3BJNA

Crystal structure of c-terminal domain of putative transcriptional regulator from vibrio cholerae, targeted domain 79-240
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
162
structure length
162
Chain Sequence
SYETSQHNLDAVEAVLSRLQKQTGEMAAYMVPVGYRALCVSQRESMQALRCSFVQGQSQPLLRGASSKVMLAYMPAARCEKILRYFGEDPTLDKWQSEFEKIRRHGYAVSTSEIDPGVSGISAPVMKGSKLIGAISVMAPAHRVESNKQRIILHVLQAARAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, putative
publication title Crystal structure of C-terminal domain of putative transcriptional regulator from Vibrio cholerae.
rcsb
source organism Vibrio cholerae o1 biovar eltor str. n16961
molecule tags Transcription regulator
total genus 48
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2007-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3bjnA00
4YOFA 3NOUC 5HSQA 4R70A 3MF0A 2M7VA 3OOVA 2O99A 4IUKA 2O9CA 2VKSA 4G3KA 2W3HA 4EU0A 4Z1WA 5HPIA 4MN7A 2W1RA 3ZQ5A 3CI6A 5C5KA 3S7QA 2XRNA 4YNRA 4CQHA 5DFYA 3IBJA 1MC0A 1VHMA 2IA2A 4FOFA 2HGVA 5HL6A 3CITA 4DN0A 2LB9A 4LRXC 4GLQA 3NOTC 2XROA 3S7NA 4BWIA 2W3DA 3KSHA 4G3WA 3S7PA 4E04A 3R4KA 3EEAA 2K2NA 4Q0HA 2W3FA 1YSQA 2B18A 4IJGA 2W1TB 5AJGA 2OOLA 3BJNA 3LFVA 3C2WA 3KSIA 1YSPA 4MDZA 2O9AA 4Q0JA 2W3EA 1ZTUA 2QYBA 3KSFA 1TF1A 4ZRRA 3S7OA 4PAUA 1F5MA 3W2ZA 4MCWA 5L8MA 2VEAA 2XSSA 2Y8HA 3NOPC 3TRCA 4Q0IA 4Y2FA 2ZMFA 4QPRA 4R6LA 4Y5FA 4Y3IA 3KO6A 3NHQA 5TJJA 2VZWA 5K5BA 4O01A 3OBFA 3MQ0A 4GW9A 4ME4A 2O9BA 2VJWA 1MKMA 1STZA 2O0YA 4ETZA 1TD5A 4O8GA 1YKDA 4MMNA 4LRZE 3MMHA 3RFBA 4O0PA 3IBRA 3G6OA 2LB5A 2G7UA 4DMZA 5LBRA 2K31A 2W1TA 2GX5A 3HCYA 3KSGA 3E98A 3DBAA 2M7UA 3E0YA 3K2NA 4IUHA 4EUVA 3O5YA 4RQ9A 5HPFA 2W3GA 4G3VA 3VV4A 2KOIA 2Y79A 5DFXA 5I5LA 4ETXA 3D3OA 2KLIA 4LRYC
chains in the Genus database with same CATH superfamily
4KZAA 3CZDA 1M6KA 5EOOA 3C4OA 2A24B 4IUKA 2HDQA 3PTEA 3GTCA 3HVFA 1G28A 4OOLA 1XGIA 3ZQ5A 3CJMA 1BZAA 4YNRA 4QU3A 3F1OA 1FCNA 4IVKA 2PD8A 2JKTI 3T4OA 2PAVP 2VV7A 3HUMA 2A2LA 5CTNA 4HH2A 3MSHA 2PDRA 3ITBA 2JN7A 5DKLA 2V8CA 1JWZA 3PAEA 3I7JA 1PW8A 4OQGA 5A91A 3VOLA 3IF6C 3QP5A 4OPQA 3VSLA 3IWOA 3ZYTA 3K3DA 2XD1A 5HZHA 4ARZA 5GLBA 5HWTA 5AVFA 3N8LA 2ZC6B 1PRQA 4Y5FA 4A5RA 3NY4A 1WE4A 3HJKA 3HLDA 4JBFA 1G6AA 4HBUA 4H6JA 4I3JA 3FWLA 2VV8A 3DTEA 1MWRA 2ZC7A 1K54C 1SDNA 2ZQ9A 3LY3A 5EM1A 3KSGA 2QJ5A 2DRWA 1N9LA 5HPFA 3RH8B 1K57C 1PZOA 1S67L 2WKRA 3BM6A 3P98A 1PNEA 1Q2QA 5GL9A 3LI9A 4I5SA 1YMSA 1LLBA 1PYYA 2V1ZA 5U47A 3UB5P 3WWXA 5CGXA 4R38A 4HIAA 1PI4A 5GLAA 4QHCA 4S2IA 3ZHHA 2VX8A 1JNUA 4CQHA 4X68A 1IFQA 1MC0A 1ESIA 3DWZA 3LIBA 5E2FA 4DDYA 1YLPA 3LUQA 4XXRA 3EQUA 3LR5A 4B88A 5A8BA 1ES5A 3IXGA 4G3WA 1LT0A 4Q0HA 5GHZA 3AGFA 5FI2A 4JF4A 2PBYA 1YQSA 3ZG5A 3NDGA 1NJ4A 3FZCA 4WL9A 2CC1A 1IEMA 2ZQAA 1TF1A 4ZRRA 2J8YA 1T1AA 5J4EA 4X55A 3SS5A 2W27A 2A49A 2HP6A 3PBSA 2ZMFA 3FKWA 3ULFA 4EV4A 2NUPC 1S1YA 1ODVA 3JPUA 4YINA 1KOUA 1IYQA 1H3QA 4Z9QA 5AQ7A 1QMFA 3OPHA 3U4LP 1HZOA 3IXBA 5CGWA 2UWXA 4LRZE 1CI8A 3IBRA 1S1ZA 4KZ3A 2PBDP 2J3WA 3R7WB 3G34A 3GR2A 3AGDA 3ZNYA 1P0ZA 1T19A 4GOGA 3N8SA 1OTIA 1K56A 4PM7A 1EROA 4WZ5C 4ETXA 5HAIA 4LCLA 2KDKA 3P01A 2EWWA 2Y2GA 1BYWA 3VMAA 5M18A 3IF6A 4QWOA 4U0XA 2O99A 3LIEA 1YLYA 3BFEA 4C3QA 3LO7A 3RXXA 2OWJA 4B4ZA 4Y0TA 3FKVA 3CI6A 1K4EA 3VE3A 5F1FA 1D7EA 1NLYA 3VOYA 2Y2PA 2HV1A 4S2NA 2W3DA 3T4SA 4DXBA 2I72A 5HDDA 1HVBA 3T50A 4D2OA 3NDEA 1YSQA 1W7FA 5FEGA 2B18A 3AGEA 3LFVA 4EERA 2O9AA 4UQIS 3VFHA 2J9PA 4N9KA 5FEFA 2XSSA 1I2SA 3KO6A 1HTZA 3S22A 2ZQCA 3F1NA 3PBOA 4I3IA 5HFOA 3G30A 3UE6A 3MQQA 3MZDA 2JBFA 4R1GA 5F69A 3MQOA 4EWFA 3RTYA 5FQIA 1TVFA 4JF5A 2R78A 1OT9A 4XUZA 1XFQA 2VK3A 3NCKA 4PMAA 4RX3A 5AQ9A 4MN6A 1G5UA 3W4PA 5DF8A 2Y2QA 2RCXA 1E3UA 3EGDC 3M6BA 2ZQ8A 5HAQA 5CEBA 1JWVA 3G2ZA 4WUJA 5IU1A 4X1MA 4YOFA 3TE8A 2JHEA 4JXWA 1K56D 3UN7A 4C75A 4XT2B 3IWIA 3ZDJA 4E3MA 5CTMA 3T4KA 1BT5A 4E3OA 2YKFA 2EX6A 4GDBA 1LL8A 3IBJA 1VB6A 4FTXA 2XFSA 4H6JB 1WYBA 4FCFA 3VP2A 1FQGA 3PR6A 3IXDA 3S7PA 3V67A 3QP8A 2K2NA 5L2FA 3A0RA 5E2GA 3BWLA 2P9VA 2Q9NA 3VOZA 1BTLA 4K0WA 1ZC2A 3WS0A 1OJ5A 1GSVA 3MZEA 1JTGA 5CHUA 4C6YA 1S4RA 1DP6A 3LIFA 3TRCA 2ACGA 1XA7A 4YFMA 2VZWA 3KYZA 2OSUA 3BECA 3BQ8A 3MZFA 2O0YA 4S2PA 4RVAA 4NG2A 1NYYA 4E3NA 1BULA 3MFDA 3OLOA 4KZ8A 5CGSA 3C38A 3OCLA 1TDGA 1T18A 5CHJA 2VGJA 3W4OA 1CK3A 3WRZA 2PR5A 4EUVA 3JVVA 2ZQDA 1PI5A 2UV0E 4BL3A 2KLIA 4ZJ1A 4KG6A 1SDEA 3HBRA 1ZKJA 3O88A 3GMWA 3UB9A 4JPMA 1XFNA 1E3UD 2Z6DA 1YAXA 3LY4A 1ONHA 4JGRA 3P09A 5HPIA 1L0DA 4P0MA 2XRNA 5IT5A 3W8KA 4F94A 4ZDXA 2W0NA 5TR7A 2QJ7A 4RYEA 5BOHA 4GN2A 1XJ2A 4X1LA 3S7NA 3UPPA 4EESA 1BLPA 5G4ZA 4EEPA 3FPWA 5EE8A 5EVEA 5IS1A 4MLLA 1GA9A 3UB6A 3IX8A 2PD7A 2W3EA 1DJAA 5HARA 4BJPA 4UEYA 3PXPA 3UY6A 2WKHA 3TJZC 3O3VA 3NHQA 4KG2A 1KVLA 