3JVUA

Crystal structure of unliganded p. aeruginosa pilt
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
342
structure length
337
Chain Sequence
MDITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPLEHKQVHALIYDIMNDKQRKDFEEFLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSKVLTMEELGMGEVFKRVSDVPRGLVLVTGPTGSGKSTTLAAMLDYLNNTKYHHILTIEDPIEFVHESKKCLVNQREVHRDTLGFSEALRSALREDPDIILVGEMRDLETIRLALTAAETGHLVFGTLHTTSAAKTIDRVVDVFPAEEKAMVRSMLSESLQSVISQTLIKKGRVAAHEIMIGTPAIRNLIREDKVAQMYSAIQTGGSLGMQTLDMCLKGLVALISRENAREKAKIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Twitching mobility protein
publication title P. aeruginosa PilT structures with and without nucleotide reveal a dynamic type IV pilus retraction motor.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Atp binding protein
total genus 97
structure length 337
sequence length 342
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3jvuA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3jvuA02
4GI7A 4TSFA 5SZJA 1VHTA 2ZETA 1BKDR 2CVHA 4WAUA 3QY0A 3I1FA 2BWJA 4KJZA 4G5QA 3O47A 2D2FA 1LTQA 2VSXA 2WPDA 5KPDA 1NLFA 5JEEA 2G88A 4GZMA 1XMVA 1XTQA 2ZJBA 2Q9AA 3IBGA 5JJIA 1NN3A 1S8FA 3D6TB 3NBZC 3G5UA 4YMVA 4ZI3A 2IXGA 3U6KA 1KZ7B 1N5JA 5J4VA 2XTMA 1GL6A 1W0JD 1OH7A 3EG5A 4JLBA 2BIFA 2IYUA 2ZSEA 3PUZA 1N3BA 3R7WA 2NO7A 4PO1A 4PHGA 2JJ1D 5E4FA 4A0RA 3HWSA 4Q1AA 1D9ZA 2ZSFA 5DHAA 2PX0A 3L0SA 3TK1A 2BJWA 2DY1A 4RCZA 1W0KD 3GLIE 4QBIA 1RRCA 1OXVA 3AB3A 2WZQA 1VIYA 1WA5A 3LVRE 4Q1FA 2FGJA 4LSGA 1G4AE 1N6LA 2FFHA 3R9XA 1KDTA 1ESNA 2JCSA 2D2EA 4M1YA 3EC1A 4IXMA 5BQ5A 4RD6A 4DWJA 3CUEF 2DFKB 2QPAA 1TUEA 3LQRA 1W7AA 3ECCA 5JRJA 5JHGB 1E9RA 4XD7D 2GK7A 2D62A 4B3XA 4C0HA 3EWAA 1P6XA 1MRNA 2ZU6A 3I61A 3ADCA 3ZD7A 1NMZA 2CE7A 3B1XA 3QNUA 5AR1A 4RCYA 4B6EA 2F9LA 1JR3A 3TW4A 4C0LA 4MKIA 1OXUA 2O0KA 2FWRA 2ZR0A 1XCPA 3HYTA 1O3YA 1RJ9A 5FOTA 5E3HA 1P5ZB 1R0WA 2RH5A 3ZS9A 4IJMA 1U2RA 2Q9CA 1RRFA 1X86B 3MJHA 4WBSA 4HB3A 4HAZA 3BS4A 4RSGA 4V02A 2VSOA 1K6MA 2XITA 3H84A 3IGFA 1IXSB 1FNMA 4EFLA 3IO3A 3VTKA 4BFWA 5KSZA 2ORIA 4FCVA 4LV6A 2VP0A 3QPUA 1DOAA 2HJVA 5KDDA 1KMHB 4BLSA 5M04A 2ANBA 2GXQA 4LV8B 3SN6A 4ACAA 4U02A 4V0KA 1EFCA 1CKEA 1GDDA 1JR6A 1S4QA 3VQTA 2HCJB 1UBEA 4MKGA 4Z1MD 1Z0FA 4CW7A 4NONA 3EA0A 4W5JA 2ZROA 1KDPA 2G0NA 5G3ZA 5KNBA 4IVQA 5F98A 1R10A 4Q1EA 1T5LA 1W1WA 2QAGB 1Z83A 1KKMA 2ZRDA 5TMPA 1N6RA 2Q21A 2PL3A 4UXIA 3BBPA 3PENA 1AN0A 1E9BA 2QRNA 2DWQA 1NSTA 2W2TA 4GOKA 1W44A 3OIVA 2UZ3A 3GLGB 3P20A 4DCNA 1NJGA 2ATVA 2QP3A 4JBXA 1HV8A 1LVGA 1LW7A 2OCBA 1W46A 1G17A 1DS6A 5FBLB 1ZYUA 2GZDA 1NN5A 2OEPA 2HEIA 1P60A 3PUXA 2X2FA 5G41A 5H70A 2HT6A 4Q9HA 3B8HA 4Z54A 2XOKD 2VRWA 2Z0MA 3RSOA 4R2IA 4DCUA 4GT1A 3IIJA 1KI8A 3OAAA 4UQOA 5EP2A 5JJLA 1ZUHA 1N6KA 2GCOB 1JPNA 2F55A 1F5NA 3JZAA 1DO2A 1WP9A 5SZHB 4QGAA 2QAGC 3F5FA 3K9NA 3X2SA 1AIPA 3UPUA 2F1JA 3PR1A 4IKEA 4CEIB 3GD7A 1OPXA 2BV3A 2WIAA 2YZ2A 1JEEA 3K0FB 3ZLJA 2VF8A 2O5VA 4ESVA 2AXPA 4RZ2A 1GL7A 2H57A 1E2DA 4TYQA 3UWKA 4JZKA 1ESMA 5FOSA 4ARZA 621PA 1KOFA 4CT5A 1UEJA 4KFRA 4N0DA 3W8NA 1XD2A 2F3TA 2HXYA 1NY6A 2YJTD 3LBHA 5C1BA 3AV0B 4KFSA 3U7HB 1DAIA 1KAGA 2OBMA 3AVYA 1F2TA 2HLDD 2B21A 4LJ8A 3WMGA 3RRNA 1I2MA 2JLRA 5B2ZA 2KJQA 3BD9A 3BFKA 4MA4A 1TX4B 2YNMA 3AP1A 3RAPR 2WMNB 1XJCA 2ZSBA 5JJKA 4C0AC 1GKUB 4FXPA 4IFBA 4LYAA 2QZ4A 1ZC4A 1U0LA 1E9FA 4D81A 4WA7A 4MYTA 5F3WB 2FSFA 1CR1A 4XWAA 3Q85A 3H4MA 3DO6A 1XP8A 4KBFA 1P72A 4JVSB 5BN3A 2VP2A 4CIDA 4P4SB 5HE9A 1UBGA 1OSNA 3A1TA 2VO1A 2ZRIA 2QP9X 4HAUA 4MITA 2OSBA 1SVMA 2QN6A 3Q3JB 4OYHA 3B1YA 1YE8A 5D3QA 2EU8A 2G1KA 1G18A 1QHHB 2ZS9A 2GZAA 3ZZTA 4C30A 3GLHA 4HAVA 4LJ9A 2YC4C 2SHKA 4JLPA 2OV2A 1US8B 5FBWB 2XNDD 3SFVA 1TF5A 3EZ7A 1N6PA 4GOXA 5F9FA 2Z6VA 3ZYCA 2O8CB 1U9IA 2IWRA 5CK4A 4LBWA 4HZIA 4V0LA 3V00A 1QZXA 4PR0A 3A8TA 4XIGS 1II9A 3DZDA 1NVUQ 5FUYA 4DCVA 1SHZA 3QG5A 1GRQA 4KYUA 2ZI5A 1G3RA 4I1SA 2IYZA 1HUQA 2WJIA 2W6JA 1PV4A 4LC1A 3GLGE 2KBFA 2ERXA 3KKNA 3I8SA 1JALA 2YWHA 1DTSA 1I4DD 2G0TA 4R2HA 4AC9A 2DPXA 4D4KA 5C46F 4TTQA 2OUKA 3OHMA 2MMGA 3IEVA 2JLVA 2C8VA 4FMCF 4HUQA 2J87A 2P5TB 4IVPA 4JBWA 5GVSA 3MJRA 3QQ5A 3QSYA 4G5GA 2P65A 1G6OA 4YMUA 4MYHA 2OE2A 4H9GA 4BEJA 1DARA 3EIQA 1QDEA 2FF7A 1CU1A 3B82A 5TARA 3TMKA 3W90A 4AYXA 2FZLA 2OESA 5DE3A 4MYCA 2O8FB 1SKQA 1U0JA 2F1IA 2XTZA 1RFLA 4Q18A 1LY1A 1WE2A 3FHOA 3TUIC 3MGCA 3U3RA 1FW6A 3CX8A 1OIWA 1IY1A 1SZPA 4YDSA 1JPJA 3DL0A 2W0MA 1X3SA 5EZ5A 4QL3A 4ZCLA 1H8HD 1TF2A 3AVQA 3WYAA 4M9QA 3THOA 3K0AA 4GOJA 2PLFA 5EE0A 5EE9A 2FPLA 2WPDD 1UFQA 2AN9A 1TL7C 1ZNWA 4LBZA 1XD9A 4JBYA 3CRVA 3U4QA 3VNUA 3TJZA 1IXRC 4LDJA 3A1WA 1OW3B 1ZVQA 3AVTA 4HLDA 1HE1C 1GRRA 3GEIA 3PEVA 1M7HA 1Z0IA 5CLLA 1R7RA 2QM8A 3WBJA 3LWNA 3T15A 4JL5A 1UKEA 2BM0A 1UKVY 3CBQA 5CM8B 3HU2A 4LK2A 3CNOA 4DXAA 1NJFA 3CNLA 3EA5A 4EPRA 4R7ZA 1P2SA 3K0CC 3D3QA 3KKQA 1MO3A 2C77A 3GLFB 1SVOA 4A0HA 2YINC 5FFMA 1UBFA 2JLWA 4RJLA 3SC3A 1QHGA 3CIOA 3EAQA 4YMSA 2NGRA 4UKDA 3K9GA 2OCYC 2P6UA 2J41A 4JYCA 2G6BA 5FUVA 4OI0A 3M4YA 5J4HA 1HE8B 1A5TA 1L4YA 2YV5A 3CF0A 3K1JA 2FV8A 1KI9A 2B92A 3UIEA 3LX5A 4E22A 1T0HB 2BDTA 1TU3A 3WBKA 1HH4A 2WJVA 1TPZA 