3JVUA

Crystal structure of unliganded p. aeruginosa pilt
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
342
structure length
337
Chain Sequence
MDITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPLEHKQVHALIYDIMNDKQRKDFEEFLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSKVLTMEELGMGEVFKRVSDVPRGLVLVTGPTGSGKSTTLAAMLDYLNNTKYHHILTIEDPIEFVHESKKCLVNQREVHRDTLGFSEALRSALREDPDIILVGEMRDLETIRLALTAAETGHLVFGTLHTTSAAKTIDRVVDVFPAEEKAMVRSMLSESLQSVISQTLIKKGRVAAHEIMIGTPAIRNLIREDKVAQMYSAIQTGGSLGMQTLDMCLKGLVALISRENAREKAKIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Twitching mobility protein
publication title P. aeruginosa PilT structures with and without nucleotide reveal a dynamic type IV pilus retraction motor.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Atp binding protein
total genus 97
structure length 337
sequence length 342
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3jvuA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3jvuA02
1YJ5A 5FBVB 4DCTA 2J3EA 2ASEA 4P3YA 1W49A 1KKMA 2EFDB 3QENA 5K8UA 3GJ6A 4I1VA 2A5DA 4G1UC 4YXWA 3K9GA 3TNFA 1GKIA 5EP2A 1J99A 3CNLA 3KJHA 4A8JB 4Y0AA 3GEIA 2JA1A 3K09C 2JLXA 2IA5A 3PUVA 4EPWA 2ZI9A 2FMXA 4RCYA 1BKDR 3RRZA 4AYTA 1EWQA 2IXEA 1W5SA 2CHVA 2ZRMA 3AF4A 5FTNA 1UBEA 3N5CA 3LDAA 2O8DA 1Z0KA 4HAZA 3AVQA 5JWRA 4RD4A 3SBDA 2GJKA 1PJRA 3AVTA 1ZM3A 2ZI3A 3KB1A 4M21A 3AUXA 4FINA 4NCNA 4C0SA 4GT1A 4Q4JB 1VHLA 3KJEA 4AKEA 3SYNA 3BB1A 4OQMA 4BFWA 4XD7A 4OI4A 1XFAA 1OYWA 5L3SB 3EPLA 1RJ9A 4JLVA 3EG5A 2BHRA 4OHXA 1DEKA 2IT1A 4MITA 3I5YA 3TMKA 4GOKA 3TKLA 4LZZA 4RFSB 2V6IA 3LRPA 3LXXA 1KDOA 4D25A 3X1ZA 4HB2A 4IRUB 4WZAE 5LD2C 1SXJE 3N2EA 1O3YA 4K81B 3I62A 5LB2A 4D0NA 5DN6D 3DMDA 1U8ZA 2JLRA 3IHLA 4TZ0A 4UNRA 2GJ9A 3IGFA 4UNSA 1E79D 2BBWA 3U44B 4Q4HA 1TQ6A 2V1XA 4ZIRB 3H2YA 4PAQA 2ZU6A 1E98A 4A8JA 5CB8A 5KSOA 3C15C 3SDZA 2VHTA 2PCLA 4PPFA 2WMOB 4GOJA 4XVRA 2CMKA 1X1RA 4YDSA 3EZ6A 4KVAA 1UDWA 1R6BX 1CJUC 1XD8A 4HLCA 1Q12A 2WJGA 4M0LA 2E87A 1YKSA 1KZGB 3ZIAA 3RANA 3THOA 1MO3A 1LFDB 3W5JA 3ZZ0A 2GZHA 2O0HA 4YMWA 5FPYA 2BC9A 3L0OA 4IXNA 3CRVA 3CM0A 3MLEA 5CM9C 3VX4A 1DPFA 4XVUA 1N6PA 4U02A 2JLYA 5G53C 1W0JD 4AKGA 1ZM2A 1A1VA 3QKUA 2D7DA 2FSHA 1W47A 3GLIB 4TYWA 2ORWA 2FZLA 5LDDC 5JJLA 2W0SA 4PAMA 4Q00A 2BMDA 4DEYA 3QPUA 2I1VB 2WSMA 5JI2E 1XF9A 5L3SA 2QROA 4IDOA 1NJFA 2OCYC 2ODBA 2ODEA 3FHOA 4RFSA 2CBZA 3SJZA 3IQWA 5EXSA 1OT3A 5K8LA 1CKEA 2P3SA 1WB9A 1JAIA 1AGPA 1ZW6A 3W8NA 1NG9A 4TT3A 3ZVRA 1WCV1 1Z2CA 2IK8A 2GEVA 1D8TA 2HT1A 1HQCA 1SKYE 1CR4A 5G3YA 4Q9JA 3U44A 1P5ZB 4JLOA 3MD0A 4P32A 1E9AA 1UKYA 3I1FA 3M1IA 4YDHB 5FI1B 4ZIRA 2F55A 3CF2A 2QN6A 4QBIA 2GKSA 1HY3A 3KQUA 1OF1A 2WM9B 1OH8A 3UMFA 4P4UA 4Q4LA 3TJZA 1T8TA 2FFBA 1NJGA 3P1JA 3DMNA 4IVPA 4U7DA 1NVWQ 2REOA 1RVDA 2QSYA 4UJ5A 2XNSA 4UNNA 3TIFA 4HB4A 1E32A 5B58C 2GXSA 1D9XA 1TEVA 2A5YB 3WXMA 4IFEA 3HP1A 3IIJA 1G41A 2J59A 2W6ID 4JSYA 5DH9A 1M7HA 5L8VA 1HT2E 1Q1QA 3A4LA 4ZCIA 1SKQA 3SI7A 1MKYA 4L5BA 3VAAA 2IBMA 1QHHB 2NO6A 2QT0A 3GLIA 2CK3A 1JB1A 5CDFA 1TU4A 3EASA 1R0XA 5DO9A 4CEHB 4AWXA 3B78A 1GRRA 1WF3A 2IC5A 1CJMA 3RRMA 3CH4B 3A4MA 3DVLA 3ZGXA 3UK6A 3UPUA 4LJ9A 5HR5A 5IRCD 3MGCA 3WYGA 4XJXA 1ESNA 4UXHA 1E1RD 1S1MA 5BYJA 2VP9A 1SXJC 1JR3A 2AKYA 2VL7A 4HYYA 4MYCA 4QNMA 5C1BA 5E95A 4P31A 4QJ5A 2CCKA 4HAWA 3EARA 4US0R 2YV5A 4EFMA 4OKSA 4LYAA 3AEZA 1FZQA 4K46A 4BZPA 5EP4A 1GNQA 5FFMA 5F2EA 3O8CA 5KTYA 3WRYC 4GP7A 1US8B 1Z6YA 4JT4A 3ASYA 4KSCA 4I81A 1GL9B 3ZQJA 2Z6VA 3ZZUA 2ZRKA 1P4SA 5J4LA 2UZ3A 1OHHA 2CJWB 5HE9A 1SGWA 3KUDA 3ICEA 5H1YA 4IOJA 3UMRA 3WBJA 5UKDA 2D4HA 2XX3A 3RRYA 3UMSA 5CM8B 1X86B 1YRBA 4TYPA 3P32A 4B2PA 2JGNA 3BIFA 4DUGD 1KSHA 2H92A 1K6MA 4TLDA 4URYR 4X8OA 2SHKA 4HZUB 1T6NA 2GZDA 2J0QA 1EFCA 4O2RA 2ZI6A 3NBXX 4LC0A 2F1RA 1QHHA 4BLOA 3LFUA 2RGAA 2BEKA 3QY0A 3Q72A 3MWLA 3HU2A 4FIDA 4CEHA 2FFAA 2REBA 5TXGA 1E9SA 4CGZA 1GKUB 1S9HA 1IAQA 1DAFA 1Z83A 2C96A 5LD2B 4K8OA 3GLHB 1KO5A 4FN5A 4S35A 4XTCS 3GJXC 2W2XA 5FOWA 2CXXA 2ZYVX 3Q5DA 3UWKA 4TLEA 1HYQA 2F43B 2I3BA 4ZCLA 1WP9A 4CIDA 3SR0A 1U0LA 3CX6A 1U8YA 3ETLA 3ZD7A 4Q21A 3DKPA 4MGIR 3RC3A 3UG7A 5JEEA 1XTQA 2R2AA 2XEXA 4LPKA 1OFUX 2IS1A 1P6XA 1VTKA 3VFDA 1LV7A 3K09A 4LV8B 4GSYA 3NBFA 2D7CA 1US8A 2J45A 2YYZA 4OI1A 3CWZA 3LNCA 1FNNA 4QFMA 1XEXB 4ABYA 5F9FA 2WIAA 4NMMA 4LC1A 1G20E 3GFPA 4US1R 4J0QA 5EXTA 4DEXA 1OXTA 4LYHA 1SXJD 4IOKA 5BW8A 1PLLA 2FPKA 4KI0A 4AY2A 5CYOA 1ZNWA 3CX7A 4M1WA 3X1XA 1DARA 1QBKC 3B1YA 3CWQA 3GEEA 3T1TA 2PH1A 1XX6A 4CEIB 1JBKA 2A5FA 4HZUA 3L8ZA 2OAP1 2KBFA 3OAAD 4X8MA 4NU0A 2WWIA 3DOFA 1W7AA 1QG4A 2GWHA 4M53A 4IJMA 4O25A 1FTSA 2PX3A 4ESHA 3GLHA 5AUPB 2E9SA 3H0KA 1Z0DA 2XSZD 5AUNB 1FX0B 1P73A 3AH8A 1G5RA 1LVGA 4E09A 5JRZA 2F43A 5KHOC 1JEDA 2IYRA 1NG1A 1QHXA 4XWAA 3TK1A 3QVVA 5DE3A 1NVUQ 3RABA 3U4QB 1TMKA 4A15A 1L8QA 1P9WA 4PSAA 3IPYA 3ADDA 4IVRA 4PZLA 3CNOA 3QE0A 4HDQB 3WNCA 2R6DA 4PANA 3SZRA 4TMKA 2QA5A 1UDXA 3FKQA 4HLDA 4OHWA 5G40A 4OHVA 4C0AC 5JS7A 2GK6A 1KI8A 1XTIA 2OHFA 2VA8A 2HF8A 3KUCA 3W34A 4EPVA 1IY0A 2ERYA 1KI1A 4PSKA 4ASUA 4DSNA 1XEXA 3IEVA 2O8BB 5CK4A 3TVDA 1D9ZA 3NDBB 1RRPA 3KTAB 3GJ3A 3I61A 