2ZQAA

Cefotaxime acyl-intermediate structure of class a beta-lacta toho-1 e166a/r274n/r276n triple mutant
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase Toho-1
publication title Structural Basis of Extend Spectrum Beta-Lactamase in Correlation of Enzymatic Kinetics and Thermal Stability of Acyl-Intermediates
rcsb
source organism Escherichia coli
total genus 95
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zqaA00
5F1FA 1PZPA 3HUOA 1PW8A 4OQGA 1VQQA 4R0QA 4CJNA 2RCXA 2XEPA 5FI6A 4EV4A 3IXBA 1FCNA 1GHMA 4OPQA 4BQMA 1KGGA 2ZC4B 1SCWA 1IYSA 5FQKA 2WUQA 3BEBA 2ZQAA 3G35A 5FAOA 3NY4A 2BLSA 1DJCA 3QHYA 5F82A 4R1GA 4WEKA 1XA1A 3DWZA 4K91A 5DF8A 4JXSA 4GDBA 1BLSA 4DXCA 4OQ0A 4ID4A 2H10A 1K6SA 4DXBA 4PMAA 1JWZA 2XFTA 4E3NA 4QY5A 4BL2A 4MNRA 3RJUA 3FYZA 3AGDA 4BLMA 5TFQA 4WZ4A 1FQGA 3FZCA 1W8QA 3Q82A 4DKIA 1K6RA 4GB7A 4ZJ2A 4P0MA 3ISGA 2X71A 4HESA 2J8YA 3VP3A 5AQ7A 2XDMA 4GD6A 4EUZA 3OPLA 1C3BA 1KGEA 1LI0A 5FQIA 3TG9A 3Q7VB 2WAEA 3NI9A 2C6WB 2Y2QA 4MBHA 4X6TA 3FKVA 1ESUA 5FATA 1PZOA 3WS4A 4KZ7A 4S2MA 1ALQA 3V3RA 3VFHA 5A93A 4BENA 3G4PA 4Y7PA 2Y2IA 2FFYA 2JE5A 4E3OA 4QD4A 2XK1A 4ZBEA 3HLBA 2OLVA 2XF3A 4KZ6A 5GLDA 5CXWA 3ZG5A 4GD8A 4Z9QA 5G18A 2ZC7A 1ONGA 2GDNA 5EOOA 1MWUA 2J7VA 1RP5A 3O87A 1YMSA 4WMCD 5A91A 2IWDA 4JBFA 5FAQA 3WWXA 1XPBA 3LEZA 4UAAA 2EX2A 1M40A 3UDXA 3WS2A 3BFFA 3MKFA 5DTTA 5CERA 3MXRA 4BL3A 3BLMA 4S2OA 2ZQ9A 3HLCA 5CHJA 2WKHA 3VSLA 3ITBA 4OPYA 4FSFA 4PM7A 3IF5A 1H8YA 1YLJA 2HDRA 2G2WA 3IQAA 4LENA 4U3TA 3FKWA 3BRMA 1MXOA 1NZOA 4OP8A 2B5RA 3HL9A 5TGFA 2E8IA 2Q9NA 4WYYA 4JXWA 1K57A 1JWPA 2PU2A 2P74A 3HLWA 4IEDA 2A49A 3CZDA 4O7DA 4S2IA 5CRFA 3TSGA 2DNSA 3WS0A 1I2WA 1YLWA 2ZM8A 1PYYA 1HTZA 1MWTA 4LV2A 2HP6A 1M6KA 1YM1A 3BLSA 2EX9A 1BZAA 5CGSA 2R9WA 4K0XA 4P87A 1NRFA 3DWKA 1HVBA 2Y2GA 4R4SA 5TR7A 2EXBA 2ZJ9A 1GA0A 1FR6A 4P85A 5AQBA 1GHPA 1ZKJA 2Y4AA 1Y54A 1GHIA 3N7WA 4YINA 1IEMA 1W7FA 2Y2HA 3P98A 2J9PA 2ZD8A 4QU3A 1YQSA 4EWFA 3G32A 1BLCA 5E2EA 2WYXA 2ZLYA 1Q2QA 3VP1A 2WADA 5DF9A 3N8RA 3TOIA 2C5WB 2JBFA 2H0YA 4F94A 4A5RA 2ZC6B 1L2SA 1GCEA 3C4OA 1MWSA 1SKFA 4KZ9A 1I2SA 4GNUA 1ES3A 1IKGA 3GRJA 3S4XA 1ES2A 3Q07A 5KZHA 3UE0A 1K57C 1PWDA 4QJGA 2EFXA 3NDGA 3HUMA 1YT4A 1XA7A 4HEFA 4OOMA 4X68A 2ZC3B 5DTSA 1KGFA 4N9KA 3IHBA 1W8YA 4RYEA 3RXXA 1LLBA 5KSCA 3P09A 3N6IA 5M19A 1Z6FA 1SHVA 3MZDA 1LL5A 3NBLA 2XFSA 4S2KA 4IBXA 1K38A 4X53A 3ZNTA 2Y2NA 4KG2A 5AQAA 4E3KA 4WZ5A 3EQVA 3Q1FA 5HARA 4MLLA 1E4DA 2J9OA 3GVBA 3PBQA 1K25A 2OV5A 3UE1A 4UHUA 2VGKA 3MXSA 3BFCA 4MEZA 4X55A 1HD8A 4Y0UA 2V2FF 5F83A 3WRTA 2BG1A 5FQJA 1GA9A 2ZC5B 2A3UA 4KZ4A 3IWIA 4R23A 1TDGA 4ZDXA 3LY4A 4GKUA 4ZJ3A 5M1AA 2FFFB 5I94A 1JVJA 4DE2A 5HW3A 3UPOA 1MKIA 3GTCA 5E43A 3PBSA 1U60A 5EOEA 1SDNA 2PU4A 1HZOA 2PBYA 2WGWA 5HAPA 5JYOA 3PAGA 4NK3A 3HLFA 1FOFA 1Q2PA 4N92A 4U0TA 4R3JA 3FWLA 1PWGA 2ZM0A 4KQRA 5CEBA 2Y59A 2Y2MA 2WGWB 2WAFA 2EXAA 3SH8A 3CMZA 4C75A 2WGVA 5HL1A 1QMFA 1WE4A 4EBNA 3GSGA 3E2KA 1NY0A 5FDHA 4BD1A 4OKPA 4XUZA 4B88A 4DF6A 4KQQA 4OQIA 3EQUA 4M3KA 1YMXA 2Z2LB 2ZQ7A 3UDFA 2R9XA 4DE3A 3LCEA 3SS5A 3GQZA 5A92A 3BFEA 5HAQA 1BSGA 1VM1A 5AQ9A 4KZ3A 1BUEA 3LY3A 4JF6A 3OCLA 2VGJA 2ZQDA 3G30A 3O86A 3GMWA 2Y2PA 3IWOA 5E2FA 5FASA 3IH8A 1IKIA 4Y0TA 4OPZA 2QPNA 1KVLA 4BD0A 3I7JA 3M6BA 1JWVA 2Q9MA 5E2HA 4R3BA 3V5MA 2WZZA 2V20A 1TEMA 1KDSA 5FAPA 4DDYA 2HDQA 2HDSA 4GDNA 5DVAA 5CEDA 3ZVWA 1YLTA 1KE0A 1FSWA 1PIOA 1G68A 4RVAA 1KDWA 5CTNA 3IXHA 5EPHA 2X01A 4L0LA 3ZDJA 5L2FA 5E2GA 2ZMAA 4LV1A 5F1GA 3QNCA 4WEJA 1LI9A 4HBUA 3VOYA 3AGEA 1BULA 2Y2KA 4JKTA 3E2LA 2XLNA 2ZQCA 1LHYA 5JYPA 4KENB 4XXRA 1FCMA 4PM5A 4DE1A 4KG6A 3MBZA 3ZHHA 1K56A 1WYBA 3N8SA 2V1ZA 4E3IA 3VP0A 4GN2A 1CEGA 1SDEA 4PM9A 4BJPA 1L0DA 3BECA 4K0WA 1H8ZA 2H5SA 