4PX9A 2P5SA 4XSGA 2VHCA 3QVUA 2BMFA 1QHSA 3TQCA 1PLJA 1N6OA 4HZUA 3NC0C 3A1UA 2QT1A 3DMDA 3OESA 2Q3FA 1XPOA 5TDHA 1JR3D 4M0LA 3A58B 3EPJA 4MDEA 3TSWA 2PEZA 5IT5A 2NQ2C 1W4BA 3D7MA 1R0XA 4W5HA 2QPTA 4YQFA 3RC8A 1GKIA 1E2QA 2BJVA 1NLYA 3IUYA 5AUOB 3BOSA 3FMOB 4I81A 2QAJA 4DDVA 3AKYA 1Z6AA 2X19A 4L8GA 1ZD1A 4NTZA 1W4RA 1AGPA 2ODBA 1KGDA 3FOZA 1Z0DA 4D6PA 4JVLA 4A4DA 3GEEA 2G1JA 4O2LA 1YR6A 3LV8A 1A7JA 3TIFA 1VECA 1E4VA 2MSEB 2GXAA 2I1VB 4UNSA 3EX7C 1E2NA 1JEDA 3BFXA 2P0EA 2Z4RA 4K46A 4B32A 3U44B 2ZITA 3TQFA 4HB0A 3KUCA 4M1SA 1XBTA 1JI0A 1AS2A 2C9OA 3A4NA 4IEEA 2N46A 5G40A 2XGJA 1JECA 3VKHA 1UEIA 1G7CA 4AI6A 2EFHB 1BH2A 4V0NA 4Q7MB 1ZP6A 4JLKA 4KLNA 5C18A 4XSHA 2A5GA 5K8TA 2GESA 1W36D 2ZRJA 4KODA 4IEIA 4QKQA 2ZRPA 1ZRHA 1IONA 4PAQA 2IWHA 4EUNA 1KIMA 4YC7A 4AKGA 3AH8A 4B73A 1W47A 2H8KA 3W8RA 2YVUA 4B44A 4KAXA 4PAOA 4F7WA 1PVOA 2OFXA 3UG6A 4M9XA 1OXSC 4HDOB 5FTKA 1AQYA 2C9YA 4LYHA 4TZ6A 2GJKA 2ZM5A 1MT0A 4JLNA 2BBSA 3OAAD 1E69A 4RD1A 4KLZA 2PT7A 1ZW6A 2FFQA 3AVXA 1VCOA 3T61A 3K9LA 4BFSA 4YDHB 4US0R 4OHVA 1XDBA 3BWDD 4DRZA 4JKYA 3ZZUA 4A8JB 1TQ6A 4DC9A 5HZHA 2W6IA 2TMKA 3GLFE 4TQ9A 2GBLA 5DI9A 4KSBA 2ASEA 1EWRA 2RKOA 2ZSDA 3LW7A 1DAHA 3VR2A 4QJ5A 3ZVMA 3QBVA 2KWIA 1X8KA 1NSFA 3A4MA 3M1IA 1KO4A 3ND8A 3BIFA 4JSTA 3B13B 4B34A 4M2LA 2OILA 2R2AA 1DE0A 3P26A 1T8UA 5AJWA 1Q1ZA 4MUAA 3RS5A 3T34A 2WTUA 3BH0A 2I1QA 3I72A 2E1RA 1I4LD 2VSFA 2IXFA 3L82B 1G8PA 4HZUB 1XZPA 2RAPA 3QXHA 3DMNA 2HF9A 2FG5A 3WNBA 3TVDA 3KTAA 1D2EA 2G9NA 2IS1A 2RGNC 1N0WA 3AQ4A 5HR5A 3TW8B 1M7BA 3W5JA 2JLYA 1U8ZA 2OXCA 2Q0HA 1Z0KA 4A8JC 4CZ2A 2PLRA 2AX4A 3PUWA 4OQMA 3DZ8A 4Q4HB 3VU9B 1NN1A 3DKPA 5IDVA 1PUIA 5EXXA 1ZC3A 2HCBA 3IQWA 5KSOA 1QBKC 3GFTA 1ETUA 4UNPA 3LDAA 3T35A 1EFRD 1NRJB 1Z0AA 3BB3A 3QKRA 1GFIA 1AKYA 3FKSA 2O8EB 1E79D 1J90A 4FMDF 1X8JA 2JJ8A 5AK0A 3SU8A 4LPSA 2V55B 4C0QC 4EJSA 3AF3A 1WCV1 1D2NA 1SXJA 1YRBA 2ZRLA 4AIIA 3QF4A 2VTKA 4B74A 5JEDA 3SZRA 3OEHA 1VCNA 1E2GA 1SKYB 3SEAA 4DKXA 1GL9B 4Q00A 4PZLA 5CJ2A 2WHXA 1L2TA 1OT3A 2L0XA 3R20A 1OFUX 3GEHA 3UG7A 3PJRA 4N3NA 2IYSA 4ABYA 1DEKA 1YZTA 1XEFA 2G3YA 2ZXUA 4U5XA 4RD2A 2CLCX 2VHJA 4HI0E 4FMDB 5CYPA 5JI3E 1BYIA 1KK0A 3KZ1E 4OK3A 2CK3A 3SHFA 3VR4A 1N6NA 1XMSA 5FUWA 3C7KA 3QJYA 5LBIA 3QKSB 3X1DA 4TMZA 2ZJ2A 2YOFA 1UDXA 1R0YA 2O8DB 2JIZA 1YJ5A 5GJBA 2VPPA 3TGPA 1KJZA 3QEJA 5EXTA 1Q0UA 2FU5C 2P6RA 2P3SA 5L3QB 4M9SA 4NCJA 2IYRA 4Q9LA 2IBMA 1DG1G 1FP7A 3GJXC 4TQAA 1GUAA 4FD2A 2WWWA 5HZKA 3C5HA 2HDNB 1JXMA 4KCGA 2WJHA 3KX2A 3SE0A 4F4IA 2PJZA 1GNRA 5DYIA 4F91B 3C14C 5JBQA 1KO8A 2GWHA 1Y63A 4P32A 4GP6A 2OFOA 1F2UB 4MGKR 5FR2A 4PTLA 1E1QA 2X2EA 3S1AA 3AEZA 5FL3A 2IHYA 2ZRBA 4KXFB 4TL9A 2WVJA 4A2WA 2J0UB 2I3BA 5BW8A 2IUUA 5ANRB 1XEWX 2C98A 4QXAA 3KQLA 4B75A 1OJLA 4JLOA 3NEYA 2ZAOA 4LHVA 1HTWA 2YOHA 5A5GA 4GBMA 3QVVA 1XXHB 2R62A 3N2EA 1P73A 3MD0A 1FOEB 2OAQ1 3RSLA 4P4UA 2ZE8A 4X8LA 3E2IA 2MSCB 2EWVA 2ZS7A 2K5UA 3NDBB 1DAMA 2MSDB 1AA9A 4DDUA 4NKRA 4LJAA 2D74A 2AXNA 3K09C 5HKKA 2BMJA 2V4ZA 4PC3A 2ZI7A 3CWZA 4BRUA 4TMTA 5FR1A 4Q4AA 4LWZA 1NKTA 1DADA 3W6PA 4P3YA 4TMWA 4D25A 1FUKA 5DIFA 3QUSA 2QSZA 4ZDKA 2OAP1 3VMFA 1Z0JA 4F38A 3G0HA 1E2MA 1W5TA 821PA 2C78A 1IJFA 3KKPA 2OXRA 2VIIA 2O8BB 4DIDA 2IHBA 4DEYA 3PEWA 2Q3HA 5P21A 1Z6XA 1E96A 3N70A 2CJWA 1VKJA 3MWYW 5DLQC 1W2GA 4C3ZA 4BFTA 3GFOA 3I8XA 1II8B 2FSGA 3CRQA 1KMQA 3IKJA 4WZ6A 4EQ6B 3I62A 1EK0A 2QU8A 4EAQA 4DSUA 5LPNA 2XX3A 4LGMA 5EE1A 3C8UA 1XTKA 1Z29A 1M6NA 1K8RA 5FTMA 1W5SA 4B48A 1N6IA 3WHKA 1KI3A 3HU3A 4RY2A 1VYTA 1XEXA 2ZVPX 2A5JA 5FUXA 1VIAA 2BMDA 4B3CA 4IXNA 1T8TA 3NTUA 4UXJA 3O8BA 4ZCIA 1YHNA 5DO9A 4NMMA 4OK6A 2CCKA 4KYIB 2W0SA 4ON9A 3R9IA 1ELOA 4TYYA 4A92A 2QGNA 1JXOA 1Q57A 2PZGA 4MGIR 1RW4A 4JJKA 3TR0A 1JAIA 2UVQA 1SXJC 3LNCA 1G5RA 1GP2A 4F4JA 2IEYA 4RD3A 4YONB 5K8UA 1UJ2A 5KPJA 4W9MC 1MKYA 3BH7A 2Z4SA 3LVQE 4HYYA 4LY6A 2ZRNA 2ZJOA 1GNQA 1E1RD 3RYTC 3CX7A 5FL7A 2ZJ5A 3VFDA 4Q01A 3LY5A 1K5GA 1GRNA 5KTYA 2FPKA 1OHHA 4WXRA 2CHGA 1PLKA 3NDPA 1E9DA 2ZYVX 2JDIA 4ITRC 4FCWA 1MR3F 2A7QA 1FMJA 3QXJA 4PPQA 2JLSA 3SYLA 4TYWA 3FHTA 4JT2A 4WZBE 2PMDA 4II7A 1SHKA 2DBYA 1U90A 4JLMA 3F3YA 4V03A 4DLVA 4QJ3A 2IC5A 1J2JA 1XXHE 2C2HA 3KUDA 3IEUA 4ASUA 2XB4A 1S1CA 3LBIA 5JSZB 1OIVA 1Z3IX 2F6RA 2ZE5A 5E7IA 2XTNA 4TN1A 1LF5A 1E0JA 2BCGY 1EG7A 3CZPA 3L0PA 4ZV4A 4CEJA 5AJXA 1Z2AA 1U99A 4ZKEA 1YZKA 4C2TA 4KO8A 3ZD6A 2J7KA 1P3JA 2QT0A 5JZVA 1U98A 4NCKA 5FPTA 1SVIA 1G9XA 1VG0B 1IY2A 1V43A 1CJMA 2OO7A 3PG5A 5B64A 3CF6R 1Q3TA 1YZLA 4DB4A 2AFHE 4AURA 3I92A 2QGZA 5IRCD 2W6ID 5EZ6B 1WMSA 2FGKA 2IYQA 3TRFA 1NP6A 3Q5DA 2V7QA 3M0EA 1Q12A 2DWPA 2P6NA 1J8MF 5AJZA 2QUZA 4IDPA 1GNPA 1R6BX 2IYYA 4LC0A 4B71A 3CRRA 3SJBA 4GP7A 3DOEA 3R7WB 4QHSA 2WICA 4KI0A 3PUYA 3BB1A 3L0IB 4ACBA 4C4PA 3F0TA 3VAAA 1KTVA 2WWGA 3ASYA 1PJRA 2R6AA 3BB4A 4KFTA 1Z5ZA 2P2LA 3KXLA 1DPFA 1CTQA 2FPMA 4AG5A 3KXIA 1G6HA 1XEXB 4I1VA 3K8YA 1C1YA 4L9SA 4KV9A 3PV0A 3SOPA 4JVMA 1W49A 1G3IA 1KI1A 1Q1EA 3Q9LA 2V6IA 2ZSAA 3KQKA 2CBZA 3AUXA 3A37A 3SFZA 1UAAA 1DVRA 1RVDA 4M1OA 3W3ZB 3TH5A 2QSYA 4PANA 2IYWA 3RS2A 4ZO4A 1F6BA 3P32A 3UATA 2FDCA 2F1HA 2QQEA 3THYA 2AD1A 4OQXA 3TVTA 1Z63A 1XU4A 4QGGA 