2P6UA 2IWHA 3A1WA 4B33A 5CLQA 1N6LA 3TQFA 4CEJB 4MUAA 4RY2A 3RYTC 1NLZA 2J46A 3AVPA 1TEXA 4P4TA 4Q5IA 3U3RA 4YLGA 4CEIA 4YONB 4R98A 2IHBA 3IBYA 2CE2X 4D4JA 4ZI2A 1G6OA 1RKBA 3CIOA 5JS8A 3Q8XB 4TSFD 1HE1C 4KCGA 1ANKA 4HZIA 4PSVA 2AK2A 1R7RA 2ZR7A 1K5DA 4RD2A 4IOMA 4OHZA 1E0KA 2FSIA 2IUTA 1XTKA 1P3JA 5FOUA 4Q7JB 3KKQA 2HDNB 1GG2A 2F1HA 1EXMA 3PIRA 1D2NA 3RWMB 4C0LA 3TAHA 1OE0A 4F93B 1PVOA 2RGCA 2XZPA 3D8BA 4O0MA 4IDHA 4POAA 4Q01A 1XJQA 3U4QA 3AKEA 1WDTA 2NO1A 3NH9A 4IXMA 3KL4A 2B8TA 3WMEA 4AIIA 4GDFA 4PHFA 3DO6A 5FI0B 1X8LA 4LSGA 3DOEA 4U00A 1Z3IX 4LBVA 3MG9A 4RKEA 4JLBA 3FHCB 4BLQA 4DLTA 2OXCA 4BGDA 1KK0A 1GFIA 4QHTA 4YMSA 3BH0A 1K5GA 3AB3A 3TRFA 1CLUA 4TWZA 3MCAA 5FOXA 3R9IA 4FMBB 3PVSA 4V0KA 5JLJA 4JLJA 1W36C 1YZGA 5KNCA 3LQQA 2QBYB 3GLIE 2WWFA 5CDFE 3R9XA 5E3HA 4EJSC 3FWYA 2IYLD 3KTAA 3LQRA 4QL3A 1U8AA 4FMCB 3SFVA 2FF7A 5JMTA 2C99A 2Z83A 2ZI4A 4CEJA 2JJ2D 5FR2A 4G5SA 2QQEA 2JIZA 1D5CA 2ATXA 4PC6A 3QSYA 2AD5A 2AX4A 1GTVA 2QTHA 3BFVA 3K0AB 1DOAA 3KXLA 4PAOA 1KZ7B 1XEWY 4LHWA 1M7GA 5H68A 1L4UA 3BS4A 5JCPA 1NBMA 4LJ4A 3QKRB 4KLZA 4A8JC 6Q21A 2ZQ5A 3IQXA 1IN4A 2PZFA 3SNHA 1G3IA 4ON9A 1UEIA 1EGAA 2IHYA 4MKIA 1E2DA 1SVIA 4KFUA 4DJTA 4RCZA 5FPHA 2JDID 1TUEA 2Q9AA 1NN0A 4G3XA 5J4YA 1IOZA 4ITRC 3WYFA 1PLKA 4RD1A 5HTKA 3CO5A 1NY5A 3SJCA 1ZC4A 3GFOA 4HB3A 1OSNA 1XTSA 3QXCA 2QGNA 2QY9A 5FPSA 5ELXA 3RVBA 4M9XA 2W6JA 4A92A 3NTUA 4OI0A 1GM5A 3K9NA 5CITA 3VHLB 1F2TB 2B8WA 2QBYA 1XMJA 2HCJB 4LBWA 4TQAA 3KQLA 4UJ3A 5B30A 2YWEA 1E1QA 3B82A 3K1JA 3S1AB 4KYIB 4R2HA 4HLQB 4DIDA 4FWIB 4DXAA 4JVMA 3I73A 2C95A 3LLUA 3OF5A 3NXSA 4Q1CA 4AG5A 1XPUA 4NE2A 3I72A 1KSFX 1CIPA 3BH6A 2IUUA 1ZINA 1E9FA 4V0LA 4LI0A 1AS2A 1Q22A 1E2EA 4M22A 3MWJA 3K0AA 2BDTA 4D81A 3EX7C 1XEFA 2OXRA 2AHOA 1AM4D 3DZ8A 4C30A 4B2IA 1W36D 3BGWA 4P4SB 1ZVQA 1UKEA 1CEEA 2UVQA 1OB5A 3SJAA 3NC1C 1TADA 3PEUA 3QKRA 3HPRA 4URWR 1S3GA 2R9VA 1ZC3A 2AN9A 1G7TA 1F3OA 2QUZA 2RGEA 3QKSB 3RNLA 4AYXA 2XOKA 4N0EA 1D2MA 4TYQA 3B7GA 1FW6A 5C18A 1R5NA 2J0SA 1QRAA 1Z6TA 3O8RA 1FP7A 3T15A 2FFQA 3HYRA 4JMPA 3ZVLA 3U7GA 2YOGA 1AN0A 5JFGA 1IN7A 4QBFA 1ZM9A 2BMEA 1QHYA 4BLSA 2DWPA 4DCNA 1GL7A 2BVNA 2OCBA 3VR5A 3OIUA 3FVQA 2GVDC 2V55B 2GJ8A 1ZNYA 4GMDA 5TB5A 2WAXA 2MSDB 2ZEJA 2QMOA 3QUSA 3VNVA 1Z8FA 2YWGA 2ZXUA 2ZSFA 3K8YA 3S1AA 1KO8A 3X1YA 2FPLA 1RYFA 4JBWA 4QJ3A 5KDOA 4QGGA 3GLHE 5EJEA 3EPHA 1I4LD 1NN3A 2NOAA 1ZUIA 4MYUA 1E94E 1TL7C 4PC2A 2QSZA 3A1UA 4RJLA 1AKYA 1C9KA 1N6HA 3DL0A 5FTKA 3TE6A 1TTTA 1ZU5A 3T5GA 4MQBA 3KXIA 3PR1A 5KDDA 5EUMA 5L3QB 3EIHA 3REFA 2ZRCA 1ZU4A 4P4SA 1DAIA 4DHEA 4WOPA 2GTPA 2VQSA 2GEDA 2QQ0A 3LO5A 2XB2A 3GJ4A 4TMXA 3QKSA 3UKDA 3U3JA 2O8CB 2RGXA 3QVUA 1OXUA 1XCMA 2F9MA 2QPAA 2Z4RA 2WJVA 3HPQA 4G5RA 3T61A 5JEDA 2HEIA 2DFLA 4B48A 5D3MB 5JI3E 3ZD6A 1E0SA 2QRZA 5DIFA 2BCJQ 3AP1A 4RZ2A 4TT3D 4JS0A 3VNUA 1G5PA 2X19A 1JNYA 1S3SA 3QOFA 5AJYA 4FXPA 1QG2A 2RMKA 1U94A 1KJWA 4XVQA 1Z5ZA 4EJSB 5HKKA 3ONWA 3O47A 4DDVA 3RS3A 1KI2A 4PO8A 1CU1A 4LHVA 4BRWA 2QP4A 2Q3MA 4URVR 3U60B 3NBYC 2PL3A 3SEAA 4PZYA 3CF6R 1OFHA 3K70B 3MFYA 4ZPXA 1BOFA 2PT5A 1L4YA 5CIWA 4JYBA 3IIKA 4LX0A 2OUKA 4D4KA 3ZZTA 1ZD1A 2NTYC 1QDEA 4WBSA 1OIVA 1MO4A 3CRW1 2R65A 3G0HA 4KITB 2O0JA 1W4BA 2VSOA 4Q9IA 1Z07A 3UWOA 1HE8B 1VG0B 3KKMA 2RHDA 5KPJA 5HCIA 2A5GA 3BB3A 2CK3D 1U99A 2RKOA 4A0HA 1BMFA 1KHTA 3AF1A 3NG1A 4LYJA 1P2TA 1CRQA 4LBYA 4S2EA 1DBSA 3FFBA 3FKSD 1A5TA 2FEMA 4EKDA 5DISB 4Q19A 3HDTA 4Z1MA 5FTMA 4JL5A 5CJPA 2CL0X 2IYTA 2PT7A 2NIPA 5SZJA 2NPFA 2GEUA 4DLVA 1XMVA 4M1YA 2O8CA 1XJCA 2ZR9A 1JR3D 4M1MA 4XOIA 5D3MA 3RAPR 1R5BA 3U6KA 3LW7A 3EIEA 1JQLB 4A0FA 1Y3AA 2MMGA 2R6FA 4G5QA 4NHOA 1KO4A 3LY5A 2J1LA 1P2UA 1NL3A 4XSHA 5IK2A 3GLGB 2FWRA 2G88A 4TMZA 1GVNB 3EXAA 1HURA 4EJSA 3OFNA 2XAUA 4MRVA 1E2MA 1U81A 3SS8A 2A30A 4IDQA 2MSEB 2OILA 1OHHD 3B2EA 3LW8A 4B6EA 5FTJA 1IXZA 1OFIA 5F3WB 2H7VA 2ZROA 2QP3A 1GIAA 4FW9A 5JECA 4W9MC 3BWDD 1E9EA 1YZLA 1Z22A 2ORVA 4ZDWA 5J5CA 1BYIA 4QC2A 2OFWA 2RGBA 4OQNA 1T0HB 2GNOA 5FUXA 1U9IA 4A9AA 2WIBA 2H57A 4B6FA 2FJUA 4LPSA 4Q9LA 3UXMA 3QXXA 1VPLA 1GWNA 4IOLA 2J7PA 4GRAA 4BFZA 4C0KA 1YZUA 3CW2A 1Q20A 4C3ZA 5KYKA 1XPOA 2ZUBA 2FH5B 3GFTA 2D06A 1DG3A 5EUQB 2UZIR 1BH2A 4PO1A 4D82A 1VKJA 3BBPA 1F5NA 3BERA 4PXAA 4C0HA 2ZSBA 1UM8A 4PHHA 5DHFA 5FTLA 3V4FA 2YHSA 1G17A 2A9KA 1IXRC 1S0UA 3VHXA 4URUR 4EQ6B 3HU3A 5B64A 5EP1A 1T5LA 1N2CE 1E4YA 3K9HA 4QBHA 5SZHB 1OXSC 2Q3HA 3A6PC 1Z29A 2HYDA 1YU9A 4MRSA 4JT2A 5FUVA 3TLXA 1NVVR 5KUTA 2RCNA 1CR0A 2HF9A 2ZRJA 3I4LA 4Q4JA 3CR7A 2O8FB 1E2NA 2IF0A 2ZETA 3A4NA 5AWFC 4EFLA 2OE2A 5HZHA 3GLGA 4JLNA 1IQPA 2W2VA 2HLDA 3KQKA 4LHXA 1J70A 1G8GA 3AVUA 1CR1A 2XTNA 2LKCA 5KSPA 1IM2A 2BJVA 4M2LA 4Q7MB 2ZE8A 4FI3C 3LXRA 4BUJA 2AWNA 1E2LA 2CL6X 4RKFA 3U3KA 3VKHA 2WBLC 1IN6A 5EE9A 3VR2A 3OEEA 4DLUA 1M1YE 1DAMA 2A78A 1VCNA 4KU4A 4KO8A 1G16A 3HJNA 3WY9A 1GITA 3THXB 2FGJA 1J7KA 1LF5A 3IILA 4A36A 1JXMA 3VR4A 2H18A 1KAGA 5KSZA 2ZJ8A 4B3DA 3FDIA 2BV3A 2ZM5A 2C5LA 4B3GA 2JCSA 3SE0A 4BASA 1ZUNB 4E03A 2O8EB 3AKYA 3QXSA 2MSCB 1ZCBA 2QMUA 2WWGA 1VCIA 121PA 4IKEA 4B32A 4EDHA 4JVSB 2OZEA 2WWHA 5B2ZA 4GZMA 4EQ6A 3T1VA 1NVVQ 4AI6A 1COWD 1NKTA 4M1TA 1I4DD 