VA 4BLMA 3C8CA 5HWVA 3MR0A 4BD1A 1IYSA 1PNEA 3PBQA 3BWLA 3EEHA 4X53A 4R6LA 1TVFA 2Y2LA 4H6JA 3UDFA 1T1BA 3VP1A 3LYXA 4Y13A 3BYDA 4C75A 3T12B 2NUPC 1CJFA 3LIBA 3TRCA 3NY4A 2ZQCA 5CGWA 1BLHA 3O3VA 4KZBA 1PYYA 4NEED 1W79A 2HPBA 2PR6A 3CG5A 4JBFA 3KO6A 4WYYA 4HH3A 2QKPA 4NXGA 4GZBA 4OH0A 3CLOA 1XJ3A 2IWCA 2VKSA 5EV0A 1U60A 5EOEA 1DJAA 3CITA 4K08A 3F1OA 2O99A 4YINA 1YM1A 2A2LA 4OP5A 1ES5A 3V39A 3G31A 5CTMA 3WS4A 5EVIA 3ZDJA 3BY9A 3F1NB 3K3CA 4QY5A 4GS9B 3PBTA 1ZC2A 1YMXA 3MF0A 3R7WA 4MLLA 2W1TB 1NY0A 1XJ4A 3RXWA 1E25A 1XFQA 1RGYA 3N4IA 2Y2KA 5G4YA 5HDDA 5AQAA 5CGXA 2J3TC 1H8MA 3KSGA 4E6WA 1IYPA 1XXMA 3T50A 1KDSA 2BTFP 2PBDP 1DP6A 3ZVTA 2WKIA 5F83A 2XSSA 4E3LA 3V3RA 4JGRA 5F1GA 4IUHA 5HPFA 1S4SA 1YKDA 4CLCD 1MY8A 2HZ5A 3RTYA 4LGWA 4DMZA 4WBGA 3NOTC 2L4RA 4QJGA 3ZG7B 3IF6C 4DRTA 4N1XA 2O9BA 1EROA 3FPVA 3WWXA 5LBRA 4Q8IA 3C30A 5HD5A 3HUNA 3V67A 2UV0E 2XD1A 3IX8A 4BBUA 3UPOA 1LI0A 1FSYA 1DP9A 1HLUP 2ZOHA 4QWOA 4DE3A 2BLSA 4ZBEA 4MEZA 5E2FA 1OTAA 2H0TA 1DP8A 3CWFA 1ESIA 2VV7A 3GR2A 3IWQA 1K4EA 4UA9A 2EFXA 3NULA 1OJGA 1E3UA 1K56D 1TS0A 2WZXA 3T4OA 4P85A 4L0LA 1XJ2A 4RX3A 2V8CA 3V5MA 2QPNA 4FD8A 2VEAA 5AVFA 4BD0A 3IH9A 3ZG5A 5CEDA 1SKOA 1F5MA 4GLQA 1H8ZA 5HX9A 2XH9A 1D1JA 1FSWA 4OQIA 3D72A 2WYXA 4QHCA 5FDHA 3OOVA 1N9NA 4KQDA 1QMFA 3LGOA 1S0WA 1ES2A 1JWZA 4ZJ3A 4GDNA
chains in the Genus database with same CATH topology
5IS1A 2OWJA 3OC2A 2HJ9C 2PDRA 1OJ5A 4WLAA 1VB6A 2QHKA 4ETXA 4LPZA 1V9ZA 3MFXA 4ETZA 3F1PA 1D06A 5HPIA 4LLOB 4HP4A 2VV6A 2MJ6A 2VGLS 3KYZA 3FPWA 3UB7A 4CLCC 1OPXA 3O5YA 4EESA 5KIZA 5DKLA 1OTDA 2PYRA 3OLOA 3LI8A 1LT0A 2WKRA 4CLCA 1H3QA 3ZQ5A 4LRZE 3K3DA 2ZMVA 2YKFA 2DMWA 4JGOA 2O0YA 2XRNA 4Q0IA 3K2NA 1MZUA 2CMNA 3FG8A 1V9YA 3C2WA 4WUJA 2V0UA 4G3KA 3LICA 4F3LA 3CI6A 3HJKA 2HV1A 3MMHA 4I3JA 2QJ5A 1WA9A 1TS7A 2G7UA 4BBVA 3EEAA 4PAUA 1YSPA 4JGPA 3GDIA 4II7A 3H82B 4IHQA 2PD8A 5F69A 5HZHA 1S67L 4Z1WA 4HJ3A 5TBMB 4G3VA 4WN5A 4B9OA 2PD7A 2JKTM 4GHIA 3S7OA 3UB9A 4R70A 3TJZC 2O9CA 3RH8B 4L9FA 4L9EA 5J7EA 4HJ6A 3MQ0A 5IT5A 2QYBA 3VOLA 1G28A 4HOIA 4E04A 4L9GA 3T4LA 2EWWA 3P01A 5MC7A 2W3FA 5HWTA 3VV4A 2XROA 3EGXC 1ZHHB 4YWZA 1STZA 3JVUA 3IS2A 4EQ1A 1N9OA 3ULFA 3OBFA 4XT2A 2K2NA 1S4RA 4GCZA 4I5SA 3ICYA 4MDZA 3D3OA 2VX8A 5J4EA 5K5BA 5HL6A 3A0SA 4QPRA 4Q0HA 2M1CA 1T1AA 3H7WB 4EUVA 5L8MA 2JKRI 4HHDA 4ME4A 5EFWA 5KSHA 2GNXA 4MN6A 4YNRA 2XA7S 2A24A 5C5KA 3KYQA 1TS6A 2GZAA 4MCWA 2JN7A 4R3AA 4I3AA 3F1PB 3HJIA 3LIFA 3LR3A 2M7VA 5TJJA 3GECA 2WKQA 3MJQA 2W3HA 4HH2A 5HDSA 2BASA 3EWKA 4CLCE 2L0WA 3HCYA 3FC7A 2VJWA 4GW9A 3E4OA 3BW6A 4BBTA 1LSWA 4CLCB 3LIAA 4I39A 1S1YA 2Z6CA 2PHYA 5HWWA 2H28A 3UB6A 1P97A 1XJ6A 3F1NA 2J3TD 1NLYA 3KSIA 2Y79A 4KUOA 5G4ZA 4KUKA 3B47A 5I5LA 4GS9A 2KDKA 2VGLM 4NXBA 4OOLA 4ARZA 4F3LB 1EW0A 1W63M 3SW1A 3NOPC 3PYPA 1X0OA 3IBJA 1P9RA 2V9AA 2W1TA 3TE8A 4HJ4A 4O8GA 1P9WA 4IUKA 5IU1A 2ZOIA 3PBOA 3LIDA 1NLZA 4HY8A 2OOLA 1D7EA 2K31A 3JVVA 1OTEA 2R78A 3LUQA 2ZMFA 4YOFA 2V0WA 4GHIB 3E4QA 3A0VA 4EETB 4MN7A 3C8CA 3UE3A 5HWVA 2V1AA 3MR0A 4OOMA 3PBQA 2GX5A 4HI4A 3BWLA 2QWSA 3EEHA 4R6LA 2JKRM 3G6OA 2J80A 4H6JA 5DF9A 2VLGA 1T1BA 3OCLA 4CQHA 4XT2B 4HP9A 2EA9A 3LYXA 1T18A 3S7QA 2YKHA 3PXPA 4WF0A 1OT9A 3W2ZA 3CUEC 3UMDA 2NUPC 4KQOA 1JNUA 4R38A 3PHYA 2EWVA 3LIBA 3LR4A 3LR0A 3TRCA 3LR5A 4HNBA 4UQIS 4Y3IA 2Y8HA 1F9IA 2NUTC 5AVEA 2L1MA 5DJTA 4DJ3A 5F5YA 2OWHA 3NHQA 3PR6A 1S66L 4I38A 5A8BA 4NEED 3KX0X 2LB5A 4I3IA 4BJPA 