5EFWA 5CHMA 4O7DA 4NKPA 5EVIB 4HBTA 3HL9A 3C7VA 3E2LA 4BBTA 1ESUA 5GLCA 4WZ4A 5HD3A 1LI0A 4EW7A 3UDIA 4LFUA 3MS6A 3MMHA 4FD8A 1D1JA 5GLDA 4R4RA 3C7UA 2K31A 4EEUA 4K91A 3TOIA 4OKPA 3K2NA 2P74A 5IHVA 2ZQ7A 3MKEA 4S2MA 1JWPA 2OAP1 2EXAA 1DRMA 2XDMA 1GHIA 4IEDA 3ZVTA 4L9FA 3G4PA 3SH9A 2JKGA 2ZOIA 1CI9A 5HX9A 5MC7A 5E2HA 4JLFA 2PHYA 2IA2A 4LENA 3F1PB 4CLCA 1RGYA 2ZLYA 5DKKA 3GRJA 5EOEA 4HQAA 2W3FA 5FAOA 2DNSA 3UPOA 4E3KA 1FSYA 3G2YA 1NY0A 3WS1A 2Y91A 4Y2FA 3N8RA 3EEHA 3IS2A 1ZHHB 4KUOA 3LIAA 3Q7ZA 1XPBA 4BD1A 4FH4A 1XJ4A 3ZNTA 4L0LA 3ZGAB 1BLHA 1F2KA 1TD5A 3T1XA 4WLAA 4XT2A 3BLSA 3N4IA 4E3LA 5DF9A 2G7UA 3A3EA 4EXOA 1K4FA 3KYEA 4MNRA 3QHYA 3LR3A 1U60A 4KZ5A 4OH0A 5FI6A 1XJ3A 2W3GA 4S2NC 2A3UA 5EECA 1FCMA 2L0WA 3D3OA 2P9VB 3QP1A 1LL5A 1YLTA 5HSQA 3TSGA 3Q7VB 3UB7A 1S0WA 1MWTA 4LLOB 2OAQ1 4CJNA 5DJTA 2XF3A 1L0EA 3E4QA 3N7WA 1XJ6A 4MN7A 2W1RA 4EBNA 2J3TC 4DJ2A 1XX2A 1MKIA 3S4XA 2V1BA 5F83A 5HL6A 3CITA 4U3TA 4N92A 1E25A 2M1CA 4OOYA 4X56A 4KZBA 4HJ4A 4E04A 2Y59A 1H5XA 4OP5A 4CLCD 2WGWB 4IJGA 3C2WA 1HLUP 1QMEA 2OLVA 1UGUA 4B93A 5E2EA 4HOIA 4P85A 5FA7A 4OQIA 3IXHA 5K5BA 1PWCA 5KIZA 4BD0A 4GW9A 3T1SA 4Y0OA 1MY8A 5CERA 2L4RA 3DAVA 4X25A 3GECA 1TS0A 4BMWA 1YKDA 4Y15A 1VEUA 2OLUA 1FR1A 5GHYA 3V50A 3PYPA 1MWUA 5F82A 3V5MA 1IOUA 1RP5A 1Z6FA 1LI9A 2ZMVA 2WAEA 1EWZA 4ZJ2A 2P7JA 5F5YA 1YLWA 3BFFA 2ZC3B 2IWDA 4DE0A 4X69A 4WM9A 1NRJA 2QPNA 3OOVA 4JGOA 1KDSA 4UHUA 2Y2HA 5FI7A 4FSFA 1LSVA 5C5KA 1CQAA 2BTFP 1CEGA 3BY9A 4FOFA 1MXOA 4P6BA 1LSXA 4PHTA 4CPKA 4DN0A 4LRXC 3TW8A 2WKIA 3A0VA 1SZVA 2K7SA 1OT6A 4KZ9A 3M2JA 3SH8A 1Y54A 5EVIA 1H0MA 3KSIA 3BEBA 5HDSA 4OVDA 3QNBA 1TDLA 3DW0A 1HD8A 4WELA 4L9GA 2VEAA 2Y8HA 3UE1A 2KX6A 2Y2NA 2QWSA 3PBNA 1S4SA 3LCEA 2Z2LB 3GSGA 1XP4A 5DVAA 3MQ0A 3Q82A 4JF6A 5I94A 3VP0A 4GCZA 1SKFA 3E4PA 2QHKA 4CLCB 5AQAA 4LCMA 1YPRA 3A3IA 2C6WB 3HLBA 2ZMAA 1N9BA 4OP8A 3E98A 2WADA 4HP4A 1JVJA 3PBTA 4FUWA 2R9WA 4K08A 3F1PA 2G2UA 4PM6A 3T4LA 3EGXC 1OJGA 4WBGA 1UWNX 4EBPA 5M19A 3OCNA 4G3KA 2W3HA 1IYPA 1VETA 3IS2B 3S7QA 4L9EA 1LHYA 5KMWA 5DTKA 2Y55A 2ZL1B 4QB8A 2V20A 1IYOA 1FILA 1K38A 5FDSA 4H8RA 1PIOA 3C4PA 3IWQA 3WS5A 2ZBBA 5EUAA 3OC2A 4OQ0A 3EEAA 4HI4A 3HLGA 3LICA 4HEFA 4KQDA 3IQAA 3EWKA 1CEFA 4MN5A 5AJGA 5FQ9A 4MDZA 4DE2A 1S6RA 4R3BA 4Q0JA 1VQQA 2ZM8A 4NXBA 5EVID 1BLSA 4GS9A 1C3BA 1SKOA 2B95A 4R6LA 4S2LA 5TJJA 3O86A 3PBQA 4OOMA 2PYRA 4KZ4A 4O01A 5F68A 2QZ6A 3DTIA 3OZHA 1J3WA 1GCEA 2VJWA 3IX4A 4ETZA 3Q7VA 2E8JA 3B47A 2B5RA 4EETB 5HDCA 2JKFA 3ITAA 3JVUA 3ZG7B 4CLCC 3DBAA 1TEMA 2VA0A 2ZOHA 3CUEA 4S2JA 4BBUA 3MKFA 2J3TD 3NC8A 1MPLA 3PAGA 5CRFA 3Q07A 1TS6A 3QP2A 2J7VA 5L10A 1L2SA 4LV1A 3WS2A 3BFCA 2M7VA 3HREA 1H8ZA 2WGWA 3RJUA 1XGJA 2XQZA 2I9VA 2WYXA 2H0YA 1NWZA 4UQIM 4OPRA 3B33A 3VP1A 4IHQA 4KZ7A 3SH7A 1FIKA 1ZG4A 3C8CA 2WK0A 2PYPA 5DJUA 1T1BA 4X53A 2XROA 5L07A 1PZPA 1LSWA 2C5WB 1VEUB 2PU2A 3LYXA 2IWBA 3H82B 1W79A 2RL3A 3HLFA 3UDFA 4IVIA 1S66L 1TS8A 2XEPA 4P6ZS 2X71A 3M2KA 4NK3A 5L09A 4M4XA 4PAUA 4RX2A 3W2ZA 4BBVA 4MCWA 4E3JA 4R3AA 2H10A 3PHYA 2JKRM 3LIDA 2XK1A 3C30A 3FPVA 2ZM2A 3ZG0A 2PR6A 3BQAA 1KGGA 4LV3A 4ZTKA 3IF5A 3ZG9B 3LR4A 4UA9A 1N9NA 4O8GA 1O07A 2YKHA 1W8QA 4R4SA 2ZC4B 3HCYA 2GX5A 4X6TA 5F1GA 1GA0A 1O7EA 2JKRI 4PPRA 3MXQA 3GDIA 3FV7A 4WF0A 1NXYA 1OTDA 2WUQA 2H5SA 1EW0A 3MF0A 1N9OA 5JYPA 1ES3A 2V9AA 4WMCA 5DF7A 4EQIA 1PFLA 3BYDA 5HWWA 3UB8A 2O9CA 3A3DA 1ZG6A 3TG9A 5KZHA 4DJ3A 3T1RA 2AVXA 4QY6A 5DFYA 1KVMA 1V9ZA 2ZJ9A 3CWFA 2Q9MA 1L0FA 2HGVA 1NZUA 4HH3A 2R9XA 1L3LA 5D3OA 4GLQA 3NOTC 2Y2OA 3SS3A 3E2KA 4ZJ3A 2FFFB 2VGLS 2B02A 2H28A 2P08A 4DDSA 3FG8A 1ACFA 1Q2PA 2XD5A 5HD5A 2QYBA 4N1HA 5GHXA 1W63Q 1OPXA 3VSKA 2ZM0A 4GHIA 5TBMA 4Y13A 2Y2JA 5JYOA 4Y3IA 1T1CA 5CECA 5TGFA 4HJ3A 4DF6A 5DTSA 1VETB 3GQZA 1P9WA 3UMEA 2Y4AA 1FSWA 4BL2A 2O9BA 2WAFA 1STZA 1KGFA 1YT4A 4GD6A 2XA7S 2EWVA 4MBHA 3E4OA 3UE0A 2Y2KA 4WN5A 2LB5A 5LBRA 5EVLA 2W1TA 3CHWP 4P6ZM 3D9YA 1E4DA 2GJ3A 1MZUA 4OONA 1K6SA 4G3VA 2ZL1A 4NXEA 5EV0A 1I5QA 3OPLA 3V3SA 3SZTA 5EVIC 4MEZA 3KX0X 4F3LA 4GS9B 4UA6A 2WZZA 2VKSA 1SKOB 1EI5A 3BW6A 3A3FA 3U2AA 4E6XA 4MBKA 4WMCD 5G4YA 4HNBA 3CMZA 1BUEA 2CMNA 1H8MA 5A93A 5FQJA 4LPZA 1OMEA 4K0XA 5KSHA 5FQKA 5CEDA 4DRTA 1YM1A 2JE5A 1XXMA 1OTBA 3SW1A 4IBXA 3BJNA 1K55A 3UPNA 2V8FA 3SOIA 4UA7A 2E8IA 2Q0OA 2EX8A 3EOIA 4EQ1A 4JXVA 1WA9A 4R3JA 4N1XA 3GVBA 2BLSA 3WRTA 1CJFA 1DJBA 3LEZA 2Y2MA 4S2OA 2WGIA 2Y2LA 3IHBA 1PWDA 4QY5A 3ICYA 4WEJA 3Q81A 1FOFA 3A3JA 2MJ6A 2Z2MB 2INWA 3BY8A 2VGLM 4WYYA 4PM5A 4DMZA 4PKYG 3K3CA 3C5AA 2Z6CA 3L7HA 3LGOA 2FFYA 2HDRA 2EFXA 2EXBA 1W63M 3D4FA 4ZAMA 4NEED 3VV4A 2Y79A 3H7WB 1J9MA 4ZBEA 3VP4A 4LRYC 4R0QA 3ZFZA 2EA9A 3LEQA 3IH9A 2XFTA 3SS4A 2Y2IA 1YLJA 4HHDA 2HPBA 3B3XA 3MXRA 3H82A 3V3RA 2PRFA 2X01A 4Z1WA 3MR0A 3LI8A 