3BJNA

Crystal structure of c-terminal domain of putative transcriptional regulator from vibrio cholerae, targeted domain 79-240
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
162
structure length
162
Chain Sequence
SYETSQHNLDAVEAVLSRLQKQTGEMAAYMVPVGYRALCVSQRESMQALRCSFVQGQSQPLLRGASSKVMLAYMPAARCEKILRYFGEDPTLDKWQSEFEKIRRHGYAVSTSEIDPGVSGISAPVMKGSKLIGAISVMAPAHRVESNKQRIILHVLQAARAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of C-terminal domain of putative transcriptional regulator from Vibrio cholerae.
rcsb
source organism Vibrio cholerae o1 biovar eltor str. n16961
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, putative
total genus 48
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2007-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3bjnA00
2M7UA 3ZQ5A 1TF1A 4CQHA 5C5KA 3CI6A 2O99A 3RFBA 3IBRA 4Q0IA 3KSGA 2B18A 3S7OA 2HGVA 2W1RA 1YSPA 3G6OA 5HPFA 2ZMFA 4ETXA 3C2WA 2IA2A 4GW9A 2VEAA 4ZRRA 4YNRA 4G3KA 4Z1WA 2W1TB 3OBFA 4MMNA 4RQ9A 4G3VA 3NHQA 2LB5A 4E04A 3IBJA 4LRYC 2KOIA 4Q0HA 3DBAA 2K31A 3CITA 3KO6A 3NOUC 5HSQA 4ETZA 1MKMA 3KSFA 2Y8HA 3NOPC 3K2NA 2O9AA 3W2ZA 4Q0JA 5DFXA 2O0YA 2KLIA 3MQ0A 1MC0A 1TD5A 2W3HA 2VZWA 4LRXC 5HL6A 4LRZE 3O5YA 4FOFA 4G3WA 3R4KA 4BWIA 2O9CA 1VHMA 4Y2FA 3S7PA 4DN0A 5AJGA 5L8MA 2W3GA 4Y5FA 2W3DA 2W1TA 2VJWA 3EEAA 3MF0A 1STZA 1YKDA 3S7NA 4O8GA 4IUHA 2QYBA 4PAUA 2Y79A 1ZTUA 3NOTC 2XRNA 3TRCA 5HPIA 5TJJA 2M7VA 1YSQA 2OOLA 4MN7A 3E98A 2XROA 3S7QA 3BJNA 2O9BA 5K5BA 4DMZA 4MDZA 2W3FA 4GLQA 5LBRA 2GX5A 3MMHA 2LB9A 4MCWA 3KSIA 4Y3IA 4EUVA 4O0PA 4O01A 3D3OA 4R6LA 2W3EA 2VKSA 5DFYA 3KSHA 3VV4A 4IJGA 4IUKA 2G7UA 4ME4A 4YOFA 3E0YA 1F5MA 4QPRA 2XSSA 4EU0A 3HCYA 5I5LA 3OOVA 4R70A 3LFVA 2K2NA
chains in the Genus database with same CATH superfamily
1XFQA 3G2ZA 3N7WA 3FG8A 5CX7A 2OAQ1 5F68A 3KSGA 2B18A 2WZXA 3T1RA 3UDFA 3IX4A 4OQ0A 4DXBA 1M6KA 2IA2A 3CPTB 4ESPA 3SS3A 4NETA 3W4OA 3MZFA 3CPTA 3IBJA 5L2FA 3WS0A 3A3EA 1T1AA 4P6ZM 4E3OA 2WKHA 3PBTA 3H9WA 1K56A 1FR6A 5FI7A 4DF6A 2W3HA 3Q82A 2A3UA 1K57A 3DAVA 4FOFA 1J9MA 1OTBA 5HAPA 4NEED 3EEHA 1N9BA 4DN0A 3T1XA 3GV9A 1E3UD 4RVAA 3WS5A 1ZKJA 3SW1A 1G6OA 2XR0A 5FSRA 2Z6CA 5CTNA 4R3AA 3U4LP 4MLLA 3NOTC 3B42A 3TRCA 3MQQA 4P85A 5IS1A 4EESA 3DTKA 4IBRA 4ARZA 1KDWA 4DMZA 2VV8A 1G68A 4GDNA 2KDKA 4XXRA 4GDBA 3MFXA 5EVID 5EE8A 3UNWA 4Y0TA 3MJQA 4JF6A 1S4RA 5A91A 2HPBA 3ZCZA 4ME4A 1IFQA 4KZ4A 2L4RA 1SHVA 4CQHA 3G32A 1SKFA 1YLWA 3OPLA 4JXVA 3VMAA 1SKOA 4R38A 4X55A 1CI8A 5FAOA 3C30A 5F69A 4ETXA 1YM1A 2HV1A 2ZL1B 3SS4A 1K0KA 3WS2A 2DRWA 4LRYC 3NBLA 1FCNA 5A92A 1JNUA 3HLGA 2Y2LA 2E8JA 2E8IA 2RCXA 4ZAMA 1XGIA 2KLIA 2B02A 2XGNA 2ZQDA 1LHYA 4KG5A 1FSWA 3MZDA 4JF5A 2C6WB 3UN7A 5A93A 3O5YA 3HLBA 4D60A 4WLAA 2VGLM 3HJKA 2V0UA 5FATA 1FSYA 4HBUA 3S1YA 4UHUA 2UWXA 3V50A 2ZQ7A 4DJ2A 4QY6A 1NJ4A 1MWUA 2L1MA 4WZ5C 1ZTUA 5HPIA 1GSWA 3T1SA 1OTIA 3OPRA 2A24A 4HJ6A 1JTDA 1RP5A 4X53A 1GSVA 1LSXA 4EXOA 3IQAA 3NC8A 3N4IA 4HQAA 4MCWA 5F1GA 4Y3IA 5CTMA 2EWWA 4O0PA 4DE3A 3D3OA 2IWBA 5DKLA 4OOMA 3VSKA 1ZG4A 3IX3A 2PR6A 1KGFA 4EQ1A 3Q81A 2WKIA 2JKFA 2Y4AA 4S2NA 4IVIA 3PXPA 2OLVA 2WADA 2XF3A 1YSPA 2HZ5A 2H5SA 3C2WA 2Y2IA 3LCEA 1I5QA 1IOUA 1CF0A 1K55A 4KZ3A 4E04A 5G4YA 3DBAA 4QD4A 4IVKA 4B88A 1N9LA 3G4PA 3CLOA 1W7FA 3UB8A 5FI6A 1CEGA 1Y4OA 1ONHA 2H10A 4OOLA 5GLAA 3CJMA 5EVLA 1ONGA 5J8XA 3PYPA 3IH8A 5CEDA 5E2FA 4GNUA 4OPQA 3VP2A 5FEGA 4H8RA 3UMEA 4JXGA 1DY6A 2JCHA 3ZG5A 4MNRA 1YKDA 1GHMA 1EROA 5GLCA 5IT5A 4LV2A 1MWRA 4BJPA 3PTEA 3PBSA 1MWTA 3T4OA 3ZDJA 4MDZA 1WA9A 2V20A 3A3FA 2JKTM 2OWJA 1V9ZA 2ZMAA 2Y2GA 1C3BA 4UA9A 4MBFA 2WK0A 3FPWA 4YFMA 3MQOA 4OVDA 3T12B 5A90A 1MPLA 3UPOA 4BBVA 3RH8B 3HCYA 1H8ZA 2J8YA 4Y2FA 3O86A 3IF6B 3MFDA 3QHYA 4Q8IA 4QY5A 2YKFA 4ZJ3A 3IBRA 4Q0IA 4PM7A 2Z6DA 1TS6A 1T18A 2XD1A 5FEFA 5AQ7A 1IKGA 1K6SA 4KZ8A 5HPFA 4BBTA 1EI5A 1F98A 2HP6A 2VEAA 1S6RA 4FTXA 3C7UA 2W0NA 2X01A 1NYMA 3AGFA 2JBFA 4PM6A 2QJ5A 5HSQA 5HDDA 4DDYA 4EEUA 1YAXA 3BW6A 3NDEA 2OAP1 4Q0JA 4JBFA 2PRFA 1ZHHB 2V1ZA 4KZAA 5DTSA 3UE3A 2JKRI 2VA0A 1W8YA 4U0TA 3C38A 4G3WA 2HDRA 2V1BA 3HUMA 2V0WA 3PBNA 1FILA 3ZG7B 1YLZA 4EEPA 4EBPA 4HH3A 3VE3A 1BT5A 4L0LA 3ICYA 2VK3A 4O8GA 2VX8A 2M7VA 1WE4A 2G2UA 1S4SA 4LCMA 3ITBA 4WF0A 3BWLA 1AWIA 1Y54A 2J3WA 2FFFB 4N1XA 1L0DA 1QMFA 2GX5A 3B3XA 3MMHA 3SH8A 1D1JA 3KSIA 3NULA 4MN5A 3BY8A 2ZQAA 3UB7A 1N4OA 3O88A 2WKPA 3P09A 2ZQCA 5I5LA 5I94A 4HOIA 4GD6A 4R70A 1GSXA 3K3CA 1KE3A 1VQQA 1G5UA 2O99A 4KZ9A 3A3JA 3LIAA 3UDIA 2WKEA 4OPYA 2DNSA 4KZ7A 3BFFA 4B9OA 4Z1WA 3VFHA 3OBFA 1LL5A 3QP2A 4F94A 5DJUA 1YMSA 4GHIB 2P9VB 3KO6A 3IF6A 1OTAA 1ODVA 2R78A 4BENA 2PD8A 4NXBA 2Y2JA 3GR2A 5AQBA 4BLMA 4E3MA 2BASA 3W4PA 3S7PA 5J4EA 2JKTI 2GNXA 2W1TA 1N9NA 5KZHA 3CZDA 1VETA 2Y91A 3BYDA 