2ZQAA

Cefotaxime acyl-intermediate structure of class a beta-lacta toho-1 e166a/r274n/r276n triple mutant
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase Toho-1
publication title Structural Basis of Extend Spectrum Beta-Lactamase in Correlation of Enzymatic Kinetics and Thermal Stability of Acyl-Intermediates
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zqaA00
1FOFA 1PYYA 3FWLA 3ZVTA 1RCJA 4X69A 3Q81A 3WS4A 4ZDXA 1J9MA 2Y2OA 1L0DA 1BT5A 4R23A 5U47A 4Z9QA 1W5DA 4DXCA 2V2FF 4K91A 4KZ3A 4BD1A 5A91A 3MXRA 2PBYA 1JWPA 4E3OA 4GKUA 3Q82A 3M2JA 3O86A 2HDRA 3IXHA 2JE5A 1EROA 1EWZA 2PU2A 1PZPA 3FKVA 3BM6A 5CGXA 3MKEA 2EXBA 5AQAA 1DJBA 4LV1A 1IYPA 2P9VA 1MWRA 2DRWA 5FA7A 3NY4A 1VQQA 4DE1A 2Y55A 2ZC4B 4S2MA 3MXSA 3BLSA 1MPLA 3UPPA 1XP4A 3UPNA 2J9OA 2P74A 1NRFA 3LY4A 4ZJ2A 4C6YA 4LV3A 3PBTA 2UWXA 1MBLA 3UE1A 1S0WA 4XUZA 5KSCA 4KZ8A 4LCLA 3HUOA 1JWVA 3NI9A 1SKFA 2WZZA 4GOGA 4JBFA 4BL3A 3NIAA 3C4PA 1MKIA 3OCLA 4KZBA 5HAIA 2Y4AA 5KZHA 2ZQAA 3W8KA 4LENA 4FH4A 3ZG9B 3IQAA 1BLHA 2EX6A 1HD8A 2J8YA 2X71A 3CZDA 4OP8A 2C6WB 4P85A 2HP6A 4B4ZA 3UO9A 3A3IA 3UDIA 2WK0A 1MWTA 5GLDA 1Q2QA 1GA9A 4PM5A 2DCFA 4P0MA 4IBRA 3ZHHA 3MFDA 3HUNA 5CHUA 2C5WB 1E25A 3AGDA 2EX8A 3N4IA 3M6HA 3N8RA 3IXDA 1IYOA 2QPNA 3PBQA 4X53A 2Y2IA 1N4OA 4ZJ3A 1YMSA 4ZBEA 1CEGA 1TEMA 4DE3A 1I2WA 1YLTA 2ZC6B 1E3UD 3HLDA 3M6BA 3ZG8B 3ITBA 4MEZA 2OLVA 5EOEA 1Y54A 1BTLA 1YM1A 3V3RA 4M3KA 4DDYA 5FQMA 2XH9A 2Y2HA 5EECA 4FCFA 5FQKA 5EOOA 3HBRA 2Y59A 4FH2A 1G6AA 1ZKJA 3V50A 2ZQDA 1RGZA 5M19A 4DRTA 4QU3A 2ZM2A 4EQIA 4F94A 3G32A 2EXAA 3BRMA 1TVFA 1RP5A 1NXYA 1YQSA 1L0EA 1H8ZA 2WKIA 1E3UA 2JBFA 3GVBA 5HAQA 2XD5A 3HLFA 5D3OA 1K4FA 1PZOA 4QD4A 3C7VA 4S2OA 2A49A 1GHPA 1ZG6A 2QZ6A 1JWZA 3VP0A 1LI9A 2ZC7A 4KZ5A 1FSYA 2CC1A 4HBUA 4JXSA 4WZ4A 1YMXA 3CJMA 3SS3A 3ZNTA 1KE0A 1BLSA 1K54A 4KZAA 2Y2KA 1K55A 4MBHA 4FD8A 4OPZA 3ZVWA 3OCNA 3QHYA 3LCEA 3SS5A 2ZLYA 2OLUA 1W8QA 1YT4A 5HX9A 3N8SA 4DF6A 5HL1A 2ZQ9A 4OQIA 4X68A 1L0GA 1NY0A 1MWSA 3MZDA 1YLZA 3OPLA 3G2ZA 1PWCA 4R0QA 1BSGA 1W79A 3PAGA 4E3LA 3C5AA 3WS2A 1GHMA 3MZEA 2I72A 4K0WA 5FQQA 4EBNA 5CGWA 3RXWA 1IKIA 1MWUA 2WGWA 4OQ0A 3VP3A 5FQ9A 3Q7VB 1O07A 1PI5A 3BFFA 4UA7A 4N9LA 2ZC5B 1CK3A 3FV7A 4CPKA 1K57A 4RX3A 3TG9A 3ZCZA 4E3JA 5CTNA 3LO7A 5FSRA 1KGEA 1XPBA 1KDWA 4X6TA 4BENA 5F1FA 2VGKA 2Y2PA 3BFCA 1KGFA 4JPMA 5F1GA 1HVBA 4B88A 1XXMA 3QNCA 4QY5A 1JTDA 3A3EA 4KQOA 4YINA 3WRZA 1M40A 1SDEA 3B3XA 2FFYA 1NYMA 2H5SA 5FI6A 4C3QA 4IBXA 2HP9A 4S2PA 4OLGA 2G2UA 2HP5A 4PM6A 2HDUA 1O7EA 5KSHA 1FCMA 2XF3A 4WM9A 3TSGA 3BFGA 3JYIA 3UNWA 1XA7A 3WS5A 2XFTA 3C7UA 4ZTKA 4OH0A 4NETA 2Y2JA 5DTTA 5AQ9A 3P09A 4HBTA 4WEKA 4QB8A 5DTSA 1LL9A 3BEBA 4S2IA 2P9VB 4MBKA 4WBGA 3O88A 1WYCA 1IKGA 3G35A 3O3VA 1W7FA 3W4OA 4BD0A 1FR6A 5GHZA 5EVID 2XDMA 2Z2LB 5HARA 4DDSA 2XR0A 5FATA 2WKEA 4S2NC 1WE4A 2ZQ7A 3GRJA 5CGSA 1ALQA 1DY6A 2Y91A 4P6BA 2FFFB 1K38A 1YLYA 4KZ7A 3ZG0A 3OPPA 3Q07A 4WZ5C 4LCMA 2HDQA 4MBFA 5GL9A 1FCOA 3G2YA 4U0XA 3VOYA 1K6RA 3A3JA 4S2JA 4C75A 4LV0A 1W8YA 3IXGA 1NJ4A 1TDGA 4WMCD 3QNBA 3HLEA 3DWZA 5EVIA 4E3NA 3VMAA 3WS0A 5L2FA 3UPOA 2R9WA 3OPRA 2QMIA 2ZQ8A 5E2GA 5DTKA 1H8YA 2ZC3B 3E2KA 4EV4A 5CEBA 3N7WA 5EVLA 4N1XA 2DNSA 5A93A 1I5QA 3BFDA 3I7JA 3O87A 3BLMA 3IF6A 3ZDJA 2H0YA 2XEPA 5M1AA 3GV9A 2Y2QA 3PBOA 1KE3A 3S22A 3NC8A 3G4PA 4GD6A 1XKZA 5GHYA 4WMCA 4E3MA 1FCNA 2WADA 4RX2A 4JXWA 5FI7A 4U0TA 5AQBA 1LHYA 2Y2MA 3G31A 5CHJA 1K25A 1IYQA 5AQ7A 3V39A 3IHAA 3VP1A 3ZFZA 4ZJ1A 4EWFA 5A90A 3HLBA 2WGIA 4OONA 3SOIA 3Q1FA 1KVMA 4H8RA 3VP2A 3GR2A 4E3KA 4QJGA 5HAPA 2G2WA 1KDSA 1ES5A 2Q9MA 4RYEA 1IELA 1XGJA 3IH8A 3NDEA 3HUMA 3A3FA 4OOMA 3HLGA 4HEFA 3PTEA 5JYPA 3PBNA 1TDLA 4U3TA 1HZOA 4OVDA 3SS4A 1IYSA 4HESA 2H0TA 3ITAA 1K56D 5FAOA 5EUAA 1FSWA 3AGFA 4JF6A 4OPYA 3FZCA 4KENB 4OLDA 3UY6A 4EBPA 2EFUA 3WWXA 1SCWA 5GLAA 3IWQA 5TFQA 4UA6A 3D4FA 4DXBA 5IHVA 4BJPA 4OQHA 1NYYA 5CXWA 5CECA 1ERMA 5E43A 5CRFA 1PW8A 3MZFA 1LLBA 2IWDA 2A3UA 1K56A 1QMFA 2B5RA 1QMEA 5DVAA 3TOIA 2PU4A 2ZMAA 5TGFA 3IT9A 3SH8A 4A5RA 1LI0A 2WUQA 3FYZA 1C3BA 3UDXA 2RL3A 3BFEA 5DF7A 1ES4A 2WAFA 3S4XA 3C4OA 3ZG7B 5HW3A 1H5XA 2RCXA 1YLPA 4E6XA 3CMZA 3DW0A 3HLCA 1L2SA 4QY6A 5E2FA 2ZM8A 4UHUA 5HFOA 1Q2PA 1XX2A 3LY3A 5CEDA 1K6SA 1PWDA 1BLPA 1ZC2A 3BECA 3VP4A 2WGWB 1KVLA 2Y2GA 3PBRA 1AXBA 4GNUA 5M18A 1FQGA 1K4EA 4GDNA 1DJAA 2JC7A 4DE2A 2OV5A 2X02A 1NZUA 5EE8A 4OQGA 1ESIA 5CERA 3VFHA 2XQZA 4Q8IA 4DE0A 1GA0A 4L0LA 3G34A 4NK3A 4OOYA 5FDHA 4E6WA 3UDFA 2GDNA 4IEDA 3ISGA 4PPRA 5GLBA 1L0FA 5FQIA 4XXRA 1FR1A 1K54C 3WS1A 1OMEA 3OPHA 1K55C 3GQZA 3HVFA 2X01A 4KG2A 3EQUA 4K0XA 1Z6FA 3HL9A 1CI8A 2ZQCA 3WRTA 2H10A 2EFXA 5E2EA 4KZ9A 2V1ZA 4OKPA 3UE0A 5DF9A 1ONHA 2HDSA 4X56A 4KQRA 5JYOA 3VSKA 4B4XA 5J8XA 4WEJA 3G30A 5G18A 4N9KA 1RGYA 4S2KA 1N9BA 1MXOA 3M2KA 4D2OA 4GZBA 4OPQA 1EI5A 2EX9A 5A92A 3Q7ZA 2IWBA 4GDBA 5KMWA 1BZAA 3N6IA 4JXVA 2BLSA 1ES2A 4KG6A 1BUEA 2EX2A 5FQJA 1SHVA 4N92A 4XUXA 2XD1A 3GMWA 3HREA 4O7DA 3LEZA 3MKFA 5BOHA 3EQVA 1JVJA 4KZ4A 4OPRA 1M6KA 4PM8A 2Z2MB 4RA7A 1ES3A 1NZOA 3IXBA 2ZJ9A 4Y0TA 3MBZA 5F83A 4YFMA 1K57C 1LL5A 4UA9A 4WYYA 3P98A 2WKHA 4JXGA 3ZG5A 4DKIA 5GLCA 4JF5A 4Y0UA 3IHBA 3IH9A 2XFSA 4PM7A 3V5MA 5EVIB 3SH9A 3BYDA 3PBSA 3SH7A 2E8IA 4E3IA 4GD8A 4BLMA 1GHIA 3NCKA 3RXXA 3OZHA 1S6RA 2WZXA 3DWKA 5CTMA 3VFFA 5I94A 3S1YA 4OOLA 3W4QA 3IF6B 1GCEA 1CI9A 2ZD8A 1PWGA 3A3DA 1WYBA 2R9XA 3NBLA 2VGJA 4GB7A 4MLLA 3VOZA 3FKWA 2HPBA 1ESUA 2V20A 1ERQA 1IEMA 4R4SA 5GHXA 4EBLA 1XA1A 5DF8A 4JF4A 3IWIA 4S2LA 5TR7A 1I2SA 3IWOA 3IF5A 4CJNA 2Y2LA 4IVIA 3GTCA 4WELA 4P87A 2Y2NA 3W4PA 4JLFA 1E4DA 3ZGAB 1YLWA 1BULA 1CEFA 2WYXA 1U60A 4KQQA 1SDNA 1G68A 4EUZA 4BL2A 4QHCA 4ZAMA 1ONGA 1DJCA 2J9PA 4RVAA 4Y7PA 5F82A 3NDGA 4Y0OA 2XK1A 3AGEA 2IWCA 4LV2A 3DTMA 1KE4A 3E2LA 4GN2A 5E2HA 5EVIC 5FASA 1KGGA 4X55A 1PI4A 5EPHA 1PW1A 3GSGA 3RJUA 2XLNA 1VM1A 1PIOA 3V3SA 4R1GA 1YLJA 3ZNYA 2ZM0A 3OC2A 5CHMA 2JCHA 4KG5A 3HLWA 5FI2A 4IVKA 1JTGA 2BG1A 4PMAA 1XGIA 4BQMA 4OP5A 1ZG4A 4S2NA 4R3BA 4PM9A 4R3JA 3UE3A 3PAEA 4UAAA 3IF6C 2WGVA 1BLCA 3N8LA 4ID4A 2Q9NA 4JKTA 3UN7A 5FAQA 4N1HA 2OSUA 5FAPA 1MY8A 3Q7VA 1HTZA 4WZ5A 2J7VA 2WAEA 4R4RA 4FSFA 3VSLA 3CG5A 4KZ6A 4MNRA 2XGNA
chains in the Genus database with same CATH superfamily