2PR6A 3KO6A 3KSFA 5DJUA 1ZTUA 2QKPA 4HH3A 4NXGA 4HIAA 3H82A 1LSXA 1UGUA 4B93A 3E4PA 3MQOA 2VZWA 3CLOA 2JHEA 1XJ3A 3LI9A 1Y28A 2VKSA 4P6ZS 1UWPX 2PYPA 3CITA 5FL3A 4K08A 3F1OA 2O99A 1N9LA 1YSQA 2XA7M 4EXOA 2A2LA 3ZYTA 5DFXA 1MC0A 2P08A 4M4XA 2PR5A 3BY9A 3F1NB 3LFVA 3K3CA 2D02A 2W3GA 4GS9B 4GJ4A 3PBTA 4ARZB 2O9AA 4FSFA 3MF0A 2J3WA 3R7WA 4DN0A 3B42A 2W1TB 3E98A 1DRMA 1XJ4A 2OAQ1 4WL9A 2PT7A 1XFQA 4EU0A 5G4YA 2W0NA 5HDDA 1GSXA 1LL8A 3R4KA 2J3TC 1H8MA 3KSGA 3DBAA 4EERA 4UEYA 3VE3A 3T50A 2P04A 3EOIA 1W63Q 1DP6A 2WKPA 2KX6A 4NXEA 4ZRRA 1TS8A 2W3EA 2XSSA 3BY8A 4JGRA 2KOIA 4AFIA 4EW7A 3T4SA 4IUHA 5HPFA 4BWIA 1S4SA 3MXQA 2K7SA 2VA0A 1F98A 1IFQA 1YKDA 2Z6DA 4CLCD 4EEUA 5HD3A 4H6JB 4PKYA 2HJEA 1IOUA 4Y5FA 4IJGA 1NWZA 3RFBA 1GSVA 1T19A 1YAXA 1TD5A 3RTYA 2W3DA 4DMZA 4MMNA 4PKYG 3NOTC 1OT6A 2L4RA 1XFNA 1KOUA 2W1RA 3H9WA 2P7JA 2INWA 3UMEA 2O9BA 3FPVA 3C38A 4BMWA 5LBRA 2LB9A 3C30A 1BYWA 2W27A 3IS2B 5HD5A 3P7NA 3PBNA 5J3WA 3V67A 3A0RA 2HF6A 3T4KA 3KSHA 4BBUA 3BJNA 4NXFA 4JGQA 3PBSA 5CX7A 5HSQA 1DP9A 2QJ7A 2ZOHA 3BQ8A 3EGDC 2V1BA 1OTAA 5HDCA 3U2AA 4WELA 3CUEA 1DP8A 3BQAA 4G3WA 3CWFA 4LRXC 3LIEA 4O01A 4UQIM 3UE6A 2VV7A 1OTBA 1UWNX 4NKPA 3IBRA 4Y2FA 2A24B 4PHTA 3F1OB 3E0YA 4WEKA 1OJGA 2B02A 2VV8A 2IA2A 4LRYC 4MN5A 1P0ZA 1TS0A 3EQUA 3T4OA 3NOUC 2D01A 3T4QA 4EEPA 4O0PA 4L0LA 1XJ2A 5TBMA 1T1CA 3S7NA 3T4JA 2I9VA 4WEJA 1GSWA 1TF1A 2HGVA 4RQ9A 3MQQA 3S7PA 4DJ2A 4P6ZM 2M7UA 2VEAA 5AVFA 3NJAA 3R7WB 3TW8A 2KLIA 2GJ3A 1LSVA 1F5MA 3OCNA 4GLQA 3CAXA 3B33A 5DFYA 2JKTI 2ZBBA 3UB8A 4HQAA 3D72A 3EQVA 3OOVA 1VHMA 3T4TA 2FH5A 5F68A 1ODVA 1OTIA 1G6OA 1N9NA 4KQDA 3PBRA 2FZ0A 5F6AA 2B18A 3VE4A 3H7WA 1NRJA 1MKMA 4FOFA 5DKKA 2OAP1 1S1ZA 4Q0JA 5AJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RFB A;  4EUV A;  5L8M A;  3TRC A;  1TD5 A;  2W3D A;  4ME4 A;  4Y3I A;  4DMZ A;  2Y8H A;  4YNR A;  4MMN A;  3NOT C;  4ETX A;  2W1R A;  4ETZ A;  5C5K A;  5HPI A;  3NHQ A;  2O9B A;  5LBR A;  2LB9 A;  4MCW A;  2LB5 A;  2M7V A;  3KO6 A;  3KSF A;  5TJJ A;  1ZTU A;  3KSH A;  3BJN A;  3O5Y A;  5AJG A;  2W3H A;  5HSQ A;  2VZW A;  3HCY A;  3ZQ5 A;  2VJW A;  4LRZ E;  4GW9 A;  2VKS A;  3CIT A;  4G3W A;  4LRX C;  2O0Y A;  2XRN A;  4O01 A;  3K2N A;  4Q0I A;  3C2W A;  2O99 A;  1YSQ A;  4G3K A;  3IBR A;  4Y2F A;  3CI6 A;  3E0Y A;  3KSI A;  2Y79 A;  3MMH A;  5DFX A;  5I5L A;  2IA2 A;  4LRY C;  1MC0 A;  3LFV A;  3NOU C;  2G7U A;  2W3G A;  3NOP C;  4O0P A;  3EEA A;  3IBJ A;  4PAU A;  1YSP A;  2W1T A;  3S7N A;  2O9A A;  4O8G A;  3MF0 A;  4IUK A;  4Z1W A;  1TF1 A;  4DN0 A;  2HGV A;  4G3V A;  2OOL A;  4RQ9 A;  3S7P A;  2W1T B;  3E98 A;  2K31 A;  3S7O A;  4R70 A;  2VEA A;  2M7U A;  2O9C A;  4EU0 A;  2ZMF A;  3MQ0 A;  3R4K A;  2KLI A;  4YOF A;  2QYB A;  3KSG A;  4E04 A;  3DBA A;  1F5M A;  4MN7 A;  2W3F A;  4GLQ A;  3VV4 A;  2XRO A;  5DFY A;  1STZ A;  2GX5 A;  4ZRR A;  2W3E A;  2XSS A;  4R6L A;  3OOV A;  3OBF A;  1VHM A;  2KOI A;  2K2N A;  3G6O A;  4IUH A;  5HPF A;  4BWI A;  2B18 A;  4CQH A;  4MDZ A;  1YKD A;  3D3O A;  5K5B A;  5HL6 A;  3S7Q A;  1MKM A;  4FOF A;  4QPR A;  3W2Z A;  4Q0H A;  4Y5F A;  4Q0J A;  4IJG A; 
#chains in the Genus database with same CATH topology