2XA7M 4JKTA 1XKZA 2EFUA 4S2KA 5J7EA 3G32A 1KDWA 3OPPA 2XH9A 4MBFA 3HLEA 4DE3A 1N4OA 1IKGA 1P97A 1OTAA 4NXGA 1ZTUA 5FDHA 3T1QB 3VE4A 5J3WA 2G2WA 3S7OA 2OWHA 2DMWA 3NOPC 3CUEC 3MFXA 4Q0IA 1X0OA 3FC7A 1NZOA 1UWPX 4HJ6A 3T4TA 1FR6A 4Y7PA 3MJQA 3HLWA 4OQHA 3CG5A 4IBRA 2WZXA 1VM1A 4DKIA 2BG1A 2FZ0A 4WEKA 1L0GA 2HJ9C 2EX2A 3CPTA 2VGKA 4FH2A 2JC7A 1K0KA 5AVEA 4E3IA 1CF0A 3GV9A 2GZAA 3E0YA 4IUHA 1BSGA 3UDXA 3NBLA 1K25A 3O5YA 5HWVA 5FAPA 1GHMA 2HP5A 3WS4A 4PM8A 3NOUC 3MXSA 5G18A 4U0TA 5F6AA 1ES4A 2QKPA 4GHIB 5TBMB 4PM9A 1GSWA 4KG5A 1K54A 1RCJA 3CAXA 1A0KA 4GDNA 3A0SA 5E43A 2LB9A 3NJAA 2D01A 2HF6A 4P87A 4BWIA 1K57A 3HUOA 2BASA 1IYSA 3OPRA 2W1TB 2XR0A 3P7NA 1DY6A 3F1OB 2V0UA 3D72A 4N9LA 4KQOA 4JXGA 4OPZA 3RXWA 1H8YA 1OTEA 2JCHA 1DP8A 3NECA 1DJCA 2A24A 2WKQA 5EPHA 3UE3A 1MWSA 4UAAA 4F3LB 3VFFA 3UMDA 5J8XA 4II7A 5FQMA 3PBRA 1ERQA 2L1MA 1YMXA 1LL9A 4ME4A 1WYCA 2ZD8A 2V2FF 4LV2A 3M6HA 5KSCA 5TFQA 1RGZA 1NYMA 2NUTC 4GZBA 3RFBA 4O0PA 3VP3A 3G6OA 4ARZB 3N6IA 1I2WA 4PKYA 4Q8IA 1JTDA 4OPYA 2XGNA 2M7UA 3BLMA 4QJGA 1NRFA 1Y4OA 4I38A 5DFXA 1P9RA 1V9YA 3W4QA 2J80A 4DE1A 1ALQA 3IH8A 4KZ6A 4R70A 4JGPA 1MBLA 2OV5A 3ZG8B 2HJEA 4AFIA 1PWGA 2PU4A 4RA7A 4EU0A 4GJ4A 2WGVA 1KE3A 1G6OA 1IELA 4B9OA 4DXCA 1SCWA 5FSRA 1ONGA 4KENB 4Y17A 3IHAA 1TS7A 3V39A 2ZC5B 3KSHA 3S1YA 4D60A 3LR0A 4WZ5A 3R4KA 1F9IA 2HZ5A 5HW3A 4ID4A 4GNUA 4KQRA 3IX3A 4BLMA 3NI9A 1AXBA 1DP9A 5EM0A 4GB7A 5FASA 3HLCA 2H0TA 3EQVA 1Y28A 3B42A 3BFGA 5AQBA 3UNWA 4Y0UA 1GSXA 1Z09A 3BRMA 1F5MA 4M3KA 5L8MA 5CX7A 2HP9A 3NIAA 5FL3A 4QPRA 3O87A 3ZCZA 4HESA 3CLOA 1K6RA 3Q1FA 3H7WA 2J9OA 2WKEA 3OBFA 4KQQA 3MBZA 3NULA 1KE4A 3FYZA 1MKMA 1KE0A 1ES2A 2XLNA 4NXFA 3DTKA 4LV0A 2VLGA 2HDUA 1XA1A 3IT9A 4JGQA 3ZVWA 1SHVA 4RQ9A 2D02A 1NLZA 2KOIA 4GKUA 3T4QA 4QD4A 5M1AA 1K55C 5A92A 4EBLA 5FAQA 5HL1A 3HUNA 4OLGA 4EUZA 1F98A 4ESPA 2IWCA 5CXWA 1VHMA 1M40A 1GHPA 3G31A 4BQMA 4JXSA 2V0WA 3HJIA 2QMIA 4NETA 3T12B 4HY8A 3R7WA 2WKPA 1IKIA 3IF6B 3CPTB 2DCFA 2HDSA 1YLZA 2V1AA 1FCOA 4LGWA 2OOLA 1D06A 3T4JA 1YSPA 1G68A 1W5DA 2GNXA 2FH5A 3DWKA 4E6WA 3KSFA 1BLCA 1AWIA 3QNCA 1KGEA 3UO9A 2PT7A 2GDNA 3L9KA 5DTTA 4R23A 4I3AA 3BFDA 4I39A 3G35A 4OLDA 3ISGA 2X02A 2EX9A 4GD8A 4XUXA 1PW1A 5FATA 4CLCE 3QP4A 3JYIA 2P04A 3H9WA 1W8YA 4MMNA 5A90A 4KUKA 5HAPA 4BENA 3KYQA 3QP6A 5FQQA 2VV6A 4HP9A 2JKTM 3F1NB 4YWZA 3DTMA 1ERMA 5I5LA 4B4XA
chains in the Genus database with same CATH topology
2EA9A 3EGXC 1OJGA 1UWNX 3UB9A 4HHDA 1XFNA 2Z6DA 3OCNA 1YAXA 3H82A 2A24B 4IUKA 4JGRA 4G3KA 1G28A 2W3HA 4Z1WA 5HPIA 4OOLA 3MR0A 3IS2B 3ZQ5A 3LI8A 3S7QA 2XRNA 2XA7M 4L9EA 4YNRA 5IT5A 3F1OA 2PD8A 2JKTI 2W0NA 3T4OA 2VV7A 5J7EA 2QJ7A 1XJ2A 2A2LA 3S7NA 4EESA 2ZBBA 4HH2A 3OC2A 5G4ZA 3EEAA 4HI4A 4EEPA 2PDRA 3LICA 3FPWA 4KQDA 2JN7A 5DKLA 3EWKA 5IS1A 1P97A 1OTAA 4MN5A 5AJGA 4NXGA 3UB6A 3VOLA 4MDZA 4Q0JA 2PD7A 2W3EA 1ZTUA 3VE4A 5J3WA 3S7OA 4NXBA 2OWHA 3ZYTA 4BJPA 4GS9A 2DMWA 3K3DA 5HZHA 4ARZA 4UEYA 5HWTA 3NOPC 3CUEC 3MFXA 3PXPA 4Q0IA 3TJZC 5AVFA 1X0OA 4R6LA 4Y5FA 3FC7A 1UWPX 3NHQA 4HJ6A 5TJJA 3HJKA 3PBQA 4OOMA 2PYRA 5EFWA 3T4TA 4O01A 4NKPA 4BBTA 5F68A 4H6JA 3MJQA 4I3JA 5HD3A 4EW7A 2VJWA 2VV8A 4ETZA 3B47A 4EETB 5HDCA 2FZ0A 3MMHA 4WEKA 2HJ9C 2K31A 5AVEA 4EEUA 3JVUA 3KSGA 2GZAA 2QJ5A 4CLCC 3DBAA 2VA0A 2ZOHA 3E0YA 3K2NA 3CUEA 4IUHA 4BBUA 1N9LA 2J3TD 3O5YA 5HPFA 5HWVA 1TS6A 3RH8B 2OAP1 1S67L 2WKRA 1DRMA 3NOUC 4L9FA 3LI9A 4I5SA 2M7VA 4R38A 5F6AA 2ZOIA 4HIAA 2QKPA 4GHIB 5TBMB 2I9VA 1GSWA 1NWZA 4UQIM 3CAXA 2VX8A 5MC7A 3B33A 1JNUA 4CQHA 4IHQA 1IFQA 2PHYA 1MC0A 3LIBA 3A0SA 2IA2A 3LUQA 3F1PB 4CLCA 3C8CA 2PYPA 3EQUA 2LB9A 3NJAA 2D01A 3LR5A 1T1BA 5DJUA 5DKKA 2XROA 2HF6A 5A8BA 4BWIA 1LSWA 4G3WA 1LT0A 3LYXA 4Q0HA 4HQAA 2BASA 3H82B 2W3FA 2W1TB 3P7NA 4WL9A 1S66L 1TS8A 3F1OB 2V0UA 4P6ZS 1TF1A 4ZRRA 3D72A 4KQOA 4M4XA 4PAUA 1T1AA 5J4EA 1OTEA 3W2ZA 2W27A 4BBVA 1DP8A 4MCWA 4R3AA 2A24A 2WKQA 4Y2FA 3PBSA 3PHYA 2ZMFA 3UE3A 3ULFA 2NUPC 3EEHA 2JKRM 3IS2A 3LIDA 4F3LB 1S1YA 1ZHHB 4KUOA 1ODVA 3LIAA 3C30A 3UMDA 1KOUA 4II7A 1XJ4A 1H3QA 3PBRA 3FPVA 2PR6A 3BQAA 2L1MA 4L0LA 4ME4A 3LR4A 1N9NA 1TD5A 4WLAA 4O8GA 4XT2A 2NUTC 4LRZE 3RFBA 4O0PA 2YKHA 3IBRA 3G6OA 1S1ZA 4ARZB 5DF9A 2G7UA 2J3WA 4EXOA 3R7WB 4PKYA 3HCYA 1P0ZA 1T19A 2GX5A 3LR3A 1OTIA 2M7UA 2JKRI 3MXQA 3GDIA 1XJ3A 2W3GA 4WF0A 1OTDA 4I38A 5DFXA 1V9YA 1P9RA 2L0WA 4ETXA 3D3OA 2J80A 2KDKA 3P01A 5HSQA 2EWWA 1EW0A 3MF0A 4R70A 4JGPA 3UB7A 1BYWA 1N9OA 2V9AA 4LLOB 2OAQ1 2O99A 3LIEA 5DJTA 5HWWA 3UB8A 2O9CA 2HJEA 4AFIA 3E4QA 4EU0A 1XJ6A 4MN7A 2OWJA 2W1RA 4GJ4A 3CI6A 4DJ3A 2J3TC 4DJ2A 5DFYA 3VE3A 1V9ZA 1G6OA 2V1BA 1D7EA 1NLYA 3CWFA 4B9OA 2HGVA 5HL6A 3CITA 4HH3A 2M1CA 4GLQA 3NOTC 1TS7A 2HV1A 2W3DA 3KSHA 4HJ4A 3T4SA 4E04A 3LR0A 3R4KA 1F9IA 5HDDA 3T50A 4CLCD 2VGLS 