1FOFA 3KSGA 1G5UA 3Q81A 4I38A 2FZ0A 3IX3A 1MKMA 5F69A 5U47A 3K3CA 4K91A 3UB5P 4BD1A 2ZMVA 4I3IA 3D3OA 2HDRA 2JE5A 4HP4A 3MF0A 3BM6A 3EEAA 3JVUA 5FA7A 1VQQA 4YOFA 1S4SA 2ZC4B 5IS1A 4Y2FA 1XP4A 1YSQA 4BBUA 3LY4A 4C6YA 3PBTA 1PRQA 5TBMA 3LIBA 1YAXA 4JBFA 4BL3A 5EM1A 3NOTC 3NIAA 4NXEA 5KZHA 5FL3A 4FH4A 3IQAA 3A3IA 2WK0A 4PM5A 1GA9A 4IBRA 3MFDA 1GSVA 5HDSA 1OTIA 3AGDA 3N4IA 1XJ6A 3CI6A 2EWWA 3PBQA 2QJ5A 1STZA 3T1XA 1CEGA 2BTFP 4DE3A 4ETZA 1I2WA 2ZC6B 4IUKA 1E3UD 4M3KA 3T4QA 4B9OA 3HBRA 3V50A 2ZM2A 3DAVA 3BRMA 4DMZA 1XJ2A 2XD5A 5L8MA 2INWA 1VEUB 4WLAA 2PR6A 1DP9A 1H8MA 3VP0A 3CITA 2CC1A 3PXPA 4WZ4A 3CJMA 4Q0HA 1UWPX 4KZAA 5HD3A 3MMHA 4HJ3A 4MBHA 3BQ8A 1W63M 3SS5A 2VEAA 4YWZA 1YT4A 5HL1A 2ZL1A 1L0GA 1NY0A 1MWSA 3OPLA 3G2ZA 2PBDP 4E3LA 3MXQA 3KSFA 4K0WA 4EBNA 4N9LA 2ZC5B 1CK3A 4O8GA 4RX3A 3ZCZA 5FSRA 2VGKA 2J3TD 4JPMA 1XXMA 4QY5A 1JTDA 1YKDA 3SZTA 4KQDA 3B3XA 1NYMA 4OLGA 2HP5A 5KSHA 1FCMA 2XF3A 4B93A 1UWNX 3C7UA 5AQ9A 2W0NA 4HNBA 1D06A 4BMWA 4Y5FA 2PRFA 1FILA 2XDMA 2A2LA 4DDSA 2ZQ7A 2O0YA 3GRJA 5CGSA 5DJUA 5TBMB 1ALQA 3KYEA 3E4PA 2PD7A 1YLYA 4U0XA 4C75A 1W8YA 2V1BA 2UV0E 3VMAA 3UPOA 2R9WA 3OPRA 2OAP1 1H8YA 3E2KA 5CEBA 2OWHA 2VK3A 5DFXA 4NKPA 3F1NB 2H0YA 3S22A 1KE3A 4GD6A 4WMCA 2WADA 2EA9A 4RX2A 4U0TA 4GJ4A 5CHJA 1K25A 1IYQA 4EWFA 4ZJ1A 3MJQA 3Q1FA 4H8RA 3GR2A 4QJGA 2G2WA 2XROA 1ES5A 1IELA 3F1PA 3IH8A 3NDEA 4HH2A 3PTEA 1TDLA 2JN7A 4OVDA 1Y28A 1IYSA 1GSXA 4DN0A 2B02A 4RQ9A 2KDKA 4OPYA 4OLDA 3QP1A 2EFUA 2PD8A 4HOIA 5L09A 4DXBA 1NYYA 5CRFA 1OPXA 1QMFA 2B5RA 1QMEA 3SH8A 4A5RA 2WUQA 2RL3A 2ZL1B 5DF7A 4EEUA 1ES4A 2RCXA 3LI9A 3DW0A 2QWSA 1CQAA 4UHUA 5HFOA 5CEDA 2WKPA 2JKFA 5HL6A 2OV5A 2X02A 5EE8A 5AVEA 5J3WA 2OAQ1 2H28A 2L4RA 1GA0A 1S1ZA 4NK3A 3RH8B 5FDHA 2G7UA 1OMEA 3OPHA 1K55C 4KG2A 4K0XA 1CI8A 2H10A 4KZ9A 2V1ZA 3UE0A 1ONHA 4KQRA 4PHTA 4B4XA 3CLOA 4WEJA 4Y13A 1N9BA 1MXOA 2JHEA 2PT7A 3MSHA 5A92A 4GW9A 1ES2A 1BUEA 1SHVA 2XD1A 3HREA 3LEZA 1NZOA 3T4JA 3MBZA 4YFMA 4UA9A 2WKHA 2VKSA 4JF5A 4R70A 4Y0UA 4Y3IA 3SH7A 2E8IA 4UQIS 3D72A 1GHIA 4I5SA 5HPIA 2VJWA 3OZHA 3VFFA 5I94A 3S1YA 3KSHA 4LPZA 1CF0A 3VOLA 3NBLA 2VGJA 3LI8A 4GB7A 5DKLA 2CMNA 5LBRA 3FKWA 5C5KA 1ERQA 5GHXA 4EBLA 3IWOA 4CJNA 4WELA 5K5BA 4P87A 3ZGAB 1YLWA 3F1PB 1BULA 1U60A 4ARZB 4BL2A 3E98A 1ONGA 1DP8A 4RVAA 4Y7PA 3S7PA 4Y0OA 3MQ0A 5EVIC 1KE4A 5FASA 1PW1A 1YLJA 5CHMA 2JCHA 1GSWA 1TS7A 3KX0X 4PMAA 4R3BA 4MN5A 3UE3A 4ID4A 3N8LA 4JKTA 2Q9NA 5IU1A 1MY8A 4Q0JA 4HP9A 2WAEA 1PYYA 3FWLA 5HSQA 1RCJA 3WS4A 1J9MA 1OTEA 4R23A 4Z9QA 4DXCA 4G3WA 5A91A 4CLCC 2PYPA 3S7OA 1EROA 2PU2A 1PZPA 5CGXA 2EXBA 1MC0A 5AQAA 3VV4A 1DJBA 1IYPA 4DE1A 2HZ5A 2PYRA 1ZTUA 1MPLA 3UPNA 2J9OA 4DJ2A 2P74A 3UE1A 4KZ8A 3HUOA 3NI9A 1SKFA 2JKRM 1F5MA 2Y8HA 5IT5A 4KZBA 5HAIA 3LIAA 1ODVA 1BLHA 2J8YA 4OP8A 2C6WB 2HP6A 5FEGA 1MWTA 2HJEA 4P0MA 3ZHHA 3HUNA 2C5WB 1EW0A 3M6HA 1IYOA 3MQOA 2O9AA 2Y2IA 3T1SA 1VHMA 1S4RA 3HJIA 1TEMA 1YLTA 1V9ZA 2M1CA 3ZG8B 2JKTI 1YM1A 2XH9A 5EECA 5EOOA 3R7WA 1G6AA 2M7UA 5M19A 1RGZA 3A0SA 2EXAA 1TVFA 4LFUA 1T1BA 2JBFA 3GVBA 3PR6A 1K4FA 2VX8A 3MFXA 2A49A 5MC7A 3EGXC 1SKOA 2ZC7A 3FG8A 1YMXA 5HPFA 1K55A 3O5YA 4L9FA 4OPZA 3OCNA 2HF6A 1JNUA 3LCEA 4HIAA 5HX9A 4DF6A 3UB8A 3CUEC 3HCYA 1TF1A 4X68A 1TS8A 4R0QA 2KLIA 4ZRRA 1S1YA 3WS2A 3LUQA 5FQQA 2W3DA 1IKIA 2WGWA 3QP8A 1O07A 3BFFA 3DTKA 4CPKA 5CTNA 3E4QA 5I5LA 2PHYA 3RFBA 1XPBA 4BENA 5J4EA 3BFCA 4B88A 4YINA 3WRZA 1XFQA 2FFYA 4IBXA 3T1QB 4PM6A 2G2UA 4CLCE 3TSGA 1XA7A 3WS5A 3S7QA 3D9YA 1BYWA 4OH0A 5DTTA 2Y2JA 3ICYA 5EM0A 4HBTA 2XRNA 4MBKA 4WBGA 3O3VA 1W7FA 3IBJA 3T4OA 2Z2LB 5HARA 3BJNA 2XR0A 1WE4A 1SZVA 1A0KA 3H7WB 2IA2A 3OPPA 3Q07A 3E4OA 2HDQA 3VOYA 1NLYA 3A0RA 4HJ6A 1TDGA 3QNBA 3HLEA 5EVIA 3P7NA 5L2FA 2ZQ8A 4JGRA 5DTKA 4DJ3A 2B18A 3I7JA 3O87A 4JGQA 4EU0A 3BLMA 3E0YA 3GV9A 3NC8A 1XKZA 2YKFA 5FI7A 4Z1WA 3KO6A 2Y2MA 3V39A 3VP1A 4BBVA 4EQ1A 3VP2A 3R7WB 1KDSA 3K3DA 4RYEA 1XGJA 2D01A 3HUMA 3A3FA 3TW8A 4CLCA 2H0TA 1ZHHB 1K56D 2KX6A 5FAOA 3T4KA 3FZCA 4KENB 4EBPA 3UY6A 3B33A 1OTAA 1SKOB 4LRZE 5TFQA 4UA6A 5CXWA 4PKYA 3UB6A 2W3GA 1S67L 3MZFA 4EERA 5DVAA 3LEQA 2ZMAA 3VE3A 3C2WA 3FYZA 1C3BA 3UDXA 3S4XA 3ZG7B 1VETA 3HLCA 1L2SA 2K31A 2ZM8A 4NXBA 4P6ZM 2XA7M 1Q2PA 3H82A 2O9BA 1K6SA 2W1RA 5HZHA 2WGWB 1KVLA 1AXBA 5M18A 1FQGA 3F1OA 1T1AA 3LR0A 4Y17A 4OQGA 2J3WA 3JVVA 3BY9A 4DE0A 2GJ3A 2VGLM 3G34A 4OOYA 3UDFA 4IEDA 3NOPC 4PPRA 1L0FA 1FR1A 1K54C 3GQZA 1N9OA 2ZMFA 3HL9A 1N9LA 3WRTA 2EFXA 2HV1A 1NLZA 4X56A 5JYOA 5L07A 3QP6A 1OT9A 4D2OA 4OPQA 4HJ4A 3GDIA 3LFVA 5KMWA 4NXGA 3N6IA 4JXVA 2BLSA 4G3VA 5FQJA 2EX2A 3MQQA 2W3HA 5BOHA 3S7NA 3EQVA 4OPRA 4PM8A 2Z2MB 3DBAA 3IXBA 3BY8A 1K57C 2W1TA 3P98A 4WYYA 3ZG5A 3V5MA 3C30A 3IH9A 4PM7A 3CUEA 5EVIB 1NRJA 1Y4OA 4GD8A 1XFNA 3QP2A 3DWKA 4OOLA 2R78A 4NG2A 2ZD8A 4EXOA 2R9XA 2V8FA 4LGWA 3VOZA 3CWFA 4R4SA 5DF8A 3IWIA 5TR7A 1I2SA 4IVIA 3RTYA 3GTCA 3W4PA 3ULFA 2VV7A 3OBFA 2KOIA 1CEFA 1G68A 3L9KA 4CLCB 5F82A 2LB9A 4EUVA 2XK1A 3AGEA 4LV2A 3E2LA 1PI4A 2ZOIA 3RJUA 2JKGA 3V3SA 3ZNYA 3HLWA 1BLCA 5FAQA 5FAPA 2J7VA 4PKYG 4FSFA 3VSLA 4IHQA 5DJTA 4X69A 1L0DA 3H82B 3QP4A 4E3OA 4GKUA 1YSPA 3IXHA 1EWZA 5DFYA 3JPUA 1MWRA 2DRWA 2V0UA 5KIZA 2Y55A 4S2MA 3BLSA 2UWXA 1MBLA 2Y79A 4XUZA 5EFWA 4AFIA 4LCLA 1JWVA 4QWOA 1K0KA 4GOGA 3BW6A 3C4PA 1MKIA 2Y4AA 3DTIA 5CX7A 4MDZA 2ZQAA 4LENA 3ZG9B 4X1MA 1HD8A 1TS6A 3CZDA 5GLDA 1Q2QA 2GX5A 1OJ5A 5CHUA 3N8RA 3IXDA 4Q0IA 2W1TB 3CPTA 2BASA 4MEZA 5EOEA 1Y54A 1BTLA 4DDYA 2P08A 1OTBA 1ZKJA 1Z09A 2I9VA 4F94A 4EQIA 2PR5A 1T1CA 1NXYA 1H8ZA 1E3UA 2WKIA 4BWIA 5HD5A 4II7A 5D3OA 4GHIA 1TS0A 1PZOA 4QD4A 1ZG6A 1JWZA 2L0WA 4KZ5A 1FSYA 4JXSA 3LR3A 1KE0A 1BLSA 1K54A 2Y2KA 3IX8A 2OOLA 3ZVWA 2M7VA 3EWKA 1W8QA 1XJ3A 5HDDA 5FEFA 1YLZA 1W79A 4IJGA 3PAGA 4P6ZS 2XA7S 3MZEA 4FOFA 4H6JA 1MWUA 5FQ9A 4UA7A 3FV7A 1K57A 3LO7A 1PNEA 2WKQA 4X6TA 5F1FA 1D1JA 1J3WA 2Y2PA 4I3AA 1HVBA 2VGLS 3EEHA 4EESA 1S66L 2H5SA 4C3QA 2HP9A 4S2PA 4HI4A 1O7EA 3UNWA 4HY8A 2XFTA 5EV0A 4NETA 3P09A 3NJAA 4HH3A 1LL9A 3BEBA 3O88A 4XT2A 1WYCA 1P9WA 4BD0A 2VV6A 2D02A 2WKEA 4S2NC 3OOVA 4F3LA 2Y91A 4MCWA 1K38A 1F9IA 5GL9A 3A3JA 4L9GA 4LV0A 3IXGA 4WMCD 5HWTA 3WS0A 1FIKA 4EV4A 2ZC3B 5G4YA 5G4ZA 2VV8A 2O99A 4NXFA 3ZDJA 2XSSA 2ZOHA 2XEPA 5M1AA 3PBOA 4ETXA 4WF0A 1MZUA 5GHYA 2A24A 3CPTB 3LYXA 4EW7A 4JXWA 2P04A 3FPVA 1TD5A 4WL9A 3G31A 5AQ7A 3ZFZA 3R4KA 2GNXA 4OONA 3SOIA 1LSVA 5HAPA 1DRMA 3HLGA 1PFLA 3PBNA 1LL8A 1VEUA 3MR0A 1F2KA 3AGFA 4JF6A 4GHIB 3C38A 1G6OA 1SCWA 5GLAA 3IWQA 4EETB 3D4FA 5IHVA 4BJPA 5J7EA 3BWLA 1ERMA 2V1AA 5E43A 1PW8A 3NHQA 2V9AA 1LLBA 2IWDA 4I3JA 3CHWP 3TOIA 3T1RA 2PU4A 3L7HA 2WAFA 3C4OA 5HW3A 1H5XA 3IBRA 4E6XA 3CMZA 4QY6A 5E2FA 3T12B 1XJ4A 1XX2A 3TE8A 4H6JB 3BECA 3VP4A 2Y2GA 3PBRA 2K7SA 3DTEA 3A0VA 2Z6CA 5TJJA 1DJAA 2JC7A 2JKTM 1HLUP 1NZUA 2NUTC 2LB5A 4E6WA 4LRXC 2GDNA 5GLBA 3HVFA 3EQUA 1Z6FA 2ZQCA 5E2EA 4OKPA 5DF9A 2HDSA 3VSKA 4PAUA 3G6OA 3G30A 1RGYA 1X0OA 4S2KA 5DKKA 3T4LA 3M2KA 4GZBA 4XT2B 2EX9A 3Q7ZA 1BZAA 1UGUA 4N92A 3GMWA 4F3LB 1JVJA 3KYQA 5F83A 4JXGA 4DKIA 1T19A 1P0ZA 3IHBA 3SH9A 4UEYA 4E3IA 3LIDA 4BLMA 2W3FA 3F1NA 2V0WA 1S6RA 2PAVP 1V9YA 4GCZA 1CI9A 4UQIM 1WYBA 2A24B 4MN7A 2HPBA 1ESUA 1IEMA 2V20A 1XA1A 2GZAA 4S2LA 3IF5A 2Y2LA 3KYZA 5F6AA 2Y2NA 4JLFA 1E4DA 2WYXA 4KQQA 2K2NA 1ACFA 3LR5A 3ZQ5A 3NDGA 5E2HA 1KGGA 4X55A 5EPHA 5HWVA 2ZM0A 3OC2A 5FI2A 1JTGA 4BQMA 1XGIA 2J80A 1ZG4A 4S2NA 4LRYC 3LGOA 3PAEA 3IF6C 2WGVA 3UN7A 3Q7VA 3CG5A 4KZ6A 4HHDA 3ZVTA 2EWVA 1IOUA 4ZDXA 2Y2OA 1BT5A 