 1F2K A;  4PM7 A;  5CEB A;  1PI5 A;  2HJ9 C;  1I5Q A;  4WLA A;  4LCL A;  1VB6 A;  4ETX A;  5CGS A;  4ETZ A;  2JBF A;  3F1P A;  3UNW A;  3BM6 A;  4LLO B;  4NK3 A;  3UE0 A;  2ZD8 A;  1MXO A;  1KVL A;  5HW3 A;  3KYZ A;  3MZE A;  3P98 A;  4X6T A;  5HL1 A;  3SH8 A;  5KIZ A;  3OLO A;  4CLC A;  4LRZ E;  3ZHH A;  4MBF A;  3S4X A;  5M1A A;  3FG8 A;  4CJN A;  3C2W A;  3CI6 A;  3HLF A;  2QJ5 A;  4S2J A;  2G7U A;  4JXV A;  4KZ6 A;  2Q9N A;  4PAU A;  5FAP A;  2Y59 A;  2WK0 A;  4HJ3 A;  4QU3 A;  5TBM B;  2X71 A;  3T1X A;  4FUW A;  3S7O A;  3AGE A;  3TJZ C;  1LI9 A;  4GNU A;  5FEF A;  3LCE A;  4WZ5 C;  1SDN A;  1PWG A;  1PRQ A;  4HJ6 A;  1G28 A;  3T4L A;  2EWW A;  2HP9 A;  5HWT A;  1FCM A;  2VGJ A;  4YWZ A;  2JKF A;  4EQ1 A;  3OBF A;  4GD8 A;  4GCZ A;  5GL9 A;  4BQM A;  2ZL1 B;  2IWD A;  4I5S A;  3LO7 A;  4P6B A;  3D3O A;  3B3X A;  3FWL A;  4KZ3 A;  3ITB A;  1NRF A;  4Q0H A;  1JVJ A;  1HTZ A;  1W5D A;  1RCJ A;  5L8M A;  1PWD A;  4HHD A;  2DNS A;  5EFW A;  2V1Z A;  2XGN A;  2ZM8 A;  2J8Y A;  5BOH A;  4EBL A;  5CRF A;  4DXB A;  4R3A A;  4GD6 A;  4I3A A;  1KE4 A;  1L3L A;  2X02 A;  1XGI A;  5TJJ A;  4P87 A;  4HH2 A;  2BAS A;  2JE5 A;  3EWK A;  3BW6 A;  3C5A A;  4BBT A;  1FCO A;  1VQQ A;  4LV0 A;  4JPM A;  2EX9 A;  4E3J A;  1XJ6 A;  2B95 A;  2J3T D;  4KUO A;  4KUK A;  3B47 A;  4QB8 A;  5HAI A;  2KDK A;  1VET A;  1W63 M;  4PM5 A;  3IBJ A;  2VK3 A;  2WGW B;  3TE8 A;  4HJ4 A;  1H0M A;  1P9W A;  4UHU A;  2ZOI A;  3LID A;  1D7E A;  1OTE A;  5M18 A;  4F94 A;  4HES A;  3ITA A;  1N4O A;  4OPZ A;  3W8K A;  1MPL A;  2V0W A;  4MN7 A;  2V1A A;  3VP3 A;  3GMW A;  1K57 C;  5JYP A;  4JLF A;  2GX5 A;  1TDG A;  1PI4 A;  2J80 A;  5DF9 A;  3V3S A;  3OCL A;  2RCX A;  4CQH A;  4XT2 B;  4HP9 A;  5TR7 A;  3S7Q A;  4WF0 A;  3W2Z A;  3CUE C;  5FSR A;  4R38 A;  3PHY A;  2G2U A;  3LR4 A;  3LR0 A;  1K25 A;  3LR5 A;  4Y3I A;  1NYM A;  4ZJ2 A;  2OWH A;  3NHQ A;  3WRT A;  4DF6 A;  3IXH A;  4KZA A;  3PR6 A;  1S66 L;  2JC7 A;  5FAT A;  4YFM A;  3SS5 A;  2AVX A;  3HLC A;  3QP2 A;  4FTX A;  4OP8 A;  4S2N A;  3S22 A;  4K0X A;  1UGU A;  3MKF A;  4XUX A;  5FI6 A;  5FL3 A;  2ZC4 B;  1ZG6 A;  4EXO A;  1ZKJ A;  3ZYT A;  3DTM A;  3BFE A;  5FQI A;  2HP6 A;  3LFV A;  2W3G A;  4KG5 A;  1YLT A;  5F1F A;  4ARZ B;  3ZGA B;  5J8X A;  2WAF A;  4JXS A;  1O07 A;  3B42 A;  1FR1 A;  3CMZ A;  1DRM A;  3E98 A;  2OAQ 1;  4EU0 A;  2C6W B;  2W0N A;  3R4K A;  1NJ4 A;  1DJC A;  3LEQ A;  4EER A;  4RVA A;  3VE3 A;  2P04 A;  3EOI A;  1W63 Q;  4HBU A;  3Q7V B;  2XEP A;  5CXW A;  4NXE A;  1IKG A;  4AFI A;  1L0D A;  4R1G A;  3CPT A;  3T4S A;  3M2J A;  3MXQ A;  2K7S A;  1IFQ A;  2P9V A;  1KDW A;  4E3N A;  4H6J B;  4PKY A;  3G30 A;  5EE8 A;  1NWZ A;  3RFB A;  1T19 A;  5EVE A;  1EWZ A;  1YAX A;  4LV3 A;  2W3D A;  1Q2P A;  4BL2 A;  4KEN B;  2ZQ8 A;  4MMN A;  4E3M A;  4EBP A;  4M3K A;  1KOU A;  2W1R A;  2Y2M A;  2HDQ A;  2H10 A;  3QNC A;  1BT5 A;  3C38 A;  3IH8 A;  2I72 A;  2W27 A;  5E2H A;  5JYO A;  3ZNT A;  5J3W A;  3IF6 A;  4JF6 A;  3A0R A;  1JWP A;  3W4O A;  3KSH A;  2EX8 A;  5CX7 A;  5HSQ A;  3NEC A;  1ALQ A;  3EGD C;  4G3W A;  3P09 A;  3DAV A;  4IVK A;  4O01 A;  3UE6 A;  2A24 B;  3ZFZ A;  3QP5 A;  1VEU A;  3F1O B;  4WEK A;  1HD8 A;  5EM1 A;  3G35 A;  4MN5 A;  5EPH A;  3IF5 A;  2B5R A;  4O0P A;  5FEG A;  4UA7 A;  2PU2 A;  4WEJ A;  2WZZ A;  1PW8 A;  3HLB A;  3S7P A;  4DJ2 A;  4P6Z M;  1CEG A;  2M7U A;  1DJB A;  3R7W B;  3E2K A;  4D60 A;  1LSV A;  3BEC A;  3OCN A;  3CAX A;  1JTD A;  1ERM A;  4IED A;  4OQG A;  1GHM A;  5CHU A;  1K55 C;  5E2G A;  4X55 A;  3T4T A;  1Z6F A;  1OTI