3KQNA 3GD7A 4HAYA 2ZJ5A 4NCKA 5EE5B 1PZNA 3U3OA 3J81k 1DE0A 2O52A 1DG1G 2O8FA 3JZAA 3T34A 2MMCA 2JLUA 1E99A 721PA 1G4UR 3SBEA 2R62A 3C7KA 1N6RA 2DYKA 2OV2A 3FKSA 4GI7A 5FOVA 4UQOA 3VQTA 4ASUD 1Q1ZA 2IXGA 3AQ4A 2ZRDA 2OFOA 3FFAA 2FU5C 4W7SA 3W90A 4N0DA 2Q3FA 2IS4A 4KBFA 4TYYA 1L2TA 4H1UA 3WNDA 1GNPA 3NEYA 3AVWA 1H8HD 3THWB 1C4OA 2BKUA 2QTFA 2ZRLA 1DELA 5HZKA 5DGXA 2V8OA 4E07A 1ONBA 4URZR 1JAHA 4X8HA 1S8FA 5GJWC 2GCOB 2PZGA 3LX8A 3W3ZB 2BCGY 3T06B 1G1MA 2X77A 1NSTA 1FQJA 4F91B 4B47A 1A7JA 4F7WA 1E2PA 3EWAA 1R10A 4BFXA 2C78A 3MWYW 4F92B 2ANCA 4CT5A 2QORA 2GF0A 4DWJA 2XJ4A 2IW3A 1CBUA 3D7MA 1KOFA 2GBLC 3VR3A 3IIMA 1R2QA 1M8PA 1BO6A 1N3BA 3TW8B 1IY2A 2GJSA 1M74A 1SZPA 2VF8A 1NRJB 1ZNXA 5FBLB 1TUIA 1RRGA 2QM7A 4NH0A 4EPRA 1Z08A 4ZCMA 1TNDA 4MYHA 2IUSA 3DHWC 2LWIA 3I3SR 1N5JA 2AXNA 1XDBA 2B92A 1NMYA 5DNYB 1LW7A 2HJGA 2B7CA 3CRMA 1W4AA 3CUEF 3PQCA 3QQ5A 4R71A 3THWA 2GRJA 5L3RA 3X2SA 3PCRB 5AR1A 5FH9A 1KK2A 2JIZD 4LY6A 2FE4A 2PCJA 3B9PA 1AA9A 5CK5A 2P6NA 5C4GB 2F3TA 2GCOA 1GZSA 4DC9A 1MOZA 2I1QA 4JYCA 2REXB 2YOHA 4HB0A 2X1VA 1G3QA 4HSEA 4RZ3A 2OCAA 3W6OA 2XXAB 2NMVA 821PA 1E69A 1NBMD 2CJWA 2FA9A 3TBKA 3X1DA 1QHGA 1KDTA 1KO1A 1T8UA 1DADA 1FUKA 2ZRHA 1Y63A 2IYQA 4OBEA 4BLRA 1NKSA 4BWYA 3DPUA 5G41A 4AC9A 3Q7PA 1NI3A 4UXJA 4B3CA 4Q48A 1YHNA 2OBNA 3LVQE 1QVAA 1GILA 4ACBA 3I92A 3B6EA 3UANA 2QPOA 4OQLA 2ERXA 4ZKEA 4LJYA 3CPJB 1NLFA 3K0CA 2EWWA 1P60A 2DR3A 3F0TA 1J90A 4GOXA 4BFYA 1E9CA 2QAGB 3FMPB 3Q85A 1VCMA 2C9OA 4V0MA 3CB4A 2AKAB 4W5HA 2W6JD 1MT0A 1Z06A 2KB0A 5J4HA 5J4VA 5TMPA 1LY1A 1E9DA 1Q1EA 4EFNA 1KMQA 1TAGA 2ZPTX 4NYJR 4C0JA 4R2IA 1YR6A 1XXHB 1I4TD 2W83A 1B23P 2V7QA 1MRNA 2V6JA 1E1QD 2V9PA 4A82A 4QM6A 3TUIC 3NDPA 1ZM4A 3FYHA 2D62A 2Y8EA 1YR7A 4DKXA 1COWA 3FMIA 5CLLA 3U2QA 4AKIA 1HUQA 5J40A 1E2KA 3ZVMA 2B6HA 4ZI3A 4L9SA 4RFVA 2ZRAA 1KI7A 3W8RA 2ZUDA 3EC1A 1E3MA 4JVNA 2EVWX 3N2IA 1LB1B 3OIVA 3ZH9B 4ARZB 4QBGB 2ECKA 2EFHB 1GSIA 4OJQA 5TV2A 4B3BA 1N6KA 3OIWA 2WZQA 1TU3A 4TTQA 4IHQA 3PUXA 3L0PA 1WMSA 3NHBA 3GLGE 4R9UC 1PUJA 1RZ3A 5BXQC 1H8HA 3EPKA 4XTRA 5JBQA 2XOKD 3KQHA 1OXXK 3GLFB 2C98A 4ZKDA 5E7IA 1IN5A 1XU4A 5SZIA 2ANBA 4NCIA 1SVKA 1II9A 1KIMA 1H65A 4KAXA 4V0OA 2JATA 4TQ9A 1T4GA 1S96A 1TF5A 1YR9A 3PUWA 4TYNA 3VKGA 1FPMA 2NZJA 2QAGA 3IPXA 4JZKA 1GNRA 3AVVA 1G18A 3LBHA 5IF9A 2JLQA 3G82C 4NYJQ 2H17A 1XD2B 2WKRA 2G6BA 1E9BA 2J9RA 3ZDQA 4LUCA 4UKDA 4CDGA 3VKWA 3KKPA 4YQFA 1XXHA 2OT3B 1EESA 4US2R 1OFTA 3TVTA 1FX0A 4DSOA 1OJLA 1H8ED 3V00A 5FR1A 4CZ2A 2YZ2A 5LBIA 2W00A 3ND9A 2GXAA 2F9LA 3KFVA 3KFXA 3SHWA 4Q4AB 3CX8A 1WE2A 3I32A 4Q66C 5AUQA 3RLFA 2QZ4A 1GKYA 3W6NA 4EPTA 4RD6A 3CONA 4KXFB 1FFHA 2XZOA 1KKLA 8OHMA 5JCZA 2QMHA 1KI6B 4Z51A 1G8PA 2KSQA 2GZAA 2ZR0A 3QXHA 2XB4A 4MKHA 1TF7A 4A4DA 3L82B 3RS7A 2PLFA 2QGZA 4LJAA 2KBEA 1DAHA 2RHMA 4OHYA 2O8BA 2D74A 2ZAOA 4AURA 5JSZB 3R8FA 1KO7A 3ZLJA 2H16A 4KHZA 2DFTA 3LAWA 2ZTSA 4I99A 2A3RA 4HUQB 5CYPA 4OQXA 3EZFA 1R0YA 3GLFA 2N1BA 3AF2A 4OI2A 4PZZA 3OZXA 3K70C 5GADl 2GESA 5FBWB 1YZNA 1JR3E 4MRNA 2ZRGA 621PA 4PFSA 1C1YA 4TTPA 1VDZA 1P7CA 1EK0A 2JJ8A 1E96A 1U9IC 2VBCA 1NMZA 2VIIA 2ZJYA 4Q02A 5ANRB 2P5SA 4L15A 1G19A 1N5KA 2N42A 1E2GA 4MGKR 1XD2A 2IEZA 1CULC 5HKKD 1RRFA 2C03A 2WMNB 3TUJC 1OKKD 1FP6A 1Z0JA 2P65A 4GBMA 4D6PA 3RC8A 5JWOA 3WBKA 2G77B 3U6BA 3EAQA 5LB4A 3TR0A 2FDCA 1VIYA 1KJZA 4Q4AA 3K0SA 2BMJA 4IEIA 1NNEA 2VLIA 2WJYA 4QHSA 1DAGA 4X8LA 1UBFA 4PPNA 1CF4A 1KI3A 4HLUA 1R5OA 3T5DA 2Z5FA 4GP6A 1G9XA 1KI6A 2ZJAA 4DCUA 2WSSA 2GILA 2AR7A 3GJ5A 1A82A 1BMFD 5B57C 4LJ6A 5H8WA 5JJKA 4D4MA 2J7KA 2FG5A 2OCPA 1G64A 3L0SA 5JSZA 3QIAA 1AQUA 4Z1MD 3H4MA 5E7JA 2GBLA 1MO5A 1CP2A 1ZAKA 2R6AA 3C5HA 1E0AA 4NDZA 2OFXA 4L9WA 1KSJA 2C2HA 3I8SA 4TN1A 1O87A 4WIAA 3LV8A 1X3SA 2VP6A 1N6OA 1T9HA 2JAQA 2Q6TA 1MRSA 2ZYTX 4PX9A 2FX3A 3NWJA 3THYB 3L8YA 1KDRA 4C0BA 4P0TA 4TMWA 2J41A 4YC7A 5FL7A 4Q7LA 4C2UA 4M8NE 4NYMR 4B3XA 2R6CA 3B60A 5IK2D 1ZNZA 4Q1DA 4BPBA 3MAAC 2O0KA 1M2OB 1AZTA 3OFND 1YZQA 5DHAA 2BBTA 2VPPA 5DI3B 1XD9A 3CKLA 3PJRA 4O2LA 2X2FA 2YWFA 3MUFA 3K70D 3MRSA 3EC2A 1XP8A 1NVXQ 3ZS9A 3SQXA 2GCNA 3RRNA 3F5FA 3BFXA 2YWHA 2NO7A 4G01B 4MUBA 2WJIA 1HV8A 4YMVA 1N5IA 1E2QA 4LV5B 3N70A 2EW1A 2XTZA 2J7PD 3B8HA 3L2OB 1G7RA 3DM9B 2QI9C 4M9ZA 3VTKA 4WZBE 1F2TA 3VU9B 4QGHA 2A5JA 1M6NA 3RS2A 1GRNA 2WKQA 1ZM7A 1FQKA 1H8EA 3R20A 1GUAA 4JLPA 1XB2A 1P2VA 4IVQA 1N0UA 2PMKA 2QNRA 2VP5A 2V3CC 4NCHA 2FZ4A 4OL0A 2BBSA 4TLAA 2IXFA 2B21A 1N5LA 3IO3A 3QBTA 5FUYA 3KZ1E 2QE7A 1JJVA 2XGJA 3ADCA 2PX0A 1ESMA 2NZ8A 4NYMQ 3WMFA 5JJIA 4MRPA 3AV0B 2DFKB 4DLZA 2HYIC 4QXAA 4M1SA 1BIFA 3SU8A 1CJTC 2ONJA 4FMDF 2GJAA 1GL6A 3QF7A 1EG7A 1AJEA 2NO0A 3ZVNA 2HLDD 1W0KD 2VP4A 4GFDA 3VR6A 2Z43A 2EFEB 1X8KA 2IWRA 3O8DA 2GA8A 2IX3A 1NLYA 3G5UA 3K9LA 4W5JA 1CRPA 1EFHA 2VSXA 1R8QA 3U5ZB 2GHIA 2FNAA 2G0TA 2ONKA 3K0EA 5DSZA 1R8SA 2CCJA 3QEOA 3OEED 1FTNA 3Q7QA 2CL7X 2O5VA 5EP3A 1JXOA 2FSFA 1UPTA 3A1VA 2ZSEA 4QNRA 2P67A 4B34A 4G0NA 1Z0FA 3B13B 2GXUA 5KSYA 1OKKA 1KI4A 1ZD8A 2WWWA 3H1TA 4DB4A 1YE8A 2K5UA 3TSOA 3K0FB 3QEJA 2QAJA 4DLYA 4CT4B 2KE5A 3W6PA 4Q03A 3B1XA 4G5OA 5K8IA 1Q44A 2CDNA 4TMTA 4JLKA 1LF0A 1N6NA 1KY3A 5EXPA 2BEJA 4FMCF 