3ZHHA 2Y2KA 5CRFA 1KVLA 1OTDA 2QJ7A 3QP5A 1XX2A 3UB9A 3BFDA 1W63M 2O9BA 1XJ4A 4BL3A 1TS0A 5CGXA 1H8YA 4GOGA 2WAEA 2ZOIA 4OKPA 4CLCC 1BULA 1ES5A 5HD3A 4QPRA 3N8SA 3OOVA 2ZD8A 2J3TD 3ZVWA 1PNEA 2V2FF 1F9IA 2V8CA 1XP4A 4KG2A 5FI2A 1I2WA 4X68A 3IWOA 4WL9A 2X02A 2ZC5B 3CUEA 4F3LB 4WELA 2EXAA 3ZYTA 4GW9A 4N9KA 2OWHA 5M1AA 3FC7A 5L09A 2LB5A 3G35A 1XPBA 3U2AA 3IHAA 1H5XA 4CLCD 3FWLA 1RGZA 2HDUA 1CI9A 4NG2A 1CJFA 4A5RA 3GECA 5DFXA 2MJ6A 1FOFA 1PI4A 5TFQA 1F2KA 2JC7A 1NLYA 3IF5A 3BLSA 4I38A 1LI9A 5G18A 3F1OB 3IXGA 4BWIA 3R4KA 2XEPA 2PT7A 3VOLA 4FH4A 2W3DA 4WUJA 4NXGA 3E2KA 3FV7A 2P08A 1XA7A 3Q1FA 3BFEA 5GHYA 4DDSA 4OOYA 4GS9A 3LIEA 3BJNA 1FR1A 4WZ5A 5HWVA 2LB9A 5EVIB 1GHIA 5G4ZA 3BEBA 5AVEA 2VKSA 4LCLA 3VV4A 5HFOA 2X71A 4R0QA 4X1MA 4ZBEA 1HTZA 2JHEA 2HP9A 4X1LA 3ZQ5A 3E4PA 3B47A 1BZAA 5GL9A 1XXMA 4O7DA 3HUNA 3M2JA 3GTCA 4I5SA 1ESIA 3QNBA 3B33A 3I7JA 4JXSA 3TG9A 3S4XA 4C6YA 3TE8A 5EPHA 1YT4A 1J3WA 1XJ3A 3V3RA 4KUOA 4K0WA 5BOHA 2HJ9C 4FSFA 3RXWA 4OP5A 2XA7S 1ZG6A 3W4QA 1ACFA 3NDGA 4L9FA 1EW0A 4HBTA 4EQIA 1XA1A 2O0YA 3ZG8B 4FCFA 5JYOA 5DF9A 3G34A 2ZM8A 3P7NA 4BBUA 2RL3A 3FYZA 5EOEA 4C3QA 5TBMB 1BSGA 3HJIA 1P9WA 4GJ4A 1ERMA 1CK3A 1Q2PA 2O9CA 2VGLS 1HVBA 1K56D 2D01A 4PM8A 5DTTA 1BYWA 3WS1A 4LV3A 3VSLA 4EBNA 4E3NA 1K4FA 2OSUA 3MF0A 3LR4A 2GZAA 1ALQA 4R3BA 4Y17A 2H0TA 3BLMA 5D3OA 3DWZA 1W8QA 1DRMA 1BLCA 3MZEA 3P98A 4IEDA 2JKRM 1TVFA 1S66L 3CUEC 2BG1A 1DP8A 3IS2A 2G7UA 1K57C 1NWZA 2EFUA 3H7WA 4M3KA 3CWFA 3IXHA 3FKVA 2W27A 3UE6A 3A3DA 3HLCA 2XFTA 3PHYA 1PZPA 1K4EA 4P0MA 3SOIA 2PD7A 4NKPA 3RXXA 3EQUA 5EV0A 1QMEA 2Y2OA 1Y28A 2W1RA 2EA9A 3G2YA 4R3JA 3T1QB 4CLCA 4JGPA 2ZMFA 4UEYA 5KSHA 4ZJ1A 4S2PA 4MMNA 5FDSA 4Q0HA 1YLYA 2ZJ9A 3VFFA 3CITA 4K91A 3NOUC 5L10A 2XLNA 4S2OA 3OCLA 3MXRA 1DP6A 1G28A 4MBHA 3O3VA 4LRXC 1MY8A 3JVVA 4B4ZA 4HP9A 4RX2A 3BQ8A 4EV4A 3QNCA 2NUTC 2K7SA 4BL2A 4FUWA 2WGWB 5FQKA 5GHXA 2Y79A 3ZVTA 3NY4A 4I3JA 4UA7A 4P87A 4HNBA 3Q7VA 4C75A 2IWDA 3NECA 1PRQA 2EWVA 5FQJA 1Z6FA 1A0KA 4NK3A 5CERA 4Y0UA 1NLZA 4IJGA 1TDGA 2QZ6A 5HZHA 1FIKA 1KE4A 4L9GA 2J80A 3BECA 3EGXC 2WZZA 4YWZA 1BUEA 1YMXA 4ZTKA 5F83A 1DP9A 2ZC6B 2R9WA 2XH9A 4EWFA 2PAVP 3VP1A 1P97A 4KUKA 3LR0A 2KOIA 5A8BA 2K31A 4OQGA 4PHTA 3LIBA 1W63Q 3LR5A 5HAIA 2GDNA 1L0FA 4XT2A 3T4SA 2EX9A 3SH9A 1BTLA 2ZM0A 3IWIA 4EETB 1SKOB 4MN6A 2HF6A 4KZ6A 2JKGA 3M6HA 5F82A 3W8KA 4HH2A 1VHMA 4BD0A 4EERA 2G2WA 4KQRA 3FZCA 5AQAA 3LIFA 3O87A 5CGWA 2ACGA 2VJWA 5KIZA 3OLOA 4RA7A 1L3LA 3CG5A 3IXBA 4WEJA 1RGYA 4RYEA 1H3QA 5FAPA 2A49A 1UWPX 5K5BA 1ES3A 4CJNA 1WYBA 4ARZB 3T4QA 1P0ZA 4N92A 4P6ZS 3BRMA 1I2SA 5FASA 1JTGA 4KENB 1EWZA 3DWKA 2V9AA 3V5MA 4DXCA 3R7WA 3HL9A 3D72A 3IHBA 3BQAA 1OPXA 5C5KA 5FQQA 2I9VA 5DF8A 1SDNA 5IU1A 3ITAA 2Y59A 2HGVA 1H8MA 4WEKA 4X69A 2EFXA 2XD5A 4X25A 4ZRRA 2CC1A 3WRZA 4G3VA 3MKEA 5FL3A 5HD5A 4QB8A 4WZ4A 2WKQA 5FA7A 4PKYA 4LFUA 2IWCA 1PWCA 1CQAA 4I3AA 1U60A 1V9YA 5HDSA 1FCOA 2WGWA 1OT6A 2Y2NA 4NXEA 3D9YA 3MXQA 4IHQA 4ID4A 1SCWA 2OV5A 5F6AA 3LI8A 4LRZE 1T19A 3T4KA 2HDQA 5E2EA 1T1BA 4GN2A 5HAQA 1XGJA 1PYYA 2P04A 4JGQA 2PU2A 3K3DA 3RJUA 4I3IA 1D7EA 2JE5A 3T50A 4FH2A 3OPHA 2V1AA 2FZ0A 4MN7A 2Y2MA 3S7QA 3WWXA 1K55C 1KOUA 2NUPC 3HBRA 5HW3A 2BTFP 2ZOHA 3FKWA 5CEBA 3AGDA 4JXWA 3ZG9B 3FPVA 3LGOA 5TR7A 1IYPA 1PWGA 1Z09A 3F1PB 3UDXA 3KSHA 4HIAA 5MC7A 5AQ9A 4EU0A 4JPMA 5J3WA 4DE2A 2M7UA 5JYPA 1N9OA 4KQDA 1SZVA 4Y7PA 3IS2B 1XKZA 3Q7VB 5EVEA 1S1YA 5HARA 3S7OA 4JGRA 5CGSA 5HL1A 4Y0OA 3G6OA 1JWVA 3IX8A 4GZBA 4GCZA 4YNRA 2W1TB 4RQ9A 3NHQA 3P01A 3PAEA 4R4RA 1L0GA 4CLCB 4ZDXA 3NCKA 2YKHA 3EOIA 2WGVA 4ETZA 1XJ2A 1K25A 4E3IA 5FAQA 2JN7A 5CHUA 3F1PA 3ZNTA 1K6RA 1JVJA 4ZJ2A 5E2HA 3SZTA 3D4FA 4Z9QA 5EOOA 4JGOA 2P9VA 4IBXA 1IYOA 4WYYA 1UGUA 4XUZA 5EM0A 5L8MA 3MXSA 3TSGA 4KZ5A 2W3GA 4QWOA 5M19A 3L9KA 5EM1A 3CMZA 4X56A 2FFYA 5EVIA 3C4OA 4IUHA 2QYBA 5TJJA 2OOLA 4GD8A 3V67A 5FDHA 3NI9A 3ZNYA 2QMIA 3BFGA 5FQIA 2GJ3A 4F3LA 1WYCA 1ES2A 3LI9A 4HI4A 3TW8A 1L0EA 3NIAA 3N8RA 4GKUA 5DVAA 4EUVA 1GHPA 5E2GA 1OMEA 2J7VA 2W3EA 5DFYA 3GDIA 1BLPA 3Q07A 4IUKA 3E2LA 1VEUB 1F5MA 1RCJA 2XA7M 1E4DA 4OONA 2VLGA 5FQ9A 4E3KA 3L7HA 4UQIM 4E3JA 3HVFA 3LYXA 4Y13A 4R23A 5F5YA 4FD8A 4LV1A 1K54A 1MZUA 3C4PA 1NRFA 1E25A 5GLBA 5HX9A 1NZOA 2ZQ8A 1TS8A 2ZLYA 4E6XA 2Y2PA 1PFLA 2PBYA 2P74A 3CHWP 4WN5A 1VB6A 3NOPC 4PM9A 3K2NA 2O9AA 2PYRA 1MWSA 3VE4A 3JVUA 1DJCA 2CMNA 4MEZA 2WGIA 2VZWA 4OPRA 5CXWA 3PAGA 4I39A 1NYYA 4HHDA 1PI5A 1OT9A 3QP6A 4S2LA 1TS7A 3PBRA 4K08A 1IYSA 3V3SA 1YSQA 1MKIA 2XROA 5F1FA 4BD1A 1AXBA 3LIDA 2PYPA 3UE0A 3Q7ZA 3HLDA 4HESA 1KDSA 1NXYA 4M4XA 4S2MA 2PBDP 3H7WB 4PMAA 2XSSA 5HWTA 4P6BA 2QPNA 3UB5P 1T1CA 1DJBA 3LO7A 2QKPA 3ISGA 2Y55A 4CLCE 5J7EA 3G30A 3CI6A 4OLDA 2J3TC 4EBLA 3MR0A 3C7VA 3UPNA 3LEQA 1BLHA 3PBOA 2H0YA 