A;  3DW0 A;  2Q9M A;  3PBR A;  2FZ0 A;  5F6A A;  5FI7 A;  4C3Q A;  4IBR A;  3H7W A;  4K0W A;  2HDR A;  5EUA A;  1IKI A;  3UDX A;  1OJ5 A;  1E4D A;  5GHY A;  5EEC A;  1HZO A;  1DY6 A;  3VP0 A;  2VV6 A;  3T1S A;  5FDS A;  4P0M A;  3FPW A;  3UB7 A;  2ZC3 B;  3U4L P;  2XK1 A;  5CEC A;  3LI8 A;  1L0E A;  3V50 A;  1H3Q A;  3ZQ5 A;  2XFS A;  1FIL A;  2DMW A;  3MKE A;  3HBR A;  1MZU A;  5EOO A;  4OLG A;  1V9Y A;  1KGG A;  2V0U A;  4G3K A;  4EQI A;  5A92 A;  3O86 A;  2Y2H A;  3MMH A;  4R4R A;  4CPK A;  1TEM A;  1WA9 A;  1TS7 A;  4S2O A;  4U0T A;  4BBV A;  5L2F A;  3EEA A;  1YSP A;  4JGP A;  3GDI A;  4II7 A;  3H82 B;  5F69 A;  3HL9 A;  3UB5 P;  3OPP A;  4G3V A;  3ZCZ A;  4WN5 A;  4E6X A;  4B9O A;  2JKT M;  4GHI A;  3UB9 A;  3MSH A;  4R70 A;  4A5R A;  3RH8 B;  4L9E A;  5IT5 A;  2QYB A;  3VOL A;  4HOI A;  4E04 A;  5EM0 A;  1XA1 A;  4L9G A;  4Z9Q A;  3AGD A;  4MNR A;  4WZ5 A;  2FFY A;  2Y2Q A;  3JPU A;  3Q82 A;  1SKO B;  3IT9 A;  1XGJ A;  1CI8 A;  4E3O A;  5DTT A;  2K2N A;  1S4R A;  3WS5 A;  5DF7 A;  3ICY A;  1BLP A;  4BEN A;  4MDZ A;  5J4E A;  3GQZ A;  5GLC A;  5HL6 A;  3A0S A;  5F82 A;  1I2S A;  3L7H A;  2M1C A;  4PPR A;  5KSH A;  1W7F A;  4ESP A;  4N92 A;  3PTE A;  1CI9 A;  1HVB A;  3KYQ A;  3WRZ A;  2PAV P;  4MCW A;  1BZA A;  3F1P B;  1IYQ A;  4KG2 A;  3FZC A;  1LHY A;  3ISG A;  4KZ5 A;  2WKQ A;  3WS2 A;  1PFL A;  2W3H A;  3VSK A;  1YLJ A;  3HCY A;  3HUM A;  4GW9 A;  1GCE A;  1KE0 A;  5AQ9 A;  2WAD A;  4CLC B;  1AWI A;  3LIA A;  2ZJ9 A;  2ZQA A;  4I39 A;  5HWW A;  2H28 A;  4Y7P A;  3C7U A;  3UB6 A;  1P97 A;  2V8F A;  4N9L A;  3LY4 A;  5I5L A;  2VGL M;  4NXB A;  4OOL A;  4OPR A;  3FYZ A;  3A3I A;  3WS1 A;  4KG6 A;  3BEB A;  1BLC A;  3UN7 A;  1P9R A;  2V9A A;  4O7D A;  1LLB A;  4O8G A;  4IUK A;  1NLZ A;  4HY8 A;  2OOL A;  4WZ4 A;  3ZG9 B;  2K31 A;  4WMC D;  2V2F F;  3LUQ A;  2OLV A;  3A0V A;  3NI9 A;  3MXS A;  3N7W A;  4EBN A;  2XDM A;  4OOM A;  3MFD A;  2V20 A;  3L9K A;  1K57 A;  3G6O A;  4OOY A;  2VLG A;  1KGF A;  3C7V A;  1J9M A;  3PXP A;  1JNU A;  3OPL A;  2ZMA A;  2HDS A;  1YLZ A;  3TG9 A;  3MZD A;  5AVE A;  1K56 A;  3QNB A;  5DJT A;  4DJ3 A;  3PAG A;  4GOG A;  3UPN A;  4E3K A;  5A8B A;  3QP8 A;  2LB5 A;  1G5U A;  4I3I A;  4BJP A;  1NYY A;  1ZTU A;  4HIA A;  4QY6 A;  3IQA A;  3MQO A;  1XKZ A;  2JHE A;  5AQB A;  3LI9 A;  4P6Z S;  1UWP X;  2Y2N A;  2A49 A;  4ID4 A;  1YSQ A;  5A91 A;  2XA7 M;  3UE1 A;  5CTN A;  3CHW P;  3SS3 A;  2P08 A;  1I2W A;  2PR5 A;  2D02 A;  1M6K A;  3ZG8 B;  4OON A;  1YLY A;  1YPR A;  2EX6 A;  2ZC6 B;  1VET B;  4N1H A;  3C4P A;  4FSF A;  4S2L A;  4DN0 A;  3BFF A;  1AXB A;  4WL9 A;  2PT7 A;  2XD5 A;  1GSX A;  1LL8 A;  4HBT A;  4UEY A;  1CEF A;  2OSU A;  2WGV A;  2PRF A;  3NIA A;  2HDU A;  2XFT A;  3SZT A;  1A0K A;  1MWS A;  4U3T A;  2EFU A;  2KX6 A;  1O7E A;  4ZRR A;  5HAQ A;  3BY8 A;  1PW1 A;  1ZG4 A;  2KOI A;  4R4S A;  4EW7 A;  1K54 A;  1YLW A;  2VA0 A;  3N8L A;  1F98 A;  2J9P A;  4ZJ1 A;  3HUO A;  3JYI A;  1ONG A;  2Y2I A;  3RJU A;  4R3J A;  4Y5F A;  1IOU A;  4IJG A;  1TD5 A;  3Q81 A;  2DRW A;  2ZM0 A;  3KYE A;  3ZG0 A;  2P7J A;  1L0F A;  4OPQ A;  1BYW A;  3IS2 B;  4X56 A;  3P7N A;  3VP2 A;  3GTC A;  2HF6 A;  1NZU A;  1FCN A;  2Y2P A;  3BJN A;  4C6Y A;  4NXF A;  4JGQ A;  2QJ7 A;  4LV2 A;  1ESU A;  4DKI A;  1K38 A;  2V1B A;  3U2A A;  4LV1 A;  3BQA A;  4LRX C;  4UQI M;  3LIE