2ZQAA

Cefotaxime acyl-intermediate structure of class a beta-lacta toho-1 e166a/r274n/r276n triple mutant
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Extend Spectrum Beta-Lactamase in Correlation of Enzymatic Kinetics and Thermal Stability of Acyl-Intermediates
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase Toho-1
total genus 95
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zqaA00
4EBNA 5FA7A 4E3OA 5AQ9A 5FASA 3G35A 4GN2A 1ZKJA 2Q9NA 4OQHA 3IWIA 2Z2MB 4BQMA 3NDEA 4UHUA 1MBLA 2XGNA 3N8LA 3PBNA 5DTSA 2WAEA 3MZFA 3OPLA 1CEFA 4GZBA 1BUEA 5FQQA 1YM1A 2WADA 5F82A 1ES3A 2JE5A 5EVIC 3QNCA 4OPYA 1H5XA 2OLVA 3E2LA 1Q2PA 3HLGA 3HUMA 3UPOA 4E6WA 2HDQA 3PBQA 1PZOA 3GV9A 5DF8A 3MFDA 4X69A 5M19A 2HP6A 1YT4A 4D2OA 3WS1A 2ZC5B 1JTGA 2XR0A 4JF4A 4KQOA 4X53A 5EUAA 1LI0A 3GTCA 1PIOA 5EVIB 1M40A 4EBLA 5KSCA 3WS0A 4EWFA 1CI8A 2QPNA 1G6AA 4K0XA 5GHYA 3PAEA 2VGKA 1YLZA 4CJNA 2A49A 4E6XA 3O87A 4GOGA 4JXWA 3G2ZA 4JF6A 4LV1A 4DXCA 3VP4A 1HTZA 2JCHA 3C4PA 4PM5A 3CG5A 2WK0A 2XH9A 2IWCA 4QD4A 1HVBA 3UDXA 5HFOA 3M6HA 3UE3A 5G18A 4E3JA 1K6SA 4MBHA 2OV5A 4X55A 4Y0TA 2EX2A 4P6BA 1FCOA 1I2WA 1KE3A 4Y0UA 1W7FA 3S4XA 2WKHA 4JBFA 3WRZA 1BLSA 5KZHA 4EUZA 4FH2A 4GKUA 5HAPA 2IWDA 3DW0A 3ITAA 1Z6FA 1XGIA 2DNSA 3O86A 2H5SA 3RXXA 2HDUA 3IQAA 4WYYA 3FZCA 2V20A 1K57A 5EOEA 4WMCA 2XF3A 2ZLYA 4KZ4A 1K56D 4N1HA 3HL9A 2WAFA 2JBFA 3BFFA 4N9LA 4OQIA 2ZC3B 3GRJA 4R4SA 5EVLA 2HDRA 3G2YA 4LCMA 3RXWA 4E3NA 2PU4A 5E2HA 4GD6A 3UNWA 1K57C 2H0YA 3E2KA 3BEBA 4WMCD 3GVBA 4S2NC 1K56A 1HZOA 5I94A 4GD8A 1YLWA 4KENB 3NCKA 5FQ9A 1PW8A 2EX9A 3VFFA 3ZG9B 5M1AA 1ES4A 4K91A 4X6TA 4F94A 1IYQA 1FQGA 3Q7VB 4LV0A 1FR6A 1RGZA 5E2FA 2ZC4B 5HX9A 3VSLA 2WZZA 3HLWA 4BL2A 3LY3A 5HAQA 1CI9A 1TDLA 3C7VA 5GLCA 3V3RA 1NZUA 4N92A 3ZFZA 5CTMA 1W5DA 1XPBA 4LV3A 4PPRA 5HL1A 3V3SA 3FWLA 3DWZA 4N9KA 1S0WA 4RYEA 3VP0A 3AGFA 4UA6A 4QU3A 2EX8A 2J9PA 1YLPA 3PBOA 5AQ7A 3WWXA 1YLJA 1IKGA 4K0WA 1KGEA 1PWGA 2H0TA 4OLDA 2EXAA 4S2IA 5M18A 4UA7A 4HBUA 3VP1A 1JWZA 3G30A 3C7UA 4R3BA 5DTTA 4DXBA 4OONA 3AGEA 3W8KA 1KE4A 2XEPA 4DE0A 5CTNA 1JWVA 1ONGA 4KQRA 3VSKA 3SH8A 2DRWA 3LEZA 3PTEA 2Y4AA 4WZ5A 4DF6A 4QY6A 3HLCA 4R23A 3SOIA 1EROA 4R1GA 1ESIA 1GHIA 2P9VB 1SCWA 4ZTKA 5IHVA 3V5MA 3W4OA 4BJPA 3NI9A 3SS3A 3IWOA 2XQZA 5FSRA 2Y2NA 2WYXA 1FSWA 4R0QA 3BECA 3ZGAB 1LLBA 2J7VA 3I7JA 4S2OA 4IBRA 1SKFA 5FAOA 2XDMA 4X68A 1K4FA 4KZ3A 4C3QA 1WE4A 1XGJA 1Y54A 2PU2A 3OCLA 4N1XA 5FI2A 5GLAA 3WS4A 1IYPA 4YINA 5CXWA 2HP5A 4WBGA 1ALQA 1L0GA 5FI7A 3IHBA 1IEMA 4C75A 2P9VA 1MY8A 3ZDJA 4OPRA 2Y2GA 1LL9A 3UO9A 1ESUA 2XK1A 3UE0A 1IYOA 2XFTA 4RA7A 4BD1A 1GA9A 4S2LA 1PI5A 5FQMA 3UY6A 3BM6A 4B88A 4PM6A 3W4PA 4BD0A 3Q1FA 2RL3A 3C5AA 5CHJA 5CRFA 1ERQA 4OVDA 2HDSA 4WEKA 1SHVA 4HESA 1PI4A 3UPNA 1KE0A 3A3IA 3MXSA 3UE1A 3P09A 2HP9A 2WGWB 4NETA 1NJ4A 1DJBA 3G31A 3MKFA 5EVIA 1NYMA 2WUQA 5GLBA 3TG9A 5A90A 4OH0A 3GR2A 1M6KA 3LO7A 4DDYA 1L2SA 1E4DA 1YMXA 1FR1A 1K55A 5U47A 3BFCA 4S2JA 2VGJA 4S2NA 2E8IA 2G2UA 1K4EA 3SS4A 1NZOA 2Y91A 2XFSA 4UA9A 4M3KA 1ZG4A 1KVMA 1NYYA 1DJAA 4JXGA 1L0EA 1XXMA 2X71A 1IYSA 1K6RA 1WYBA 1KVLA 2WGVA 3UPPA 3IWQA 1FSYA 2HPBA 5GL9A 4P87A 5JYPA 2ZQAA 4KG5A 5AQAA 3QHYA 3HLFA 3W4QA 4U0XA 4BENA 2Y2HA 4E3IA 4P85A 1BZAA 5HAIA 2Y2LA 2ZD8A 1DY6A 4WM9A 3ZG5A 4E3KA 3MZDA 5FI6A 4E3MA 5E2GA 1E25A 1H8YA 1L0DA 4OKPA 1MXOA 2ZQCA 3DTMA 3N8SA 5HARA 3IF6C 2PBYA 1FCMA 4L0LA 4DKIA 4LENA 3IXGA 4NK3A 2WKIA 1PWDA 1XA1A 4B4XA 4IEDA 1RGYA 3PBSA 3NIAA 3IXDA 1I5QA 4HEFA 4KZAA 3WS2A 3ZG8B 3IF6B 1W8YA 4FH4A 5E2EA 2X01A 4GB7A 1GHPA 2ZQ9A 3MBZA 4O7DA 1ES2A 1FOFA 1N9BA 3OCNA 2C6WB 3GMWA 4RVAA 5DF7A 4JPMA 1L0FA 1XKZA 2EXBA 3PBTA 4ZJ3A 1WYCA 5CGSA 4WEJA 1YLTA 1MWRA 2UWXA 4RX3A 2ZMAA 3IXBA 3MZEA 4Y7PA 1KDSA 1EWZA 4RX2A 4U0TA 3Q7VA 4GDBA 3G32A 5F1FA 1OMEA 3IF6A 2EX6A 3FV7A 3HVFA 3IHAA 3BRMA 1K54A 2DCFA 3IT9A 4PMAA 3UDIA 4Z9QA 1TDGA 4DE1A 3MKEA 4KZ7A 3IXHA 2Y2KA 4MNRA 4KG2A 3HUOA 1BLHA 1CK3A 3HBRA 4DRTA 2WZXA 4S2MA 5CEBA 1RP5A 2ZQDA 4OOLA 3QNBA 4IBXA 4XUXA 5FAQA 4OPZA 3EQUA 5BOHA 3SS5A 4PM9A 2IWBA 3Q82A 1KGGA 3ISGA 4JXVA 4LV2A 4OPQA 3WRTA 3DWKA 3NDGA 1ZC2A 4HBTA 1E3UD 2Z2LB 1MPLA 4JKTA 4BLMA 4DE3A 1K55C 3N4IA 2H10A 4KZ6A 1BTLA 3CJMA 1ERMA 1NXYA 1C3BA 3OZHA 1GA0A 1QMEA 2ZQ7A 3ZG7B 4Y0OA 1O07A 1K25A 4R3JA 3ZG0A 5CECA 5CEDA 1H8ZA 5F1GA 5A91A 2WGWA 3O3VA 3O88A 1KDWA 4JXSA 4KZBA 2V1ZA 3NY4A 1LI9A 4OP8A 4EQIA 4KG6A 2P74A 5AQBA 1ZG6A 4EV4A 1BT5A 1G68A 4ZBEA 3NBLA 3IH9A 3VOZA 4UAAA 4X56A 4ZJ2A 3UN7A 3D4FA 4LCLA 5FATA 2ZM0A 1ES5A 4OQGA 3GSGA 1N4OA 3WS5A 2A3UA 1GCEA 5E43A 4S2KA 2J8YA 3CZDA 1YQSA 4ID4A 4P0MA 5CHUA 3LY4A 1J9MA 1PYYA 4PM7A 5F83A 3TSGA 1MWUA 4DDSA 4QJGA 1CEGA 3NC8A 4DE2A 5D3OA 1JVJA 1LL5A 3OPPA 1ONHA 2R9WA 3M2JA 4WELA 4KZ9A 3FKVA 3ZHHA 1Q2QA 4JF5A 4WZ4A 3FYZA 4BL3A 2Y2JA 2CC1A 3A3FA 3OPRA 2I72A 1O7EA 1VQQA 2XD1A 5EVID 3BFDA 4QHCA 3BLMA 2BG1A 1W8QA 3Q81A 3VP3A 1MWTA 2X02A 4OOYA 4IVKA 3ZCZA 3IH8A 5TR7A 1BULA 2XLNA 4R4RA 1I2SA 3SH7A 3S22A 4OLGA 3TOIA 3HREA 4FD8A 3VP2A 1MWSA 1YLYA 3Q07A 3ZNYA 2Y2MA 1KGFA 2FFYA 3OPHA 1JTDA 2RCXA 3S1YA 3M2KA 4OQ0A 2EFXA 2G2WA 3AGDA 3N7WA 4B4ZA 3MXRA 5FQJA 2EFUA 2ZQ8A 1PWCA 5FQKA 5EECA 5EPHA 2ZJ9A 1NRFA 4MBFA 3G4PA 5CERA 5A92A 1EI5A 3SH9A 4OOMA 2Q9MA 5EE8A 1IELA 3M6BA 2ZC7A 4H8RA 3RJUA 3HLDA 5JYOA 3BYDA 4CPKA 2BLSA 2Y2QA 2B5RA 5FDHA 4S2PA 1JWPA 3ZVWA 1PW1A 1W79A 2XD5A 4KZ5A 2JC7A 3A3DA 4U3TA 4EBPA 5FAPA 1BLPA 2C5WB 4XXRA 5CGXA 2FFFB 2J9OA 2OSUA 2R9XA 2QMIA 4XUZA 3N8RA 1QMFA 5GHXA 4MBKA 5TFQA 3ITBA 5KSHA 4PM8A 2WKEA 1SDEA 3A3JA 3ZVTA 1K38A 3G34A 1GHMA 3BFEA 4FSFA 1LHYA 3Q7ZA 4ZDXA 2OLUA 5A93A 2WGIA 3GQZA 3PBRA 1HD8A 4KQQA 3JYIA 3VMAA 4MLLA 1SDNA 2ZM8A 3HLBA 1TEMA 1E3UA 4ZAMA 3IF5A 3HLEA 3BLSA 1BSGA 5DTKA 5FQIA 1DJCA 5J8XA 5TGFA 1BLCA 4OP5A 3V39A 1PZPA 1U60A 2V2FF 2Y2PA 1XA7A 3OC2A 5GLDA 1XP4A 2Y59A 4C6YA 3HUNA 5L2FA 3V50A 3N6IA 3EQVA 1VM1A 1NY0A 3B3XA 4Q8IA 3LCEA 5CGWA 2ZM2A 3VFHA 3FKWA 2Y2IA 1MKIA 4E3LA 5DVAA 3BFGA 1S6RA 3C4OA 4ZJ1A 3ZNTA 1AXBA 1IKIA 1TVFA 4FCFA 3CMZA 2ZC6B 1YMSA 1K54C 3P98A 2Y55A 2GDNA 4WZ5C 4GNUA 5CHMA 5DF9A 5EOOA 3VOYA 4YFMA 5KMWA 3PAGA 4A5RA 3UDFA 4JLFA 1XX2A 3A3EA 4QB8A 5GHZA 4IVIA 2Y2OA 2QZ6A 4MEZA 4QY5A 5HW3A 1FCNA 1RCJA 4KZ8A 4GDNA
chains in the Genus database with same CATH superfamily