2XQZA 4WBGA 2XK1A 1OJ5A 1W79A 3QP1A 3LUQA 1HD8A 1JWPA 4LPZA 1XJ6A 3MS6A 4HJ3A 4HP4A 4PKYG 1NY0A 3BFCA 2EX2A 4OLGA 3DTEA 4QU3A 2FH5A 3JPUA 3C8CA 5CHMA 1YQSA 1CEFA 4B93A 1K38A 2EX8A 2INWA 3UPPA 4OPZA 1GCEA 2J9OA 1DJAA 5HDCA 4XT2B 4DKIA 3AGEA 3ZGAB 1KVMA 2XRNA 2KX6A 1NZUA 3UO9A 4DE1A 2B95A 1KGGA 5EVIC 2ZBBA 3F1NA 1ES4A 2I72A 4WMCA 3R7WB 5LBRA 4OP8A 3CAXA 5CHJA 3BY9A 3A3IA 1MBLA 2D02A 2PR5A 2ZQ9A 1LT0A 2PU4A 3E0YA 3T4LA 1IYQA 1S0WA 3HLFA 3IH9A 3HLWA 3LFVA 2K2NA 3QP4A 1TF1A 1SDEA 2ZC7A 4N9LA 1M40A 3UY6A 3RFBA 3EQVA 1GA9A 2HJEA 1LI0A 5AVFA 4L9EA 4GS9B 3IWQA 3A0RA 3HLEA 2WYXA 3SH7A 3GQZA 1O07A 4G3KA 4JF4A 4KQOA 3KYQA 4DE0A 3F1NB 2L0WA 4HY8A 4PM5A 4EW7A 2VV7A 1NRJA 4LV0A 1UWNX 3OPPA 1OTEA 4OQHA 5DJTA 3DW0A 3ULFA 3NJAA 1IKIA 1TD5A 3MSHA 3T4JA 3LICA 3DTMA 1VM1A 4AFIA 1LSVA 2ZC4B 5HL6A 2VGJA 2XDMA 2V8FA 4MBKA 4D2OA 2QHKA 4QHCA 5AJGA 2B5RA 4Y5FA 3VOYA 3SS5A 3MBZA 5HWWA 3KYEA 2XFSA 2Z2MB 2Y2HA 4X6TA 3VP0A 3UE1A 3HUOA 3MKFA 4DJ3A 3OCNA 4LGWA 4N1HA 2DCFA 4UAAA 2Z2LB 5DKKA 2WAFA 3PR6A 1P9RA 4H6JA 3T4TA 1D06A 1HZOA 1VEUA 1VETB 5TBMA 5L07A 4HEFA 4H6JB 3M2KA 4II7A 1YLTA 4KZBA 2UV0E 2WUQA 3LEZA 3QP8A 4S2KA 3GRJA 1TDLA 3A0SA 3F1OA 2HP5A 3M6BA 5KMWA 3H82B 2C5WB 3VP4A 1XFNA 1OJGA 5GHZA 3IXDA 4RX3A 2EX6A 3C5AA 1MXOA 2ZM2A 3LR3A 1K54C 1ESUA 2HDSA 2H28A 3OZHA 3KSFA 4E6WA 2Y8HA 2ZMVA 4BQMA 2M1CA 1PWDA 3G31A 2VGKA 2P7JA 4QJGA 3GMWA 1MC0A 3MQ0A 1LSWA 4Y15A 4NXFA 1FQGA 1TEMA 3A0VA 1ERQA 5IHVA 1Q2QA 5CECA 5KSCA 4S2IA 1IELA 2WKRA 2Q0OA 1STZA 1H0MA 4GHIA 4U3TA 4WMCD 4HJ4A 4PAUA 3IT9A 1HLUP 2Q9MA 3E98A 3KX0X 4LLOB 2ZL1A 2W3FA 2ZC3B 5FQMA 4YINA 1O7EA 4CPKA 4O01A 1E3UA 3ZFZA 4LENA 1S1ZA 4UQIS 4EUZA 2EXBA 2J9PA 3OC2A 3JYIA 1YLPA 1GA0A 2AVXA 3VOZA 3LY4A 1S67L 4OH0A 1KE0A 4KQQA 4U0XA 3E4QA 2BLSA 2A2LA 3IF6C 1PW1A 5DF7A 4E3LA 3UMDA 3E4OA 5EUAA 2A24B 3LY3A 3H82A 2QWSA 4WM9A 1MKMA 1FCMA 3S22A 3V39A 1X0OA 2R9XA 4OQIA 3W2ZA 5DTKA 2PHYA 4KG6A 4R1GA 3HREA 3GVBA 1LLBA 3EWKA 3RTYA 5U47A 4XUXA 4PPRA 3KYZA 3VP3A 3GSGA 3DTIA 4JKTA 3UB6A 1PZOA 4UA6A 4DRTA 2VV6A 1KGEA 2OLUA 3TOIA 3EGDC 1LL8A 3N6IA 1YPRA 3N8LA 1ZC2A 5GLDA 2DMWA 1LL9A 3EEAA 3S7NA 2Q9NA 3WRTA 3ZG0A 1IEMA 3BM6A 4B4XA 5M18A 4R4SA 4GLQA 2PDRA 4S2JA 1PIOA 5EFWA 1PW8A 4K0XA 3WS4A 4GB7A 2Y2QA 3TJZC 4R6LA 5E43A 5TGFA 1JWZA 3PBQA 4JLFA 4YOFA 5EECA 1L2SA 1BLSA 1YLJA 4BMWA 1W5DA 4S2NC 1G6AA
chains in the Genus database with same CATH topology
4L9GA 1XFQA 3K3CA 2J80A 4CLCE 5J7EA 3FG8A 5CX7A 3EGXC 3CI6A 2J3TC 2O99A 2OAQ1 3LIAA 5F68A 3KSGA 2B18A 3MR0A 4YWZA 3PBOA 2IA2A 4B9OA 1DP9A 1OJ5A 4Z1WA 3OBFA 3LUQA 1XJ6A 1P97A 4HP4A 4KUKA 3LR0A 4HJ3A 4LPZA 3IBJA 5DJUA 2KOIA 4GHIB 5A8BA 2K31A 3KO6A 1T1AA 4PKYG 4PHTA 1OTAA 1W63Q 3LIBA 1ODVA 3LR5A 4P6ZM 3PBTA 2R78A 3H9WA 2FH5A 4XT2A 3T4SA 2PD8A 2W3HA 4NXBA 3C8CA 4EETB 4FOFA 4MN6A 2HF6A 4EERA 2BASA 4HH2A 1VHMA 1OTBA 3S7PA 4NEED 3EEHA 4B93A 4DN0A 5J4EA 2JKTI 2GNXA 2INWA 3LIFA 2W1TA 1N9NA 3SW1A 1G6OA 2VJWA 5KIZA 3OLOA 5HDCA 4XT2B 2Z6CA 4R3AA 3NOTC 3B42A 1OTDA 2XRNA 2KX6A 2QJ7A 3MQQA 4WEJA 3TRCA 5IS1A 1H3QA 3UB9A 4EESA 1W63M 1UWPX 2O9BA 4ARZA 1XJ4A 5K5BA 2ZBBA 3F1NA 4DMZA 1TS0A 2VV8A 3R7WB 5LBRA 2KDKA 3MFXA 3CAXA 3BY9A 4ARZB 2ZOIA 4CLCC 3MJQA 3T4QA 1P0ZA 1S4RA 2D02A 4P6ZS 2PR5A 5HD3A 1LT0A 4ME4A 1IFQA 3E0YA 4QPRA 3T4LA 2L4RA 2V9AA 3OOVA 3LFVA 2K2NA 2J3TD 1TF1A 4CQHA 3R7WA 3D72A 3BQAA 1OPXA 5C5KA 4R38A 2I9VA 1F9IA 3RFBA 3EQVA 5IU1A 4WL9A 2HJEA 5AVFA 4L9EA 2HGVA 1H8MA 4GS9B 4WEKA 3A0RA 3C30A 3CUEA 5F69A 4F3LB 4ETXA 4WELA 2HV1A 3ZYTA 4GW9A 2OWHA 4ZRRA 3FC7A 4G3KA 4KQOA 3KYQA 4G3VA 2LB5A 3U2AA 4LRYC 5FL3A 4CLCD 5HD5A 1JNUA 2WKQA 3F1NB 2L0WA 4HY8A 4PKYA 4EW7A 2VV7A 1NRJA 3GECA 1UWNX 4I3AA 5DFXA 2MJ6A 1V9YA 1OTEA 5HDSA 5DJTA 2KLIA 3ULFA 3NJAA 2B02A 1OT6A 4NXEA 1TD5A 3MXQA 4IHQA 3LICA 3T4JA 4AFIA 1NLYA 4I38A 1LSVA 5HL6A 5F6AA 3LI8A 4LRZE 3F1OB 3O5YA 4BWIA 4WLAA 3R4KA 2VGLM 3HJKA 1T19A 2PT7A 3VOLA 3T4KA 2QHKA 2V0UA 1T1BA 5AJGA 4Y5FA 2W3DA 4WUJA 4NXGA 5HWWA 2P08A 2P04A 4DJ2A 4JGQA 2L1MA 3K3DA 4I3IA 1D7EA 3T50A 1ZTUA 5HPIA 2V1AA 4GS9A 1GSWA 2FZ0A 3LIEA 4MN7A 3S7QA 3BJNA 1OTIA 4HJ6A 2A24A 3OCNA 4DJ3A 1GSVA 1KOUA 2NUPC 1LSXA 4EXOA 5HWVA 2ZOHA 5DKKA 2LB9A 4HQAA 4MCWA 4Y3IA 3PR6A 2EWWA 3FPVA 4O0PA 5G4ZA 3D3OA 1P9RA 5AVEA 4H6JA 2VKSA 3F1PB 3T4TA 3KSHA 3VV4A 1D06A 5DKLA 4HIAA 5MC7A 4OOMA 5TBMA 4EU0A 4H6JB 5J3WA 2PR6A 4II7A 2JHEA 2M7UA 3ZQ5A 3E4PA 4EQ1A 3B47A 1N9OA 4KQDA 3A0SA 3F1OA 3IS2B 3PXPA 3H82B 1XFNA 1S1YA 3S7OA 4JGRA 4I5SA 3B33A 1YSPA 3G6OA 3C2WA 3TE8A 1OJGA 4GCZA 4YNRA 1XJ3A 2W1TB 1IOUA 4KUOA 4RQ9A 3LR3A 3NHQA 3P01A 2HJ9C 4FSFA 4E04A 2XA7S 5G4YA 4CLCB 3DBAA 2H28A 2YKHA 1N9LA 3EOIA 4L9FA 1EW0A 3CLOA 4ETZA 1XJ2A 3KSFA 2Y8HA 2ZMVA 2M1CA 2JN7A 2P7JA 3UB8A 2O0YA 1MC0A 3MQ0A 1LSWA 4NXFA 5DF9A 