1L7VC 4FWIB 4DSOA 1YR7A 4W7SA 3CPHA 4CRWB 1OFTA 3FKSD 5KOYA 5J40A 5CYOA 4HDCA 1WBDA 4B47A 5EUMA 1COWD 2OLKA 5CK5A 1G16A 1T3LA 3THXA 3U3KA 3GP8A 3K70B 2C99A 1U8AA 2WWXA 1RJ9B 3VR5A 1SXJD 4Q47A 1MO4A 4Q7LA 1WF3A 5IHPA 4J0QA 4NHOA 2LCFA 3ZS8A 3T1VA 2ZUBA 4ZIRA 3U6BA 3QEOA 4IOMA 1KZGB 2GRJA 3AVVA 4AY2A 3T06B 3H2YA 3QENA 4A0FA 3BJIC 3GJ7A 1S0UA 4QBHA 2WM9B 5F2EA 4BFZA 1A2BA 2QORA 3KJHA 2FOLA 2FN4A 3SYNA 1VPLA 3QOFA 5JCPA 2WKPA 3IIMA 3O8CA 4TMXA 1LS1A 3D31A 2VA8A 2IX3A 1ZMXA 2CK3D 5K8LA 3OE7A 5GADl 1XTJA 2I4IA 4JJZA 5CDFA 2B8TA 3TE6A 4D0NA 4EPYA 1Z2CA 3UMRA 4AD8A 1P2TA 3K70C 1E3MA 2ZI4A 4LZZA 4NCIA 5KDOA 4XTRA 2WIBA 5DH9A 4GSYA 1VYVA 5E7MA 1KJWA 4OJKA 4AWXA 1YR9A 2AL7A 2ZREA 3I32A 3WP0A 2PZEA 1MRSA 4RFSA 4CYMA 4KVAA 1W36B 1CRPA 1LS6A 1H8EA 4HUTA 2HYIC 5KSYA 1G8FA 1XX6A 2F43A 4HLCA 3B2EA 4M4SA 2NG1A 1WDTA 1NMXA 3L0OA 4DLYA 1T5IA 2EFEB 1R4AA 2JASA 4DB2A 1VG9B 2GDJA 1GITA 2XJ9A 3GJ3A 1P7CA 1T0JB 4CF7A 4Z8XA 1NG9A 1FTSA 2YWGA 1Z08A 4IDOA 1BMFD 5FPYA 5TB5A 3SI7A 1RRPA 1D2MA 1P2UA 3ETLA 4V0OA 2O0JA 4HAWA 5DISB 3L2OB 4LOAA 2JEOA 3NC1C 4TLCA 4KITB 4R98A 4BFXA 1E2IA 2ZJ8A 2YOGA 2KBEA 1W36C 4B3BA 1FMLA 4PZYA 1KI2A 4BZPA 1YKSA 2WJGA 1U8YA 3B60A 4IOLA 4NP6A 5DI3A 4XVQA 4ARZB 2NO1A 4BECA 3LD9A 2QTFA 3NWJA 2Q6TA 3SQXA 5L3SA 1DELA 1KSJA 1XZQA 1T3HA 3UMFA 1XD2B 3EC2A 4FMCB 2ODWA 3OZXA 4TSFD 1II0A 4NU0A 4WXPA 5JWRA 1GAJA 4MGZR 4B43A 3KJIA 3CZQA 3RRYA 3KQHA 1Z6YA 1BO6A 3FFAA 2ZR9A 3FPAA 721PA 2N42A 1R8QA 1F2TB 4IFEA 1V5WA 1P61B 3LO5A 5SZIA 4ESHA 2YYZA 1TQ4A 4HLUA 4FMBB 4LJ5A 5DSZA 1NBMA 2R8RA 1OKKA 2A9KA 5AJVB 2QNRA 3THXB 1IXZA 1CR4A 1JR3E 2IW3A 1KI6A 1Q21A 1ZAKA 2J3EA 3LW8A 2E87A 2W58A 2XSZA 4PXAA 3P4XA 5FOXA 3IPYA 4Y0AA 4G01B 5JECA 2XAUA 3BC1A 2ZANA 2BCJQ 3FTQA 1TUIA 2V1XA 2WSSA 2GILA 1IY0A 1R2QA 4D0GA 2J7PA 3B9PA 3DM5A 2ZVQX 2GXUA 4O0MA 5EP1A 1BS1A 2ZE6A 4EFNA 4Q19A 4C7OA 1J8YF 2VEDA 5FOVA 2GZHA 2QQ0A 1FX0A 3L8ZA 1GZSA 2IYXA 3I3SR 3ZQJA 3QE0A 1EESA 4MKHA 1P75A 3ZJYA 3OIUA 3ZQ6A 2FE4A 4KBGA 3CKLA 1ZM3A 3LLMA 3GLHB 1D6JA 2GJ9A 1CRQA 4X8OA 1BYUA 4QOSA 2GVZC 3EZFA 1B0UA 4IDNA 4PSKA 3UANA 1P62B 1G64A 1Z47A 4MGYR 4JSYA 1J99A 1YU9A 3MFYA 1GG2A 2F7SA 3FMFA 4QGHA 4PC7A 1E2KA 2W2VA 1T6NA 4CT4B 1PLLA 4OHZA 1G4UR 1YRAA 2OBLA 3RWOA 3K70D 2R44A 2G83A 3IHLA 3K53A 3UKDA 1R8SA 2D7CA 3H0KA 3THWA 1KSGA 2CXXA 2A2ZA 1W0JA 4TMKA 3ZDQA 5TXGA 1MH1A 1EX6A 4E5UA 5EQTA 3FHCB 1RIFA 2XXAA 5FL7D 2WKRA 2GCPA 1LV7A 1AZSC 4LHZA 1TADA 4G1UC 4DEXA 1CF4A 3X1YA 3H86A 1KO7A 3AF4A 4NBSA 1OHHD 1DG3A 4BFUA 2QG6A 5CLQA 2FX3A 4EPTA 4HUQB 4M9ZA 2GVDC 2J0QA 2V3CC 3SHWA 1CULC 1M2OB 5FPSA 3P1JA 4M8NE 1U9IC 3AP3A 3V4RA 3CNNA 3KB1A 4M21A 5EUQB 4QBGB 3PITA 3QG1A 3X1ZA 4A2QA 4ZDWA 3CR7A 1T4GA 1G3MA 3PVSA 2IS2A 1OYWA 4DDWA 1UBCA 1YR8A 2R65A 4Q1CA 3AKCA 1YZGA 4TLDA 4D4MA 1QRAA 2CL6X 4DLXA 3REGA 2ODNA 1AK2A 1XF9A 2DR3A 1XFAA 2YC2C 5FI1B 1IN6A 3MWJA 3JVVA 3MAAC 4F93B 2JLUA 2IYTA 4E09A 3GJ5A 1JJ7A 4A82A 2WOJA 3CX6A 2IYVA 4DCSA 3KFVA 1W4AA 3OF5A 1Z07A 3TAHA 4B3DA 5IK2A 1TQDA 3I73A 1O87A 2J0SA 3U5ZB 4Q9IA 3TNFA 4D4JA 3K0AB 8OHMA 3SYKA 3OIYA 1D8TA 4BWYA 2ZE7A 4DLUA 2WKQA 3FWYA 2NO0A 4OKSA 1GTVA 4JLVA 4P0TA 3PCRB 4NDZA 4A9AA 3QF7A 3U4QB 1NVXQ 5LB2A 4BRWA 3W3AA 1KI6B 1QHNA 2BHRA 3OIWA 4L15A 5J4KA 2EVWX 3NBFA 3GLIA 2CCGA 2ZUDA 4TLAA 3TLXA 5SZKB 3BORA 4ILEA 2GAAA 2Z83A 2IL1A 1TTTA 3LBNA 1ZCAA 4A0GA 1SVKA 2RGCA 4BPBA 2BBOA 1OV4A 1U81A 2WSMA 1CJVC 2QE7A 3GJ8A 4C7OB 1G3QA 2BM1A 3CLVA 3T1TA 3HPQA 2OCPA 5EXPA 1G19A 2VP6A 3EXAA 4GMXA 4QM6A 2WAYA 3PEUA 4D0LB 4DVGA 3RANA 3TSOA 1RC8A 3MWKA 1RE0A 2GJSA 2RHMA 4EPXA 1ZM4A 1CJUC 1EFTA 1UDWA 2VHTA 1L8QA 2XZPA 3ASZA 1S9HA 3DDCA 2VH5R 1VCIA 3GLHE 1GWNA 1NG1A 4X8MA 221PA 2HT1A 4PHFA 2XZLA 1S2MA 2MMCA 4PO9A 5HE8A 1RKBA 4QNMA 4QGFA 5EP4A 3A36A 4WZAE 2PCJA 2W00A 3KQNA 2G77B 3AVPA 4MRVA 2ZU0C 2DHRA 1XPUA 1DAKA 2QA5A 2UZIR 4M1TA 2ANCA 2ZRCA 3EIEA 1OXTA 4V0ME 4OL0A 4TQUS 2IF0A 1YZUA 1DAGA 4GZLA 3SJCA 4HEJA 4AK9A 3EZ6A 2HJGA 4BEBA 5TY0A 2ZJYA 5AUNB 1TU4A 3W34A 2ZQ5A 2FMXA 4H1UA 4XH9B 4XJXA 2ATXA 4UJ5A 4EDHA 1IOZA 2JLZA 3U7GA 4Q5IA 4KVGA 5AWFC 3WNCA 1KO1A 4Y0VA 3ZVLA 4WW0A 1T3SA 2ODEA 1KK3A 4ZDJA 2DB3A 3BAFA 3LXXA 2ZJAA 2BOVA 3BERA 2OLJA 5AUPB 4QRHA 2NPIA 4PHTA 3FFBA 3CM0A 3QIAA 4C0BA 1ZCBA 4JT4A 4TMVA 4LBVA 4A6PA 3JZMA 5BN5A 2A3RA 1ZNZA 3A1VA 1WBBA 2Z43A 3JVUA 3PIRA 2J9RA 3OEEA 4G3XA 3LQQA 4YMTA 3CW2A 1AKEA 4P33A 4TL7A 3EPHA 1EX7A 1Q22A 1JB1A 2WV9A 2EYQA 3MLEA 5FPHA 3C4JA 3ZH9B 1XMJA 2PZFA 2W6JD 4I4LA 5AUQA 4W5WA 2DCUA 4A36A 1W48A 2VBCA 2WWHA 3Q72A 4MRPA 1HEIA 4TYPA 1GM5A 4GL2A 1FFHA 1XTSA 1XMIA 2C04A 4D80A 2BC9A 3SBDA 4Q4LA 4PHHA 4E03A 2PX3A 4L16A 5FBRB 5BYJA 3TSZA 2ECKA 2QY9A 3X1XA 2A5YB 3E5HA 2IT1A 3L43A 4RD4A 2CHQA 4Q1BA 3SJZA 1E2FA 5B30A 4ZKDA 1YQTA 1KI4A 4F92B 4DLZA 1NMYA 3DHWC 4JS0A 2XNDA 1VTKA 1A82A 1FP6A 4TT3A 3B9QA 3D8BA 2QI9C 2X1VA 3CF2A 4BFVA 1CJKC 4RZ3A 2QMUA 1ODFA 1IN4A 3QXCA 1NLZA 3BFVA 1N5IA 3K0EA 1R5BA 3VKGA 3KJGA 5A0FA 2OM2A 4OI2A 1P2VA 4PPGA 4MRNA 4R9UC 4S35A 4XWOA 4URUR 2PBRA 4GRAA 5CIWA 3U61B 1R5NA 1UKYA 3FYHA 3TUZC 1A4RA 1G5PA 4NH0A 2R6GA 1GVNB 1BIFA 3VHXA 4A6XA 2VL7A 4URYR 3QBTA 1TNDA 3GFPA 2H92A 4I1OA 3KTAB 1HA3A 