3N4IA 3GR2A 3MFDA 3SS4A 3HLGA 2Y55A 1H5XA 3IWQA 3S1YA 1K4EA 1KVMA 1YLZA 1L0EA 2EX6A 3M2JA 4RX2A 1IYQA 5GLBA 1BTLA 3G31A 3GV9A 3M6HA 4R4RA 4DRTA 1IYPA 1W79A 2JCHA 3Q7ZA 3OZHA 3S22A 4RA7A 1BLPA 5EECA 1K54A 5EUAA 4OLGA 3ZG0A 1KE3A 3CG5A 1K55A 4N9LA 5DTKA 4JLFA 1XX2A 3PBNA 4RX3A 3HLEA 3ITAA 3QNBA 2X02A 1EI5A 1O7EA 4KZ8A 3VFFA 4B4XA 4EBLA 2HP5A 1L0FA 1OMEA 5GLCA 4OLDA 5GHXA 3G2ZA 1WYCA 3A3DA 4IBRA 4QY6A 3SS3A 2CC1A 4MBFA 1DJAA 1DY6A 4X56A 1CEFA 2XD5A 3IXGA 3OPHA 4JF4A 3BFGA 5HFOA 3SOIA 3C4PA 1ES4A 4OOYA 4UA7A 2XQZA 4FCFA 3MKEA 3ZG8B 1XGJA 2XGNA 1W5DA 4LCMA 3HREA 3V3SA 2Y2LA 2XD1A 1S0WA 1NJ4A 5EVID 1FCOA 5CTMA 3V50A 3VP4A 4KZBA 1JTGA 3IXDA 1PW1A 1XKZA 3C7VA 4UA9A 3VP2A 1BT5A 1K54C 2WK0A 3C5AA 3WS1A 1K55C 3Q81A 3A3IA 4NETA 4QB8A 2IWBA 1NXYA 3MZFA 3A3FA 3RXWA 3PTEA 4OPRA 1L0GA 3AGFA 3IF6A 4E6XA 3ZGAB 4U0XA 1PI4A 3CJMA 1ES5A 3VOZA 3DTMA 2HDUA 3ZNYA 1FSYA 1ERMA 2EFUA 4EQIA 3ZVTA 3B3XA 4E3JA 5EE8A 3IF6B 2ZQ8A 4OQHA 3BYDA 5D3OA 4OP5A 1ONHA 5GLAA 1DJBA 1N4OA 4N1HA 4S2NA 4B4ZA 1K56D 1XGIA 3M2KA 1RGZA 4FH2A 2UWXA 5M18A 3W8KA 1RCJA 5U47A 4ZTKA 4PM8A 1J9MA 1KE4A 4CPKA 3O3VA 5FQMA 4C6YA 1ERQA 2DRWA 2DCFA 4IVKA 2H0TA 3Q7VA 5CECA 4XUXA 2WGIA 4WZ5C 2Z2MB 3PBTA 4PM6A 4S2JA 1TDLA 4GOGA 3SH7A 2RL3A 4JXGA 3DW0A 3HUNA 5CGXA 4PPRA 3A3JA 1LL9A 5FQ9A 4DDSA 3UY6A 4Y0OA 1E3UA 2JC7A 5FSRA 2HP9A 4KG5A 3ZCZA 3NCKA 5EVIA 1CI8A 2OLUA 5KMWA 1EWZA 3HBRA 1ZC2A 3SH9A 4E6WA 3PBRA 3OPPA 3G34A 3IF6C 1NYYA 5GL9A 3ZG9B 1CI9A 4S2LA 5EVIB 2Y91A 3IT9A 4MBKA 3C7UA 4C3QA 3UN7A 2QMIA 5HAIA 2QZ6A 3A3EA 3ZG7B 3OCNA 3UDIA 5FQQA 3FV7A 1ZG4A 2I72A 1NYMA 3MZEA 4GZBA 4YFMA 1MY8A 4UA6A 3HVFA 4S2NC 4OONA 4WM9A 4OOLA 2P9VA 5DF7A 3VMAA 3O88A 4P6BA 4ZJ1A 3OC2A 3UNWA 4JPMA 5HX9A 2P9VB 2G2UA 2Y2OA 1RGYA 1AXBA 2Y2JA 5FA7A 4KZAA 4HBTA 3UPPA 3HLDA 5GHZA 3W4OA 5CHMA 1I5QA 2WZXA 3LO7A 5FI2A 4DE0A 3N8LA 1FR1A 1NZUA 1EROA 4FH4A 3UO9A 3VSKA 3PBOA 1BLHA 3BFDA 4QHCA 4OH0A 4S2PA 5EVIC 4LV3A 4ZAMA 3JYIA 3UPNA 4LV0A 5KSHA 1E25A 1ESIA 4E3MA 4JF5A 5EVLA 4E3LA 2HPBA 4WBGA 4IVIA 3WRZA 4X69A 5CHUA 1QMEA 2IWCA 3G2YA 3NC8A 4LCLA 1MPLA 4OVDA 3ZFZA 4WELA 3V39A 3W4QA 5A90A 1K4FA 1PI5A 4H8RA 1XP4A 3BM6A 1IYOA 2WKIA 3UE3A 3D4FA 1S6RA 1XXMA 4FD8A 4WMCA 2XR0A 3IH9A 1IELA 5BOHA 1N9BA 4N1XA 1YLYA 1PWCA 5GHYA 4KZ5A 2WKEA 3OPRA 5FI7A 1O07A 1YLPA 1ZG6A 4EBPA 3WS5A 4D2OA 5IHVA 1MWRA 1JTDA 4Q8IA 4JXVA 3IHAA 2XH9A 2EX8A 2OSUA 3PAEA 4KQOA 3NIAA 5J8XA 1MBLA 1CK3A 3NDEA 5CGWA 1G6AA 1TVFA 1E3UD 3W4PA 2ZM2A
chains in the Genus database with same CATH superfamily
1TD5A 4OQGA 1KGGA 2ZC4B 5FDSA 3KYEA 3BEBA 2ZQAA 5F82A 4WEKA 2L1MA 3FPWA 2H10A 1YSQA 5L10A 2XFTA 3S7PA 4BL2A 3AGDA 2VKSA 1W8QA 5A8BA 1JNUA 2V9AA 2X71A 4HESA 3VP3A 5AQ7A 4GD6A 4EUZA 3A0RA 3TG9A 3T1SA 2C6WB 4FUWA 1ESUA 5FATA 4CLCE 1ALQA 3BJNA 2FFYA 4QD4A 1BYWA 3ZG5A 2VV7A 4GD8A 2ZC7A 3HJKA 5EOOA 2J7VA 4JBFA 4UAAA 3UDXA 3BFFA 5DTTA 3MXRA 4BL3A 3BLMA 4S2OA 3T1XA 3HLCA 2QJ5A 4PAUA 3VSLA 2WKQA 4FSFA 4PM7A 3IF5A 4G3VA 1YLJA 3IQAA 4U3TA 3FKWA 4GHIB 3LR4A 1G5UA 1LL8A 3R7WB 3LIFA 4WYYA 1K57A 1NRJA 3DAVA 4O7DA 3CZDA 5G4ZA 2ZM8A 1YLWA 1MWTA 4EU0A 1YM1A 1HVBA 2Y2GA 2Z6CA 2EXBA 1A0KA 2ZJ9A 4P85A 1GHPA 1ZKJA 1Y54A 1IEMA 1W7FA 3TE8A 2XSSA 2WYXA 3VP1A 3QP4A 2C5WB 4F94A 4GCZA 1L2SA 1GCEA 1MWSA 4KUOA 5LBRA 2W3GA 1IKGA 1ES2A 3Q07A 3UE0A 1PWDA 3HUMA 4WF0A 2ZC3B 3IS2B 1KGFA 4N9KA 1Z6FA 4ME4A 1LL5A 4Y13A 2XFSA 4IBXA 1LSVA 2Y2NA 4KG2A 4E3KA 2WKPA 3MR0A 3UE1A 5J7EA 3KO6A 4MEZA 2ZC5B 2A3UA 3BQ8A 3LY4A 4DE2A 2P04A 5EOEA 3EEAA 4I39A 5TBMB 1S1YA 3A0SA 3ZYTA 3HLFA 2HZ5A 2Y2MA 2WAFA 3CMZA 1QMFA 4EBNA 1NY0A 3BWLA 5FDHA 4OQIA 2ZOIA 4M3KA 1YMXA 3B47A 3UDFA 4DE3A 3LCEA 3SS5A 5A92A 5HAQA 4KZ3A 5E2FA 1V9YA 1IKIA 1DP8A 3I7JA 1ZHHB 2PR5A 2WZZA 2PD8A 2V20A 1KDSA 