1XXHE 4D0LB 5TY0A 1E4VA 1N0WA 2ATVA 2JLSA 3PXGA 1G3RA 4O3MA 3RS4A 3CRQA 5JRJA 1TQ4A 3A37A 3VX3A 5L3QA 1VECA 2CNWA 4OK3A 1OB2A 5DLQC 2ZVQX 1U90A 3CR8A 4NKRA 3PUZA 2G1JA 3OEHA 4BFSA 4JLDA 2QTVB 1JECA 1D2EA 1AS3A 1W1WA 3F3YA 2PEZA 1AK2A 4PC3A 1XTRA 4Q4HB 2P5TB 1XBTA 3NKVA 1EX7A 1WA5A 1JALA 3U7HB 4WXPA 2AFHE 2UKDA 2D3WA 5P21A 2C8VA 5CJ2A 2H1LA 3GLFE 5IT5A 5TVKA 3EZ9A 4D2IA 4YMTA 5FOTA 3HU1A 2AD1A 4MDEA 2OEPA 3K0CC 2R8RA 3BAFA 3PEYA 3I8XA 4JBYA 4QOSA 2Q9CA 5FPTA 1RIFA 1E0JA 3K0FA 3EA0A 1Z28A 1WXQA 2ZVPX 5J47A 1DS6A 1ZBDA 3B5JA 4YMUA 1NBME 4PHTA 5EQTA 3T1OA 3AKDA 1K8RA 2PLRA 2WHXA 1IJFA 1HEIA 1S2MA 3UG6A 4ERNA 4HDCA 2BM0A 4KLNA 3GEHA 2OESA 4DRZA 2ZS8A 1AKEA 1G7SA 3BD9A 5AJZA 3PFIA 1W4RA 1WBDA 2YJTD 3R9WA 2EFGA 2GETA 3BC1A 5C4MA 4Q18A 4WA7A 4GNKA 4U5XA 1ZRHA 1SHZA 4PO9A 5E4FA 4ZO4A 1DO0A 2IEYA 1TPZA 4OK6A 3DDCA 2OBMA 5LPNA 4DT1B 5F9HA 1RE0A 2OO7A 3SOPA 3T35A 3QG1A 1P9RA 1G8YA 2D2EA 2RB4A 4TL8A 4LWZA 4V02A 1P61B 1OXVA 3KKOA 3MMPA 2XNDA 2ZIAA 2BWJA 2PMDA 4IDPA 1U2RA 3T1QA 2WJJA 1Z6GA 2EYQA 2JEOA 4Q1FA 3TW4A 1EFRA 1Q0UA 4HATA 2JJ1A 3A36A 4F4CA 4QHYA 1J8YF 1W48A 1GP2A 2GAOA 4M9SA 3UIEA 2TMKA 5CB6A 1YZKA 2VRWA 4JL8A 1J2JA 1XZQA 2OG2A 1ODFA 2DWQA 1CR2A 2X2EA 4DDWA 4I4LA 4BZQA 1VCOA 3GQBA 1HH4A 4DSUA 4HAVA 1W0KA 3EPJA 4ACAA 2PZEA 4B76A 4BECA 2H8KA 2IF2A 2QAGC 2ZREA 4G5GA 4LJ8A 3SN6A 2NQ2C 4B71A 5JHGB 3U61B 1N25A 1YZTA 1Z6XA 3RSOA 3BE4A 2YVUA 2WKPA 4LYFA 1AZSC 2ZRPA 2IYWA 1SHKA 1IBRA 3KXKA 4EPXA 3FMFA 4N1AA 2IYYA 3QG5A 2IYVA 2CVFA 2VHUA 1AS0A 1HT1E 1QHIA 5AUOB 4Q7KA 1KNQA 2ZRBA 2AL7A 1I2MA 3ND8A 3R8CA 4M4SA 4QKQA 4MGZR 2ZI7A 4TLBA 1WBBA 3E1SA 1YVDA 3NHAA 1A4RA 3ZS8A 5FUWA 3FHTA 1SVWA 2YNMA 1XZPA 2DY1A 3SJBA 1RW4A 5BWMA 1VYUA 1AGRA 3NIBA 1S4QA 3IBGA 4EPYA 1SVSA 2WWXA 3BK7A 4NBSA 1UJ2A 4BFUA 1ZUHA 1A2KC 4NZYA 4BLPA 4AD8A 2XZLA 2YOFA 4BQSA 4DT1A 2FN4A 4H1VA 3GJ0A 1M7BA 4Q9KA 1E2JA 4B75A 4DCVA 3FPAA 2VSFA 4B74A 4Z54A 1G7CA 1MR3F 2H5EA 2V7QD 4KODA 4LRWA 3LVRE 4TL6A 1PV4A 1FUUA 4JKYA 4TMVA 1FMJA 4OK5A 521PA 1WQ1R 4I1OA 4DLRA 4IDNA 1W4CA 4PC1A 1OV4A 4B73A 1EFUA 1EWRA 1VIAA 4LBZA 4A2WA 2FSGA 2C77A 3FGNA 1X8JA 2EWVA 2IL1A 2VHQA 3AGQA 3F8TA 4W5WA 5DYIA 1FOEB 1NSFA 1P75A 4V03A 2OLKA 3A1SA 1KK1A 1CTQA 1XWIA 2WPDA 1DAKA 3SYLA 2JLVA 4TL7A 3FB4A 3LH5A 3QXJA 4JBXA 3U3MA 5KO2A 3WHKA 3E5HA 5AK0A 4DDUA 4JKIA 5FBRB 4KYUA 4MRRA 1Z63A 1G4AE 2IYUA 5DI9A 5HCNA 3PG5A 4QG7A 3EIQA 2VP0A 2ZE7A 4OJKA 3KKNA 2NPIA 3D31A 4OQFA 2CHQA 4URXR 1ZJ6A 3B85A 2W2TA 4NL4H 1OH5A 5FPKA 1GOTA 3EW9A 2ZUCA 1P72A 1P2SA 4WVFA 3THXA 1PLJA 3RWOA 3GMTA 2BJWA 1UADA 2W0MA 3BRWD 1U0JA 3OE7D 2AXPA 2RGNA 1AIPA 1SULA 4LDJA 2VF7A 4HLUC 4HAXA 4IEEA 4PQFA 3ZYCA 2JLWA 4WXRA 4MA4A 5EE0A 2LCFA 1U98A 1SVOA 1N6IA 1W2GA 2C04A 1LS6A 3U7EB 5EZ5A 2O8EA 1ZMXA 1N0VC 2CVHA 3V4RA 1VG9B 1RFLA 1UEJA 1UKVY 3HYTA 1Q57A 3ADKA 3AVXA 1OH7A 1ETUA 2P0EA 4L8GA 1KK3A 3L0IB 4HDOB 4WAUA 2RGDA 1XPRA 1NMXA 5CIQA 4C9BA 4GMXA 1NY6A 1Z0AA 3M4YA 5JWHA 2X8AA 1DVRA 3P27A 2W58A 1M34E 3AKCA 3SYKA 1E2HA 3AF0A 3C41J 1QHNA 2IS2A 3WYAA 2HJVA 4PTLA 4NTZA 3JVVA 1W46A 1Z47A 3MJRA 4NYIR 4PPGA 3CZQA 4JLMA 1IY1A 1FL9A 1RC8A 3D3QA 4KFTA 4QGFA 4H9GA 4FWTA 3P4XA 5DN6A 4AKHA 3C4JA 1JQJC 4AYWA 1MH1A 4BFVA 2QM8A 1JJ7A 2A2ZA 3LA6A 1KGDA 2ZSAA 1JPJA 2J0VA 1E79A 1HQYE 4RSGA 5HPYB 3TAUA 2KJQA 2QPTA 3CRRA 3IDQA 3O8BA 4BZXA 3GPLA 1W44A 5EE3A 4EIWA 1V5WA 2FV8A 1TX4B 4JVLA 4CF7A 5M04A 1CS4C 3C5CA 1VHTA 2ZRIA 4NP6A 2IS6A 5AJVB 2QT1A 1IN8A 1MABB 1QVRA 1UKZA 1NIPA 1Z0IA 2J87A 2LKDA 3IHWA 4ILEA 4LV6A 5KPDA 3AGPA 4Q1AA 3B1VA 4CYMA 1U0HC 4JL6A 3ICQB 2KWIA 4JJKA 2BMFA 2R44A 2J5XA 2VTKA 2AWOA 3B1ZA 3AVOA 3C14C 2DCUA 3B1WA 1JI0A 4A6XA 4MKGA 3CH5A 1W0JA 1NN5A 4RVCA 3PEWA 2ZJ2A 3VR1A 3WP1B 2EYUA 4LGMA 2DB3A 1J8MF 4UXIA 1MV5A 4FCTA 3WMGA 4II7A 1NP6A 3TGPA 2F1JA 3IKJA 4BLTA 1Z6AA 4Y0VA 1II0A 2ZAMA 4DLXA 5IDVA 4A2PA 4NYIQ 1T0JB 2VEDA 2Z4SA 2CLCX 3X1WA 2D2FA 1ZP6A 2WOJA 1V43A 5FBQB 2DPXA 2ZRFA 2A7QA 3SFZA 4MDFA 1T3HA 4PPQA 4CW7A 2WSSD 3WRXC 4A0GA 1IJEA 4HAUA 4I1UA 1SQ5A 4GPTA 3ZJYA 4F4IA 5H70A 4DLSA 3TQCA 1DAEA 4KFRA 4M1OA 1XEWX 3OIYA 2WJHA 2FFHA 3NC0C 5A5GA 1LS1A 2F1IA 2G0NA 2ORIA 2GF9A 2BBOA 4C7OB 3WNBA 3B9QA 1LTQA 4C0QC 2V1UA 1G5TA 2B7BA 4MYTA 3M6AA 4JJZA 1Q1BA 2JASA 5JZVA 3RSLA 1G3MA 1F2UB 2F3RA 3P4YA 2ZJZA 5EZ6B 3I5XA 3NVAA 1ELOA 1SVLA 2RGGA 1JEEA 4LHZA 4B44A 1MABA 4BFTA 2GK7A 3GP8A 3NEJA 4HI0E 5FL7D 3KDSE 4AG6A 2DFNA 3OESA 2EQBA 2YINC 1HA3A 2OLJA 3ECCA 2XXAA 4M9QA 4L16A 2PJRA 2W6IA 4E22A 5EXXA 4TQUS 4V0NA 4E5UA 4KFSA 2VHCA 3FMOB 4D80A 1ZCAA 4HEJA 3WP0A 4RD0A 2GXQA 4JLAA 4QGAA 5G3ZA 1OIWA 3BFKA 3HR7A 3HR8A 2ZANA 2GAAA 5TARA 3CPHA 3IUYA 1WRBA 1BYUA 2VO1A 4C4PA 1XTJA 2GDJA 2NO9A 2WVJA 3Q9LA 1IXSB 2VP2A 4Q1BA 2HT6A 3SHFA 1ZYUA 4FD2A 3RDPA 2C9YA 1QZXA 3OE7A 2DBYA 5L3VA 1CJKC 1E1RA 1UBCA 2QP9X 2ZSDA 4IFBA 3PEVA 5E7MA 2NGRA 4WW0A 1E2FA 3W5IA 3LD9A 1G291 1II8B 2XJ9A 2ZU0C 2J0UB 3GJ7A 3Q3JB 3UATA 2Z0MA 3W9YA 3DEFA 2QU8A 1ZD9A 4DZZA 2RAPA 5A0FA 1XMIA 3R7WB 1W5TA 3MWKA 2CLSA 1TF2A 4C7OA 2XTMA 2VH5R 4FMDB 2BKEA 4BRUA 4Q1EA 4XSGA 1EX6A 1E2IA 1F2UA 5BN3A 3PITA 2QE7D 1SXJB 3LBIA 4DCSA 5J4KA 1PUIA 3DKVA 4D0GA 2BOVA 1E6CA 4F38A 4ARZA 