3F1PA 3P7NA 4BBUA 3A0VA 4OOLA 3PYPA 5TBMB 3HJIA 1P9WA 4GJ4A 2O9CA 2VGLS 4JGOA 2D01A 1UGUA 5L8MA 3UMEA 2W3GA 2WKRA 1BYWA 3MF0A 1STZA 1YKDA 2GZAA 3LR4A 4GHIA 4IUHA 4HJ4A 2QYBA 4PAUA 5IT5A 4BJPA 5TJJA 2OOLA 3V67A 3E98A 3KX0X 3PBSA 3T4OA 4LLOB 4MDZA 1DRMA 1WA9A 2W3FA 2GJ3A 4F3LA 3LI9A 4HI4A 2JKTM 2OWJA 1V9ZA 3TW8A 2JKRM 1S66L 4EUVA 3CUEC 4O01A 1DP8A 2W3EA 3FPWA 5DFYA 3GDIA 3IS2A 4IUKA 2G7UA 1NWZA 1S1ZA 3MQOA 3H7WA 1F5MA 4UQIS 3CWFA 2XA7M 2W27A 3OC2A 4BBVA 3RH8B 3HCYA 3UE6A 2VLGA 4Y2FA 1S67L 3PHYA 4UQIM 3E4QA 2PD7A 2A2LA 2YKFA 4NKPA 3LYXA 3IBRA 3EQUA 4Q0IA 2Z6DA 1TS6A 1T18A 5F5YA 1Y28A 2W1RA 2EA9A 1MZUA 4CLCA 5HPFA 4JGPA 2ZMFA 3UMDA 4BBTA 3E4OA 4UEYA 5KSHA 1F98A 2VEAA 2A24B 2W0NA 3H82A 4MMNA 2QWSA 1TS8A 4Q0HA 2QJ5A 3CITA 3NOUC 5HSQA 5HDDA 1MKMA 4WN5A 1YAXA 4EEUA 3BW6A 1VB6A 3NOPC 1X0OA 3K2NA 2O9AA 2PYRA 3VE4A 2OAP1 3W2ZA 4Q0JA 2PHYA 3JVUA 3OCLA 2CMNA 1DP6A 1G28A 1ZHHB 2VZWA 2JKRI 2VA0A 4LRXC 3UE3A 3JVVA 3EWKA 4HP9A 3C38A 3RTYA 4G3WA 2V1BA 3KYZA 2V0WA 3UB6A 3BQ8A 3PBNA 2VV6A 2NUTC 4I39A 4EEPA 4HH3A 2K7SA 3VE3A 4HHDA 4L0LA 3ICYA 3EGDC 1LL8A 1OT9A 2DMWA 3EEAA 3S7NA 4O8GA 1TS7A 3PBRA 4K08A 2Y79A 4I3JA 2VX8A 2M7VA 1YSQA 4HNBA 2XROA 1S4SA 4WF0A 3BWLA 4GLQA 2PDRA 3LIDA 2J3WA 2PYPA 2GX5A 2EWVA 3MMHA 5EFWA 3KSIA 3TJZC 4MN5A 3BY8A 3UB7A 4R6LA 4M4XA 1NLZA 2WKPA 3PBQA 4IJGA 4YOFA 3H7WB 2XSSA 4BMWA 5HZHA 5HWTA 1T1CA 5I5LA 4HOIA 4R70A 2QKPA 1GSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7U A;  3ZQ5 A;  1TF1 A;  4CQH A;  5C5K A;  3CI6 A;  2O99 A;  3RFB A;  3IBR A;  4Q0I A;  3KSG A;  2B18 A;  3S7O A;  2HGV A;  2W1R A;  1YSP A;  3G6O A;  5HPF A;  2ZMF A;  4ETX A;  3C2W A;  2IA2 A;  4GW9 A;  2VEA A;  4ZRR A;  4YNR A;  4G3K A;  4Z1W A;  2W1T B;  3OBF A;  4MMN A;  4RQ9 A;  4G3V A;  3NHQ A;  2LB5 A;  4E04 A;  3IBJ A;  4LRY C;  2KOI A;  4Q0H A;  3DBA A;  2K31 A;  3CIT A;  3KO6 A;  3NOU C;  5HSQ A;  4ETZ A;  1MKM A;  3KSF A;  2Y8H A;  3NOP C;  3K2N A;  2O9A A;  3W2Z A;  4Q0J A;  5DFX A;  2O0Y A;  2KLI A;  3MQ0 A;  1MC0 A;  1TD5 A;  2W3H A;  2VZW A;  4LRX C;  5HL6 A;  4LRZ E;  3O5Y A;  4FOF A;  4G3W A;  3R4K A;  4BWI A;  2O9C A;  1VHM A;  4Y2F A;  3S7P A;  4DN0 A;  5AJG A;  5L8M A;  2W3G A;  4Y5F A;  2W3D A;  2W1T A;  2VJW A;  3EEA A;  3MF0 A;  1STZ A;  1YKD A;  3S7N A;  4O8G A;  4IUH A;  2QYB A;  4PAU A;  2Y79 A;  1ZTU A;  3NOT C;  2XRN A;  3TRC A;  5HPI A;  5TJJ A;  2M7V A;  1YSQ A;  2OOL A;  4MN7 A;  3E98 A;  2XRO A;  3S7Q A;  3BJN A;  2O9B A;  5K5B A;  4DMZ A;  4MDZ A;  2W3F A;  4GLQ A;  5LBR A;  2GX5 A;  3MMH A;  2LB9 A;  4MCW A;  3KSI A;  4Y3I A;  4EUV A;  4O0P A;  4O01 A;  3D3O A;  4R6L A;  2W3E A;  2VKS A;  5DFY A;  3KSH A;  3VV4 A;  4IJG A;  4IUK A;  2G7U A;  4ME4 A;  4YOF A;  3E0Y A;  1F5M A;  4QPR A;  2XSS A;  4EU0 A;  3HCY A;  5I5L A;  3OOV A;  4R70 A;  3LFV A;  2K2N A; 
#chains in the Genus database with same CATH topology
 1XFQ A;  3G2Z A;  3N7W A;  3FG8 A;  5CX7 A;  2OAQ 1;  5F68 A;  3KSG A;  2B18 A;  2WZX A;  3T1R A;  3UDF A;  3IX4 A;  4OQ0 A;  4DXB A;  1M6K A;  2IA2 A;  3CPT B;  4ESP A;  3SS3 A;  4NET A;  3W4O A;  3MZF A;  3CPT A;  3IBJ A;  5L2F A;  3WS0 A;  3A3E A;  1T1A A;  4P6Z M;  4E3O A;  2WKH A;  3PBT A;  3H9W A;  1K56 A;  1FR6 A;  5FI7 A;  4DF6 A;  2W3H A;  3Q82 A;  2A3U A;  1K57 A;  3DAV A;  4FOF A;  1J9M A;  1OTB A;  5HAP A;  4NEE D;  3EEH A;  1N9B A;  4DN0 A;  3T1X A;  3GV9 A;  1E3U D;  4RVA A;  3WS5 A;  1ZKJ A;  3SW1 A;  1G6O A;  2XR0 A;  5FSR A;  2Z6C A;  5CTN A;  4R3A A;  3U4L P;  4MLL A;  3NOT C;  3B42 A;  3TRC A;  3MQQ A;  4P85 A;  5IS1 A;  4EES A;  3DTK A;  4IBR A;  4ARZ A;  1KDW A;  4DMZ A;  2VV8 A;  1G68 A;  4GDN A;  2KDK A;  4XXR A;  4GDB A;  3MFX A;  5EVI D;  5EE8 A;  3UNW A;  4Y0T A;  3MJQ A;  4JF6 A;  1S4R A;  5A91 A;  2HPB A;  3ZCZ A;  4ME4 A;  1IFQ A;  4KZ4 A;  2L4R A;  1SHV A;  4CQH A;  3G32 A;  1SKF A;  1YLW A;  3OPL A;  4JXV A;  3VMA A;  1SKO A;  4R38 A;  4X55 A;  1CI8 A;  5FAO A;  3C30 A;  5F69 A;  4ETX A;  1YM1 A;  2HV1 A;  2ZL1 B;  3SS4 A;  1K0K A;  3WS2 A;  2DRW A;  4LRY C;  3NBL A;  1FCN A;  5A92 A;  1JNU A;  3HLG A;  2Y2L A;  2E8J A;  2E8I A;  2RCX A;  4ZAM A;  1XGI A;  2KLI A;  2B02 A;  2XGN A;  2ZQD A;  1LHY A;  4KG5 A;  1FSW A;  3MZD A;  4JF5 A;  2C6W B;  3UN7 A;  5A93 A;  3O5Y A;  3HLB A;  4D60 A;  4WLA A;  2VGL M;  3HJK A;  2V0U A;  5FAT A;  1FSY A;  4HBU A;  3S1Y A;  4UHU A;  2UWX A;  3V50 A;  2ZQ7 A;  4DJ2 A;  4QY6 A;  1NJ4 A;  1MWU A;  2L1M A;  4WZ5 C;  1ZTU A;  5HPI A;  1GSW A;  3T1S A;  1OTI A;  3OPR A;  2A24 A;  4HJ6 A;  1JTD A;  1RP5 A;  4X53 A;  1GSV A;  1LSX A;  4EXO A;  3IQA A;  3NC8 A;  3N4I A;  4HQA A;  4MCW A;  5F1G A;  4Y3I A;  5CTM A;  2EWW A;  4O0P A;  4DE3 A;  