4HY8A 1KE0A 1G68A 3IXHA 2WKRA 3HCYA 4LV1A 3LIBA 4HIAA 4JGPA 1LI9A 4HBUA 3VOYA 3VV4A 1BULA 3E2LA 2XLNA 2ZQCA 1LHYA 3BW6A 1FCMA 2D02A 1VEUA 3MBZA 1WYBA 5CX7A 4E3IA 4R38A 1L0DA 1W63Q 3BECA 3RH8B 3TW8A 3IBRA 2Y55A 1H5XA 3S1YA 1KVMA 4RX2A 3GV9A 2JCHA 3EGDC 1K54A 1KE3A 4JLFA 3PBNA 3ITAA 3QNBA 5I5LA 4EBLA 5DJUA 2HP5A 4HOIA 1OMEA 1XJ4A 3G2ZA 1WYCA 3SS3A 4EUVA 3DTEA 2XRNA 4MBFA 1G6OA 1DY6A 1CEFA 3IXGA 3SOIA 5HFOA 3BFGA 5DKLA 2JHEA 4OOYA 3E0YA 4FCFA 3MKEA 2XGNA 2O9AA 3VP4A 4KZBA 1JTGA 1PW1A 1N9NA 1HLUP 3F1OA 3WS1A 4IUKA 1K55C 2I9VA 3PTEA 4OPRA 4E6XA 3ZGAB 1PI4A 1ERMA 2EFUA 3ZVTA 3LR3A 4HHDA 2ZQ8A 4OP5A 4I3JA 1ONHA 5GLAA 5EV0A 5M18A 1RGZA 1CJFA 4CPKA 4CLCA 1J9MA 1ERQA 2DRWA 5CECA 4CLCB 4PM6A 4S2JA 1TDLA 2RL3A 2W3HA 2YKHA 3HUNA 4DDSA 4Y0OA 3LR5A 1T1AA 4KG5A 3A0VA 3QP1A 4E6WA 3SH9A 3PBRA 3OPPA 5GL9A 2Y91A 3IT9A 2FZ0A 3MQOA 5FQQA 1NYMA 4OOLA 3MXQA 3O88A 5HPIA 3B33A 2G2UA 2A24A 5FA7A 3HLDA 5GHZA 2WZXA 3CUEC 4DE0A 2A24B 3UB8A 3UO9A 3PBOA 1E25A 4IVIA 1QMEA 3G2YA 3QP5A 1TF1A 2PT7A 4WELA 3V39A 3W4QA 1PI5A 4II7A 1EW0A 4H8RA 1XP4A 3LIEA 1LSXA 3BM6A 2WKIA 1S6RA 1XXMA 2VZWA 2HF6A 4FTXA 5L07A 3NOPC 2W1TB 4R3AA 2P08A 4KQOA 3NIAA 4IUHA 1MBLA 1CK3A 5CGWA 1G6AA 1IOUA 4MN5A 1E3UD 5TR7A 3MQ0A 3PBTA 3W4PA 1PZPA 3HUOA 3OOVA 1VQQA 1ACFA 1FCNA 4BQMA 5DFYA 1DJCA 1Y28A 3CITA 4R1GA 1KOUA 2VGLS 4MN7A 4ID4A 1K6SA 2PYRA 4E3NA 5TFQA 1FQGA 1CQAA 5FL3A 2J8YA 4HQAA 1OTAA 1C3BA 3UB5P 2XA7M 3Q7VB 2ZMVA 3FKVA 4KZ7A 3V3RA 4BENA 4Y7PA 3T4QA 4B93A 2JE5A 3HLBA 2V0WA 2OLVA 2XF3A 5GLDA 5L09A 2PRFA 4ETZA 4WMCD 5A91A 2IWDA 4HJ4A 5FAQA 1XPBA 1H3QA 3MKFA 5F69A 2W3DA 4H6JA 4Q0JA 4LENA 1MXOA 4H6JB 2E8IA 2P74A 3HLWA 3TSGA 1X0OA 2GNXA 2HP6A 3BLSA 2EX9A 5CGSA 2R9WA 3U2AA 4P87A 1NRFA 3DWKA 1GA0A 4HH2A 5AQBA 2Y4AA 1UWPX 4YINA 2Y2HA 5HSQA 2INWA 1YQSA 4EWFA 4EEPA 1P0ZA 2ZLYA 3KYZA 2ZC6B 4O01A 3NJAA 3GRJA 4D60A 5KZHA 2L4RA 2EFXA 3NDGA 1YT4A 1XA7A 4OOMA 3LIDA 3IHBA 3RXXA 3CWFA 3PXPA 3D72A 3P09A 3IX4A 3UB6A 3NBLA 1CF0A 4X53A 3D9YA 5AQAA 1MC0A 4MLLA 1E4DA 4WLAA 1NWZA 3GVBA 3BFCA 4MCWA 4X55A 5F83A 2V2FF 1OTEA 1PNEA 4R23A 1TDGA 4GKUA 4EW7A 3S7OA 5HW3A 3IX8A 1U60A 1SDNA 2PU4A 1HZOA 5HAPA 1YAXA 5JYOA 1H0MA 4G3WA 5HZHA 4KQRA 2VK3A 2Y59A 2EXAA 1OTBA 2VA0A 5HL1A 3T4TA 4BD1A 2M7UA 4OKPA 1N9LA 3JVUA 4XUZA 4B88A 2XA7S 3UB9A 3F1NA 4IHQA 2R9XA 3VE3A 1BSGA 1BUEA 4JF6A 3OCLA 3O86A 4UEYA 4OPZA 2Q9MA 5HDDA 1TEMA 5FAPA 2HDQA 5DVAA 3ZVWA 1YLTA 1FSWA 4RVAA 4BWIA 2NUPC 4BBUA 2Y2KA 5HD5A 2NUTC 3DTIA 4KENB 4XXRA 4DE1A 3N8SA 4NG2A 1SDEA 4PM9A 3LUQA 2H5SA 3RFBA 1D06A 5GLBA 2EX6A 1IYQA 3M6HA 1IYPA 3Q7ZA 4NXGA 1DRMA 1D1JA 3ZG0A 3CG5A 2O99A 5DTKA 3IX3A 4I5SA 4RX3A 3HLEA 4K08A 3NOTC 4YNRA 4OLDA 2PDRA 3QP2A 4IBRA 3MS6A 2OAQ1 4JF4A 3OPHA 1ES4A 1ZTUA 2B02A 1V9ZA 2Y2LA 4GLQA 5CTMA 2V8FA 1XKZA 3C5AA 2XROA 3Q81A 1YKDA 4QB8A 5HPFA 5EVEA 1F2KA 1NXYA 3A3FA 3LFVA 1XJ6A 4HI4A 3IF6A 3DTMA 2HDUA 3ZNYA 4EQIA 3VOLA 3IF6B 4MDZA 4F3LA 1DJBA 1N4OA 4S2NA 4B4ZA 1K56D 4F3LB 4PKYA 5FQMA 2H0TA 4XUXA 3SH7A 5CGXA 4PPRA 1LL9A 5FQ9A 2J3TC 5HL6A 2HP9A 2ZOHA 3NCKA 5EVIA 2OLUA 1EWZA 3ZG9B 4IJGA 5EVIB 4DJ2A 3C7UA 4C3QA 3UN7A 2QZ6A 3JVVA 1F98A 3ZG7B 3LICA 3U4LP 3UDIA 1ZG4A 4GZBA 5F5YA 4YFMA 2IA2A 4UA6A 1OT9A 3LI8A 4WM9A 2P9VA 2J3WA 4ZJ1A 2GZAA 5HX9A 2P9VB 2D01A 3C38A 1AXBA 4HBTA 3W4OA 5CHMA 1VEUB 3EOIA 3N8LA 5F6AA 2J3TD 4PKYG 3BFDA 4S2PA 3JYIA 1ESIA 4ARZA 2M7VA 2UV0E 5J3WA 3NECA 4ARZB 1VB6A 2QYBA 5IU1A 1K4FA 2V8CA 3UE3A 3D4FA 1D7EA 4FD8A 2XR0A 3IH9A 5BOHA 1N9BA 2JKTI 1PWCA 1W63M 4Z1WA 4ESPA 5FI7A 1YLPA 1WA9A 4D2OA 1JTDA 4JXVA 3T4OA 4JGOA 3NDEA 1T1BA 3ULFA 2VJWA 1GSXA 3QP8A 1PW8A 4R0QA 3UMEA 2RCXA 2XEPA 5FI6A 1SCWA 3CI6A 1IYSA 2V0UA 3G35A 3NY4A 2BLSA 3QHYA 4DN0A 1XA1A 3F1OB 1K0KA 3DWZA 4NXEA 1YPRA 4JXSA 