2VX8A 2JHEA 5FA7A 5AQ9A 4GN2A 4HHDA 3KSIA 3NOUC 2WAEA 3OPLA 1A0KA 1F9IA 1CEFA 1BUEA 5HSQA 4OPYA 1YSPA 4E6WA 3GV9A 5DF8A 4X69A 5M19A 4D2OA 1OTDA 1JTGA 3GTCA 1LL8A 1PIOA 4EBLA 4MN7A 4K0XA 5F6AA 3PAEA 3UB8A 3BWLA 4JF6A 2JKTM 2JCHA 3NOTC 2V9AA 3RTYA 1K6SA 1NLYA 4X55A 1XFNA 2ZMVA 3MQOA 4KUKA 5KZHA 4EUZA 4FH2A 3UE6A 3LEQA 3ITAA 5IT5A 1Z6FA 3KYZA 4UEYA 1S1ZA 5EM1A 4CLCE 2H5SA 2PD8A 4BBVA 3IQAA 3CPTA 1ZTUA 2VJWA 2QHKA 2PR6A 3UNWA 1K57C 4Y5FA 4GD8A 1PW8A 2EX9A 1W63M 4X6TA 1HLUP 2O9BA 1FR6A 1RGZA 3HJIA 5HX9A 5HAQA 3MF0A 1TDLA 4R38A 4FTXA 4N9KA 1S0WA 3VP0A 4F3LA 1YLJA 4K0WA 1KGEA 2H0TA 4S2IA 4UQIS 5M18A 4R3BA 1EW0A 2J3TC 5CTNA 4KQRA 1F98A 3VSKA 3QP4A 4QY6A 2W3FA 1MKMA 1SKOA 4R1GA 3T1QB 3SS3A 4F3LB 2OWHA 3NOPC 3D3OA 3IX4A 1OTAA 2Y2NA 5L07A 4YWZA 1LLBA 3LUQA 3W2ZA 4S2OA 1LSXA 3UB5P 3NULA 2UV0E 2A24A 5GLAA 5CXWA 4ETZA 4Q0HA 4RA7A 5AVEA 4BD1A 4EERA 5FQMA 1PI5A 3UY6A 3BM6A 3W4PA 2PT7A 3LR4A 2VV8A 2V0UA 3UPNA 3A3IA 3UE1A 4NETA 3G31A 1NYMA 5DJTA 1M6KA 1Z09A 3S7QA 5U47A 4PKYG 2G2UA 3P7NA 1NZOA 4IHQA 2Y91A 1ZG4A 1KVMA 1K6RA 2JKRI 3LIEA 1GSVA 5GL9A 4P87A 2L4RA 4KG5A 3W4QA 4Y13A 2Y2LA 2ZD8A 1DY6A 3IS2A 5E2GA 4MN6A 2W27A 4Y17A 2OAQ1 1OT6A 4NK3A 2WKIA 1PWDA 1XA1A 4AFIA 4B4XA 2X01A 4IUHA 3MBZA 2INWA 1N9BA 3F1NA 3GMWA 3PBTA 2M7VA 1OTBA 3QP6A 5CGSA 1YLTA 1MWRA 4RX3A 4RX2A 2V1BA 3ULFA 4ARZB 2PHYA 2PAVP 2XA7S 3MKEA 2GNXA 4MNRA 3HUOA 4XT2B 1BLHA 2A2LA 4JGPA 2V8FA 3VV4A 2HGVA 2I9VA 2IWBA 4JXVA 4LV2A 1TS0A 1ZC2A 2Z2LB 4BLMA 3RFBA 2H10A 3CJMA 1C3BA 1G6OA 4Y0OA 2FZ0A 5J3WA 3O3VA 2BTFP 4JXSA 1LI9A 1ZG6A 4BBUA 2ZBBA 3BW6A 3T4TA 3C2WA 2J8YA 1L3LA 4P0MA 4ID4A 3LY4A 4PM7A 3NC8A 5D3OA 1JVJA 1LL5A 2R9WA 3ZHHA 3FKVA 4NXGA 3R7WA 4BL3A 2Y2JA 3VE4A 3A3FA 2BG1A 2W3EA 2X02A 5EVEA 4IVKA 3ZCZA 1T1AA 4HOIA 3IS2B 5TR7A 1I2SA 3VP2A 1MWSA 1OPXA 3F1PA 1XJ6A 3M2KA 5FQJA 2EFUA 2ZQ8A 5FQKA 2ZJ9A 5HPFA 1DP9A 1EI5A 2VV6A 4OOMA 2Q9MA 5JYOA 5HL6A 2B5RA 4ZRRA 3ZVWA 1PW1A 1W79A 4I3JA 2XD5A 4KZ5A 2C5WB 2FFFB 3N8RA 1QMFA 3ITBA 5KSHA 2WKEA 4HJ6A 3A3JA 3G34A 2GX5A 1HD8A 4I38A 1OJ5A 1IFQA 1SDNA 3HLBA 1TEMA 1E3UA 3H7WB 1OT9A 2NUTC 2EWWA 3HLEA 1BLCA 3UB6A 3V39A 1PZPA 1TF1A 3R7WB 1T1BA 3TRCA 1DP8A 3QP1A 3EQVA 1VM1A 3B3XA 3LCEA 2Y2IA 3ZNTA 1IKIA 4FCFA 3ICYA 1K54C 4WZ5C 5CHMA 3H9WA 5KMWA 3PAGA 4QB8A 2O9CA 2Y2OA 4KUOA 2QJ5A 4KZ8A 3FPVA 3NECA 5LBRA 1ZKJA 3T4LA 3N8LA 3PBNA 1CJFA 5DTSA 1YM1A 3E2LA 3NJAA 1GSWA 3UPOA 2HDQA 5TJJA 3PBQA 1PZOA 3C38A 1YT4A 3EGDC 3WS1A 2ZC5B 3DBAA 3LR0A 4EWFA 1CI8A 3LYXA 2P04A 5GHYA 3UB9A 1LSVA 2ZL1A 2VGKA 3O87A 4JXWA 3VP4A 1UWPX 3CG5A 4FOFA 2XH9A 2IWCA 1HVBA 5HFOA 4JGRA 1BYWA 2EX2A 3F1NB 3MQQA 2VGLS 4H6JA 4P6ZS 2QJ7A 5HAPA 3DW0A 3KSGA 2KOIA 2HDUA 3FZCA 1K57A 5L8MA 2ZLYA 3MMHA 1G5UA 4N1HA 1K56D 5J7EA 2JBFA 3BFFA 4N9LA 2E8JA 2ZC3B 3MSHA 3NHQA 3G2YA 3RXWA 4E3NA 5E2HA 4GD6A 2BASA 3BEBA 3C30A 3GVBA 1K56A 3JPUA 5I94A 1YLWA 5HDSA 4KENB 3ZG9B 1LSWA 2WZZA 4BL2A 2W1TA 5G4ZA 3C7VA 5GLCA 5K5BA 3ZFZA 4LV3A 5HL1A 4PPRA 3V3SA 3FWLA 3DWZA 3E0YA 1LT0A 4RYEA 4R6LA 3EWKA 2W0NA 3T1RA 4UA6A 2YKHA 4QU3A 4CLCD 1YLPA 3PBOA 3WWXA 3BQ8A 1IKGA 3E4QA 4OLDA 3KYQA 3U4LP 3BY8A 2LB5A 3VP1A 3G30A 4DXBA 4OONA 3W8KA 1P97A 2OOLA 3MR0A 4WF0A 1ONGA 4Y2FA 4DF6A 4WZ5A 4LPZA 3HLCA 4EEUA 4BWIA 1EROA 1JNUA 2OAP1 3E4PA 4ZTKA 1GHIA 3W4OA 3NI9A 1UGUA 2A24B 3VE3A 1MC0A 1DRMA 2WYXA 5HD3A 4R0QA 3BECA 2J7VA 3I7JA 4IBRA 2XDMA 1K4FA 4HH3A 4KZ3A 1Y54A 4N1XA 1VETB 5FI2A 3DTIA 1ALQA 5FI7A 3IHBA 5TBMB 1MY8A 3ZDJA 3HJKA 3UO9A 1ESUA 2GZAA 3UE0A 4Y15A 1GA9A 4S2LA 3F1PB 4X1LA 4BD0A 4OVDA 3T4QA 3S7PA 4MCWA 2HZ5A 2HP9A 1DJBA 3UB7A 2PR5A 2WUQA 1TD5A 5HWWA 3LO7A 3OOVA 4DN0A 1E4DA 1FR1A 3BFCA 2EA9A 2E8IA 2VEAA 2VA0A 2XFSA 4UA9A 4G3VA 1NYYA 1IYSA 1WYBA 2WGVA 3UPPA 1FSYA 1FILA 2ZQAA 3HLFA 4U0XA 2Y2HA 3LI8A 1VEUB 4G3WA 4XT2A 5FI6A 2W3DA 4ESPA 3DTMA 3N8SA 3IF6C 2PBYA 4LENA 3IXGA 3ZQ5A 4KZAA 4FH4A 5E2EA 4GB7A 2JN7A 3V67A 1FOFA 2C6WB 1XFQA 4JPMA 4WLAA 1WYCA 2MJ6A 3QP8A 3MZEA 4Y7PA 3MS6A 4GCZA 3G32A 2JKFA 3UMEA 3IHAA 1SKOB 3BRMA 2DCFA 4Z9QA 2Q0OA 4Y3IA 3CHWP 4DE1A 1T1CA 4KZ7A 3IXHA 2Y2KA 2JKRM 1CK3A 2WZXA 4S2MA 1W63Q 2ZQDA 4XUXA 2PYPA 5BOHA 5EFWA 3ISGA 3DWKA 4HBTA 4DE3A 2M1CA 2Z6CA 4KZ6A 1MZUA 3OZHA 5DKKA 2ZQ7A 3ZG7B 2VZWA 1K25A 4R3JA 2V1ZA 3NY4A 4E04A 3NBLA 3VOZA 4IJGA 1ES5A 3JVVA 4ARZA 2A3UA 1XJ3A 4E6XA 5F83A 3TSGA 1J3WA 4QJGA 3LR5A 2Y79A 3M2JA 4WELA 3T4OA 3D72A 3FYZA 2D01A 3LIFA 1P9RA 1VQQA 3QP5A 5EVID 4I5SA 3BFDA 1Y28A 1MWTA 4OOYA 3BQAA 4R4RA 4WL9A 3SH7A 3JVUA 3TOIA 2WKPA 3ZNYA 4HI4A 4R70A 3CAXA 1JTDA 2EFXA 4B4ZA 5EPHA 3LFVA 1NRFA 4EW7A 5EE8A 1IELA 4H8RA 3BYDA 2BLSA 5FDHA 4S2PA 4NXFA 1S4SA 4I3IA 1STZA 4KQDA 5A8BA 4U3TA 5FAPA 1P9WA 2J9OA 2OSUA 1XJ4A 3H7WA 5GHXA 4MBKA 3L7HA 3K2NA 3T4KA 3ZVTA 1GHMA 2O9AA 3BFEA 3H82B 3L9KA 1TS8A 4KQQA 2HV1A 3IBJA 5FDSA 4LGWA 4MLLA 3DTEA 3IF5A 5FQIA 3TE8A 2K31A 1NLZA 2Y2PA 4H6JB 5GLDA 4C6YA 5L2FA 3V50A 5HD5A 1UWNX 4Q8IA 4LFUA 5CGWA 3VFHA 3BFGA 5L09A 4ZJ1A 1AXBA 2Y55A 2GDNA 2LB9A 3LICA 3VOYA 3S7OA 3DAVA 4X1MA 3UDFA 4JLFA 5GHZA 4IVIA 3T4SA 1RCJA 4GDNA 4E3OA 3F1OB 1VHMA 5FASA 4OQHA 4YOFA 4BQMA 2Z2MB 3NDEA 3FG8A 2ZOHA 3MZFA 1K0KA 5FQQA 5EVIC 3QNCA 1H5XA 3HUMA 1Q2PA 3HLGA 2HJ9C 2DMWA 3MFDA 1P0ZA 2PYRA 5KIZA 2HP6A 2L1MA 4JF4A 4X53A 1M40A 5KSCA 2QPNA 4Q0IA 3PXPA 4CJNA 2A49A 3G2ZA 1HTZA 3C4PA 4BBTA 5HPIA 1D06A 2WK0A 3SZTA 4NXBA 4QD4A 3MJQA 3UE3A 4PHTA 5G18A 4E3JA 4Y0TA 3CUEC 1W7FA 3S4XA 2WKHA 1VB6A 4JBFA 3WRZA 4GKUA 2IWDA 4GHIA 3O86A 3RXXA 2V20A 1D7EA 4KZ4A 4OQIA 3GRJA 4R4SA 1S67L 4LCMA 5HZHA 4B93A 2L0WA 1HZOA 5FQ9A 5M1AA 4F94A 5G4YA 3Q7VB 5E2FA 2Z6DA 2ZC4B 3VSLA 3LR3A 4GJ4A 3HLWA 3LY3A 1CI9A 1NZUA 4N92A 1OTIA 1W5DA 3T1SA 2V0WA 3AGFA 2J9PA 4QWOA 2HJEA 5AQ7A 2EXAA 3RH8B 2Y8HA 2XRNA 4UA7A 1JWZA 3C7UA 3FPWA 4DE0A 2J80A 4RQ9A 2DRWA 3LEZA 2Y4AA 4O01A 4PKYA 1ESIA 5TBMA 1SCWA 4BJPA 4CLCC 1VETA 5FSRA 3ZGAB 5DKLA 2QKPA 1SKFA 4C3QA 1XGJA 2PU2A 3WS4A 1IYPA 2HP5A 1L0GA 4C75A 2P9VA 4OPRA 1LL9A 2XK1A 4LLOB 5F5YA 1IYOA 2XFTA 4B88A 4PM6A 3Q1FA 3C5AA 5CHJA 4X25A 3LIDA 2HDSA 4HESA 1KE0A 3P09A 1OTEA 2WGWB 1YAXA 5EVIA 3MFXA 5A90A 4OH0A 1K55A 4MN5A 4S2JA 2VGJA 3EEAA 1K4EA 4UQIM 3CITA 1L0EA 1XXMA 2X71A 1YKDA 4YNRA 1KVLA 3IWQA 2HPBA 4L9GA 3B47A 4P85A 4WM9A 1H0MA 2D02A 2P7JA 4OKPA 2ZQCA 5HARA 2EWVA 4IEDA 3PBSA 3IXDA 2O99A 3ZG8B 3WS2A 2QWSA 2ZQ9A 1H8MA 3LIAA 4RVAA 3QP2A 5DF7A 1L0FA 1XKZA 1N9LA 4LRZE 4WEJA 2ZMAA 1KDSA 1EWZA 2J3TD 4U0TA 4HP9A 3Q7VA 4GDBA 3IF6A 3FV7A 3HVFA 1K54A 4PMAA 1TDGA 2VGLM 3CUEA 4CQHA 4P6ZM 5F69A 3HBRA 4Z1WA 3IX3A 3A0VA 5CEBA 1RP5A 4OOLA 5L10A 1CQAA 4IBXA 3SS5A 4PM9A 4L9FA 1KGGA 4OPQA 3WRTA 3NDGA 2VLGA 4JKTA 3IBRA 1BTLA 1ERMA 1NXYA 1GA0A 1QMEA 2JKTI 1O07A 5CECA 2IA2A 5CEDA 1H8ZA 5A91A 2WGWA 3O88A 1KDWA 1G28A 4ME4A 4OP8A 4EQIA 4KG6A 5AQBA 3PYPA 1ZHHB 1G68A 4ZBEA 4HY8A 4UAAA 4X56A 4ZJ2A 3D4FA 4LCLA 5FATA 3GSGA 2H28A 5EV0A 3WS5A 2VKSA 2K7SA 1Y4OA 4S2KA 3EOIA 3CZDA 2OWJA 1J9MA 1PYYA 3UMDA 4DDSA 3OPPA 1ONHA 4KZ9A 1Q2QA 1DP6A 4JF5A 2CC1A 3OPRA 2I72A 1O7EA 2XD1A 1YPRA 3BLMA 1W8QA 3VP3A 4HNBA 3IH8A 3U2AA 2XROA 5C5KA 3S22A 4OLGA 3HREA 5HDCA 1ODVA 4FD8A 3MQ0A 3T50A 3P01A 2RCXA 2P08A 4M4XA 4OQ0A 4NG2A 2G2WA 3AGDA 3N7WA 1PWCA 5EECA 5FEGA 4R3AA 4MBFA 3SW1A 3G4PA 5CERA 5A92A 3M6BA 4WN5A 3RJUA 3CWFA 2KX6A 2JC7A 3A3DA 5CGXA 2R9XA 3KSFA 4XUZA 5TFQA 3T4JA 3MXQA 4PM8A 5HDDA 1TS7A 1K38A 4EU0A 4FSFA 1LHYA 3Q7ZA 4ZDXA 2OLUA 3PBRA 3KX0X 3JYIA 3VMAA 1V9ZA 4ZAMA 2WKQA 1BSGA 5DTKA 1DJCA 5J8XA 3GECA 3OC2A 1YSQA 