3D3O A;  2IWB A;  5DKL A;  4OOM A;  3VSK A;  1ZG4 A;  3IX3 A;  2PR6 A;  1KGF A;  4EQ1 A;  3Q81 A;  2WKI A;  2JKF A;  2Y4A A;  4S2N A;  4IVI A;  3PXP A;  2OLV A;  2WAD A;  2XF3 A;  1YSP A;  2HZ5 A;  2H5S A;  3C2W A;  2Y2I A;  3LCE A;  1I5Q A;  1IOU A;  1CF0 A;  1K55 A;  4KZ3 A;  4E04 A;  5G4Y A;  3DBA A;  4QD4 A;  4IVK A;  4B88 A;  1N9L A;  3G4P A;  3CLO A;  1W7F A;  3UB8 A;  5FI6 A;  1CEG A;  1Y4O A;  1ONH A;  2H10 A;  4OOL A;  5GLA A;  3CJM A;  5EVL A;  1ONG A;  5J8X A;  3PYP A;  3IH8 A;  5CED A;  5E2F A;  4GNU A;  4OPQ A;  3VP2 A;  5FEG A;  4H8R A;  3UME A;  4JXG A;  1DY6 A;  2JCH A;  3ZG5 A;  4MNR A;  1YKD A;  1GHM A;  1ERO A;  5GLC A;  5IT5 A;  4LV2 A;  1MWR A;  4BJP A;  3PTE A;  3PBS A;  1MWT A;  3T4O A;  3ZDJ A;  4MDZ A;  1WA9 A;  2V20 A;  3A3F A;  2JKT M;  2OWJ A;  1V9Z A;  2ZMA A;  2Y2G A;  1C3B A;  4UA9 A;  4MBF A;  2WK0 A;  3FPW A;  4YFM A;  3MQO A;  4OVD A;  3T12 B;  5A90 A;  1MPL A;  3UPO A;  4BBV A;  3RH8 B;  3HCY A;  1H8Z A;  2J8Y A;  4Y2F A;  3O86 A;  3IF6 B;  3MFD A;  3QHY A;  4Q8I A;  4QY5 A;  2YKF A;  4ZJ3 A;  3IBR A;  4Q0I A;  4PM7 A;  2Z6D A;  1TS6 A;  1T18 A;  2XD1 A;  5FEF A;  5AQ7 A;  1IKG A;  1K6S A;  4KZ8 A;  5HPF A;  4BBT A;  1EI5 A;  1F98 A;  2HP6 A;  2VEA A;  1S6R A;  4FTX A;  3C7U A;  2W0N A;  2X01 A;  1NYM A;  3AGF A;  2JBF A;  4PM6 A;  2QJ5 A;  5HSQ A;  5HDD A;  4DDY A;  4EEU A;  1YAX A;  3BW6 A;  3NDE A;  2OAP 1;  4Q0J A;  4JBF A;  2PRF A;  1ZHH B;  2V1Z A;  4KZA A;  5DTS A;  3UE3 A;  2JKR I;  2VA0 A;  1W8Y A;  4U0T A;  3C38 A;  4G3W A;  2HDR A;  2V1B A;  3HUM A;  2V0W A;  3PBN A;  1FIL A;  3ZG7 B;  1YLZ A;  4EEP A;  4EBP A;  4HH3 A;  3VE3 A;  1BT5 A;  4L0L A;  3ICY A;  2VK3 A;  4O8G A;  2VX8 A;  2M7V A;  1WE4 A;  2G2U A;  1S4S A;  4LCM A;  3ITB A;  4WF0 A;  3BWL A;  1AWI A;  1Y54 A;  2J3W A;  2FFF B;  4N1X A;  1L0D A;  1QMF A;  2GX5 A;  3B3X A;  3MMH A;  3SH8 A;  1D1J A;  3KSI A;  3NUL A;  4MN5 A;  3BY8 A;  2ZQA A;  3UB7 A;  1N4O A;  3O88 A;  2WKP A;  3P09 A;  2ZQC A;  5I5L A;  5I94 A;  4HOI A;  4GD6 A;  4R70 A;  1GSX A;  3K3C A;  1KE3 A;  1VQQ A;  1G5U A;  2O99 A;  4KZ9 A;  3A3J A;  3LIA A;  3UDI A;  2WKE A;  4OPY A;  2DNS A;  4KZ7 A;  3BFF A;  4B9O A;  4Z1W A;  3VFH A;  3OBF A;  1LL5 A;  3QP2 A;  4F94 A;  5DJU A;  1YMS A;  4GHI B;  2P9V B;  3KO6 A;  3IF6 A;  1OTA A;  1ODV A;  2R78 A;  4BEN A;  2PD8 A;  4NXB A;  2Y2J A;  3GR2 A;  5AQB A;  4BLM A;  4E3M A;  2BAS A;  3W4P A;  3S7P A;  5J4E A;  2JKT I;  2GNX A;  2W1T A;  1N9N A;  5KZH A;  3CZD A;  1VET A;  2Y91 A;  3BYD A;  3ZHH A;  2Y2K A;  5CRF A;  1KVL A;  1OTD A;  2QJ7 A;  3QP5 A;  1XX2 A;  3UB9 A;  3BFD A;  1W63 M;  2O9B A;  1XJ4 A;  4BL3 A;  1TS0 A;  5CGX A;  1H8Y A;  4GOG A;  2WAE A;  2ZOI A;  4OKP A;  4CLC C;  1BUL A;  1ES5 A;  5HD3 A;  4QPR A;  3N8S A;  3OOV A;  2ZD8 A;  2J3T D;  3ZVW A;  1PNE A;  2V2F F;  1F9I A;  2V8C A;  1XP4 A;  4KG2 A;  5FI2 A;  1I2W A;  4X68 A;  3IWO A;  4WL9 A;  2X02 A;  2ZC5 B;  3CUE A;  4F3L B;  4WEL A;  2EXA A;  3ZYT A;  4GW9 A;  4N9K A;  2OWH A;  5M1A A;  3FC7 A;  5L09 A;  2LB5 A;  3G35 A;  1XPB A;  3U2A A;  3IHA A;  1H5X A;  4CLC D;  3FWL A;  1RGZ A;  2HDU A;  1CI9 A;  4NG2 A;  1CJF A;  4A5R A;  3GEC A;  5DFX A;  2MJ6 A;  1FOF A;  1PI4 A;  5TFQ A;  1F2K A;  2JC7 A;  1NLY A;  3IF5 A;  3BLS A;  4I38 A;  1LI9 A;  5G18 A;  3F1O B;  3IXG A;  4BWI A;  3R4K A;  2XEP A;  2PT7 A;  3VOL A;  4FH4 A;  2W3D A;  4WUJ A;  4NXG A;  3E2K A;  3FV7 A;  2P08 A;  1XA7 A;  3Q1F A;  3BFE A;  5GHY A;  4DDS A;  4OOY A;  4GS9 A;  3LIE A;  3BJN A;  1FR1 A;  4WZ5 A;  5HWV A;  2LB9 A;  5EVI B;  1GHI A;  5G4Z A;  3BEB A;  5AVE A;  2VKS A;  4LCL A;  3VV4 A;  5HFO A;  2X71 A;  4R0Q A;  4X1M A;  4ZBE A;  1HTZ A;  2JHE A;  2HP9 A;  4X1L A;  3ZQ5 A;  3E4P A;  3B47 A;  1BZA A;  5GL9 A;  1XXM A;  4O7D A;  3HUN A;  3M2J A;  3GTC A;  4I5S A;  1ESI A;  3QNB A;  3B33 A;  3I7J A;  4JXS A;  3TG9 A;  3S4X A;  4C6Y A;  3TE8 A;  5EPH A;  1YT4 A;  1J3W A;  1XJ3 A;  3V3R A;  4KUO A;  4K0W A;  5BOH A;  2HJ9 C;  4FSF A;  3RXW A;  4OP5 A;  2XA7 S;  1ZG6 A;  3W4Q A;  1ACF A;  3NDG A;  4L9F A;  1EW0 A;  4HBT A;  4EQI A;  1XA1 A;  2O0Y A;  3ZG8 B;  4FCF A;  5JYO A;  5DF9 A;  3G34 A;  2ZM8 A;  3P7N A;  4BBU A;  2RL3 A;  3FYZ A;  5EOE A;  4C3Q A;  5TBM B;  1BSG A;  3HJI A;  1P9W A;  4GJ4 A;  1ERM A;  1CK3 A;  1Q2P A;  2O9C A;  2VGL S;  1HVB A;  1K56 D;  2D01 A;  4PM8 A;  5DTT A;  1BYW A;  3WS1 A;  4LV3 A;  3VSL A;  4EBN A;  4E3N A;  1K4F A;  2OSU A;  3MF0 A;  3LR4 A;  2GZA A;  1ALQ A;  4R3B A;  4Y17 A;  2H0T A;  3BLM A;  5D3O A;  3DWZ A;  1W8Q A;  1DRM A;  1BLC A;  3MZE A;  3P98 A;  4IED A;  2JKR M;  1TVF A;  1S66 L;  3CUE C;  2BG1 A;  1DP8 A;  3IS2 