1BLSA 2CMNA 4HJ3A 4OQ0A 4KUKA 4DXBA 4PMAA 1JWZA 3CPTA 4QY5A 4MNRA 3RJUA 3W2ZA 3CPTB 4Q0HA 3FC7A 4DKIA 4GB7A 4P0MA 3TRCA 1N9OA 3OPLA 4M4XA 1KGEA 1J3WA 1LI0A 5FQIA 4MBHA 3WS4A 2Q0OA 1PZOA 1LT0A 4S2MA 5DKKA 3DBAA 3G4PA 2Y2IA 4E3OA 4ZBEA 3UMDA 4KZ6A 5G18A 2GDNA 1MWUA 3O87A 1YMSA 2EX2A 1M40A 3WS2A 4FOFA 3L9KA 5CERA 4LRXC 4L9GA 2ZQ9A 4MMNA 3KSFA 2R78A 2EWWA 2WKHA 3ITBA 2A2LA 3MSHA 3P01A 3T4KA 3BRMA 4GJ4A 4WL9A 2B5RA 5TGFA 3FPVA 4JXWA 2PAVP 4S2IA 5CRFA 2A49A 1PYYA 4LV2A 1M6KA 2M1CA 1BZAA 4R4SA 3EWKA 2PYPA 4HP9A 1GSWA 3P98A 2ZD8A 4QU3A 5IT5A 3G32A 1IFQA 5E2EA 2WADA 5DF9A 3TOIA 1YSPA 4EERA 2JBFA 2H0YA 2KDKA 4CQHA 1SKFA 4KZ9A 1I2SA 4GS9A 2ZL1A 3S4XA 3GECA 1K57C 4QJGA 4GS9B 2JKRI 5DTSA 1W8YA 1LLBA 2JN7A 5KIZA 5M19A 1SHVA 3JPUA 1K38A 1P97A 3Q1FA 5HARA 2J9OA 3PBQA 4UHUA 2VGKA 4Y0UA 1HD8A 1Z09A 4KZ4A 2PBDP 3IWIA 4ZDXA 4Y5FA 5I94A 1JVJA 1MKIA 5E43A 4HH3A 5EM1A 4KQDA 2PBYA 3PAGA 1Q2PA 4U0TA 3V67A 4R3JA 2OAP1 1PWGA 2ZM0A 3C2WA 5FEFA 3SH8A 2BASA 2WGVA 3S7QA 5FEGA 3LYXA 3GSGA 3E2KA 4Y17A 2JKFA 2Z2LB 2ZQ7A 4XT2A 3GQZA 4EESA 5AQ9A 1VM1A 3LY3A 2VGJA 3G30A 4XT2B 3GMWA 5FASA 3G6OA 3IH8A 3ZQ5A 4Y0TA 2ACGA 2VV8A 1JWVA 4R3BA 2JKTM 4DDYA 2HDSA 4GDNA 5CEDA 4BMWA 3R4KA 3T4JA 1PIOA 4EXOA 1FIKA 4R6LA 1KDWA 5CTNA 5EPHA 2X01A 5L2FA 1F5MA 2AVXA 3AGEA 4JKTA 1DP6A 1TS8A 3K3DA 4PM5A 5L8MA 5HWWA 4BBTA 5EFWA 3ZHHA 4GN2A 4BJPA 2W27A 1S67L 3GR2A 2PR6A 3HLGA 1YLZA 3OBFA 1L0EA 3M2JA 2P7JA 4DRTA 1BTLA 3G31A 3T12B 1W79A 5EUAA 4OLGA 3SW1A 1K55A 2LB9A 1XJ2A 1XFNA 5K5BA 4KZ8A 1EI5A 4QWOA 2VX8A 1L0FA 5GLCA 2QWSA 5GHXA 2Z6DA 1DJAA 3C4PA 5AJGA 1XGJA 3C30A 3V3SA 3HREA 2XD1A 5G4YA 2HGVA 1NJ4A 5EVID 3BY8A 1OPXA 3IXDA 3C7VA 3VP2A 1K54C 2WK0A 2GJ3A 3A3IA 1T1CA 3MZFA 5DJTA 3AGFA 3CJMA 1ES5A 4L9EA 4ZRRA 3VOZA 4R70A 1FSYA 3B3XA 5D3OA 2O9BA 3ICYA 3H7WA 3M2KA 4FH2A 4RQ9A 2UWXA 1KE4A 3O3VA 3PR6A 2DCFA 4IVKA 3H7WB 3D3OA 2WGIA 4WZ5C 4GW9A 2Z2MB 3LEQA 4JXGA 3GDIA 3CAXA 3A3JA 3F1NB 3CUEA 1OTDA 3UY6A 1UGUA 3HJIA 1E3UA 5FSRA 3PHYA 1CI8A 2EA9A 5KMWA 3HBRA 1UWNX 3G34A 4E04A 3EEHA 4Q0IA 3OCNA 2I72A 3MZEA 1MY8A 4X1MA 1OJGA 5DF7A 4P6BA 4CLCC 5AVEA 4JPMA 1NLYA 3T4SA 2O0YA 2JKRM 4GHIA 2Y2JA 4PHTA 3UB7A 1P9RA 3R7WA 1I5QA 3LO7A 5FI2A 3EGXC 2GX5A 3VSKA 5HDSA 3CLOA 3OLOA 4QHCA 5KSHA 4ZAMA 4LV0A 2YKFA 2W3FA 4JF5A 5EVLA 4E3LA 2HPBA 4WBGA 2OWJA 2HJEA 3NC8A 5A90A 1GSVA 1H8MA 3LI9A 4WUJA 1OJ5A 4WMCA 3T1QB 1IELA 3H9WA 4N1XA 4CLCD 5GHYA 4KZ5A 4EBPA 3WS5A 5IHVA 1MWRA 3IHAA 5TJJA 1L3LA 2EX8A 2OSUA 4DJ3A 5J8XA 1AWIA 1PRQA 1TS0A 4NKPA 1TVFA 1T18A 2ZM2A 1L0GA 5F1FA 3IS2A 4O8GA 3S7NA 4CJNA 3BQAA 5C5KA 4EV4A 2B18A 3IXBA 4OPQA 1GHMA 5FQKA 2WUQA 5FAOA 4LRZE 2PD7A 1MZUA 4HNBA 3F1PA 4K91A 5DF8A 4GDBA 4DXCA 3F1PB 4LLOB 2W1RA 3FYZA 4BLMA 4WZ4A 2O9CA 3FZCA 1S4SA 1TS6A 2EWVA 3Q82A 1K6RA 3NHQA 4ZJ2A 5TBMA 4MN6A 3RTYA 3ISGA 3KYQA 3L7HA 2XDMA 1DP9A 2ZBBA 5HWTA 2WAEA 3NI9A 4X6TA 2Y2QA 1XFQA 4UQIM 3VFHA 5A93A 2W3EA 2XK1A 3E4PA 5CXWA 4Z9QA 3KSIA 2VLGA 2OOLA 1ONGA 1RP5A 3K2NA 3LGOA 3WWXA 3LEZA 4BBVA 3E4OA 4B9OA 3NULA 5CHJA 4O0PA 4OPYA 1H8YA 2V1AA 2HDRA 2G2WA 2FH5A 1NZOA 4OP8A 3HL9A 2Q9NA 1JWPA 2PU2A 4IEDA 4P6ZM 2DNSA 3WS0A 1I2WA 1HTZA 2KX6A 1OTIA 4K0XA 4YWZA 1FR6A 1GHIA 3N7WA 2QHKA 2J9PA 1BLCA 1LSWA 1Q2QA 2KLIA 4EQ1A 3N8RA 1SZVA 4A5RA 1S4RA 3C4OA 4GNUA 1ES3A 1STZA 5F68A 1OT6A 4HEFA 3MF0A 3QP6A 4X68A 5IS1A 2LB5A 4RYEA 4YOFA 2DMWA 5KSCA 3N6IA 3IBJA 3MZDA 2K31A 2JKGA 4S2KA 4EEUA 3ZNTA 2VGLM 4WZ5A 3EQVA 2K7SA 4Y3IA 1K25A 2OV5A 3MXSA 3KSGA 3WRTA 4I3IA 1NLZA 2BG1A 1GA9A 5FQJA 3SZTA 2HV1A 4ZJ3A 5M1AA 2FFFB 3UPOA 3GTCA 3PBSA 3C8CA 2WGWA 2MJ6A 1PFLA 3NOUC 4NK3A 3T4LA 1FOFA 4N92A 3FWLA 5CEBA 2WGWB 4C75A 3KX0X 1S66L 1WE4A 3T1RA 5MC7A 4Y2FA 4DF6A 4KQQA 3EQUA 5J4EA 4AFIA 3BFEA 2BTFP 4NEED 4JGQA 