3JVUA

Crystal structure of unliganded p. aeruginosa pilt
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
342
structure length
337
Chain Sequence
MDITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPLEHKQVHALIYDIMNDKQRKDFEEFLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSKVLTMEELGMGEVFKRVSDVPRGLVLVTGPTGSGKSTTLAAMLDYLNNTKYHHILTIEDPIEFVHESKKCLVNQREVHRDTLGFSEALRSALREDPDIILVGEMRDLETIRLALTAAETGHLVFGTLHTTSAAKTIDRVVDVFPAEEKAMVRSMLSESLQSVISQTLIKKGRVAAHEIMIGTPAIRNLIREDKVAQMYSAIQTGGSLGMQTLDMCLKGLVALISRENAREKAKIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Atp binding protein
molecule keywords Twitching mobility protein
publication title P. aeruginosa PilT structures with and without nucleotide reveal a dynamic type IV pilus retraction motor.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 97
structure length 337
sequence length 342
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3jvuA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3jvuA02
4JMPA 2AWNA 2MMCA 3AB3A 3K0AB 1OHHD 1GNQA 4OHXA 3B9QA 3NC0C 2ZROA 2RGAA 4YMVA 3L8ZA 4DSUA 5CB8A 4JL8A 3KZ1E 4LV6A 3BB3A 5EQTA 3CF0A 2X8AA 2JLQA 3GEIA 3ND9A 3UK6A 5JFGA 5C1BA 3E5HA 4LYHA 4TLBA 4FMDB 4HAYA 2ODWA 1Z0DA 3WMFA 1I4LD 2WBLC 3OIYA 4Q9JA 1XCGB 3MWJA 3EC2A 4L9WA 3T1OA 2IUSA 4G1UC 4LBYA 1KIMA 2ZRBA 2R6AA 2WICA 4FMDF 4JJKA 1S3SA 3OESA 4LRWA 4WXPA 3LWNA 3REGA 1UAAA 3C5CA 2Z6VA 2Q3MA 1GIAA 1OSNA 1UADA 4V03A 4IFEA 4C0AC 1DOAA 1H65A 1WDTA 121PA 1RJ9A 5HTKA 4Z1MD 4AI6A 1Z6TA 4DDUA 3FGNA 3LNCA 4OQNA 2CVHA 4Q4AB 3UG6A 1FP7A 3WYAA 3THYA 2AN9A 1T0JB 3VNVA 4F92B 1NSTA 1UEIA 1ZYUA 1OXUA 2J0UB 1NLYA 5JMTA 1FUUA 2YWEA 4QRHA 2GAAA 4M4SA 1E9FA 4FINA 3AVXA 2A2ZA 1CF4A 5FUXA 1S96A 1US8B 5BYKA 5G53C 5AUOB 2JIZA 1II8B 2B7CA 3EZ9A 1SZPA 2ZRFA 2GXAA 3A6PC 2ERXA 4DLRA 4QNRA 2ZQ5A 4UXHA 5LB2A 5AJXA 3A1WA 4MYCA 1P2SA 4JBYA 1CRQA 2VP5A 3OIWA 4KSCA 4B47A 4KLNA 1CIPA 1YRAA 4IOJA 1OXTA 3SE0A 2G0NA 4LC1A 4IXNA 4B33A 1IN5A 2C9CA 2HCBA 3I32A 3SYLA 4A0FA 4LY6A 4KO8A 3T35A 2ZYWX 1XEFA 1ZNZA 2GILA 2ZETA 2O5VA 2W83A 1P9WA 2SHKA 1ZNWA 2NO9A 4BLTA 1F2UB 4BLRA 1U2RA 4A9AA 1WA5A 5DHFA 3NG1A 1VCMA 2F9LA 1W2HA 1W36D 4Q66C 5L3SB 3UANA 3I4LA 3RS2A 5BQ5A 3VHLB 4BLOA 1G7TA 3KQKA 3SI7A 3WMGA 3TGPA 3RDPA 2C2HA 2FMXA 1Z63A 4QJ3A 1R6BX 1IQPA 4PO9A 1MABA 4ASUA 5B57C 2OCYC 1JPNA 2CVFA 1KI4A 2YKGA 4P31A 5BYJA 1XU4A 3AH8A 3CNOA 1F2TB 5KSZA 3TBKA 1MRSA 1N6RA 1TQ2A 1N6LA 2BKUA 2NG1A 2QRNA 1W44A 1YR6A 1EWQA 3QPVA 3K0SA 2JDID 5HE8A 1UM8A 2JJ1A 4DCUA 1R10A 2WKPA 4AYTA 2WWXA 1I4TD 5CJ2A 3TSZA 2AKYA 4Z54A 2ORVA 4JLBA 1AQYA 5HPYB 4ACAA 4EJSB 4Q03A 4WBSA 1XXHB 1VG0B 1YZKA 2WWWA 1ZVQA 3W6OA 5EP4A 3RC8A 3HR7A 4Z8XA 2YNMA 1UBEA 2P0EA 1OH8A 4M9SA 1OFHA 1IHUA 4IRUB 1DG3A 1II9A 4EJSC 3PENA 3CBQA 5JWOA 1Z6AA 1OFTA 3SJZA 3IIKA 4M1TA 1HYQA 2K5UA 4A0RA 4PHTA 3I72A 1RW4A 1M2OB 4Q1AA 2J5XA 5E7MA 5L3RA 4HATA 3EZ6A 1VCNA 1Q1BA 1UBGA 3PUXA 2WIAA 1Q20A 3I8XA 2IYVA 4DB2A 2FEMA 5SZHB 3SFVA 3VKWA 4OHZA 2PL3A 4QKQA 3TNFA 3K70B 4PC3A 2XTNA 1FNNA 4US0R 3IIMA 3RRZA 5KDDA 5H8WA 4C2TA 1E4YA 4EDHA 2RGEA 3WHLA 3TUZC 2VA8A 1OJLA 2NO7A 4TMWA 1Z2CA 4TTQA 3WY9A 2JAQA 2OG2A 4ZDKA 1PLLA 4ZI3A 3AF3A 4KODA 4HB3A 5FTJA 1W4CA 4KCGA 3K70C 3FHTA 2GVDC 4PAQA 1A82A 2WWFA 3BH6A 1NBMD 2O0JA 3OEHD 2JASA 4G5QA 4TL9A 3WRYC 5EP3A 4OHVA 4UNPA 4QM7A 5GADl 3KFXA 4LJYA 1KO8A 1CTQA 1GP2A 5IK2D 3RS3A 1TU3A 1OFUX 3KJGA 2GZHA 2RGXA 3OE7A 4EFMA 1PLKA 3BD9A 4F38A 3WBJA 1A1VA 1YJ5A 4KYUA 4OQFA 1ZM3A 4QGHA 2PH1A 1VG8A 3UATA 4HAZA 1HURA 2IF0A 3FWYA 2WIBA 4UXIA 1AK2A 1N6PA 2ODEA 2QI9C 1TL7C 4NYIR 4FD2A 4W7SA 3W5IA 5JSZA 2VF7A 1AM4D 5GVRA 3ICQB 4D4JA 3WNCA 3CWZA 1M34E 2BJVA 1Z6GA 3PEVA 3X1DA 4BFSA 4F4JA 4QM6A 1KMHB 2XB4A 3QUSA 2IHBA 2J45A 1RC8A 2Q0HA 1MABB 3JZMA 2Z43A 1XEXB 2ZI6A 4HLQB 3EZ7A 5EUMA 1GNPA 2FA9A 1KO1A 4M9ZA 2BC9A 2H18A 2BM1A 4PZYA 5F9FA 4NONA 1VYVA 5DI9A 2WKRA 4R9UC 3VFDA 1VHTA 2YWFA 3LX5A 1N5JA 3EC1A 3AVPA 1KJWA 1C4OA 4U7DA 4XSHA 1ZC3A 1N2CE 4WOPA 1YR8A 3BFXA 1PZNA 1PUIA 5FBQB 1DARA 2ZRMA 3HJNA 3QNUA 3SHWA 3B85A 3CIOA 4Q9KA 3TVDA 4AY2A 2VH5R 4JLNA 4Q18A 2QAGA 2KE5A 4AIIA 2J46A 5DGXA 4X8OA 2ZR9A 3DHWC 4PANA 5DE3A 1P9NA 3KKQA 2FU5C 2OESA 3CLVA 2WJYA 2W0MA 2YZ2A 1PUJA 2GK7A 2GEDA 4KFUA 5EXXA 3E1SA 1RKBA 4NE2A 3GLGA 1GL6A 1FQKA 2V9PA 4AD8A 1MO4A 1TADA 2BCGY 4TYNA 3QOFA 3QENA 4LJAA 5F3WB 4LBWA 1P61B 3EZFA 2CCJA 1HT1E 2Q6TA 5DNYB 1QG2A 3OFND 1FL9A 3MG9A 2FFBA 5DSZA 1SXJA 4IEIA 4XH9B 1KK3A 1AQUA 1UFQA 3CR7A 2BBTA 2BMJA 3V9PA 1ZM7A 2ZM5A 2G83A 4E07A 3J81k 4NZYA 2NPFA 4KVAA 3U7HB 2I1QA 3IBGA 4Q21A 4U02A 1D2EA 2LKCA 3A1UA 3K9HA 2ECKA 3TE6A 1W0KA 2F6RA 2OFXA 4PHGA 5CDFA 4B3FX 2Z83A 1UKVY 4NYJR 3PIRA 3CRVA 1QF9A 2V1UA 2X19A 4MKHA 2PT7A 4R71A 1DAIA 3H1TA 1SVIA 1XZPA 2OCBA 1MO5A 2HT6A 4H1UA 1FUKA 3UIEA 5JZVA 2XX3A 3I5YA 3TW4A 1VIAA 1SVWA 3BIFA 3BBPA 3DPUA 2CLCX 4LBZA 4CYMA 3I62A 4YMUA 1DADA 2G1JA 4EPTA 3TIFA 3THWA 3AVYA 3O47A 5BN5A 1M7BA 3CZQA 3DOFA 3PG5A 4W5JA 3KJIA 3UMSA 8OHMA 3W3AA 1S9HA 2DHRA 1ANKA 3IBYA 2IX3A 1OXSC 5AJZA 3ZS9A 1ZC4A 4RKFA 3WXMA 5L3VA 3M1IA 1NJGA 3MD0A 4PC6A 4ACBA 4A2PA 4LBVA 4KVGA 4OL0A 2XNDD 3U7FB 4HZUA 4BZXA 