1W5DA 2V2FF 4KZ3A 2ZBBA 1N9NA 3OLOA 3MXRA 4X1LA 2PBYA 1JWPA 3Q82A 3EGDC 3M2JA 3O86A 3FKVA 3H9WA 4JGOA 3MKEA 5HWWA 4LV1A 5HDCA 4E04A 2P9VA 2VA0A 3NY4A 3MXSA 3UPPA 2QHKA 1LSWA 1NRFA 4ZJ2A 4LV3A 4BBTA 3SW1A 1S0WA 5KSCA 2WZZA 1DP6A 3OCLA 3NECA 1LSXA 3W8KA 3HJKA 3UMEA 2EX6A 3MS6A 2X71A 4B4ZA 4P85A 3UO9A 3UDIA 2DCFA 2PDRA 3LR4A 4WN5A 1E25A 2EX8A 4M4XA 2QPNA 4X53A 3LIEA 1N4OA 4ZJ3A 1YMSA 4ZBEA 3U4LP 3M6BA 3HLDA 3ITBA 2OLVA 3V3RA 2J3TC 5FQMA 5A8BA 1AWIA 2Y2HA 5FQKA 4FCFA 3PYPA 3TJZC 3C8CA 4ME4A 2Y59A 4FH2A 2ZQDA 4DRTA 4QU3A 3G32A 4FUWA 5FDSA 1RP5A 2HGVA 1YQSA 3ZYTA 1L0EA 3T4TA 1NWZA 5HAQA 3HLFA 4NEED 3C7VA 4S2OA 1GHPA 4ARZA 2QZ6A 1LI9A 1WA9A 4KUKA 4I39A 4HBUA 3SS3A 3ZNTA 3BQAA 2DMWA 4FD8A 3QHYA 1OTDA 2ZLYA 2OLUA 3N8SA 4CQHA 2ZQ9A 4OQIA 4L9EA 3MZDA 1PWCA 1BSGA 3T50A 3FC7A 3C5AA 1GHMA 1VETB 2I72A 4FTXA 3U2AA 5F68A 5CGWA 3RXWA 4OQ0A 3VP3A 3Q7VB 1PI5A 3PHYA 4E3JA 3TG9A 3F1OB 1F98A 1KGEA 3T4SA 2W27A 1KDWA 1KGFA 5F1GA 3QNCA 3A3EA 1YPRA 4KQOA 1IFQA 1M40A 1SDEA 5FI6A 3UE6A 1LT0A 2HDUA 4WM9A 3BFGA 3JYIA 4ZTKA 4MMNA 3NOUC 4WEKA 4QB8A 5DTSA 4S2IA 4X25A 2P9VB 4R38A 1IKGA 3G35A 3W4OA 1FR6A 5GHZA 5EVID 3P01A 5FATA 2FH5A 4GS9A 4P6BA 1DY6A 2MJ6A 2FFFB 4IUHA 4KZ7A 3ZG0A 4EEPA 4WZ5C 4LCMA 4MBFA 1FCOA 3G2YA 1K6RA 4S2JA 1NJ4A 3DWZA 3UB9A 4E3NA 2NUPC 2QMIA 5E2GA 3N7WA 1KOUA 2ACGA 5EVLA 4N1XA 2DNSA 4YNRA 5A93A 1I5QA 3BFDA 4G3KA 3IF6A 2Y2QA 2L1MA 3G4PA 3LICA 3NULA 4CLCD 4E3MA 1FCNA 2Z6DA 5AQBA 3FPWA 1LHYA 4ESPA 4GLQA 5A90A 3IHAA 5EVEA 3HLBA 2WGIA 1D7EA 1KVMA 4E3KA 3TRCA 4LLOB 4KUOA 2Q9MA 5F5YA 4OOMA 3K2NA 4HEFA 5JYPA 2VZWA 4U3TA 1HZOA 3SS4A 4K08A 4HESA 3ITAA 3IS2A 3LIFA 5EUAA 1FSWA 1OJGA 3WWXA 2JKRI 2QKPA 3CAXA 4OQHA 1L3LA 2O9CA 5CECA 3EOIA 2A3UA 1P9RA 1K56A 3VE4A 5TGFA 3IT9A 3QP5A 1LI0A 3BFEA 4MN6A 3IX4A 2HJ9C 1YLPA 5AJGA 1VB6A 3LY3A 1PWDA 1BLPA 1ZC2A 4GNUA 1K4EA 4GDNA 1P97A 4DE2A 3GECA 1ESIA 5CERA 3VFHA 2XQZA 4Q8IA 4HQAA 4L0LA 4QPRA 1T18A 3ISGA 3V67A 5FQIA 4XXRA 3WS1A 3KSIA 2X01A 4R3AA 2Q0OA 5AVFA 4D60A 5J8XA 2P7JA 5G18A 4N9KA 2QJ7A 1EI5A 4O01A 4R6LA 2IWBA 4GDBA 4KG6A 1H0MA 4XUXA 3H7WA 4O7DA 3MKFA 4GS9B 4KZ4A 2W3EA 1M6KA 4RA7A 1ES3A 2ZJ9A 4JGPA 4Y0TA 1LL5A 5GLCA 2XFSA 2V8CA 3BYDA 3PBSA 4O0PA 1CJFA 3NCKA 3RXXA 2WZXA 5CTMA 3W4QA 3IF6B 1GCEA 1PWGA 4WUJA 3A3DA 4MLLA 3UMDA 2QYBA 1H3QA 4JF4A 2WKRA 2B95A 1W63Q 2VLGA 1SDNA 2YKHA 4EUZA 3UB7A 3B42A 4QHCA 4ZAMA 1DJCA 2J9PA 2AVXA 2E8JA 3IS2B 1OT6A 2IWCA 2OWJA 4Y15A 3DTMA 4GN2A 3GSGA 1G28A 2XLNA 1VM1A 1PIOA 4R1GA 4KG5A 4IVKA 2BG1A 4OP5A 4PM9A 4R3JA 4UAAA 4N1HA 2OSUA 1HTZA 3W2ZA 4WZ5A 3B47A 4R4RA 4MNRA 2XGNA 5L10A
chains in the Genus database with same CATH topology
1FOFA 1PYYA 3FWLA 3ZVTA 1RCJA 4X69A 3Q81A 3WS4A 4ZDXA 1J9MA 2Y2OA 1L0DA 1BT5A 4R23A 5U47A 4Z9QA 1W5DA 4DXCA 2V2FF 4K91A 4KZ3A 4BD1A 5A91A 3MXRA 2PBYA 1JWPA 4E3OA 4GKUA 3Q82A 3M2JA 3O86A 2HDRA 3IXHA 2JE5A 1EROA 1EWZA 2PU2A 1PZPA 3FKVA 3BM6A 5CGXA 3MKEA 2EXBA 5AQAA 1DJBA 4LV1A 1IYPA 2P9VA 1MWRA 2DRWA 5FA7A 3NY4A 1VQQA 4DE1A 2Y55A 2ZC4B 4S2MA 3MXSA 3BLSA 1MPLA 3UPPA 1XP4A 3UPNA 2J9OA 2P74A 1NRFA 3LY4A 4ZJ2A 4C6YA 4LV3A 3PBTA 2UWXA 1MBLA 3UE1A 1S0WA 4XUZA 5KSCA 4KZ8A 4LCLA 3HUOA 1JWVA 3NI9A 1SKFA 2WZZA 4GOGA 4JBFA 4BL3A 3NIAA 3C4PA 1MKIA 3OCLA 4KZBA 5HAIA 2Y4AA 5KZHA 2ZQAA 3W8KA 4LENA 4FH4A 3ZG9B 3IQAA 1BLHA 2EX6A 1HD8A 2J8YA 2X71A 3CZDA 4OP8A 2C6WB 4P85A 2HP6A 4B4ZA 3UO9A 3A3IA 3UDIA 2WK0A 1MWTA 5GLDA 1Q2QA 1GA9A 4PM5A 2DCFA 4P0MA 4IBRA 3ZHHA 3MFDA 3HUNA 5CHUA 2C5WB 1E25A 3AGDA 2EX8A 3N4IA 3M6HA 3N8RA 3IXDA 1IYOA 2QPNA 3PBQA 4X53A 2Y2IA 1N4OA 4ZJ3A 1YMSA 4ZBEA 1CEGA 1TEMA 4DE3A 1I2WA 1YLTA 2ZC6B 1E3UD 3HLDA 3M6BA 3ZG8B 3ITBA 4MEZA 2OLVA 5EOEA 1Y54A 1BTLA 1YM1A 3V3RA 4M3KA 4DDYA 5FQMA 2XH9A 2Y2HA 5EECA 4FCFA 5FQKA 5EOOA 3HBRA 2Y59A 4FH2A 1G6AA 1ZKJA 3V50A 2ZQDA 1RGZA 5M19A 4DRTA 4QU3A 2ZM2A 4EQIA 4F94A 3G32A 2EXAA 3BRMA 1TVFA 1RP5A 1NXYA 1YQSA 1L0EA 1H8ZA 2WKIA 1E3UA 2JBFA 3GVBA 5HAQA 2XD5A 3HLFA 5D3OA 1K4FA 1PZOA 4QD4A 3C7VA 4S2OA 2A49A 1GHPA 1ZG6A 2QZ6A 1JWZA 3VP0A 1LI9A 2ZC7A 4KZ5A 1FSYA 2CC1A 4HBUA 4JXSA 4WZ4A 1YMXA 3CJMA 3SS3A 3ZNTA 1KE0A 1BLSA 1K54A 4KZAA 2Y2KA 1K55A 4MBHA 4FD8A 4OPZA 3ZVWA 3OCNA 3QHYA 3LCEA 3SS5A 2ZLYA 2OLUA 1W8QA 1YT4A 5HX9A 3N8SA 4DF6A 5HL1A 2ZQ9A 4OQIA 4X68A 1L0GA 1NY0A 1MWSA 3MZDA 1YLZA 3OPLA 3G2ZA 1PWCA 4R0QA 1BSGA 1W79A 3PAGA 4E3LA 3C5AA 3WS2A 1GHMA 3MZEA 2I72A 4K0WA 5FQQA 4EBNA 5CGWA 3RXWA 1IKIA 1MWUA 2WGWA 4OQ0A 3VP3A 5FQ9A 3Q7VB 1O07A 1PI5A 3BFFA 4UA7A 4N9LA 2ZC5B 1CK3A 3FV7A 4CPKA 1K57A 4RX3A 3TG9A 3ZCZA 4E3JA 5CTNA 3LO7A 5FSRA 1KGEA 1XPBA 1KDWA 4X6TA 4BENA 5F1FA 2VGKA 2Y2PA 3BFCA 1KGFA 4JPMA 5F1GA 1HVBA 4B88A 1XXMA 3QNCA 4QY5A 1JTDA 3A3EA 4KQOA 4YINA 3WRZA 1M40A 1SDEA 3B3XA 2FFYA 1NYMA 2H5SA 5FI6A 4C3QA 4IBXA 2HP9A 4S2PA 4OLGA 2G2UA 2HP5A 4PM6A 2HDUA 1O7EA 5KSHA 1FCMA 2XF3A 4WM9A 3TSGA 3BFGA 3JYIA 3UNWA 1XA7A 3WS5A 2XFTA 3C7UA 4ZTKA 4OH0A 4NETA 2Y2JA 5DTTA 5AQ9A 3P09A 4HBTA 4WEKA 4QB8A 5DTSA 1LL9A 3BEBA 4S2IA 2P9VB 4MBKA 4WBGA 3O88A 1WYCA 1IKGA 3G35A 3O3VA 1W7FA 3W4OA 4BD0A 1FR6A 5GHZA 5EVID 2XDMA 2Z2LB 5HARA 4DDSA 2XR0A 5FATA 2WKEA 4S2NC 1WE4A 2ZQ7A 3GRJA 5CGSA 1ALQA 1DY6A 2Y91A 4P6BA 2FFFB 1K38A 1YLYA 4KZ7A 3ZG0A 3OPPA 3Q07A 4WZ5C 4LCMA 2HDQA 4MBFA 5GL9A 1FCOA 3G2YA 4U0XA 3VOYA 1K6RA 3A3JA 4S2JA 4C75A 4LV0A 1W8YA 3IXGA 1NJ4A 1TDGA 4WMCD 3QNBA 3HLEA 3DWZA 5EVIA 4E3NA 3VMAA 3WS0A 5L2FA 3UPOA 2R9WA 3OPRA 2QMIA 2ZQ8A 5E2GA 5DTKA 1H8YA 2ZC3B 3E2KA 4EV4A 5CEBA 3N7WA 5EVLA 4N1XA 2DNSA 5A93A 1I5QA 3BFDA 3I7JA 3O87A 3BLMA 3IF6A 3ZDJA 2H0YA 2XEPA 5M1AA 3GV9A 2Y2QA 3PBOA 1KE3A 3S22A 3NC8A 3G4PA 4GD6A 1XKZA 5GHYA 4WMCA 4E3MA 1FCNA 2WADA 4RX2A 4JXWA 5FI7A 4U0TA 5AQBA 1LHYA 2Y2MA 3G31A 5CHJA 1K25A 1IYQA 5AQ7A 3V39A 3IHAA 3VP1A 3ZFZA 4ZJ1A 4EWFA 5A90A 3HLBA 2WGIA 4OONA 3SOIA 3Q1FA 1KVMA 4H8RA 3VP2A 3GR2A 4E3KA 4QJGA 5HAPA 2G2WA 1KDSA 1ES5A 2Q9MA 4RYEA 1IELA 1XGJA 3IH8A 3NDEA 3HUMA 3A3FA 4OOMA 3HLGA 4HEFA 3PTEA 5JYPA 3PBNA 1TDLA 4U3TA 1HZOA 4OVDA 3SS4A 1IYSA 4HESA 2H0TA 3ITAA 1K56D 5FAOA 5EUAA 1FSWA 3AGFA 4JF6A 4OPYA 3FZCA 4KENB 4OLDA 3UY6A 4EBPA 2EFUA 3WWXA 1SCWA 5GLAA 3IWQA 5TFQA 4UA6A 3D4FA 4DXBA 5IHVA 4BJPA 4OQHA 1NYYA 5CXWA 5CECA 1ERMA 5E43A 5CRFA 1PW8A 3MZFA 1LLBA 2IWDA 2A3UA 1K56A 1QMFA 2B5RA 1QMEA 5DVAA 3TOIA 2PU4A 2ZMAA 5TGFA 3IT9A 3SH8A 4A5RA 1LI0A 2WUQA 3FYZA 1C3BA 3UDXA 2RL3A 3BFEA 5DF7A 1ES4A 2WAFA 3S4XA 3C4OA 3ZG7B 5HW3A 1H5XA 2RCXA 1YLPA 4E6XA 3CMZA 3DW0A 3HLCA 1L2SA 4QY6A 5E2FA 2ZM8A 4UHUA 5HFOA 1Q2PA 1XX2A 3LY3A 5CEDA 1K6SA 1PWDA 1BLPA 1ZC2A 3BECA 3VP4A 2WGWB 1KVLA 2Y2GA 3PBRA 1AXBA 4GNUA 5M18A 1FQGA 1K4EA 4GDNA 1DJAA 2JC7A 4DE2A 2OV5A 2X02A 1NZUA 5EE8A 4OQGA 1ESIA 5CERA 3VFHA 2XQZA 4Q8IA 4DE0A 1GA0A 4L0LA 3G34A 4NK3A 4OOYA 5FDHA 4E6WA 3UDFA 2GDNA 4IEDA 3ISGA 4PPRA 5GLBA 1L0FA 5FQIA 4XXRA 1FR1A 1K54C 3WS1A 1OMEA 3OPHA 1K55C 3GQZA 3HVFA 2X01A 