2B02A 2H28A 1YSQA 2P08A 2B18A 3FG8A 4IJGA 1DP9A 3LFVA 3C2WA 4EERA 3EQVA 2O9AA 1Y28A 4UQIS 5HD5A 2QYBA 3B42A 1UGUA 4B93A 1GSXA 1W63Q 1F5MA 1OPXA 4HOIA 5L8MA 5CX7A 2XSSA 4GHIA 5TBMA 5FL3A 4QPRA 4Y3IA 3KO6A 1T1CA 5K5BA 4HJ3A 3F1NA 5KIZA 3CLOA 3PBOA 4I3IA 3H7WA 3UE6A 1P9WA 3MQQA 3OBFA 4GW9A 3UMEA 2O9BA 1MKMA 1STZA 2L4RA 3GECA 5F69A 1TS0A 3MQOA 2XA7S 2EWVA 3E4OA 4BMWA 1YKDA 3RTYA 4NXFA 4WN5A 2LB5A 2R78A 1OT9A 3PYPA 1XFQA 5LBRA 2VLGA 2W1TA 1IOUA 4MN6A 4P6ZM 4JGQA 2GJ3A 1MZUA 2ZMVA 4RQ9A 2D02A 3EGDC 4G3VA 1NLZA 2KOIA 2P7JA 4NXEA 5F5YA 4WUJA 5IU1A 3T4QA 4YOFA 3TE8A 2JHEA 3KX0X 4XT2B 4F3LA 1NRJA 4GS9B 3OOVA 4JGOA 2VKSA 3U2AA 3BW6A 3T4KA 4FSFA 1LSVA 2YKFA 1F98A 5C5KA 1LL8A 3IBJA 5G4YA 1VB6A 4HNBA 1VHMA 3BY9A 4FOFA 2CMNA 1H8MA 1LSXA 4H6JB 4PHTA 2V0WA 3HJIA 4LPZA 4DN0A 4LRXC 3PR6A 3TW8A 5KSHA 3A0VA 4HY8A 3R7WA 2K7SA 2WKPA 3S7PA 1OT6A 3V67A 2K2NA 1OTBA 3SW1A 2V1AA 3A0RA 2OOLA 3BJNA 1D06A 3T4JA 3KSIA 1YSPA 3BWLA 2GNXA 2FH5A 5HDSA 3KSFA 1OJ5A 1GSVA 3EOIA 4EQ1A 2PT7A 4WELA 4L9GA 2VEAA 1S4RA 1WA9A 1DP6A 2Y8HA 3LIFA 3TRCA 2KX6A 4I3AA 2QWSA 3PBNA 1S4SA 2VZWA 3KYZA 4I39A 4CLCE 3MQ0A 3ICYA 3BQ8A 4WEJA 2P04A 2O0YA 4GCZA 2MJ6A 3H9WA 4MMNA 3E4PA 2QHKA 2INWA 4CLCB 3BY8A 2VGLM 3OLOA 4KUKA 4DMZA 4PKYG 3KYQA 3C38A 3OCLA 3K3CA 2Z6CA 2VV6A 1T18A 3E98A 4HP9A 2JKTM 1W63M 2PR5A 4EUVA 4HP4A 3F1NB 3PBTA 4NEED 4K08A 2Y79A 4YWZA 3VV4A 3JVVA 3H7WB 3F1PA 5I5LA 2KLIA 4LRYC 3T4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YOF A;  3NOU C;  5HSQ A;  4R70 A;  3MF0 A;  2M7V A;  3OOV A;  2O99 A;  4IUK A;  2O9C A;  2VKS A;  4G3K A;  2W3H A;  4EU0 A;  4Z1W A;  5HPI A;  4MN7 A;  2W1R A;  3ZQ5 A;  3CI6 A;  5C5K A;  3S7Q A;  2XRN A;  4YNR A;  4CQH A;  5DFY A;  3IBJ A;  1MC0 A;  1VHM A;  2IA2 A;  4FOF A;  2HGV A;  5HL6 A;  3CIT A;  4DN0 A;  2LB9 A;  4LRX C;  4GLQ A;  3NOT C;  2XRO A;  3S7N A;  4BWI A;  2W3D A;  3KSH A;  4G3W A;  3S7P A;  4E04 A;  3R4K A;  3EEA A;  2K2N A;  4Q0H A;  2W3F A;  1YSQ A;  2B18 A;  4IJG A;  2W1T B;  5AJG A;  2OOL A;  3BJN A;  3LFV A;  3C2W A;  3KSI A;  1YSP A;  4MDZ A;  2O9A A;  4Q0J A;  2W3E A;  1ZTU A;  2QYB A;  3KSF A;  1TF1 A;  4ZRR A;  3S7O A;  4PAU A;  1F5M A;  3W2Z A;  4MCW A;  5L8M A;  2VEA A;  2XSS A;  2Y8H A;  3NOP C;  3TRC A;  4Q0I A;  4Y2F A;  2ZMF A;  4QPR A;  4R6L A;  4Y5F A;  4Y3I A;  3KO6 A;  3NHQ A;  5TJJ A;  2VZW A;  5K5B A;  4O01 A;  3OBF A;  3MQ0 A;  4GW9 A;  4ME4 A;  2O9B A;  2VJW A;  1MKM A;  1STZ A;  2O0Y A;  4ETZ A;  1TD5 A;  4O8G A;  1YKD A;  4MMN A;  4LRZ E;  3MMH A;  3RFB A;  4O0P A;  3IBR A;  3G6O A;  2LB5 A;  2G7U A;  4DMZ A;  5LBR A;  2K31 A;  2W1T A;  2GX5 A;  3HCY A;  3KSG A;  3E98 A;  3DBA A;  2M7U A;  3E0Y A;  3K2N A;  4IUH A;  4EUV A;  3O5Y A;  4RQ9 A;  5HPF A;  2W3G A;  4G3V A;  3VV4 A;  2KOI A;  2Y79 A;  5DFX A;  5I5L A;  4ETX A;  3D3O A;  2KLI A;  4LRY C; 
#chains in the Genus database with same CATH topology
 4KZA A;  3CZD A;  1M6K A;  5EOO A;  3C4O A;  2A24 B;  4IUK A;  2HDQ A;  3PTE A;  3GTC A;  3HVF A;  1G28 A;  4OOL A;  1XGI A;  3ZQ5 A;  3CJM A;  1BZA A;  4YNR A;  4QU3 A;  3F1O A;  1FCN A;  4IVK A;  2PD8 A;  2JKT I;  3T4O A;  2PAV P;  2VV7 A;  3HUM A;  2A2L A;  5CTN A;  4HH2 A;  3MSH A;  2PDR A;  3ITB A;  2JN7 A;  5DKL A;  2V8C A;  1JWZ A;  3PAE A;  3I7J A;  1PW8 A;  4OQG A;  5A91 A;  3VOL A;  3IF6 C;  3QP5 A;  4OPQ A;  3VSL A;  3IWO A;  3ZYT A;  3K3D A;  2XD1 A;  5HZH A;  4ARZ A;  5GLB A;  5HWT A;  5AVF A;  3N8L A;  2ZC6 B;  1PRQ A;  4Y5F A;  4A5R A;  3NY4 A;  1WE4 A;  3HJK A;  3HLD A;  4JBF A;  1G6A A;  4HBU A;  4H6J A;  4I3J A;  3FWL A;  2VV8 A;  3DTE A;  1MWR A;  2ZC7 A;  1K54 C;  1SDN A;  2ZQ9 A;  3LY3 A;  5EM1 A;  3KSG A;  2QJ5 A;  2DRW A;  1N9L A;  5HPF A;  3RH8 B;  1K57 C;  1PZO A;  1S67 L;  2WKR A;  3BM6 A;  3P98 A;  1PNE A;  1Q2Q A;  5GL9 A;  3LI9 A;  4I5S A;  1YMS A;  1LLB A;  1PYY A;  2V1Z A;  5U47 A;  3UB5 P;  3WWX A;  5CGX A;  4R38 A;  4HIA A;  1PI4 A;  5GLA A;  4QHC A;  4S2I A;  3ZHH A;  2VX8 A;  1JNU A;  4CQH A;  4X68 A;  1IFQ A;  1MC0 A;  1ESI A;  3DWZ A;  3LIB A;  5E2F A;  4DDY A;  1YLP A;  3LUQ A;  4XXR A;  3EQU A;  3LR5 A;  4B88 A;  5A8B A;  1ES5 A;  3IXG A;  4G3W A;  1LT0 A;  4Q0H A;  5GHZ A;  3AGF A;  5FI2 A;  4JF4 A;  2PBY A;  1YQS A;  3ZG5 A;  3NDG A;  1NJ4 A;  3FZC A;  4WL9 A;  2CC1 A;  1IEM A;  2ZQA A;  1TF1 A;  4ZRR A;  2J8Y A;  1T1A A;  5J4E A;  4X55 A;  3SS5 A;  2W27 A;  2A49 A;  2HP6 A;  3PBS A;  2ZMF A;  3FKW A;  3ULF A;  4EV4 A;  2NUP C;  1S1Y A;  1ODV A;  3JPU A;  4YIN A;  1KOU A;  1IYQ A;  1H3Q A;  4Z9Q A;  5AQ7 A;  1QMF A;  3OPH A;  3U4L P;  1HZO A;  3IXB A;  5CGW A;  2UWX A;  4LRZ E;  1CI8 A;  3IBR A;  1S1Z A;  4KZ3 A;  2PBD P;  2J3W A;  3R7W B;  3G34 