1Q21A 2REXB 4CW7A 3SYKA 2ZIAA 5DI3A 4ZI2A 1DO2A 2FFQA 3K9LA 4PPFA 5JI3E 2ZANA 1ZM2A 4POAA 2C99A 2J7PA 4GBMA 2IWHA 1MO3A 3OE7D 5CLLA 4A15A 5L8VA 4OK6A 2QENA 3O8RA 4DUGA 3HYRA 5TV2A 3TLXA 4M0LA 4DEYA 1NG9A 2ZI9A 4A36A 3G82C 4A2WA 4JKIA 2GBLA 2J1LA 2ERYA 2EVWX 4S2EA 4URXR 2ZEJA 3ZJYA 2ZI3A 3RSOA 2LWIA 4C0SA 2ZJ8A 1KZGB 2YV5A 3CX8A 2X77A 3B1VA 3DDCA 4EKDA 3SQXA 4JLAA 3QJYA 3SBEA 4WIAA 3TK1A 2O8CA 4HUQA 4ON9A 3FTQA 1Q12A 4B74A 3H2YA 3GLFA 1JALA 1DAHA 221PA 5FTKA 3VKGA 1E9EA 2UZIR 2JJ2D 4B34A 4C0QC 2JLSA 4LHVA 2R6FA 4MRSA 5CIQA 2WWHA 2YC4C 3K9NA 3QE0A 3ICEA 3KTAA 2EFDB 1E96A 4OI1A 3SDZA 4DSTA 1E9RA 3IPXA 5KNDA 3PITA 3QSYA 2ANCA 3GLHB 3NH6A 2BEJA 1UPTA 5HKKA 1XDBA 4DCVA 1GDDA 1HE8B 4GZMA 3RRMA 4DWJA 1COWD 2WSSD 2A9KA 2WMNB 2ZSFA 1WF3A 4FWTA 1TUIA 2C77A 5IDVA 3NKVA 4BFUA 2O8FA 1GVNB 4DT1B 2ZYUX 2QMUA 5EJEA 2FFAA 2OFOA 3KDSE 3EPHA 4FN5A 1C1YA 1OKKA 1JEEA 5D3MB 4A8JB 1E32A 3F5FA 3P4YA 2CE2X 2JEOA 1GWNA 1FQJA 3B60A 4ITRC 3U44B 2NMVA 2E1RA 4B32A 4ZCIA 1W47A 4XVQA 3Q8XB 4OI4A 2R2AA 3VR1A 1G3QA 1ZCAA 1YZUA 4AKIA 4TZ0A 1OXVA 4LX0A 1EG7A 2W58A 3D3QA 2BM0A 4V0LA 2WZQA 3TSWA 3JZAA 4A8JC 2BMDA 1KSHA 4RZXA 4G0NA 3THOA 1TEXA 3K0CA 1Z29A 3JVUA 1SXJD 3LW7A 2GETA 5IHPA 1NMYA 4CT4B 2CCGA 1AKYA 3K09A 1OF1A 2GJKA 1EFHA 1D5CA 1RFLA 1E2DA 2D74A 4C9BA 1ZD1A 3OEEA 3GJ6A 3AF0A 5HR5A 4ZCLA 4EUNA 1KI2A 2AK2A 4D4LA 1SQ5A 1T3SA 1WMSA 2D2EA 4LJ5A 4PSVA 2XOKA 1NVVQ 2YWGA 4RJLA 4XVRA 3VR5A 5JEEA 1X8JA 4OYHA 3LBHA 5C4MA 5IRCD 1YZLA 4PX9A 2XJ9A 4GP7A 1A2KC 2JLUA 4GFDA 1OE0A 4M22A 5FFMA 3KQNA 2ZUCA 4NDZA 5B58C 5DIFA 4D4MA 5JBQA 2ZUDA 3UPUA 2WJGA 3LVQE 4YMSA 1W7AA 3VR2A 2J3EA 3IDQA 3R20A 1SVSA 5AJVB 5TARA 2A7QA 2QTHA 3EG5A 2ZSEA 4BLQA 3Q7PA 3GLGE 3FVQA 3QPUA 2OAP1 4TMTA 4C0LA 3LFUA 1XX6A 3ZZ0A 2CJWB 1F5NA 1G18A 1DAGA 4GOXA 3GLHE 4XOIA 4NP6A 2VF8A 4NCHA 4DCTA 4TMKA 3MLEA 1XCMA 1Q3TA 1NI3A 2P3SA 3DKPA 4D25A 2W6IA 4GI7A 3ADBA 1VCOA 3NBZC 4Q19A 3OIVA 2BOVA 4C30A 1M1YE 3RWOA 3FOZA 2IUTA 4YQFA 2P2LA 1FX0B 1NN1A 1I4DD 2J7PD 3EIQA 1GOTA 3GLFB 4L9SA 3PUVA 4TLCA 4Q02A 3A4MA 2R62A 2PLFA 3FFAA 2WJVA 4AG6A 4DUGD 2I4IA 3M6AA 3O8BA 3IHWA 1A4RA 3KKOA 1JR3D 5EZ5A 1W4RA 2NQ2C 1RRFA 2QMEA 1GG2A 3TUJC 5FBRB 1KDPA 1R5NA 2J0SA 2IS4A 5FOWA 1DTSA 1KDOA 3AVTA 2H57A 4IJMA 4IOKA 4LWZA 3MJHA 4YLGA 2EYQA 1R5OA 2EFGA 1NN5A 4Q4AA 1CXZA 5AJWA 1IN4A 3ADDA 1P2UA 2O8FB 2ZAMA 4DLYA 4DB4A 5KTYA 3PR1A 2I3BA 2OZEA 2XXAB 2BJWA 5CITA 2J0UA 3C5HA 4OHWA 4URWR 2WPDD 1E1RA 3AQ4A 1NMXA 3GFTA 4G5GA 1E2IA 1US8A 3RAPR 2GK6A 1II8A 4HLCA 1KNQA 4U00A 3S1AB 1IXZA 4Q47A 1EFTA 1GTVA 3DMDA 1AN0A 2PX0A 3R7WB 1KI7A 3K53A 5FOSA 3O8DA 1E79A 1T8UA 4E09A 5HKKD 2A5FA 3GJ5A 1YZTA 4OQLA 1N3BA 3SS8A 1N6KA 1T5LA 1VYTA 3CZPA 2VSFA 3CRQA 3P20A 4MH0R 1EGAA 3IUYA 4LC0A 4E5UA 1XJ0A 2AFIE 2IW3A 3LW8A 1KK1A 2GKSA 1NSFA 1IY0A 4FI3C 4JSTA 4N0EA 1OKKD 2RKOA 2YYZA 3IQWA 3UG7A 1JAIA 4EPRA 4PPGA 3U3MA 1Q3HA 1F2UA 5DO9A 4ZV4A 2FG5A 1UKYA 2DFNA 3C7KA 3Q72A 3AEZA 5L3SA 3FFBA 1W1WA 4L4UA 1OH7A 3ND8A 3PFIA 1ZD9A 4D4KA 1GRQA 3KXLA 2ZS8A 2ZJAA 4FXPA 1CEEA 5JHGB 4DSNA 4DC9A 1R0ZA 2QZ4A 4B75A 2C98A 3VU9B 3P27A 2GJ8A 4MKGA 1HT2E 2ZITA 1JNYA 3AKDA 3RVBA 1F2TA 2GCOA 3GLFE 4NCIA 3X2SA 3CPHA 4B3DA 3L8YA 4MITA 4F4CA 2BBWA 2CL7X 4D80A 5AJYA 3WP1B 5KNBA 2DFLA 2I1VB 2ZJZA 5E3HA 4EJSA 4NL4H 2GZAA 4HLDA 3GLIB 1XXHA 3I61A 2ZI7A 1RYHA 2RGNC 3X1XA 4MGYR 2PT5A 3GFPA 5KHOC 2P6NA 3LRPA 4BLPA 2IS1A 1XMVA 4DHEA 1Z47A 1J70A 2JA1A 2YJTD 1Z28A 3EIEA 3BFVA 3CB4A 2QT1A 2GWHA 2HF8A 2QE7D 1DAKA 5C4GB 1R0YA 1X1SA 4P3YA 3SU8A 4TMVA 4X8LA 1MRNA 1PJRA 1BIFA 3UWOA 2ZTSA 4I4LA 3D6TB 1BKDR 1W4AA 1FMLA 5FBWB 4X8MA 2YVUA 3AVVA 1LS1A 3AP3A 1DG1G 1U94A 4JKYA 3ZZUA 4RFSB 4H9GA 2RGCA 3TAUA 3WNBA 3C4JA 5E7JA 4A92A 1I2DA 1B23P 4B71A 1KY3A 1QVRA 1QHSA 1UBFA 3N70A 4LJ9A 4MYUA 1L8QA 4RZ3A 4TYWA 1OYYA 1YU9A 3VR3A 1FW6A 2OUKA 4JLKA 3U4QB 3KB2A 5FL3A 2D2FA 3VR6A 1ZU5A 1QHIA 2CNWA 2XB2A 4HB4A 2O8EB 2FPMA 1F60A 1IOZA 4MA4A 3CKLA 2DYKA 1X3SA 2ZJOA 4CZ2A 3N5CA 4M1SA 5A5GA 2F55A 3FMOB 4B73A 3EA5A 1MKYA 2O8BB 2PZEA 4EPWA 3AUYA 2VHCA 4OHYA 3QBTA 4ZPXA 3H0KA 4TYYA 4L5BA 3BC1A 1XTJA 4JS0A 4KAXA 1UKEA 4M53A 3B2EA 1BS1A 4M1MA 4EPYA 2UZ3A 2IF2A 3F8TA 2XZLA 2WMOB 2YHSA 1E1RD 1NN0A 2H5EA 3D7MA 4JL5A 1DAFA 1K8RA 1R7RA 4C0JA 2WKQA 1W36B 2RGDA 2W2TA 4BWYA 5LPNA 1FMJA 2ZREA 3U60B 2AFHE 4HB2A 4IW3B 5EE1A 2PZFA 3OF5A 1ZUHA 1E94E 1Z0AA 4JYBA 2FV8A 4PAOA 1KMHA 3MGCA 4LHYA 4LK2A 3C8UA 4RFVA 1AS3A 1XEXA 1Z83A 2VP2A 1W36C 4LJ7A 1RZ3A 2PMKA 3SJAA 3SYNA 3KKPA 4ZCMA 4JJZA 4HEJA 4DLXA 1J8MF 5FOXA 1CS4C 2GCOB 1XP8A 1HV8A 2A5YB 1N25A 3CM0A 4PR0A 3NTUA 4Y0AA 4WW0A 2J0QA 2D4HA 3E2IA 2VP6A 1QHXA 2VHTA 3ZVLA 2GJAA 4YMWA 3D31A 5F2EA 1GKUB 5A4JA 5H70A 3T34A 5FR1A 2OBLA 3HU1A 1IN7A 2CK3A 2BV3A 2N42A 4US2R 3ZH9B 2KBEA 4GMDA 4M1WA 3FKSD 2IYTA 3GJXC 1IN8A 2B8TA 2XZPA 1Q57A 1E2HA 1T9HA 2L0XA 4JT4A 4F91B 1KNXA 4GZLA 4FW9A 3LXRA 4C7OA 1P2TA 5FL7A 3B82A 4Q4JB 3RRYA 4M9XA 2NO0A 2VP9A 3B1YA 3LLMA 5HCNA 2MSCB 5TY0A 1X8LA 4NBSA 2Z4RA 5KPJA 3TSOA 1W5TA 3TRFA 4A4DA 1E0SA 1GRNA 4AG5A 5JCZA 1EFUA 5KO2A 2QMOA 2WM9B 1AA9A 3WP0A 2EW1A 4TSFA 2MMGA 3NEYA 3RNLA 2H7VA 1HY3A 3MCAA 4HDCA 3RWMB 4DLUA 3A4NA 3T12A 