4UQIS 2ZQDA 2Y8HA 3T50A 2Y2PA 3IWOA 3LIAA 1SKOA 1G28A 2QPNA 1VHMA 1KVLA 4LGWA 4BD0A 3M6BA 5E2HA 3V5MA 2VV6A 4X1LA 1P9WA 4I3AA 5HD3A 4ETXA 5HWVA 1SKOB 3DTKA 3ZDJA 4L0LA 3CHWP 5E2GA 2ZMAA 5F1GA 3QNCA 4WEJA 4EETB 4Y15A 4LPZA 5JYPA 1FILA 4KG6A 1K56A 2QJ7A 3BY9A 2V1ZA 1MKMA 3VP0A 1CEGA 4K0WA 1H8ZA 3N4IA 3MFDA 3SS4A 3IWQA 1K4EA 1XJ3A 4P6ZS 4R4RA 2PHYA 4NXBA 3OZHA 3S22A 4RA7A 1BLPA 5EECA 2OWHA 4N9LA 1XX2A 2W1TA 3VFFA 4B4XA 2X02A 1O7EA 3P7NA 3PYPA 3A3DA 4QY6A 2CC1A 3E4QA 2ZL1B 4X56A 2XD5A 4UA7A 2XQZA 2QKPA 3MJQA 3ZG8B 2V1BA 1VETA 4I38A 1W5DA 4LCMA 1S0WA 1FCOA 3V50A 4UA9A 1BT5A 1VETB 4DMZA 2HJ9C 4NXFA 4NETA 2IWBA 3RXWA 3UE6A 4U0XA 1F9IA 4E3JA 3VE4A 5EE8A 2L0WA 4OQHA 1S1ZA 4G3KA 3BYDA 2VEAA 2H28A 4N1HA 1XGIA 3W8KA 1RCJA 5U47A 4ZTKA 4PM8A 4C6YA 3Q7VA 3H82A 4HJ6A 5EM0A 5HDCA 4X25A 1TS7A 4GOGA 4LRYC 3DW0A 3MMHA 3H82B 2G7UA 3K3CA 2JC7A 2ZMFA 3LR0A 3ZCZA 1ZC2A 4WN5A 2B95A 3IF6C 1Y4OA 4L9FA 1NYYA 3E98A 1CI9A 4S2LA 3MFXA 5AVFA 4MBKA 2QMIA 5HAIA 3A3EA 3FV7A 3HVFA 4S2NC 4OONA 3VMAA 2W0NA 3OC2A 3UNWA 1ODVA 4HP4A 2Y2OA 1RGYA 3B42A 4KZAA 3UPPA 1FR1A 1NZUA 1EROA 4FH4A 3KSHA 1BLHA 4OH0A 5EVIC 4LV3A 3UPNA 3TJZC 3MQQA 4E3MA 2KOIA 2K2NA 3WRZA 4X69A 5CHUA 2IWCA 4LCLA 2Y79A 1MPLA 4OVDA 3ZFZA 4QPRA 4LFUA 1IYOA 1T19A 1YLYA 2WKEA 3OPRA 2J80A 1O07A 1ZG6A 2E8JA 4Q8IA 3O5YA 2XH9A 5DFXA 3PAEA 3FG8A 4JGRA
chains in the Genus database with same CATH topology
5F1FA 1PZPA 3HUOA 1PW8A 4OQGA 1VQQA 4R0QA 4CJNA 2RCXA 2XEPA 5FI6A 4EV4A 3IXBA 1FCNA 1GHMA 4OPQA 4BQMA 1KGGA 2ZC4B 1SCWA 1IYSA 5FQKA 2WUQA 3BEBA 2ZQAA 3G35A 5FAOA 3NY4A 2BLSA 1DJCA 3QHYA 5F82A 4R1GA 4WEKA 1XA1A 3DWZA 4K91A 5DF8A 4JXSA 4GDBA 1BLSA 4DXCA 4OQ0A 4ID4A 2H10A 1K6SA 4DXBA 4PMAA 1JWZA 2XFTA 4E3NA 4QY5A 4BL2A 4MNRA 3RJUA 3FYZA 3AGDA 4BLMA 5TFQA 4WZ4A 1FQGA 3FZCA 1W8QA 3Q82A 4DKIA 1K6RA 4GB7A 4ZJ2A 4P0MA 3ISGA 2X71A 4HESA 2J8YA 3VP3A 5AQ7A 2XDMA 4GD6A 4EUZA 3OPLA 1C3BA 1KGEA 1LI0A 5FQIA 3TG9A 3Q7VB 2WAEA 3NI9A 2C6WB 2Y2QA 4MBHA 4X6TA 3FKVA 1ESUA 5FATA 1PZOA 3WS4A 4KZ7A 4S2MA 1ALQA 3V3RA 3VFHA 5A93A 4BENA 3G4PA 4Y7PA 2Y2IA 2FFYA 2JE5A 4E3OA 4QD4A 2XK1A 4ZBEA 3HLBA 2OLVA 2XF3A 4KZ6A 5GLDA 5CXWA 3ZG5A 4GD8A 4Z9QA 5G18A 2ZC7A 1ONGA 2GDNA 5EOOA 1MWUA 2J7VA 1RP5A 3O87A 1YMSA 4WMCD 5A91A 2IWDA 4JBFA 5FAQA 3WWXA 1XPBA 3LEZA 4UAAA 2EX2A 1M40A 3UDXA 3WS2A 3BFFA 3MKFA 5DTTA 5CERA 3MXRA 4BL3A 3BLMA 4S2OA 2ZQ9A 3HLCA 5CHJA 2WKHA 3VSLA 3ITBA 4OPYA 4FSFA 4PM7A 3IF5A 1H8YA 1YLJA 2HDRA 2G2WA 3IQAA 4LENA 4U3TA 3FKWA 3BRMA 1MXOA 1NZOA 4OP8A 2B5RA 3HL9A 5TGFA 2E8IA 2Q9NA 4WYYA 4JXWA 1K57A 1JWPA 2PU2A 2P74A 3HLWA 4IEDA 2A49A 3CZDA 4O7DA 4S2IA 5CRFA 3TSGA 2DNSA 3WS0A 1I2WA 1YLWA 2ZM8A 1PYYA 1HTZA 1MWTA 4LV2A 2HP6A 1M6KA 1YM1A 3BLSA 2EX9A 1BZAA 5CGSA 2R9WA 4K0XA 4P87A 1NRFA 3DWKA 1HVBA 2Y2GA 4R4SA 5TR7A 2EXBA 2ZJ9A 1GA0A 1FR6A 4P85A 5AQBA 1GHPA 1ZKJA 2Y4AA 1Y54A 1GHIA 3N7WA 4YINA 1IEMA 1W7FA 2Y2HA 3P98A 2J9PA 2ZD8A 4QU3A 1YQSA 4EWFA 3G32A 1BLCA 5E2EA 2WYXA 2ZLYA 1Q2QA 3VP1A 2WADA 5DF9A 3N8RA 3TOIA 2C5WB 2JBFA 2H0YA 4F94A 4A5RA 2ZC6B 1L2SA 1GCEA 3C4OA 1MWSA 1SKFA 4KZ9A 1I2SA 4GNUA 1ES3A 1IKGA 3GRJA 3S4XA 1ES2A 3Q07A 5KZHA 3UE0A 1K57C 1PWDA 4QJGA 2EFXA 3NDGA 3HUMA 1YT4A 1XA7A 4HEFA 4OOMA 4X68A 2ZC3B 5DTSA 1KGFA 4N9KA 3IHBA 1W8YA 4RYEA 3RXXA 1LLBA 5KSCA 3P09A 3N6IA 5M19A 1Z6FA 1SHVA 3MZDA 1LL5A 3NBLA 2XFSA 4S2KA 4IBXA 1K38A 4X53A 3ZNTA 2Y2NA 4KG2A 5AQAA 4E3KA 4WZ5A 3EQVA 3Q1FA 5HARA 4MLLA 1E4DA 2J9OA 3GVBA 3PBQA 1K25A 2OV5A 3UE1A 4UHUA 2VGKA 3MXSA 3BFCA 4MEZA 4X55A 1HD8A 4Y0UA 2V2FF 5F83A 3WRTA 2BG1A 5FQJA 1GA9A 2ZC5B 2A3UA 4KZ4A 3IWIA 4R23A 1TDGA 4ZDXA 3LY4A 4GKUA 4ZJ3A 5M1AA 2FFFB 5I94A 1JVJA 4DE2A 5HW3A 3UPOA 1MKIA 3GTCA 5E43A 3PBSA 1U60A 5EOEA 1SDNA 2PU4A 1HZOA 2PBYA 2WGWA 5HAPA 