1Z6GA 2D06A 1Y3AA 4URVR 3KFXA 3EZ9A 5JI2E 1IAQA 4IOJA 1QF9A 2ORVA 5J4LA 2D7DA 2VLIA 4POAA 2IA5A 3NKVA 4DUGA 1QHIA 4D26A 1ANKA 1XPRA 1G1MA 2GBLC 3U60B 4WVFA 4LHWA 2J7PD 4Q03A 4HATA 1OF1A 3FMIA 3GJ4A 4JVNA 1Q3HA 2P67A 3B78A 4EPVA 3B85A 1WXQA 1ZUIA 3QKRB 2FJUA 3W6OA 4BZQA 3W5IA 2HUPA 1ZU5A 2RGGA 4IHQA 4C9BA 2WWFA 3RHFA 3RRMA 3WYGA 3WRXC 3SQWA 4BLTA 1K5DA 2QAGA 3FB4A 3FVQA 4MH0R 4EJSB 5LDDC 1SXJB 3TKLA 3QF4B 2JATA 4I99A 2JLXA 1KDOA 1X6VA 2W2XA 3GJ6A 2CCJA 3NIBA 5E7JA 4N1AA 1H8HA 4X8HA 3B1WA 4A15A 3WYFA 2BMEA 3GLGA 3AF2A 2JGNA 2HF8A 3KL4A 1KDRA 1SKYE 2Y8EA 5TVKA 2IUTA 4JL8A 4BLPA 3IDQA 3UXMA 4DLWA 5GJVC 1MO5A 4C0KA 1AS0A 1E94E 1LB1B 2N1BA 4Z8YA 2XB2A 1HURA 1HY3A 2NMVA 4RKFA 2RGEA 2FH5B 1ZNYA 4FI3C 2ZPTX 2H18A 3QXXA 2BBWA 4EFMA 1Q20A 4IDQA 3ND9A 1AZTA 5KYKA 4PZZA 3MMPA 2X8AA 1WQ1R 3AF1A 4AKEA 4OI1A 1MO6A 2GNOA 5CM9C 2VP9A 3ZVRA 2GCOA 2J45A 5KDLA 3RDPA 4B3FX 3MRSA 3I4LA 5CJPA 1E2LA 4Q7JB 4EJSC 5KNDA 1F3OA 1XWIA 2XNSA 3SS8A 3WMFA 1VG1A 2BEJA 1X1RA 2ZIAA 5EE3A 4CEIA 2YWEA 4U00A 3GCGA 3RS4A 3K0FA 3T5GA 3A1SA 4Q9JA 1NVWQ 4D4LA 3I5XA 4N0EA 5HCNA 1LFDB 1OXXK 3OFNA 3ONWA 3WP1B 4QBFA 4EKDA 3PFIA 4QC2A 4C0JA 2V1UA 3ADKA 3FKQA 2WJYA 3W9YA 1JNYA 3QKUA 3LA6A 1E0KA 4ERNA 4LYJA 3C15C 5A4JA 1F48A 1CR0A 1MOZA 1JBKA 1GILA 4QM7A 1KK1A 3AM1A 3AUYA 1P4SA 1P9NA 3S1AB 3K9HA 1A2KC 2NIPA 4YXWA 5H8WA 3WXMA 421PA 4PC6A 4AKIA 1F60A 4DLRA 1S96A 2WAXA 5IK2D 1E99A 3NHBA 3KKOA 2VQSA 1TF7A 2NOAA 2VYFA 1C9KA 1KO5A 4LUCA 3HU1A 3GPLA 1M7GA 2R6FA 4JIMA 4LYFA 3VR1A 3E70C 1X8LA 3MG9A 4B2IA 3N2IA 2A5DA 1EXMA 2ZRMA 2H17A 4P4SA 2FEOA 4HB2A 4LJ4A 2UKDA 1CEEA 2AWOA 1AJEA 4LHXA 1ZD8A 1AQUA 4OQLA 2QBYA 1MABA 1R0ZA 3V4FA 2IUSA 3R9WA 2QE7D 4Q4AB 4B76A 5DNYB 1QHHA 1SVSA 4I1UA 1OFIA 2CNWA 3RVBA 1FQJA 2ZAMA 4XTCS 1OYYA 1US8A 2WMOB 2AD5A 1OH6A 4NZYA 1G21E 2O8CA 2ZYUX 3LH5A 5JHHB 5FOUA 2CJWB 2C9CA 2CL7X 4QG7A 4URZR 3BE4A 1UKZA 3EW9A 4HAYA 1LNZA 3IPXA 1SXJE 3ADBA 3IIKA 3KQUA 1OB5A 1TQ2A 2C96A 2AHOA 1KSFX 1CJTC 2C95A 2JAQA 3NG1A 5FH9A 4JL6A 4FWTA 1G41A 1XCGB 3KB2A 3T12A 1N6HA 2R9VA 4PQFA 1ZINA 2B7BA 2B6HA 1XNJA 1HYQA 4RZUA 3EIHA 3VR3A 5JMTA 1E6CA 1E2PA 1ZIOA 2JJ2A 4PPNA 4ZI2A 1S3SA 4O3MA 1GOTA 2ZUCA 2DWOA 1XJQA 1XJ0A 1GSIA 5F9HA 3AVWA 2GHIA 5J5CA 4DDTA 3ZZ0A 4QHYA 3MWLA 4A1FA 3AVOA 1HQYE 1IN5A 1NL3A 3AGQA 5EJEA 5L3RA 4DJTA 3HR8A 2KB0A 2BVNA 3DKVA 3RS7A 1TMKA 1KYIA 2EFCB 2NO6A 2QMOA 2EW1A 1KSHA 2AWNA 3CRMA 3RABA 3B6EA 5JFGA 3T1QA 5DN6A 4D2IA 1G8HA 3AGPA 3GJ0A 3RNLA 2ZI3A 3CRW1 3NH6A 4DT1A 2QRZA 3WHLA 1TEXA 4M1KA 2GCNA 2O8FA 2D4HA 2RCNA 1KNQA 5KNCA 4BLOA 1X1SA 4NCNA 5CIQA 1G291 1FL9A 1KAOA 4OQNA 3K0CA 4L4UA 4OI4A 5JCZA 3OEHD 1D9XA 121PA 1VCMA 3PXGA 2PCLA 1NI3A 4GPTA 2C5LA 5JRZA 3OEED 3EASA 5C4MA 5JS7A 3VKWA 4RZXA 2KI5A 2QROA 4GFDA 1JJVA 3ICEA 4XVRA 4OK5A 2NO9A 3WMEA 1OE0A 4OHWA 3A4LA 2J59A 2LKCA 2ZYWX 4LJ6A 4B33A 1QHXA 2PEYA 1T9HA 3AVUA 3MUFA 3U3OA 1ZM9A 2B7CA 2GAOA 4WOPA 2VF7A 2ZRFA 4CDGA 4OHYA 2DFTA 2JIZD 2QEQA 5KUTA 3M6AA 1FPMA 5KSPA 2VP5A 2VHQA 1FZQA 2OZEA 4CEJB 4IVRA 1HT2E 1EFRA 1S3GA 3GLFA 1DBSA 2QBYB 2GK6A 3B1VA 1MABB 1E79A 4B35A 3KKMA 2A78A 2ZI9A 4BASA 5LD2B 4TTRA 4TWZA 3AKEA 2B8WA 2FA9A 1WRBA 1RYFA 4DSTA 1VG8A 4IDHA 1E9EA 1IN8A 2IS6A 2RGAA 4GMDA 4P4TA 2QTVB 3AF0A 3VNVA 2H7VA 1C4OA 1PUJA 2HV8A 4Q1DA 4URWR 3DVLA 4L9WA 1KI7A 3P27A 3HR7A 4TT3D 1GKYA 1J7KA 1G5TA 1E1QD 2OT3B 1TAGA 3QPWA 4IRUB 5KU1A 2H16A 1XD8A 1DAEA 1IJEA 4G5RA 4PO8A 2IS4A 1I4TD 3C16C 2CDNA 4V0MA 4MYUA 4TLBA 1E32A 4UNQA 4NYIR 2CLDX 4O2RA 3T5DA 2IXEA 5FPKA 4ZPXA 5IF9A 4MDFA 2ERYA 3EZ2A 4M1WA 1OIXA 1RYHA 3EPKA 4RFVA 1G20E 5LD2C 4PQYA 1FTNA 4QHTA 3GMTA 5JWOA 3VX4A 5L3VA 3KDSE 5FOWA 1E4YA 2V54A 2RB4A 3AP2A 2PT5A 4DBLC 5FTLA 5JWHA 1LF0A 4DUGD 2WJJA 4MUBA 2REBA 1Z06A 2YKGA 5FI0B 1EWQA 2HXSA 1VDZA 3ZIAA 4XWKA 4QJ4A 1IN7A 4URXR 5HKKD 1QHYA 5HPYB 3UWOA 3QKTA 3THYB 3X1WA 3U7EB 2IYLD 3HP1A 4Q7KA 1N5LA 4BUJA 5EE5B 1NY5A 3U44A 2GA8A 2F3RA 5E95A 2KE5A 4LV5B 4DT1B 4JLAA 1M34E 4PSAA 2V8OA 3NBYC 4NE2A 1IHUA 1E2HA 1YZNA 1QG4A 3CO5A 4JYBA 4GDFA 1OFHA 1KKLA 2J1LA 1AGRA 4XOIA 2QENA 3DPUA 2GEVA 4LHYA 4ZIRB 3TAUA 4M1MA 1Z28A 4PAMA 4TL6A 2ZRAA 1VYUA 1G7SA 1S9DA 4NYIQ 1RPZA 3C41J 5GJWC 4US2R 2RGDA 1NIPA 5FBQB 1QVAA 1D5CA 3R8CA 4CEHA 3CPJB 3VR6A 4LI0A 2CLSA 2O0HA 3LXRA 4NPHA 3CWQA 4XVUA 1CP2A 1YVDA 2AKAB 3SBEA 1B23P 1QVRA 2AFIE 1OB2A 1JQLB 1PZNA 4FIDA 4ZCMA 3HYRA 4TTPA 2IK8A 3U3JA 1ONBA 2JA1A 5DHFA 1GIAA 1BOFA 2EFGA 2RGNA 3SDZA 5BXQC 3Q8XB 2ZYTX 2QMEA 4HDQB 3BGWA 3UMSA 3IQXA 1JAHA 2CMKA 2FFBA 2RHDA 4A8JA 1P9RA 3HDTA 4JLDA 4RFSB 4OBEA 2XZOA 1H65A 3OFND 4G0NA 4CVNA 1SVLA 1E9AA 2ONJA 1S1MA 1CLUA 4PSVA 4JLJA 4TLEA 2ONKA 3RLFA 4P31A 4UNRA 1G7TA 4M22A 1ZU4A 1CBUA 5JLJA 4TZ0A 2F43B 3CONA 4AG6A 1FUUA 5FTJA 4RKEA 2GEDA 1YZQA 1E2JA 2F1RA 2JJ1A 4K8OA 4YXWD 3RRZA 2R6CA 3TBKA 1CXZA 1E2EA 2ZR7A 1UADA 1W0KA 3NVAA 2JDID 3CB4A 4BE7B 3E1SA 1M1YE 3G82C 3LX8A 2ZTSA 1G8GA 3IO5A 4BQSA 1EFUA 4MRRA 1AS3A 4G5OA 1KK2A 1OH5A 4Q4HA 3VU9A 2DFNA 1XTIA 2J5XA 4TYNA 3I5YA 4NYMR 4ASUD 1MV5A 5CB6A 4H1VA 2PH1A 2X77A 2A30A 2Z5FA 2NPFA 5DI3B 4DLTA 4TL8A 3A6PC 2GEUA 3H1TA 2OG2A 1AM4D 3NBXX 4XD7A 5L3SB 1XB2A 3Q7QA 1DO0A 2A5FA 5HTKA 