2IXEA 1GUAA 1YR9A 3A1TA 1S1CA 1TU4A 4HZIA 1OB2A 3QXSA 1OIXA 1IXRC 1P75A 1DELA 2QPOA 4QBIA 3SR0A 2Q3HA 2XGJA 3THXB 3Q7QA 1G3IA 4MUAA 1ZW6A 3OIUA 4D0GA 2CCKA 4NYMQ 5K8UA 5CK4A 5DYIA 1Z08A 4DKXA 1ZM4A 1H8HA 4P32A 1CRPA 1KI3A 5UKDA 1AGRA 1Z22A 1NNEA 1SKQA 1Q22A 1E9AA 3HPQA 4RSGA 4B3BA 5JJLA 4BRUA 2O52A 4YXWA 2B7BA 3EPLA 4RD3A 5JECA 3KKNA 1E0AA 3VHXA 4DLTA 1Z07A 4K46A 1T91A 4OI2A 5IT5A 1GNRA 1KHTA 1XTKA 3NBFA 4GMXA 1XMJA 1Z06A 5J47A 1U98A 3AV0B 2ORIA 4A0GA 1P3JA 5FPKA 2GXQA 3R8FA 4X8HA 1S0UA 3K70D 4A0HA 1NKTA 1G4AE 2W6JA 3Q3JB 4XJXA 3SZRA 4CEJB 2GJ9A 2ODNA 3AF4A 4GNKA 3QBVA 4M1YA 4M21A 5DISB 5DYGA 2QL6A 4ZKDA 2FNAA 5FPHA 2R44A 2IS2A 1TTTA 3HP1A 2W0SA 1SKYB 3L43A 4MDFA 3PEUA 5EZ6B 1ZM9A 3I5XA 1KAOA 1TPZA 5AR1A 2GXUA 3VAAA 4A82A 4Q48A 4TL8A 1M74A 1XXHE 3BOSA 3DKVA 4TYQA 2JIZD 2QY9A 2CLSA 3FB4A 1G291 3HU2A 3LLUA 4JT2A 5FPYA 1WBDA 4KFTA 1Q0UA 4D81A 2NIPA 1XPOA 1E1QA 2ZAOA 1KZ7B 3W8RA 3KQLA 4JLPA 2QUZA 1ZUIA 1P6XA 1R8QA 2R6DA 4NU0A 2H17A 3ADCA 1J2JA 4JLOA 2HUPA 4DDTA 1GSIA 3B1XA 4E03A 3U61B 3A37A 3GEHA 4WZAE 1JPJA 2GAOA 3RS5A 2NOAA 3K1JA 2NZJA 2KJQA 2Q9AA 2ZS7A 1XFAA 4BECA 4XWOA 1KI8A 3PUZA 2ATVA 1NVUQ 1NF3A 3QXJA 4XTCS 3TAHA 3QI2A 2RGGA 1SULA 1XTRA 3L82B 2PJRA 3KQHA 3CPJB 2VHQA 1X8KA 1G19A 4ASUD 4NCNA 2GRJA 2CHVA 2CL0X 3KXKA 4YDSA 2PLRA 1EFRA 2VEDA 2PJZA 4A6XA 2RAPA 1KY2A 4H1VA 621PA 2FWRA 4C7OB 2QQ0A 1X86B 4HAUA 2PX3A 4UJ3A 2ZRLA 3VMFA 3P1JA 1A2BA 2H8KA 4OK3A 4QJ5A 1JQJC 3LQRA 1SVMA 5M04A 4ILEA 2H1LA 2JJ1D 4FCVA 3EWAA 5KSYA 2ZJ5A 4B48A 1O87A 2REOA 5K8IA 3GLHA 2QP9X 3NH9A 1D9XA 4URYR 1GKYA 2CK3D 2OCAA 2QM7A 4OJKA 1NP6A 4O25A 1YZNA 3QEOA 4NCJA 4EFLA 1N6OA 2BBSA 2IEYA 4DT1A 3UMRA 2Z0MA 2N1BA 5A0FA 5EE5B 1IBRA 4LHXA 5D3MA 2IT1A 4A8JA 3LH5A 4P4UA 4DLZA 3U44A 1NY6A 2GDJA 1OT3A 1GL7A 2KI5A 1OH6A 1SKYE 3K8YA 2NO1A 2Z4SA 2R8RA 5F98A 2NZ8A 2ZRNA 3VR4A 2CMKA 3BXZA 4NH0A 4D26A 3FYHA 4TLDA 2C03A 1D2MA 4P4TA 2E9SA 4TLAA 4OI0A 3ZQJA 5FR2A 1MO6A 4LHWA 3EZ2A 2QN6A 4RY2A 2YINC 4ZDIA 4NTZA 3CNLA 1ZINA 2A3RA 1OFIA 2ZE5A 5LB4A 4EFNA 3SQWA 2HLDA 4AKGA 3IGFA 2CXXA 2O0HA 2QP3A 3V4FA 4RZ2A 3T1VA 2FH5B 3GD7A 3PVSA 1XPUA 2QT0A 3NC1C 4BFZA 3C41J 5L3QB 1FZQA 1YKSA 2W2VA 2IK8A 4EIWA 1H8HD 4JLMA 3TJZA 2C95A 1AS0A 2AD5A 2WWYA 5FUWA 4D2IA 1XZQA 3V4RA 1T0HB 1Q44A 3H4MA 1UKZA 2ONKA 3RS7A 3B9PA 4BUJA 1WQ1R 4PSKA 1T4GA 1S9DA 4PHHA 2FSIA 1U9IC 2G88A 5SZKB 2G9NA 3CRRA 4LZZA 4P0TA 3QKSB 2JATA 4I1VA 821PA 4WZ6A 3DZ8A 3MWYW 4UJ5A 2BHRA 4TTRA 3U6BA 4IDQA 3MRSA 1Z5ZA 2J0VA 3B5JA 3LX8A 3AVUA 4GOKA 4NKRA 1JQLB 2CJWA 4GSYA 5AUNB 2QG6A 3ZVMA 4IHQA 5ELXA 4AKHA 3E70C 4TQUS 5G3YA 3B13B 3TH5A 2GF0A 5F9HA 2QSYA 1J8YF 2HCJB 1DEKA 1Y3AA 4QHSA 4Q01A 1D6JA 5EUQB 2OEPA 4JL6A 2XEXA 4KYIB 4TT3A 1E98A 4GOJA 4CEIA 1XF9A 4IFBA 5B2ZA 5JHHB 3AVOA 1CR4A 3BH0A 1FX0A 1E3MA 5CM9C 2QRZA 1VECA 2GF9A 3C16C 3WHKA 3LAWA 4RZUA 1KDRA 1XPRA 2XNSA 2UKDA 1OV4A 3EIHA 1G4UR 4QG7A 4RKEA 2QBYB 2IYYA 4YC7A 1U8AA 2IYQA 1VTKA 2R6CA 3I1FA 4AC9A 3QKTA 4AK9A 1UF9A 1M7HA 2HF9A 1L2TA 4TYPA 4Y0VA 1JB1A 2CLDX 2EU8A 1OIWA 4M9QA 2C04A 1GITA 3NHBA 4URUR 1XEWY 3GJ3A 1CU1A 1AGPA 5J4KA 3AM1A 4UXJA 1JBKA 4G5SA 1RE0A 4Q9IA 4HAXA 2ZRCA 4LV5B 4B3XA 2XXAA 3CW2A 4URZR 3MSXA 2QORA 3L0IB 4BPBA 2ZJ2A 1O3YA 1UJ2A 3KJEA 3M0EA 4ESHA 1NG1A 4GRAA 4JVLA 5EE3A 5FUYA 1AIPA 3IQXA 3S1AA 2VL7A 2GJSA 1LNZA 5DLQC 1SVLA 3R7WA 2WOOA 3AGPA 3U2QA 1E99A 1G17A 4OK5A 1PVOA 2QPAA 1M6NA 2AXNA 3Q85A 1WCV1 4JLVA 1F3OA 1YE8A 4JLDA 2IC5A 1GAJA 5G3ZA 2FOLA 3K0FB 2DFKB 4URVR 1P7CA 2DCUA 4RCZA 3WYGA 3VKHA 1DO0A 2RGBA 1GM5A 1G5PA 2FFHA 1Z3IX 5KOYA 3DOEA 4NMMA 1EFCA 4DBLC 1NRJB 3QKRB 2QU8A 3GJ4A 2J87A 1W0KD 5J40A 1KKMA 1VYUA 1B0UA 3EASA 1T8TA 2BCJQ 4JVMA 4CEHB 1E9BA 3AGQA 3ZDQA 1VG9B 4P4SA 1ESMA 3DZDA 5GJVC 3VU9A 1G1MA 2IHYA 3GEEA 4QGAA 1LVGA 1EESA 3H86A 4KBGA 4UQOA 3P32A 5CYOA 5HCIA 4KI0A 3W6PA 5GJCA 1ZIOA 2HJVA 1N0VC 2ZI4A 2C8VA 421PA 5JEDA 3GP8A 1N0UA 4F7WA 4DDVA 2BWJA 2F9MA 2RGNA 2ZRKA 5DN6A 3BB4A 3SHFA 1V5WA 2OLKA 2ZE6A 2ZR7A 4II7A 4I1OA 1DPFA 2GVZC 2OCPA 1OHHA 1XCPA 2FN4A 3I3SR 1OPXA 1KJZA 4IOMA 4S35A 1W46A 3AP2A 4TN1A 1T6NA 4HAWA 4Q4HA 4XSGA 3SEAA 3MFYA 1KGDA 5BWMA 3GLIA 5FBLB 2JCSA 2EYUA 5AK0A 5EP1A 1IAQA 1TEVA 5D3QA 2QGNA 1I2MA 1R0WA 1Z6XA 2HYDA 1R2QA 1QVAA 1XNJA 3BERA 3TKLA 2JLYA 3Q9LA 4GPTA 2OBMA 2ZU0C 3W9YA 1YZQA 1WB9A 4CEIB 1IJEA 3BGWA 3PCRB 3U3RA 1BO6A 2X2FA 4U5XA 2WWGA 3DM5A 3L2OB 1TQ4A 3HDTA 3KL4A 2Q9BA 5J4LA 1LF0A 3BWDD 4I1SA 3T5DA 3CONA 3R9WA 4HB0A 1G20E 1E0JA 2VLIA 3ETLA 4ARZB 3PEWA 1LY1A 4Z1MA 5BXQC 3ZLJA 3VX3A 4RFSA 4QBGB 4M1KA 5FOUA 1XJCA 5TB5A 1Z0KA 2QP4A 4GL2A 5KDLA 1XTIA 1QBKC 2J7KA 1IM2A 2AR7A 2QM8A 1U99A 4LJ6A 2Y8EA 4JBXA 4WXRA 2D62A 1CULC 1BYIA 3U4QA 1CJUC 1YQTA 1ONBA 1W0JA 3EXAA 1G7CA 4B6EA 5JCPA 1ZMXA 4G01B 3SOPA 4OJQA 5B30A 6Q21A 2O8EA 1U0LA 2IL1A 1VKJA 3EWSA 3V00A 5GJBA 3QKUA 2OSBA 4MGIR 3UMFA 4PQRA 3KUDA 1KO7A 5EXTA 1JXOA 2X1VA 1CJMA 1YHNA 5KYKA 1KI6B 3LV8A 2AX4A 4L16A 1ELOA 2AHOA 2O8BA 1LTQA 1G8FA 2GHIA 2OHFA 4RD0A 4DLWA 5LDDC 1Z6YA 2ZS9A 4ZDJA 4QGGA 4AKEA 1C9KA 5KU1A 4MRNA 5FTMA 1PV4A 5HE9A 3ECCA 3U6KA 5FOTA 1FPMA 5B64A 3O8CA 1AS2A 1ZD8A 4Q7LA 3PV0A 4O2RA 3CF2A 2G3YA 3RYTC 5K8LA 4TL6A 5KDOA 