5JYOA 3PAGA 4NK3A 3HLFA 1FOFA 1Q2PA 4N92A 4U0TA 4R3JA 3FWLA 1PWGA 2ZM0A 4KQRA 5CEBA 2Y59A 2Y2MA 2WGWB 2WAFA 2EXAA 3SH8A 3CMZA 4C75A 2WGVA 5HL1A 1QMFA 1WE4A 4EBNA 3GSGA 3E2KA 1NY0A 5FDHA 4BD1A 4OKPA 4XUZA 4B88A 4DF6A 4KQQA 4OQIA 3EQUA 4M3KA 1YMXA 2Z2LB 2ZQ7A 3UDFA 2R9XA 4DE3A 3LCEA 3SS5A 3GQZA 5A92A 3BFEA 5HAQA 1BSGA 1VM1A 5AQ9A 4KZ3A 1BUEA 3LY3A 4JF6A 3OCLA 2VGJA 2ZQDA 3G30A 3O86A 3GMWA 2Y2PA 3IWOA 5E2FA 5FASA 3IH8A 1IKIA 4Y0TA 4OPZA 2QPNA 1KVLA 4BD0A 3I7JA 3M6BA 1JWVA 2Q9MA 5E2HA 4R3BA 3V5MA 2WZZA 2V20A 1TEMA 1KDSA 5FAPA 4DDYA 2HDQA 2HDSA 4GDNA 5DVAA 5CEDA 3ZVWA 1YLTA 1KE0A 1FSWA 1PIOA 1G68A 4RVAA 1KDWA 5CTNA 3IXHA 5EPHA 2X01A 4L0LA 3ZDJA 5L2FA 5E2GA 2ZMAA 4LV1A 5F1GA 3QNCA 4WEJA 1LI9A 4HBUA 3VOYA 3AGEA 1BULA 2Y2KA 4JKTA 3E2LA 2XLNA 2ZQCA 1LHYA 5JYPA 4KENB 4XXRA 1FCMA 4PM5A 4DE1A 4KG6A 3MBZA 3ZHHA 1K56A 1WYBA 3N8SA 2V1ZA 4E3IA 3VP0A 4GN2A 1CEGA 1SDEA 4PM9A 4BJPA 1L0DA 3BECA 4K0WA 1H8ZA 2H5SA 3N4IA 3GR2A 3MFDA 3SS4A 3HLGA 2Y55A 1H5XA 3IWQA 3S1YA 1K4EA 1KVMA 1YLZA 1L0EA 2EX6A 3M2JA 4RX2A 1IYQA 5GLBA 1BTLA 3G31A 3GV9A 3M6HA 4R4RA 4DRTA 1IYPA 1W79A 2JCHA 3Q7ZA 3OZHA 3S22A 4RA7A 1BLPA 5EECA 1K54A 5EUAA 4OLGA 3ZG0A 1KE3A 3CG5A 1K55A 4N9LA 5DTKA 4JLFA 1XX2A 3PBNA 4RX3A 3HLEA 3ITAA 3QNBA 2X02A 1EI5A 1O7EA 4KZ8A 3VFFA 4B4XA 4EBLA 2HP5A 1L0FA 1OMEA 5GLCA 4OLDA 5GHXA 3G2ZA 1WYCA 3A3DA 4IBRA 4QY6A 3SS3A 2CC1A 4MBFA 1DJAA 1DY6A 4X56A 1CEFA 2XD5A 3IXGA 3OPHA 4JF4A 3BFGA 5HFOA 3SOIA 3C4PA 1ES4A 4OOYA 4UA7A 2XQZA 4FCFA 3MKEA 3ZG8B 1XGJA 2XGNA 1W5DA 4LCMA 3HREA 3V3SA 2Y2LA 2XD1A 1S0WA 1NJ4A 5EVID 1FCOA 5CTMA 3V50A 3VP4A 4KZBA 1JTGA 3IXDA 1PW1A 1XKZA 3C7VA 4UA9A 3VP2A 1BT5A 1K54C 2WK0A 3C5AA 3WS1A 1K55C 3Q81A 3A3IA 4NETA 4QB8A 2IWBA 1NXYA 3MZFA 3A3FA 3RXWA 3PTEA 4OPRA 1L0GA 3AGFA 3IF6A 4E6XA 3ZGAB 4U0XA 1PI4A 3CJMA 1ES5A 3VOZA 3DTMA 2HDUA 3ZNYA 1FSYA 1ERMA 2EFUA 4EQIA 3ZVTA 3B3XA 4E3JA 5EE8A 3IF6B 2ZQ8A 4OQHA 3BYDA 5D3OA 4OP5A 1ONHA 5GLAA 1DJBA 1N4OA 4N1HA 4S2NA 4B4ZA 1K56D 1XGIA 3M2KA 1RGZA 4FH2A 2UWXA 5M18A 3W8KA 1RCJA 5U47A 4ZTKA 4PM8A 1J9MA 1KE4A 4CPKA 3O3VA 5FQMA 4C6YA 1ERQA 2DRWA 2DCFA 4IVKA 2H0TA 3Q7VA 5CECA 4XUXA 2WGIA 4WZ5C 2Z2MB 3PBTA 4PM6A 4S2JA 1TDLA 4GOGA 3SH7A 2RL3A 4JXGA 3DW0A 3HUNA 5CGXA 4PPRA 3A3JA 1LL9A 5FQ9A 4DDSA 3UY6A 4Y0OA 1E3UA 2JC7A 5FSRA 2HP9A 4KG5A 3ZCZA 3NCKA 5EVIA 1CI8A 2OLUA 5KMWA 1EWZA 3HBRA 1ZC2A 3SH9A 4E6WA 3PBRA 3OPPA 3G34A 3IF6C 1NYYA 5GL9A 3ZG9B 1CI9A 4S2LA 5EVIB 2Y91A 3IT9A 4MBKA 3C7UA 4C3QA 3UN7A 2QMIA 5HAIA 2QZ6A 3A3EA 3ZG7B 3OCNA 3UDIA 5FQQA 3FV7A 1ZG4A 2I72A 1NYMA 3MZEA 4GZBA 4YFMA 1MY8A 4UA6A 3HVFA 4S2NC 4OONA 4WM9A 4OOLA 2P9VA 5DF7A 3VMAA 3O88A 4P6BA 4ZJ1A 3OC2A 3UNWA 4JPMA 5HX9A 2P9VB 2G2UA 2Y2OA 1RGYA 1AXBA 2Y2JA 5FA7A 4KZAA 4HBTA 3UPPA 3HLDA 5GHZA 3W4OA 5CHMA 1I5QA 2WZXA 3LO7A 5FI2A 4DE0A 3N8LA 1FR1A 1NZUA 1EROA 4FH4A 3UO9A 3VSKA 3PBOA 1BLHA 3BFDA 4QHCA 4OH0A 4S2PA 5EVIC 4LV3A 4ZAMA 3JYIA 3UPNA 4LV0A 5KSHA 1E25A 1ESIA 4E3MA 4JF5A 5EVLA 4E3LA 2HPBA 4WBGA 4IVIA 3WRZA 4X69A 5CHUA 1QMEA 2IWCA 3G2YA 3NC8A 4LCLA 1MPLA 4OVDA 3ZFZA 4WELA 3V39A 3W4QA 5A90A 1K4FA 1PI5A 4H8RA 1XP4A 3BM6A 1IYOA 2WKIA 3UE3A 3D4FA 1S6RA 1XXMA 4FD8A 4WMCA 2XR0A 3IH9A 1IELA 5BOHA 1N9BA 4N1XA 1YLYA 1PWCA 5GHYA 4KZ5A 2WKEA 3OPRA 5FI7A 1O07A 1YLPA 1ZG6A 4EBPA 3WS5A 4D2OA 5IHVA 1MWRA 1JTDA 4Q8IA 4JXVA 3IHAA 2XH9A 2EX8A 2OSUA 3PAEA 4KQOA 3NIAA 5J8XA 1MBLA 1CK3A 3NDEA 5CGWA 1G6AA 1TVFA 1E3UD 3W4PA 2ZM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F1F A;  1PZP A;  3HUO A;  1PW8 A;  4OQG A;  1VQQ A;  4R0Q A;  4CJN A;  2RCX A;  2XEP A;  5FI6 A;  4EV4 A;  3IXB A;  1FCN A;  1GHM A;  4OPQ A;  4BQM A;  1KGG A;  2ZC4 B;  1SCW A;  1IYS A;  5FQK A;  2WUQ A;  3BEB A;  2ZQA A;  3G35 A;  5FAO