4KG2A 3EQUA 4K0XA 1Z6FA 3HL9A 1CI8A 2ZQCA 3WRTA 2H10A 2EFXA 5E2EA 4KZ9A 2V1ZA 4OKPA 3UE0A 5DF9A 1ONHA 2HDSA 4X56A 4KQRA 5JYOA 3VSKA 4B4XA 5J8XA 4WEJA 3G30A 5G18A 4N9KA 1RGYA 4S2KA 1N9BA 1MXOA 3M2KA 4D2OA 4GZBA 4OPQA 1EI5A 2EX9A 5A92A 3Q7ZA 2IWBA 4GDBA 5KMWA 1BZAA 3N6IA 4JXVA 2BLSA 1ES2A 4KG6A 1BUEA 2EX2A 5FQJA 1SHVA 4N92A 4XUXA 2XD1A 3GMWA 3HREA 4O7DA 3LEZA 3MKFA 5BOHA 3EQVA 1JVJA 4KZ4A 4OPRA 1M6KA 4PM8A 2Z2MB 4RA7A 1ES3A 1NZOA 3IXBA 2ZJ9A 4Y0TA 3MBZA 5F83A 4YFMA 1K57C 1LL5A 4UA9A 4WYYA 3P98A 2WKHA 4JXGA 3ZG5A 4DKIA 5GLCA 4JF5A 4Y0UA 3IHBA 3IH9A 2XFSA 4PM7A 3V5MA 5EVIB 3SH9A 3BYDA 3PBSA 3SH7A 2E8IA 4E3IA 4GD8A 4BLMA 1GHIA 3NCKA 3RXXA 3OZHA 1S6RA 2WZXA 3DWKA 5CTMA 3VFFA 5I94A 3S1YA 4OOLA 3W4QA 3IF6B 1GCEA 1CI9A 2ZD8A 1PWGA 3A3DA 1WYBA 2R9XA 3NBLA 2VGJA 4GB7A 4MLLA 3VOZA 3FKWA 2HPBA 1ESUA 2V20A 1ERQA 1IEMA 4R4SA 5GHXA 4EBLA 1XA1A 5DF8A 4JF4A 3IWIA 4S2LA 5TR7A 1I2SA 3IWOA 3IF5A 4CJNA 2Y2LA 4IVIA 3GTCA 4WELA 4P87A 2Y2NA 3W4PA 4JLFA 1E4DA 3ZGAB 1YLWA 1BULA 1CEFA 2WYXA 1U60A 4KQQA 1SDNA 1G68A 4EUZA 4BL2A 4QHCA 4ZAMA 1ONGA 1DJCA 2J9PA 4RVAA 4Y7PA 5F82A 3NDGA 4Y0OA 2XK1A 3AGEA 2IWCA 4LV2A 3DTMA 1KE4A 3E2LA 4GN2A 5E2HA 5EVIC 5FASA 1KGGA 4X55A 1PI4A 5EPHA 1PW1A 3GSGA 3RJUA 2XLNA 1VM1A 1PIOA 3V3SA 4R1GA 1YLJA 3ZNYA 2ZM0A 3OC2A 5CHMA 2JCHA 4KG5A 3HLWA 5FI2A 4IVKA 1JTGA 2BG1A 4PMAA 1XGIA 4BQMA 4OP5A 1ZG4A 4S2NA 4R3BA 4PM9A 4R3JA 3UE3A 3PAEA 4UAAA 3IF6C 2WGVA 1BLCA 3N8LA 4ID4A 2Q9NA 4JKTA 3UN7A 5FAQA 4N1HA 2OSUA 5FAPA 1MY8A 3Q7VA 1HTZA 4WZ5A 2J7VA 2WAEA 4R4RA 4FSFA 3VSLA 3CG5A 4KZ6A 4MNRA 2XGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOF A;  1PYY A;  3FWL A;  3ZVT A;  1RCJ A;  4X69 A;  3Q81 A;  3WS4 A;  4ZDX A;  1J9M A;  2Y2O A;  1L0D A;  1BT5 A;  4R23 A;  5U47 A;  4Z9Q A;  1W5D A;  4DXC A;  2V2F F;  4K91 A;  4KZ3 A;  4BD1 A;  5A91 A;  3MXR A;  2PBY A;  1JWP A;  4E3O A;  4GKU A;  3Q82 A;  3M2J A;  3O86 A;  2HDR A;  3IXH A;  2JE5 A;  1ERO A;  1EWZ A;  2PU2 A;  1PZP A;  3FKV A;  3BM6 A;  5CGX A;  3MKE A;  2EXB A;  5AQA A;  1DJB A;  4LV1 A;  1IYP A;  2P9V A;  1MWR A;  2DRW A;  5FA7 A;  3NY4 A;  1VQQ A;  4DE1 A;  2Y55 A;  2ZC4 B;  4S2M A;  3MXS A;  3BLS A;  1MPL A;  3UPP A;  1XP4 A;  3UPN A;  2J9O A;  2P74 A;  1NRF A;  3LY4 A;  4ZJ2 A;  4C6Y A;  4LV3 A;  3PBT A;  2UWX A;  1MBL A;  3UE1 A;  1S0W A;  4XUZ A;  5KSC A;  4KZ8 A;  4LCL A;  3HUO A;  1JWV A;  3NI9 A;  1SKF A;  2WZZ A;  4GOG A;  4JBF A;  4BL3 A;  3NIA A;  3C4P A;  1MKI A;  3OCL A;  4KZB A;  5HAI A;  2Y4A A;  5KZH A;  2ZQA A;  3W8K A;  4LEN A;  4FH4 A;  3ZG9 B;  3IQA A;  1BLH A;  2EX6 A;  1HD8 A;  2J8Y A;  2X71 A;  3CZD A;  4OP8 A;  2C6W B;  4P85 A;  2HP6 A;  4B4Z A;  3UO9 A;  3A3I A;  3UDI A;  2WK0 A;  1MWT A;  5GLD A;  1Q2Q A;  1GA9 A;  4PM5 A;  2DCF A;  4P0M A;  4IBR A;  3ZHH A;  3MFD A;  3HUN A;  5CHU A;  2C5W B;  1E25 A;  3AGD A;  2EX8 A;  3N4I A;  3M6H A;  3N8R A;  3IXD A;  1IYO A;  2QPN A;  3PBQ A;  4X53 A;  2Y2I A;  1N4O A;  4ZJ3 A;  1YMS A;  4ZBE A;  1CEG A;  1TEM A;  4DE3 A;  1I2W A;  1YLT A;  2ZC6 B;  1E3U D;  3HLD A;  3M6B A;  3ZG8 B;  3ITB A;  4MEZ A;  2OLV A;  5EOE A;  1Y54 A;  1BTL A;  1YM1 A;  3V3R A;  4M3K A;  4DDY A;  5FQM A;  2XH9 A;  2Y2H A;  5EEC A;  4FCF A;  5FQK A;  5EOO A;  3HBR A;  2Y59 A;  4FH2 A;  1G6A A;  1ZKJ A;  3V50 A;  2ZQD A;  1RGZ A;  5M19 A;  4DRT A;  4QU3 A;  2ZM2 A;  4EQI A;  4F94 A;  3G32 A;  2EXA A;  3BRM A;  1TVF A;  1RP5 A;  1NXY A;  1YQS A;  1L0E A;  1H8Z A;  2WKI A;  1E3U A;  2JBF A;  3GVB A;  5HAQ A;  2XD5 A;  3HLF A;  5D3O A;  1K4F A;  1PZO A;  4QD4 A;  3C7V A;  4S2O A;  2A49 A;  1GHP A;  1ZG6 A;  2QZ6 A;  1JWZ A;  3VP0 A;  1LI9 A;  2ZC7 A;  4KZ5 A;  1FSY A;  2CC1 A;  4HBU A;  4JXS A;  4WZ4 A;  1YMX A;  3CJM A;  3SS3 A;  3ZNT A;  1KE0 A;  1BLS A;  1K54 A;  4KZA A;  2Y2K A;  1K55 A;  4MBH A;  4FD8 A;  4OPZ A;  3ZVW A;  3OCN A;  3QHY A;  3LCE A;  3SS5 A;  2ZLY A;  2OLU A;  1W8Q A;  1YT4 A;  5HX9 A;  3N8S A;  4DF6 A;  5HL1 A;  2ZQ9 A;  4OQI A;  4X68 A;  1L0G A;  1NY0 A;  1MWS A;  3MZD A;  1YLZ A;  3OPL A;  3G2Z A;  1PWC A;  4R0Q A;  1BSG A;  1W79 A;  3PAG A;  4E3L A;  3C5A A;  3WS2 A;  1GHM A;  3MZE A;  2I72 A;  4K0W A;  5FQQ A;  4EBN A;  5CGW A;  3RXW A;  1IKI A;  1MWU A;  2WGW A;  4OQ0 A;  3VP3 A;  5FQ9 A;  3Q7V B;  1O07 A;  1PI5 A;  3BFF A;  4UA7 A;  4N9L A;  2ZC5 B;  1CK3 A;  3FV7 A;  4CPK A;  1K57 A;  4RX3 A;  3TG9 A;  3ZCZ A;  4E3J A;  5CTN A;  3LO7 A;  5FSR A;  1KGE A;  1XPB A;  1KDW A;  4X6T A;  4BEN A;  5F1F A;  2VGK A;  2Y2P A;  3BFC A;  1KGF A;  4JPM A;  5F1G A;  1HVB A;  4B88 A;  1XXM A;  3QNC A;  4QY5 A;  1JTD A;  3A3E A;  4KQO A;  4YIN A;  3WRZ A;  1M40 A;  1SDE A;  3B3X A;  2FFY A;  1NYM A;  2H5S A;  5FI6 A;  4C3Q A;  4IBX A;  2HP9 A;  4S2P A;  4OLG A;  2G2U A;  2HP5 A;  4PM6 A;  2HDU A;  1O7E A;  5KSH A;  1FCM A;  2XF3 A;  4WM9 A;  3TSG A;  3BFG A;  3JYI A;  3UNW A;  1XA7 A;  3WS5 A;  2XFT A;  3C7U A;  4ZTK A;  4OH0 A;  4NET A;  2Y2J A;  5DTT A;  5AQ9 A;  3P09 A;  4HBT A;  4WEK A;  4QB8 A;  5DTS A;  1LL9 A;  3BEB A;  4S2I A;  2P9V B;  4MBK A;  4WBG A;  3O88 A;  1WYC A;  1IKG A;  3G35 A;  3O3V A;  1W7F A;  3W4O A;  4BD0 A;  1FR6 A;  5GHZ A;  5EVI D;  2XDM A;  2Z2L B;  5HAR A;  4DDS A;  2XR0 A;  5FAT A;  2WKE A;  4S2N C;  1WE4 A;  2ZQ7 A;  3GRJ A;  5CGS A;  1ALQ A;  1DY6 A;  2Y91 A;  4P6B A;  2FFF B;  1K38 A;  1YLY A;  4KZ7 A;  3ZG0 A;  3OPP A;  3Q07 A;  4WZ5 C;  4LCM A;  2HDQ A;  4MBF A;  5GL9 A;  1FCO A;  3G2Y A;  4U0X A;  3VOY A;  1K6R A;  3A3J A;  4S2J A;  4C75 A;  4LV0 A;  1W8Y A;  3IXG A;  1NJ4 A;  1TDG A;  4WMC D;  3QNB A;  3HLE A;  3DWZ A;  5EVI A;  4E3N A;  3VMA A;  3WS0 A;  5L2F A;  3UPO A;  2R9W A;  3OPR A;  2QMI A;  2ZQ8 A;  5E2G A;  5DTK A;  1H8Y A;  2ZC3 B;  3E2K A;  4EV4 A;  5CEB A;  3N7W A;  5EVL A;  4N1X A;  2DNS A;  5A93 A;  1I5Q A;  3BFD A;  3I7J A;  3O87 A;  3BLM A;  3IF6 A;  3ZDJ A;  2H0Y A;  2XEP A;  5M1A A;  3GV9 A;  2Y2Q A;  3PBO A;  1KE3 A;  3S22 A;  3NC8 A;  3G4P A;  4GD6 A;  1XKZ A;  5GHY A;  4WMC A;  4E3M A;  1FCN A;  2WAD A;  4RX2 A;  4JXW A;  5FI7 A;  4U0T A;  5AQB A;  1LHY A;  2Y2M A;  3G31 A;  5CHJ A;  1K25 A;  1IYQ A;  5AQ7 A;  3V39 A;  3IHA A;  3VP1 A;  3ZFZ A;  4ZJ1 A;  4EWF A;  5A90 A;  3HLB A;  2WGI A;  4OON A;  3SOI A;  3Q1F A;  1KVM A;  4H8R A;  3VP2 A;  3GR2 A;  4E3K A;  4QJG A;  5HAP A;  2G2W A;  1KDS A;  1ES5 A;  2Q9M A;  4RYE A;  1IEL A;  1XGJ A;  3IH8 A;  3NDE A;  3HUM A;  3A3F A;  4OOM A;  3HLG A;  4HEF A;  3PTE A;  5JYP A;  3PBN A;  1TDL A;  4U3T A;  1HZO A;  4OVD A;  3SS4 A;  1IYS A;  4HES A;  2H0T A;  3ITA A;  1K56 D;  5FAO A;  5EUA A;  1FSW A;  3AGF A;  4JF6 A;  4OPY A;  3FZC A;  4KEN B;  4OLD A;  3UY6 A;  4EBP A;  2EFU A;  3WWX A;  1SCW A;  5GLA A;  3IWQ A;  5TFQ A;  4UA6 A;  3D4F A;  4DXB A;  