2O8EA 1R5OA 4IW3B 5CITA 5UKDA 2V6JA 4B6FA 2ZRGA 3PQCA 2FSIA 2CVFA 3R8FA 2GXSA 2Q9BA 3P4YA 2GJ8A 2BEKA 5L8VA 2GETA 2EWWA 4LBYA 4M53A 2CNWD 3SR0A 3IILA 4DCTA 3RC3A 3MCAA 3BK7A 4QNRA 1E1RA 2NZ8A 4PFSA 1IBRA 2QMHA 1XRJA 1ZUNB 2V7QD 2EQBA 3KJEA 3CH5A 3CPEA 3ZGXA 4LCBA 2OCAA 1Z22A 4G5SA 3UK6A 2WWIA 2KSQA 3J81k 4FCTA 3BRWD 3U3MA 3RWMB 2R6DA 3L8YA 5EXSA 4U7DA 2DFLA 5J4YA 2J46A 4NYJR 3T1OA 4E07A 3B7GA 2D3WA 1A1VA 3V9PA 1FX0B 3ADDA 4D82A 1KY3A 3QKSA 4Z1MA 2JJ2D 4CEHB 3TR5A 5TV2A 2O8DA 2J0VA 2JLQA 4PQRA 4Q9KA 4DIEA 2AK3A 4NYMQ 2WWYA 1N5KA 1RRGA 1SVWA 5J47A 2H5EA 2ZRKA 5FBVB 4Q4JA 1KHTA 1CIPA 1CS4C 3FE2A 4OHXA 4AYTA 3WRYC 4OJQA 4HLUC 3HPRA 4AKHA 5L3QA 5CDFE 5D3MA 1M8PA 4BGDA 4NL4H 4YMWA 3IBYA 6Q21A 1ZNXA 3F8TA 5DN6D 3VHLB 3LFUA 3TUJC 1NIJA 3Q7PA 1N2CE 3O8DA 4DHEA 5JS8A 1EGAA 2VHUA 4B3GA 1XTRA 4UJ3A 1ZJ6A 5K8IA 2QP4A 3RS3A 2LKDA 3KXKA 3DM9B 3K09A 2ZEJA 2CL0X 2GJAA 4JKIA 5DYGA 1F2UA 1TEVA 2GF0A 2QTHA 3THWB 1FQKA 1N25A 1DAFA 2OFWA 5GVRA 2QM7A 3AKDA 2XEXA 2XOKA 1ZBDA 4BLQA 2J0UA 1QG2A 5LB4A 2XXAB 3C5CA 5FTNA 2PMKA 2OBNA 2BKUA 2NTYC 2E9SA 2RMKA 1E98A 1NKSA 2C03A 1XXHA 1W2HA 5BYKA 2IF2A 2QL6A 4IOKA 1OLOA 4LJ7A 4NYJQ 3WNDA 521PA 2GKSA 3O8RA 5H68A 3NHAA 1U0HC 4MKFA 2FZ4A 2HYDA 4YLGA 1XEWY 5CB8A 3OE7D 3FGNA 1VMAA 3BH6A 2DYKA 3LAWA 5EP3A 4LRWA 4A2PA 1U94A 2EFDB 1Q44A 4ZDIA 3GQBA 3REFA 1RZ3A 1ZM7A 5G3YA 1KJYA 3BXZA 1Q1QA 1G3UA 3N5CA 4FW9A 1HT1E 3U7FB 5BWMA 4PC2A 5ELXA 4JMPA 1M74A 2HLDA 3EWSA 2FFAA 1N0UA 2BBTA 4KFUA 4FINA 1FNNA 1Z8FA 2H1LA 2O8BA 1COWA 2AK2A 1IQPA 1H8ED 2BKEA 2VP4A 4O25A 3EPLA 4KHZA 4Z51A 1W4CA 4KSCA 4F4CA 4BLRA 5C4GB 4EIWA 4AYWA 2FSHA 5DGXA 2ZS8A 1II8A 1UF9A 1XCMA 4EQ6A 2Q3MA 1WB9A 3NH9A 2FNAA 1P9WA 2REXB 3SJAA 3LLUA 4MQBA 1NBME 5B57C 4LJYA 1E0SA 3GLIB 2ZRHA 4B2PA 2ORWA 5HCIA 5KO2A 2IEZA 1UPTA 2YHSA 3DOFA 5BN4A 3IHWA 3QPVA 3FDIA 3SNHA 1VHLA 1NN0A 4WIAA 5AJYA 2REOA 2WOOA 2NZJA 3VX3A 1KNXA 3QI2A 1ZD9A 3NEJA 5KHOC 4UXHA 1E9SA 1OH8A 3FMPB 2F9MA 4HSEA 2XJ4A 3CR8A 1E9CA 4LPKA 4DSNA 2QPOA 1NVVR 2RGXA 4RD0A 3RS0A 4Q4JB 5G53C 4Q66C 3ZVNA 3LRPA 3B5JA 2AR7A 2ZJZA 3EARA 4K81B 1NF3A 4Q48A 4C2UA 1J70A 4B2LA 3Q5EA 3ZIAD 4GNKA 3B1ZA 1Q1BA 5D3MB 4BZXA 2WBLC 3HJNA 1HQCA 3U2QA 1G7RA 2CE2X 2FEMA 2RGBA 4HAXA 4RVCA 4CGZA 4C0SA 4US1R 2V9PA 1G8YA 3NXSA 4FN5A 4PC1A 3K0SA 2ZI6A 4R71A 3PEYA 2LWIA 1NBMD 3PUVA 1NNEA 1OKKD 4DLSA 1I2DA 2CHVA 4L5BA 2XSZD 2EYUA 3QXSA 1UM8A 5B58C 5C2JB 5GJCA 1L4UA 1SQ5A 1CR2A 2WSSD 4HLQB 1BMFA 3ICQB 2AKYA 1KY2A 2GTPA 2PJRA 1KMHA 4HB4A 1SGWA 3WY9A 4S2EA 4BFYA 4OQFA 4PPFA 1E0AA 4Q02A 1EFHA 2W83A 2OHFA 4QFMA 1N0VC 3DEFA 2CEAA 4MRSA 4DZZA 2GF9A 3MSXA 4LX0A 4KU4A 1T91A 5JSZA 1Z6TA 4EPWA 1IM2A 5H1YA 1JQJC 4NCHA 1SULA 2YWFA 2O52A 1NVVQ 4UNNA 3W6NA 3CH4B 1ZIPA 4Q21A 1ZM2A
chains in the Genus database with same CATH superfamily
2M7UA 3NHYA 3CMMA 2Y2KA 1NRWA 2HXGA 3PX3A 2WD8A 3CKMA 4LV0A 3JPYA 4JEMA 4OD0A 3D6TB 3NBZC 3IJ5A 3NHUA 2FN7A 3U6KA 4ZZIA 3OTGA 3C6MA 4HHDA 3IR7A 4E7OA 1CHDA 2W6MA 4Y6LA 2P9EA 2QSJA 3ZKAA 1RRCA 5FI6A 3F4BA 5ICMA 3GUYA 2F90A 3LMKA 5FJJA 2NV2B 2DFKB 3M1YA 1BLSA 2J5KA 3SC4A 4WELA 4WINA 1JR3A 2J8ZA 3WLQA 1B0AA 3OBBA 2NPOA 3IXBA 2XQVA 2ZIXB 1XN4A 3HJAA 2XI4A 1J0DA 1ZK0A 4RAQA 5GHYA 1GCAA 3LUDA 3GUUA 5COBA 1K7EB 3HGTA 1GDDA 5DHSA 4K6GA 1J9ZA 2GFIA 2ZIUB 3WLIA 2CXOA 4HR7A 2FHPA 3UB3A 3FA2A 4W1SA 5K2MA 3KYQA 1LK0A 2PK3A 3OICA 1AN0A 3OZTA 4XR9A 1DJCA 2A67A 3AONB 3UJDA 3MBOA 3OSUA 1UJ6A 1W46A 4EUEA 1WY7A 3T7DA 4OEHA 3FTFA 3RIYA 1NLUA 1C7EA 1Z9BA 4LKRA 3AW8A 4X97A 1NATA 1SKMA 5IABA 4WY8A 2EF0A 3TRKA 3EDRA 1CQZA 4ARZA 4F4CA 4K9DA 3MJDA 1KOFA 3H0EA 2R1VA 1UL1X 4EF6A 3PI6A 2GEKA 4ZO9A 6NULA 2XFSA 4LYAA 3ZHSA 1O57A 5LL6P 4XWAA 1NJ8A 3H4MA 1OUMA 1J23A 4HAUA 2R8ZA 2HOQA 5K0GA 3IXQA 3RAEC 4KXNA 5F5YA 3HB5X 4DYVA 2OQVA 4LJ9A 4UW9A 3HFSA 3SF8B 1NNUA 1US8B 1TF5A 1R0CA 3WNZA 2P04A 2Z6VA 2IWRA 1V71A 2FYTA 3OLQA 5EWLA 3ROEA 5FUYA 3R77A 4XLTA 3E9YA 1TZMA 3GA0A 2NXCA 1RP7A 3QXGA 2WTXA 4D9NA 4CQMD 1V4BA 1B6GA 2X8LA 3HDVA 5LMUB 1VL0A 2IZOA 1KDYA 5TARA 2QRLA 4LVCA 3VTZA 1S2LA 2A4MA 2GERA 4TWJA 4XM0A 2JFOA 1IY1A 4YDSA 3TB6A 2BGRA 4M7WA 2E8JA 2I0FA 4YFVA 4R68A 3IA2A 1OW3B 2NUPA 5FOQA 4D46A 1FFEA 3ZIDA 4P92A 3LWNA 3HJCA 3KE9A 3VNQA 3DE4X 4Q6BA 2QV7A 3PFKA 4M9UA 4ER5A 1HLPA 1HGXA 2XGOA 4KQCA 3REQB 3JATA 3OOYA 1EP3B 3UV7A 3INRA 5B1HA 3RTDA 1VHWA 1L4YA 3CF0A 3IP8A 2GDNA 3RK0A 3KOYA 2R3SA 4PLFA 1GA1A 4A10A 1P4JA 1HH4A 3C6QA 1UWNX 3KPYA 3RC8A 5AUOB 3HGQA 3JWHA 3LHSA 1C8BA 4HWGA 1Z0DA 1S5PA 1VECA 4JJ6A 3ZWBA 1CNEA 3GLKA 1ODSA 3AY6A 4P3NA 4O4HF 1ML3A 2YX1A 2FW0A 2G9QA 5KWSA 4K28A 3TTVA 4O1HA 4KODA 2PUVA 4L1KA 4EVIA 1HORA 4NXMB 3MTGA 5KVSA 1TA4A 4AP6A 2GNPA 4I8DA 3ONFA 1L7XA 1LTKA 4LYHA 4BQRA 3HCDA 4JD5A 4RD1A 5TC4A 4EM6A 3AVXA 1K56D 2WHYA 3K9LA 4J1NA 4US0R 5CHJA 4Y9DA 1EUCB 3STUA 3USES 5DI9A 4OQIA 4MUAA 3KEQA 1UBUS 2E7ZA 5H7XA 3CW8X 3OCUA 2IXFA 3FUXA 4MCAA 2X6TA 3WNBA 2HP9A 4ZVKA 4UA6A 1U8ZA 2PLRA 3OX2A 1PR2A 4YMLA 4O4JF 1HQDA 3AEYA 4TGLA 1E79D 3QP2A 1FSFA 3RIMA 1IVNA 4BLVA 3HL0A 5DX8A 4C0QC 3JU3A 4NBRA 4M0PA 3RHSA 5JMOA 4G23A 4MZXA 2NZWA 1DJNA 5J1TB 4ABYA 4RD2A 3SZMA 4BP8A 4JHXA 4KUGA 1NXOA 3E27A 2YXLA 3EEHA 