3IPYA 2ATXA 2A5JA 5CM8B 5J4VA 1AJEA 4K81B 2OT3B 4OQXA 3CWQA 4CDGA 1DE0A 2AXPA 1SHKA 4QOSA 4QXAA 4RVCA 2ZSDA 3HWSA 4P4SB 1XRJA 3OAAA 4Q1BA 1KOFA 2ZRJA 2XTZA 1PLJA 4XD7A 3RSLA 3FMFA 2JDIA 3MJRA 1YVDA 3TR0A 4Q7MB 1HEIA 3OEED 4F4IA 2VP4A 3MWKA 1JECA 1S1MA 5J5CA 4D0LB 1WE2A 2XOKD 1FTSA 1CJKC 4OQMA 3FHCB 5E4FA 1G3MA 1M7GA 4CIDA 3AF2A 1R0XA 1YRBA 3LDAA 4NCKA 2BBOA 1L4UA 1XD9A 2NTYC 2IYUA 4I99A 4Q4HB 2DB3A 5JJKA 2O0KA 4LSGA 2NGRA 1G5TA 1Z8FA 4BFXA 1UEJA 2CHQA 3HPRA 4E22A 1ZUNB 1U8ZA 2FEOA 4DCNA 4Q4JA 2QA5A 1KK2A 4DEXA 3NEJA 4MYHA 4LV8B 2REBA 1E2LA 2FZ4A 5DN6D 2ZXUA 1NY5A 2H92A 4B43A 5KPDA 2F7SA 4L15A 2IYLD 1Y63A 3ZQ6A 2W2XA 1P2VA 1HA3A 1MOZA 4R7ZA 4M1OA 2GEVA 4QL3A 1X1RA 2FDCA 4XTRA 3QVUA 3QVVA 4V0NA 1P9RA 3MAAC 4TQ9A 4EQ6B 1BMFA 3T06B 1KTVA 2W6ID 3LA6A 2VO1A 1ZIPA 3THXA 2MSDB 2PCLA 4QBFA 2QQEA 3BS4A 2B21A 4W5HA 2HXSA 4LPKA 1OXXK 3RC3A 1ZNXA 1CKEA 1E2KA 1E2NA 3IHLA 1S8FA 1XD2B 3HU3A 4BZPA 2QAJA 3KX2A 1GL9B 3EW9A 1IN6A 4V02A 4YONB 5K8TA 3W5JA 1NLZA 4OBEA 1E2MA 1NBMA 5E95A 3HR8A 2VSXA 1ZRHA 3OEHA 1N0WA 2F43B 4LJ4A 3P4XA 2VHJA 4TLEA 2WWIA 5IK2A 3TVTA 4Q9LA 2J59A 4MUBA 4BEBA 2IXFA 5CIWA 3TQFA 2ZUBA 2PEYA 2OM2A 4CEJA 1U90A 1TF5A 1XB2A 2F1JA 3SJCA 1OIVA 4PXAA 4Q1DA 4QHYA 5JI2E 3G0HA 1W0JD 1XTSA 1KJYA 3PXGA 3P26A 2ZPTX 4HLUC 2FZLA 4MKIA 3GLIE 3CO5A 3T15A 3CX6A 1NLFA 2IYWA 2KB0A 3NHAA 5SZJA 5JJIA 2AK3A 2P6UA 5E7IA 1Q1ZA 2OV2A 2XSZA 1R8SA 1E79D 2F3TA 3ZYCA 2OILA 2CE7A 2LKDA 4KBFA 4HSEA 4PO1A 3AVQA 4DXAA 5AUQA 3KQUA 2JLRA 1GRRA 4JBWA 4V0OA 1KO5A 4QJ4A 1YZGA 2V6JA 4C2UA 1QHNA 4P33A 1RRCA 4DVGA 5H1YA 1GFIA 5FOVA 2V3CC 1D2NA 5JLJA 1ZAKA 2EFCB 1KDTA 3K0EA 4HAVA 4O0MA 4TQAA 2OE2A 2ZR0A 3WYFA 3KB1A 3QF4B 2ONJA 4Q1FA 2OLJA 4ZDWA 2H16A 5ANRB 4DDWA 1R4AA 3CH4B 3RABA 1G8YA 2OO7A 3QEJA 1N6IA 721PA 3A4LA 3I8SA 1E6CA 1NL3A 3ZIAA 2PZGA 4B2LA 1N5IA 1UDWA 4Q7JB 2FPLA 1XWIA 1RRPA 2RH5A 3A1SA 3FKQA 2ZI5A 2FPKA 2BDTA 2G77B 1G7RA 1XMSA 3OAAD 3TW8B 3LXXA 1SVKA 2NO6A 3FMIA 4FMCB 1XEWX 4XD7D 3A1VA 2FSFA 3T1QA 2P6RA 5BN3A 1WP9A 1P72A 4JVSB 2ZRAA 1VMAA 2FGJA 4Q00A 3T61A 1CLUA 5EP2A 5AUPB 2C96A 4FMCF 1ZU4A 3W6NA 4ERNA 4MGKR 3RLFA 2MSEB 4GT1A 4PAMA 1CJTC 5C46F 1NKSA 3BORA 3OFNA 2B92A 3DMNA 4RD6A 5FPSA 1IJFA 1G6HA 4NHOA 1QG4A 1RRGA 2P5TB 4LOAA 4BFWA 4I81A 4LUCA 1DAMA 4DIEA 3ZD6A 1W5SA 2RHDA 1NVXQ 1BH2A 4V0KA 4RD4A 5DHAA 4IDNA 1NVVR 3FE2A 2C78A 1QHYA 3I73A 4YDHB 1NIPA 1E2GA 4A2QA 1G8HA 3EARA 4V0MA 4BFTA 2J41A 4QC2A 2G0TA 3T5GA 3CX7A 1JAHA 2VSOA 4OKSA 4C0BA 4PC1A 1K6MA 2R9VA 2ZVPX 3DVLA 3LBIA 5EE9A 1VIYA 1P62B 1ESNA 5G40A 1RJ9B 3KXIA 1E2QA 1EXMA 3A36A 1BMFD 4G3XA 5J4HA 1CR2A 3A58B 3THYB 2D7DA 4M8NE 3H84A 4DZZA 4BLSA 3CRMA 2B6HA 3GFOA 4MGZR 5L3QA 4MQBA 2KSQA 1U9IA 1TQDA 5AWFC 3W3ZB 2VIIA 2HXYA 2A78A 2JLZA 4HDQB 2WJHA 2CNWD 4R2HA 4ZKEA 4BE7B 4TTPA 4C4PA 2NPIA 4IDOA 2XNDA 1JJ7A 4D0NA 2GA8A 4B35A 3U5ZB 1QHHA 3SN6A 1BOFA 5GVSA 4MRVA 5FI1B 3AP1A 4NPHA 2Z5FA 2IUUA 3BB1A 2PBRA 2GEUA 4LGMA 2C5LA 2CDNA 2CL6X 2DR3A 1XBTA 2WVJA 3ADKA 3QKSA 3LBNA 3G5UA 1EX6A 1ZBDA 3LVRE 2WAXA 2D06A 2VP0A 3B1ZA 4JZKA 1E2EA 3GPLA 1F6BA 1LS6A 4CVNA 3C15C 1SVOA 2GXSA 4B6FA 3CH5A 1CP2A 3JVVA 2V54A 3B78A 1RPZA 3W8NA 2C9OA 1Z2AA 2D7CA 4QBHA 2A30A 4XVUA 4O3MA 1P4SA 3UKDA 2ZRDA 2QSZA 1TNDA 2XITA 2TMKA 3RS0A 2XSZD 4IDPA 1G7SA 4LPSA 3B8HA 1FP6A 2IXGA 3U3KA 1ETUA 1P5ZB 2HV8A 2V7QA 4GDFA 3NIBA 3ASZA 3BJIC 4CGZA 2BVNA 4DSOA 2JJ2A 2EWVA 4WZBE 1OLOA 5EE0A 4DIDA 1KSJA 3U7EB 3AUXA 2JLVA 3D8BA 4PFSA 2FE4A 3B1WA 2F1RA 4ZO4A 1SGWA 2DWQA 3EPJA 2QBYA 1E2PA 1Z0FA 2WV9A 3MUFA 4F93B 1DBSA 4PSAA 4AYXA 4KFRA 4KHZA 1NBME 3PJRA 1KI9A 4K8OA 1KSGA 1COWA 2WSSA 4AYWA 3ZIAD 3QIAA 1EWRA 4CF7A 3FPAA 4PC7A 1N5KA 3QXXA 4BEJA 2ZSAA 2KWIA 3UWKA 2V8OA 1G3UA 1BYUA 3KUCA 5IF9A 3Q5DA 1ZNYA 1RYFA 3SBDA 5FL7D 2ZE7A 4KFSA 3RHFA 2R6GA 2FX3A 2EFHB 4KV9A 3U7GA 1L4YA 3SNHA 1CR0A 5TVKA 2GESA 1LV7A 2F1HA 3BK7A 4XWAA 4BZQA 2RHMA 4UKDA 5DH9A 3WBKA 4TSFD 4Z51A 4IOLA 2IA5A 3OHMA 5P21A 4HUTA 1SHZA 4PPQA 3NVAA 3K0FA 1VHLA 5FTNA 3TQCA 4B3CA 4QFMA 2JLXA 3AKCA 2W00A 3Q5EA 4KJZA 3N2IA 5FUVA 5TXGA 2QPTA 3DM9B 3LY5A 4IVQA 3L0PA 1L7VC 3X1ZA 1WXQA 1HTWA 4C3ZA 3L0SA 4J0QA 1X6VA 2ZSBA 2WSMA 4DLSA 4A6PA 1Q1EA 2VBCA 1GZSA 3QKRA 5JWHA 4IEEA 3ZZTA 5JWRA 1J99A 1N5LA 4KITB 3VX4A 2VYFA 3BH7A 3SFZA 4ESVA 5HZHA 2HYIC 4CEHA 2OXRA 4I1UA 3WRXC 3CF6R 1AKEA 1CBUA 1UBCA 4HI0E 3RRNA 4YXWD 1U81A 2Q9CA 4RCYA 1Z0JA 2GCPA 2Q21A 1LB1B 1NVWQ 2BMEA 3WMEA 1TF7A 1KO4A 4EPVA 1N6NA 4EPXA 1QHHB 2O8DA 1T3HA 3ZS8A 4FIDA 2ZYTX 5SZIA 3WNDA 3QQ5A 4YMTA 1S2MA 1E9CA 1P60A 4R98A 2DY1A 3EA0A 4LHZA 3GMTA 4PZZA 1W4BA 4LJ8A 4LYJA 2W6JD 3REFA 4B2IA 3AVWA 1DS6A 1KKLA 1LF5A 1W49A 3LD9A 1J7KA 2GZDA 3IILA 1E69A 1EX7A 4FWIB 5C2JB 4WAUA 3VQTA 2AD1A 2IS6A 2RCNA 2YOGA 3RANA 4MYTA 4PZLA 3QXCA 1TQ6A 5JSZB 1AZTA 1FOEB 1F48A 1G3RA 1H8EA 4D82A 4HDOB 1G6OA 3CNNA 2IYSA 1E1QD 2KBFA 5CYPA 2LCFA 1VDZA 2YWHA 1TX4B 4L8GA 4JIMA 3B7GA 5FBVB 3ZVRA 3QXHA 1GKIA 3MWLA 1S4QA 1E2FA 2DBYA 1UDXA 3W34A 4UNRA 1JR3A 5LBIA 2UVQA 1DVRA 3KJHA 1G16A 3IO5A 4JLJA 4PO8A 4V0ME 4PHFA 3LO5A 5CLQA 2ZVQX 4TMZA 2ZRPA 4ARZA 3IEUA 4TL7A 2ZE8A 1A5TA 4XWKA 2G1KA 2OBNA 4Q7KA 2AWOA 3TMKA 1J90A 2QAGB 3B6EA 3DL0A 2ANBA 