A;  2G7U A;  1K57 C;  1NWZ A;  2EFU A;  3H7W A;  4M3K A;  3CWF A;  3IXH A;  3FKV A;  2W27 A;  3UE6 A;  3A3D A;  3HLC A;  2XFT A;  3PHY A;  1PZP A;  1K4E A;  4P0M A;  3SOI A;  2PD7 A;  4NKP A;  3RXX A;  3EQU A;  5EV0 A;  1QME A;  2Y2O A;  1Y28 A;  2W1R A;  2EA9 A;  3G2Y A;  4R3J A;  3T1Q B;  4CLC A;  4JGP A;  2ZMF A;  4UEY A;  5KSH A;  4ZJ1 A;  4S2P A;  4MMN A;  5FDS A;  4Q0H A;  1YLY A;  2ZJ9 A;  3VFF A;  3CIT A;  4K91 A;  3NOU C;  5L10 A;  2XLN A;  4S2O A;  3OCL A;  3MXR A;  1DP6 A;  1G28 A;  4MBH A;  3O3V A;  4LRX C;  1MY8 A;  3JVV A;  4B4Z A;  4HP9 A;  4RX2 A;  3BQ8 A;  4EV4 A;  3QNC A;  2NUT C;  2K7S A;  4BL2 A;  4FUW A;  2WGW B;  5FQK A;  5GHX A;  2Y79 A;  3ZVT A;  3NY4 A;  4I3J A;  4UA7 A;  4P87 A;  4HNB A;  3Q7V A;  4C75 A;  2IWD A;  3NEC A;  1PRQ A;  2EWV A;  5FQJ A;  1Z6F A;  1A0K A;  4NK3 A;  5CER A;  4Y0U A;  1NLZ A;  4IJG A;  1TDG A;  2QZ6 A;  5HZH A;  1FIK A;  1KE4 A;  4L9G A;  2J80 A;  3BEC A;  3EGX C;  2WZZ A;  4YWZ A;  1BUE A;  1YMX A;  4ZTK A;  5F83 A;  1DP9 A;  2ZC6 B;  2R9W A;  2XH9 A;  4EWF A;  2PAV P;  3VP1 A;  1P97 A;  4KUK A;  3LR0 A;  2KOI A;  5A8B A;  2K31 A;  4OQG A;  4PHT A;  3LIB A;  1W63 Q;  3LR5 A;  5HAI A;  2GDN A;  1L0F A;  4XT2 A;  3T4S A;  2EX9 A;  3SH9 A;  1BTL A;  2ZM0 A;  3IWI A;  4EET B;  1SKO B;  4MN6 A;  2HF6 A;  4KZ6 A;  2JKG A;  3M6H A;  5F82 A;  3W8K A;  4HH2 A;  1VHM A;  4BD0 A;  4EER A;  2G2W A;  4KQR A;  3FZC A;  5AQA A;  3LIF A;  3O87 A;  5CGW A;  2ACG A;  2VJW A;  5KIZ A;  3OLO A;  4RA7 A;  1L3L A;  3CG5 A;  3IXB A;  4WEJ A;  1RGY A;  4RYE A;  1H3Q A;  5FAP A;  2A49 A;  1UWP X;  5K5B A;  1ES3 A;  4CJN A;  1WYB A;  4ARZ B;  3T4Q A;  1P0Z A;  4N92 A;  4P6Z S;  3BRM A;  1I2S A;  5FAS A;  1JTG A;  4KEN B;  1EWZ A;  3DWK A;  2V9A A;  3V5M A;  4DXC A;  3R7W A;  3HL9 A;  3D72 A;  3IHB A;  3BQA A;  1OPX A;  5C5K A;  5FQQ A;  2I9V A;  5DF8 A;  1SDN A;  5IU1 A;  3ITA A;  2Y59 A;  2HGV A;  1H8M A;  4WEK A;  4X69 A;  2EFX A;  2XD5 A;  4X25 A;  4ZRR A;  2CC1 A;  3WRZ A;  4G3V A;  3MKE A;  5FL3 A;  5HD5 A;  4QB8 A;  4WZ4 A;  2WKQ A;  5FA7 A;  4PKY A;  4LFU A;  2IWC A;  1PWC A;  1CQA A;  4I3A A;  1U60 A;  1V9Y A;  5HDS A;  1FCO A;  2WGW A;  1OT6 A;  2Y2N A;  4NXE A;  3D9Y A;  3MXQ A;  4IHQ A;  4ID4 A;  1SCW A;  2OV5 A;  5F6A A;  3LI8 A;  4LRZ E;  1T19 A;  3T4K A;  2HDQ A;  5E2E A;  1T1B A;  4GN2 A;  5HAQ A;  1XGJ A;  1PYY A;  2P04 A;  4JGQ A;  2PU2 A;  3K3D A;  3RJU A;  4I3I A;  1D7E A;  2JE5 A;  3T50 A;  4FH2 A;  3OPH A;  2V1A A;  2FZ0 A;  4MN7 A;  2Y2M A;  3S7Q A;  3WWX A;  1K55 C;  1KOU A;  2NUP C;  3HBR A;  5HW3 A;  2BTF P;  2ZOH A;  3FKW A;  5CEB A;  3AGD A;  4JXW A;  3ZG9 B;  3FPV A;  3LGO A;  5TR7 A;  1IYP A;  1PWG A;  1Z09 A;  3F1P B;  3UDX A;  3KSH A;  4HIA A;  5MC7 A;  5AQ9 A;  4EU0 A;  4JPM A;  5J3W A;  4DE2 A;  2M7U A;  5JYP A;  1N9O A;  4KQD A;  1SZV A;  4Y7P A;  3IS2 B;  1XKZ A;  3Q7V B;  5EVE A;  1S1Y A;  5HAR A;  3S7O A;  4JGR A;  5CGS A;  5HL1 A;  4Y0O A;  3G6O A;  1JWV A;  3IX8 A;  4GZB A;  4GCZ A;  4YNR A;  2W1T B;  4RQ9 A;  3NHQ A;  3P01 A;  3PAE A;  4R4R A;  1L0G A;  4CLC B;  4ZDX A;  3NCK A;  2YKH A;  3EOI A;  2WGV A;  4ETZ A;  1XJ2 A;  1K25 A;  4E3I A;  5FAQ A;  2JN7 A;  5CHU A;  3F1P A;  3ZNT A;  1K6R A;  1JVJ A;  4ZJ2 A;  5E2H A;  3SZT A;  3D4F A;  4Z9Q A;  5EOO A;  4JGO A;  2P9V A;  4IBX A;  1IYO A;  4WYY A;  1UGU A;  4XUZ A;  5EM0 A;  5L8M A;  3MXS A;  3TSG A;  4KZ5 A;  2W3G A;  4QWO A;  5M19 A;  3L9K A;  5EM1 A;  3CMZ A;  4X56 A;  2FFY A;  5EVI A;  3C4O A;  4IUH A;  2QYB A;  5TJJ A;  2OOL A;  4GD8 A;  3V67 A;  5FDH A;  3NI9 A;  3ZNY A;  2QMI A;  3BFG A;  5FQI A;  2GJ3 A;  4F3L A;  1WYC A;  1ES2 A;  3LI9 A;  4HI4 A;  3TW8 A;  1L0E A;  3NIA A;  3N8R A;  4GKU A;  5DVA A;  4EUV A;  1GHP A;  5E2G A;  1OME A;  2J7V A;  2W3E A;  5DFY A;  3GDI A;  1BLP A;  3Q07 A;  4IUK A;  3E2L A;  1VEU B;  1F5M A;  1RCJ A;  2XA7 M;  1E4D A;  4OON A;  2VLG A;  5FQ9 A;  4E3K A;  3L7H A;  4UQI M;  4E3J A;  3HVF A;  3LYX A;  4Y13 A;  4R23 A;  5F5Y A;  4FD8 A;  4LV1 A;  1K54 A;  1MZU A;  3C4P A;  1NRF A;  1E25 A;  5GLB A;  5HX9 A;  1NZO A;  2ZQ8 A;  1TS8 A;  2ZLY A;  4E6X A;  2Y2P A;  1PFL A;  2PBY A;  2P74 A;  3CHW P;  4WN5 A;  1VB6 A;  3NOP C;  4PM9 A;  3K2N A;  2O9A A;  2PYR A;  1MWS A;  3VE4 A;  3JVU A;  1DJC A;  2CMN A;  4MEZ A;  2WGI A;  2VZW A;  4OPR A;  5CXW A;  3PAG A;  4I39 A;  1NYY A;  4HHD A;  1PI5 A;  1OT9 A;  3QP6 A;  4S2L A;  1TS7 A;  3PBR A;  4K08 A;  1IYS A;  3V3S A;  1YSQ A;  1MKI A;  2XRO A;  5F1F A;  4BD1 A;  1AXB A;  3LID A;  2PYP A;  3UE0 A;  3Q7Z A;  3HLD A;  4HES A;  1KDS A;  1NXY A;  4M4X A;  4S2M A;  2PBD P;  3H7W B;  4PMA A;  2XSS A;  5HWT A;  4P6B A;  