A;  3GR2 A;  3AGD A;  3ZNY A;  1P0Z A;  1T19 A;  4GOG A;  3N8S A;  1OTI A;  1K56 A;  4PM7 A;  1ERO A;  4WZ5 C;  4ETX A;  5HAI A;  4LCL A;  2KDK A;  3P01 A;  2EWW A;  2Y2G A;  1BYW A;  3VMA A;  5M18 A;  3IF6 A;  4QWO A;  4U0X A;  2O99 A;  3LIE A;  1YLY A;  3BFE A;  4C3Q A;  3LO7 A;  3RXX A;  2OWJ A;  4B4Z A;  4Y0T A;  3FKV A;  3CI6 A;  1K4E A;  3VE3 A;  5F1F A;  1D7E A;  1NLY A;  3VOY A;  2Y2P A;  2HV1 A;  4S2N A;  2W3D A;  3T4S A;  4DXB A;  2I72 A;  5HDD A;  1HVB A;  3T50 A;  4D2O A;  3NDE A;  1YSQ A;  1W7F A;  5FEG A;  2B18 A;  3AGE A;  3LFV A;  4EER A;  2O9A A;  4UQI S;  3VFH A;  2J9P A;  4N9K A;  5FEF A;  2XSS A;  1I2S A;  3KO6 A;  1HTZ A;  3S22 A;  2ZQC A;  3F1N A;  3PBO A;  4I3I A;  5HFO A;  3G30 A;  3UE6 A;  3MQQ A;  3MZD A;  2JBF A;  4R1G A;  5F69 A;  3MQO A;  4EWF A;  3RTY A;  5FQI A;  1TVF A;  4JF5 A;  2R78 A;  1OT9 A;  4XUZ A;  1XFQ A;  2VK3 A;  3NCK A;  4PMA A;  4RX3 A;  5AQ9 A;  4MN6 A;  1G5U A;  3W4P A;  5DF8 A;  2Y2Q A;  2RCX A;  1E3U A;  3EGD C;  3M6B A;  2ZQ8 A;  5HAQ A;  5CEB A;  1JWV A;  3G2Z A;  4WUJ A;  5IU1 A;  4X1M A;  4YOF A;  3TE8 A;  2JHE A;  4JXW A;  1K56 D;  3UN7 A;  4C75 A;  4XT2 B;  3IWI A;  3ZDJ A;  4E3M A;  5CTM A;  3T4K A;  1BT5 A;  4E3O A;  2YKF A;  2EX6 A;  4GDB A;  1LL8 A;  3IBJ A;  1VB6 A;  4FTX A;  2XFS A;  4H6J B;  1WYB A;  4FCF A;  3VP2 A;  1FQG A;  3PR6 A;  3IXD A;  3S7P A;  3V67 A;  3QP8 A;  2K2N A;  5L2F A;  3A0R A;  5E2G A;  3BWL A;  2P9V A;  2Q9N A;  3VOZ A;  1BTL A;  4K0W A;  1ZC2 A;  3WS0 A;  1OJ5 A;  1GSV A;  3MZE A;  1JTG A;  5CHU A;  4C6Y A;  1S4R A;  1DP6 A;  3LIF A;  3TRC A;  2ACG A;  1XA7 A;  4YFM A;  2VZW A;  3KYZ A;  2OSU A;  3BEC A;  3BQ8 A;  3MZF A;  2O0Y A;  4S2P A;  4RVA A;  4NG2 A;  1NYY A;  4E3N A;  1BUL A;  3MFD A;  3OLO A;  4KZ8 A;  5CGS A;  3C38 A;  3OCL A;  1TDG A;  1T18 A;  5CHJ A;  2VGJ A;  3W4O A;  1CK3 A;  3WRZ A;  2PR5 A;  4EUV A;  3JVV A;  2ZQD A;  1PI5 A;  2UV0 E;  4BL3 A;  2KLI A;  4ZJ1 A;  4KG6 A;  1SDE A;  3HBR A;  1ZKJ A;  3O88 A;  3GMW A;  3UB9 A;  4JPM A;  1XFN A;  1E3U D;  2Z6D A;  1YAX A;  3LY4 A;  1ONH A;  4JGR A;  3P09 A;  5HPI A;  1L0D A;  4P0M A;  2XRN A;  5IT5 A;  3W8K A;  4F94 A;  4ZDX A;  2W0N A;  5TR7 A;  2QJ7 A;  4RYE A;  5BOH A;  4GN2 A;  1XJ2 A;  4X1L A;  3S7N A;  3UPP A;  4EES A;  1BLP A;  5G4Z A;  4EEP A;  3FPW A;  5EE8 A;  5EVE A;  5IS1 A;  4MLL A;  1GA9 A;  3UB6 A;  3IX8 A;  2PD7 A;  2W3E A;  1DJA A;  5HAR A;  4BJP A;  4UEY A;  3PXP A;  3UY6 A;  2WKH A;  3TJZ C;  3O3V A;  3NHQ A;  4KG2 A;  1KVL A;  5EFW A;  5CHM A;  4O7D A;  4NKP A;  5EVI B;  4HBT A;  3HL9 A;  3C7V A;  3E2L A;  4BBT A;  1ESU A;  5GLC A;  4WZ4 A;  5HD3 A;  1LI0 A;  4EW7 A;  3UDI A;  4LFU A;  3MS6 A;  3MMH A;  4FD8 A;  1D1J A;  5GLD A;  4R4R A;  3C7U A;  2K31 A;  4EEU A;  4K91 A;  3TOI A;  4OKP A;  3K2N A;  2P74 A;  5IHV A;  2ZQ7 A;  3MKE A;  4S2M A;  1JWP A;  2OAP 1;  2EXA A;  1DRM A;  2XDM A;  1GHI A;  4IED A;  3ZVT A;  4L9F A;  3G4P A;  3SH9 A;  2JKG A;  2ZOI A;  1CI9 A;  5HX9 A;  5MC7 A;  5E2H A;  4JLF A;  2PHY A;  2IA2 A;  4LEN A;  3F1P B;  4CLC A;  1RGY A;  2ZLY A;  5DKK A;  3GRJ A;  5EOE A;  4HQA A;  2W3F A;  5FAO A;  2DNS A;  3UPO A;  4E3K A;  1FSY A;  3G2Y A;  1NY0 A;  3WS1 A;  2Y91 A;  4Y2F A;  3N8R A;  3EEH A;  3IS2 A;  1ZHH B;  4KUO A;  3LIA A;  3Q7Z A;  1XPB A;  4BD1 A;  4FH4 A;  1XJ4 A;  3ZNT A;  4L0L A;  3ZGA B;  1BLH A;  1F2K A;  1TD5 A;  3T1X A;  4WLA A;  4XT2 A;  3BLS A;  3N4I A;  4E3L A;  5DF9 A;  2G7U A;  3A3E A;  4EXO A;  1K4F A;  3KYE A;  4MNR A;  3QHY A;  3LR3 A;  1U60 A;  4KZ5 A;  4OH0 A;  5FI6 A;  1XJ3 A;  2W3G A;  4S2N C;  2A3U A;  5EEC A;  1FCM A;  2L0W A;  3D3O A;  2P9V B;  3QP1 A;  1LL5 A;  1YLT A;  5HSQ A;  3TSG A;  3Q7V B;  3UB7 A;  1S0W A;  1MWT A;  4LLO B;  2OAQ 1;  4CJN A;  5DJT A;  2XF3 A;  1L0E A;  3E4Q A;  3N7W A;  1XJ6 A;  4MN7 A;  2W1R A;  4EBN A;  2J3T C;  4DJ2 A;  1XX2 A;  1MKI A;  3S4X A;  2V1B A;  5F83 A;  5HL6 A;  3CIT A;  4U3T A;  4N92 A;  1E25 A;  2M1C A;  4OOY A;  4X56 A;  4KZB A;  4HJ4 A;  4E04 A;  2Y59 A;  1H5X A;  4OP5 A;  4CLC D;  2WGW B;  4IJG A;  3C2W A;  1HLU P;  1QME A;  2OLV A;  1UGU A;  4B93 A;  5E2E A;  4HOI A;  4P85 A;  5FA7 A;  4OQI A;  3IXH A;  5K5B A;  1PWC A;  5KIZ A;  4BD0 A;  4GW9 A;  3T1S A;  4Y0O A;  1MY8 A;  5CER A;  2L4R A;  3DAV A;  4X25 A;  3GEC A;  1TS0 A;  4BMW A;  1YKD A;  4Y15 A;  1VEU A;  2OLU A;  1FR1 A;  5GHY A;  3V50 A;  3PYP A;  1MWU A;  5F82 A;  3V5M A;  1IOU A;  1RP5 A;  1Z6F A;  1LI9 A;  2ZMV A;  2WAE A;  1EWZ A;  4ZJ2 A;  2P7J A;  5F5Y A;  1YLW A;  3BFF A;  2ZC3 B;  2IWD A;  4DE0 A;  4X69 A;  4WM9 A;  1NRJ A;  2QPN A;  3OOV A;  4JGO A;  1KDS A;  4UHU A;  2Y2H A;  5FI7 A;  4FSF