4XWKA 4JIMA 2F7SA 4MH0R 4I1SA 5BYKA 4DUGA 3IEUA 2QEQA 3DM5A 3JZMA 1KJYA 2XITA 3EA5A 1XRJA 3NH6A 2P2LA 3BOSA 3FE2A 1FMLA 1UBGA 5BN4A 4QJ4A 5GVRA 1S1CA 1VG8A 4NCJA 3AF3A 1XMSA 3CLVA 2L0XA 4TLCA 2AFIE 3AP2A 1KI9A 5A4JA 4PR0A 1X6VA 3OHMA 3C16C 1DTSA 1KYIA 1NF3A 4N3NA 2Q0HA 3RS0A 1XNJA 2ZE6A 3BJIC 1F60A 3GJ8A 3TSWA 2ZJBA 3EZ2A 2PJZA 3KB2A 3M0EA 2ODWA 3ASZA 4LJ7A 2OSBA 1RRCA 1II8A 3RHFA 1X1SA 2R6GA 3L43A 1VYTA 3BORA 4AK9A 4LHYA 2J0UA 4IW3B 4WZ6A 3BH7A 1Q21A 1R0WA 2ZITA 1EFTA 4A1FA 4NPHA 3FOZA 3AP3A 4B3FX 4QM7A 4TL9A 2BM1A 2C9CA 3KJGA 4DLWA 1HTWA 1UFQA 3R7WA 2EFCB 1GRQA 1TQ2A 1CJVC 2Q21A 2NG1A 2KI5A 1QHSA 2ZI5A 3A58B 4LJ5A 2WWYA 1KY2A 2DWOA 2V54A 1YR8A 4ZDIA 3QPWA 1KNXA 1R4AA 2IYZA 3BXZA 4Z8YA 1SXJA 2WAYA 1OYYA 2VYFA 2QMEA 4PHGA 3FTQA 3LX5A 4DBLC 1DO2A 2CNWD 3WHLA 5GJBA 3P20A 1OW3B 1ZIPA 1SKYB 3P26A 4FCVA 3TSZA 2RH5A 5KU1A 4LOAA 4TZ6A 2WOOA 4GZLA 1T5IA 3OEHD 1XCPA 4TTRA 1IONA 2I4IA 2ZRNA 5AJWA 3OAAA 3E2IA 1QF9A 3CPEA 3SC3A 4HUQA 5C2JB 1LNZA 1P9NA 1Q3HA 5GJCA 4YXWD 1KTVA 3CNNA 2CE7A 3TR5A 1RPZA 4MGYR 4ZV4A 3EWSA 2OM2A 2QL6A 2WICA 4DVGA 5KOYA 5AJXA 1KDPA 3QBVA 1YRAA 5GJVC 2ZE5A 2YC2C 1B0UA 4Z8XA 3CF0A 2CLDX 3KJIA 4HUTA 3V9PA 4GL2A 2XSZA 2AK3A 5FL3A 4Q9HA 1OH6A 1I2DA 3AUYA 3BB4A 2OBLA 4P33A 2HXYA 1KMHB 1OLOA 3T12A 4A2QA 3TH5A 2WTUA 5GVSA 3LLMA 2F6RA 4EUNA 4F4JA 5KNBA 4M1KA 1G6HA 3A1TA 1BS1A 2GCPA 3LBNA 4PQYA 4QRHA 4B43A 1RYHA 4DSTA 3TUZC 4UNPA 5FOSA 1SVMA 3GCGA 3CZPA 4L4UA 4B35A 4XD7D 5JHHB 5BQ5A 4MKFA 4PC7A 5EE1A 1T91A 4DIEA 1F48A 1YQTA 3W3AA 2PBRA 2YKGA 4RZUA 4LCBA 3REGA 1GDDA 2WV9A 4FCWA 2HUPA 5C46F 4A0RA 4D4LA 3H84A 3NBZC 4BEBA 4V0ME 2ODNA 4D26A 421PA 4KSBA 1IHUA 5F98A 1JPNA 4KVGA 4ESVA 1Q3TA 1TQDA 1S9DA 4XH9B 4LK2A 4PQRA 2XNDD 4TSFA 1F6BA 221PA 1ZIOA 4XWOA 3IO5A 2IYXA 2VHJA 2HXSA 3QF4B 3QJYA 3PUYA 4KBGA 4B2LA 1CXZA 3KX2A 2IYSA 1OPXA 1EFRD 4EAQA 1AQYA 3THYA 2FPMA 2JJ1D 2HV8A 4CRWB 1W2HA 4BE7B 5SZKB 4ZDKA 1R0ZA 1NN1A 3ADBA 3E70C 4JSTA 2JLZA 2QENA 2ZS7A 1XCGB 4DB2A 2HCBA 3QI2A 3ZIAD 1KAOA 2CCGA 4BEJA 1UAAA 1KMHA 2BIFA 2QRNA 1VG1A 2RGNC 5DI3A 1XJ0A 2ZJOA 4KJZA 4UNQA 4C2TA 4R7ZA 5TDHA 1GAJA 2G3YA 1G8FA 2P6RA 3MJHA 2EU8A 4KV9A 1VMAA 3D6TB 1KSGA 1FNMA 3U7FB 2G9NA 2CEAA 3QNUA 2G83A 5KNDA 1VYVA 1A2BA 3C8UA 3QPVA 3SQWA 3A8TA 2FOLA 3LWNA 3VMFA 4CVNA 5HE8A 4Q47A 2OAQ1 5D3QA 2O8DB 2G1KA 5KDLA 3JVUA 2GVZC 2CHGA 2JJ2A 1G8HA 5DYGA 4ZDJA 3VU9A 3EZ7A 1G3UA 2ZYUX 4RD3A 3RS5A 3AM1A 1D6JA 2FGKA 3MSXA 3PENA 3Q5EA 2V4ZA 1OIXA 5IHPA 1W36B 3AVYA 3H86A 3CBQA 1G21E 1MO6A 2FEOA 1JR6A 2Q9BA 2PEYA 1T3SA 3QF4A 5BN5A 4NONA 4OYHA 5K8TA 4A6PA 3ZQ6A 1L7VC 1RJ9B 3HWSA 2ZYWX 3QKTA 4RZXA 2DHRA 3K53A 2YC4C 1NIJA 2E1RA 2ZS9A 1Z2AA 1E9RA 1UF9A 1P62B 2QG6A 4DDTA 2N46A 3DZDA 3PV0A 2WPDD 1T3LA 2JDIA 4XIGS
chains in the Genus database with same CATH superfamily
3AEUB 3OU2A 5F7JA 1YJ5A 1A5ZA 3UGJA 4HF7A 2ASEA 4BO7A 1QIFA 1DIGA 1PWDA 4OVDA 3I9V6 1B8VA 4IDBA 4E51A 4J94A 2ICAA 3OTOB 1OBCA 1PZOA 5DM4A 5TQ0B 2ZI3A 4C0SA 4GT1A 2G7MC 3FSRA 3A6DA 4ROSA 2OHVA 5G2OA 3QMMA 5JUWA 2EGGA 3I5YA 1I9CA 3TKLA 2CXRA 3UK2A 3LIBA 2FW9A 3DMDA 3S7NA 5IT9A 2NP7A 3I58A 5KSOA 1TDJA 4BBVA 4OLHA 3GGGA 4UPVA 2M2IA 4MHSA 5EPUA 1W0JD 2PD7A 1P18A 4MYRA 3TCXB 5EJMA 2RHBA 1VM6A 5K0ZA 3OPYI 5C1OA 3ZY6A 1AGPA 2WTMA 2IK8A 2J6IA 1YNOA 5KS2A 1CR4A 1YQEA 2VJKA 2Q8NA 5KWVA 2BELA 1LNQA 3CJMA 3GWGA 4Q15A 3Q3CA 1YMSA 2REOA 2FWBA 4KPUB 5CHEA 2GZ1A 4AZ3A 1TLTA 1YDGA 3GCDA 4MICA 1D7EA 2EQ5A 2ZJ0A 4MLZA 4ZQBA 1R3DA 2QT0A 1NE7A 3UOWA 1X1EA 5CT6A 4MRAA 5HR5A 4B4OA 3HY4A 2EIHA 2VNAA 3VZRA 1M0SA 4UM9D 5E95A 1S4RA 3A3DA 4JT4A 2ZRKA 4DUYB 1CJCA 4L7QA 3KUDA 1OTBA 5JQGF 2AGVA 4TKMA 4ISBA 4J0CA 3OZRA 3P32A 1X7ZB 1POWA 4RPIA 2SHKA 3PPXA 1HRKA 2QZPA 1Z15A 3ZG7B 3LFUA 3SH7A 4RPLA 2BEKA 2CFSA 2ZXEA 1Q0HA 1LI7A 1OX4A 4MEAA 1WOMA 4HPJB 4DQXA 2GERA 4MCHA 2W2XA 4R8LA 3C4OA 2R6JA 5JH7B 4DR5B 3H8VA 1JIJA 3KZNA 4KYVA 4PYJA 2FPSA 4LV8B 1MXFA 3GXBA 1CDOA 1YTLA 2RSLA 3ZCRA 1Z26A 1T2NA 1FCMA 2H4HA 3NIFB 3QLTA 2ZMFA 1A5AB 3ZWVA 1FP1D 3KHTA 2LIVA 3CUWA 1U0NA 1STOA 1PIOA 3QUTA 3M6LA 1SUBA 3R0QA 1IYQA 3H7IA 4KRFA 3V5MA 4M3NA 5AUNB 4Q0IA 2TMGA 1G5RA 1V41E 1QHXA 1KZ4A 3CNOA 3I9OA 1L8OA 3DH0A 4M55A 4I4TA 1W581 5EFZA 2GK6A 2HF8A 2AHRA 2I3DA 4BTVA 1KI1A 5C5DA 1M6EX 2DOKA 1JKMA 5B1EA 4NE9A 3W3AD 3OPYA 1CRZA 1MZVA 5CLQA 4HG2A 5IMSA 4WNCA 5AM0A 4YONB 4R98A 1MB4A 4KCGA 1R4MA 4HAOA 2IUTA 1XTKA 1QG0A 4BAUA 4OP5A 4MIKA 4LZOA 1H2XA 3RBAA 5ADWA 2PYZA 4IXMA 3MG9A 2QTMA 4DLTA 2R8YA 1KF0A 4OH1A 3GA5A 3JALB 2Z95A 4E08A 4EWLA 4ZGGA 3C85A 4G5SA 2VJMA 3OC0A 1UQTA 4O2AF 4XYGA 3ITEA 3AEKB 5HF8A 5JSKA 2CYBA 1JPUA 4F1KA 3BEDA 1C8KA 4KXWA 3QWAA 2Y99A 3D5EA 3SXUB 1UEIA 3HRKA 1U3DA 4AECA 3WRYA 5IN5A 4C7VA 5HTKA 5K05A 3VA7A 4Y9TA 2PPVA 2QGNA 5JVDB 3SM9A 1T29A 4HYTA 1NQ5A 3MJSA 4DXAA 1DEOA 3VYUB 4YCJA 3FI0A 4BYMA 1E8MA 1PL7A 4J75A 3CYFA 1B6TA 3AW9A 3JQEA 5TEVA 1FW6A 2K2NA 3DOOA 2BEVA 3NOUC 1XTBA 2V20A 1JHUA 1PR1A 2HDQA 4ETZA 5CX7A 1QE3A 4YP6A 4LZWA 4RTLA 4B4ZA 1RJDA 2B36A 1RQPA 3G0DA 1BVUA 1ZU5A 1CPYA 1EDOA 2Q41A 3EVBA 2P5YA 4R54A 2XTJA 2RHHA 4NATA 1EJBA 3F1OA 2AQIA 4FN4A 3HEAA 4TSRA 1XCMA 3WADA 1R6XA 1SKOB 2QRZA 2PMEA 4CE6A 3FFWA 