2ZJ2A 1R0SA 4DYDA 3GNLA 1GPKA 3ZCUA 1SO8A 1A7UA 4JWTA 1CY6A 3MBZA 4TQAA 1OFVA 4EDFA 2JCVA 3SICE 1P18A 2PJZA 5E9AA 4AUNA 1DTWA 4MUKA 1NXTA 3EMDA 3PKJA 1TJ3A 4U7GA 3KQLA 4LLOB 1TAQA 4X1OA 3VRHA 4K9SA 2RJ3A 1M1NA 3FPBA 1R6DA 3MD0A 3P9PA 4OREX 4Y2HA 4NKRA 5JZMA 2HMSA 1T13A 4N1HA 3KZXA 3ZXXA 2BGMA 4Q4AA 4X41A 4IIDA 5A6SB 1UJMA 2HK6A 2QSZA 3PD0A 1G21B 5EYPA 1Y33E 1NI5A 4CM9D 5HNKA 2Q5OA 4KREA 1J21A 4OHMA 4L4RA 4X20A 1JG4A 2VK1A 2W6ZA 4AJEA 4EAQA 4GKBA 1IYPA 4RIHA 4AJ1A 2JZOA 3GRJA 1N6IA 4UAGA 4YRTA 4IDAA 4TT8A 2FJPA 2BGGA 2AI1A 5AYVA 4OQPA 3K6SB 3EWKA 4DPKA 3BQAA 4E1BA 1X70A 2HU7A 3CE6A 3VISA 4A91A 1PZHA 1UJ2A 3FB1A 4JX8A 2VTEA 4KENB 3DAGA 3MJCA 4HYYA 1WO8A 2ZJOA 4AMVA 3L8HA 4F60A 2BEVA 2QN1A 1Z39A 2FPKA 4JV5B 4FCWA 2DTDA 4P34A 4RVOA 2JKRI 5AIAA 4BTLA 3BSWA 2GX5A 4JLMA 3O8OA 2R8BA 1AGNA 3B20A 2ZE5A 1LF5A 3L0PA 3S7PA 1NBAA 1L5RA 3I0ZA 5DNVA 4RUKA 2AG0A 3KWLA 4BMCA 2JI7A 3S0JA 2O9CA 3AEQA 2PSJA 5JAOA 3FMVA 4CM4B 2PXAA 2CXSA 1EGVB 1PZXA 1CUYA 1EA7A 4WLFA 5C7YA 2DWPA 2FX5A 4AUKA 4IDPA 3VAZA 2B95A 1RJFA 3OWOA 3TMAA 3ASYA 2WWGA 3QA3E 2PX5A 1QFYA 2WNHA 4G9EA 2YS7A 5T3UA 3S2SA 5JCJD 1DDOA 5C51B 4QGGA 3ZV4A 1X42A 4UE2A 3H42B 4BQMA 1YQ9A 5J40A 4KXWA 1MQ9A 5CK5A 5G1PA 3SHQA 3K70B 2CNBA 2YMLA 1MO4A 1ZGZA 2QW8A 5IHPA 4EG8A 4UFNA 3S4XA 3F74A 2C94A 1E5XA 3RFUA 1ID8A 2IX3A 3CVOA 2QG4A 3FRHA 3CN9A 3KTFA 5CH5A 5AESA 4U7TB 5J2UA 3RASA 2NXNA 4MRAA 4XWTA 4M4XA 1CRPA 3PC8A 5K05A 1X14A 1U2DC 1KARA 1QP0A 2NVUB 1JEQA 1Y4SA 4MUJA 3FKVA 1W73A 2I8CA 3TBFA 1Z74A 4H15A 1MC8A 1NC3A 4K40A 5AW3A 3SKVA 2YRFA 1QO7A 2JHPA 7YASA 4F2GA 4E6XA 1P2UA 4MEZA 2M1ZA 3GN2A 4BFXA 1GR1A 2Q2WA 3L7OA 4N47A 4ILKA 3VPXA 4FYWA 1FMLA 2P2ZA 4NP6A 2HMTA 1A9XA 4BECA 4EB3A 1ADJA 4WDQA 1GAJA 4MGZR 5L7YA 2Y2UA 1V5WA 2P7JA 3H9QA 4ESHA 3OT1A 3FX2A 4HLUA 3BJRA 3DWFA 3VR4H 4ZAWA 3NZEA 1P5FA 4G01B 3D0QA 2V1XA 2WSSA 1IG3A 4HIAA 4KZ7A 1EA5A 4L3OA 1BS1A 3FFWA 3CGGA 4DG9A 1L2SA 2JS7A 3QQPA 4MKHA 1QAMA 2H28A 4ESPA 2YXNA 4QOSA 3G8BA 3KKEA 4MBKA 4K9OA 4WZAB 1U0SY 9ATCA 1E2KA 2JIOA 4J7XA 1QCYA 1G4UR 1OX6A 2O5RA 2JAHA 3H75A 3FUCA 2BHNA 4TMKA 3BGOS 2JIMA 2VYND 4EW3A 3OUZA 3UV6A 2K2NA 2EZTA 4BFUA 2FX3A 1K7CA 3VP1A 4WESB 4M8NE 3IPLA 3KB1A 5EUQB 1GDHA 3NAMA 1Y6ZA 3ED1A 1K2WA 4G36A 3VI4B 4TLDA 3M6FA 3ABRB 4ZODA 3O73A 3COJA 2VZLA 2G8LA 1F4PA 1XF9A 3BHIA 4ZTBA 2HV1A 2WOJA 1UPBA 4EG3A 4GKUA 4I9UA 3R0XA 1IMJA 1NYTA 2OV1A 3UO9A 1XHLA 2CB9A 2W6QA 4OPRA 1GGVA 2E2WA 1GHTA 1GNTA 4KG7A 4RS3A 4AJNA 2YQ4A 2RGCA 4BPBA 5AKLA 2XNCA 2VDVE 2ROQA 5EXPA 1AH2A 3MWKA 1RDFA 4DPMA 2VHTA 1NUTA 4WZ4A 1E3DA 3OOSA 3WISA 3V7FA 3A36A 4WJZA 3PWTA 3GEPA 1U31A 2MSLA 5EPUA 2ZZNA 1H0KA 2WU3A 4KQXA 2PMWB 2AYYA 3EBLA 2FMXA 1TKCA 3UAOA 1NI4A 4EARA 4HDSA 4RPKA 2I03A 2OHOA 2ZSUA 4PHTA 2YXBA 5U47A 4J75A 1WPRA 1A2OA 4YMTA 3OPLA 3JD1A 5KAMA 4D45A 3LZ6A 1YZFA 1NW3A 3CLSD 1Y82A 4EZBA 4YRSA 4GL2A 3GZJA 3A4TA 3A06A 1RP5A 1K3UB 4Q4LA 1WD5A 1QCCA 2A2LA 2P9CA 3T4UA 3SR4A 1SIBE 2O1SA 1GA4A 4HV4A 5KKCA 2CHQA 5IJAA 4Q3LA 3TM5A 3FKWA 4DLZA 4JS0A 4GLFA 4KRGA 3MUOA 1JTGA 4RZ3A 3I53A 1N1MA 5HMMA 2OM2A 4MRNA 1HETA 1T2NA 4URUR 3C5AA 1O08A 2H9YA 3JWIA 4QLAA 4URVR 3TTWA 4POAA 4U39A 3P0IA 4DUGA 1QHIA 1GXSA 5C9ZA 2RL3A 2QN7A 4LZPA 5CFQA 3RUFA 5EMKA 1Q7EA 5JSUA 2XWSA 4UQIS 3WGGA 1K54C 2OWJA 2B3TA 4AMUA 2JATA 3M70A 1RXSA 1X6VA 2JC3A 2BMEA 2Y8EA 2XCOA 5FD8A 3BSFA 4KO1S 5BV8A 2Y9PB 4H7JA 4KNYA 1AQ6A 6ADHA 2DHEA 4PGMA 3AF1A 3NHLA 1JJIA 1JHXA 3RADC 2FQYA 5DM4A 3QELB 2IP2A 4C21A 1ES4A 4OFWA 2HAEA 3WMFA 5BV0A 4LDPA 4DVJA 1ZK1A 3K72B 4MW0A 4W7IA 4Y2GA 4QBFA 4EKDA 3W9YA 3LWZA 4RTJA 4GNUA 4UPVA 3FNHA 2PSFA 4Q1VA 2LZ0A 2EKLA 5DHTA 3O3NB 4YFYA 4TLMB 4ZCTA 4LUCA 3GRVA 5FASA 4B2IA 4EB0A 3N2IA 4CKBA 1MUUA 5EFZA 4HK4A 3BF7A 1QMFA 2FE1A 3MXTA 4WKOA 4FD8A 3NJ8A 4B4ZA 2NM0A 2CNWA 2XD5A 3NCTA 4FR2A 3VR2D 5CLJA 3TFQA 3KQSA 2ZBRA 5BSUA 3KB2A 4GPAA 1N6HA 3HUDA 2B6HA 1V47A 3VR3A 3LIIA 1V1JA 4UU7A 5L10A 1OZGA 5BR7A 1ES3A 1KSHA 5LP6C 4GPBA 1JG1A 4IG4A 4DMHA 1TTQB 2P6PA 5HFJA 2NUTC 2O8FA 4Z4HA 5FCDA 4DF3A 1A72A 1X1SA 4KK4A 3GFRA 4UM9D 2W0NA 5HPIA 3H5WA 4O5AA 4IHJA 3EZGA 5BOVA 2NO9A 1CUFA 4G8DA 4JLWA 2JGKA 3VNRA 3CEMA 3VR4D 4OHYA 3C3EA 1T5SA 1FPMA 2J9YB 1X7XA 1J1UA 2VPQA 2WGIA 3U4LP 4DIKA 3EEIA 3ZZ1A 1NZOA 3OCWA 1GA0A 4BAGA 3AF0A 1E77A 3MXQA 3EHDA 1E1QD 5HWVA 1OI3A 1ZIXA 4ZAZA 4C7VA 3M1LA 2BM9A 2CDNA 2OSUA 5LXTF 4MW4A 4LCLA 3LYHA 3R3JA 1VJ1A 5GIOE 3HRKA 5L3VA 3DP9A 3HA5A 5FOWA 1PDWA 1IDN1 2QX4A 1H2XA 1EWQA 4XWKA 1F8FA 2V97A 5MFPA 5JDCA 1MVLA 4N7RA 5HS6A 2IYLD 2CY0A 1E3TA 2IY9A 4CJNA 1E2HA 3HBAA 3CO5A 1KY4A 1LWOA 4O1IA 1IHXA 1Z15A 4INAA 2SKEA 3SSNA 2PKEA 5IZ4A 5B4TA 2CXNA 4RJKA 5F4BA 4PAMA 3VZBA 1ZQ9A 1G7SA 1M6KA 3C41J 3E15A 5FBQB 2WJ3A 3NHFA 5C8VA 4EI9A 4O4HA 2O54A 4CFZA 4PYQA 1YK1A 5BXQC 5BYBA 4INPA 1RI3A 4TWIA 1H65A 4RLFA 1I7DA 4G0NA 1JTEA 3ZVKA 5CVTA 1G7TA 1ZU4A 1U2GC 2VJBA 4YALA 4ZJ1A 2H1HA 1YZQA 5EA2A 1XRQA 1E2EA 4DMKA 1H0MA 5GZ1A 1LT0A 2VPIA 3PHCA 3DH0A 1Y1PA 3VU9A 1MV5A 5JAMA 3NBXX 1FE8A 4CG3A 4OXRA 1R5OA 3QLEA 2Y1GA 6REQB 1JIIA 1OX4A 1YE5A 2N0SA 4QNRA 1V9YA 3NULA 3O3VA 4JOBA 3X1MA 2EQBA 3N6IA 3ZGXA 2GK3A 3MWDA 4OKIA 2C3YA 4IDDA 1FX0B 4L5CA 4LECA 