A;  5G18 A;  1OTB A;  1UWN X;  3IBR A;  4Y2F A;  4PHT A;  1Y4O A;  2B02 A;  5HAR A;  3T1Q B;  2ZQD A;  4LCM A;  3NOU C;  2GDN A;  4EEP A;  2ACG A;  5GLA A;  1T1C A;  2PU4 A;  3S7N A;  3T4J A;  2I9V A;  2WGI A;  3UY6 A;  1Z09 A;  4RQ9 A;  4OQH A;  3NJA A;  1L0G A;  1ACF A;  3LEZ A;  3TW8 A;  2KLI A;  5L10 A;  1M40 A;  2JKT I;  1FR6 A;  4KZ4 A;  2ZBB A;  3UB8 A;  3E2L A;  3ZVW A;  2Y2J A;  4X69 A;  1YMS A;  1ODV A;  1G6O A;  2EXB A;  1K55 A;  3G2Z A;  2DCF A;  3CPT B;  1SKF A;  1MKM A;  5DKK A;  2P9V B;  5AJG A;  5IS1 A;  1H8Y A;  3O88 A;  2OWJ A;  3OC2 A;  3WS0 A;  2QHK A;  1JWV A;  1KVM A;  5U47 A;  3MFX A;  5HPI A;  3BLS A;  3AGF A;  5GHX A;  3DWK A;  2VGL S;  4GKU A;  5E43 A;  1OPX A;  3O5Y A;  3IF6 B;  2J9O A;  5KSC A;  4R0Q A;  1LT0 A;  1VM1 A;  2ZMV A;  2P74 A;  3FV7 A;  2ZM2 A;  2XRN A;  3K2N A;  3T1R A;  1FOF A;  4WUJ A;  3LIC A;  3NDG A;  4EWF A;  4X1M A;  4KZ7 A;  4F3L A;  1SCW A;  3HJK A;  4I3J A;  2R9W A;  1IEL A;  3A3F A;  4XXR A;  1VEU B;  3CJM A;  5CHJ A;  1ES3 A;  4KZ8 A;  4B4Z A;  4IHQ A;  1K6R A;  4Z1W A;  5HZH A;  3RXX A;  3BFC A;  3FKW A;  3IHA A;  5J7E A;  3MQ0 A;  1FIK A;  3IXB A;  4WM9 A;  4MBH A;  3P01 A;  4DDS A;  2W3F A;  3VV4 A;  5MC7 A;  2XRO A;  5TGF A;  1ZHH B;  5EVI B;  3JVU A;  3VP4 A;  1XPB A;  1BLS A;  1GHP A;  3ULF A;  1SHV A;  3D9Y A;  3QP1 A;  1E3U D;  5KMW A;  4S2N C;  1GHI A;  1OME A;  4Y17 A;  5FQQ A;  5EVL A;  2ZLY A;  4Y0O A;  1MWT A;  4NET A;  4EUV A;  3H7W B;  3DTK A;  4YNR A;  4MN6 A;  1YLP A;  4ZTK A;  1MBL A;  2XA7 S;  2A24 A;  5C5K A;  1PIO A;  4S2I A;  4DE1 A;  4K91 A;  5L07 A;  1CF0 A;  3UPP A;  2GZA A;  2JN7 A;  1BUE A;  3LIF A;  3LR3 A;  1LL9 A;  3HLE A;  2ZQ9 A;  3A3J A;  2L0W A;  1NZO A;  3FC7 A;  2VJW A;  4PMA A;  3GV9 A;  1K0K A;  4JXG A;  5FAS A;  1LL5 A;  2WAE A;  5I94 A;  1S1Y A;  2Z6C A;  3IWO A;  1CK3 A;  2PHY A;  3F1N A;  4FH2 A;  1NLY A;  3KSI A;  2XF3 A;  2Y79 A;  5G4Z A;  4GS9 A;  5M19 A;  1G6A A;  1X0O A;  5A93 A;  2W1T A;  5FA7 A;  5IU1 A;  4OQ0 A;  1YT4 A;  3JVV A;  1XA7 A;  3NCK A;  2PBY A;  3S1Y A;  3GRJ A;  4GHI B;  3E4Q A;  1QME A;  4EET B;  1N9B A;  3UE3 A;  1WYC A;  5GLB A;  3Q1F A;  4S2K A;  1ERQ A;  4HI4 A;  2E8I A;  2WUQ A;  2QWS A;  4X68 A;  4LFU A;  2JKR M;  3IXD A;  5FQJ A;  5FQM A;  4RA7 A;  4UAA A;  1WYB A;  2EA9 A;  3MBZ A;  1T18 A;  2YKH A;  1OT9 A;  3W4Q A;  3UMD A;  4KQO A;  3MXR A;  3BFG A;  2EWV A;  4Y0U A;  4DE0 A;  4HNB A;  4UQI S;  1FQG A;  2Y8H A;  1F9I A;  2NUT C;  3D4F A;  5DTK A;  3BLM A;  2L1M A;  5F5Y A;  3M6B A;  4I38 A;  3KX0 X;  4Y0T A;  4NG2 A;  1GA9 A;  1KGE A;  3KSF A;  5DJU A;  3H82 A;  1LSX A;  3IX4 A;  2J7V A;  4B93 A;  1PZP A;  3E4P A;  2VZW A;  3O87 A;  1Y28 A;  2PYP A;  1MWU A;  3N6I A;  1N9L A;  5EVI C;  1RGZ A;  5FQK A;  1PWC A;  5GHZ A;  4EV4 A;  5DFX A;  1MC0 A;  4M4X A;  3VSL A;  3HLG A;  4GJ4 A;  4KZ9 A;  4EUZ A;  3OPH A;  2HP5 A;  2O9A A;  3VOY A;  2J3W A;  5AQ7 A;  3DWZ A;  2EXA A;  3BFD A;  4R23 A;  1K6S A;  2X01 A;  2WKH A;  3UDI A;  3Q07 A;  4B88 A;  4N9K A;  3DBA A;  3OPR A;  2Z2M B;  2Z2L B;  2WKP A;  5FQ9 A;  3IX3 A;  2OLU A;  3TSG A;  1TS8 A;  2W3E A;  4U0X A;  3HLW A;  5KZH A;  3CZD A;  3QP6 A;  4BWI A;  2EX2 A;  4RX2 A;  1SDE A;  2Z6D A;  4EEU A;  3N8S A;  4FH4 A;  5HD3 A;  2HJE A;  1W8Q A;  2XR0 A;  3GSG A;  3A3E A;  1GSV A;  1Q2Q A;  3VFF A;  4PKY G;  1OT6 A;  4UA6 A;  