5IHV A;  4BJP A;  4OQH A;  1NYY A;  5CXW A;  5CEC A;  1ERM A;  5E43 A;  5CRF A;  1PW8 A;  3MZF A;  1LLB A;  2IWD A;  2A3U A;  1K56 A;  1QMF A;  2B5R A;  1QME A;  5DVA A;  3TOI A;  2PU4 A;  2ZMA A;  5TGF A;  3IT9 A;  3SH8 A;  4A5R A;  1LI0 A;  2WUQ A;  3FYZ A;  1C3B A;  3UDX A;  2RL3 A;  3BFE A;  5DF7 A;  1ES4 A;  2WAF A;  3S4X A;  3C4O A;  3ZG7 B;  5HW3 A;  1H5X A;  2RCX A;  1YLP A;  4E6X A;  3CMZ A;  3DW0 A;  3HLC A;  1L2S A;  4QY6 A;  5E2F A;  2ZM8 A;  4UHU A;  5HFO A;  1Q2P A;  1XX2 A;  3LY3 A;  5CED A;  1K6S A;  1PWD A;  1BLP A;  1ZC2 A;  3BEC A;  3VP4 A;  2WGW B;  1KVL A;  2Y2G A;  3PBR A;  1AXB A;  4GNU A;  5M18 A;  1FQG A;  1K4E A;  4GDN A;  1DJA A;  2JC7 A;  4DE2 A;  2OV5 A;  2X02 A;  1NZU A;  5EE8 A;  4OQG A;  1ESI A;  5CER A;  3VFH A;  2XQZ A;  4Q8I A;  4DE0 A;  1GA0 A;  4L0L A;  3G34 A;  4NK3 A;  4OOY A;  5FDH A;  4E6W A;  3UDF A;  2GDN A;  4IED A;  3ISG A;  4PPR A;  5GLB A;  1L0F A;  5FQI A;  4XXR A;  1FR1 A;  1K54 C;  3WS1 A;  1OME A;  3OPH A;  1K55 C;  3GQZ A;  3HVF A;  2X01 A;  4KG2 A;  3EQU A;  4K0X A;  1Z6F A;  3HL9 A;  1CI8 A;  2ZQC A;  3WRT A;  2H10 A;  2EFX A;  5E2E A;  4KZ9 A;  2V1Z A;  4OKP A;  3UE0 A;  5DF9 A;  1ONH A;  2HDS A;  4X56 A;  4KQR A;  5JYO A;  3VSK A;  4B4X A;  5J8X A;  4WEJ A;  3G30 A;  5G18 A;  4N9K A;  1RGY A;  4S2K A;  1N9B A;  1MXO A;  3M2K A;  4D2O A;  4GZB A;  4OPQ A;  1EI5 A;  2EX9 A;  5A92 A;  3Q7Z A;  2IWB A;  4GDB A;  5KMW A;  1BZA A;  3N6I A;  4JXV A;  2BLS A;  1ES2 A;  4KG6 A;  1BUE A;  2EX2 A;  5FQJ A;  1SHV A;  4N92 A;  4XUX A;  2XD1 A;  3GMW A;  3HRE A;  4O7D A;  3LEZ A;  3MKF A;  5BOH A;  3EQV A;  1JVJ A;  4KZ4 A;  4OPR A;  1M6K A;  4PM8 A;  2Z2M B;  4RA7 A;  1ES3 A;  1NZO A;  3IXB A;  2ZJ9 A;  4Y0T A;  3MBZ A;  5F83 A;  4YFM A;  1K57 C;  1LL5 A;  4UA9 A;  4WYY A;  3P98 A;  2WKH A;  4JXG A;  3ZG5 A;  4DKI A;  5GLC A;  4JF5 A;  4Y0U A;  3IHB A;  3IH9 A;  2XFS A;  4PM7 A;  3V5M A;  5EVI B;  3SH9 A;  3BYD A;  3PBS A;  3SH7 A;  2E8I A;  4E3I A;  4GD8 A;  4BLM A;  1GHI A;  3NCK A;  3RXX A;  3OZH A;  1S6R A;  2WZX A;  3DWK A;  5CTM A;  3VFF A;  5I94 A;  3S1Y A;  4OOL A;  3W4Q A;  3IF6 B;  1GCE A;  1CI9 A;  2ZD8 A;  1PWG A;  3A3D A;  1WYB A;  2R9X A;  3NBL A;  2VGJ A;  4GB7 A;  4MLL A;  3VOZ A;  3FKW A;  2HPB A;  1ESU A;  2V20 A;  1ERQ A;  1IEM A;  4R4S A;  5GHX A;  4EBL A;  1XA1 A;  5DF8 A;  4JF4 A;  3IWI A;  4S2L A;  5TR7 A;  1I2S A;  3IWO A;  3IF5 A;  4CJN A;  2Y2L A;  4IVI A;  3GTC A;  4WEL A;  4P87 A;  2Y2N A;  3W4P A;  4JLF A;  1E4D A;  3ZGA B;  1YLW A;  1BUL A;  1CEF A;  2WYX A;  1U60 A;  4KQQ A;  1SDN A;  1G68 A;  4EUZ A;  4BL2 A;  4QHC A;  4ZAM A;  1ONG A;  1DJC A;  2J9P A;  4RVA A;  4Y7P A;  5F82 A;  3NDG A;  4Y0O A;  2XK1 A;  3AGE A;  2IWC A;  4LV2 A;  3DTM A;  1KE4 A;  3E2L A;  4GN2 A;  5E2H A;  5EVI C;  5FAS A;  1KGG A;  4X55 A;  1PI4 A;  5EPH A;  1PW1 A;  3GSG A;  3RJU A;  2XLN A;  1VM1 A;  1PIO A;  3V3S A;  4R1G A;  1YLJ A;  3ZNY A;  2ZM0 A;  3OC2 A;  5CHM A;  2JCH A;  4KG5 A;  3HLW A;  5FI2 A;  4IVK A;  1JTG A;  2BG1 A;  4PMA A;  1XGI A;  4BQM A;  4OP5 A;  1ZG4 A;  4S2N A;  4R3B A;  4PM9 A;  4R3J A;  3UE3 A;  3PAE A;  4UAA A;  3IF6 C;  2WGV A;  1BLC A;  3N8L A;  4ID4 A;  2Q9N A;  4JKT A;  3UN7 A;  5FAQ A;  4N1H A;  2OSU A;  5FAP A;  1MY8 A;  3Q7V A;  1HTZ A;  4WZ5 A;  2J7V A;  2WAE A;  4R4R A;  4FSF A;  3VSL A;  3CG5 A;  4KZ6 A;  4MNR A;  2XGN A; 
#chains in the Genus database with same CATH topology
 1FOF A;  3KSG A;  1G5U A;  3Q81 A;  4I38 A;  2FZ0 A;  3IX3 A;  1MKM A;  5F69 A;  5U47 A;  3K3C A;  4K91 A;  3UB5 P;  4BD1 A;  2ZMV A;  4I3I A;  3D3O A;  2HDR A;  2JE5 A;  4HP4 A;  3MF0 A;  3BM6 A;  3EEA A;  3JVU A;  5FA7 A;  1VQQ A;  4YOF A;  1S4S A;  2ZC4 B;  5IS1 A;  4Y2F A;  1XP4 A;  1YSQ A;  4BBU A;  3LY4 A;  4C6Y A;  3PBT A;  1PRQ A;  5TBM A;  3LIB A;  1YAX A;  4JBF A;  4BL3 A;  5EM1 A;  3NOT C;  3NIA A;  4NXE A;  5KZH A;  5FL3 A;  4FH4 A;  3IQA A;  3A3I A;  2WK0 A;  4PM5 A;  1GA9 A;  4IBR A;  3MFD A;  1GSV A;  5HDS A;  1OTI A;  3AGD A;  3N4I A;  1XJ6 A;  3CI6 A;  2EWW A;  3PBQ A;  2QJ5 A;  1STZ A;  3T1X A;  1CEG A;  2BTF P;  4DE3 A;  4ETZ A;  1I2W A;  2ZC6 B;  4IUK A;  1E3U D;  4M3K A;  3T4Q A;  4B9O A;  3HBR A;  3V50 A;  2ZM2 A;  3DAV A;  3BRM A;  4DMZ A;  1XJ2 A;  2XD5 A;  5L8M A;  2INW A;  1VEU B;  4WLA A;  2PR6 A;  1DP9 A;  1H8M A;  3VP0 A;  3CIT A;  2CC1 A;  3PXP A;  4WZ4 A;  3CJM A;  4Q0H A;  1UWP X;  4KZA A;  5HD3 A;  3MMH A;  4HJ3 A;  4MBH A;  3BQ8 A;  1W63 M;  3SS5 A;  2VEA A;  4YWZ A;  1YT4 A;  5HL1 A;  2ZL1 A;  1L0G A;  1NY0 A;  1MWS A;  3OPL A;  3G2Z A;  2PBD P;  4E3L A;  3MXQ A;  3KSF A;  4K0W A;  4EBN A;  4N9L A;  2ZC5 B;  1CK3 A;  4O8G A;  4RX3 A;  3ZCZ A;  5FSR A;  2VGK A;  2J3T D;  4JPM A;  1XXM A;  4QY5 A;  1JTD A;  1YKD A;  3SZT A;  4KQD A;  3B3X A;  1NYM A;  4OLG A;  2HP5 A;  5KSH A;  1FCM A;  2XF3 A;  4B93 A;  1UWN X;  3C7U A;  5AQ9 A;  2W0N A;  4HNB A;  1D06 A;  4BMW A;  4Y5F A;  2PRF A;  1FIL A;  2XDM A;  2A2L A;  4DDS A;  2ZQ7 A;  2O0Y A;  3GRJ A;  5CGS A;  5DJU A;  5TBM B;  1ALQ A;  3KYE A;  3E4P A;  2PD7 A;  1YLY A;  4U0X A;  4C75 A;  1W8Y A;  2V1B A;  2UV0 E;  3VMA A;  3UPO A;  2R9W A;  3OPR A;  2OAP 1;  1H8Y A;  3E2K A;  5CEB A;  2OWH A;  2VK3 A;  5DFX A;  4NKP A;  3F1N B;  2H0Y A;  3S22 A;  1KE3 A;  4GD6 A;  4WMC A;  2WAD A;  2EA9 A;  4RX2 A;  4U0T A;  4GJ4 A;  5CHJ A;  1K25 A;  1IYQ A;  4EWF A;  4ZJ1 A;  3MJQ A;  3Q1F A;  4H8R A;  3GR2 A;  4QJG A;  2G2W A;  2XRO A;  1ES5 A;  1IEL A;  3F1P A;  3IH8 A;  3NDE A;  4HH2 A;  3PTE A;  1TDL A;  2JN7 A;  4OVD A;  1Y28 A;  1IYS A;  1GSX A;  4DN0 A;  2B02 A;  4RQ9 A;  2KDK A;  4OPY A;  4OLD A;  3QP1 A;  2EFU A;  2PD8 A;  4HOI A;  5L09 A;  4DXB A;  1NYY A;  5CRF A;  1OPX A;  1QMF A;  2B5R A;  1QME A;  3SH8 A;  4A5R A;  2WUQ A;  2RL3 A;  2ZL1 B;  5DF7 A;  4EEU A;  1ES4 A;  2RCX A;  3LI9 A;  3DW0 A;  2QWS A;  1CQA A;  4UHU A;  5HFO A;  5CED A;  2WKP A;  2JKF A;  5HL6 A;  2OV5 A;  2X02 A;  5EE8 A;  5AVE A;  5J3W A;  2OAQ 1;  2H28 A;  2L4R A;  1GA0 A;  1S1Z A;  4NK3 A;  3RH8 B;  5FDH A;  2G7U A;  1OME A;  3OPH A;  1K55 C;  4KG2 A;  4K0X A;  1CI8 A;  2H10 A;  4KZ9 A;  2V1Z A;  3UE0 A;  1ONH A;  4KQR A;  4PHT A;  4B4X A;  3CLO A;  4WEJ A;  4Y13 A;  1N9B A;  1MXO A;  2JHE A;  2PT7 A;  3MSH A;  5A92 A;  4GW9 A;  1ES2 A;  1BUE A;  1SHV A;  2XD1 A;  3HRE A;  3LEZ A;  1NZO A;  3T4J A;  3MBZ A;  4YFM A;  4UA9 A;  2WKH A;  2VKS A;  4JF5 A;  4R70 A;  4Y0U A;  4Y3I A;  3SH7 A;  2E8I A;  4UQI S;  3D72 A;  1GHI A;  4I5S A;  5HPI A;  2VJW A;  3OZH A;  3VFF A;  5I94 A;  3S1Y A;  3KSH A;  4LPZ A;  1CF0 A;  3VOL A;  3NBL A;  2VGJ A;  3LI8 A;  4GB7 A;  5DKL A;  2CMN A;  5LBR A;  3FKW A;  5C5K A;  1ERQ A;  5GHX A;  4EBL A;  3IWO A;  4CJN