4GS9A 1XP4A 2Y59A 2ZM2A 3FKWA 1N9NA 4E3LA 5DVAA 3C4OA 4NEED 2ZC6B 1S4RA 5FEFA 4GNUA 5DF9A 4L9EA 4A5RA 3E4OA 2NUPC 5HW3A 4QY5A 3LIBA 4EBNA 3O5YA 2PD7A 1OJGA 3G35A 2Q9NA 3LI9A 3IWIA 1T18A 2V1AA 4UHUA 1MBLA 2XGNA 4GZBA 5F82A 2WADA 1ES3A 2JE5A 3TW8A 4HJ4A 2OLVA 2QYBA 2KLIA 4HP4A 2XR0A 4KQOA 5EUAA 1LI0A 5EVIB 3WS0A 1G6AA 4HIAA 1YLZA 4GOGA 3C8CA 3EEHA 5DFXA 4LV1A 4DXCA 4BMWA 4PM5A 4PAUA 4GHIB 3KSHA 3UDXA 3M6HA 4MBHA 2OV5A 3KO6A 4QPRA 4P6BA 1FCOA 1I2WA 1KE3A 4Y0UA 3G6OA 1BLSA 2KDKA 4EEPA 5AJGA 1XGIA 2DNSA 3EGXC 2JKGA 4WYYA 5EOEA 4WMCA 2XF3A 5MC7A 3HL9A 2HF6A 2WAFA 5EVLA 2HDRA 2PU4A 2H0YA 2ZL1B 3E2KA 4WMCD 2R78A 4NXEA 4S2NC 3NCKA 3VFFA 2VV7A 1ES4A 4K91A 1IYQA 1FQGA 3IX8A 4LV0A 3HCYA 4CLCA 5FL3A 2W3GA 3V3RA 5CTMA 3OLOA 1WA9A 3FC7A 1XPBA 3BJNA 4B9OA 5F68A 5DJUA 4DJ3A 2FH5A 3DTKA 2EX8A 1PWGA 1NRJA 4HBUA 5DTTA 2V8CA 3AGEA 1KE4A 2XEPA 2ACGA 1JWVA 3SH8A 3PTEA 3PHYA 4R23A 2J3WA 3SOIA 3CLOA 2PDRA 3V5MA 2P9VB 5IHVA 4LRXC 4HJ3A 3IWOA 2XQZA 1FSWA 2VK3A 5FAOA 4X68A 1WE4A 4CLCB 3OCLA 3K3CA 4YINA 4DJ2A 4WBGA 1IEMA 2Y2GA 5J4EA 1IOUA 4HQAA 2B95A 2RL3A 2CMNA 5CRFA 1ERQA 4WEKA 1SHVA 1PI4A 3MXSA 2B18A 1NJ4A 4II7A 3MKFA 5GLBA 5HWTA 3TG9A 4IUKA 3GR2A 2GJ3A 4DDYA 1L2SA 1YMXA 4S2NA 3ZYTA 3SS4A 2K2NA 4M3KA 1DJAA 3A0RA 4JXGA 4O0PA 5JYPA 5AQAA 3QHYA 4BENA 4E3IA 1BZAA 5HAIA 2W3HA 3ZG5A 4WUJA 4E3KA 3MZDA 4E3MA 1E25A 1H8YA 2O0YA 1L0DA 1MXOA 1FCMA 4L0LA 4DKIA 1RGYA 3NIAA 1I5QA 4HEFA 3IF6B 5EM0A 1W8YA 1GHPA 5AVFA 4EETB 4O7DA 1ES2A 3OCNA 4FUWA 2ZMFA 2XA7M 4MDZA 2EXBA 4ZJ3A 3BY9A 5HWVA 3D9YA 1N9OA 2UWXA 3IXBA 2G7UA 1PRQA 5F1FA 1OMEA 2EX6A 5I5LA 1SZVA 3IT9A 4JGOA 4EXOA 3UDIA 4LRYC 1GSXA 4EUVA 5IU1A 4KG2A 1X0OA 4DRTA 3T12B 3QNBA 5FAQA 4OPZA 3EQUA 3Q82A 4HH2A 1NWZA 1E3UD 1MPLA 3E98A 1K55C 3N4IA 2W1RA 1H3QA 3F1OA 4GS9B 3ZG0A 5F1GA 4KZBA 4G3KA 2P74A 4Q0JA 4EV4A 1BT5A 4DMZA 3IH9A 3UN7A 2ZM0A 1KOUA 5IS1A 4OQGA 5DFYA 1N4OA 2B02A 3VOLA 5E43A 1GCEA 3CI6A 1YQSA 5CHUA 3T1XA 1MWUA 1CEGA 4DE2A 1PNEA 4WZ4A 1PFLA 4QHCA 2PBDP 3Q81A 1BULA 4K08A 2XLNA 1F5MA 1ACFA 1FIKA 3OBFA 4D60A 1YLYA 3Q07A 2Y2MA 1KGFA 2FFYA 3OPHA 4I39A 3S1YA 1D1JA 3A0SA 5CX7A 3MXRA 4JGQA 3LGOA 1V9YA 3B42A 3SH9A 3PR6A 3R4KA 2ZC7A 4EESA 2WKRA 3HLDA 1F2KA 4CPKA 2Y2QA 2PRFA 3GDIA 1JWPA 2YKFA 4EBPA 1BLPA 4XXRA 1CF0A 3B33A 2QMIA 4O8GA 1XJ2A 1TS6A 3TJZC 1SDEA 1S1YA 3S7NA 5A93A 2WGIA 3GQZA 2M7UA 4GLQA 4I3AA 4ETXA 2ZM8A 3KYEA 4GW9A 3CPTB 3BLSA 5TGFA 4OP5A 2V2FF 1U60A 2AVXA 1XA7A 2XSSA 3HUNA 3N6IA 4EQ1A 1NY0A 4MMNA 2W1TB 1MKIA 1S6RA 1TVFA 3CMZA 1YMSA 3P98A 2ZOIA 5EOOA 4YFMA 3H82A 4NKPA 1XX2A 3A3EA 1T19A 1S66L 1VEUA 2QZ6A 3K3DA 4MEZA 1FCNA 1AWIA
chains in the Genus database with same CATH topology
4EBNA 5FA7A 4E3OA 5AQ9A 5FASA 3G35A 4GN2A 1ZKJA 2Q9NA 4OQHA 3IWIA 2Z2MB 4BQMA 3NDEA 4UHUA 1MBLA 2XGNA 3N8LA 3PBNA 5DTSA 2WAEA 3MZFA 3OPLA 1CEFA 4GZBA 1BUEA 5FQQA 1YM1A 2WADA 5F82A 1ES3A 2JE5A 5EVIC 3QNCA 4OPYA 1H5XA 2OLVA 3E2LA 1Q2PA 3HLGA 3HUMA 3UPOA 4E6WA 2HDQA 3PBQA 1PZOA 3GV9A 5DF8A 3MFDA 4X69A 5M19A 2HP6A 1YT4A 4D2OA 3WS1A 2ZC5B 1JTGA 2XR0A 4JF4A 4KQOA 4X53A 5EUAA 1LI0A 3GTCA 1PIOA 5EVIB 1M40A 4EBLA 5KSCA 3WS0A 4EWFA 1CI8A 2QPNA 1G6AA 4K0XA 5GHYA 3PAEA 2VGKA 1YLZA 4CJNA 2A49A 4E6XA 3O87A 4GOGA 4JXWA 3G2ZA 4JF6A 4LV1A 4DXCA 3VP4A 1HTZA 2JCHA 3C4PA 4PM5A 3CG5A 2WK0A 2XH9A 2IWCA 4QD4A 1HVBA 3UDXA 5HFOA 3M6HA 3UE3A 5G18A 4E3JA 1K6SA 4MBHA 2OV5A 4X55A 4Y0TA 2EX2A 4P6BA 1FCOA 1I2WA 1KE3A 4Y0UA 1W7FA 3S4XA 2WKHA 4JBFA 3WRZA 1BLSA 5KZHA 4EUZA 4FH2A 4GKUA 5HAPA 2IWDA 3DW0A 3ITAA 1Z6FA 1XGIA 2DNSA 3O86A 2H5SA 3RXXA 2HDUA 3IQAA 4WYYA 3FZCA 2V20A 1K57A 5EOEA 4WMCA 2XF3A 2ZLYA 4KZ4A 1K56D 4N1HA 3HL9A 2WAFA 2JBFA 3BFFA 4N9LA 4OQIA 2ZC3B 3GRJA 4R4SA 5EVLA 2HDRA 3G2YA 4LCMA 3RXWA 4E3NA 2PU4A 5E2HA 4GD6A 3UNWA 1K57C 2H0YA 3E2KA 3BEBA 4WMCD 3GVBA 4S2NC 1K56A 1HZOA 5I94A 4GD8A 1YLWA 4KENB 3NCKA 5FQ9A 1PW8A 2EX9A 3VFFA 3ZG9B 5M1AA 1ES4A 4K91A 4X6TA 4F94A 1IYQA 1FQGA 3Q7VB 4LV0A 1FR6A 1RGZA 5E2FA 2ZC4B 5HX9A 3VSLA 2WZZA 3HLWA 4BL2A 3LY3A 5HAQA 1CI9A 1TDLA 3C7VA 5GLCA 3V3RA 1NZUA 4N92A 3ZFZA 5CTMA 1W5DA 1XPBA 4LV3A 4PPRA 5HL1A 3V3SA 3FWLA 3DWZA 4N9KA 1S0WA 4RYEA 3VP0A 3AGFA 4UA6A 4QU3A 2EX8A 2J9PA 1YLPA 3PBOA 5AQ7A 3WWXA 1YLJA 1IKGA 4K0WA 1KGEA 1PWGA 2H0TA 4OLDA 2EXAA 4S2IA 5M18A 4UA7A 4HBUA 3VP1A 1JWZA 3G30A 3C7UA 4R3BA 5DTTA 4DXBA 4OONA 3AGEA 3W8KA 1KE4A 2XEPA 4DE0A 5CTNA 1JWVA 1ONGA 4KQRA 3VSKA 3SH8A 2DRWA 3LEZA 3PTEA 2Y4AA 4WZ5A 4DF6A 4QY6A 3HLCA 4R23A 3SOIA 1EROA 4R1GA 1ESIA 1GHIA 2P9VB 1SCWA 4ZTKA 5IHVA 3V5MA 3W4OA 4BJPA 3NI9A 3SS3A 3IWOA 2XQZA 5FSRA 2Y2NA 2WYXA 1FSWA 4R0QA 3BECA 3ZGAB 1LLBA 2J7VA 3I7JA 4S2OA 4IBRA 1SKFA 5FAOA 2XDMA 4X68A 1K4FA 4KZ3A 4C3QA 1WE4A 1XGJA 1Y54A 2PU2A 3OCLA 4N1XA 5FI2A 5GLAA 3WS4A 1IYPA 4YINA 5CXWA 2HP5A 4WBGA 1ALQA 1L0GA 5FI7A 3IHBA 1IEMA 4C75A 2P9VA 1MY8A 3ZDJA 4OPRA 2Y2GA 1LL9A 3UO9A 1ESUA 2XK1A 3UE0A 1IYOA 2XFTA 4RA7A 4BD1A 1GA9A 4S2LA 1PI5A 5FQMA 3UY6A 3BM6A 4B88A 4PM6A 3W4PA 4BD0A 3Q1FA 2RL3A 3C5AA 5CHJA 5CRFA 1ERQA 4OVDA 2HDSA 4WEKA 1SHVA 4HESA 1PI4A 3UPNA 1KE0A 3A3IA 3MXSA 3UE1A 3P09A 2HP9A 2WGWB 4NETA 1NJ4A 1DJBA 3G31A 3MKFA 5EVIA 1NYMA 2WUQA 5GLBA 3TG9A 5A90A 4OH0A 3GR2A 1M6KA 3LO7A 4DDYA 1L2SA 1E4DA 1YMXA 1FR1A 1K55A 5U47A 3BFCA 4S2JA 2VGJA 4S2NA 2E8IA 2G2UA 1K4EA 3SS4A 1NZOA 2Y91A 2XFSA 4UA9A 4M3KA 1ZG4A 1KVMA 1NYYA 1DJAA 4JXGA 1L0EA 1XXMA 2X71A 1IYSA 1K6RA 1WYBA 1KVLA 2WGVA 3UPPA 3IWQA 1FSYA 2HPBA 5GL9A 4P87A 5JYPA 2ZQAA 4KG5A 5AQAA 3QHYA 3HLFA 3W4QA 4U0XA 4BENA 2Y2HA 4E3IA 4P85A 1BZAA 5HAIA 2Y2LA 2ZD8A 1DY6A 4WM9A 3ZG5A 4E3KA 3MZDA 5FI6A 4E3MA 5E2GA 1E25A 1H8YA 1L0DA 4OKPA 1MXOA 2ZQCA 3DTMA 3N8SA 5HARA 3IF6C 2PBYA 1FCMA 4L0LA 4DKIA 4LENA 3IXGA 4NK3A 2WKIA 1PWDA 1XA1A 4B4XA 4IEDA 1RGYA 3PBSA 3NIAA 3IXDA 1I5QA 4HEFA 4KZAA 3WS2A 3ZG8B 3IF6B 1W8YA 4FH4A 5E2EA 2X01A 4GB7A 1GHPA 2ZQ9A 3MBZA 4O7DA 1ES2A 1FOFA 1N9BA 3OCNA 2C6WB 3GMWA 4RVAA 5DF7A 4JPMA 1L0FA 1XKZA 2EXBA 3PBTA 4ZJ3A 1WYCA 5CGSA 4WEJA 1YLTA 1MWRA 2UWXA 4RX3A 2ZMAA 3IXBA 3MZEA 4Y7PA 1KDSA 1EWZA 4RX2A 4U0TA 3Q7VA 4GDBA 3G32A 5F1FA 1OMEA 3IF6A 2EX6A 3FV7A 3HVFA 3IHAA 3BRMA 1K54A 2DCFA 3IT9A 4PMAA 3UDIA 4Z9QA 1TDGA 4DE1A 3MKEA 4KZ7A 3IXHA 2Y2KA 4MNRA 4KG2A 3HUOA 1BLHA 1CK3A 3HBRA 4DRTA 2WZXA 4S2MA 5CEBA 1RP5A 2ZQDA 4OOLA 3QNBA 4IBXA 4XUXA 5FAQA 4OPZA 3EQUA 5BOHA 3SS5A 4PM9A 2IWBA 3Q82A 1KGGA 3ISGA 4JXVA 4LV2A 4OPQA 3WRTA 3DWKA 3NDGA 1ZC2A 4HBTA 1E3UD 2Z2LB 1MPLA 4JKTA 4BLMA 4DE3A 1K55C 3N4IA 2H10A 4KZ6A 1BTLA 3CJMA 1ERMA 1NXYA 1C3BA 3OZHA 1GA0A 1QMEA 2ZQ7A 3ZG7B 4Y0OA 1O07A 1K25A 4R3JA 3ZG0A 5CECA 5CEDA 1H8ZA 5F1GA 5A91A 2WGWA 3O3VA 3O88A 1KDWA 4JXSA 4KZBA 2V1ZA 3NY4A 1LI9A 4OP8A 4EQIA 4KG6A 2P74A 5AQBA 1ZG6A 4EV4A 1BT5A 1G68A 4ZBEA 3NBLA 3IH9A 3VOZA 4UAAA 4X56A 4ZJ2A 3UN7A 3D4FA 4LCLA 5FATA 2ZM0A 1ES5A 4OQGA 3GSGA 1N4OA 3WS5A 2A3UA 1GCEA 5E43A 4S2KA 2J8YA 3CZDA 1YQSA 4ID4A 