A;  1LSV A;  5C5K A;  1CQA A;  2BTF P;  1CEG A;  3BY9 A;  4FOF A;  1MXO A;  4P6B A;  1LSX A;  4PHT A;  4CPK A;  4DN0 A;  4LRX C;  3TW8 A;  2WKI A;  3A0V A;  1SZV A;  2K7S A;  1OT6 A;  4KZ9 A;  3M2J A;  3SH8 A;  1Y54 A;  5EVI A;  1H0M A;  3KSI A;  3BEB A;  5HDS A;  4OVD A;  3QNB A;  1TDL A;  3DW0 A;  1HD8 A;  4WEL A;  4L9G A;  2VEA A;  2Y8H A;  3UE1 A;  2KX6 A;  2Y2N A;  2QWS A;  3PBN A;  1S4S A;  3LCE A;  2Z2L B;  3GSG A;  1XP4 A;  5DVA A;  3MQ0 A;  3Q82 A;  4JF6 A;  5I94 A;  3VP0 A;  4GCZ A;  1SKF A;  3E4P A;  2QHK A;  4CLC B;  5AQA A;  4LCM A;  1YPR A;  3A3I A;  2C6W B;  3HLB A;  2ZMA A;  1N9B A;  4OP8 A;  3E98 A;  2WAD A;  4HP4 A;  1JVJ A;  3PBT A;  4FUW A;  2R9W A;  4K08 A;  3F1P A;  2G2U A;  4PM6 A;  3T4L A;  3EGX C;  1OJG A;  4WBG A;  1UWN X;  4EBP A;  5M19 A;  3OCN A;  4G3K A;  2W3H A;  1IYP A;  1VET A;  3IS2 B;  3S7Q A;  4L9E A;  1LHY A;  5KMW A;  5DTK A;  2Y55 A;  2ZL1 B;  4QB8 A;  2V20 A;  1IYO A;  1FIL A;  1K38 A;  5FDS A;  4H8R A;  1PIO A;  3C4P A;  3IWQ A;  3WS5 A;  2ZBB A;  5EUA A;  3OC2 A;  4OQ0 A;  3EEA A;  4HI4 A;  3HLG A;  3LIC A;  4HEF A;  4KQD A;  3IQA A;  3EWK A;  1CEF A;  4MN5 A;  5AJG A;  5FQ9 A;  4MDZ A;  4DE2 A;  1S6R A;  4R3B A;  4Q0J A;  1VQQ A;  2ZM8 A;  4NXB A;  5EVI D;  1BLS A;  4GS9 A;  1C3B A;  1SKO A;  2B95 A;  4R6L A;  4S2L A;  5TJJ A;  3O86 A;  3PBQ A;  4OOM A;  2PYR A;  4KZ4 A;  4O01 A;  5F68 A;  2QZ6 A;  3DTI A;  3OZH A;  1J3W A;  1GCE A;  2VJW A;  3IX4 A;  4ETZ A;  3Q7V A;  2E8J A;  3B47 A;  2B5R A;  4EET B;  5HDC A;  2JKF A;  3ITA A;  3JVU A;  3ZG7 B;  4CLC C;  3DBA A;  1TEM A;  2VA0 A;  2ZOH A;  3CUE A;  4S2J A;  4BBU A;  3MKF A;  2J3T D;  3NC8 A;  1MPL A;  3PAG A;  5CRF A;  3Q07 A;  1TS6 A;  3QP2 A;  2J7V A;  5L10 A;  1L2S A;  4LV1 A;  3WS2 A;  3BFC A;  2M7V A;  3HRE A;  1H8Z A;  2WGW A;  3RJU A;  1XGJ A;  2XQZ A;  2I9V A;  2WYX A;  2H0Y A;  1NWZ A;  4UQI M;  4OPR A;  3B33 A;  3VP1 A;  4IHQ A;  4KZ7 A;  3SH7 A;  1FIK A;  1ZG4 A;  3C8C A;  2WK0 A;  2PYP A;  5DJU A;  1T1B A;  4X53 A;  2XRO A;  5L07 A;  1PZP A;  1LSW A;  2C5W B;  1VEU B;  2PU2 A;  3LYX A;  2IWB A;  3H82 B;  1W79 A;  2RL3 A;  3HLF A;  3UDF A;  4IVI A;  1S66 L;  1TS8 A;  2XEP A;  4P6Z S;  2X71 A;  3M2K A;  4NK3 A;  5L09 A;  4M4X A;  4PAU A;  4RX2 A;  3W2Z A;  4BBV A;  4MCW A;  4E3J A;  4R3A A;  2H10 A;  3PHY A;  2JKR M;  3LID A;  2XK1 A;  3C30 A;  3FPV A;  2ZM2 A;  3ZG0 A;  2PR6 A;  3BQA A;  1KGG A;  4LV3 A;  4ZTK A;  3IF5 A;  3ZG9 B;  3LR4 A;  4UA9 A;  1N9N A;  4O8G A;  1O07 A;  2YKH A;  1W8Q A;  4R4S A;  2ZC4 B;  3HCY A;  2GX5 A;  4X6T A;  5F1G A;  1GA0 A;  1O7E A;  2JKR I;  4PPR A;  3MXQ A;  3GDI A;  3FV7 A;  4WF0 A;  1NXY A;  1OTD A;  2WUQ A;  2H5S A;  1EW0 A;  3MF0 A;  1N9O A;  5JYP A;  1ES3 A;  2V9A A;  4WMC A;  5DF7 A;  4EQI A;  1PFL A;  3BYD A;  5HWW A;  3UB8 A;  2O9C A;  3A3D A;  1ZG6 A;  3TG9 A;  5KZH A;  4DJ3 A;  3T1R A;  2AVX A;  4QY6 A;  5DFY A;  1KVM A;  1V9Z A;  2ZJ9 A;  3CWF A;  2Q9M A;  1L0F A;  2HGV A;  1NZU A;  4HH3 A;  2R9X A;  1L3L A;  5D3O A;  4GLQ A;  3NOT C;  2Y2O A;  3SS3 A;  3E2K A;  4ZJ3 A;  2FFF B;  2VGL S;  2B02 A;  2H28 A;  2P08 A;  4DDS A;  3FG8 A;  1ACF A;  1Q2P A;  2XD5 A;  5HD5 A;  2QYB A;  4N1H A;  5GHX A;  1W63 Q;  1OPX A;  3VSK A;  2ZM0 A;  4GHI A;  5TBM A;  4Y13 A;  2Y2J A;  5JYO A;  4Y3I A;  1T1C A;  5CEC A;  5TGF A;  4HJ3 A;  4DF6 A;  5DTS A;  1VET B;  3GQZ A;  1P9W A;  3UME A;  2Y4A A;  1FSW A;  4BL2 A;  2O9B A;  2WAF A;  1STZ A;  1KGF A;  1YT4 A;  4GD6 A;  2XA7 S;  2EWV A;  4MBH A;  3E4O A;  3UE0 A;  2Y2K A;  4WN5 A;  2LB5 A;  5LBR A;  5EVL A;  2W1T A;  3CHW P;  4P6Z M;  3D9Y A;  1E4D A;  2GJ3 A;  1MZU A;  4OON A;  1K6S A;  4G3V A;  2ZL1 A;  4NXE A;  5EV0 A;  1I5Q A;  3OPL A;  3V3S A;  3SZT A;  5EVI C;  4MEZ A;  3KX0 X;  4F3L A;  4GS9 B;  4UA6 A;  2WZZ A;  2VKS A;  1SKO B;  1EI5 A;  3BW6 A;  3A3F A;  3U2A A;  4E6X A;  4MBK A;  4WMC D;  5G4Y A;  4HNB A;  3CMZ A;  1BUE A;  2CMN A;  1H8M A;  5A93 A;  5FQJ A;  4LPZ A;  1OME A;  4K0X A;  5KSH A;  5FQK A;  5CED A;  4DRT A;  1YM1 A;  2JE5 A;  1XXM A;  1OTB A;  3SW1 A;  4IBX A;  3BJN A;  1K55 A;  3UPN A;  2V8F A;  3SOI A;  4UA7 A;  2E8I A;  2Q0O A;  2EX8 A;  3EOI A;  4EQ1 A;  4JXV A;  1WA9 A;  4R3J A;  4N1X A;  3GVB A;  2BLS A;  3WRT A;  1CJF A;  1DJB A;  3LEZ A;  2Y2M A;  4S2O A;  2WGI A;  2Y2L A;  3IHB A;  1PWD A;  4QY5 A;  3ICY A;  4WEJ A;  3Q81 A;  1FOF A;  3A3J A;  2MJ6 A;  2Z2M B;  2INW A;  3BY8 A;  2VGL M;  4WYY A;  4PM5 A;  4DMZ A;  4PKY G;  3K3C A;  3C5A A;  2Z6C A;  3L7H A;  3LGO A;  2FFY A;  2HDR A;  2EFX A;  2EXB A;  1W63 M;  3D4F A;  4ZAM A;  4NEE D;  3VV4 A;  2Y79 A;  3H7W B;  1J9M A;  4ZBE A;  3VP4 A;  4LRY C;  