4Q9KA 4PQRA 2WWYA 3I28A 5A8BA 3OP1A 4D44A 5EVJA 4KVZA 1FIUA 1FFGA 3I0MA 3NTXA 4B3GA 2VF5X 1XTRA 4F4DA 1NX6A 3WDKA 1J2EA 1GFSA 2FPIA 4UCWA 4TMYA 4G1CA 1EX1A 1R4MB 2OBNA 4ZRMA 2JGEA 2NTYC 3FSGA 4CLCD 3RBVA 4LJ7A 1SC9A 5HUQA 2EXAA 4M0FA 3AEUA 2ZIWB 1WABA 1FDVA 1HBJA 4OXXA 4PC2A 3QBEA 3CKYA 1N0UA 3N86A 3WDLA 1BKYA 3WS7A 1I7SB 5CLFA 4Z51A 3N6VA 2FNAA 1BWRA 4TVKA 2REXB 3U9TA 3T5MA 2ZRHA 3UW3A 4C29A 2Z8YA 1A69A 2Z56A 1CW2B 1KAHA 2AZMA 1H1TA 4NPAA 4BFLA 1GYRA 2TMGA 3N6RA 4GXRA 4RD0A 4GZBA 3EARA 4K81B 4OQGA 3GIWA 1W25A 2EZ4A 2WF5A 2XECA 3AF6A 5CW2A 4R71A 1V1MA 3PE6A 1OKKD 3R3UA 4W5TA 2Q28A 5C2JB 2FZKA 5ALZA 1BMFA 3NP7A 1SGWA 2DP4E 1KFKB 3LYUA 1JQAA 4QFMA 2CEAA 4N12A 2H31A 2CGEA 2E0IA 3VPBA 2WM8A 1ZM2A 1NWCA 1CR6A 3IOCA 2XNKA 2NU7B 4FQ7A 1LTQA 4OQQA 3LY7A 2WPDA 2EDAA 4AJ9A 3G5UA 4G09A 3O5AA 4TMFA 1W94A 4EQIA 4H6XA 1B8OA 1PJ4A 5KS2A 2OP1A 5FQOA 3ZGOA 5YASA 2L17A 4KW7A 2ZSFA 4Q3NA 3K2BA 2B5OA 5DFAA 4B87A 1W8DA 2CMFA 3LVRE 1X38A 5H81A 1DFGA 1SK8A 4MV6A 4DWJA 2ZUVA 2J85A 1HFJA 1XAIA 4RHCA 3AR6A 1V9CA 1OTHA 3EVTA 1SKUA 4WNIA 1KQPA 2I4RA 1H1DA 1QV7A 1O6BA 4EGSA 1O3YA 3TW0A 1ECJA 2W22A 3RUHA 2BUCA 3BS4A 4E5SA 2ET6A 5G2OA 1BE1A 3D3EA 1DOAA 1NW8A 2R25B 1ABBA 4UE3S 2JCGA 2HN9A 3EA0A 4MR7A 3NO4A 2QAGB 1Z83A 1YVUA 3LUAA 1E9BA 3H5VA 1GYQA 2LDBA 2I29A 5EHIA 1DRKA 4BKMA 2HT6A 4Q9HA 2AMFA 2GPNA 2BTOA 2VRWA 1AKRA 4GT1A 1AA6A 2WM2A 4IX1A 3F6BX 3RRFA 2AI3A 2AXQA 3R7BA 3IRVA 3JV7A 1A97A 3FHJA 4YJGB 1QVZA 3T3IA 1BC5A 3UWKA 4KUEA 4AMGA 5T7BA 4E5MA 2D6FA 4CT5A 3UTDA 3W8NA 1FS5A 3N7WA 1H2FA 5CP8A 3MBKA 1QFSA 3DAFA 4B46A 4QU3A 2QZ4A 1DWPA 1FQGA 1P72A 5K4AA 1JA0A 4AW9A 3SM3A 1FB5A 1HYEA 1QGYA 3SXUA 3WWYA 1GLGA 1QHHB 3DUFB 2ZS9A 3O90A 2FQQA 1XJ6A 4TQGA 5K3CA 1N6PA 4MUGA 2CVQA 1K08A 1OAKA 1AKVA 2XUPA 1GRQA 1IYZA 4MUXA 1W8YA 1G3RA 4I1SA 1ZQ1A 4KACA 4IGAA 2Z95A 3KKNA 3UMBA 4L95C 4QPJC 2XKJE 3U4IA 4HUQA 4RE6A 4DWWA 3MJRA 2MDTA 1NE2A 1MOPA 4E6EA 5BSGA 3W7AA 3V1KA 1FDIA 2FF7A 2DSTA 4D4HA 1EXVA 2A49A 4J3FA 3U3RA 2VS1A 1FW6A 3ZE7A 5BPHA 3BW6A 1RAHA 2JCHA 3EF1A 1JXQA 3ZZMA 4C43A 4DJ3A 3RR2A 5K01A 1Z0IA 1R7RA 2QMYA 3WBJA 3DW3X 4F3KA 1UKVY 1ZJYA 2O1WA 5LQAA 2XCSB 3V5MA 3EA5A 1Q0ZA 2ADOA 1MO2A 1JT9A 1Z4KA 1KEEB 1CT9A 2Y2JA 4YMSA 2OCYC 2J41A 3SEQA 3M4YA 5J4HA 5KYGA 2WTEA 4LYEA 5E1OA 2BDTA 3GXOA 4YRKA 2QUJA 1H4TA 3I04M 2AOWA 3TQCA 1DHRA 4BWVA 3FTCA 2JH8A 3A58B 1UZNA 4EY5A 3SIPA 3FZYA 3WGYA 2QPTA 2QAJA 3AFMA 7REQB 2X19A 2JVJA 4EGFA 3IAAA 2ODBA 3QP9A 3GEEA 2G1JA 1JDZA 4N0PA 1PR6A 1U2EA 3FAZA 2Y05A 5DEOA 3W5VA 1XBTA 1OT6A 2FUG1 3IH5A 3CPTA 4U9HS 4PCVA 1PI5A 2PM8A 5D8DA 4KWIA 1BH2A 4XSHA 2B5RA 4WEQA 5FI7A 3F96A 4EY8A 2IWHA 1GSXA 1KIMA 1NGSA 2A0KA 3C43A 1J2RA 1ADGA 4ATNA 1OXSC 3T50A 3IMCA 1AQYA 1REQB 5HEKA 2JI9A 4FHEA 1SUWA 3TYXA 4QT4A 2XVZA 3T61A 3MYRA 5TS2A 4JGGA 5FF9A 4DC9A 1FK8A 1TIPA 2JD2A 4GXNA 1RZRA 4KSBA 1JWVA 1EWRA 2HZ7A 5L09A 2C3MA 1KO4A 2J3LA 4KKXB 4D9MA 3LDUA 3K16A 4QHCA 1KMNA 1AXEA 4CKWB 2KMLA 2A6PA 4L0LA 2XKKA 4IF6A 3GB9A 5IDVA 1PUIA 5EXXA 4JPMA 3IQWA 3HZOA 4BBUA 1CUIA 4DDSA 1QBKC 1AKNA 5LNK6 1SC1A 1Z37A 2Z2JA 2V55B 4V38A 5FRDA 4EJSA 1WZUA 1D2NA 1QS0B 1GHMA 4JXGA 4N48A 1E2GA 2HBZA 3UPDA 4CUZA 3DKKA 2W3FA 2WHPA 4RMNA 4BB0A 1TS7A 4LA4A 3N0RA 3ZHRA 3EXFB 5JDIC 1Q0TA 2CK3A 2HP5A 3ANXA 4YREA 3RC2A 2QX7A 4DA4A 2Z2KA 2XKAA 3QU5A 4TMZA 2O8DB 2LE0A 3SBOA 1MZVA 2HJEA 1Q0UA 3U16A 2C5FA 4HQLA 1L5YA 5BWLA 2IBMA 5J7EA 5DTMA 4D0SA 1T8YA 4ER0A 5HZKA 2YYAA 3SE0A 2B6NA 5EKUA 2FN8A 1NC1A 2BDUA 4M89A 5FR2A 4PTLA 5K0ZA 1ECLA 2WVJA 5FLKA 2CXHA 3ECAA 4B75A 1MNAA 3VJLA 2EX1A 4JDUA 4HSGA 2AUTA 1Y1KE 5CPBA 2P1DA 4FDAA 4BBZA 2V0GA 1DV2A 1AA9A 1UT8A 1ZH6A 4BRUA 5KYTA 1I9CA 1WHTB 1JSRA 3MINB 4EITA 1CD5A 4DEYA 5F12A 4DTIA 4IILA 2CJWA 2IBSA 3NWPA 5I7RA 5ICEA 4D9BA 1LU9A 4ANFA 4O63O 1ACJA 2YHIB 5JNUA 1J8FA 1VYTA 5BN4B 2EG9A 1VIAA 1Y5NA 4YP7A 3ML1A 2W3EA 4KPYA 3NATA 3HJGA 1FTQA 1RPTA 3R41A 2M7VA 3AGDA 3WO1A 2IEYA 3GGJA 1T9KA 1YCHA 1ESCA 3LBAA 5KYUA 3MRVA 1MN6A 2FR8A 4BCCA 4PFQA 1XXMA 1E1RD 2FJ0A 4DJFC 3LI2A 4QJBA 4KL8S 5BWNA 3HFGA 1CK4A 4L08A 3GROA 4MKRA 2JLSA 1TM4E 4ECEA 1SHKA 2EP7A 5DV9A 4QJ3A 4UZEA 5E7IA 3UOAB 1OGYA 3RTEA 4C2TA 2HJSA 2JKTI 4HP4A 5DM1A 5ICSA 3VP3A 3FPJA 4MYSA 4MR8A 1V43A 2JVKA 5EOVA 3F5QA 3I92A 3QV1A 4MYDA 3T1SA 4KNVA 4R4RA 4WT7A 4WKCA 1OZFA 2V7QA 1KPIA 1LPBB 2MT9A 3DAYA 3IOYA 4MJLA 4CV3A 1S2DA 4X56A 3D81A 1Z5ZA 1BCRB 5GONB 4KV9A 4CM8B 2ORYA 3UWPA 3RS2A 1I5RA 2QQEA 3S2IA 5LXTA 4FWIB 4L8FA 3S44A 4Q34A 5KOYA 2NSLA 3G9UA 2OV5A 3L6RA 1YUMA 4LFCB 2QVBA 1UC9A 4XB1A 1FSSA 5JC8A 4MWBA 3AVVA 3GJ7A 4BFZA 2H29A 2VDMB 1UWCA 1XTJA 1Z75A 3GG2A 3BFJA 3R7AA 2WIBA 5HX9A 3FI0A 4RFSA 3V7YA 4B6QA 3MCTA 1T9ZA 5DBFA 4TXNA 3BXFA 4GNRA 1FS4A 3B2EA 3I1IA 3UK0A 1ZD4A 1HDZA 2Y2MA 2B4AA 2GEBA 1DC6A 1W36C 2PWPA 5JV5A 1JKMA 1U8YA 3T4SA 3CLHA 3T7EA 4QRIA 1RBZA 4YAJA 1K86A 1RADA 4YY3B 4NDAA 1F2TB 1TU0A 1QZZA 1TQ4A 2PS9A 2BTEA 3HVUA 1B6TA 2NVBA 3ILVA 5KHLB 4IGEA 3FTQA 1EB9A 3AEKB 4ZC1A 1E3IA 2NYVA 5J2UF 1NZDA 3DL4A 4Q19A 4NK3A 3QNWA 4Y3UA 4OQ4A 3I6IA 3F49S 3S7OA 4KBGA 1ZM3A 2L2QA 5J5VA 5AW6A 4X8OA 4B6PA 5KX5B 3OI7A 1Y3FE 3PDUA 4QGHA 4DL9A 4CT4B 3RWOA 3S27A 4CODB 