2QPN A;  3UB5 P;  1T1C A;  1DJB A;  3LO7 A;  2QKP A;  3ISG A;  2Y55 A;  4CLC E;  5J7E A;  3G30 A;  3CI6 A;  4OLD A;  2J3T C;  4EBL A;  3MR0 A;  3C7V A;  3UPN A;  3LEQ A;  1BLH A;  3PBO A;  2H0Y A;  2XQZ A;  4WBG A;  2XK1 A;  1OJ5 A;  1W79 A;  3QP1 A;  3LUQ A;  1HD8 A;  1JWP A;  4LPZ A;  1XJ6 A;  3MS6 A;  4HJ3 A;  4HP4 A;  4PKY G;  1NY0 A;  3BFC A;  2EX2 A;  4OLG A;  3DTE A;  4QU3 A;  2FH5 A;  3JPU A;  3C8C A;  5CHM A;  1YQS A;  1CEF A;  4B93 A;  1K38 A;  2EX8 A;  2INW A;  3UPP A;  4OPZ A;  1GCE A;  2J9O A;  1DJA A;  5HDC A;  4XT2 B;  4DKI A;  3AGE A;  3ZGA B;  1KVM A;  2XRN A;  2KX6 A;  1NZU A;  3UO9 A;  4DE1 A;  2B95 A;  1KGG A;  5EVI C;  2ZBB A;  3F1N A;  1ES4 A;  2I72 A;  4WMC A;  3R7W B;  5LBR A;  4OP8 A;  3CAX A;  5CHJ A;  3BY9 A;  3A3I A;  1MBL A;  2D02 A;  2PR5 A;  2ZQ9 A;  1LT0 A;  2PU4 A;  3E0Y A;  3T4L A;  1IYQ A;  1S0W A;  3HLF A;  3IH9 A;  3HLW A;  3LFV A;  2K2N A;  3QP4 A;  1TF1 A;  1SDE A;  2ZC7 A;  4N9L A;  1M40 A;  3UY6 A;  3RFB A;  3EQV A;  1GA9 A;  2HJE A;  1LI0 A;  5AVF A;  4L9E A;  4GS9 B;  3IWQ A;  3A0R A;  3HLE A;  2WYX A;  3SH7 A;  3GQZ A;  1O07 A;  4G3K A;  4JF4 A;  4KQO A;  3KYQ A;  4DE0 A;  3F1N B;  2L0W A;  4HY8 A;  4PM5 A;  4EW7 A;  2VV7 A;  1NRJ A;  4LV0 A;  1UWN X;  3OPP A;  1OTE A;  4OQH A;  5DJT A;  3DW0 A;  3ULF A;  3NJA A;  1IKI A;  1TD5 A;  3MSH A;  3T4J A;  3LIC A;  3DTM A;  1VM1 A;  4AFI A;  1LSV A;  2ZC4 B;  5HL6 A;  2VGJ A;  2XDM A;  2V8F A;  4MBK A;  4D2O A;  2QHK A;  4QHC A;  5AJG A;  2B5R A;  4Y5F A;  3VOY A;  3SS5 A;  3MBZ A;  5HWW A;  3KYE A;  2XFS A;  2Z2M B;  2Y2H A;  4X6T A;  3VP0 A;  3UE1 A;  3HUO A;  3MKF A;  4DJ3 A;  3OCN A;  4LGW A;  4N1H A;  2DCF A;  4UAA A;  2Z2L B;  5DKK A;  2WAF A;  3PR6 A;  1P9R A;  4H6J A;  3T4T A;  1D06 A;  1HZO A;  1VEU A;  1VET B;  5TBM A;  5L07 A;  4HEF A;  4H6J B;  3M2K A;  4II7 A;  1YLT A;  4KZB A;  2UV0 E;  2WUQ A;  3LEZ A;  3QP8 A;  4S2K A;  3GRJ A;  1TDL A;  3A0S A;  3F1O A;  2HP5 A;  3M6B A;  5KMW A;  3H82 B;  2C5W B;  3VP4 A;  1XFN A;  1OJG A;  5GHZ A;  3IXD A;  4RX3 A;  2EX6 A;  3C5A A;  1MXO A;  2ZM2 A;  3LR3 A;  1K54 C;  1ESU A;  2HDS A;  2H28 A;  3OZH A;  3KSF A;  4E6W A;  2Y8H A;  2ZMV A;  4BQM A;  2M1C A;  1PWD A;  3G31 A;  2VGK A;  2P7J A;  4QJG A;  3GMW A;  1MC0 A;  3MQ0 A;  1LSW A;  4Y15 A;  4NXF A;  1FQG A;  1TEM A;  3A0V A;  1ERQ A;  5IHV A;  1Q2Q A;  5CEC A;  5KSC A;  4S2I A;  1IEL A;  2WKR A;  2Q0O A;  1STZ A;  1H0M A;  4GHI A;  4U3T A;  4WMC D;  4HJ4 A;  4PAU A;  3IT9 A;  1HLU P;  2Q9M A;  3E98 A;  3KX0 X;  4LLO B;  2ZL1 A;  2W3F A;  2ZC3 B;  5FQM A;  4YIN A;  1O7E A;  4CPK A;  4O01 A;  1E3U A;  3ZFZ A;  4LEN A;  1S1Z A;  4UQI S;  4EUZ A;  2EXB A;  2J9P A;  3OC2 A;  3JYI A;  1YLP A;  1GA0 A;  2AVX A;  3VOZ A;  3LY4 A;  1S67 L;  4OH0 A;  1KE0 A;  4KQQ A;  4U0X A;  3E4Q A;  2BLS A;  2A2L A;  3IF6 C;  1PW1 A;  5DF7 A;  4E3L A;  3UMD A;  3E4O A;  5EUA A;  2A24 B;  3LY3 A;  3H82 A;  2QWS A;  4WM9 A;  1MKM A;  1FCM A;  3S22 A;  3V39 A;  1X0O A;  2R9X A;  4OQI A;  3W2Z A;  5DTK A;  2PHY A;  4KG6 A;  4R1G A;  3HRE A;  3GVB A;  1LLB A;  3EWK A;  3RTY A;  5U47 A;  4XUX A;  4PPR A;  3KYZ A;  3VP3 A;  3GSG A;  3DTI A;  4JKT A;  3UB6 A;  1PZO A;  4UA6 A;  4DRT A;  2VV6 A;  1KGE A;  2OLU A;  3TOI A;  3EGD C;  1LL8 A;  3N6I A;  1YPR A;  3N8L A;  1ZC2 A;  5GLD A;  2DMW A;  1LL9 A;  3EEA A;  3S7N A;  2Q9N A;  3WRT A;  3ZG0 A;  1IEM A;  3BM6 A;  4B4X A;  5M18 A;  4R4S A;  4GLQ A;  2PDR A;  4S2J A;  1PIO A;  5EFW A;  1PW8 A;  4K0X A;  3WS4 A;  4GB7 A;  2Y2Q A;  3TJZ C;  4R6L A;  5E43 A;  5TGF A;  1JWZ A;  3PBQ A;  4JLF A;  4YOF A;  5EEC A;  1L2S A;  1BLS A;  1YLJ A;  4BMW A;  1W5D A;  4S2N C;  1G6A A; 
#chains in the Genus database with same CATH homology
 4L9G A;  1XFQ A;  3K3C A;  2J80 A;  4CLC E;  5J7E A;  3FG8 A;  5CX7 A;  3EGX C;  3CI6 A;  2J3T C;  2O99 A;  2OAQ 1;  3LIA A;  5F68 A;  3KSG A;  2B18 A;  3MR0 A;  4YWZ A;  3PBO A;  2IA2 A;  4B9O A;  1DP9 A;  1OJ5 A;  4Z1W A;  3OBF A;  3LUQ A;  1XJ6 A;  1P97 A;  4HP4 A;  4KUK A;  3LR0 A;  4HJ3 A;  4LPZ A;  3IBJ A;  5DJU A;  2KOI A;  4GHI B;  5A8B A;  2K31 A;  3KO6 A;  1T1A A;  4PKY G;  4PHT A;  1OTA A;  1W63 Q;  3LIB A;  1ODV A;  3LR5 A;  4P6Z M;  3PBT A;  2R78 A;  3H9W A;  2FH5 A;  4XT2 A;  3T4S A;  2PD8 A;  2W3H A;  4NXB A;  3C8C A;  4EET B;  4FOF A;  4MN6 A;  2HF6 A;  4EER A;  2BAS A;  4HH2 A;  1VHM A;  1OTB A;  3S7P A;  4NEE D;  3EEH A;  4B93 A;  4DN0 A;  5J4E A;  2JKT I;  2GNX A;  2INW A;  3LIF A;  2W1T A;  1N9N A;  3SW1 A;  1G6O A;  2VJW A;  5KIZ A;  3OLO A;  5HDC A;  4XT2 B;  2Z6C A;  4R3A A;  3NOT C;  3B42 A;  1OTD A;  2XRN A;  2KX6 A;  2QJ7 A;  3MQQ A;  4WEJ A;  3TRC A;  