4LI0A 5KUTA 1U0JA 4UNSA 5JRJA 1QDEA 2V7QD 4MRPA 2BIFA 3NDPA 3F0TA 4BQSA 1EFRD 2WPDA 1KAGA 2ZJYA 1LW7A 1JEDA 4RD1A 3GLGB 2ZJBA 1FTNA 3MMPA 2PMDA 3NBXX 1HUQA 2P5SA 4N3NA 2QAGC 5H68A 4Q4LA 2N46A 4D6PA 3NDBB 1MH1A 1E4VA 2OXCA 1KI6A 2J9RA 4US1R 5KNCA 3EX7C 1W48A 1ODFA 2E87A 3ZGXA 1K5DA 1K5GA 3KKMA 1SXJB 3QG1A 3SC3A 3TR5A 1G8PA 3IIJA 4CRWB 4A1FA 1GILA 2AKAB 2YOFA 4MKFA 4Q5IA 4JYCA 1Z0IA 2HJGA 1NMZA 3CUEF 4IKEA 4BASA 4PC2A 3FDIA 1SXJC 1FNMA 1TF2A 2PEZA 2QTVB 2HEIA 2A5DA 1T5IA 1W2GA 4JSYA 4PQFA 1QZXA 3TUIC 5BW8A 5JS8A 2YC2C 1JXMA 1CR1A 2VPPA 3VTKA 3M4YA 3QY0A 2DWOA 1NN3A 3NBYC 4JVNA 4B44A 1G9XA 4Q1EA 1NIJA 5JRZA 4FCWA 4LDJA 4G5RA 4QHTA 5GJWC 4O2LA 2ODBA 2DFTA 5CJPA 4BFVA 1D9ZA 2O8DB 1D8TA 1FFHA 4UNNA 2HLDD 2Q3FA 1S3GA 2ZRHA 1T3LA 4KU4A 2BKEA 2ZYVX 3GJ0A 1U8YA 3PUYA 4PPNA 2GTPA 3THWB 3F3YA 2PCJA 1HE1C 3L0OA 2CBZA 1VCIA 3GJ7A 2RMKA 3NXSA 2QROA 4IVRA 1TMKA 4B76A 3BE4A 1ZCBA 3T1TA 5KSPA 2R65A 1ZJ6A 2WTUA 2JGNA 2QTFA 4HYYA 2EQBA 1DAEA 3N2EA 4Q9HA 1OH5A 2ASEA 1E2JA 2HDNB 2WJJA 3PQCA 3W90A 3UXMA 4IXMA 2XZOA 4HZUB 1II0A 3LQQA 2QNRA 2WOJA 4ZIRA 3HYTA 1R5BA 5C18A 2AL7A 4NYMR 1Q1QA 5DI3B 1HQCA 1YR7A 1MV5A 3GCGA 5LD2B 4QGFA 2DWPA 2FSHA 2QE7A 3QPWA 3QF7A 3CR8A 3IEVA 1IXSB 4TMXA 1E0KA 4KLZA 4C0KA 3ZD7A 4W9MC 3K0AA 1KK0A 1VG1A 1N6HA 2V1XA 4WA7A 4MDEA 4TWZA 1JR6A 4QNMA 5FTLA 5LD2C 4XIGS 1KSFX 2B8WA 1P73A 4W5WA 4KXFB 3CRW1 3OZXA 4CT5A 4EQ6A 1SXJE 3R9XA 2GCNA 1TUEA 2HT1A 3EPKA 4KSBA 2EFEB 4NYIQ 2QMHA 1H8ED 4TZ6A 1NJFA 1G8GA 4TT3D 1E9DA 2O8CB 4HUQB 2V4ZA 1QRAA 4UNQA 2IWRA 2GBLC 3GJ8A 5HZKA 4ABYA 3I92A 1IY1A 5FPTA 4WVFA 1M8PA 4DCSA 1RIFA 2JJ8A 4GP6A 2IEZA 2QEQA 1XD2A 5J4YA 1QHGA 3IKJA 1OW3B 3AKEA 5CDFE 1JI0A 1A7JA 2VRWA 2X2EA 5KSOA 1RVDA 2VTKA 4EAQA 3KTAB 3X1YA 2CHGA 2FSGA 4IVPA 3PUWA 4Q1CA 3DO6A 2WJIA 3CPEA 1KI1A 1KYIA 1IONA 3PEYA 1E9SA 3SJBA 2BMFA 2F43A 4PTLA 5FI0B 1G21E 4N0DA 1KMQA 5G41A 1CJVC 4MRRA 2FGKA 1LFDB 2ZRIA 2QGZA 2G6BA 3QG5A 2EWWA 2IYZA 2DPXA 5BN4A 4DLVA 1MT0A 2C9YA 4HLUA 4M2LA 1XD8A 2WHXA 2D3WA 2IBMA 4FMBB 1XMIA 3IO3A 4RD2A 5CK5A 3KFVA 1OB5A 3EAQA 5JS7A 2ZRGA 3AKYA 4FCTA 3BFKA 4B2PA 5CB6A 2V55B 4LYAA 4Z8YA 3GQBA 1TAGA 2F3RA 5FH9A 4LYFA 3ASYA 4AURA 2F1IA 3FHOA 1XTQA 1IY2A 2P67A 2WAYA 3NWJA 2P65A 2VQSA 1AZSC 2CEAA 5EXSA 2OFWA 4C0HA 1HQYE 5EXPA 3U3JA 1G41A 1G64A 3U3OA 1VPLA 1ZP6A 1U0HC 3AF1A 3ONWA 1EK0A 3ZVNA 5TMPA 4PQYA 3BAFA 2GNOA 2FF7A 4DJTA 2RB4A 2YOHA 3R9IA 3RS4A 3C14C 4BRWA 2XJ4A 3R8CA 3QF4A 3FMPB 1JR3E 2VHUA 3K0CC 4IDHA 4BGDA 521PA 3A8TA 1MR3F 2IYXA 3K09C 5TDHA 4AWXA 1XJQA 2A5GA 3VNUA 1OYWA 2IYRA 4BFYA 4NYJQ 3K9GA 3BRWD 4G5OA 3FKSA 4DRZA 4B3GA 2V6IA 1HH4A 2OAQ1 2ORWA 2XTMA 2JLWA 1G5RA 4R2IA 4ZIRB 2XAUA 1V43A 3X1WA 4LCBA 2ZU6A 1JJVA 2FJUA 1WBBA 4N1AA 2BEKA 1WRBA 3DEFA
chains in the Genus database with same CATH superfamily
4CU2A 2FR1A 5I9MA 2J3QA 1TJ5A 4ZC8A 3VVLA 3I1JA 4EEKA 1TVMA 2BTFP 3KE9A 1YC5A 4B7AA 2ORYA 2YZ7A 3H9UA 4L4RA 3TI7A 4NFHA 1ZTUA 4LRWA 1XI2A 2C94A 5ITZA 4BTVA 2B69A 3C39A 1SIOA 1Z6TA 4N7BA 2PFGA 2C29D 1Z7EA 1T0JB 1C3OB 4P5EA 5A5DA 1QNFA 3WB9A 2YWEA 1X1BA 1YVRA 5FO1A 5JW6A 4RJIA 4ZRRA 1D8AA 4JJIA 3TTTA 1YRAA 2GNXA 4B33A 1C9EA 2R87A 3NVKI 1XYYA 2O5VA 1P9WA 1MOSA 3HJHA 2V1AA 1Y9AA 3CS3A 1WZIA 3WMGA 3TGPA 4B5LA 4R4SA 3ASUA 2FPOA 1QR6A 3DQQA 4P31A 2WF9A 3K0SA 1ZLYA 4J07A 2CF6A 3CPTB 4JXXA 3KPJA 3TFWA 4JLBA 4EJSB 1YZYA 4PZPA 4JR0A 3IPRA 1OFHA 1II9A 3ZJ4A 2G06A 3ND6A 3WLIA 3AM3A 3WV5A 3H9EO 2XVXA 3BWMA 3WYEA 1N2CB 5LNK1 1SZJG 3NAMA 2C9DA 3T7RA 1W96A 3VYVA 2OV3A 3DVRX 2EFYA 1SBYA 4CKWB 2XDQA 5KDDA 3NDJA 5AHOA 1V41E 3I4FA 1YONA 2QF7A 4ZI3A 2PBZA 1Y3BE 2IH4A 2FUNB 2XNKA 1XVAA 3BH6A 4NEQA 1PR9A 2TSYB 4QM7A 2ZBVA 2JGEA 1OASA 4FGKA 3WBJA 4EHKA 1HURA 1PT6A 5HL1A 5HBRA 4S1NA 3PEVA 1Z6GA 1C7RA 1RC8A 4MR7A 2Z43A 1IEMA 1LTHR 3LRTA 4WY8A 3FYUA 5BSUA 5KKCA 4BZZA 1KYVA 1NUSA 1NNI1 3UN7A 1XUOA 1HDOA 2HRZA 1PUIA 2WQ6A 1DARA 3H8VA 3NTRA 2DJIA 3D6UA 4LRQA 4C7XA 5K0TA 2P08A 3T3HA 1JTVA 4IDCA 1COZA 4DF3A 2BRUC 5ED0A 2M6LA 1VBKA 4J29A 1WIWA 2C2KA 1QG2A 1L5MA 4JI0B 5JYOA 5AI5A 2BMJA 3IFSA 1ZM7A 2QPLA 2BKLA 3RF7A 4Q21A 2LKCA 2WAAA 3MTDA 2X19A 1DAIA 5JYBA 3T7SA 3V8PA 4TPKA 2PJUA 3THWA 3ZV5A 2BY4A 4HDAA 4ZEOA 2JL1A 1S4SA 3LP5A 4H1HA 3FPWA 2HBYA 3SHOA 2ECQA 3PYMA 3SYKA 4TN5A 3D64A 3U4DA 5DNEA 1NQAO 4Y6OA 3GGCA 1TVCA 1S6RA 4WN9A 4BLMA 2PGNA 4AF7A 5HAIA 5FTKA 2JJ2D 3ICEA 5KOJB 1PZXA 3E4DA 3BG5A 2ANCA 3IKVA 1XDBA 4DWJA 2CZQA 3C5EA 2C77A 1Q92A 3ZY4A 4AKTA 1JEEA 3PXDA 4U3TA 1E32A 3ZDCA 4WGGA 4XXHA 1SZDA 1D6MA 4UTXA 1RACA 5BR1A 3MWFA 1E3JA 3DDHA 1JDUA 3KZMA 1C3XA 1F8UA 4NATA 4QPJC 3C3KA 1SWWA 4FOPA 4ALJA 4D4LA 1EQUA 1YBAA 4OHPA 4XVRA 4QQRA 4NXNB 4Q9AA 1I6MA 2JLUA 2K2WA 3H5AA 4WX2B 2JE5A 4OSOA 2WJGA 2HXGA 1T1EA 1UCFA 2BASA 2O7RA 2OAP1 3MJVA 1P7ZA 4EGSA 3ZK9A 2Z4TA 3RIYA 3UO8B 4FOOA 4PX2A 3D3EA 2HHHB 1IUOA 3NHJA 4C30A 1RABA 1IATA 1JVSA 3EIQA 3HDJA 2V7GA 4QVIA 2VDQB 3LYLA 2VUHB 2OQVA 3IHWA 3D3KA 4B7ZA 5KYUA 5CHEA 2C2GA 3MMZA 4OONA 4P87A 3OZDA 5AJTA 3LIBA 1IN4A 3NV9A 4HMPA 5EQJB 3S2ZA 4WE3A 1L5HA 4NDNE 3Q1LA 4UOEA 1IXZA 4H0CA 3DZIA 1SEVA 5FOSA 3SZMA 1NUAA 2ZJ6A 3O9VA 4A26A 2VSFA 3CRQA 3QZUA 5AXAA 4EV4A 2PD7A 4HH2A 