4R0Q A;  3ZFZ A;  2EA9 A;  3LEQ A;  3IH9 A;  2XFT A;  3SS4 A;  2Y2I A;  1YLJ A;  4HHD A;  2HPB A;  3B3X A;  3MXR A;  3H82 A;  3V3R A;  2PRF A;  2X01 A;  4Z1W A;  3MR0 A;  3LI8 A;  2XA7 M;  4JKT A;  1XKZ A;  2EFU A;  4S2K A;  5J7E A;  3G32 A;  1KDW A;  3OPP A;  2XH9 A;  4MBF A;  3HLE A;  4DE3 A;  1N4O A;  1IKG A;  1P97 A;  1OTA A;  4NXG A;  1ZTU A;  5FDH A;  3T1Q B;  3VE4 A;  5J3W A;  2G2W A;  3S7O A;  2OWH A;  2DMW A;  3NOP C;  3CUE C;  3MFX A;  4Q0I A;  1X0O A;  3FC7 A;  1NZO A;  1UWP X;  4HJ6 A;  3T4T A;  1FR6 A;  4Y7P A;  3MJQ A;  3HLW A;  4OQH A;  3CG5 A;  4IBR A;  2WZX A;  1VM1 A;  4DKI A;  2BG1 A;  2FZ0 A;  4WEK A;  1L0G A;  2HJ9 C;  2EX2 A;  3CPT A;  2VGK A;  4FH2 A;  2JC7 A;  1K0K A;  5AVE A;  4E3I A;  1CF0 A;  3GV9 A;  2GZA A;  3E0Y A;  4IUH A;  1BSG A;  3UDX A;  3NBL A;  1K25 A;  3O5Y A;  5HWV A;  5FAP A;  1GHM A;  2HP5 A;  3WS4 A;  4PM8 A;  3NOU C;  3MXS A;  5G18 A;  4U0T A;  5F6A A;  1ES4 A;  2QKP A;  4GHI B;  5TBM B;  4PM9 A;  1GSW A;  4KG5 A;  1K54 A;  1RCJ A;  3CAX A;  1A0K A;  4GDN A;  3A0S A;  5E43 A;  2LB9 A;  3NJA A;  2D01 A;  2HF6 A;  4P87 A;  4BWI A;  1K57 A;  3HUO A;  2BAS A;  1IYS A;  3OPR A;  2W1T B;  2XR0 A;  3P7N A;  1DY6 A;  3F1O B;  2V0U A;  3D72 A;  4N9L A;  4KQO A;  4JXG A;  4OPZ A;  3RXW A;  1H8Y A;  1OTE A;  2JCH A;  1DP8 A;  3NEC A;  1DJC A;  2A24 A;  2WKQ A;  5EPH A;  3UE3 A;  1MWS A;  4UAA A;  4F3L B;  3VFF A;  3UMD A;  5J8X A;  4II7 A;  5FQM A;  3PBR A;  1ERQ A;  2L1M A;  1YMX A;  1LL9 A;  4ME4 A;  1WYC A;  2ZD8 A;  2V2F F;  4LV2 A;  3M6H A;  5KSC A;  5TFQ A;  1RGZ A;  1NYM A;  2NUT C;  4GZB A;  3RFB A;  4O0P A;  3VP3 A;  3G6O A;  4ARZ B;  3N6I A;  1I2W A;  4PKY A;  4Q8I A;  1JTD A;  4OPY A;  2XGN A;  2M7U A;  3BLM A;  4QJG A;  1NRF A;  1Y4O A;  4I38 A;  5DFX A;  1P9R A;  1V9Y A;  3W4Q A;  2J80 A;  4DE1 A;  1ALQ A;  3IH8 A;  4KZ6 A;  4R70 A;  4JGP A;  1MBL A;  2OV5 A;  3ZG8 B;  2HJE A;  4AFI A;  1PWG A;  2PU4 A;  4RA7 A;  4EU0 A;  4GJ4 A;  2WGV A;  1KE3 A;  1G6O A;  1IEL A;  4B9O A;  4DXC A;  1SCW A;  5FSR A;  1ONG A;  4KEN B;  4Y17 A;  3IHA A;  1TS7 A;  3V39 A;  2ZC5 B;  3KSH A;  3S1Y A;  4D60 A;  3LR0 A;  4WZ5 A;  3R4K A;  1F9I A;  2HZ5 A;  5HW3 A;  4ID4 A;  4GNU A;  4KQR A;  3IX3 A;  4BLM A;  3NI9 A;  1AXB A;  1DP9 A;  5EM0 A;  4GB7 A;  5FAS A;  3HLC A;  2H0T A;  3EQV A;  1Y28 A;  3B42 A;  3BFG A;  5AQB A;  3UNW A;  4Y0U A;  1GSX A;  1Z09 A;  3BRM A;  1F5M A;  4M3K A;  5L8M A;  5CX7 A;  2HP9 A;  3NIA A;  5FL3 A;  4QPR A;  3O87 A;  3ZCZ A;  4HES A;  3CLO A;  1K6R A;  3Q1F A;  3H7W A;  2J9O A;  2WKE A;  3OBF A;  4KQQ A;  3MBZ A;  3NUL A;  1KE4 A;  3FYZ A;  1MKM A;  1KE0 A;  1ES2 A;  2XLN A;  4NXF A;  3DTK A;  4LV0 A;  2VLG A;  2HDU A;  1XA1 A;  3IT9 A;  4JGQ A;  3ZVW A;  1SHV A;  4RQ9 A;  2D02 A;  1NLZ A;  2KOI A;  4GKU A;  3T4Q A;  4QD4 A;  5M1A A;  1K55 C;  5A92 A;  4EBL A;  5FAQ A;  5HL1 A;  3HUN A;  4OLG A;  4EUZ A;  1F98 A;  4ESP A;  2IWC A;  5CXW A;  1VHM A;  1M40 A;  1GHP A;  3G31 A;  4BQM A;  4JXS A;  2V0W A;  3HJI A;  2QMI A;  4NET A;  3T12 B;  4HY8 A;  3R7W A;  2WKP A;  1IKI A;  3IF6 B;  3CPT B;  2DCF A;  2HDS A;  1YLZ A;  2V1A A;  1FCO A;  4LGW A;  2OOL A;  1D06 A;  3T4J A;  1YSP A;  1G68 A;  1W5D A;  2GNX A;  2FH5 A;  3DWK A;  4E6W A;  3KSF A;  1BLC A;  1AWI A;  3QNC A;  1KGE A;  3UO9 A;  2PT7 A;  2GDN A;  3L9K A;  5DTT A;  4R23 A;  4I3A A;  3BFD A;  4I39 A;  3G35 A;  4OLD A;  3ISG A;  2X02 A;  2EX9 A;  4GD8 A;  4XUX A;  1PW1 A;  5FAT A;  4CLC E;  3QP4 A;  3JYI A;  2P04 A;  3H9W A;  1W8Y A;  4MMN A;  5A90 A;  4KUK A;  5HAP A;  4BEN A;  3KYQ A;  3QP6 A;  5FQQ A;  2VV6 A;  4HP9 A;  2JKT M;  3F1N B;  4YWZ A;  3DTM A;  1ERM A;  5I5L A;  4B4X A; 
#chains in the Genus database with same CATH homology
 2EA9 A;  3EGX C;  1OJG A;  1UWN X;  3UB9 A;  4HHD A;  1XFN A;  2Z6D A;  3OCN A;  1YAX A;  3H82 A;  2A24 B;  4IUK A;  4JGR A;  4G3K A;  1G28 A;  2W3H A;  4Z1W A;  5HPI A;  4OOL A;  3MR0 A;  3IS2 B;  3ZQ5 A;  3LI8 A;  3S7Q A;  2XRN A;  2XA7 M;  4L9E A;  4YNR A;  5IT5 A;  3F1O A;  2PD8 A;  2JKT I;  2W0N A;  3T4O A;  2VV7 A;  5J7E A;  2QJ7 A;  1XJ2 A;  2A2L A;  3S7N A;  4EES A;  2ZBB A;  4HH2 A;  3OC2 A;  5G4Z A;  3EEA A;  4HI4 A;  4EEP A;  2PDR A;  3LIC A;  3FPW A;  4KQD A;  2JN7 A;  5DKL A;  3EWK A;  5IS1 A;  1P97 A;  1OTA A;  4MN5 A;  5AJG A;  4NXG A;  3UB6 A;  3VOL A;  4MDZ A;  4Q0J A;  2PD7 A;  2W3E A;  1ZTU A;  3VE4 A;  5J3W A;  3S7O A;  4NXB A;  2OWH A;  3ZYT A;  4BJP A;  4GS9 A;  2DMW A;  3K3D A;  5HZH A;  4ARZ A;  4UEY A;  5HWT A;  3NOP C;  3CUE C;  3MFX A;  3PXP A;  4Q0I A;  3TJZ C;  5AVF A;  1X0O A;  4R6L A;  4Y5F A;  3FC7 A;  1UWP X;  3NHQ A;  4HJ6 A;  5TJJ A;  3HJK A;  