5IS1 A;  1H3Q A;  3UB9 A;  4EES A;  1W63 M;  1UWP X;  2O9B A;  4ARZ A;  1XJ4 A;  5K5B A;  2ZBB A;  3F1N A;  4DMZ A;  1TS0 A;  2VV8 A;  3R7W B;  5LBR A;  2KDK A;  3MFX A;  3CAX A;  3BY9 A;  4ARZ B;  2ZOI A;  4CLC C;  3MJQ A;  3T4Q A;  1P0Z A;  1S4R A;  2D02 A;  4P6Z S;  2PR5 A;  5HD3 A;  1LT0 A;  4ME4 A;  1IFQ A;  3E0Y A;  4QPR A;  3T4L A;  2L4R A;  2V9A A;  3OOV A;  3LFV A;  2K2N A;  2J3T D;  1TF1 A;  4CQH A;  3R7W A;  3D72 A;  3BQA A;  1OPX A;  5C5K A;  4R38 A;  2I9V A;  1F9I A;  3RFB A;  3EQV A;  5IU1 A;  4WL9 A;  2HJE A;  5AVF A;  4L9E A;  2HGV A;  1H8M A;  4GS9 B;  4WEK A;  3A0R A;  3C30 A;  3CUE A;  5F69 A;  4F3L B;  4ETX A;  4WEL A;  2HV1 A;  3ZYT A;  4GW9 A;  2OWH A;  4ZRR A;  3FC7 A;  4G3K A;  4KQO A;  3KYQ A;  4G3V A;  2LB5 A;  3U2A A;  4LRY C;  5FL3 A;  4CLC D;  5HD5 A;  1JNU A;  2WKQ A;  3F1N B;  2L0W A;  4HY8 A;  4PKY A;  4EW7 A;  2VV7 A;  1NRJ A;  3GEC A;  1UWN X;  4I3A A;  5DFX A;  2MJ6 A;  1V9Y A;  1OTE A;  5HDS A;  5DJT A;  2KLI A;  3ULF A;  3NJA A;  2B02 A;  1OT6 A;  4NXE A;  1TD5 A;  3MXQ A;  4IHQ A;  3LIC A;  3T4J A;  4AFI A;  1NLY A;  4I38 A;  1LSV A;  5HL6 A;  5F6A A;  3LI8 A;  4LRZ E;  3F1O B;  3O5Y A;  4BWI A;  4WLA A;  3R4K A;  2VGL M;  3HJK A;  1T19 A;  2PT7 A;  3VOL A;  3T4K A;  2QHK A;  2V0U A;  1T1B A;  5AJG A;  4Y5F A;  2W3D A;  4WUJ A;  4NXG A;  5HWW A;  2P08 A;  2P04 A;  4DJ2 A;  4JGQ A;  2L1M A;  3K3D A;  4I3I A;  1D7E A;  3T50 A;  1ZTU A;  5HPI A;  2V1A A;  4GS9 A;  1GSW A;  2FZ0 A;  3LIE A;  4MN7 A;  3S7Q A;  3BJN A;  1OTI A;  4HJ6 A;  2A24 A;  3OCN A;  4DJ3 A;  1GSV A;  1KOU A;  2NUP C;  1LSX A;  4EXO A;  5HWV A;  2ZOH A;  5DKK A;  2LB9 A;  4HQA A;  4MCW A;  4Y3I A;  3PR6 A;  2EWW A;  3FPV A;  4O0P A;  5G4Z A;  3D3O A;  1P9R A;  5AVE A;  4H6J A;  2VKS A;  3F1P B;  3T4T A;  3KSH A;  3VV4 A;  1D06 A;  5DKL A;  4HIA A;  5MC7 A;  4OOM A;  5TBM A;  4EU0 A;  4H6J B;  5J3W A;  2PR6 A;  4II7 A;  2JHE A;  2M7U A;  3ZQ5 A;  3E4P A;  4EQ1 A;  3B47 A;  1N9O A;  4KQD A;  3A0S A;  3F1O A;  3IS2 B;  3PXP A;  3H82 B;  1XFN A;  1S1Y A;  3S7O A;  4JGR A;  4I5S A;  3B33 A;  1YSP A;  3G6O A;  3C2W A;  3TE8 A;  1OJG A;  4GCZ A;  4YNR A;  1XJ3 A;  2W1T B;  1IOU A;  4KUO A;  4RQ9 A;  3LR3 A;  3NHQ A;  3P01 A;  2HJ9 C;  4FSF A;  4E04 A;  2XA7 S;  5G4Y A;  4CLC B;  3DBA A;  2H28 A;  2YKH A;  1N9L A;  3EOI A;  4L9F A;  1EW0 A;  3CLO A;  4ETZ A;  1XJ2 A;  3KSF A;  2Y8H A;  2ZMV A;  2M1C A;  2JN7 A;  2P7J A;  3UB8 A;  2O0Y A;  1MC0 A;  3MQ0 A;  1LSW A;  4NXF A;  5DF9 A;  3F1P A;  3P7N A;  4BBU A;  3A0V A;  4OOL A;  3PYP A;  5TBM B;  3HJI A;  1P9W A;  4GJ4 A;  2O9C A;  2VGL S;  4JGO A;  2D01 A;  1UGU A;  5L8M A;  3UME A;  2W3G A;  2WKR A;  1BYW A;  3MF0 A;  1STZ A;  1YKD A;  2GZA A;  3LR4 A;  4GHI A;  4IUH A;  4HJ4 A;  2QYB A;  4PAU A;  5IT5 A;  4BJP A;  5TJJ A;  2OOL A;  3V67 A;  3E98 A;  3KX0 X;  3PBS A;  3T4O A;  4LLO B;  4MDZ A;  1DRM A;  1WA9 A;  2W3F A;  2GJ3 A;  4F3L A;  3LI9 A;  4HI4 A;  2JKT M;  2OWJ A;  1V9Z A;  3TW8 A;  2JKR M;  1S66 L;  4EUV A;  3CUE C;  4O01 A;  1DP8 A;  2W3E A;  3FPW A;  5DFY A;  3GDI A;  3IS2 A;  4IUK A;  2G7U A;  1NWZ A;  1S1Z A;  3MQO A;  3H7W A;  1F5M A;  4UQI S;  3CWF A;  2XA7 M;  2W27 A;  3OC2 A;  4BBV A;  3RH8 B;  3HCY A;  3UE6 A;  2VLG A;  4Y2F A;  1S67 L;  3PHY A;  4UQI M;  3E4Q A;  2PD7 A;  2A2L A;  2YKF A;  4NKP A;  3LYX A;  3IBR A;  3EQU A;  4Q0I A;  2Z6D A;  1TS6 A;  1T18 A;  5F5Y A;  1Y28 A;  2W1R A;  2EA9 A;  1MZU A;  4CLC A;  5HPF A;  4JGP A;  2ZMF A;  3UMD A;  4BBT A;  3E4O A;  4UEY A;  5KSH A;  1F98 A;  2VEA A;  2A24 B;  2W0N A;  3H82 A;  4MMN A;  2QWS A;  1TS8 A;  4Q0H A;  2QJ5 A;  3CIT A;  3NOU C;  5HSQ A;  5HDD A;  1MKM A;  4WN5 A;  1YAX A;  4EEU A;  3BW6 A;  1VB6 A;  3NOP C;  1X0O A;  3K2N A;  2O9A A;  2PYR A;  3VE4 A;  2OAP 1;  3W2Z A;  4Q0J A;  2PHY A;  3JVU A;  3OCL A;  2CMN A;  1DP6 A;  1G28 A;  1ZHH B;  2VZW A;  2JKR I;  2VA0 A;  4LRX C;  3UE3 A;  3JVV A;  3EWK A;  4HP9 A;  3C38 A;  3RTY A;  4G3W A;  2V1B A;  3KYZ A;  2V0W A;  3UB6 A;  3BQ8 A;  3PBN A;  2VV6 A;  2NUT C;  4I39 A;  4EEP A;  4HH3 A;  2K7S A;  3VE3 A;  4HHD A;  4L0L A;  3ICY A;  3EGD C;  1LL8 A;  1OT9 A;  2DMW A;  3EEA A;  3S7N A;  4O8G A;  1TS7 A;  3PBR A;  4K08 A;  2Y79 A;  4I3J A;  2VX8 A;  2M7V A;  1YSQ A;  4HNB A;  2XRO A;  1S4S A;  4WF0 A;  3BWL A;  4GLQ A;  2PDR A;  3LID A;  2J3W A;  2PYP A;  2GX5 A;  2EWV A;  3MMH A;  5EFW A;  3KSI A;  3TJZ C;  4MN5 A;  3BY8 A;  3UB7 A;  4R6L A;  4M4X A;  1NLZ A;  2WKP A;  3PBQ A;  4IJG A;  4YOF A;  3H7W B;  2XSS A;  4BMW A;  5HZH A;  5HWT A;  1T1C A;  5I5L A;  4HOI A;  4R70 A;  2QKP A;  1GSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...