2V9ZA 5EVIA 3OJOA 5EIOA 2O4CA 1M0EA 1F2UA 4ZOAA 5DO9A 3DB2A 1UMBA 1IOLA 5JHGB 4LXUA 3E22B 1NZOA 1WW2A 4YHBA 3MYYA 2HPAA 1FQGA 3VXKA 5I8ZA 1V1JA 2JF0A 2HLNA 2CSXA 4ER5A 2DFLA 1QIDA 1W8QA 3O8OB 5HIKA 1YMUA 3Q6NA 2QVBA 4DHEA 4FFLA 4QJBA 2DFDA 3LM8A 5IDXA 2VF2A 2YV2A 4J2HA 4O4LB 3DLTA 1B14A 2CLHB 4KMOA 4BX2A 4NOKA 3UWOA 5KS2A 3D4IA 3AP3A 4M0KA 4DJEC 4QUGA 3WNBA 1NY0A 3B33A 1W5BA 1BLSA 3KO8A 4PFQA 1SXGA 4C7VA 2O9CA 2OUKA 1AA6A 3V67A 4G0OA 5F7ZA 3N2NA 1L0FA 3N5CA 3U56A 3FMOB 2ZSIA 4BMXA 2PZEA 3QBTA 4LQ4A 1M6YA 4IF4A 1MB0A 3FNGA 2RI1A 4XCQA 1JVBA 4OH7A 1HYEA 2IX9A 4JL5A 4C0JA 1SY7A 1FMJA 1W4LA 3OTIA 2G28A 2CNKA 4HB2A 2PZFA 2G7UA 5I7EA 3KL2A 2ON6A 3SJAA 2R84A 5FOXA 4ZAMA 2C54A 2I2CA 1YD7A 3NALA 3U0BA 4YMWA 4ZJZA 3E3NA 2IOFA 5H70A 4B7CA 5BVGB 2WUWE 4I3GA 3G4PA 4M1WA 1IN8A 3WZMA 4BVHA 4ZMSA 1C1HA 2UYYA 4JT4A 5IJXA 2VK2A 4E2WA 2HGZA 4NECA 4AICA 1W87A 3COYA 2XGOA 2MSCB 1TB4A 1RXEA 1WVGA 2QD3A 2YTZA 4TSFA 3PFKA 5CPFA 2G7MC 3EVNA 4O8ZA 1AD2A 3T12A 1QS0B 4F5ZA 3L8FA 3ZXIA 3TMYA 2Q3HA 2CCKA 1ZJ4A 2BFDA 2XSSA 1SKQA 5LP1A 5T3YA 3NAQA 3EPLA 3KKNA 1E0AA 1BQEA 3E5NA 3VHXA 1YI0A 3HEBA 5CVJA 3PHBE 3GH3A 4OB7A 4BBPA 5J47A 5FPKA 3K70D 5ALVA 2AFVA 5FHRA 1G4AE 2W6JA 3Q3JB 4MS4A 4M21A 3SYMA 4P83A 1GQSA 1M72A 4JOSA 1TPZA 2GXUA 4A82A 4LCEA 1GSVA 3HU2A 3OFKA 3AJ9A 1FUEA 1J49A 2WZXA 1WXGA 2ZT6A 2NOAA 5EI5A 1R4NA 2YHUA 1YQDA 1SK8A 3ZI4A 2CHEA 1JFFA 2XA2A 4J90A 3QI2A 4CKBB 5CCEA 3L07A 2QQ0A 4UJ3A 1P2FA 4Q39A 4PM7A 1P0MA 1CY1A 1Y8RB 5EJ7A 1LK0A 2FZWA 5K8IA 5FEMA 2QP9X 3EIFA 1NFRA 2IZOA 1RWMA 3IAUA 4WPGA 2QZZA 4DLPA 4F06A 3A6DA 3ZWWA 2GDJA 2WZBA 1ADFA 2H28A 3GZJA 2IZZA 4YGYA 4D26A 3IV9A 4LHWA 3LF2A 1L7OA 2O2CA 1HSOA 4DY4A 5MFZA 2Y59A 4YI5A 2OGTA 4W5OA 1TT7A 1STZA 4EIWA 1NXWA 3TJZA 1MA3A 1G5UA 2AD5A 4F3LB 3X2EA 1KMIY 4JXSA 1RQXA 4PE5B 2PS1A 3RYFB 3GRAA 5H0IA 2L0WA 2R60A 1WDKA 3OX2A 3EXFB 3WS2A 4MCIA 4UJ5A 4B09A 2P27A 2WJPA 1HORA 5SY9A 5AUNB 2RHGB 3VU3A 5G3YA 5EIEA 4HNGA 4TYMA 5B36A 5DNDA 4KYIB 3I53A 4CEIA 1E3MA 5CM9C 4F71A 3DCNA 2UKDA 4PAGA 2YZNA 4JEIA 1QHEA 1L2TA 1DKOA 1GITA 3NHBA 2PMCA 1R8YA 2DPYA 1EEHA 2JGDA 2W42A 1FS5A 4YFMA 1O3YA 4U7WA 3F1NB 4EGFA 2VPYA 5EE3A 2GJSA 1SVLA 3K5WA 4ZQEA 3KZOA 4O4HF 1G17A 4JF5A 3FI0A 4RUKA 1ICIA 4BB0A 2Y2OA 1ZIXA 4KXYA 4DBLC 5B3JA 3KZKA 3O38A 4DN0A 2QNIA 4HLNA 3GJ4A 1DWOA 1EXDA 3B2NA 3PAEA 3IHBA 4BX3A 4MQFA 3ZEIA 4KXNA 4D60A 3GEEA 2BCEA 3TPCA 3DZGA 5GJCA 5JNWA 2BWJA 1Z56C 5CFPA 4CLCA 2ZTHA 1K57A 1R0LA 2VAVA 2BONA 4Y2VA 2EBHX 3ML1A 4YCSA 1DKNA 3GVXA 1JXQA 3OE4A 1BGWA 2QGNA 2HYDA 3IERA 3DS8A 4LTDA 1QPBA 3H7IA 4QWMA 4U5XA 2W3HA 1X15A 4F9FA 1ATZA 3T5DA 3CONA 2WMYA 3VX3A 1N9GB 1U04A 5FOUA 2XA9A 2OB2A 2J6CA 2JD0A 4GL2A 3KUXA 4R6LA 3OPQA 2ZTUA 2YWJA 1FLDA 5GONB 3DTYA 2VPWA 5F5XA 4UU0A 2FW6A 3UMFA 4U2EA 2PXHA 2R8XA 4L16A 5CUQA 2PX5A 5M5BA 1CQIA 1LTQA 2NUTA 5A06A 1U2QA 3UTDA 4PXSA 3MB8A 2ABWA 4NESA 4BMYA 1P80A 1MZUA 2ZXFA 4TL6A 4F84A 4CDGA 3GYBA 5AI6A 2NYRA 5JSYA 5C8YB 3HWSA 4HJ3A 1ZK2A 2I8AA 4TUYA 5KINB 1ND5A 4RHEA 3V7YA 4OHMA 1ICEA 4FZ3A 4GPAA 4X3PA 4KV7A 1QJ4A 1JJAA 4BOYA 1G5TA 3PLNA 1N33B 4DCNA 4ITVA 4RHFA 5JADA 2AF3C 1PS8A 3ZQ6A 2ZBFA 1Y5MA 3I37X 1VXOA 3U49A 3QVVA 4HBTA 2EG9A 2RHOA 5IFKA 3THXA 3FTDA 2H2FA 3W2GA 3BS4A 3HCNA 4IJUA 4MUIA 2Y2LA 4LPKA 4EYSA 1IZ9A 4TWRA 3AUSA 2UU9B 4W1RA 1KFKB 2P11A 3FCUB 1XN4A 2HDQA 5IK2A 2H1HA 3IVMA 5BN4B 3BCRA 5A9RA 3AESB 1TKBA 5DM0A 1FTQA 3P01A 1ZK0A 3NHAA 3PZBA 1PGJA 1P6QA 3O5YA 3TINA 1E79D 1U0NA 2F3TA 4TKVA 4UULA 5AUQA 1H42A 2JLRA 1JDBB 4P33A 2QKYA 3UPOA 4F56A 3CH4B 2I7DA 5HZGA 1N5IA 3NUZA 4DZRA 1Y54A 2RH5A 3A1SA 4HYTA 2FN9A 2G77B 4RMIA 4EFDA 1G7RA 5I7UA 5T8KA 1D6SA 1M1ZA 4XD7D 2Q9UA 1VMAA 2FGJA 1N9BA 3CLRD 2PH5A 2X5JO 1V8ZA 1ZU4A 4A27A 2QG4A 1NWCA 2XE7A 1WHSB 2VZLA 5C1OA 1JTDA 3JASA 8ABPA 1P9OA 4QD4A 2BUAA 4D9MA 3MINA 4R40A 1IZZA 3JQ9C 3CINA 3DKKA 3AFMA 4V0MA 3UHJA 3Q1FA 2G0TA 1Q2UA 4I08A 4PC1A 2XBMA 1XAJA 3H8SA 3SDBA 3A6GA 4FUQA 3LUDA 2GFQA 4QYTA 3AKZA 5EMLA 2J67A 2ZYDA 3F49S 3M1AA 4YB8A 4BLSA 2DR2A 1TQDA 1XA0A 2LB5A 1AHNA 2J9XB 4JLFA 4YT2A 1JSLA 2XMBA 1ZAYA 4HGOA 2Z5FA 3C70A 1JG7A 2WAXA 4MKZA 4R6XA 3VU1A 1SD1A 4B3SB 2YWCA 4KPUA 4QAQA 3D4FA 4EHBA 3UAYA 2D7CA 4YROA 2A30A 5AVZA 1VE6A 3V8NA 4X20B 3C3WA 1G8MA 3MS2A 2R00A 2HV8A 3COSA 3VMMA 2A86A 4MVJI 1GPNA 1T9GR 2IA2A 3EPJA 5K05A 3IODA 2P35A 1E2PA 4UVGA 3TFOA 1DBSA 3PLAE 4QECA 3BJMA 4AYWA 1CV2A 4KWTA 3O8LA 3PUHA 4MVJM 1ZNYA 5KYXB 4LDRA 3E98A 4NKPA 3U7QB 5CDHA 1L9XA 4BZQA 2H0AA 1RGZA 3H1FA 2EX2A 4A8TA 5FTNA 4J16C 4W6ZA 1IZYA 4B6GA 2QVLA 4YI3A 3HBRA 4I9HA 3D7SA 1A9YA 4S2KA 3AR5A 1FDVA 3GAMA 2GCPA 4FTXA 3DO8A 1RMTA 2HA2A 2GR9A 4LJ8A 3M2KA 1KAEA 5C31A 1KKLA 1TLTA 1Z8DA 3HWX1 3HGTA 5J59A 4K26A 3O87A 2AD1A 2W2LD 5LUBA 4KG7A 4REQA 4P3NA 4JGIA 1SU7A 4NZZA 5CYPA 2LCFA 4EO9A 2CHFA 4LV2A 3OZCA 4LPZA 3LO5A 3HL9A 1WTAA 4RIGA 5CT8A 2J5KA 3DV2A 4ZOLB 1T15A 1C9NA 1Z6PA 2JCVA 5EQDA 4BQSA 3PQ3A 4Y13A 5TX7A 2ZJBA 1OVMA 2DE0X 4KXMA 1GHMA 4JH0A 1C30A 3OLZA 3QY9A 3IUMA 2DCFA 4QODA 1IJBA 5BQ3A 5AMXA 2YOFA 1FNMA 3P97A 1UANA 2EGHA 4QX6A 3OU2A 3MWDA 2DFTA 2FZCA 4LRYC 1S3GA 4KU4A 3G1TA 1L4NA 4E46A 5BN5B 2CLEB 1QH8A 2QROA 1TMKA 4U2BA 