4P0MA 5CHUA 3LY4A 1J9MA 1PYYA 4PM7A 5F83A 3TSGA 1MWUA 4DDSA 4QJGA 1CEGA 3NC8A 4DE2A 5D3OA 1JVJA 1LL5A 3OPPA 1ONHA 2R9WA 3M2JA 4WELA 4KZ9A 3FKVA 3ZHHA 1Q2QA 4JF5A 4WZ4A 3FYZA 4BL3A 2Y2JA 2CC1A 3A3FA 3OPRA 2I72A 1O7EA 1VQQA 2XD1A 5EVID 3BFDA 4QHCA 3BLMA 2BG1A 1W8QA 3Q81A 3VP3A 1MWTA 2X02A 4OOYA 4IVKA 3ZCZA 3IH8A 5TR7A 1BULA 2XLNA 4R4RA 1I2SA 3SH7A 3S22A 4OLGA 3TOIA 3HREA 4FD8A 3VP2A 1MWSA 1YLYA 3Q07A 3ZNYA 2Y2MA 1KGFA 2FFYA 3OPHA 1JTDA 2RCXA 3S1YA 3M2KA 4OQ0A 2EFXA 2G2WA 3AGDA 3N7WA 4B4ZA 3MXRA 5FQJA 2EFUA 2ZQ8A 1PWCA 5FQKA 5EECA 5EPHA 2ZJ9A 1NRFA 4MBFA 3G4PA 5CERA 5A92A 1EI5A 3SH9A 4OOMA 2Q9MA 5EE8A 1IELA 3M6BA 2ZC7A 4H8RA 3RJUA 3HLDA 5JYOA 3BYDA 4CPKA 2BLSA 2Y2QA 2B5RA 5FDHA 4S2PA 1JWPA 3ZVWA 1PW1A 1W79A 2XD5A 4KZ5A 2JC7A 3A3DA 4U3TA 4EBPA 5FAPA 1BLPA 2C5WB 4XXRA 5CGXA 2FFFB 2J9OA 2OSUA 2R9XA 2QMIA 4XUZA 3N8RA 1QMFA 5GHXA 4MBKA 5TFQA 3ITBA 5KSHA 4PM8A 2WKEA 1SDEA 3A3JA 3ZVTA 1K38A 3G34A 1GHMA 3BFEA 4FSFA 1LHYA 3Q7ZA 4ZDXA 2OLUA 5A93A 2WGIA 3GQZA 3PBRA 1HD8A 4KQQA 3JYIA 3VMAA 4MLLA 1SDNA 2ZM8A 3HLBA 1TEMA 1E3UA 4ZAMA 3IF5A 3HLEA 3BLSA 1BSGA 5DTKA 5FQIA 1DJCA 5J8XA 5TGFA 1BLCA 4OP5A 3V39A 1PZPA 1U60A 2V2FF 2Y2PA 1XA7A 3OC2A 5GLDA 1XP4A 2Y59A 4C6YA 3HUNA 5L2FA 3V50A 3N6IA 3EQVA 1VM1A 1NY0A 3B3XA 4Q8IA 3LCEA 5CGWA 2ZM2A 3VFHA 3FKWA 2Y2IA 1MKIA 4E3LA 5DVAA 3BFGA 1S6RA 3C4OA 4ZJ1A 3ZNTA 1AXBA 1IKIA 1TVFA 4FCFA 3CMZA 2ZC6B 1YMSA 1K54C 3P98A 2Y55A 2GDNA 4WZ5C 4GNUA 5CHMA 5DF9A 5EOOA 3VOYA 4YFMA 5KMWA 3PAGA 4A5RA 3UDFA 4JLFA 1XX2A 3A3EA 4QB8A 5GHZA 4IVIA 2Y2OA 2QZ6A 4MEZA 4QY5A 5HW3A 1FCNA 1RCJA 4KZ8A 4GDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EBN A;  5FA7 A;  4E3O A;  5AQ9 A;  5FAS A;  3G35 A;  4GN2 A;  1ZKJ A;  2Q9N A;  4OQH A;  3IWI A;  2Z2M B;  4BQM A;  3NDE A;  4UHU A;  1MBL A;  2XGN A;  3N8L A;  3PBN A;  5DTS A;  2WAE A;  3MZF A;  3OPL A;  1CEF A;  4GZB A;  1BUE A;  5FQQ A;  1YM1 A;  2WAD A;  5F82 A;  1ES3 A;  2JE5 A;  5EVI C;  3QNC A;  4OPY A;  1H5X A;  2OLV A;  3E2L A;  1Q2P A;  3HLG A;  3HUM A;  3UPO A;  4E6W A;  2HDQ A;  3PBQ A;  1PZO A;  3GV9 A;  5DF8 A;  3MFD A;  4X69 A;  5M19 A;  2HP6 A;  1YT4 A;  4D2O A;  3WS1 A;  2ZC5 B;  1JTG A;  2XR0 A;  4JF4 A;  4KQO A;  4X53 A;  5EUA A;  1LI0 A;  3GTC A;  1PIO A;  5EVI B;  1M40 A;  4EBL A;  5KSC A;  3WS0 A;  4EWF A;  1CI8 A;  2QPN A;  1G6A A;  4K0X A;  5GHY A;  3PAE A;  2VGK A;  1YLZ A;  4CJN A;  2A49 A;  4E6X A;  3O87 A;  4GOG A;  4JXW A;  3G2Z A;  4JF6 A;  4LV1 A;  4DXC A;  3VP4 A;  1HTZ A;  2JCH A;  3C4P A;  4PM5 A;  3CG5 A;  2WK0 A;  2XH9 A;  2IWC A;  4QD4 A;  1HVB A;  3UDX A;  5HFO A;  3M6H A;  3UE3 A;  5G18 A;  4E3J A;  1K6S A;  4MBH A;  2OV5 A;  4X55 A;  4Y0T A;  2EX2 A;  4P6B A;  1FCO A;  1I2W A;  1KE3 A;  4Y0U A;  1W7F A;  3S4X A;  2WKH A;  4JBF A;  3WRZ A;  1BLS A;  5KZH A;  4EUZ A;  4FH2 A;  4GKU A;  5HAP A;  2IWD A;  3DW0 A;  3ITA A;  1Z6F A;  1XGI A;  2DNS A;  3O86 A;  2H5S A;  3RXX A;  2HDU A;  3IQA A;  4WYY A;  3FZC A;  2V20 A;  1K57 A;  5EOE A;  4WMC A;  2XF3 A;  2ZLY A;  4KZ4 A;  1K56 D;  4N1H A;  3HL9 A;  2WAF A;  2JBF A;  3BFF A;  4N9L A;  4OQI A;  2ZC3 B;  3GRJ A;  4R4S A;  5EVL A;  2HDR A;  3G2Y A;  4LCM A;  3RXW A;  4E3N A;  2PU4 A;  5E2H A;  4GD6 A;  3UNW A;  1K57 C;  2H0Y A;  3E2K A;  3BEB A;  4WMC D;  3GVB A;  4S2N C;  1K56 A;  1HZO A;  5I94 A;  4GD8 A;  1YLW A;  4KEN B;  3NCK A;  5FQ9 A;  1PW8 A;  2EX9 A;  3VFF A;  3ZG9 B;  5M1A A;  1ES4 A;  4K91 A;  4X6T A;  4F94 A;  1IYQ A;  1FQG A;  3Q7V B;  4LV0 A;  1FR6 A;  1RGZ A;  5E2F A;  2ZC4 B;  5HX9 A;  3VSL A;  2WZZ A;  3HLW A;  4BL2 A;  3LY3 A;  5HAQ A;  1CI9 A;  1TDL A;  3C7V A;  5GLC A;  3V3R A;  1NZU A;  4N92 A;  3ZFZ A;  5CTM A;  1W5D A;  1XPB A;  4LV3 A;  4PPR A;  5HL1 A;  3V3S A;  3FWL A;  3DWZ A;  4N9K A;  1S0W A;  4RYE A;  3VP0 A;  3AGF A;  4UA6 A;  4QU3 A;  2EX8 A;  2J9P A;  1YLP A;  3PBO A;  5AQ7 A;  3WWX A;  1YLJ A;  1IKG A;  4K0W A;  1KGE A;  1PWG A;  2H0T A;  4OLD A;  2EXA A;  4S2I A;  5M18 A;  4UA7 A;  4HBU A;  3VP1 A;  1JWZ A;  3G30 A;  3C7U A;  4R3B A;  5DTT A;  4DXB A;  4OON A;  3AGE A;  3W8K A;  1KE4 A;  2XEP A;  4DE0 A;  5CTN A;  1JWV A;  1ONG A;  4KQR A;  3VSK A;  3SH8 A;  2DRW A;  3LEZ A;  3PTE A;  2Y4A A;  4WZ5 A;  4DF6 A;  4QY6 A;  3HLC A;  4R23 A;  3SOI A;  1ERO A;  4R1G A;  1ESI A;  1GHI A;  2P9V B;  1SCW A;  4ZTK A;  5IHV A;  3V5M A;  3W4O A;  4BJP A;  3NI9 A;  3SS3 A;  3IWO A;  2XQZ A;  5FSR A;  2Y2N A;  2WYX A;  1FSW A;  4R0Q A;  3BEC A;  3ZGA B;  1LLB A;  2J7V A;  3I7J A;  4S2O A;  4IBR A;  1SKF A;  5FAO A;  2XDM A;  4X68 A;  1K4F A;  4KZ3 A;  4C3Q A;  1WE4 A;  1XGJ A;  1Y54 A;  2PU2 A;  3OCL A;  4N1X A;  5FI2 A;  5GLA A;  3WS4 A;  1IYP A;  4YIN A;  5CXW A;  2HP5 A;  4WBG A;  1ALQ A;  1L0G A;  5FI7 A;  3IHB A;  1IEM A;  4C75 A;  2P9V A;  1MY8 A;  3ZDJ A;  4OPR A;  2Y2G A;  1LL9 A;  3UO9 A;  1ESU A;  2XK1 A;  3UE0 A;  1IYO A;  2XFT A;  4RA7 A;  4BD1 A;  1GA9 A;  4S2L A;  1PI5 A;  5FQM A;  3UY6 A;  3BM6 A;  4B88 A;  4PM6 A;  3W4P A;  4BD0 A;  3Q1F A;  2RL3 A;  3C5A A;  5CHJ A;  5CRF A;  1ERQ A;  4OVD A;  2HDS A;  4WEK A;  1SHV A;  4HES A;  1PI4 A;  3UPN A;  1KE0 A;  3A3I A;  3MXS A;  3UE1 A;  3P09 A;  2HP9 A;  2WGW B;  4NET A;  1NJ4 A;  1DJB A;  3G31 A;  3MKF A;  5EVI A;  1NYM A;  2WUQ A;  5GLB A;  3TG9 A;  5A90 A;  4OH0 A;  3GR2 A;  1M6K A;  3LO7 A;  4DDY A;  1L2S A;  1E4D A;  1YMX A;  1FR1 A;  1K55 A;  5U47 A;  3BFC A;  4S2J A;  2VGJ A;  4S2N A;  2E8I A;  2G2U A;  1K4E A;  3SS4 A;  1NZO A;  2Y91 A;  2XFS A;  4UA9 A;  4M3K A;  1ZG4 A;  1KVM A;  1NYY A;  1DJA A;  4JXG A;  1L0E A;  1XXM A;  2X71 A;  1IYS A;  1K6R A;  1WYB A;  1KVL A;  2WGV A;  3UPP A;  3IWQ A;  1FSY A;  2HPB A;  5GL9 A;  4P87 A;  5JYP A;  2ZQA A;  4KG5 A;  5AQA A;  3QHY A;  3HLF A;  3W4Q A;  4U0X A;  4BEN A;  2Y2H A;  4E3I A;  4P85 A;  1BZA A;  5HAI A;  2Y2L A;  2ZD8 A;  1DY6 A;  4WM9 A;  3ZG5 A;  4E3K A;  3MZD A;  5FI6 A;  4E3M A;  5E2G A;  1E25 A;  1H8Y A;  1L0D A;  4OKP A;  1MXO A;  2ZQC A;  3DTM A;  3N8S A;  5HAR A;  3IF6 C;  2PBY A;  1FCM A;  4L0L A;  4DKI A;  4LEN A;  3IXG A;  4NK3 A;  2WKI A;  1PWD A;  1XA1 A;  4B4X A;  4IED A;  1RGY A;  3PBS A;  3NIA A;  3IXD A;  1I5Q A;  4HEF A;  4KZA A;  3WS2 A;  3ZG8 B;  3IF6 B;  1W8Y A;  4FH4 A;  5E2E A;  2X01 A;  4GB7 A;  1GHP A;  2ZQ9 A;  3MBZ A;  4O7D A;  1ES2 A;  1FOF A;  1N9B A;  3OCN A;  2C6W B;  3GMW A;  4RVA A;  5DF7 A;  4JPM A;  1L0F A;  1XKZ A;  2EXB A;  3PBT A;  4ZJ3 A;  1WYC A;  5CGS A;  4WEJ A;  1YLT A;  1MWR A;  2UWX A;  4RX3 A;  2ZMA A;  3IXB A;  3MZE A;  4Y7P A;  1KDS A;  1EWZ A;  4RX2 A;  4U0T A;  3Q7V A;  4GDB A;  3G32 A;  5F1F A;  1OME A;  3IF6 A;  2EX6 A;  3FV7 A;  3HVF A;  3IHA A;  3BRM A;  1K54 A;  2DCF A;  3IT9 A;  4PMA A;  3UDI A;  4Z9Q A;  1TDG A;  4DE1 A;  3MKE