4YAGA 4NI5A 5AJYA 4BNWA 4XVQA 3IOYA 5CA0F 1PGJA 4OA5A 4Q0HA 3K3CA 3PE4A 4URVR 1OTAA 1BD4A 2J6CA 3MFYA 5BO5A 1BOFA 4N65A 4IMJB 1ZLYA 4JP3A 2R48A 3JATB 4GZ5A 1Q92A 4LF8B 4N5HX 2VA9A 1JA9A 2G07A 2J3JA 1RWNA 4F12A 3NG1A 4LYJA 2FEMA 1ZKJA 1DWQA 1JFFA 3O82A 2NXWA 1JHOA 2XYVA 2QTAA 2JFNA 3B2QA 2ZR8A 2OKCA 4EJMA 4UMFA 2PAFA 5JTUA 5LQUA 3EFOB 4CCWA 4EOGA 4XRGA 3G7SA 4B9EA 1GIAA 4FW9A 1P6QA 4ZDWA 4H8RA 2FRVA 1UK6A 4OQNA 2R8ZA 5FUXA 5KINB 3JAWB 4EZEA 5KYKA 1DJMA 3GFTA 1LSXA 1G60A 2D06A 5EUQB 1BH2A 4C0HA 2XNCA 4BMNA 5ALTA 2QJFA 4NXMB 2V5AA 1DPGA 4M87A 3OA0A 1NJ8A 4MW1A 3SR3A 1KMMA 1YCHA 4A6EA 3SYMA 5ES4B 3IRUA 3TOSA 4Z0PA 4FZRA 1VKZA 3EQZA 4XJTA 2QKYA 4E5KA 3JY6A 3C3AA 1D6SA 1HGXA 3IIIA 1GITA 3VR4A 16PKA 3MNFA 4YPFA 3G9QA 1DRMA 2C5LA 3EMVA 2QMUA 2WWGA 5CA1F 3S0JA 2O9JA 3ADOA 4QTYA 1COWD 4HAYA 1QRUA 4OPQA 1RLOA 2O1EA 1E5DA 1DE0A 1FSWA 3UK7A 3ZWXA 4Y9UA 1NPTO 4YP0A 3OPXA 4DDMA 5HIAA 3E7PA 1INLA 3SQMA 4WQMA 4EI9A 1KEPA 4EUFA 4WLFA 3ZU4A 4I4IA 4LWQA 1C4OA 1YO6A 5C32A 4GR9A 3U4IA 4F6RB 2GYUA 2B82A 1DUIA 4B47A 4R3UC 5TJ9A 4YFYA 3KQVA 4WYYA 2ANCA 1UC8A 1BNCA 4OX9Y 2XE8A 2WD8A 2G09A 3I04A 2YX1A 4QO7A 3HFJA 5ABPA 3PR3A 2PRYA 2PR7A 2B7CA 1SU8A 3F3KA 2C84A 4KQCA 4E3KA 3ZLBA 1E6EA 4IIFA 1U1CA 1LSWA 1O5OA 1WMFA 1SZVA 1OOEA 2OCAA 1E69A 3L4JA 5I45A 2WTEA 1QHGA 5HRAA 4QFDA 3ZWAA 4OBEA 1I8TA 1B93A 1QVAA 4RVFA 3Q88A 3E27A 4BBTA 4BFYA 1BSGA 2C82A 3QP9A 2GPJA 1AOXA 3R76A 4C0JA 4JGQA 1ZQ1A 1SURA 2HLPA 5FORA 5L40A 2D62A 4FBMA 3G7NA 2VDPB 2C4KA 2ZUDA 3T7DA 3D64A 5FTWA 1XGJA 1P97A 3LECA 2A1IA 1JLMA 4TMFA 5BXQC 3LPMA 4IDGA 3ZE6A 2OMEA 3MQQA 1SEVA 1SVKA 3NW9A 1KIMA 4D44A 4V0OA 4TYNA 4JEHA 1J0CA 1C1HA 1X7XB 1S8OA 4FGUA 3IPXA 5DOZA 1UXJA 3L6EA 2G6BA 1X7DA 2TRSB 1XXHA 4CLCC 1WZNA 4OFXA 1Y4SA 4FQ7A 5L6MB 4WZAB 1RABA 5IDXA 1Z16A 2QMHA 2P1DA 5HK9A 3ANSA 2REQB 4CLDA 2KBEA 3JQFA 2PWPA 3UAXA 1A7KA 1PK7A 1WSBA 2H16A 1JHAA 3OZTA 1M6WA 1Q16A 3OZXA 2GESA 2I2AA 4YV1A 4LYGA 2A24B 1ES4A 4QU9A 1S4SA 2PFSA 4PAUA 3F1PB 1ISRA 5JD4A 3FFXA 3JR3A 1Z0JA 5JOQA 1CV2A 2QUHA 1E6UA 2XKJE 3GROA 1EXDA 3D7NA 1PZHA 3H2BA 4BP1A 4KQXA 4Q93A 3CURA 4PPNA 1ZVMA 5IWAB 4CLCD 4EYOA 3HABA 3IKVA 3JALA 2OGTA 3H4MA 3BCRA 5T8KC 1MO5A 4RK4A 4DMFA 5I5GA 1RXCA 4OFBA 2FX3A 3NWJA 1BX1A 3URKA 3L8YA 3HGTA 4PGFA 2R6CA 2XRYA 3COVA 1E18A 2C5BA 2PBLA 2E49A 3CKLA 4ZMRA 1H2AS 5CFNA 4LOHA 2H0YA 2PVSA 2C7PA 4MUBA 5D7NA 5EEGA 1EXWA 1HV8A 4D96A 2WG0A 1UK8A 3KYIB 3WRTA 4NZZA 1AMUA 2DHCA 2ILTA 3TLKA 4IFIA 4PBRA 4M9ZA 1VGRA 3RG2A 3TZ6A 4PSCA 4B5KA 1M6NA 3CLUC 4RPKA 3RXXA 3DWEX 1J9EA 4CPKA 4OL0A 2UUCB 5BSWA 1TI7A 1RYEA 2PX0A 3V39A 2DFKB 3T3HA 1BIFA 2XY4A 2VGLS 3FCAA 2G5GX 1FNCA 1T9CA 1YLZA 3GH3A 1IZYA 1HSZA 1GPKA 3AXSA 1NLYA 4CQJA 2VSXA 2BFNA 3U5ZB 3KYCA 1F9AA 2CNDA 2JA2A 2DTDA 3Q7QA 3WWZA 4U7WA 1SPXA 2JARA 4XQCA 4R84A 2TMDA 1ZD8A 2KX6A 1NW9B 2F8SA 3H1TA 1Q19A 1DC6A 2PTHA 3EQ6A 4JLKA 3E2KA 4B4XA 1Z73A 2O20A 2OGUA 3RS4A 3CRQA 2CF5A 13PKA 1D1SA 1CUSA 2XKAA 3RUIA 1EWTA 1ZHHA 2RI6A 3CLUD 3ZWOA 4KR3A 4YBZA 1P1HA 4JHLA 4PLCA 3NOVA 1XTRA 4Q4HB 3T1QB 3OLOA 2XRNA 4DE0A 2D3WA 2NVBA 3TQOA 3S1YA 5U47A 2EKPA 2HWYA 3QBDA 1S8AA 2GZMA 4CF4A 2ZS8A 2KMLA 2F00A 1HDIA 4B40A 3E9YA 2ZM8A 3V7NA 3HZHA 1YLTA 5JZBA 1OLXB 1F8UA 4WF0A 2QTVA 1IHOA 1E3LA 1OXVA 3DYBA 4IGEA 3QW2A 2BWJA 4FFLA 3TJMA 5ILOA 1Q95A 3DTKA 1T5HX 1W2WB 4I4CA 1W48A 5GZ3A 2EXBA 2TMKA 3VISA 2VRWA 1XDZA 3LLVA 1OZFA 5G0WA 3EFOA 1L5QA 5KVVA 3F5QA 4TN5A 4N1AA 1YI1A 4Q7KA 4F4UA 3OLQA 2CFTA 3AB7A 5AKHA 3HCFA 3FNGA 3ESRA 1M2NA 4CUJA 1MENA 1PVVA 2WWXA 3CEHA 4NBSA 4BNYA 2ZUSA 3D2AA 2Q2VA 3ZJ5A 4OQQA 1Y28A 3IOEA 1PWZA 1TS8A 5JCJD 4PC1A 4DC0A 3AGQA 2C83A 4R23A 1N2JA 1LCIA 1P17A 3U3MA 5K0NA 1URPA 1SUIA 5FBRB 2IYUA 4QG7A 5HFOA 3B89A 4EHHA 4ITUA 2NPIA 5B7QA 2OCGA 1ECBA 4ARVA 1OH5A 3EOBI 2JHCA 4AAYA 2HP6A 4X7RA 4O8GA 1IH8A 7ADHA 1SULA 3PP8A 1PJ8A 4TT8A 1KYZA 3GT7A 4WXRA 5EE0A 2LCFA 1HLDA 2IPNA 4ZI7B 1M2GA 1SKUA 1OH7A 2XCOA 3M3PA 2E89A 5ULLA 5KYXB 4WAUA 1XPRA 1VJDA 3KIPA 3H6KA 1DVRA 1M34E 4IINA 4UCXA 1T1BA 2IS2A 1OUMA 4G4GA 1QX4A 1N32B 4NYIR 1XXLA 1RC8A 3DE0X 5AXCA 2MCFA 4AYWA 3CIFA 2F67A 1KGDA 3PDJA 3H9UA 5IVIA 4F5WA 3F5SA 2HI0A 4MLDA 2O5EA 3QEMB 5HEKA 3B3JA 2O2EA 4UQIS 1CZKA 1CY6A 1NXXA 3GFVA 3W1EA 1YM1A 2H1WA 3DTVA 4F71A 5EGNA 4A6XA 2VZWA 3PE6A 1M2JA 2QPLA 5CB4A 5J2TA 2HUNA 2OZLB 2V96A 3NHKA 3RF7A 2A7QA 2P8SA 4JJGA 2AG6A 1Z5WA 3DLBA 2RFLA 1WV1A 2ORIA 4CI0B 5B12A 2BBOA 1LTQA 3CNQS 3F6PA 1Y9EA 2HQRA 5AW7A 4JJZA 1Q1BA 3ZVWA 1F2UB 3M6UA 1ZGHA 5ITSA 1U7XA 5HZGA 4MB2A 3LR4A 4NZ9A 3GP8A 4EABA 4BO1A 4Y6RA 2Z2ZA 4YO7A 2YINC 4M86A 4QT0A 3W06A 3OKCA 1VIMA 2VHCA 4RD0A 2OC4A 2EZTA 2Z5LA 3QZUA 4QPCA 3OIDA 3CVUA 1NNI1 1QP8A 5TJHA 2QR5A 4FEGA 3RRFA 5WRFA 3H97A 4L73A 5BYAA 4FE4A 4LZNA 4ER7A 2PD3A 1X77A 3KFLA 5CLGA 1G1AA 5K6TA 4BD0A 1LBHA 4NNPA 1AY0A 2B0CA 4KL8S 2Y77A 4RK1A 4AF7A 2J9FA 4K9NA 3WNVA 4IGKA 2BOVA 3JRNA 3MC1A 1NMQA 5GLBA 2XK1A 3LK6A 4OYYA 4Y2TA 3L8GA 4OIFA 4QJ4A 1W59A 3AF3A 3GMSA 5CU7A 4TLCA 2OXTA 1NF3A 1TD9A 1L5OA 2CMHA 4ZQCB 1Q84A 3NEPX 4W6QA 1R16A 1GZHB 2X5JO 1K38A 1R9MA 1CJVC 3WRZA 4DMKA 3BYZA 4HWSA 4UBLA 2AC7A 4C6RA 3K5IA 4ZDIA 2JFHA 4YRNA 5IT0A 1OW3B 2DT8A 