1XFN A;  3H9W A;  2INW A;  1EI5 A;  3UME A;  4BMW A;  2LB9 A;  4ZAM A;  3VMA A;  3PBN A;  4OLD A;  3T4K A;  2IWB A;  4MBK A;  5TFQ A;  1BTL A;  3PBS A;  4X1L A;  4GN2 A;  1JTG A;  1BSG A;  3BQ8 A;  4FCF A;  3I7J A;  5CHM A;  5HDC A;  4WEL A;  3CUE A;  2Y2G A;  4NKP A;  4JF4 A;  1G68 A;  4H8R A;  1S1Z A;  3IWI A;  3E0Y A;  2VV8 A;  2IA2 A;  4D2O A;  4LRY C;  4KQQ A;  1P0Z A;  4LEN A;  3EQU A;  2D01 A;  3T4Q A;  1PZO A;  1NXY A;  5TBM A;  3OZH A;  4JXW A;  1GSW A;  3PAE A;  1TF1 A;  3IXG A;  4JKT A;  2HGV A;  3MQQ A;  3W4P A;  3IHB A;  1IEM A;  2GJ3 A;  3UO9 A;  4GB7 A;  3C4O A;  1KE3 A;  5E2E A;  3B33 A;  4ZDX A;  5DFY A;  2ZL1 A;  4HQA A;  3SOI A;  3EQV A;  4JF5 A;  1VHM A;  2FH5 A;  5F68 A;  5IHV A;  1MWR A;  4S2M A;  2ZQ7 A;  3FKV A;  5L09 A;  1MKI A;  2JKG A;  3DTI A;  2B18 A;  1L2S A;  3VE4 A;  4XUZ A;  1S6R A;  4Y15 A;  1NRJ A;  3M2K A;  2QZ6 A;  3A3D A;  4FOF A;  2OAP 1;  4Q0J A;  2OV5 A;  4PM8 A;  3NDE A;  2PDR A;  4LPZ A;  1V9Z A;  1D06 A;  4RYE A;  5FI2 A;  4HP4 A;  2G2W A;  2MJ6 A;  5DVA A;  4CLC C;  3MZF A;  4R3B A;  4EES A;  1IYO A;  1H5X A;  2ZC7 A;  4WMC A;  5DKL A;  4DDY A;  1OTD A;  2PYR A;  4BL3 A;  2WKR A;  2A3U A;  3K3D A;  1C3B A;  3SH9 A;  1YQS A;  2YKF A;  4JGO A;  2O0Y A;  4Q0I A;  2CMN A;  5HAP A;  2HV1 A;  2WGW A;  2JCH A;  2UWX A;  2WKE A;  4KQR A;  4GDB A;  3HRE A;  4OPY A;  3VFH A;  3SH7 A;  2PD8 A;  3Q7Z A;  1S67 L;  1ES4 A;  3M6H A;  3MS6 A;  2PD7 A;  1GA0 A;  2BG1 A;  1SZV A;  2O9C A;  5CER A;  4L9F A;  2VGK A;  3HVF A;  5A90 A;  2XQZ A;  1XX2 A;  5FAQ A;  2RL3 A;  3QP4 A;  3EGX C;  2XLN A;  2FFF B;  1STZ A;  3IS2 A;  1N9O A;  1ONH A;  5DF8 A;  4XT2 A;  4PM9 A;  4DXC A;  5GLD A;  2VX8 A;  2E8J A;  4HEF A;  1W8Y A;  5K5B A;  4QPR A;  2Y91 A;  3BRM A;  1T1A A;  2C5W B;  2H0Y A;  2JKR I;  2Y55 A;  3VOZ A;  4ME4 A;  2GNX A;  4QD4 A;  2Q0O A;  5DTS A;  1TS6 A;  4E3I A;  5FAO A;  5EVI D;  3G2Y A;  2CC1 A;  1TDL A;  4OVD A;  3HJI A;  3ZNY A;  2M7V A;  1WE4 A;  4B4X A;  2ZC5 B;  3GEC A;  3N8R A;  3MJQ A;  5HDS A;  4X25 A;  1K4F A;  4CLC E;  5D3O A;  3G34 A;  1XP4 A;  1J3W A;  3E4O A;  3NBL A;  1LSW A;  3DTE A;  4S2P A;  2R9X A;  1Y54 A;  4OKP A;  4IVI A;  4PM6 A;  2H5S A;  2Y4A A;  4ARZ A;  4F3L B;  1EW0 A;  3G4P A;  3SS4 A;  3SW1 A;  3NOP C;  3PYP A;  1BUL A;  3NC8 A;  1K54 C;  2Y2O A;  3GVB A;  3HLD A;  3TOI A;  3G32 A;  3PBO A;  4IBX A;  4DE2 A;  1RP5 A;  2R78 A;  1CQA A;  3LY3 A;  2QMI A;  3QHY A;  2ZMF A;  4YOF A;  5HFO A;  3Q7V A;  4BLM A;  3C8C A;  5HWV A;  3MR0 A;  4BD1 A;  1IYS A;  1PNE A;  3PBQ A;  3BWL A;  3EEH A;  4X53 A;  4R6L A;  1TVF A;  2Y2L A;  4H6J A;  3UDF A;  1T1B A;  3VP1 A;  3LYX A;  4Y13 A;  3BYD A;  4C75 A;  3T12 B;  2NUP C;  1CJF A;  3LIB A;  3TRC A;  3NY4 A;  2ZQC A;  5CGW A;  1BLH A;  3O3V A;  4KZB A;  1PYY A;  4NEE D;  1W79 A;  2HPB A;  2PR6 A;  3CG5 A;  4JBF A;  3KO6 A;  4WYY A;  4HH3 A;  2QKP A;  4NXG A;  4GZB A;  4OH0 A;  3CLO A;  1XJ3 A;  2IWC A;  2VKS A;  5EV0 A;  1U60 A;  5EOE A;  1DJA A;  3CIT A;  4K08 A;  3F1O A;  2O99 A;  4YIN A;  1YM1 A;  2A2L A;  4OP5 A;  1ES5 A;  3V39 A;  3G31 A;  5CTM A;  3WS4 A;  5EVI A;  3ZDJ A;  3BY9 A;  3F1N B;  3K3C A;  4QY5 A;  4GS9 B;  3PBT A;  1ZC2 A;  1YMX A;  3MF0 A;  3R7W A;  4MLL A;  2W1T B;  1NY0 A;  1XJ4 A;  3RXW A;  1E25 A;  1XFQ A;  1RGY A;  3N4I A;  2Y2K A;  5G4Y A;  5HDD A;  5AQA A;  5CGX A;  