A;  4KZ7 A;  3IXH A;  2Y2K A;  4MNR A;  4KG2 A;  3HUO A;  1BLH A;  1CK3 A;  3HBR A;  4DRT A;  2WZX A;  4S2M A;  5CEB A;  1RP5 A;  2ZQD A;  4OOL A;  3QNB A;  4IBX A;  4XUX A;  5FAQ A;  4OPZ A;  3EQU A;  5BOH A;  3SS5 A;  4PM9 A;  2IWB A;  3Q82 A;  1KGG A;  3ISG A;  4JXV A;  4LV2 A;  4OPQ A;  3WRT A;  3DWK A;  3NDG A;  1ZC2 A;  4HBT A;  1E3U D;  2Z2L B;  1MPL A;  4JKT A;  4BLM A;  4DE3 A;  1K55 C;  3N4I A;  2H10 A;  4KZ6 A;  1BTL A;  3CJM A;  1ERM A;  1NXY A;  1C3B A;  3OZH A;  1GA0 A;  1QME A;  2ZQ7 A;  3ZG7 B;  4Y0O A;  1O07 A;  1K25 A;  4R3J A;  3ZG0 A;  5CEC A;  5CED A;  1H8Z A;  5F1G A;  5A91 A;  2WGW A;  3O3V A;  3O88 A;  1KDW A;  4JXS A;  4KZB A;  2V1Z A;  3NY4 A;  1LI9 A;  4OP8 A;  4EQI A;  4KG6 A;  2P74 A;  5AQB A;  1ZG6 A;  4EV4 A;  1BT5 A;  1G68 A;  4ZBE A;  3NBL A;  3IH9 A;  3VOZ A;  4UAA A;  4X56 A;  4ZJ2 A;  3UN7 A;  3D4F A;  4LCL A;  5FAT A;  2ZM0 A;  1ES5 A;  4OQG A;  3GSG A;  1N4O A;  3WS5 A;  2A3U A;  1GCE A;  5E43 A;  4S2K A;  2J8Y A;  3CZD A;  1YQS A;  4ID4 A;  4P0M A;  5CHU A;  3LY4 A;  1J9M A;  1PYY A;  4PM7 A;  5F83 A;  3TSG A;  1MWU A;  4DDS A;  4QJG A;  1CEG A;  3NC8 A;  4DE2 A;  5D3O A;  1JVJ A;  1LL5 A;  3OPP A;  1ONH A;  2R9W A;  3M2J A;  4WEL A;  4KZ9 A;  3FKV A;  3ZHH A;  1Q2Q A;  4JF5 A;  4WZ4 A;  3FYZ A;  4BL3 A;  2Y2J A;  2CC1 A;  3A3F A;  3OPR A;  2I72 A;  1O7E A;  1VQQ A;  2XD1 A;  5EVI D;  3BFD A;  4QHC A;  3BLM A;  2BG1 A;  1W8Q A;  3Q81 A;  3VP3 A;  1MWT A;  2X02 A;  4OOY A;  4IVK A;  3ZCZ A;  3IH8 A;  5TR7 A;  1BUL A;  2XLN A;  4R4R A;  1I2S A;  3SH7 A;  3S22 A;  4OLG A;  3TOI A;  3HRE A;  4FD8 A;  3VP2 A;  1MWS A;  1YLY A;  3Q07 A;  3ZNY A;  2Y2M A;  1KGF A;  2FFY A;  3OPH A;  1JTD A;  2RCX A;  3S1Y A;  3M2K A;  4OQ0 A;  2EFX A;  2G2W A;  3AGD A;  3N7W A;  4B4Z A;  3MXR A;  5FQJ A;  2EFU A;  2ZQ8 A;  1PWC A;  5FQK A;  5EEC A;  5EPH A;  2ZJ9 A;  1NRF A;  4MBF A;  3G4P A;  5CER A;  5A92 A;  1EI5 A;  3SH9 A;  4OOM A;  2Q9M A;  5EE8 A;  1IEL A;  3M6B A;  2ZC7 A;  4H8R A;  3RJU A;  3HLD A;  5JYO A;  3BYD A;  4CPK A;  2BLS A;  2Y2Q A;  2B5R A;  5FDH A;  4S2P A;  1JWP A;  3ZVW A;  1PW1 A;  1W79 A;  2XD5 A;  4KZ5 A;  2JC7 A;  3A3D A;  4U3T A;  4EBP A;  5FAP A;  1BLP A;  2C5W B;  4XXR A;  5CGX A;  2FFF B;  2J9O A;  2OSU A;  2R9X A;  2QMI A;  4XUZ A;  3N8R A;  1QMF A;  5GHX A;  4MBK A;  5TFQ A;  3ITB A;  5KSH A;  4PM8 A;  2WKE A;  1SDE A;  3A3J A;  3ZVT A;  1K38 A;  3G34 A;  1GHM A;  3BFE A;  4FSF A;  1LHY A;  3Q7Z A;  4ZDX A;  2OLU A;  5A93 A;  2WGI A;  3GQZ A;  3PBR A;  1HD8 A;  4KQQ A;  3JYI A;  3VMA A;  4MLL A;  1SDN A;  2ZM8 A;  3HLB A;  1TEM A;  1E3U A;  4ZAM A;  3IF5 A;  3HLE A;  3BLS A;  1BSG A;  5DTK A;  5FQI A;  1DJC A;  5J8X A;  5TGF A;  1BLC A;  4OP5 A;  3V39 A;  1PZP A;  1U60 A;  2V2F F;  2Y2P A;  1XA7 A;  3OC2 A;  5GLD A;  1XP4 A;  2Y59 A;  4C6Y A;  3HUN A;  5L2F A;  3V50 A;  3N6I A;  3EQV A;  1VM1 A;  1NY0 A;  3B3X A;  4Q8I A;  3LCE A;  5CGW A;  2ZM2 A;  3VFH A;  3FKW A;  2Y2I A;  1MKI A;  4E3L A;  5DVA A;  3BFG A;  1S6R A;  3C4O A;  4ZJ1 A;  3ZNT A;  1AXB A;  1IKI A;  1TVF A;  4FCF A;  3CMZ A;  2ZC6 B;  1YMS A;  1K54 C;  3P98 A;  2Y55 A;  2GDN A;  4WZ5 C;  4GNU A;  5CHM A;  5DF9 A;  5EOO A;  3VOY A;  4YFM A;  5KMW A;  3PAG A;  4A5R A;  3UDF A;  4JLF A;  1XX2 A;  3A3E A;  4QB8 A;  5GHZ A;  4IVI A;  2Y2O A;  2QZ6 A;  4MEZ A;  4QY5 A;  5HW3 A;  1FCN A;  1RCJ A;  4KZ8 A;  4GDN A; 
#chains in the Genus database with same CATH topology
 2VX8 A;  2JHE A;  5FA7 A;  5AQ9 A;  4GN2 A;  4HHD A;  3KSI A;  3NOU C;  2WAE A;  3OPL A;  1A0K A;  1F9I A;  1CEF A;  1BUE A;  5HSQ A;  4OPY A;  1YSP A;  4E6W A;  3GV9 A;  5DF8 A;  4X69 A;  5M19 A;  4D2O A;  1OTD A;  1JTG A;  3GTC A;  1LL8 A;  1PIO A;  4EBL A;  4MN7 A;  4K0X A;  5F6A A;  3PAE A;  3UB8 A;  3BWL A;  4JF6 A;  2JKT M;  2JCH A;  3NOT C;  2V9A A;  3RTY A;  1K6S A;  1NLY A;  4X55 A;  1XFN A;  2ZMV A;  3MQO A;  4KUK A;  5KZH A;  4EUZ A;  4FH2 A;  3UE6 A;  3LEQ A;  3ITA A;  5IT5 A;  1Z6F A;  3KYZ A;  4UEY A;  1S1Z A;  5EM1 A;  4CLC E;  2H5S A;  2PD8 A;  4BBV A;  3IQA A;  3CPT A;  1ZTU A;  2VJW A;  2QHK A;  2PR6 A;  3UNW A;  1K57 C;  4Y5F A;  4GD8 A;  1PW8 A;  2EX9 A;  1W63 M;  4X6T A;  1HLU P;  2O9B A;  1FR6 A;  1RGZ A;  3HJI A;  5HX9 A;  5HAQ A;  3MF0 A;  1TDL A;  4R38 A;  4FTX A;  4N9K A;  1S0W A;  3VP0 A;  4F3L A;  1YLJ A;  4K0W A;  1KGE A;  2H0T A;  4S2I A;  4UQI S;  5M18 A;  4R3B A;  1EW0 A;  2J3T C;  5CTN A;  4KQR A;  1F98 A;  3VSK A;  3QP4 A;  4QY6 A;  2W3F A;  1MKM A;  1SKO A;  4R1G A;  3T1Q B;  3SS3 A;  4F3L B;  2OWH A;  3NOP C;  3D3O A;  3IX4 A;  1OTA A;  2Y2N A;  5L07 A;  4YWZ A;  1LLB A;  3LUQ A;  3W2Z A;  4S2O A;  1LSX A;  3UB5 P;  3NUL A;  2UV0 E;  2A24 A;  5GLA A;  5CXW A;  4ETZ A;  4Q0H A;  4RA7 A;  5AVE A;  4BD1 A;  4EER A;  5FQM A;  1PI5 A;  3UY6 A;  3BM6 A;  3W4P A;  2PT7 A;  3LR4 A;  2VV8 A;  2V0U A;  3UPN A;  3A3I A;  3UE1 A;  4NET A;  3G31 A;  1NYM A;  5DJT A;  1M6K A;  1Z09 A;  3S7Q A;  5U47 A;  4PKY G;  2G2U A;  3P7N A;  1NZO A;  4IHQ A;  2Y91 A;  1ZG4 A;  1KVM A;  1K6R A;  2JKR I;  3LIE A;  1GSV A;  5GL9 A;  4P87 A;  2L4R A;  4KG5 A;  3W4Q A;  4Y13 A;  2Y2L A;  2ZD8 A;  1DY6 A;  3IS2 A;  5E2G A;  4MN6 A;  2W27 A;  4Y17 A;  2OAQ 1;  1OT6 A;  4NK3 A;  2WKI A;  1PWD A;  1XA1 A;  4AFI A;  4B4X A;  2X01 A;  4IUH A;  3MBZ A;  2INW A;  1N9B A;  3F1N A;  3GMW A;  3PBT A;  2M7V A;  1OTB A;  3QP6 A;  5CGS A;  1YLT A;  1MWR A;  4RX3 A;  4RX2 A;  2V1B A;  3ULF A;  4ARZ B;  2PHY A;  2PAV P;  2XA7 S;  3MKE A;  2GNX A;  4MNR A;  3HUO A;  4XT2 B;  1BLH A;  2A2L A;  4JGP A;  2V8F A;  3VV4 A;  2HGV A;  2I9V A;  2IWB A;  4JXV A;  4LV2 A;  1TS0 A;  1ZC2 A;  2Z2L B;  4BLM A;  3RFB A;  2H10 A;  3CJM A;  1C3B A;  1G6O A;  4Y0O A;  2FZ0 A;  5J3W A;  3O3V A;  2BTF P;  4JXS A;  1LI9 A;  1ZG6 A;  4BBU A;  2ZBB A;  3BW6 A;  3T4T A;  3C2W A;  2J8Y A;  1L3L A;  4P0M A;  4ID4 A;  3LY4 A;  4PM7 A;  3NC8 A;  5D3O A;  1JVJ A;  1LL5 A;  2R9W A;  3ZHH A;  3FKV A;  4NXG A;  3R7W A;  4BL3 A;  2Y2J A;  3VE4 A;  3A3F A;  2BG1 A;  2W3E A;  2X02 A;  5EVE A;  4IVK A;  3ZCZ A;  1T1A A;  4HOI A;  3IS2 B;  5TR7 A;  1I2S A;  3VP2 A;  1MWS A;  1OPX A;  3F1P A;  1XJ6 A;  3M2K A;  5FQJ A;  2EFU A;  2ZQ8 A;  5FQK A;  2ZJ9 A;  5HPF A;  1DP9 A;  1EI5 A;  2VV6 A;  4OOM A;  2Q9M A;  5JYO A;  5HL6 A;  2B5R A;  4ZRR A;  3ZVW A;  1PW1 A;  1W79 A;  4I3J A;  2XD5 A;  4KZ5 A;  2C5W B;  2FFF B;  3N8R A;  1QMF A;  3ITB A;  5KSH A;  2WKE A;  4HJ6 A;  3A3J A;  3G34 A;  2GX5 A;  1HD8 A;  4I38 A;  1OJ5 A;  1IFQ A;  1SDN A;  3HLB A;  1TEM A;  1E3U A;  3H7W B;  1OT9 A;  2NUT C;  2EWW A;  3HLE A;  1BLC A;  3UB6 A;  3V39 A;  1PZP A;  1TF1 A;  3R7W B;  1T1B A;  3TRC A;  1DP8 A;  3QP1 A;  3EQV A;  1VM1 A;  3B3X A;  3LCE