4RQAA 2YMQA 5GLDA 3ZEAA 2BGJA 4RDCA 5F73A 4GKAA 3TMYA 1VPEA 2WFLA 1DBRA 8ATCA 5CGWA 4EP1A 5F7ZA 1M76A 1TRKA 3CR7A 4WBNA 3PVSA 1TO6A 3IRUA 1VJGA 1OYWA 4CLRB 5T4EA 3E82A 1QRAA 2FEAA 1IOVA 1H6DA 1YZVA 1I2WA 4L0CA 1JJ7A 1AKMA 2AVDA 1HC7A 2J0SA 1MJ5A 4CIVA 4PRYA 3I5MA 5LB2A 2IHNA 1LSVA 1MLDA 1SVKA 3U0VA 8GPBA 4A0GA 1PE0A 5HVNA 1X80A 3PQ5A 1XFDA 1UFVA 3MW8A 4M0CA 1CJUC 4OMCA 3KALA 1GPUA 3KJZA 1VKZA 2LDXA 3MZDA 4KO2S 4WX2B 1XPUA 1UFRA 3AC0A 3L01A 5AUNB 2QKPA 3LP6A 4JJFA 4AUEA 2ZQ5A 4UJ5A 2W90A 5IKOA 1I6MA 3WLHA 3MMXA 2MSNA 5C52B 1LSWA 4AKSA 4YR9A 2BOVA 2Q4OA 3F9IA 1L1FA 5U9CA 3CM0A 4G4SP 3V8EA 4IUKA 1ZNZA 3OM1A 4IM7A 5TIIA 5PGMA 1Q22A 3FCXA 2LCIA 4I4LA 1MNQA 1EJ0A 3GDOA 4UATA 5GQSA 4DKJA 2C04A 1LLFA 4E03A 3OJXA 4E2XA 2D1RA 5FBRB 3O9MA 5KOJB 2QY9A 2GSWA 3INTA 4Q1BA 4R2JA 4F92B 3PFFA 4BNGA 5HRAA 1U6JA 3F1NB 2CNNA 3M2TA 4DXBA 3K0EA 3SC2B 3OMLA 4DR3B 1H94A 3MGKA 1A71A 5D00A 3VHRA 3D8UA 1I7LA 4EG0A 4X1YA 2VL7A 4CLOA 1PIOA 3GFPA 4FGSA 4UEQA 2WJ6A 3IUBA 2D7DA 1JFFA 4D26A 5J5AA 1C7FA 4RYEA 3NRJA 2RHJA 1T2CA 4EPVA 5IBRA 1RM3A 3VPAA 4MPTA 1CDZA 3WJAA 3GF4A 3RRMA 5BW6B 3TIVA 2XBLA 1JWAB 4RWZA 5AJHA 3AF2A 2DSNA 3QWIA 4I1YA 1NBIA 2EF1A 2V3WA 3UXMA 1PNOA 4C0KA 1NDHA 2N1BA 1T3TA 2A1TR 3Q82A 2A4KA 2BBWA 4NZOA 3PFNA 4B3FX 1UOOA 4BX8A 5JH7A 3M2JA 5KNDA 3OPYA 4O7DA 3ICCA 1VKRA 4U00A 3KSZO 2YZGA 3BXHA 1IWOA 5CD1A 2CLIB 2V1UA 2WJYA 5I4CA 3LA6A 1TLLA 2WF6A 4EJ6A 3UT0A 3BMOB 4EECA 3V50A 4CMBA 3K9HA 3WL6A 3IDZA 1ODCA 2IEAA 1B3BA 1Y3HA 1MORA 4BJ6A 4P9NA 2HK7A 2NOAA 3SYMA 3QLTA 1R37A 2A5DA 1MA3A 2XWJI 3ZOKA 1CEEA 4WCFC 1ZD8A 3BL5A 5ALMA 3V4FA 1P5RA 4IDBA 2W1TA 2BT4A 3B70A 1KZ9A 5F23A 2B34A 5IVPA 4ZXFA 4IEDA 1DJBA 2G40A 4R84A 1HDRA 2R9VA 5IAKA 2WF7A 1ZIOA 1GOTA 2POQX 2OM6A 4J90A 4FPXA 5ALUA 1HFKA 5CR9A 4YQYA 4BMPB 2IEBA 2PBYA 1E1YA 3EDYA 3O9ZA 5DX0A 3PKZA 1DXQA 3WHLA 3A9VA 1YQWA 2WFZA 4PWYA 1QLHA 3G85A 3BFGA 4B5KA 4YDQA 4OQNA 3K0CA 5HD5A 2W9XA 2PCLA 3KSFA 1SU8A 4U4AA 4Z9QA 2BFMA 1C3BA 4R8MA 3BILA 5JVDA 3C3MA 2HA7A 4Y6SA 1EUZA 4HF7A 3ZV3A 5I7HA 3N2GA 3NAZA 1AMUA 5D5PA 4MBFA 3TZQA 2C7GA 2JIZD 1RKUA 3BWEA 4XWWA 1WDMA 4LTMA 2UVPA 2L0WA 2XR1A 3K6JA 5ETJA 4DSTA 5EXDA 2IS6A 2H7VA 5CHEA 5ILGA 3NP9A 4Q1DA 1PEAA 5K0LA 3IAHA 1JH9A 2Q41A 2Y92A 3SS3A 4OUKX 2W2LD 2I91A 2AN3A 5FV4A 3ZTYA 4D41A 4MR9B 2YHUA 1RU3A 3P71T 4KMMA 4ONEA 5HKKD 4RHXA 2M6KA 3VP0A 3HFJA 3T1RA 4IHJF 3U7EB 2XWQA 1MA0A 1CUXA 4BUJA 3UE3A 5F9MA 3HGMA 4JLAA 4PSAA 2VC2B 1P3Y1 4TZKA 3A14A 4QUBA 3N58A 3ZNNA 1KKLA 4GC5A 1O95A 3LUHA 1CX9B 4ZIRB 1Z0SA 1Z35A 2BRUA 4QECA 4KZ4A 3BZBA 3UEOA 2CNLA 3A9SA 3MTDA 3TJMA 1QVAA 3UJ7A 3VR6A 3H0CA 4OVDA 1TFRA 4M7RA 4AJHA 1X1CA 3AMVA 1HEYA 1DCKA 3SDZA 3Q8XB 1D7AA 2CMKA 1U5CA 5CNMA 2HQ1A 1ZJ4A 1N9NA 1SVLA 3SZGA 2PN1A 5CRFA 3RLFA 3KSRA 3MERA 2R5FA 4YXWD 4HEA1 3KQYA 4OMDA 1BTOA 4BE7B 4BX3A 3LCCA 1P0IA 2WDZA 4UULA 2RCXA 2WK0A 4QTUB 2B8NA 3DTTA 4TL8A 4AMZA 2OG2A 2X76A 1NRJA 1WW2A 1WUTA 1D2HA 4FHZA 2FSIA 4B9OA 2NSJA 2YXDA 3VU1A 2QLBA 1KFCB 3PDCA 2Q8QA 4U3JA 1G8AA 3BJNA 1E60A 3HXTA 4UAJA 3EVDA 1HKHA 4DA6A 1IL0A 1N3LA 1Q6YA 3RSHA 4UM7A 3FYSA 4ZI7B 4NYJR 1IB0A 1A1VA 1Y4DE 4FONA 2GEJA 3ELYA 2ODPA 3AUSA 3JVDA 1CIPA 2GPAA 2ZQ9A 2IBTA 1N2CE 4OQHA 3PFCA 1N32B 1ZJ6A 2PS3A 2ZMAA 3OUUA 3UT5B 2QTHA 1BX0A 3NOXA 3V1UA 2F67A 4IQFA 2DQSA 4KYVA 2JJMA 2AVXA 4QFCA 3KFLA 3QLUC 2IF2A 3PGJA 3PLNA 1DT5A 1U0HC 4CM3A 1GCEA 3OE7D 3WRVA 4C6TA 1ZM7A 3ZBUA 2BI8A 1TUGA 3WLRA 2Q62A 1JPVA 2FFAA 4KFUA 3WQRA 2J9FA 3ZE2B 4F2WA 1MGPA 1QR2A 3RTBA 2Q2OA 4RQ9A 3L7JA 2WUVA 4YUWA 3C98A 3RQIA 4WZ5A 3JD3A 3NS7A 4IIEA 5DGXA 2OV6A 4YAUA 1OTDA 4ADSG 5CDYA 1EWZA 4WN5A 2V96A 3GDHA 3T5AA 4QXOA 2RK6A 5BORA 5KYXB 5A92A 3D7LA 1A0KA 4HSEA 1W1IA 4CMEC 5EXEA 4Z0PA 3OJOA 3D2BA 2WJWA 3PHGA 3WDSA 3H5AA 1GV0A 3IAM1 3H3FA 4IIGA 2WBLC 3B48A 3EDOA 1X1QA 5C35A 1NJ1A 4R8VA 4C4SA 1CVIA 5EKXA 2XSZD 2IHZA 1BU8A 3D3JA 2PJRA 1LC3A 2QRJA 4OQFA 4MB6A 5JTTA 3HXLA 4OFBA 4CETA 1K88A 5F78A 4DDMA 1LBHA 4E3LA 2PUCA 4P0TA 3F6CA 4KH0A 3MBIA 3JTMA 1BKDR 3QY0A 4KJZA 2EKQA 2XF3A 4ISCA 4JKOA 1A8PA 3C4VA 4TSRA 3ZG8B 2FFFB 2VNSA 4XM2A 3JQPA 5J4VA 3BY8A 3PHLA 2I76A 4J8PA 4ED9A 3NHSA 2KW5A 2HWKA 2QVCA 3Q2KA 5IBPA 1HLUP 2BJWA 2PLWA 4RH0A 1W0KD 3GLIE 2FW7A 2RH9B 2P79A 1WA9A 1I6KA 4KQRA 1TEHA 3EDCA 4C0LA 1IUNA 4LOJA 4DREA 3HYTA 5AK5A 5IM5A 1A27A 3C8ZA 3WLAA 3ZYTA 2QW0X 3VNSA 3LU1A 3JQFC 1Y6QA 3FCUB 2HQBA 1QX4A 4NS1A 2Q6OA 1B0ZA 3TLBA 2F8TA 4HMPA 1JFLA 5HKAA 3D3WA 3E05A 1M6EX 4QAQA 4N7MA 5AKEA 2C59A 1W1WA 1I2CA 4N3CA 3IF5A 4NJMA 2O2EA 5FLXA 2XE7A 4KI7A 1G17A 1DS6A 2X2FA 5G41A 3V1LA 2UVDA 5EP2A 2AB0A 4P6BA 2F55A 4F4HA 4F9EA 1ZOIA 5E6UA 1U0GA 2WIAA 3T7KA 2QTNA 2K7ZA 4MQ4A 2BHTA 2H57A 621PA 3WIDA 1OAAA 4U2FA 1NY6A 2A88A 2X0EA 3AV0B 4UASA 3MJVA 4PLTA 3ZV6A 3HKBA 1KYZA 3BD9A 3RAPR 3A6LA 4MN6A 2EJUA 3V1YA 3HDYA 1MVOA 4D81A 4FNMA 2FSFA 4YOFA 6LDHA 3Q85A 1UQTA 1V3QE 4ZCSA 1M2NA 3RFCA 4BJPA 3K2EA 2P3QA 4G67A 3PGLA 2HQSA 2SHKA 5JBIA 3U1BA 1V6CA 3HKEB 3N7UA 2Q9NA 1Z0ZA 1DRUA 2O8NA 5BQ3A 1BNCA 1EU1A 3NBKA 4DA7A 1P4AA 3OHMA 4JMLA 1XTVA 4XYGA 1U3UA 1VKOA 2JLVA 4DM3A 3E2LA 2VDPB 4HFJA 3G3EA 3QWBA 2JFWA 2PQMA 4ZQHA 1H2ZA 4RTSA 4MYCA 3IQZA 3A6ZA