2J3T C;  1H8M A;  3KSG A;  4E6W A;  1IYP A;  1XXM A;  3T50 A;  1KDS A;  2BTF P;  2PBD P;  1DP6 A;  3ZVT A;  2WKI A;  5F83 A;  2XSS A;  4E3L A;  3V3R A;  4JGR A;  5F1G A;  4IUH A;  5HPF A;  1S4S A;  1YKD A;  4CLC D;  1MY8 A;  2HZ5 A;  3RTY A;  4LGW A;  4DMZ A;  4WBG A;  3NOT C;  2L4R A;  4QJG A;  3ZG7 B;  3IF6 C;  4DRT A;  4N1X A;  2O9B A;  1ERO A;  3FPV A;  3WWX A;  5LBR A;  4Q8I A;  3C30 A;  5HD5 A;  3HUN A;  3V67 A;  2UV0 E;  2XD1 A;  3IX8 A;  4BBU A;  3UPO A;  1LI0 A;  1FSY A;  1DP9 A;  1HLU P;  2ZOH A;  4QWO A;  4DE3 A;  2BLS A;  4ZBE A;  4MEZ A;  5E2F A;  1OTA A;  2H0T A;  1DP8 A;  3CWF A;  1ESI A;  2VV7 A;  3GR2 A;  3IWQ A;  1K4E A;  4UA9 A;  2EFX A;  3NUL A;  1OJG A;  1E3U A;  1K56 D;  1TS0 A;  2WZX A;  3T4O A;  4P85 A;  4L0L A;  1XJ2 A;  4RX3 A;  2V8C A;  3V5M A;  2QPN A;  4FD8 A;  2VEA A;  5AVF A;  4BD0 A;  3IH9 A;  3ZG5 A;  5CED A;  1SKO A;  1F5M A;  4GLQ A;  1H8Z A;  5HX9 A;  2XH9 A;  1D1J A;  1FSW A;  4OQI A;  3D72 A;  2WYX A;  4QHC A;  5FDH A;  3OOV A;  1N9N A;  4KQD A;  1QMF A;  3LGO A;  1S0W A;  1ES2 A;  1JWZ A;  4ZJ3 A;  4GDN A; 
#chains in the Genus database with same CATH homology
 5IS1 A;  2OWJ A;  3OC2 A;  2HJ9 C;  2PDR A;  1OJ5 A;  4WLA A;  1VB6 A;  2QHK A;  4ETX A;  4LPZ A;  1V9Z A;  3MFX A;  4ETZ A;  3F1P A;  1D06 A;  5HPI A;  4LLO B;  4HP4 A;  2VV6 A;  2MJ6 A;  2VGL S;  3KYZ A;  3FPW A;  3UB7 A;  4CLC C;  1OPX A;  3O5Y A;  4EES A;  5KIZ A;  5DKL A;  1OTD A;  2PYR A;  3OLO A;  3LI8 A;  1LT0 A;  2WKR A;  4CLC A;  1H3Q A;  3ZQ5 A;  4LRZ E;  3K3D A;  2ZMV A;  2YKF A;  2DMW A;  4JGO A;  2O0Y A;  2XRN A;  4Q0I A;  3K2N A;  1MZU A;  2CMN A;  3FG8 A;  1V9Y A;  3C2W A;  4WUJ A;  2V0U A;  4G3K A;  3LIC A;  4F3L A;  3CI6 A;  3HJK A;  2HV1 A;  3MMH A;  4I3J A;  2QJ5 A;  1WA9 A;  1TS7 A;  2G7U A;  4BBV A;  3EEA A;  4PAU A;  1YSP A;  4JGP A;  3GDI A;  4II7 A;  3H82 B;  4IHQ A;  2PD8 A;  5F69 A;  5HZH A;  1S67 L;  4Z1W A;  4HJ3 A;  5TBM B;  4G3V A;  4WN5 A;  4B9O A;  2PD7 A;  2JKT M;  4GHI A;  3S7O A;  3UB9 A;  4R70 A;  3TJZ C;  2O9C A;  3RH8 B;  4L9F A;  4L9E A;  5J7E A;  4HJ6 A;  3MQ0 A;  5IT5 A;  2QYB A;  3VOL A;  1G28 A;  4HOI A;  4E04 A;  4L9G A;  3T4L A;  2EWW A;  3P01 A;  5MC7 A;  2W3F A;  5HWT A;  3VV4 A;  2XRO A;  3EGX C;  1ZHH B;  4YWZ A;  1STZ A;  3JVU A;  3IS2 A;  4EQ1 A;  1N9O A;  3ULF A;  3OBF A;  4XT2 A;  2K2N A;  1S4R A;  4GCZ A;  4I5S A;  3ICY A;  4MDZ A;  3D3O A;  2VX8 A;  5J4E A;  5K5B A;  5HL6 A;  3A0S A;  4QPR A;  4Q0H A;  2M1C A;  1T1A A;  3H7W B;  4EUV A;  5L8M A;  2JKR I;  4HHD A;  4ME4 A;  5EFW A;  5KSH A;  2GNX A;  4MN6 A;  4YNR A;  2XA7 S;  2A24 A;  5C5K A;  3KYQ A;  1TS6 A;  2GZA A;  4MCW A;  2JN7 A;  4R3A A;  4I3A A;  3F1P B;  3HJI A;  3LIF A;  3LR3 A;  2M7V A;  5TJJ A;  3GEC A;  2WKQ A;  3MJQ A;  2W3H A;  4HH2 A;  5HDS A;  2BAS A;  3EWK A;  4CLC E;  2L0W A;  3HCY A;  3FC7 A;  2VJW A;  4GW9 A;  3E4O A;  3BW6 A;  4BBT A;  1LSW A;  4CLC B;  3LIA A;  4I39 A;  1S1Y A;  2Z6C A;  2PHY A;  5HWW A;  2H28 A;  3UB6 A;  1P97 A;  1XJ6 A;  3F1N A;  2J3T D;  1NLY A;  3KSI A;  2Y79 A;  4KUO A;  5G4Z A;  4KUK A;  3B47 A;  5I5L A;  4GS9 A;  2KDK A;  2VGL M;  4NXB A;  4OOL A;  4ARZ A;  4F3L B;  1EW0 A;  1W63 M;  3SW1 A;  3NOP C;  3PYP A;  1X0O A;  3IBJ A;  1P9R A;  2V9A A;  2W1T A;  3TE8 A;  4HJ4 A;  4O8G A;  1P9W A;  4IUK A;  5IU1 A;  2ZOI A;  3PBO A;  3LID A;  1NLZ A;  4HY8 