A;  2Y2I A;  3ZNT A;  1IKI A;  4FCF A;  3ICY A;  1K54 C;  4WZ5 C;  5CHM A;  3H9W A;  5KMW A;  3PAG A;  4QB8 A;  2O9C A;  2Y2O A;  4KUO A;  2QJ5 A;  4KZ8 A;  3FPV A;  3NEC A;  5LBR A;  1ZKJ A;  3T4L A;  3N8L A;  3PBN A;  1CJF A;  5DTS A;  1YM1 A;  3E2L A;  3NJA A;  1GSW A;  3UPO A;  2HDQ A;  5TJJ A;  3PBQ A;  1PZO A;  3C38 A;  1YT4 A;  3EGD C;  3WS1 A;  2ZC5 B;  3DBA A;  3LR0 A;  4EWF A;  1CI8 A;  3LYX A;  2P04 A;  5GHY A;  3UB9 A;  1LSV A;  2ZL1 A;  2VGK A;  3O87 A;  4JXW A;  3VP4 A;  1UWP X;  3CG5 A;  4FOF A;  2XH9 A;  2IWC A;  1HVB A;  5HFO A;  4JGR A;  1BYW A;  2EX2 A;  3F1N B;  3MQQ A;  2VGL S;  4H6J A;  4P6Z S;  2QJ7 A;  5HAP A;  3DW0 A;  3KSG A;  2KOI A;  2HDU A;  3FZC A;  1K57 A;  5L8M A;  2ZLY A;  3MMH A;  1G5U A;  4N1H A;  1K56 D;  5J7E A;  2JBF A;  3BFF A;  4N9L A;  2E8J A;  2ZC3 B;  3MSH A;  3NHQ A;  3G2Y A;  3RXW A;  4E3N A;  5E2H A;  4GD6 A;  2BAS A;  3BEB A;  3C30 A;  3GVB A;  1K56 A;  3JPU A;  5I94 A;  1YLW A;  5HDS A;  4KEN B;  3ZG9 B;  1LSW A;  2WZZ A;  4BL2 A;  2W1T A;  5G4Z A;  3C7V A;  5GLC A;  5K5B A;  3ZFZ A;  4LV3 A;  5HL1 A;  4PPR A;  3V3S A;  3FWL A;  3DWZ A;  3E0Y A;  1LT0 A;  4RYE A;  4R6L A;  3EWK A;  2W0N A;  3T1R A;  4UA6 A;  2YKH A;  4QU3 A;  4CLC D;  1YLP A;  3PBO A;  3WWX A;  3BQ8 A;  1IKG A;  3E4Q A;  4OLD A;  3KYQ A;  3U4L P;  3BY8 A;  2LB5 A;  3VP1 A;  3G30 A;  4DXB A;  4OON A;  3W8K A;  1P97 A;  2OOL A;  3MR0 A;  4WF0 A;  1ONG A;  4Y2F A;  4DF6 A;  4WZ5 A;  4LPZ A;  3HLC A;  4EEU A;  4BWI A;  1ERO A;  1JNU A;  2OAP 1;  3E4P A;  4ZTK A;  1GHI A;  3W4O A;  3NI9 A;  1UGU A;  2A24 B;  3VE3 A;  1MC0 A;  1DRM A;  2WYX A;  5HD3 A;  4R0Q A;  3BEC A;  2J7V A;  3I7J A;  4IBR A;  2XDM A;  1K4F A;  4HH3 A;  4KZ3 A;  1Y54 A;  4N1X A;  1VET B;  5FI2 A;  3DTI A;  1ALQ A;  5FI7 A;  3IHB A;  5TBM B;  1MY8 A;  3ZDJ A;  3HJK A;  3UO9 A;  1ESU A;  2GZA A;  3UE0 A;  4Y15 A;  1GA9 A;  4S2L A;  3F1P B;  4X1L A;  4BD0 A;  4OVD A;  3T4Q A;  3S7P A;  4MCW A;  2HZ5 A;  2HP9 A;  1DJB A;  3UB7 A;  2PR5 A;  2WUQ A;  1TD5 A;  5HWW A;  3LO7 A;  3OOV A;  4DN0 A;  1E4D A;  1FR1 A;  3BFC A;  2EA9 A;  2E8I A;  2VEA A;  2VA0 A;  2XFS A;  4UA9 A;  4G3V A;  1NYY A;  1IYS A;  1WYB A;  2WGV A;  3UPP A;  1FSY A;  1FIL A;  2ZQA A;  3HLF A;  4U0X A;  2Y2H A;  3LI8 A;  1VEU B;  4G3W A;  4XT2 A;  5FI6 A;  2W3D A;  4ESP A;  3DTM A;  3N8S A;  3IF6 C;  2PBY A;  4LEN A;  3IXG A;  3ZQ5 A;  4KZA A;  4FH4 A;  5E2E A;  4GB7 A;  2JN7 A;  3V67 A;  1FOF A;  2C6W B;  1XFQ A;  4JPM A;  4WLA A;  1WYC A;  2MJ6 A;  3QP8 A;  3MZE A;  4Y7P A;  3MS6 A;  4GCZ A;  3G32 A;  2JKF A;  3UME A;  3IHA A;  1SKO B;  3BRM A;  2DCF A;  4Z9Q A;  2Q0O A;  4Y3I A;  3CHW P;  4DE1 A;  1T1C A;  4KZ7 A;  3IXH A;  2Y2K A;  2JKR M;  1CK3 A;  2WZX A;  4S2M A;  1W63 Q;  2ZQD A;  4XUX A;  2PYP A;  5BOH A;  5EFW A;  3ISG A;  3DWK A;  4HBT A;  4DE3 A;  2M1C A;  2Z6C A;  4KZ6 A;  1MZU A;  3OZH A;  5DKK A;  2ZQ7 A;  3ZG7 B;  2VZW A;  1K25 A;  4R3J A;  2V1Z A;  3NY4 A;  4E04 A;  3NBL A;  3VOZ A;  4IJG A;  1ES5 A;  3JVV A;  4ARZ A;  2A3U A;  1XJ3 A;  4E6X A;  5F83 A;  3TSG A;  1J3W A;  4QJG A;  3LR5 A;  2Y79 A;  3M2J A;  4WEL A;  3T4O A;  3D72 A;  3FYZ A;  2D01 A;  3LIF A;  1P9R A;  1VQQ A;  3QP5 A;  5EVI D;  4I5S A;  3BFD A;  1Y28 A;  1MWT A;  4OOY A;  3BQA A;  4R4R A;  4WL9 A;  3SH7 A;  3JVU A;  3TOI A;  2WKP A;  3ZNY A;  4HI4 A;  4R70 A;  3CAX A;  1JTD A;  2EFX A;  4B4Z A;  5EPH A;  3LFV A;  1NRF A;  4EW7 A;  5EE8 A;  1IEL A;  4H8R A;  3BYD A;  2BLS A;  5FDH A;  4S2P A;  4NXF A;  1S4S A;  4I3I A;  1STZ A;  4KQD A;  5A8B A;  4U3T A;  5FAP A;  1P9W A;  2J9O A;  2OSU A;  1XJ4 A;  3H7W A;  5GHX A;  4MBK A;  3L7H A;  3K2N A;  3T4K A;  3ZVT A;  1GHM A;  2O9A A;  3BFE A;  3H82 B;  3L9K A;  1TS8 A;  4KQQ A;  2HV1 A;  3IBJ A;  5FDS A;  4LGW A;  4MLL A;  3DTE A;  3IF5 A;  5FQI A;  3TE8 A;  2K31 A;  1NLZ A;  2Y2P A;  4H6J B;  5GLD A;  4C6Y A;  5L2F A;  3V50 A;  5HD5 A;  1UWN X;  4Q8I A;  4LFU A;  5CGW A;  3VFH A;  3BFG A;  5L09 A;  4ZJ1 A;  1AXB A;  2Y55 A;  2GDN A;  2LB9 A;  3LIC A;  3VOY A;  3S7O A;  3DAV A;  4X1M A;  3UDF A;  4JLF A;  5GHZ A;  4IVI A;  3T4S A;  1RCJ A;  4GDN A;  4E3O A;  3F1O B;  1VHM A;  5FAS A;  4OQH A;  4YOF A;  4BQM A;  2Z2M B;  3NDE A;  3FG8 A;  2ZOH A;  3MZF A;  1K0K A;  5FQQ A;  5EVI C;  3QNC A;  1H5X A;  3HUM A;  1Q2P A;  3HLG A;  2HJ9 C;  2DMW A;  3MFD A;  1P0Z A;  2PYR A;  5KIZ A;  2HP6 A;  2L1M A;  4JF4 A;  4X53 A;  1M40 A;  5KSC A;  2QPN A;  4Q0I A;  3PXP A;  4CJN A;  2A49 A;  3G2Z A;  1HTZ A;  3C4P A;  4BBT A;  5HPI A;  1D06 A;  2WK0 A;  3SZT A;  4NXB A;  4QD4 A;  3MJQ A;  3UE3 A;  4PHT A;  5G18 A;  4E3J A;  4Y0T A;  3CUE C;  1W7F A;  3S4X A;  2WKH A;  1VB6 A;  4JBF A;  3WRZ A;  4GKU A;  2IWD A;  4GHI A;  3O86 A;  3RXX A;  2V20 A;  1D7E A;  4KZ4 A;  4OQI A;  3GRJ A;  4R4S A;  1S67 L;  4LCM A;  5HZH A;  4B93 A;  2L0W A;  1HZO A;  5FQ9 A;  5M1A A;  4F94 A;  5G4Y A;  3Q7V B;  5E2F A;  2Z6D A;  2ZC4 B;  3VSL A;  3LR3 A;  4GJ4 A;  3HLW A;  3LY3 A;  1CI9 A;  1NZU A;  4N92 A;  1OTI A;  1W5D A;  3T1S A;  2V0W A;  3AGF A;  2J9P A;  4QWO A;  2HJE A;  5AQ7 A;  2EXA A;  3RH8 B;  2Y8H A;  2XRN A;  4UA7 A;  1JWZ A;  3C7U A;  3FPW A;  4DE0 A;  2J80 A;  4RQ9 A;  2DRW A;  3LEZ A;  2Y4A A;  4O01 A;  4PKY A;  1ESI A;  5TBM A;  1SCW A;  4BJP A;  4CLC C;  1VET A;  5FSR A;  3ZGA B;  5DKL A;  2QKP A;  1SKF A;  4C3Q A;  1XGJ A;  2PU2 A;  3WS4 A;  1IYP A;  2HP5 A;  1L0G A;  4C75 A;  2P9V A;  4OPR A;  1LL9 A;  2XK1 A;  4LLO B;  5F5Y A;  1IYO A;  2XFT A;  4B88 A;  4PM6 A;  3Q1F A;  3C5A A;  5CHJ A;  4X25 A;  3LID A;  2HDS A;  4HES A;  1KE0 A;  3P09 A;  1OTE A;  2WGW B;  1YAX A;  5EVI A;  3MFX A;  5A90 A;  4OH0 A;  1K55 A;  4MN5 A;  4S2J A;  2VGJ A;  3EEA A;  1K4E A;  4UQI M;  3CIT A;  1L0E A;  1XXM A;  2X71 A;  1YKD A;  4YNR A;  1KVL A;  3IWQ A;  2HPB A;  4L9G A;  3B47 A;  4P85 A;  4WM9 A;  1H0M A;  2D02 A;  2P7J A;  4OKP A;  2ZQC A;  5HAR A;  2EWV A;  4IED A;  3PBS A;  3IXD A;  2O99 A;  3ZG8 B;  3WS2 A;  2QWS A;  2ZQ9 A;  1H8M A;  3LIA A;  4RVA A;  3QP2 A;  5DF7 A;  1L0F A;  1XKZ A;  1N9L A;  4LRZ E;  4WEJ A;  2ZMA A;  1KDS A;  1EWZ A;  2J3T D;  4U0T A;  4HP9 A;  3Q7V A;  4GDB A;  3IF6 A;  3FV7 A;  3HVF A;  1K54 A;  4PMA A;  1TDG A;  2VGL M;  3CUE A;  4CQH A;  4P6Z M;  5F69 A;  3HBR A;  4Z1W A;  3IX3 A;  3A0V A;  5CEB A;  1RP5 A;  4OOL A;  5L10 A;  1CQA A;  4IBX A;  3SS5 A;  4PM9 A;  4L9F A;  1KGG A;  4OPQ A;  3WRT A;  3NDG A;  2VLG A;  4JKT A;  3IBR A;  1BTL A;  1ERM A;  1NXY A;  1GA0 A;  1QME A;  2JKT I;  1O07 A;  5CEC A;  2IA2 A;  5CED A;  1H8Z A;  5A91 A;  2WGW A;  3O88 A;  1KDW A;  1G28 A;  4ME4 A;  4OP8 A;  4EQI A;  4KG6 A;  5AQB A;  3PYP A;  1ZHH B;  1G68 A;  4ZBE A;  4HY8 A;  4UAA A;  4X56 A;  4ZJ2 