A;  3NY4 A;  2BLS A;  1DJC A;  3QHY A;  5F82 A;  4R1G A;  4WEK A;  1XA1 A;  3DWZ A;  4K91 A;  5DF8 A;  4JXS A;  4GDB A;  1BLS A;  4DXC A;  4OQ0 A;  4ID4 A;  2H10 A;  1K6S A;  4DXB A;  4PMA A;  1JWZ A;  2XFT A;  4E3N A;  4QY5 A;  4BL2 A;  4MNR A;  3RJU A;  3FYZ A;  3AGD A;  4BLM A;  5TFQ A;  4WZ4 A;  1FQG A;  3FZC A;  1W8Q A;  3Q82 A;  4DKI A;  1K6R A;  4GB7 A;  4ZJ2 A;  4P0M A;  3ISG A;  2X71 A;  4HES A;  2J8Y A;  3VP3 A;  5AQ7 A;  2XDM A;  4GD6 A;  4EUZ A;  3OPL A;  1C3B A;  1KGE A;  1LI0 A;  5FQI A;  3TG9 A;  3Q7V B;  2WAE A;  3NI9 A;  2C6W B;  2Y2Q A;  4MBH A;  4X6T A;  3FKV A;  1ESU A;  5FAT A;  1PZO A;  3WS4 A;  4KZ7 A;  4S2M A;  1ALQ A;  3V3R A;  3VFH A;  5A93 A;  4BEN A;  3G4P A;  4Y7P A;  2Y2I A;  2FFY A;  2JE5 A;  4E3O A;  4QD4 A;  2XK1 A;  4ZBE A;  3HLB A;  2OLV A;  2XF3 A;  4KZ6 A;  5GLD A;  5CXW A;  3ZG5 A;  4GD8 A;  4Z9Q A;  5G18 A;  2ZC7 A;  1ONG A;  2GDN A;  5EOO A;  1MWU A;  2J7V A;  1RP5 A;  3O87 A;  1YMS A;  4WMC D;  5A91 A;  2IWD A;  4JBF A;  5FAQ A;  3WWX A;  1XPB A;  3LEZ A;  4UAA A;  2EX2 A;  1M40 A;  3UDX A;  3WS2 A;  3BFF A;  3MKF A;  5DTT A;  5CER A;  3MXR A;  4BL3 A;  3BLM A;  4S2O A;  2ZQ9 A;  3HLC A;  5CHJ A;  2WKH A;  3VSL A;  3ITB A;  4OPY A;  4FSF A;  4PM7 A;  3IF5 A;  1H8Y A;  1YLJ A;  2HDR A;  2G2W A;  3IQA A;  4LEN A;  4U3T A;  3FKW A;  3BRM A;  1MXO A;  1NZO A;  4OP8 A;  2B5R A;  3HL9 A;  5TGF A;  2E8I A;  2Q9N A;  4WYY A;  4JXW A;  1K57 A;  1JWP A;  2PU2 A;  2P74 A;  3HLW A;  4IED A;  2A49 A;  3CZD A;  4O7D A;  4S2I A;  5CRF A;  3TSG A;  2DNS A;  3WS0 A;  1I2W A;  1YLW A;  2ZM8 A;  1PYY A;  1HTZ A;  1MWT A;  4LV2 A;  2HP6 A;  1M6K A;  1YM1 A;  3BLS A;  2EX9 A;  1BZA A;  5CGS A;  2R9W A;  4K0X A;  4P87 A;  1NRF A;  3DWK A;  1HVB A;  2Y2G A;  4R4S A;  5TR7 A;  2EXB A;  2ZJ9 A;  1GA0 A;  1FR6 A;  4P85 A;  5AQB A;  1GHP A;  1ZKJ A;  2Y4A A;  1Y54 A;  1GHI A;  3N7W A;  4YIN A;  1IEM A;  1W7F A;  2Y2H A;  3P98 A;  2J9P A;  2ZD8 A;  4QU3 A;  1YQS A;  4EWF A;  3G32 A;  1BLC A;  5E2E A;  2WYX A;  2ZLY A;  1Q2Q A;  3VP1 A;  2WAD A;  5DF9 A;  3N8R A;  3TOI A;  2C5W B;  2JBF A;  2H0Y A;  4F94 A;  4A5R A;  2ZC6 B;  1L2S A;  1GCE A;  3C4O A;  1MWS A;  1SKF A;  4KZ9 A;  1I2S A;  4GNU A;  1ES3 A;  1IKG A;  3GRJ A;  3S4X A;  1ES2 A;  3Q07 A;  5KZH A;  3UE0 A;  1K57 C;  1PWD A;  4QJG A;  2EFX A;  3NDG A;  3HUM A;  1YT4 A;  1XA7 A;  4HEF A;  4OOM A;  4X68 A;  2ZC3 B;  5DTS A;  1KGF A;  4N9K A;  3IHB A;  1W8Y A;  4RYE A;  3RXX A;  1LLB A;  5KSC A;  3P09 A;  3N6I A;  5M19 A;  1Z6F A;  1SHV A;  3MZD A;  1LL5 A;  3NBL A;  2XFS A;  4S2K A;  4IBX A;  1K38 A;  4X53 A;  3ZNT A;  2Y2N A;  4KG2 A;  5AQA A;  4E3K A;  4WZ5 A;  3EQV A;  3Q1F A;  5HAR A;  4MLL A;  1E4D A;  2J9O A;  3GVB A;  3PBQ A;  1K25 A;  2OV5 A;  3UE1 A;  4UHU A;  2VGK A;  3MXS A;  3BFC A;  4MEZ A;  4X55 A;  1HD8 A;  4Y0U A;  2V2F F;  5F83 A;  3WRT A;  2BG1 A;  5FQJ A;  1GA9 A;  2ZC5 B;  2A3U A;  4KZ4 A;  3IWI A;  4R23 A;  1TDG A;  4ZDX A;  3LY4 A;  4GKU A;  4ZJ3 A;  5M1A A;  2FFF B;  5I94 A;  1JVJ A;  4DE2 A;  5HW3 A;  3UPO A;  1MKI A;  3GTC A;  5E43 A;  3PBS A;  1U60 A;  5EOE A;  1SDN A;  2PU4 A;  1HZO A;  2PBY A;  2WGW A;  5HAP A;  5JYO A;  3PAG A;  4NK3 A;  3HLF A;  1FOF A;  1Q2P A;  4N92 A;  4U0T A;  4R3J A;  3FWL A;  1PWG A;  2ZM0 A;  4KQR A;  5CEB A;  2Y59 A;  2Y2M A;  2WGW B;  2WAF A;  2EXA A;  3SH8 A;  3CMZ A;  4C75 A;  2WGV A;  5HL1 A;  1QMF A;  1WE4 A;  4EBN A;  3GSG A;  3E2K A;  1NY0 A;  5FDH A;  4BD1 A;  4OKP A;  4XUZ A;  4B88 A;  4DF6 A;  4KQQ A;  4OQI A;  3EQU A;  4M3K A;  1YMX A;  2Z2L B;  2ZQ7 A;  3UDF A;  2R9X A;  4DE3 A;  3LCE A;  3SS5 A;  3GQZ A;  5A92 A;  3BFE A;  5HAQ A;  1BSG A;  