1QU3A 1MVNA 3ZWPA 5EJ5A 1WB6A 3EXG1 4ZQBA 1T2UA 5D1NA 1P1KA 4CN9A 1BW9B 3BFJA 3OTWA 1S2NA 4XM2A 1GCOA 5DHSA 3BIOA 1O54A 3QPWA 3IEVA 4E4RA 4MPTA 1HZJA 1ST2A 2XCRB 1WJGA 1VMDA 3D54D 3IP6A 4MEZA 2NVBA 3W2FA 1ZFNA 2IEAA 4FU0A 1QJCA 9LDTA 1XHFA 4WVFA 4D02A 1JI0A 2FSGA 4IVPA 2NUPA 3L7NA 5HQ3A 3AERA 1IDOA 1PFKA 2MJLA 2FGKA 1LFDB 2JFWA 4U0KA 2FCAA 2W4MA 2O1SA 4ECAA 1JHYA 1TAGA 4KQIA 4UVEA 4RZIA 4NI5A 5U9CA 1G64A 4YJFA 1VRVA 1CZRA 3AF1A 5JAZA 4D7AA 3RS4A 1LRLA 4X1YA 3S81A 5CXUA 4W9NC 3IAXA 3QF4A 521PA 3FAZA 2PKYX 4IHKA 2D00A 1MR3F 3K09C 4AWXA 2CFIA 1J21A 3URKA 4Z1WA 2XAUA 4XEHA 2QL7A 3LPNA 2J3TC 5EJIA 3EAGA 1MWTA 1PK9A 1OHHD 3EDQA 5D85A 1T6BY 3L8ZA 4KVZA 4TLBA 4HAYA 4BJHB 1OZHA 1Z0DA 3VMAA 2J3LA 3B3XA 4LBYA 5EYPA 1UDAA 4KX3A 3LWNA 3EVZA 3WKAA 3HVJA 4KLAA 3V4SA 1DOAA 3HSSA 3ZWDA 3JALB 1P0PA 2CVHA 2P0YA 4EBLA 1UEIA 3VDNB 1OXUA 2Z6AA 2F3UA 1EHCA 4O2AF 1KIFA 3VHRA 2CFSA 1VJCA 4QT4A 3OFSA 1MHTA 1JL3A 3A6PC 3EZ9A 1G63A 1AKQA 1Y4DE 1P2SA 1IHXA 2D1TA 2Z3WA 4IXNA 5FWXB 3P19A 1YTLA 5CT4A 4BEWA 2FX5A 5DHFA 1HSZA 3EVDA 1GR1A 4S2MA 2DLNA 3G6WA 2HUNA 4LFCB 2GKGA 3ON5A 4IIJF 1ZMBA 4HVCA 4HX5A 4G5YA 4UBLA 1MB3A 3AH8A 5M34A 2G2WA 1YR6A 4JF4A 4F86A 3NULA 3WQQA 1QTNA 4B7UA 2WWXA 4OXKA 3EVBA 4I36A 2QTAA 1PQYA 2VXYA 5JFTA 5IEBA 2O3TA 2OXEA 2I9VA 1NPYA 3VH3A 1AKVA 5F9MA 3GZTB 3VSCA 5BW4A 4NK4A 5ESDA 1X94A 5DHTA 5KVQA 1FUIA 2HW8A 5ICFA 3LNTA 2MYPA 1YM1A 3TUZC 5JS2A 3DD1A 3OCWA 4NCXA 4HB3A 4AS1A 3R3XA 1YRLA 3EMBA 1PIWA 3OEHD 3SY8A 3F97A 2NNWB 3RS3A 2BD0A 3VTAA 1J56A 1QMPA 2AQHA 3IAFA 4ZODA 3UWSA 4AB1A 3LZCA 4XUZA 4FD2A 4WCFA 1G6AA 1K9SA 1H5XA 2UUAB 2H6EA 1QORA 3ZOZA 3LY4A 2ZXUA 3LUGA 3DMTC 2W2KB 3IL2A 4L6AA 3OE1A 1C4OA 3BXHA 4HN2A 1ZC3A 2CW5A 3KZCA 4PMAA 2ORED 5EKTA 2NT3A 3NNDA 3TXAA 1GQOA 2B3TA 2CVQA 5DGXA 1MP0A 3O5AA 4TSRA 3CLVA 2GK7A 4EETB 1RKBA 1V4NA 3EZFA 2H59A 3V9AA 1VJ0A 1QH1B 4KNWA 4IGFA 4OHUA 1SKOA 1UFQA 3CTMA 1YSPA 1DX9A 2DMRA 2NPFA 4X41A 2Z83A 3GJTA 2EEPA 1RI5A 1VP3A 2Y0EA 3PXBA 3NUGA 1PNOA 5JAMA 5J3JA 5IAEA 4CYMA 5AQ1A 1DADA 3JXEA 2C4TA 1RP7A 2ZC4B 2Y2KA 1ZA1A 3V8EA 1QFJA 3WXMA 3HRHA 4ZTKA 1YDGA 3GH1A 4PAWA 5AH0A 4KVGA 3U7FB 4KR7A 4POAA 4N92A 4F5WA 3LICA 4LRXA 4Z4QA 1N1GA 2UV0E 2C5FA 1I14A 3TKAA 3SW1A 5IVKA 1JALA 1QCYA 4U2CA 4F9TA 2YC4C 5IDWA 1ZGJA 1HDIA 2PO5A 5JBNA 4R2LA 2DOKA 2AJBA 1JXAA 3RADC 1UM9A 1L8AA 3ZX4A 4OLAA 4GBJA 5IDVA 2ZYUX 2XT9A 2BH2A 4TT8A 3EPHA 4FN5A 4BN5A 4RY0A 2JEOA 1XQVA 1P6UA 1YMQA 2JZNA 3TSWA 4FJ2A 3ZDYB 4G0NA 1XJ6A 3KZNA 4GR9A 4Z86A 1KEKA 2VDOB 2B4AA 2WGWA 2R1TA 5HR5A 1SQ5A 1K8YB 3OF3A 4OYHA 2ZTLA 1F7VA 2R7AA 3W06A 4YWZA 3KQNA 4G4GA 2Q99A 5DIFA 2ZUDA 4M38A 3L93A 1PZFA 3QWBA 5BWLA 4L6CA 3QPUA 4BBVA 1ZH6A 4ZAXA 3ZZ0A 1DAGA 4GGOA 3MWGA 1TLFA 3MLEA 4LY9A 1L5GB 2WVHA 3F4KA 1VCOA 2O06A 1WL8A 4Q19A 1M1YE 4AU1A 4YJ3B 3VTFA 3H99A 4DMHA 4KGZA 2J7PD 1L1RA 5E2AA 1N1MA 4AG6A 1NWHA 2YYYA 3O8BA 3PXPA 4YRFA 3LOPA 3NTXA 2PQMA 3RBVA 1W88B 3B8EA 2IV2X 1N36B 4EBNA 4IQFA 2HIAA 2J0UA 2B2CA 1SELA 1G38A 5CX1B 4LVNA 1FLAA 3F6YA 4KREA 4UM5A 1GTVA 3MNFA 2UZAA 3STWA 3O8DA 3A2KA 5BVHA 1IMJA 1S2LA 5KHAA 4HDNA 1XJ0A 2BGMA 1GU7A 2OECA 3C7TA 3D3JA 1BXRB 2RKOA 1EVZA 1V1RB 3FGPA 4BBUA 1UKYA 3FFBA 1GRQA 1VBMA 3P27A 5FAOA 3FF1A 1E3TA 2ZITA 2LB9A 4NG5A 2V03A 4AJ1A 1RKUA 5I9IA 3X2SA 3CPHA 5LNK6 5IBRA 1Y82A 4NMWA 2QPNA 1LPPA 3VR5H 5H4GA 3GFQA 2PRYA 3N9IA 3GLIB 2GYYA 4R4JA 5ARCA 1XZFA 3ESDA 1JFVA 4ZJ3A 4ZAWA 3ZHXA 4C6YA 2YQ5A 1V9CA 1FF9A 4OQDA 5C4GB 1RM0A 4E4TA 1J1UA 3FC7A 3U9TA 3LFVA 4HF7A 5K6RA 5EINA 2FSPA 5AVFA 3N70A 1L8QA 2W8ZA 4JGOA 3WK4A 4JLKA 2Y1EA 3VR6A 1ZK4A 4S3MA 3JPWA 5EPHA 2X41A 1UK7A 2FJ0A 5C51B 4EPWA 2VHCA 1A8PA 3UY4A 1UINA 3B2EA 3DBOB 3FJYA 3N39C 1REQB 3C1AA 2OORC 2QD1A 6LDHA 5FOQA 1YAJA 3U60B 4KJXA 4IW3B 4PM4A 2VP2A 2YJ6A 1NBIA 4LJ7A 1Q7CA 4YALA 2RHCA 4JJZA 4HEJA 3OJLA 3L3BA 5DLEA 5LKRA 2Y6UA 1JQBA 1KPHA 4I50A 1Z5UA 3D31A 4GH5A 4BDTA 2LE0A 5HAQA 2RHLA 4US2R 2GRUA 4F91B 3AC0A 1G6Q1 1P2TA 3RRYA 4M9XA 4L22A 1C8LA 5BUSA 4FZ5A 2CLKB 5A7HA 3WGQA 1OC2A 1RXIA 3WP0A 5HJ5A 5TGZA 1M8JA 2BR5A 4L2IB 5JC8A 3DTKA 5IU6A 1M6VB 3NJ4A 4EHNA 1IXRC 4QEZA 3LMKA 4K1XA 1WUYA 1TT5A 1IBLB 4PBRA 1H8HA 1CRPA 2H3HA 3K16A 2SCUA 4FQ8A 4RW0A 2W11A 1T1BA 4PZ9A 1KZYC 1FNSA 4UBKA 4G9GA 2EJWA 1OY1A 5DYGA 4XWTA 4UA9A 1MQ9A 1MPTA 5LU8A 3L43A 1E3IA 4KPFC 1JJFA 3LDHA 1NP7A 4Q48A 3BOSA 4F72A 3V1YA 1WBDA 1MX3A 1ES3A 1CUGA 1P4JA 3ELYA 4D81A 1XPOA 1E1QA 2WJ6A 1N2SA 3L0BA 2JIBA 1TMOA 2Q7OE 4LF5B 4QLOA 4FKMA 2QLTA 1FNCA 3PUZA 1IY9A 4IRXA 3K8QA 2W3DA 4L8YA 1Q6YA 4NCNA 1EFRA 5KJCA 2RAPA 2OHVA 1SVMA 2H1LA 2WR8A 3QKIA 4TV9F 1BHSA 3NH9A 1T9BA 1AKNA 1FYXA 4REOA 5J2UB 4FR0A 4R0MA 2VJMA 4F6RA 4A8JA 4C6TB 3M9XA 3H9JA 4DLZA 1UXKA 5IHXA 2WJAA 3H97A 1RYYA 2IPOA 5BWBA 3NPMA 4FKZA 5C80A 1C5KA 2D6FA 1ZINA 4OOMA 1MJ5A 3ZGNA 2WE7A 3NC1C 5L3QB 5KC9A 4PNZA 3NBAA 2KX6A 2A1IA 5KQPA 5FUWA 1Q2QA 4DA6A 2X7XA 4DIKA 3PC8C 4MJLA 4E2ZA 1YU6A 2XRYA 4PHHA 1U1GA 1L5KA 1VFPA 4FGLA 4PKYA 5CAEB 2QTWB 2EFXA 3FAKA 3WOHA 3E70C 3ET5A 1Z39A 3NHPA 2GF0A 2QSYA 1J8YF 4E1BA 5EUQB 3BGDA 1JEJA 2C3MA 2B0CA 2IU0A 4HMOA 1RPTA 2HIHA 1G5QA 3LQKA 1GPH1 4GPZA 5ILOA 2BTEA 1NULA 2CLDX 4TTTS 3DTMA 