A;  3D4F A;  4LCL A;  5FAT A;  3GSG A;  2H28 A;  5EV0 A;  3WS5 A;  2VKS A;  2K7S A;  1Y4O A;  4S2K A;  3EOI A;  3CZD A;  2OWJ A;  1J9M A;  1PYY A;  3UMD A;  4DDS A;  3OPP A;  1ONH A;  4KZ9 A;  1Q2Q A;  1DP6 A;  4JF5 A;  2CC1 A;  3OPR A;  2I72 A;  1O7E A;  2XD1 A;  1YPR A;  3BLM A;  1W8Q A;  3VP3 A;  4HNB A;  3IH8 A;  3U2A A;  2XRO A;  5C5K A;  3S22 A;  4OLG A;  3HRE A;  5HDC A;  1ODV A;  4FD8 A;  3MQ0 A;  3T50 A;  3P01 A;  2RCX A;  2P08 A;  4M4X A;  4OQ0 A;  4NG2 A;  2G2W A;  3AGD A;  3N7W A;  1PWC A;  5EEC A;  5FEG A;  4R3A A;  4MBF A;  3SW1 A;  3G4P A;  5CER A;  5A92 A;  3M6B A;  4WN5 A;  3RJU A;  3CWF A;  2KX6 A;  2JC7 A;  3A3D A;  5CGX A;  2R9X A;  3KSF A;  4XUZ A;  5TFQ A;  3T4J A;  3MXQ A;  4PM8 A;  5HDD A;  1TS7 A;  1K38 A;  4EU0 A;  4FSF A;  1LHY A;  3Q7Z A;  4ZDX A;  2OLU A;  3PBR A;  3KX0 X;  3JYI A;  3VMA A;  1V9Z A;  4ZAM A;  2WKQ A;  1BSG A;  5DTK A;  1DJC A;  5J8X A;  3GEC A;  3OC2 A;  1YSQ A;  4GS9 A;  1XP4 A;  2Y59 A;  2ZM2 A;  3FKW A;  1N9N A;  4E3L A;  5DVA A;  3C4O A;  4NEE D;  2ZC6 B;  1S4R A;  5FEF A;  4GNU A;  5DF9 A;  4L9E A;  4A5R A;  3E4O A;  2NUP C;  5HW3 A;  4QY5 A;  3LIB A;  4EBN A;  3O5Y A;  2PD7 A;  1OJG A;  3G35 A;  2Q9N A;  3LI9 A;  3IWI A;  1T18 A;  2V1A A;  4UHU A;  1MBL A;  2XGN A;  4GZB A;  5F82 A;  2WAD A;  1ES3 A;  2JE5 A;  3TW8 A;  4HJ4 A;  2OLV A;  2QYB A;  2KLI A;  4HP4 A;  2XR0 A;  4KQO A;  5EUA A;  1LI0 A;  5EVI B;  3WS0 A;  1G6A A;  4HIA A;  1YLZ A;  4GOG A;  3C8C A;  3EEH A;  5DFX A;  4LV1 A;  4DXC A;  4BMW A;  4PM5 A;  4PAU A;  4GHI B;  3KSH A;  3UDX A;  3M6H A;  4MBH A;  2OV5 A;  3KO6 A;  4QPR A;  4P6B A;  1FCO A;  1I2W A;  1KE3 A;  4Y0U A;  3G6O A;  1BLS A;  2KDK A;  4EEP A;  5AJG A;  1XGI A;  2DNS A;  3EGX C;  2JKG A;  4WYY A;  5EOE A;  4WMC A;  2XF3 A;  5MC7 A;  3HL9 A;  2HF6 A;  2WAF A;  5EVL A;  2HDR A;  2PU4 A;  2H0Y A;  2ZL1 B;  3E2K A;  4WMC D;  2R78 A;  4NXE A;  4S2N C;  3NCK A;  3VFF A;  2VV7 A;  1ES4 A;  4K91 A;  1IYQ A;  1FQG A;  3IX8 A;  4LV0 A;  3HCY A;  4CLC A;  5FL3 A;  2W3G A;  3V3R A;  5CTM A;  3OLO A;  1WA9 A;  3FC7 A;  1XPB A;  3BJN A;  4B9O A;  5F68 A;  5DJU A;  4DJ3 A;  2FH5 A;  3DTK A;  2EX8 A;  1PWG A;  1NRJ A;  4HBU A;  5DTT A;  2V8C A;  3AGE A;  1KE4 A;  2XEP A;  2ACG A;  1JWV A;  3SH8 A;  3PTE A;  3PHY A;  4R23 A;  2J3W A;  3SOI A;  3CLO A;  2PDR A;  3V5M A;  2P9V B;  5IHV A;  4LRX C;  4HJ3 A;  3IWO A;  2XQZ A;  1FSW A;  2VK3 A;  5FAO A;  4X68 A;  1WE4 A;  4CLC B;  3OCL A;  3K3C A;  4YIN A;  4DJ2 A;  4WBG A;  1IEM A;  2Y2G A;  5J4E A;  1IOU A;  4HQA A;  2B95 A;  2RL3 A;  2CMN A;  5CRF A;  1ERQ A;  4WEK A;  1SHV A;  1PI4 A;  3MXS A;  2B18 A;  1NJ4 A;  4II7 A;  3MKF A;  5GLB A;  5HWT A;  3TG9 A;  4IUK A;  3GR2 A;  2GJ3 A;  4DDY A;  1L2S A;  1YMX A;  4S2N A;  3ZYT A;  3SS4 A;  2K2N A;  4M3K A;  1DJA A;  3A0R A;  4JXG A;  4O0P A;  5JYP A;  5AQA A;  3QHY A;  4BEN A;  4E3I A;  1BZA A;  5HAI A;  2W3H A;  3ZG5 A;  4WUJ A;  4E3K A;  3MZD A;  4E3M A;  1E25 A;  1H8Y A;  2O0Y A;  1L0D A;  1MXO A;  1FCM A;  4L0L A;  4DKI A;  1RGY A;  3NIA A;  1I5Q A;  4HEF A;  3IF6 B;  5EM0 A;  1W8Y A;  1GHP A;  5AVF A;  4EET B;  4O7D A;  1ES2 A;  3OCN A;  4FUW A;  2ZMF A;  2XA7 M;  4MDZ A;  2EXB A;  4ZJ3 A;  3BY9 A;  5HWV A;  3D9Y A;  1N9O A;  2UWX A;  3IXB A;  2G7U A;  1PRQ A;  5F1F A;  1OME A;  2EX6 A;  5I5L A;  1SZV A;  3IT9 A;  4JGO A;  4EXO A;  3UDI A;  4LRY C;  1GSX A;  4EUV A;  5IU1 A;  4KG2 A;  1X0O A;  4DRT A;  3T12 B;  3QNB A;  5FAQ A;  4OPZ A;  3EQU A;  3Q82 A;  4HH2 A;  1NWZ A;  1E3U D;  1MPL A;  3E98 A;  1K55 C;  3N4I A;  2W1R A;  1H3Q A;  3F1O A;  4GS9 B;  3ZG0 A;  5F1G A;  4KZB A;  4G3K A;  2P74 A;  4Q0J A;  4EV4 A;  1BT5 A;  4DMZ A;  3IH9 A;  3UN7 A;  2ZM0 A;  1KOU A;  5IS1 A;  4OQG A;  5DFY A;  1N4O A;  2B02 A;  3VOL A;  5E43 A;  1GCE A;  3CI6 A;  1YQS A;  5CHU A;  3T1X A;  1MWU A;  1CEG A;  4DE2 A;  1PNE A;  4WZ4 A;  1PFL A;  4QHC A;  2PBD P;  3Q81 A;  1BUL A;  4K08 A;  2XLN A;  1F5M A;  1ACF A;  1FIK A;  3OBF A;  4D60 A;  1YLY A;  3Q07 A;  2Y2M A;  1KGF A;  2FFY A;  3OPH A;  4I39 A;  3S1Y A;  1D1J A;  3A0S A;  5CX7 A;  3MXR A;  4JGQ A;  3LGO A;  1V9Y A;  3B42 A;  3SH9 A;  3PR6 A;  3R4K A;  2ZC7 A;  4EES A;  2WKR A;  3HLD A;  1F2K A;  4CPK A;  2Y2Q A;  2PRF A;  3GDI A;  1JWP A;  2YKF A;  4EBP A;  1BLP A;  4XXR A;  1CF0 A;  3B33 A;  2QMI A;  4O8G A;  1XJ2 A;  1TS6 A;  3TJZ C;  1SDE A;  1S1Y A;  3S7N A;  5A93 A;  2WGI A;  3GQZ A;  2M7U A;  4GLQ A;  4I3A A;  4ETX A;  2ZM8 A;  3KYE A;  4GW9 A;  3CPT B;  3BLS A;  5TGF A;  4OP5 A;  2V2F F;  1U60 A;  2AVX A;  1XA7 A;  2XSS A;  3HUN A;  3N6I A;  4EQ1 A;  1NY0 A;  4MMN A;  2W1T B;  1MKI A;  1S6R A;  1TVF A;  3CMZ A;  1YMS A;  3P98 A;  2ZOI A;  5EOO A;  4YFM A;  3H82 A;  4NKP A;  1XX2 A;  3A3E A;  1T19 A;  1S66 L;  1VEU A;  2QZ6 A;  3K3D A;  4MEZ A;  1FCN A;  1AWI A; 
#chains in the Genus database with same CATH homology
 4EBN A;  5FA7 A;  4E3O A;  5AQ9 A;  5FAS A;  3G35 A;  4GN2 A;  1ZKJ A;  2Q9N A;  4OQH A;  3IWI A;  2Z2M B;  4BQM A;  3NDE A;  4UHU A;  1MBL A;  2XGN A;  3N8L A;  3PBN A;  5DTS A;  2WAE A;  3MZF A;  3OPL A;  1CEF A;  4GZB A;  1BUE A;  5FQQ A;  1YM1 A;  2WAD A;  5F82 A;  1ES3 A;  2JE5 A;  5EVI C;  3QNC A;  4OPY A;  1H5X A;  2OLV A;  3E2L A;  1Q2P A;  3HLG A;  3HUM A;  3UPO A;  4E6W A;  2HDQ A;  3PBQ A;  1PZO A;  3GV9 A;  5DF8 A;  3MFD A;  4X69 A;  5M19 A;  2HP6 A;  1YT4 A;  4D2O A;  3WS1 A;  2ZC5 B;  1JTG A;  2XR0 A;  4JF4 A;  4KQO A;  4X53 A;  5EUA A;  1LI0 A;  3GTC A;  1PIO A;  5EVI B;  1M40 A;  4EBL A;  5KSC A;  3WS0 A;  4EWF A;  1CI8 A;  2QPN A;  1G6A A;  4K0X A;  5GHY A;  3PAE A;  2VGK A;  1YLZ A;  4CJN A;  2A49 A;  4E6X A;  3O87 A;  4GOG A;  4JXW A;  3G2Z A;  4JF6 A;  4LV1 A;  4DXC A;  3VP4 A;  1HTZ A;  2JCH A;  3C4P A;  4PM5 A;  3CG5 A;  2WK0 A;  2XH9 A;  2IWC A;  4QD4 A;  1HVB A;  3UDX A;  5HFO A;  3M6H A;  3UE3 A;  5G18 A;  4E3J A;  1K6S A;  4MBH A;  2OV5 A;  4X55 A;  4Y0T A;  2EX2 A;  4P6B A;  1FCO A;  1I2W A;  1KE3 A;  4Y0U A;  1W7F A;  3S4X A;  2WKH A;  4JBF A;  3WRZ A;  1BLS A;  5KZH A;  4EUZ A;  4FH2 A;  4GKU A;  5HAP A;  2IWD A;  3DW0 A;  3ITA A;  1Z6F A;  1XGI A;  2DNS A;  3O86 A;  2H5S A;  3RXX A;  2HDU A;  3IQA A;  4WYY A;  3FZC A;  2V20 A;  1K57 A;  5EOE A;  4WMC A;  2XF3 A;  2ZLY A;  4KZ4 A;  1K56 D;  4N1H A;  3HL9 A;  2WAF A;  2JBF A;  3BFF A;  4N9L A;  4OQI A;  2ZC3 B;  3GRJ A;  4R4S A;  5EVL A;  2HDR A;  3G2Y A;  4LCM A;  3RXW A;  4E3N A;  2PU4 A;  5E2H A;  4GD6 A;  3UNW A;  1K57 C;  2H0Y A;  3E2K A;  3BEB A;  4WMC D;  3GVB A;  4S2N C;  1K56 A;  1HZO A;  5I94 A;  4GD8 A;  1YLW A;  4KEN B;  3NCK A;  5FQ9 A;  1PW8 A;  2EX9 A;  3VFF A;  3ZG9 B;  5M1A A;  1ES4 A;  4K91 A;  4X6T A;  4F94 A;  1IYQ A;  1FQG A;  3Q7V