5A04A 3JQRA 4LIPD 1P5RA 1Y6RA 1V48A 3DAFA 5IFLA 1KBOA 1GPH1 3PC7A 1SQ0A 1JL3A 3AHGA 3KDPA 3TCKA 1KDWA 3NGMA 5I3ZA 1TO6A 1H9CA 3F1PA 2CVZA 1KMHB 1RCUA 1ALQA 1EP3B 1YBHA 2CNKA 1GGFA 3BG5A 5A4MS 4QRIA 3NNSA 2Y1XA 3FSEA 1K98A 4BEBA 3HGMA 5CUQA 4D26A 4KSBA 2DFDA 3K0HA 2BR5A 2Q2WA 1TQDA 4OH7A 1Y9DA 2HXSA 3K8QA 4OLGA 1WE4A 4WACA 1S7GA 2EAUA 3ADBA 3CVJA 1S5PA 1KEWA 1NW4A 2VPQA 5FF9A 1N9LA 3D8UA 1G8FA 3C74A 3D6TB 1VYVA 1KH2A 4GL4A 3PWSA 2I29A 1FXUA 3GD5A 9MHTA 3NOPC 5F77A 2I7TA 3M6IA 3E2MA 1IZ9A 3E4DA 4X68A 1RXYA 1CNMA 1LJUA 3R3XA 5LP1A 1L5MA 3H2HA 4N0PA 4F3NA 2YFHA 1KMIY 2WPDD 2JDIA 4KP7A 4OHMA 3CPTA 1RC0A 2EFDB 4OPMA 3VH1A 3TNFA 5EP2A 3LCRA 3IV6A 1OWNA 3VJRA 2Q0QA 3GEBA 1OASA 3IQIX 4E32A 5EMJA 5B6JA 3DDHA 5FTNA 2CC2A 1T5OA 3IOMA 2JFZA 3VHQA 1BTOA 5EC8A 3LXUX 2J31A 1AURA 3KB1A 3PDIA 1NVMB 3AUXA 4MQEA 5BNIA 1V5GA 3IAM1 1SCJA 2XWQA 1M3SA 4FNOA 1RJ9A 4JLVA 1MBZA 4U2KA 1DEKA 3V1YA 1K4EA 4MITA 4P85A 4AIRA 1VPEA 1V7CA 1RT9A 3SC4A 2O7RA 5HD5A 2OP0A 1JDPA 1OPRA 4CCYA 3IGFA 2D6FA 4Q4HA 1A97A 2G4VA 1YB7A 5BQOA 3SDZA 3PDHA 1UPBA 4AF6A 4ZOLB 4DUZB 3NCTA 2JGEA 3K6SA 4OU4A 4QTTB 4YX9A 5H3HA 4I19A 1RI4A 1W8DA 3OZCA 3N8IA 3SZUA 3I6BA 1IK4A 2PMBA 4Q00A 2IU6A 1JPVA 3SX4A 2P1RA 3RD5A 3ET5A 4RFSA 3QVMA 1V8BA 4CTNA 5AW5A 7YASA 1FNBA 4PZCA 3P8ZA 4JLOA 4ZIRA 1GLGA 4LYDA 1YR1A 2H4ZA 1NJGA 4U7DA 1OROA 1U3CA 3G2YA 2I87A 4UNNA 4OXNA 2NV0A 1E32A 4DCPA 4AJNA 5EJ8A 3E4PA 2SKDA 4JSYA 2ADMA 3VAAA 3HNOA 1F8FA 3STWA 1WF3A 3OJOA 3AUSA 3PGMA 5L6LB 2FFFB 1S1MA 2PL5A 2VP9A 3DCIA 3E4OA 4QZVA 1ULHA 1TQHA 4H6JB 1YVPA 4DQVA 3OJXA 1US8B 3QQPA 4KSCA 1OHHA 4HO1X 3WS7A 3NCHA 4ZJYA 3F3SA 1B2LA 4M1EA 3W6ZA 4YYZA 1WB4A 4LAFA 3V80A 4O4LF 4KR2A 1X1TA 1XWWA 2LRHA 3H6GA 3LCVB 1EFCA 3NBXX 5IAGA 1NRIA 3Q72A 1F6WA 4EARA 5AHXA 3Q5DA 4CCAA 3BT7A 2AX3A 2EJTA 1JWPA 3RC3A 2POQX 5HIMA 3H83A 1NW7A 4W8OA 2Y2OA 4DHWA 1I94B 1MFPA 4UPDA 4OI1A 1NJ2A 2L82A 1RNLA 3KHSA 5EXTA 2BN4A 3QVJA 4AY2A 2AZ4A 2F8LA 4M1WA 3R6WA 2IEGA 4KPYA 3PBRA 3PXEA 4XARA 2JI7A 4YINA 1ZG6A 2WUFA 1I36A 4LMPA 3LY7A 2E9SA 1CI9A 4F1JA 2F43A 3E4QA 3GAFA 5LYYA 4WJKB 1RQ7A 1YB2A 4OIMA 3BGIA 2XBUA 3QEBZ 4OHWA 1GPDG 2RHOA 2AYZA 4ZQEA 4ASUA 1QNFA 3IEVA 3LI2A 1QR2A 5DNUA 1SXPA 4XLTA 1NBOA 2FXIA 4B33A 4TRNA 1GYQA 3UJNA 2FMKA 4AMBA 1CUAA 4IDAA 3DVSX 2G9RA 4CMHA 5THQA 4C87A 3A70A 4AP5A 3INTA 4H6WA 4OQYA 1DC4A 1NVBA 4WN9B 4TTSA 4DWOA 3L7MA 4CM4B 2FHPA 4NMHA 3RUPA 1N7GA 5LCXA 1N0IA 3O4GA 5KMWA 4XX0A 3DO6A 3RSGA 5F2NA 4FHZA 1KETA 2EATA 2XI4A 1R88A 4HWKA 4QDUA 4EK9A 2GLXA 4PRKA 3N07A 4ZZ0A 4EJSC 1UXIA 3K0BA 4FMCB 2QMQA 2NU9B 5IS1A 4JD5A 2H85A 2RIRA 3K0AB 1T35A 5L4NA 4LHWA 3K6JA 4E6XA 4QOEA 2GN4A 2QVYX 3LA8A 1LWNA 4A8JC 3D6AA 3O90A 1AMOA 1J23A 5EZYA 4EWFA 3FWPA 3TSYA 5I9IA 2GBFA 2JHPA 1XTSA 2IOFA 3F8SA 4FB4A 2WMYA 2E55A 5B30A 2B78A 5BMVB 2K7ZA 1TYDE 3KB8A 4MIYA 3OQBA 3KLNA 3NXSA 2Y2UA 1KSFX 3PQ3A 1CIPA 5ICGA 4Y2XA 5KCZA 1ZINA 5HYVA 1E2EA 1CQJA 2OORA 1VL0A 1QR6A 1AM4D 3PQ5A 3RYHB 1UKEA 1GT6A 3CB2A 4OONA 1PJ4A 3F9RA 1AGYA 2ESRA 1HX7A 1UZNA 2E7ZA 1WW8A 2IWCA 2R96A 3T15A 4FILA 2PR2A 1L0DA 1QHYA 1GL7A 4R68A 2CMGA 3G0IA 4BTLA 3OQIA 1IUNA 1QO0D 1E61A 3EPHA 2CDBA 3VO8A 3LUFA 2P0AA 2GX5A 1I1HA 1IZ7A 1F51E 4KXXA 3FKWA 3EIHA 4BE4A 2C2MA 1T1EA 3GJ4A 3UE0A 4QJBA 1LL5A 1OXUA 1ISIA 3W4IA 2P9HA 3REQB 2O3QA 3E2LA 2AJDA 2VYND 1L5LA 3NT5A 3K2NA 2R97A 3R0ZA 1S3SA 3OCCA 3VZSA 3L1HA 4S2PA 4TZKA 1HG0A 3ONWA 4H7FA 5A5EA 5FUBA 3ENQA 4D6YA 4G1FA 4F04A 3CF6R 4H6VA 3CJQA 3DMGA 4D4KA 4XQEA 3Q3GE 2PXAA 1XTTA 4XKJA 2JBAB 5C5IA 5FA7A 2W8BB 4I5FA 2CL5A 3AF1A 1LPMA 2QQ5A 4Z1MA 4JL5A 1T2CA 5ADVA 4DLVA 2O8CA 2ZR9A 5AHRA 2FP4B 2BFFB 3EIEA 4RMHA 1Y3AA 4DQDA 1J97A 2Q1WA 1ES3A 5AQBA 3HLDA 2HHJA 2W1TB 4XSHA 3GAAA 1J5EB 1HURA 1ZNQO 1U81A 2A30A 1IPHA 3NY4A 4PTYA 2Z09A 5KQSA 2ZZNA 2G9QA 2Y8HA 4FGWA 2ORED 1NQWA 3GU3A 3VBEA 4MUJA 1N1MA 4G0PA 1K06A 2QRVB 4PO1A 2PUAA 4ZMBA 3OO1A 1PJ3A 4DDYA 1UK9A 3H82B 1Y5IA 2CDRA 2BSXA 2AB0A 2HHLA 3DVRX 4QBHA 4EG8A 2G8NA 2B6NA 3ZDZB 4R16A 3PZBA 3C3EA 1P0QA 3M6MD 1ZK3A 3OJWA 5A3QA 1W88A 4UVHA 3D7KA 4NBTA 5KSPA 5KYUB 3TQTA 1DRKA 2MYNA 3ZIUA 4J07A 5EPHA 4BUJA 3CTPA 1GHPA 3MTBA 2GSDA 3KT0A 3OEEA 2JFOA 4M38A 1SUEA 2WJZB 4KO8A 3ORQA 1J7KA 5ISMA 5KSZA 3SH8A 3KR1A 4LRYC 4KLAA 4ZOLA 4PLWA 2WWHA 4P87A 4NFSA 3E98A 2MT9A 5EOOA 1CF2O 1PZNA 4R0NA 3RSZA 2JH9A 1AKTA 4AM8A 1G4UR 3RIHA 1ZD2P 2ZRDA 2OFOA 3FFAA 4ZJ1A 2Q3FA 3E8SA 5E1OA 1E0DA 2JFWA 4ZI5A 1ZTUA 1I33A 3ROEA 3W2EA 3W2TA 3JZIA 1HR0B 5HGJA 1NMEA 4YP1A 4G3WA 5KEIA 3NIDB 2OAEA 1GGMA 3M6XA 3QELB 1E2PA 3E1KA 4E15A 4CKWB 4JXVA 4QASA 5AVOA 3TW8B 2Z6AA 3HJRA 3PSHA 1RRGA 3SSMA 2PUDA 1L8XA 4LCJA 1KXZA 4LG1A 5C7IO 3CUUA 5FP0A 3ROGA 3Q87B 2AXNA 1SC3A 3BQMB 1NAIA 4CV0A 4EA9A 1LW7A 2HJGA 3PQCA 4R71A 1FUYB 2O1XA 1FK8A 4KYTA 4GG1A 2HFKA 3WL3A 2F3TA 5AM5A 4DC9A 2YOHA 2X1VA 3AEXA 4GBED 1YQUA 1NBMD 5DYYA 2B7LA 4X65B 1QAOA 1WNFA 2W22A 3H5TA 1V95A 5EVJA 2V6MA 1AQIA 2C0QA 2C9DA 4IKOA 2WYXA 5G4KB 2HQ1A 5K3DA 2W0NA 3ZNNA 3RJMA 3EVDA 4R2IA 3U4CA 4YCBA 4NCBA 5CLLA 3JYOA 4AKIA 4W1SA 2Q46A 1P0IA 4ZD6A 1D03A 2C3UA 3ZHZA 3SLGA 3CCCA 3KU1A 4E3OA 2C5GA 4WT7A 4X64B 4OJQA 5E7IA 4LE1A 2ATEA 1C2YA 1LBSA 