A;  4WEL A;  5K5B A;  4P87 A;  3ZGA B;  1YLW A;  3F1P B;  1BUL A;  1U60 A;  4ARZ B;  4BL2 A;  3E98 A;  1ONG A;  1DP8 A;  4RVA A;  4Y7P A;  3S7P A;  4Y0O A;  3MQ0 A;  5EVI C;  1KE4 A;  5FAS A;  1PW1 A;  1YLJ A;  5CHM A;  2JCH A;  1GSW A;  1TS7 A;  3KX0 X;  4PMA A;  4R3B A;  4MN5 A;  3UE3 A;  4ID4 A;  3N8L A;  4JKT A;  2Q9N A;  5IU1 A;  1MY8 A;  4Q0J A;  4HP9 A;  2WAE A;  1PYY A;  3FWL A;  5HSQ A;  1RCJ A;  3WS4 A;  1J9M A;  1OTE A;  4R23 A;  4Z9Q A;  4DXC A;  4G3W A;  5A91 A;  4CLC C;  2PYP A;  3S7O A;  1ERO A;  2PU2 A;  1PZP A;  5CGX A;  2EXB A;  1MC0 A;  5AQA A;  3VV4 A;  1DJB A;  1IYP A;  4DE1 A;  2HZ5 A;  2PYR A;  1ZTU A;  1MPL A;  3UPN A;  2J9O A;  4DJ2 A;  2P74 A;  3UE1 A;  4KZ8 A;  3HUO A;  3NI9 A;  1SKF A;  2JKR M;  1F5M A;  2Y8H A;  5IT5 A;  4KZB A;  5HAI A;  3LIA A;  1ODV A;  1BLH A;  2J8Y A;  4OP8 A;  2C6W B;  2HP6 A;  5FEG A;  1MWT A;  2HJE A;  4P0M A;  3ZHH A;  3HUN A;  2C5W B;  1EW0 A;  3M6H A;  1IYO A;  3MQO A;  2O9A A;  2Y2I A;  3T1S A;  1VHM A;  1S4R A;  3HJI A;  1TEM A;  1YLT A;  1V9Z A;  2M1C A;  3ZG8 B;  2JKT I;  1YM1 A;  2XH9 A;  5EEC A;  5EOO A;  3R7W A;  1G6A A;  2M7U A;  5M19 A;  1RGZ A;  3A0S A;  2EXA A;  1TVF A;  4LFU A;  1T1B A;  2JBF A;  3GVB A;  3PR6 A;  1K4F A;  2VX8 A;  3MFX A;  2A49 A;  5MC7 A;  3EGX C;  1SKO A;  2ZC7 A;  3FG8 A;  1YMX A;  5HPF A;  1K55 A;  3O5Y A;  4L9F A;  4OPZ A;  3OCN A;  2HF6 A;  1JNU A;  3LCE A;  4HIA A;  5HX9 A;  4DF6 A;  3UB8 A;  3CUE C;  3HCY A;  1TF1 A;  4X68 A;  1TS8 A;  4R0Q A;  2KLI A;  4ZRR A;  1S1Y A;  3WS2 A;  3LUQ A;  5FQQ A;  2W3D A;  1IKI A;  2WGW A;  3QP8 A;  1O07 A;  3BFF A;  3DTK A;  4CPK A;  5CTN A;  3E4Q A;  5I5L A;  2PHY A;  3RFB A;  1XPB A;  4BEN A;  5J4E A;  3BFC A;  4B88 A;  4YIN A;  3WRZ A;  1XFQ A;  2FFY A;  4IBX A;  3T1Q B;  4PM6 A;  2G2U A;  4CLC E;  3TSG A;  1XA7 A;  3WS5 A;  3S7Q A;  3D9Y A;  1BYW A;  4OH0 A;  5DTT A;  2Y2J A;  3ICY A;  5EM0 A;  4HBT A;  2XRN A;  4MBK A;  4WBG A;  3O3V A;  1W7F A;  3IBJ A;  3T4O A;  2Z2L B;  5HAR A;  3BJN A;  2XR0 A;  1WE4 A;  1SZV A;  1A0K A;  3H7W B;  2IA2 A;  3OPP A;  3Q07 A;  3E4O A;  2HDQ A;  3VOY A;  1NLY A;  3A0R A;  4HJ6 A;  1TDG A;  3QNB A;  3HLE A;  5EVI A;  3P7N A;  5L2F A;  2ZQ8 A;  4JGR A;  5DTK A;  4DJ3 A;  2B18 A;  3I7J A;  3O87 A;  4JGQ A;  4EU0 A;  3BLM A;  3E0Y A;  3GV9 A;  3NC8 A;  1XKZ A;  2YKF A;  5FI7 A;  4Z1W A;  3KO6 A;  2Y2M A;  3V39 A;  3VP1 A;  4BBV A;  4EQ1 A;  3VP2 A;  3R7W B;  1KDS A;  3K3D A;  4RYE A;  1XGJ A;  2D01 A;  3HUM A;  3A3F A;  3TW8 A;  4CLC A;  2H0T A;  1ZHH B;  1K56 D;  2KX6 A;  5FAO A;  3T4K A;  3FZC A;  4KEN B;  4EBP A;  3UY6 A;  3B33 A;  1OTA A;  1SKO B;  4LRZ E;  5TFQ A;  4UA6 A;  5CXW A;  4PKY A;  3UB6 A;  2W3G A;  1S67 L;  3MZF A;  4EER A;  5DVA A;  3LEQ A;  2ZMA A;  3VE3 A;  3C2W A;  3FYZ A;  1C3B A;  3UDX A;  3S4X A;  3ZG7 B;  1VET A;  3HLC A;  1L2S A;  2K31 A;  2ZM8 A;  4NXB A;  4P6Z M;  2XA7 M;  1Q2P A;  3H82 A;  2O9B A;  1K6S A;  2W1R A;  5HZH A;  2WGW B;  1KVL A;  1AXB A;  5M18 A;  1FQG A;  3F1O A;  1T1A A;  3LR0 A;  4Y17 A;  4OQG A;  2J3W A;  3JVV A;  3BY9 A;  4DE0 A;  2GJ3 A;  2VGL M;  3G34 A;  4OOY A;  3UDF A;  4IED A;  3NOP C;  4PPR A;  1L0F A;  1FR1 A;  1K54 C;  3GQZ A;  1N9O A;  2ZMF A;  3HL9 A;  1N9L A;  3WRT A;  2EFX A;  2HV1 A;  1NLZ A;  4X56 A;  5JYO A;  5L07 A;  3QP6 A;  1OT9 A;  4D2O A;  4OPQ A;  4HJ4 A;  3GDI A;  3LFV A;  5KMW A;  4NXG A;  3N6I A;  4JXV A;  2BLS A;  4G3V A;  5FQJ A;  2EX2 A;  3MQQ A;  2W3H A;  5BOH A;  3S7N A;  3EQV A;  4OPR A;  4PM8 A;  2Z2M B;  3DBA A;  3IXB A;  3BY8 A;  1K57 C;  2W1T A;  3P98 A;  4WYY A;  3ZG5 A;  3V5M A;  3C30 A;  3IH9 A;  4PM7 A;  3CUE A;  5EVI B;  1NRJ A;  1Y4O A;  4GD8 A;  1XFN A;  3QP2 A;  3DWK A;  4OOL A;  2R78 A;  4NG2 A;  2ZD8 A;  4EXO A;  2R9X A;  2V8F A;  4LGW A;  3VOZ A;  3CWF A;  4R4S A;  5DF8 A;  3IWI A;  5TR7 A;  1I2S A;  4IVI A;  3RTY A;  3GTC A;  3W4P A;  3ULF A;  2VV7 A;  3OBF A;  2KOI A;  1CEF A;  1G68 A;  3L9K A;  4CLC B;  5F82 A;  2LB9 A;  4EUV A;  2XK1 A;  3AGE A;  4LV2 A;  3E2L A;  1PI4 A;  2ZOI A;  3RJU A;  2JKG A;  3V3S A;  3ZNY A;  3HLW A;  1BLC A;  5FAQ A;  5FAP A;  2J7V A;  4PKY G;  4FSF A;  3VSL A;  4IHQ A;  5DJT A;  4X69 A;  1L0D A;  3H82 B;  3QP4 A;  4E3O A;  4GKU A;  1YSP A;  3IXH A;  1EWZ A;  5DFY A;  3JPU A;  1MWR A;  2DRW A;  2V0U A;  5KIZ A;  2Y55 A;  4S2M A;  3BLS A;  2UWX A;  1MBL A;  2Y79 A;  4XUZ A;  5EFW A;  4AFI A;  4LCL A;  1JWV A;  4QWO A;  1K0K A;  4GOG A;  3BW6 A;  3C4P A;  1MKI A;  2Y4A A;  3DTI A;  5CX7 A;  4MDZ A;  2ZQA A;  4LEN A;  3ZG9 B;  4X1M A;  1HD8 A;  1TS6 A;  3CZD A;  5GLD A;  1Q2Q A;  2GX5 A;  1OJ5 A;  5CHU A;  3N8R A;  3IXD A;  4Q0I A;  2W1T B;  3CPT A;  2BAS A;  4MEZ A;  5EOE A;  1Y54 A;  1BTL A;  4DDY A;  2P08 A;  1OTB A;  1ZKJ A;  1Z09 A;  2I9V A;  4F94 A;  4EQI A;  2PR5 A;  1T1C A;  1NXY A;  1H8Z A;  1E3U A;  2WKI A;  4BWI A;  5HD5 A;  4II7 A;  5D3O A;  4GHI A;  1TS0 A;  1PZO A;  4QD4 A;  1ZG6 A;  1JWZ A;  2L0W A;  4KZ5 A;  1FSY A;  4JXS A;  3LR3 A;  1KE0 A;  1BLS A;  1K54 A;  2Y2K A;  3IX8 A;  2OOL A;  3ZVW A;  2M7V A;  3EWK A;  1W8Q A;  1XJ3 A;  5HDD A;  5FEF A;  1YLZ A;  1W79 A;  4IJG A;  3PAG A;  4P6Z S;  2XA7 S;  3MZE A;  4FOF A;  4H6J A;  1MWU A;  5FQ9 A;  4UA7 A;  3FV7 A;  1K57 A;  3LO7 A;  1PNE A;  2WKQ A;  4X6T A;  5F1F A;  1D1J A;  1J3W A;  2Y2P A;  4I3A A;  1HVB A;  2VGL S;  3EEH A;  4EES A;  1S66 L;  2H5S A;  4C3Q A;  2HP9 A;  4S2P A;  4HI4 A;  1O7E A;  3UNW A;  4HY8 A;  2XFT A;  5EV0 A;  4NET A;  3P09 A;  3NJA A;  4HH3 A;  1LL9 A;  3BEB A;  3O88 A;  4XT2 A;  1WYC A;  1P9W A;  4BD0 A;  2VV6 A;  2D02 A;  2WKE A;  4S2N C;  3OOV A;  4F3L A;  2Y91 A;  4MCW A;  1K38 A;  1F9I A;  5GL9 A;  3A3J A;  4L9G A;  4LV0 A;  3IXG A;  4WMC D;  5HWT A;  3WS0 A;  1FIK A;  4EV4 A;  2ZC3 B;  5G4Y A;  5G4Z A;  2VV8 A;  2O99 A;  4NXF A;  3ZDJ A;  2XSS A;  2ZOH A;  2XEP A;  5M1A A;  3PBO A;  4ETX A;  4WF0 A;  1MZU A;  5GHY A;  2A24 A;  3CPT B;  3LYX A;  4EW7 A;  4JXW A;  2P04 A;  3FPV A;  1TD5 A;  4WL9 A;  3G31 A;  5AQ7 A;  3ZFZ A;  3R4K A;  2GNX A;  4OON A;  3SOI A;  1LSV A;  5HAP A;  1DRM A;  3HLG A;  1PFL A;  3PBN A;  1LL8 A;  1VEU A;  3MR0 A;  1F2K A;  3AGF A;  4JF6 A;  4GHI B;  3C38 A;  1G6O A;  1SCW A;  5GLA A;  3IWQ A;  4EET B;  3D4F A;  5IHV A;  4BJP A;  5J7E A;  3BWL A;  1ERM A;  2V1A A;  5E43 A;  1PW8 A;  3NHQ A;  2V9A A;  1LLB A;  2IWD A;  4I3J A;  3CHW P;  3TOI A;  3T1R A;  2PU4 A;  3L7H A;  2WAF A;  3C4O A;  5HW3 A;  1H5X A;  3IBR A;  4E6X A;  3CMZ A;  4QY6 A;  5E2F A;  3T12 B;  1XJ4 A;  1XX2 A;  3TE8 A;  4H6J B;  3BEC A;  3VP4 A;  2Y2G A;  3PBR A;  2K7S A;  3DTE A;  3A0V A;  2Z6C A;  5TJJ A;  1DJA A;  2JC7 A;  2JKT M;  1HLU P;  1NZU A;  2NUT C;  2LB5 A;  4E6W A;  4LRX