A;  2OOL A;  1D7E A;  2K31 A;  3JVV A;  1OTE A;  2R78 A;  3LUQ A;  2ZMF A;  4YOF A;  2V0W A;  4GHI B;  3E4Q A;  3A0V A;  4EET B;  4MN7 A;  3C8C A;  3UE3 A;  5HWV A;  2V1A A;  3MR0 A;  4OOM A;  3PBQ A;  2GX5 A;  4HI4 A;  3BWL A;  2QWS A;  3EEH A;  4R6L A;  2JKR M;  3G6O A;  2J80 A;  4H6J A;  5DF9 A;  2VLG A;  1T1B A;  3OCL A;  4CQH A;  4XT2 B;  4HP9 A;  2EA9 A;  3LYX A;  1T18 A;  3S7Q A;  2YKH A;  3PXP A;  4WF0 A;  1OT9 A;  3W2Z A;  3CUE C;  3UMD A;  2NUP C;  4KQO A;  1JNU A;  4R38 A;  3PHY A;  2EWV A;  3LIB A;  3LR4 A;  3LR0 A;  3TRC A;  3LR5 A;  4HNB A;  4UQI S;  4Y3I A;  2Y8H A;  1F9I A;  2NUT C;  5AVE A;  2L1M A;  5DJT A;  4DJ3 A;  5F5Y A;  2OWH A;  3NHQ A;  3PR6 A;  1S66 L;  4I38 A;  5A8B A;  4NEE D;  3KX0 X;  2LB5 A;  4I3I A;  4BJP A;  2PR6 A;  3KO6 A;  3KSF A;  5DJU A;  1ZTU A;  2QKP A;  4HH3 A;  4NXG A;  4HIA A;  3H82 A;  1LSX A;  1UGU A;  4B93 A;  3E4P A;  3MQO A;  2VZW A;  3CLO A;  2JHE A;  1XJ3 A;  3LI9 A;  1Y28 A;  2VKS A;  4P6Z S;  1UWP X;  2PYP A;  3CIT A;  5FL3 A;  4K08 A;  3F1O A;  2O99 A;  1N9L A;  1YSQ A;  2XA7 M;  4EXO A;  2A2L A;  3ZYT A;  5DFX A;  1MC0 A;  2P08 A;  4M4X A;  2PR5 A;  3BY9 A;  3F1N B;  3LFV A;  3K3C A;  2D02 A;  2W3G A;  4GS9 B;  4GJ4 A;  3PBT A;  4ARZ B;  2O9A A;  4FSF A;  3MF0 A;  2J3W A;  3R7W A;  4DN0 A;  3B42 A;  2W1T B;  3E98 A;  1DRM A;  1XJ4 A;  2OAQ 1;  4WL9 A;  2PT7 A;  1XFQ A;  4EU0 A;  5G4Y A;  2W0N A;  5HDD A;  1GSX A;  1LL8 A;  3R4K A;  2J3T C;  1H8M A;  3KSG A;  3DBA A;  4EER A;  4UEY A;  3VE3 A;  3T50 A;  2P04 A;  3EOI A;  1W63 Q;  1DP6 A;  2WKP A;  2KX6 A;  4NXE A;  4ZRR A;  1TS8 A;  2W3E A;  2XSS A;  3BY8 A;  4JGR A;  2KOI A;  4AFI A;  4EW7 A;  3T4S A;  4IUH A;  5HPF A;  4BWI A;  1S4S A;  3MXQ A;  2K7S A;  2VA0 A;  1F98 A;  1IFQ A;  1YKD A;  2Z6D A;  4CLC D;  4EEU A;  5HD3 A;  4H6J B;  4PKY A;  2HJE A;  1IOU A;  4Y5F A;  4IJG A;  1NWZ A;  3RFB A;  1GSV A;  1T19 A;  1YAX A;  1TD5 A;  3RTY A;  2W3D A;  4DMZ A;  4MMN A;  4PKY G;  3NOT C;  1OT6 A;  2L4R A;  1XFN A;  1KOU A;  2W1R A;  3H9W A;  2P7J A;  2INW A;  3UME A;  2O9B A;  3FPV A;  3C38 A;  4BMW A;  5LBR A;  2LB9 A;  3C30 A;  1BYW A;  2W27 A;  3IS2 B;  5HD5 A;  3P7N A;  3PBN A;  5J3W A;  3V67 A;  3A0R A;  2HF6 A;  3T4K A;  3KSH A;  4BBU A;  3BJN A;  4NXF A;  4JGQ A;  3PBS A;  5CX7 A;  5HSQ A;  1DP9 A;  2QJ7 A;  2ZOH A;  3BQ8 A;  3EGD C;  2V1B A;  1OTA A;  5HDC A;  3U2A A;  4WEL A;  3CUE A;  1DP8 A;  3BQA A;  4G3W A;  3CWF A;  4LRX C;  3LIE A;  4O01 A;  4UQI M;  3UE6 A;  2VV7 A;  1OTB A;  1UWN X;  4NKP A;  3IBR A;  4Y2F A;  2A24 B;  4PHT A;  3F1O B;  3E0Y A;  4WEK A;  1OJG A;  2B02 A;  2VV8 A;  2IA2 A;  4LRY C;  4MN5 A;  1P0Z A;  1TS0 A;  3EQU A;  3T4O A;  3NOU C;  2D01 A;  3T4Q A;  4EEP A;  4O0P A;  4L0L A;  1XJ2 A;  5TBM A;  1T1C A;  3S7N A;  3T4J A;  2I9V A;  4WEJ A;  1GSW A;  1TF1 A;  2HGV A;  4RQ9 A;  3MQQ A;  3S7P A;  4DJ2 A;  4P6Z M;  2M7U A;  2VEA A;  5AVF A;  3NJA A;  3R7W B;  3TW8 A;  2KLI A;  2GJ3 A;  1LSV A;  1F5M A;  3OCN A;  4GLQ A;  3CAX A;  3B33 A;  5DFY A;  2JKT I;  2ZBB A;  3UB8 A;  4HQA A;  3D72 A;  3EQV A;  3OOV A;  1VHM A;  3T4T A;  2FH5 A;  5F68 A;  1ODV A;  1OTI A;  1G6O A;  1N9N A;  4KQD A;  3PBR A;  2FZ0 A;  5F6A A;  2B18 A;  3VE4 A;  3H7W A;  1NRJ A;  1MKM A;  4FOF A;  5DKK A;  2OAP 1;  1S1Z A;  4Q0J A;  5AJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...