1CR6A 4ZHQB 1QMFA 4S1WA 3USZA 2G1PA 4UCXA 2ZJ2A 2BN4A 5JRDS 4QTXA 3P71T 2P6OA 4JI5B 4AJ4A 1L3BA 2XQZA 4U5QA 1C41A 5F7JA 5B12A 5G3ZA 1P7CA 2ZWOA 3K6KA 1V8FA 1UBJS 1E6WA 1VYUA 4FILA 3UMMA 1KYTA 4KBGA 4MV9A 2AYXA 4PX5A 1I7DA 3EPRA 3X3HA 4K1LA 3BB4A 2MSKA 5CRIA 3JATA 5DBEX 4DMMA 1CYEA 3VP0A 3PKJA 1YE5A 4PIVA 4C4ZA 2Y2VA 3MK31 2ZPUA 4MO9A 1Z6XA 3SIXA 1E8NA 4K9LA 4YS6A 3TDNA 3MGBA 1WZ2A 2WWGA 2W70A 5JQGF 2H52A 1TQ4A 4UBNA 4DMGA 4MVJA 4LXGA 1BMQA 3OWOA 2RHBA 4M1KA 3ND7A 3P9QA 1QBKC 3L5OA 1KVSA 1FQWA 1BYIA 3Q07A 2WHQA 4G01B 2RGUA 2X1VA 1K25A 5C52B 1X19A 1Y4UA 4YNBA 3IUNA 4CPKA 1QRTA 4RYLA 2VDRB 2JKVA 2SKCA 2OP0A 2LCIA 4MQ6A 1UXJA 5MFPA 5K3SA 3BMNB 4OA8A 4O2RA 1OTXA 4LSMA 2Q2OA 1G8JA 3CLUD 1RSZA 3CSUA 2VJKA 3AXSA 3PBKA 4WOJA 3RVQA 3OAAA 1VE1A 5JSHA 1NZJA 4Q7MB 3S5UA 3QITA 5J5CA 3SKXA 1ZRNA 3V3RA 5IU1A 1RD4A 1Y7IA 3DR5A 1RI2A 1TJYA 1H5UA 1KYQA 4C20A 3HL0A 4RJKA 2H31A 3L06A 1KRWA 3U4CA 1YAXA 1ESZA 3PWTA 4PZAA 1P2VA 4JFAA 1L5LA 4GDNA 3QVUA 4V0NA 1EMDA 1ISMA 3UBTA 1UXOA 2B21A 1AXBA 3EPPA 3IMEA 5AW4A 1WXWA 4P9NA 4YP9A 4MWCA 3A3NA 1NBMA 1O95A 2W2PA 1ISSA 3G2NA 1A9TA 3HBJA 2F43B 4TLEA 5I7VA 3RS8A 2W1TB 3IP1A 3GR6A 3M2JA 5HKLA 2X6RA 1U90A 3UK2A 5IANA 1YJ8A 1E7WA 5HMLA 1X8XA 1KQ3A 2I29A 3RS9A 3EGCA 3ANLA 1YSCA 3M4XA 4KBFA 1GRRA 4B82A 3ULFA 4BB6A 1A8SA 3PNBA 2YX1A 2VF4X 2YUIA 2GPTA 4ESOA 2P9HA 4OYRA 3ROKA 4XWWA 1E6CA 3ZDAA 1XWIA 3RH8B 2C7BA 3P0IA 3NHMA 4PG6A 4ZK2A 1YMVA 5I4BA 2DC1A 2ZRAA 4WRRA 2BDUA 1R12A 5KNBD 1BSGA 5DZSA 2VYCA 4O2BF 3UJBA 3OFNA 4GOGA 1LLCA 4NHOA 5EESA 1QG4A 2W48A 2RHDA 1PZMA 3AFNA 1Z73A 1D04A 1NVVR 2GD0A 3KUKA 3MHTA 3I1IA 3WLSA 5C8XA 3FLMA 2QL9A 1HL3A 2Q0QA 1BMFD 5LA6B 3TQOA 4DLLA 1NUQA 2D7DA 2WJWA 2A9PA 3R0XA 1RCJA 5L09A 5CG1A 2VIIA 1ZLXA 1XQWA 1MGOA 4L5YA 2XY4A 3PR6A 2C4WA 5G4LA 3HEAA 1TCCA 3KVOA 4RPKA 1BX3A 5KAMA 4XIFA 2OQRA 3TD6A 2OFFA 3B1ZA 1KOJA 3ZZ1A 1YDHA 3LQFA 4ZEMA 2Y05A 2Y77A 4MTLA 1X0XA 2JFGA 1NAHA 1FP6A 4R84A 4D3DA 4CKZA 5D00A 4NR0A 4WZBE 5EE0A 3OZAA 2FE4A 1DX6A 3MUFA 3ZK8A 4KHZA 1L5VA 3PJRA 2BMVA 4GD3Q 1EWRA 2ZSAA 2CDRA 2CVZA 3WGOA 4A8HA 1RYFA 3SBDA 5FL7D 4D3YA 1J0CA 2FX3A 4EB3A 1YBFA 4RXMA 4IIVA 4MW9A 4IX1A 5JDIC 5TF0A 1SCQA 3CW9A 1GSWA 3NBUA 3AKCA 5EFZA 4KJZA 5FUVA 5DHRA 3SC4A 3EHEA 4DG9A 2GUWA 3QVSA 1NR5A 1TA0A 1J99A 4KITB 4CEHA 1GD1O 1UBCA 4YRNA 4IDDA 5K3AA 4OXNA 5E4JA 4BWIA 2XLCA 4P86A 1T3HA 3ZS8A 5SZIA 2GEKA 1P4RA 2JI7A 1SUIA 4D8VA 5LWHA 5LQNA 1BCSB 4EW6A 4D9HA 3UPDA 3LUAA 4NU5A 2AZTA 3M6LA 1IPFA 3CZ4A 1GUBA 4WEKA 1SUAA 5JSZB 2I3AA 5JCOA 3PB3A 3U13A 4HDOB 3CNNA 5HARA 1H1TA 1S4QA 5AQ7A 4FKBA 1LGYA 4UTZA 4YNRA 4PO8A 3DEYX 5CLQA 2YWBA 4H27A 2M1XA 1T2FA 3U17A 4PY2A 4IHJB 4CQMA 3CCFA 4UNSA 5AKKA 3JY6A 2PHZA 3QE4A 3HZHA 4DABA 3NBXX 5H68A 3ILHA 1ADGA 3ZU3A 1RRVA 1W48A 2I3GA 3KKMA 3QG1A 2P6PA 1BVRA 4B87A 4EJ0A 3QRWA 3C43A 4JYCA 3V7UA 3VDRA 2PEZA 1I5OA 2MSWA 3D8NA 4N9KA 5JD6A 2G72A 4WEQA 4LMBA 3TUIC 3VTKA 5EKSA 4JVNA 1GN9A 2Z2LB 2ODBA 1D9ZA 3KOUA 2Z8YM 2V7TA 2Q3FA 3II6X 3NCKA 3CXRA 1PJ3A 4JYMA 5TVGA 1H9AA 1LSSA 3HVRA 3HVHA 1DUIA 1JWAB 1MH9A 3O92A 2WJJA 3R09A 1II0A 3ENWA 1ZUNA 2HJRA 4BRSA 4J7AA 1Y34E 4PNHA 1QTIA 2DPHA 3OUTA 3K0AA 1U9JA 2JC3A 4H1TA 1JDZA 3HZRA 1KMMA 3EQ8A 4DBLE 3GDHA 3WG9A 4HPXB 3A0RA 2B1RA 1D0IA 1Z09A 5JS6A 5MGBA 5C4IA 5D84A 3L77A 2PJDA 2QB5A 2VTKA 5DXAA 3KTAB 4D3FA 2AQKA 4O1HA 1XA4A 2IVFA 2B5RA 2GX6A 1Y1QA 4HLUA 5IKEA 4DLVA 2FVYA 5T57A 3LWDA 3DYIA 3PD0A 1TK9A 4IJWA 5EXPA 4OLBA 2POQX 3MR0A 3M70A 1MBZA 2VDUE 1I94B 3KU4A 2J9GA 2H54A 1DHRA 4KMRA 4D45A 3A8TA 2RH8A 5E1MA 3BRWD 1TVKA 5HF8A 2AMFA 1HVBA 3UF0A 2JIMA 4RVHA 2ZZMA 2P3OA 3X1WA 3EMDA 3SSAA 4B6QA 3DEFA 3M4NA 4B0PA 2QZSA 3UJCA 1N9KA 1YKFA 4IVIA 5L6LB 3CNQS 2OPBA 5DB4A 3PHCA 3BIWA 1BQ3A 4EI2A 2C8JA 5C1BA 1MAAA 1AKTA 4GMFA 3RVJA 2GS9A 3EQZA 4O3FA 4H6JB 4RNDB 1EWVA 4BNUA 4JBFA 3CZMA 4Z1MD 3FTNA 3G5LA 4G3WA 4CR8A 5K6AC 4BVEA 5CNIA 3W5DA 1US8B 3ZCTA 4ZTZB 1YACA 1SZPA 3HJIA 5E6SB 2H65A 1CIPA 4BENA 2NSHA 1OTEA 1NUUA 2V0NA 3D02A 2ZIUB 3SYLA 5JQWA 2PBYA 4L3OA 3JYIA 2ZETA 3DMRA 2NO9A 3NG1A 1W2HA 3RS2A 3D3NA 1IQPA 1MABA 3OQ1A 1JPNA 1HE3A 3ZJ5A 2QIOA 3TSAA 4CKEB 1XZDA 1LI7A 5KSZA 3BRMA 3LDFA 3VPHA 3JQDA 5CVCA 2J5BA 2F2TA 1Z4IA 3P2JA 1HE2A 4HCJA 1BHQ1 2ORVA 5HPYB 1S3FA 4OXQA 2WWWA 4OXYA 2XCUA 2QUBA 1UBEA 2Q41A 4M9SA 4LDPA 5HQJA 5DTKA 2H00A 4DSAA 3MHPA 5L3RA 4HATA 5DM4A 3DW0A 3LYHA 5FF9A 4P3PA 3W0LB 1VL2A 4AP5A 4AFIA 3SC6A 4AWBA 2HADA 2DXIA 1X2BA 1AUPA 3WY9A 1LPSA 4RHYA 3PDIA 3GA5A 1E5XA 3K8ZA 3KELA 1E9VA 3MQ0A 3DTVB 4EFMA 4O7DA 4OLDA 3BD9A 4BNYA 4OQFA 3TO5A 4DWOA 4K6KA 1PV1A 2ST1A 3NHQA 3L8DA 5NLLA 3ENVA 4G37A 4I55A 3OJEA 1VDMA 1NASA 4QO8A 2D0OB 5DFXA 2B5OA 1KMHB 1Y4ZA 2ESRA 1YI8A 4UOZA 3ZGYA 4M9ZA 3A26A 2BM1A 1VYVA 4RYDA 5CTAA 1X1QA 1OMEA 2I6XA 1R4ZA 2ODAA 4JPMA 5GZ1A 1PEKE 3CY6A 4OQIA 1M10A 1Q0RA 3TXXA 1PNVA 1ODVA 1UEXC 3NS7A 1JHOA 1WULS 1RQLA 3NCTA 1TADA 4QQNA 1P61B 4S2NA 1NQXA 4X1LA 3N8HA 1YS6A 1G2IA 3LHDA 3V9PA 1LK5A 4NZYA 2ONYA 4YUAA 1J1IA 4U02A 1YFZA 4FT4A 1UKVY 4NYJR 3PIRA 3T4OA 3IESA 2VJYA 1B2RA 4CQNA 4O01A 4PCUA 4HADA 3BIFA 5K0LA 4EUSA 2CLCX 2G1JA 3QP2A 1MMFB 4PM5A 2GHRA 4E13A 3UT5A 5AJZA 3MD0A 2GH1A 3CX4A<