C;  2GDN A;  5GLB A;  3HVF A;  3EQU A;  1Z6F A;  2ZQC A;  5E2E A;  4OKP A;  5DF9 A;  2HDS A;  3VSK A;  4PAU A;  3G6O A;  3G30 A;  1RGY A;  1X0O A;  4S2K A;  5DKK A;  3T4L A;  3M2K A;  4GZB A;  4XT2 B;  2EX9 A;  3Q7Z A;  1BZA A;  1UGU A;  4N92 A;  3GMW A;  4F3L B;  1JVJ A;  3KYQ A;  5F83 A;  4JXG A;  4DKI A;  1T19 A;  1P0Z A;  3IHB A;  3SH9 A;  4UEY A;  4E3I A;  3LID A;  4BLM A;  2W3F A;  3F1N A;  2V0W A;  1S6R A;  2PAV P;  1V9Y A;  4GCZ A;  1CI9 A;  4UQI M;  1WYB A;  2A24 B;  4MN7 A;  2HPB A;  1ESU A;  1IEM A;  2V20 A;  1XA1 A;  2GZA A;  4S2L A;  3IF5 A;  2Y2L A;  3KYZ A;  5F6A A;  2Y2N A;  4JLF A;  1E4D A;  2WYX A;  4KQQ A;  2K2N A;  1ACF A;  3LR5 A;  3ZQ5 A;  3NDG A;  5E2H A;  1KGG A;  4X55 A;  5EPH A;  5HWV A;  2ZM0 A;  3OC2 A;  5FI2 A;  1JTG A;  4BQM A;  1XGI A;  2J80 A;  1ZG4 A;  4S2N A;  4LRY C;  3LGO A;  3PAE A;  3IF6 C;  2WGV A;  3UN7 A;  3Q7V A;  3CG5 A;  4KZ6 A;  4HHD A;  3ZVT A;  2EWV A;  1IOU A;  4ZDX A;  2Y2O A;  1BT5 A;  1W5D A;  2V2F F;  4KZ3 A;  2ZBB A;  1N9N A;  3OLO A;  3MXR A;  4X1L A;  2PBY A;  1JWP A;  3Q82 A;  3EGD C;  3M2J A;  3O86 A;  3FKV A;  3H9W A;  4JGO A;  3MKE A;  5HWW A;  4LV1 A;  5HDC A;  4E04 A;  2P9V A;  2VA0 A;  3NY4 A;  3MXS A;  3UPP A;  2QHK A;  1LSW A;  1NRF A;  4ZJ2 A;  4LV3 A;  4BBT A;  3SW1 A;  1S0W A;  5KSC A;  2WZZ A;  1DP6 A;  3OCL A;  3NEC A;  1LSX A;  3W8K A;  3HJK A;  3UME A;  2EX6 A;  3MS6 A;  2X71 A;  4B4Z A;  4P85 A;  3UO9 A;  3UDI A;  2DCF A;  2PDR A;  3LR4 A;  4WN5 A;  1E25 A;  2EX8 A;  4M4X A;  2QPN A;  4X53 A;  3LIE A;  1N4O A;  4ZJ3 A;  1YMS A;  4ZBE A;  3U4L P;  3M6B A;  3HLD A;  3ITB A;  2OLV A;  3V3R A;  2J3T C;  5FQM A;  5A8B A;  1AWI A;  2Y2H A;  5FQK A;  4FCF A;  3PYP A;  3TJZ C;  3C8C A;  4ME4 A;  2Y59 A;  4FH2 A;  2ZQD A;  4DRT A;  4QU3 A;  3G32 A;  4FUW A;  5FDS A;  1RP5 A;  2HGV A;  1YQS A;  3ZYT A;  1L0E A;  3T4T A;  1NWZ A;  5HAQ A;  3HLF A;  4NEE D;  3C7V A;  4S2O A;  1GHP A;  4ARZ A;  2QZ6 A;  1LI9 A;  1WA9 A;  4KUK A;  4I39 A;  4HBU A;  3SS3 A;  3ZNT A;  3BQA A;  2DMW A;  4FD8 A;  3QHY A;  1OTD A;  2ZLY A;  2OLU A;  3N8S A;  4CQH A;  2ZQ9 A;  4OQI A;  4L9E A;  3MZD A;  1PWC A;  1BSG A;  3T50 A;  3FC7 A;  3C5A A;  1GHM A;  1VET B;  2I72 A;  4FTX A;  3U2A A;  5F68 A;  5CGW A;  3RXW A;  4OQ0 A;  3VP3 A;  3Q7V B;  1PI5 A;  3PHY A;  4E3J A;  3TG9 A;  3F1O B;  1F98 A;  1KGE A;  3T4S A;  2W27 A;  1KDW A;  1KGF A;  5F1G A;  3QNC A;  3A3E A;  1YPR A;  4KQO A;  1IFQ A;  1M40 A;  1SDE A;  5FI6 A;  3UE6 A;  1LT0 A;  2HDU A;  4WM9 A;  3BFG A;  3JYI A;  4ZTK A;  4MMN A;  3NOU C;  4WEK A;  4QB8 A;  5DTS A;  4S2I A;  4X25 A;  2P9V B;  4R38 A;  1IKG A;  3G35 A;  3W4O A;  1FR6 A;  5GHZ A;  5EVI D;  3P01 A;  5FAT A;  2FH5 A;  4GS9 A;  4P6B A;  1DY6 A;  2MJ6 A;  2FFF B;  4IUH A;  4KZ7 A;  3ZG0 A;  4EEP A;  4WZ5 C;  4LCM A;  4MBF A;  1FCO A;  3G2Y A;  1K6R A;  4S2J A;  1NJ4 A;  3DWZ A;  3UB9 A;  4E3N A;  2NUP C;  2QMI A;  5E2G A;  3N7W A;  1KOU A;  2ACG A;  5EVL A;  4N1X A;  2DNS A;  4YNR A;  5A93 A;  1I5Q A;  3BFD A;  4G3K A;  3IF6 A;  2Y2Q A;  2L1M A;  3G4P A;  3LIC A;  3NUL A;  4CLC D;  4E3M A;  1FCN A;  2Z6D A;  5AQB A;  3FPW A;  1LHY A;  4ESP A;  4GLQ A;  5A90 A;  3IHA A;  5EVE A;  3HLB A;  2WGI A;  1D7E A;  1KVM A;  4E3K A;  3TRC A;  4LLO B;  4KUO A;  2Q9M A;  5F5Y A;  4OOM A;  3K2N A;  4HEF A;  5JYP A;  2VZW A;  4U3T A;  1HZO A;  3SS4 A;  4K08 A;  4HES A;  3ITA A;  3IS2 A;  3LIF A;  5EUA A;  1FSW A;  1OJG A;  3WWX A;  2JKR I;  2QKP A;  3CAX A;  4OQH A;  1L3L A;  2O9C A;  5CEC A;  3EOI A;  2A3U A;  1P9R A;  1K56 A;  3VE4 A;  5TGF A;  3IT9 A;  3QP5 A;  1LI0 A;  3BFE A;  4MN6 A;  3IX4 A;  2HJ9 C;  1YLP A;  5AJG A;  1VB6 A;  3LY3 A;  1PWD A;  1BLP A;  1ZC2 A;  4GNU A;  1K4E A;  4GDN A;  1P97 A;  4DE2 A;  3GEC A;  1ESI A;  5CER A;  3VFH A;  2XQZ A;  4Q8I A;  4HQA A;  4L0L A;  4QPR A;  1T18 A;  3ISG A;  3V67 A;  5FQI A;  4XXR A;  3WS1 A;  3KSI A;  2X01 A;  4R3A A;  2Q0O A;  5AVF A;  4D60 A;  5J8X A;  2P7J A;  5G18 A;  4N9K A;  2QJ7 A;  1EI5 A;  4O01 A;  4R6L A;  2IWB A;  4GDB A;  4KG6 A;  1H0M A;  4XUX A;  3H7W A;  4O7D A;  3MKF A;  4GS9 B;  4KZ4 A;  2W3E A;  1M6K A;  4RA7 A;  1ES3 A;  2ZJ9 A;  4JGP A;  4Y0T A;  1LL5 A;  5GLC A;  2XFS A;  2V8C A;  3BYD A;  3PBS A;  4O0P A;  1CJF A;  3NCK A;  3RXX A;  2WZX A;  5CTM A;  3W4Q A;  3IF6 B;  1GCE A;  1PWG A;  4WUJ A;  3A3D A;  4MLL A;  3UMD A;  2QYB A;  1H3Q A;  4JF4 A;  2WKR A;  2B95 A;  1W63 Q;  2VLG A;  1SDN A;  2YKH A;  4EUZ A;  3UB7 A;  3B42 A;  4QHC A;  4ZAM A;  1DJC A;  2J9P A;  2AVX A;  2E8J A;  3IS2 B;  1OT6 A;  2IWC A;  2OWJ A;  4Y15 A;  3DTM A;  4GN2 A;  3GSG A;  1G28 A;  2XLN A;  1VM1 A;  1PIO A;  4R1G A;  4KG5 A;  4IVK A;  2BG1 A;  4OP5 A;  4PM9 A;  4R3J A;  4UAA A;  4N1H A;  2OSU A;  1HTZ A;  3W2Z A;  4WZ5 A;  3B47 A;  4R4R A;  4MNR A;  2XGN A;  5L10 A; 
#chains in the Genus database with same CATH homology
 1FOF A;  1PYY A;  3FWL A;  3ZVT A;  1RCJ A;  4X69 A;  3Q81 A;  3WS4 A;  4ZDX A;  1J9M A;  2Y2O A;  1L0D A;  1BT5 A;  4R23 A;  5U47 A;  4Z9Q A;  1W5D A;  4DXC A;  2V2F F;  4K91 A;  4KZ3 A;  4BD1 A;  5A91 A;  3MXR A;  2PBY A;  1JWP A;  4E3O A;  4GKU A;  3Q82 A;  3M2J A;  3O86 A;  2HDR A;  3IXH A;  2JE5 A;  1ERO A;  1EWZ A;  2PU2 A;  1PZP A;  3FKV A;  3BM6 A;  5CGX A;  3MKE A;  2EXB A;  5AQA A;  1DJB A;  4LV1 A;  1IYP A;  2P9V A;  1MWR A;  2DRW A;  5FA7 A;  3NY4 A;  1VQQ A;  4DE1 A;  2Y55 A;  2ZC4 B;  4S2M A;  3MXS A;  3BLS A;  1MPL A;  3UPP A;  1XP4 A;  3UPN A;  2J9O A;  2P74 A;  1NRF A;  3LY4 A;  4ZJ2 A;  4C6Y A;  4LV3 A;  3PBT A;  2UWX A;  1MBL A;  3UE1 A;  1S0W A;  4XUZ A;  5KSC A;  4KZ8 A;  4LCL A;  3HUO A;  1JWV A;  3NI9 A;  1SKF A;  2WZZ A;  4GOG A;  4JBF A;  4BL3 A;  3NIA A;  3C4P A;  1MKI A;  3OCL A;  4KZB A;  5HAI A;  2Y4A A;  5KZH A;  2ZQA A;  3W8K A;  4LEN A;  4FH4 A;  3ZG9 B;  3IQA A;  1BLH A;  2EX6 A;  1HD8 A;  2J8Y A;  2X71 A;  3CZD A;  4OP8 A;  2C6W B;  4P85 A;  2HP6 A;  4B4Z A;  3UO9 A;  3A3I A;  3UDI A;  2WK0 A;  1MWT A;  5GLD A;  1Q2Q A;  1GA9 A;  4PM5 A;  2DCF A;  4P0M A;  4IBR A;  3ZHH A;  3MFD A;  3HUN A;  5CHU A;  2C5W B;  1E25 A;  3AGD A;  2EX8 A;  3N4I A;  3M6H A;  3N8R A;  3IXD A;  1IYO A;  2QPN A;  3PBQ A;  4X53 A;  2Y2I A;  1N4O A;  4ZJ3 A;  1YMS A;  4ZBE A;  1CEG A;  1TEM A;  4DE3 A;  1I2W A;  1YLT A;  2ZC6 B;  1E3U D;  3HLD A;  3M6B A;  3ZG8 B;  3ITB A;  4MEZ A;  2OLV A;  5EOE A;  1Y54 A;  1BTL A;  1YM1 A;  3V3R A;  4M3K A;  4DDY A;  5FQM A;  2XH9 A;  2Y2H A;  5EEC A;  4FCF A;  5FQK A;  5EOO A;  3HBR A;  2Y59 A;  4FH2 A;  1G6A A;  1ZKJ A;  3V50 A;  2ZQD A;  1RGZ A;  5M19 A;  4DRT A;  4QU3 A;  2ZM2 A;  4EQI A;  4F94 A;  3G32 A;  2EXA A;  3BRM A;  1TVF A;  1RP5 A;  1NXY A;  1YQS A;  1L0E A;  1H8Z A;  2WKI A;  