3PBQ A;  4OOM A;  2PYR A;  5EFW A;  3T4T A;  4O01 A;  4NKP A;  4BBT A;  5F68 A;  4H6J A;  3MJQ A;  4I3J A;  5HD3 A;  4EW7 A;  2VJW A;  2VV8 A;  4ETZ A;  3B47 A;  4EET B;  5HDC A;  2FZ0 A;  3MMH A;  4WEK A;  2HJ9 C;  2K31 A;  5AVE A;  4EEU A;  3JVU A;  3KSG A;  2GZA A;  2QJ5 A;  4CLC C;  3DBA A;  2VA0 A;  2ZOH A;  3E0Y A;  3K2N A;  3CUE A;  4IUH A;  4BBU A;  1N9L A;  2J3T D;  3O5Y A;  5HPF A;  5HWV A;  1TS6 A;  3RH8 B;  2OAP 1;  1S67 L;  2WKR A;  1DRM A;  3NOU C;  4L9F A;  3LI9 A;  4I5S A;  2M7V A;  4R38 A;  5F6A A;  2ZOI A;  4HIA A;  2QKP A;  4GHI B;  5TBM B;  2I9V A;  1GSW A;  1NWZ A;  4UQI M;  3CAX A;  2VX8 A;  5MC7 A;  3B33 A;  1JNU A;  4CQH A;  4IHQ A;  1IFQ A;  2PHY A;  1MC0 A;  3LIB A;  3A0S A;  2IA2 A;  3LUQ A;  3F1P B;  4CLC A;  3C8C A;  2PYP A;  3EQU A;  2LB9 A;  3NJA A;  2D01 A;  3LR5 A;  1T1B A;  5DJU A;  5DKK A;  2XRO A;  2HF6 A;  5A8B A;  4BWI A;  1LSW A;  4G3W A;  1LT0 A;  3LYX A;  4Q0H A;  4HQA A;  2BAS A;  3H82 B;  2W3F A;  2W1T B;  3P7N A;  4WL9 A;  1S66 L;  1TS8 A;  3F1O B;  2V0U A;  4P6Z S;  1TF1 A;  4ZRR A;  3D72 A;  4KQO A;  4M4X A;  4PAU A;  1T1A A;  5J4E A;  1OTE A;  3W2Z A;  2W27 A;  4BBV A;  1DP8 A;  4MCW A;  4R3A A;  2A24 A;  2WKQ A;  4Y2F A;  3PBS A;  3PHY A;  2ZMF A;  3UE3 A;  3ULF A;  2NUP C;  3EEH A;  2JKR M;  3IS2 A;  3LID A;  4F3L B;  1S1Y A;  1ZHH B;  4KUO A;  1ODV A;  3LIA A;  3C30 A;  3UMD A;  1KOU A;  4II7 A;  1XJ4 A;  1H3Q A;  3PBR A;  3FPV A;  2PR6 A;  3BQA A;  2L1M A;  4L0L A;  4ME4 A;  3LR4 A;  1N9N A;  1TD5 A;  4WLA A;  4O8G A;  4XT2 A;  2NUT C;  4LRZ E;  3RFB A;  4O0P A;  2YKH A;  3IBR A;  3G6O A;  1S1Z A;  4ARZ B;  5DF9 A;  2G7U A;  2J3W A;  4EXO A;  3R7W B;  4PKY A;  3HCY A;  1P0Z A;  1T19 A;  2GX5 A;  3LR3 A;  1OTI A;  2M7U A;  2JKR I;  3MXQ A;  3GDI A;  1XJ3 A;  2W3G A;  4WF0 A;  1OTD A;  4I38 A;  5DFX A;  1V9Y A;  1P9R A;  2L0W A;  4ETX A;  3D3O A;  2J80 A;  2KDK A;  3P01 A;  5HSQ A;  2EWW A;  1EW0 A;  3MF0 A;  4R70 A;  4JGP A;  3UB7 A;  1BYW A;  1N9O A;  2V9A A;  4LLO B;  2OAQ 1;  2O99 A;  3LIE A;  5DJT A;  5HWW A;  3UB8 A;  2O9C A;  2HJE A;  4AFI A;  3E4Q A;  4EU0 A;  1XJ6 A;  4MN7 A;  2OWJ A;  2W1R A;  4GJ4 A;  3CI6 A;  4DJ3 A;  2J3T C;  4DJ2 A;  5DFY A;  3VE3 A;  1V9Z A;  1G6O A;  2V1B A;  1D7E A;  1NLY A;  3CWF A;  4B9O A;  2HGV A;  5HL6 A;  3CIT A;  4HH3 A;  2M1C A;  4GLQ A;  3NOT C;  1TS7 A;  2HV1 A;  2W3D A;  3KSH A;  4HJ4 A;  3T4S A;  4E04 A;  3LR0 A;  3R4K A;  1F9I A;  5HDD A;  3T50 A;  4CLC D;  2VGL S;  2B02 A;  2H28 A;  1YSQ A;  2P08 A;  2B18 A;  3FG8 A;  4IJG A;  1DP9 A;  3LFV A;  3C2W A;  4EER A;  3EQV A;  2O9A A;  1Y28 A;  4UQI S;  5HD5 A;  2QYB A;  3B42 A;  1UGU A;  4B93 A;  1GSX A;  1W63 Q;  1F5M A;  1OPX A;  4HOI A;  5L8M A;  5CX7 A;  2XSS A;  4GHI A;  5TBM A;  5FL3 A;  4QPR A;  4Y3I A;  3KO6 A;  1T1C A;  5K5B A;  4HJ3 A;  3F1N A;  5KIZ A;  3CLO A;  3PBO A;  4I3I A;  3H7W A;  3UE6 A;  1P9W A;  3MQQ A;  3OBF A;  4GW9 A;  3UME A;  2O9B A;  1MKM A;  1STZ A;  2L4R A;  3GEC A;  5F69 A;  1TS0 A;  3MQO A;  2XA7 S;  2EWV A;  3E4O A;  4BMW A;  1YKD A;  3RTY A;  4NXF A;  4WN5 A;  2LB5 A;  2R78 A;  1OT9 A;  3PYP A;  1XFQ A;  5LBR A;  2VLG A;  2W1T A;  1IOU A;  4MN6 A;  4P6Z M;  4JGQ A;  2GJ3 A;  1MZU A;  2ZMV A;  4RQ9 A;  2D02 A;  3EGD C;  4G3V A;  1NLZ A;  2KOI A;  2P7J A;  4NXE A;  5F5Y A;  4WUJ A;  5IU1 A;  3T4Q A;  4YOF A;  3TE8 A;  2JHE A;  3KX0 X;  4XT2 B;  4F3L A;  1NRJ A;  4GS9 B;  3OOV A;  4JGO A;  2VKS A;  3U2A A;  3BW6 A;  3T4K A;  4FSF A;  1LSV A;  2YKF A;  1F98 A;  5C5K A;  1LL8 A;  3IBJ A;  5G4Y A;  1VB6 A;  4HNB A;  1VHM A;  3BY9 A;  4FOF A;  2CMN A;  1H8M A;  1LSX A;  4H6J B;  4PHT A;  2V0W A;  3HJI A;  4LPZ A;  4DN0 A;  4LRX C;  3PR6 A;  3TW8 A;  5KSH A;  3A0V A;  4HY8 A;  3R7W A;  2K7S A;  2WKP A;  3S7P A;  1OT6 A;  3V67 A;  2K2N A;  1OTB A;  3SW1 A;  2V1A A;  3A0R A;  2OOL A;  3BJN A;  1D06 A;  3T4J A;  3KSI A;  1YSP A;  3BWL A;  2GNX A;  2FH5 A;  5HDS A;  3KSF A;  1OJ5 A;  1GSV A;  3EOI A;  4EQ1 A;  2PT7 A;  4WEL A;  4L9G A;  2VEA A;  1S4R A;  1WA9 A;  1DP6 A;  2Y8H A;  3LIF A;  3TRC A;  2KX6 A;  4I3A A;  2QWS A;  3PBN A;  1S4S A;  2VZW A;  3KYZ A;  4I39 A;  4CLC E;  3MQ0 A;  3ICY A;  3BQ8 A;  4WEJ A;  2P04 A;  2O0Y A;  4GCZ A;  2MJ6 A;  3H9W A;  4MMN A;  3E4P A;  2QHK A;  2INW A;  4CLC B;  3BY8 A;  2VGL M;  3OLO A;  4KUK A;  4DMZ A;  4PKY G;  3KYQ A;  3C38 A;  3OCL A;  3K3C A;  2Z6C A;  2VV6 A;  1T18 A;  3E98 A;  4HP9 A;  2JKT M;  1W63 M;  2PR5 A;  4EUV A;  4HP4 A;  3F1N B;  3PBT A;  4NEE D;  4K08 A;  2Y79 A;  4YWZ A;  3VV4 A;  3JVV A;  3H7W B;  3F1P A;  5I5L A;  2KLI A;  4LRY C;  3T4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...