1YFZA 2P4QA 1TF5A 3ZLTA 1RQRA 4HPXB 3LBHA 3G82C 4LNAA 2J9RA 4FNMA 4KXQA 3NC4A 3OKPA 2FN9A 2F9LA 2PD6A 2NADA 1X7YB 2RK4A 3JYIA 4TZTA 4Q66C 5EJ7A 1Y5NA 2QZ4A 3O0TA 1XYGA 4YUYA 4GSKA 1G8PA 4P7JA 2Z5GA 3I9LA 1K54A 4TVKA 3WGKA 2C4VA 5CERA 1KO7A 2C4MA 4I99A 1LEHA 5CYPA 1R0YA 4L74A 3IB3A 4KKVA 2B8JA 4PFSA 3ZE9A 2ZJYA 3PTZA 3FIJA 4ZAWA 3L6UA 5TIIA 1XZJA 4WN9A 4PGGA 1ECJA 3K0KA 2O23A 1KJZA 4NMWA 1DHRA 3OLWA 1XLTA 1OMEA 3T5DA 3EC7A 3KSDO 1SA0A 5KVSA 2Q6LA 3W3AH 2J7KA 3FUVA 4MVJA 1XHLA 4XUEA 4EBFA 1DBVO 1T9HA 3E7WA 5FEMA 4QSHA 4C14A 1VGVA 3U4AA 1TKBA 3WJ7A 3W7BA 1N9KA 4BPBA 4UUBA 1TAQA 1M2OB 1PG2A 1B7GO 3LR3A 3JQCA 3BJEA 4Q05A 3IMFA 1IELA 3G9XA 2OV3A 4XUZA 1L7OA 4J4BA 2DQKA 3BFXA 4DN6A 1I7NA 2ZBRA 4NAUA 1JQEA 4UQLA 3WGMA 2NVUA 5BMVA 2XYGA 1TVCA 1N0UA 4YUZA 2YVKA 4QUHA 1KFCB 2PT6A 1JYFA 3G2NA 4MRPA 3AV0B 1LUAA 3AOGA 3NOXA 3RYHA 4WN5A 3B5EA 1XOIA 2Z2JA 3T5MA 4KXNA 4H3HB 2OVBA 4EGCB 3GT4A 3K9LA 3NT4A 4HC4A 4GX1A 3L18A 2ONKA 3UMBA 1UPTA 1L5SA 2XMSA 2FPUA 5IAJA 4TUYA 4II2A 4M0PA 4P38A 3TEMA 4YR9A 3T0IA 1OMOA 4JGGA 3ZV3A 5LOVA 5E8JA 3RT7A 1Z6QA 2FOIA 1IVYA 1EVQA 5TY0A 3IE0A 4JI1B 5JRJA 3HY3A 5EUCA 4JUAA 1LSJA 5K2MA 4HJRA 3GG9A 4UUPA 2ZVQX 3CY6A 3CR8A 2GZ3A 3SP1A 2G1JA 4JXGA 1AK2A 3WLMA 1O2DA 2OMKA 1X9IA 5BSTA 2ZWVA 1EX7A 2F3SA 1JALA 1DIRA 1P1CA 5CJ2A 1XU7A 3WWXA 3EGXA 4Y67A 2B18A 4BU1A 1TJ4A 1Z28A 4MV9A 1GZ3A 3ABQB 4GMKA 2FSVA 3GR2A 4JBGA 1V7ZA 2BM0A 4G8JA 3OIFA 3NHPA 3MW8A 3PVCA 4WGGA 2JBAA 5K09A 3IUSA 4O2BF 3CZCA 4N92A 2QR2A 3IJEB 3AX6A 3N8LA 1D3AA 4R69A 4RVGA 3DT8A 1B8OA 5F9HA 2H7YA 2V9AA 1NUPA 2VCYA 2G06A 5B7NA 1C7EA 2BFFA 1GV1A 2PUHA 1NZUA 3P7NA 1NPDA 2AE1A 5B58T 3EIXA 1T1SA 4LMRA 4D5EA 1L7XA 4QU0A 2R66A 3FPKA 4I4LA 4EY7A 1VCOA 1YLPA 1W0KA 2PZEA 2QAGC 2QN9A 2VJLA 1QIJA 2PH7A 1VQQA 3E23A 4F46A 4TKUB 5EXDA 4UBMA 3DMRA 4QKQA 1Z5UA 4E3JA 1RCTE 5GM1A 2JFGA 3PI6A 4PS0A 2G25A 3BIOA 4DT1A 1JF8A 3H82A 1K56D 1M7BA 2BKLA 2DG2A 4EZIA 2ZATA 1B6RA 3T3OA 3U13A 4LBZA 2UXBB 2FSGA 1V8ZA 2EWVA 4PZDA 3JAKB 1XFQA 2Q6VA 3GRAA 3P9QA 1EH5A 2VJOA 3WYEA 2J5RA 4JU8A 3L01A 1V9ZA 3KVYA 3HV2A 1P72A 2BLSA 4IG4A 2GPAA 1FSFA 5F33A 4MMZB 1SVOA 1Q7EA 2VDRB 2RHWA 3LSTA 3GFGA 1YJXA 4RF4A 2ACGA 3BREA 3LX6A 1NT2A 2B2NA 1OY1A 1QYDA 4OGGA 4PTLA 3WIVA 2NU7B 2PUBA 4EETB 4XQ0A 1IY1A 2AOTA 4WLVA 3H9EO 4TWIA 4B3RB 2B4TO 4BVFA 4A26A 5HPYB 4YCNA 3WL7A 5EE3A 1T26A 2OZVA 2ZRIA 1NJ4A 3TJZA 1QVRA 4LV6A 4PNZA 4Q1AA 2JLAA 3GRJA 2B99A 3QELA 2DCUA 4IHJA 1QU3A 4CKWA 1L4HA 2DB3A 4UXIA 4E1BA 3O93A 1X1DA 1E3WB 4N5LA 2Z4SA 4K26A 5F2KA 4KR9A 3ZHBA 5FBQB 1ULAA 3WWDA 1C8BA 1X13A 1SQ5A 4GPTA 3M7IA 3TZBA 1ZS9A 3NC0C 4U3TA 4C0QC 3ZWCA 4G0WA 1OA0A 1KQ3A 1QFJA 1JEEA 4B44A 3IURA 2KQUA 5CHYA 2BZ0A 4ZZIA 2EQBA 5CR9A 1DXHA 3EZGA 4UTZA 2C2WA 3IUYA 3Q9LA 1ESZA 1LKZA 4HPWA 5JNSA 1DXOA 2Y0BA 3WIDA 1E1RA 2EIXA 4X90A 1HL3A 2NGRA 4WW0A 1LDEA 4F8YA 2FEAA 2J0UB 3GJ7A 3PK0A 4MVWA 2ZWPA 4BO4A 3ICVA 4DZZA 4RH0A 2RAPA 5JAIA 3R7WB 1DMSA 2X5NA 2NT3A 5JYOA 3L4KA 1QMGA 4Y1GA 5LMCA 5EJ9A 5JSHA 1OBOA 1B8UA 4YHBA 4JIMA 1NAHA 3JZMA 3DF7A 5K3OA 1M83A 3VR6D 3UT0A 3HYLA 2UYOA 1EHIA 4C2AA 5KJEA 1X6VA 4JQYA 4N3NA 1XNJA 2JANA 4DR3B 2PRJA 4NC9A 1RRCA 3HKCA 4PBSA 1II8A 1NYMA 4FDUA 4IW3B 3DE2X 3FOZA 5ILQA 1KFEB 2VUSA 2PRIA 5M5BA 2QM3A 1D7AA 4G3KA 4EG0A 4MDHA 1L3LA 2OUIA 4JJ6A 2IYZA 3KD2A 3M4NA 3H8JA 3FTQA 5D87A 1DO2A 3JQ8B 3WHLA 4WGFA 5JNWA 8GPBA 4LE2A 2IZ7A 3UBTA 4X1YA 5E43A 2DP4E 3GPIA 3O94A 3RVLA 1NRFA 4FBGA 5IEJA 2H10A 2WICA 3QBVA 1YRAA 4YRPA 2W2KA 2Q5CA 3QWHA 3NRJA 1TS6A 2AK3A 5FL3A 4N9KA 4RXMA 1Z9BA 3VP2A 2PBZA 2IRWA 4XEHA 7MHTA 1X39A 1G6HA 2MSNA 4PC7A 3LTNC 2R4TA 4I8DA 1KEEB 1M6VA 4S2NC 5FHRA 3KNZA 3N53A 4KVGA 3C8CA 1A8HA 4B93A 1F6BA 4P6ZM 1AQYA 3G2HA 4CRWB 4R2MA 4ODIA 1UBTS 1RPJA 4UNQA 5TDHA 2BHLA 2WJPA 1XVVA 2XYQA 5ALWA 1FNMA 2CEAA 4ZARA 1PW5A 3UEOA 2X0NA 2O8DB 1A95A 3VGPA 3U4HA 4DIKA 4ZDJA 4DM3A 1SOAA 3OM0A 1TEHA 1ONHA 5FQOA 5EVEA 1I2BA 3JQQA 4Q16A 1B41A 4BEVA 1AV7A 2AH5A 1JR6A 2X6TA 4OXRA 5K8TA 4OYHA 1PYDA 4RZXA 1GG8A 4KO1S 4FUWA 5CCEA 4I6EA 1J5PA 3DZDA 4IM7A 1QYRA 4L28A 3OQPA 1M2WA 5K8UA 4YJ3F 2C42A 2AC2A 1GKIA 4UEWA 2XF3A 4FX5A 1XU9A 2JGDB 4BENA 5BWCA 2ACEA 4HN4B 3HN6A 3OZUA 2ZT5A 3F6SA 5TFQA 3E6AA 2ZRMA 5C5KA 1EP2B 5KQRA 1VLLA 4RJTA 1ZM3A 4UBNA 4OL9A 3WQSB 1KQFA 4KQOA 3ZBUA 3CE9A 2ECPA 2PU7A 2JIMA 4OI4A 5DK6A 1FFBA 2BHRA 4FZ5A 4R1PA 3R7FA 5LDHA 3C7VA 4XCXA 3LUBA 4YV7A 5LD2C 3AEUA 9GPBA 2QUJA 4LXTA 4ZRMA 5DGTA 2FFYA 5TQ0A 3FLMA 4DWVA 2VYQA 2A9VA 4NWIA 3VX4A 2B8NA 2IHUA 5IAAA 5DNEA 3L46A 4MOWA 2W0SA 5AXAA 5J59A 5LIPA 3QPUA 4WKOA 4N1HA 2Q07A 3L6CA 4BGIA 3HCWA 3NIWA 4FGJA 1Y42X 1KY5A 4JASB 2X7HA 1UBSB 4X84A 1QC5B 3IEIA 4M83A 3HXLA 1HNWB 1GHMA 5C1DA 1FYXA 1TVEA 4BMPB 2DUNA 2AA3A 1GGKA 4BX0A 2NO6A 3FMVA 1WIWA 3ENZA 2QMYA 4EY5A 3EULA 5IRCD 1ESNA 3DDOA 2N1MA 2ZPAA 1JFSA 1JR3A 4ND7A 1N2OA 3LQYA 3S8YA 5EP4A 1MB9A 5FFMA 2G2UA 4Y0OA 2W8ZA 4CR7A 3UQYS 1L5KA 4YV0A 3MRXA 5ALDA 3JAKA 1JU4A 5UKDA 4KPUA 3MPUA 4KDEA 4RANA 3S28A 4UTOA 2GZDA 5ARCA 2WM8A 2ZI6A 4CWAA 4AY5A 3H9JA 3QY0A 3HU2A 4AJ4A 2I72A 2XQJA 4EG4A 2WAOA 2IW1A 1XA1A 1KL7A 1HDXA 3GLHB 3RREA 3BMOB 2VWQA 5E7QA 1U8YA 1T43A 4Q21A 3UG7A 2PKXA