1E3U A;  2JBF A;  3GVB A;  5HAQ A;  2XD5 A;  3HLF A;  5D3O A;  1K4F A;  1PZO A;  4QD4 A;  3C7V A;  4S2O A;  2A49 A;  1GHP A;  1ZG6 A;  2QZ6 A;  1JWZ A;  3VP0 A;  1LI9 A;  2ZC7 A;  4KZ5 A;  1FSY A;  2CC1 A;  4HBU A;  4JXS A;  4WZ4 A;  1YMX A;  3CJM A;  3SS3 A;  3ZNT A;  1KE0 A;  1BLS A;  1K54 A;  4KZA A;  2Y2K A;  1K55 A;  4MBH A;  4FD8 A;  4OPZ A;  3ZVW A;  3OCN A;  3QHY A;  3LCE A;  3SS5 A;  2ZLY A;  2OLU A;  1W8Q A;  1YT4 A;  5HX9 A;  3N8S A;  4DF6 A;  5HL1 A;  2ZQ9 A;  4OQI A;  4X68 A;  1L0G A;  1NY0 A;  1MWS A;  3MZD A;  1YLZ A;  3OPL A;  3G2Z A;  1PWC A;  4R0Q A;  1BSG A;  1W79 A;  3PAG A;  4E3L A;  3C5A A;  3WS2 A;  1GHM A;  3MZE A;  2I72 A;  4K0W A;  5FQQ A;  4EBN A;  5CGW A;  3RXW A;  1IKI A;  1MWU A;  2WGW A;  4OQ0 A;  3VP3 A;  5FQ9 A;  3Q7V B;  1O07 A;  1PI5 A;  3BFF A;  4UA7 A;  4N9L A;  2ZC5 B;  1CK3 A;  3FV7 A;  4CPK A;  1K57 A;  4RX3 A;  3TG9 A;  3ZCZ A;  4E3J A;  5CTN A;  3LO7 A;  5FSR A;  1KGE A;  1XPB A;  1KDW A;  4X6T A;  4BEN A;  5F1F A;  2VGK A;  2Y2P A;  3BFC A;  1KGF A;  4JPM A;  5F1G A;  1HVB A;  4B88 A;  1XXM A;  3QNC A;  4QY5 A;  1JTD A;  3A3E A;  4KQO A;  4YIN A;  3WRZ A;  1M40 A;  1SDE A;  3B3X A;  2FFY A;  1NYM A;  2H5S A;  5FI6 A;  4C3Q A;  4IBX A;  2HP9 A;  4S2P A;  4OLG A;  2G2U A;  2HP5 A;  4PM6 A;  2HDU A;  1O7E A;  5KSH A;  1FCM A;  2XF3 A;  4WM9 A;  3TSG A;  3BFG A;  3JYI A;  3UNW A;  1XA7 A;  3WS5 A;  2XFT A;  3C7U A;  4ZTK A;  4OH0 A;  4NET A;  2Y2J A;  5DTT A;  5AQ9 A;  3P09 A;  4HBT A;  4WEK A;  4QB8 A;  5DTS A;  1LL9 A;  3BEB A;  4S2I A;  2P9V B;  4MBK A;  4WBG A;  3O88 A;  1WYC A;  1IKG A;  3G35 A;  3O3V A;  1W7F A;  3W4O A;  4BD0 A;  1FR6 A;  5GHZ A;  5EVI D;  2XDM A;  2Z2L B;  5HAR A;  4DDS A;  2XR0 A;  5FAT A;  2WKE A;  4S2N C;  1WE4 A;  2ZQ7 A;  3GRJ A;  5CGS A;  1ALQ A;  1DY6 A;  2Y91 A;  4P6B A;  2FFF B;  1K38 A;  1YLY A;  4KZ7 A;  3ZG0 A;  3OPP A;  3Q07 A;  4WZ5 C;  4LCM A;  2HDQ A;  4MBF A;  5GL9 A;  1FCO A;  3G2Y A;  4U0X A;  3VOY A;  1K6R A;  3A3J A;  4S2J A;  4C75 A;  4LV0 A;  1W8Y A;  3IXG A;  1NJ4 A;  1TDG A;  4WMC D;  3QNB A;  3HLE A;  3DWZ A;  5EVI A;  4E3N A;  3VMA A;  3WS0 A;  5L2F A;  3UPO A;  2R9W A;  3OPR A;  2QMI A;  2ZQ8 A;  5E2G A;  5DTK A;  1H8Y A;  2ZC3 B;  3E2K A;  4EV4 A;  5CEB A;  3N7W A;  5EVL A;  4N1X A;  2DNS A;  5A93 A;  1I5Q A;  3BFD A;  3I7J A;  3O87 A;  3BLM A;  3IF6 A;  3ZDJ A;  2H0Y A;  2XEP A;  5M1A A;  3GV9 A;  2Y2Q A;  3PBO A;  1KE3 A;  3S22 A;  3NC8 A;  3G4P A;  4GD6 A;  1XKZ A;  5GHY A;  4WMC A;  4E3M A;  1FCN A;  2WAD A;  4RX2 A;  4JXW A;  5FI7 A;  4U0T A;  5AQB A;  1LHY A;  2Y2M A;  3G31 A;  5CHJ A;  1K25 A;  1IYQ A;  5AQ7 A;  3V39 A;  3IHA A;  3VP1 A;  3ZFZ A;  4ZJ1 A;  4EWF A;  5A90 A;  3HLB A;  2WGI A;  4OON A;  3SOI A;  3Q1F A;  1KVM A;  4H8R A;  3VP2 A;  3GR2 A;  4E3K A;  4QJG A;  5HAP A;  2G2W A;  1KDS A;  1ES5 A;  2Q9M A;  4RYE A;  1IEL A;  1XGJ A;  3IH8 A;  3NDE A;  3HUM A;  3A3F A;  4OOM A;  3HLG A;  4HEF A;  3PTE A;  5JYP A;  3PBN A;  1TDL A;  4U3T A;  1HZO A;  4OVD A;  3SS4 A;  1IYS A;  4HES A;  2H0T A;  3ITA A;  1K56 D;  5FAO A;  5EUA A;  1FSW A;  3AGF A;  4JF6 A;  4OPY A;  3FZC A;  4KEN B;  4OLD A;  3UY6 A;  4EBP A;  2EFU A;  3WWX A;  1SCW A;  5GLA A;  3IWQ A;  5TFQ A;  4UA6 A;  3D4F A;  4DXB A;  5IHV A;  4BJP A;  4OQH A;  1NYY A;  5CXW A;  5CEC A;  1ERM A;  5E43 A;  5CRF A;  1PW8 A;  3MZF A;  1LLB A;  2IWD A;  2A3U A;  1K56 A;  1QMF A;  2B5R A;  1QME A;  5DVA A;  3TOI A;  2PU4 A;  2ZMA A;  5TGF A;  3IT9 A;  3SH8 A;  4A5R A;  1LI0 A;  2WUQ A;  3FYZ A;  1C3B A;  3UDX A;  2RL3 A;  3BFE A;  5DF7 A;  1ES4 A;  2WAF A;  3S4X A;  3C4O A;  3ZG7 B;  5HW3 A;  1H5X A;  2RCX A;  1YLP A;  4E6X A;  3CMZ A;  3DW0 A;  3HLC A;  1L2S A;  4QY6 A;  5E2F A;  2ZM8 A;  4UHU A;  5HFO A;  1Q2P A;  1XX2 A;  3LY3 A;  5CED A;  1K6S A;  1PWD A;  1BLP A;  1ZC2 A;  3BEC A;  3VP4 A;  2WGW B;  1KVL A;  2Y2G A;  3PBR A;  1AXB A;  4GNU A;  5M18 A;  1FQG A;  1K4E A;  4GDN A;  1DJA A;  2JC7 A;  4DE2 A;  2OV5 A;  2X02 A;  1NZU A;  5EE8 A;  4OQG A;  1ESI A;  5CER A;  3VFH A;  2XQZ A;  4Q8I A;  4DE0 A;  1GA0 A;  4L0L A;  3G34 A;  4NK3 A;  4OOY A;  5FDH A;  4E6W A;  3UDF A;  2GDN A;  4IED A;  3ISG A;  4PPR A;  5GLB A;  1L0F A;  5FQI A;  4XXR A;  1FR1 A;  1K54 C;  3WS1 A;  1OME A;  3OPH A;  1K55 C;  3GQZ A;  3HVF A;  2X01 A;  4KG2 A;  3EQU A;  4K0X A;  1Z6F A;  3HL9 A;  1CI8 A;  2ZQC A;  3WRT A;  2H10 A;  2EFX A;  5E2E A;  4KZ9 A;  2V1Z A;  4OKP A;  3UE0 A;  5DF9 A;  1ONH A;  2HDS A;  4X56 A;  4KQR A;  5JYO A;  3VSK A;  4B4X A;  5J8X A;  4WEJ A;  3G30 A;  5G18 A;  4N9K A;  1RGY A;  4S2K A;  1N9B A;  1MXO A;  3M2K A;  4D2O A;  4GZB A;  4OPQ A;  1EI5 A;  2EX9 A;  5A92 A;  3Q7Z A;  2IWB A;  4GDB A;  5KMW A;  1BZA A;  3N6I A;  4JXV A;  2BLS A;  1ES2 A;  4KG6 A;  1BUE A;  2EX2 A;  5FQJ A;  1SHV A;  4N92 A;  4XUX A;  2XD1 A;  3GMW A;  3HRE A;  4O7D A;  3LEZ A;  3MKF A;  5BOH A;  3EQV A;  1JVJ A;  4KZ4 A;  4OPR A;  1M6K A;  4PM8 A;  2Z2M B;  4RA7 A;  1ES3 A;  1NZO A;  3IXB A;  2ZJ9 A;  4Y0T A;  3MBZ A;  5F83 A;  4YFM A;  1K57 C;  1LL5 A;  4UA9 A;  4WYY A;  3P98 A;  2WKH A;  4JXG A;  3ZG5 A;  4DKI A;  5GLC A;  4JF5 A;  4Y0U A;  3IHB A;  3IH9 A;  2XFS A;  4PM7 A;  3V5M A;  5EVI B;  3SH9 A;  3BYD A;  3PBS A;  3SH7 A;  2E8I A;  4E3I A;  4GD8 A;  4BLM A;  1GHI A;  3NCK A;  3RXX A;  3OZH A;  1S6R A;  2WZX A;  3DWK A;  5CTM A;  3VFF A;  5I94 A;  3S1Y A;  4OOL A;  3W4Q A;  3IF6 B;  1GCE A;  1CI9 A;  2ZD8 A;  1PWG A;  3A3D A;  1WYB A;  2R9X A;  3NBL A;  2VGJ A;  4GB7 A;  4MLL A;  3VOZ A;  3FKW A;  2HPB A;  1ESU A;  2V20 A;  1ERQ A;  1IEM A;  4R4S A;  5GHX A;  4EBL A;  1XA1 A;  5DF8 A;  4JF4 A;  3IWI A;  4S2L A;  5TR7 A;  1I2S A;  3IWO A;  3IF5 A;  4CJN A;  2Y2L A;  4IVI A;  3GTC A;  4WEL A;  4P87 A;  2Y2N A;  3W4P A;  4JLF A;  1E4D A;  3ZGA B;  1YLW A;  1BUL A;  1CEF A;  2WYX A;  1U60 A;  4KQQ A;  1SDN A;  1G68 A;  4EUZ A;  4BL2 A;  4QHC A;  4ZAM A;  1ONG A;  1DJC A;  2J9P A;  4RVA A;  4Y7P A;  5F82 A;  3NDG A;  4Y0O A;  2XK1 A;  3AGE A;  2IWC A;  4LV2 A;  3DTM A;  1KE4 A;  3E2L A;  4GN2 A;  5E2H A;  5EVI C;  5FAS A;  1KGG A;  4X55 A;  1PI4 A;  5EPH A;  1PW1 A;  3GSG A;  3RJU A;  2XLN A;  1VM1 A;  1PIO A;  3V3S A;  4R1G A;  1YLJ A;  3ZNY A;  2ZM0 A;  3OC2 A;  5CHM A;  2JCH A;  4KG5 A;  3HLW A;  5FI2 A;  4IVK A;  1JTG A;  2BG1 A;  4PMA A;  1XGI A;  4BQM A;  4OP5 A;  1ZG4 A;  4S2N A;  4R3B A;  4PM9 A;  4R3J A;  3UE3 A;  3PAE A;  4UAA A;  3IF6 C;  2WGV A;  1BLC A;  3N8L A;  4ID4 A;  2Q9N A;  4JKT A;  3UN7 A;  5FAQ A;  4N1H A;  2OSU A;  5FAP A;  1MY8 A;  3Q7V A;  1HTZ A;  4WZ5 A;  2J7V A;  2WAE A;  4R4R A;  4FSF A;  3VSL A;  3CG5 A;  4KZ6 A;  4MNR A;  2XGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...