B;  4LV0 A;  1FR6 A;  1RGZ A;  5E2F A;  2ZC4 B;  5HX9 A;  3VSL A;  2WZZ A;  3HLW A;  4BL2 A;  3LY3 A;  5HAQ A;  1CI9 A;  1TDL A;  3C7V A;  5GLC A;  3V3R A;  1NZU A;  4N92 A;  3ZFZ A;  5CTM A;  1W5D A;  1XPB A;  4LV3 A;  4PPR A;  5HL1 A;  3V3S A;  3FWL A;  3DWZ A;  4N9K A;  1S0W A;  4RYE A;  3VP0 A;  3AGF A;  4UA6 A;  4QU3 A;  2EX8 A;  2J9P A;  1YLP A;  3PBO A;  5AQ7 A;  3WWX A;  1YLJ A;  1IKG A;  4K0W A;  1KGE A;  1PWG A;  2H0T A;  4OLD A;  2EXA A;  4S2I A;  5M18 A;  4UA7 A;  4HBU A;  3VP1 A;  1JWZ A;  3G30 A;  3C7U A;  4R3B A;  5DTT A;  4DXB A;  4OON A;  3AGE A;  3W8K A;  1KE4 A;  2XEP A;  4DE0 A;  5CTN A;  1JWV A;  1ONG A;  4KQR A;  3VSK A;  3SH8 A;  2DRW A;  3LEZ A;  3PTE A;  2Y4A A;  4WZ5 A;  4DF6 A;  4QY6 A;  3HLC A;  4R23 A;  3SOI A;  1ERO A;  4R1G A;  1ESI A;  1GHI A;  2P9V B;  1SCW A;  4ZTK A;  5IHV A;  3V5M A;  3W4O A;  4BJP A;  3NI9 A;  3SS3 A;  3IWO A;  2XQZ A;  5FSR A;  2Y2N A;  2WYX A;  1FSW A;  4R0Q A;  3BEC A;  3ZGA B;  1LLB A;  2J7V A;  3I7J A;  4S2O A;  4IBR A;  1SKF A;  5FAO A;  2XDM A;  4X68 A;  1K4F A;  4KZ3 A;  4C3Q A;  1WE4 A;  1XGJ A;  1Y54 A;  2PU2 A;  3OCL A;  4N1X A;  5FI2 A;  5GLA A;  3WS4 A;  1IYP A;  4YIN A;  5CXW A;  2HP5 A;  4WBG A;  1ALQ A;  1L0G A;  5FI7 A;  3IHB A;  1IEM A;  4C75 A;  2P9V A;  1MY8 A;  3ZDJ A;  4OPR A;  2Y2G A;  1LL9 A;  3UO9 A;  1ESU A;  2XK1 A;  3UE0 A;  1IYO A;  2XFT A;  4RA7 A;  4BD1 A;  1GA9 A;  4S2L A;  1PI5 A;  5FQM A;  3UY6 A;  3BM6 A;  4B88 A;  4PM6 A;  3W4P A;  4BD0 A;  3Q1F A;  2RL3 A;  3C5A A;  5CHJ A;  5CRF A;  1ERQ A;  4OVD A;  2HDS A;  4WEK A;  1SHV A;  4HES A;  1PI4 A;  3UPN A;  1KE0 A;  3A3I A;  3MXS A;  3UE1 A;  3P09 A;  2HP9 A;  2WGW B;  4NET A;  1NJ4 A;  1DJB A;  3G31 A;  3MKF A;  5EVI A;  1NYM A;  2WUQ A;  5GLB A;  3TG9 A;  5A90 A;  4OH0 A;  3GR2 A;  1M6K A;  3LO7 A;  4DDY A;  1L2S A;  1E4D A;  1YMX A;  1FR1 A;  1K55 A;  5U47 A;  3BFC A;  4S2J A;  2VGJ A;  4S2N A;  2E8I A;  2G2U A;  1K4E A;  3SS4 A;  1NZO A;  2Y91 A;  2XFS A;  4UA9 A;  4M3K A;  1ZG4 A;  1KVM A;  1NYY A;  1DJA A;  4JXG A;  1L0E A;  1XXM A;  2X71 A;  1IYS A;  1K6R A;  1WYB A;  1KVL A;  2WGV A;  3UPP A;  3IWQ A;  1FSY A;  2HPB A;  5GL9 A;  4P87 A;  5JYP A;  2ZQA A;  4KG5 A;  5AQA A;  3QHY A;  3HLF A;  3W4Q A;  4U0X A;  4BEN A;  2Y2H A;  4E3I A;  4P85 A;  1BZA A;  5HAI A;  2Y2L A;  2ZD8 A;  1DY6 A;  4WM9 A;  3ZG5 A;  4E3K A;  3MZD A;  5FI6 A;  4E3M A;  5E2G A;  1E25 A;  1H8Y A;  1L0D A;  4OKP A;  1MXO A;  2ZQC A;  3DTM A;  3N8S A;  5HAR A;  3IF6 C;  2PBY A;  1FCM A;  4L0L A;  4DKI A;  4LEN A;  3IXG A;  4NK3 A;  2WKI A;  1PWD A;  1XA1 A;  4B4X A;  4IED A;  1RGY A;  3PBS A;  3NIA A;  3IXD A;  1I5Q A;  4HEF A;  4KZA A;  3WS2 A;  3ZG8 B;  3IF6 B;  1W8Y A;  4FH4 A;  5E2E A;  2X01 A;  4GB7 A;  1GHP A;  2ZQ9 A;  3MBZ A;  4O7D A;  1ES2 A;  1FOF A;  1N9B A;  3OCN A;  2C6W B;  3GMW A;  4RVA A;  5DF7 A;  4JPM A;  1L0F A;  1XKZ A;  2EXB A;  3PBT A;  4ZJ3 A;  1WYC A;  5CGS A;  4WEJ A;  1YLT A;  1MWR A;  2UWX A;  4RX3 A;  2ZMA A;  3IXB A;  3MZE A;  4Y7P A;  1KDS A;  1EWZ A;  4RX2 A;  4U0T A;  3Q7V A;  4GDB A;  3G32 A;  5F1F A;  1OME A;  3IF6 A;  2EX6 A;  3FV7 A;  3HVF A;  3IHA A;  3BRM A;  1K54 A;  2DCF A;  3IT9 A;  4PMA A;  3UDI A;  4Z9Q A;  1TDG A;  4DE1 A;  3MKE A;  4KZ7 A;  3IXH A;  2Y2K A;  4MNR A;  4KG2 A;  3HUO A;  1BLH A;  1CK3 A;  3HBR A;  4DRT A;  2WZX A;  4S2M A;  5CEB A;  1RP5 A;  2ZQD A;  4OOL A;  3QNB A;  4IBX A;  4XUX A;  5FAQ A;  4OPZ A;  3EQU A;  5BOH A;  3SS5 A;  4PM9 A;  2IWB A;  3Q82 A;  1KGG A;  3ISG A;  4JXV A;  4LV2 A;  4OPQ A;  3WRT A;  3DWK A;  3NDG A;  1ZC2 A;  4HBT A;  1E3U D;  2Z2L B;  1MPL A;  4JKT A;  4BLM A;  4DE3 A;  1K55 C;  3N4I A;  2H10 A;  4KZ6 A;  1BTL A;  3CJM A;  1ERM A;  1NXY A;  1C3B A;  3OZH A;  1GA0 A;  1QME A;  2ZQ7 A;  3ZG7 B;  4Y0O A;  1O07 A;  1K25 A;  4R3J A;  3ZG0 A;  5CEC A;  5CED A;  1H8Z A;  5F1G A;  5A91 A;  2WGW A;  3O3V A;  3O88 A;  1KDW A;  4JXS A;  4KZB A;  2V1Z A;  3NY4 A;  1LI9 A;  4OP8 A;  4EQI A;  4KG6 A;  2P74 A;  5AQB A;  1ZG6 A;  4EV4 A;  1BT5 A;  1G68 A;  4ZBE A;  3NBL A;  3IH9 A;  3VOZ A;  4UAA A;  4X56 A;  4ZJ2 A;  3UN7 A;  3D4F A;  4LCL A;  5FAT A;  2ZM0 A;  1ES5 A;  4OQG A;  3GSG A;  1N4O A;  3WS5 A;  2A3U A;  1GCE A;  5E43 A;  4S2K A;  2J8Y A;  3CZD A;  1YQS A;  4ID4 A;  4P0M A;  5CHU A;  3LY4 A;  1J9M A;  1PYY A;  4PM7 A;  5F83 A;  3TSG A;  1MWU A;  4DDS A;  4QJG A;  1CEG A;  3NC8 A;  4DE2 A;  5D3O A;  1JVJ A;  1LL5 A;  3OPP A;  1ONH A;  2R9W A;  3M2J A;  4WEL A;  4KZ9 A;  3FKV A;  3ZHH A;  1Q2Q A;  4JF5 A;  4WZ4 A;  3FYZ A;  4BL3 A;  2Y2J A;  2CC1 A;  3A3F A;  3OPR A;  2I72 A;  1O7E A;  1VQQ A;  2XD1 A;  5EVI D;  3BFD A;  4QHC A;  3BLM A;  2BG1 A;  1W8Q A;  3Q81 A;  3VP3 A;  1MWT A;  2X02 A;  4OOY A;  4IVK A;  3ZCZ A;  3IH8 A;  5TR7 A;  1BUL A;  2XLN A;  4R4R A;  1I2S A;  3SH7 A;  3S22 A;  4OLG A;  3TOI A;  3HRE A;  4FD8 A;  3VP2 A;  1MWS A;  1YLY A;  3Q07 A;  3ZNY A;  2Y2M A;  1KGF A;  2FFY A;  3OPH A;  1JTD A;  2RCX A;  3S1Y A;  3M2K A;  4OQ0 A;  2EFX A;  2G2W A;  3AGD A;  3N7W A;  4B4Z A;  3MXR A;  5FQJ A;  2EFU A;  2ZQ8 A;  1PWC A;  5FQK A;  5EEC A;  5EPH A;  2ZJ9 A;  1NRF A;  4MBF A;  3G4P A;  5CER A;  5A92 A;  1EI5 A;  3SH9 A;  4OOM A;  2Q9M A;  5EE8 A;  1IEL A;  3M6B A;  2ZC7 A;  4H8R A;  3RJU A;  3HLD A;  5JYO A;  3BYD A;  4CPK A;  2BLS A;  2Y2Q A;  2B5R A;  5FDH A;  4S2P A;  1JWP A;  3ZVW A;  1PW1 A;  1W79 A;  2XD5 A;  4KZ5 A;  2JC7 A;  3A3D A;  4U3T A;  4EBP A;  5FAP A;  1BLP A;  2C5W B;  4XXR A;  5CGX A;  2FFF B;  2J9O A;  2OSU A;  2R9X A;  2QMI A;  4XUZ A;  3N8R A;  1QMF A;  5GHX A;  4MBK A;  5TFQ A;  3ITB A;  5KSH A;  4PM8 A;  2WKE A;  1SDE A;  3A3J A;  3ZVT A;  1K38 A;  3G34 A;  1GHM A;  3BFE A;  4FSF A;  1LHY A;  3Q7Z A;  4ZDX A;  2OLU A;  5A93 A;  2WGI A;  3GQZ A;  3PBR A;  1HD8 A;  4KQQ A;  3JYI A;  3VMA A;  4MLL A;  1SDN A;  2ZM8 A;  3HLB A;  1TEM A;  1E3U A;  4ZAM A;  3IF5 A;  3HLE A;  3BLS A;  1BSG A;  5DTK A;  5FQI A;  1DJC A;  5J8X A;  5TGF A;  1BLC A;  4OP5 A;  3V39 A;  1PZP A;  1U60 A;  2V2F F;  2Y2P A;  1XA7 A;  3OC2 A;  5GLD A;  1XP4 A;  2Y59 A;  4C6Y A;  3HUN A;  5L2F A;  3V50 A;  3N6I A;  3EQV A;  1VM1 A;  1NY0 A;  3B3X A;  4Q8I A;  3LCE A;  5CGW A;  2ZM2 A;  3VFH A;  3FKW A;  2Y2I A;  1MKI A;  4E3L A;  5DVA A;  3BFG A;  1S6R A;  3C4O A;  4ZJ1 A;  3ZNT A;  1AXB A;  1IKI A;  1TVF A;  4FCF A;  3CMZ A;  2ZC6 B;  1YMS A;  1K54 C;  3P98 A;  2Y55 A;  2GDN A;  4WZ5 C;  4GNU A;  5CHM A;  5DF9 A;  5EOO A;  3VOY A;  4YFM A;  5KMW A;  3PAG A;  4A5R A;  3UDF A;  4JLF A;  1XX2 A;  3A3E A;  4QB8 A;  5GHZ A;  4IVI A;  2Y2O A;  2QZ6 A;  4MEZ A;  4QY5 A;  5HW3 A;  1FCN A;  1RCJ A;  4KZ8 A;  4GDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...