1VM1 A;  5AQ9 A;  4KZ3 A;  1BUE A;  3LY3 A;  4JF6 A;  3OCL A;  2VGJ A;  2ZQD A;  3G30 A;  3O86 A;  3GMW A;  2Y2P A;  3IWO A;  5E2F A;  5FAS A;  3IH8 A;  1IKI A;  4Y0T A;  4OPZ A;  2QPN A;  1KVL A;  4BD0 A;  3I7J A;  3M6B A;  1JWV A;  2Q9M A;  5E2H A;  4R3B A;  3V5M A;  2WZZ A;  2V20 A;  1TEM A;  1KDS A;  5FAP A;  4DDY A;  2HDQ A;  2HDS A;  4GDN A;  5DVA A;  5CED A;  3ZVW A;  1YLT A;  1KE0 A;  1FSW A;  1PIO A;  1G68 A;  4RVA A;  1KDW A;  5CTN A;  3IXH A;  5EPH A;  2X01 A;  4L0L A;  3ZDJ A;  5L2F A;  5E2G A;  2ZMA A;  4LV1 A;  5F1G A;  3QNC A;  4WEJ A;  1LI9 A;  4HBU A;  3VOY A;  3AGE A;  1BUL A;  2Y2K A;  4JKT A;  3E2L A;  2XLN A;  2ZQC A;  1LHY A;  5JYP A;  4KEN B;  4XXR A;  1FCM A;  4PM5 A;  4DE1 A;  4KG6 A;  3MBZ A;  3ZHH A;  1K56 A;  1WYB A;  3N8S A;  2V1Z A;  4E3I A;  3VP0 A;  4GN2 A;  1CEG A;  1SDE A;  4PM9 A;  4BJP A;  1L0D A;  3BEC A;  4K0W A;  1H8Z A;  2H5S A;  3N4I A;  3GR2 A;  3MFD A;  3SS4 A;  3HLG A;  2Y55 A;  1H5X A;  3IWQ A;  3S1Y A;  1K4E A;  1KVM A;  1YLZ A;  1L0E A;  2EX6 A;  3M2J A;  4RX2 A;  1IYQ A;  5GLB A;  1BTL A;  3G31 A;  3GV9 A;  3M6H A;  4R4R A;  4DRT A;  1IYP A;  1W79 A;  2JCH A;  3Q7Z A;  3OZH A;  3S22 A;  4RA7 A;  1BLP A;  5EEC A;  1K54 A;  5EUA A;  4OLG A;  3ZG0 A;  1KE3 A;  3CG5 A;  1K55 A;  4N9L A;  5DTK A;  4JLF A;  1XX2 A;  3PBN A;  4RX3 A;  3HLE A;  3ITA A;  3QNB A;  2X02 A;  1EI5 A;  1O7E A;  4KZ8 A;  3VFF A;  4B4X A;  4EBL A;  2HP5 A;  1L0F A;  1OME A;  5GLC A;  4OLD A;  5GHX A;  3G2Z A;  1WYC A;  3A3D A;  4IBR A;  4QY6 A;  3SS3 A;  2CC1 A;  4MBF A;  1DJA A;  1DY6 A;  4X56 A;  1CEF A;  2XD5 A;  3IXG A;  3OPH A;  4JF4 A;  3BFG A;  5HFO A;  3SOI A;  3C4P A;  1ES4 A;  4OOY A;  4UA7 A;  2XQZ A;  4FCF A;  3MKE A;  3ZG8 B;  1XGJ A;  2XGN A;  1W5D A;  4LCM A;  3HRE A;  3V3S A;  2Y2L A;  2XD1 A;  1S0W A;  1NJ4 A;  5EVI D;  1FCO A;  5CTM A;  3V50 A;  3VP4 A;  4KZB A;  1JTG A;  3IXD A;  1PW1 A;  1XKZ A;  3C7V A;  4UA9 A;  3VP2 A;  1BT5 A;  1K54 C;  2WK0 A;  3C5A A;  3WS1 A;  1K55 C;  3Q81 A;  3A3I A;  4NET A;  4QB8 A;  2IWB A;  1NXY A;  3MZF A;  3A3F A;  3RXW A;  3PTE A;  4OPR A;  1L0G A;  3AGF A;  3IF6 A;  4E6X A;  3ZGA B;  4U0X A;  1PI4 A;  3CJM A;  1ES5 A;  3VOZ A;  3DTM A;  2HDU A;  3ZNY A;  1FSY A;  1ERM A;  2EFU A;  4EQI A;  3ZVT A;  3B3X A;  4E3J A;  5EE8 A;  3IF6 B;  2ZQ8 A;  4OQH A;  3BYD A;  5D3O A;  4OP5 A;  1ONH A;  5GLA A;  1DJB A;  1N4O A;  4N1H A;  4S2N A;  4B4Z A;  1K56 D;  1XGI A;  3M2K A;  1RGZ A;  4FH2 A;  2UWX A;  5M18 A;  3W8K A;  1RCJ A;  5U47 A;  4ZTK A;  4PM8 A;  1J9M A;  1KE4 A;  4CPK A;  3O3V A;  5FQM A;  4C6Y A;  1ERQ A;  2DRW A;  2DCF A;  4IVK A;  2H0T A;  3Q7V A;  5CEC A;  4XUX A;  2WGI A;  4WZ5 C;  2Z2M B;  3PBT A;  4PM6 A;  4S2J A;  1TDL A;  4GOG A;  3SH7 A;  2RL3 A;  4JXG A;  3DW0 A;  3HUN A;  5CGX A;  4PPR A;  3A3J A;  1LL9 A;  5FQ9 A;  4DDS A;  3UY6 A;  4Y0O A;  1E3U A;  2JC7 A;  5FSR A;  2HP9 A;  4KG5 A;  3ZCZ A;  3NCK A;  5EVI A;  1CI8 A;  2OLU A;  5KMW A;  1EWZ A;  3HBR A;  1ZC2 A;  3SH9 A;  4E6W A;  3PBR A;  3OPP A;  3G34 A;  3IF6 C;  1NYY A;  5GL9 A;  3ZG9 B;  1CI9 A;  4S2L A;  5EVI B;  2Y91 A;  3IT9 A;  4MBK A;  3C7U A;  4C3Q A;  3UN7 A;  2QMI A;  5HAI A;  2QZ6 A;  3A3E A;  3ZG7 B;  3OCN A;  3UDI A;  5FQQ A;  3FV7 A;  1ZG4 A;  2I72 A;  1NYM A;  3MZE A;  4GZB A;  4YFM A;  1MY8 A;  4UA6 A;  3HVF A;  4S2N C;  4OON A;  4WM9 A;  4OOL A;  2P9V A;  5DF7 A;  3VMA A;  3O88 A;  4P6B A;  4ZJ1 A;  3OC2 A;  3UNW A;  4JPM A;  5HX9 A;  2P9V B;  2G2U A;  2Y2O A;  1RGY A;  1AXB A;  2Y2J A;  5FA7 A;  4KZA A;  4HBT A;  3UPP A;  3HLD A;  5GHZ A;  3W4O A;  5CHM A;  1I5Q A;  2WZX A;  3LO7 A;  5FI2 A;  4DE0 A;  3N8L A;  1FR1 A;  1NZU A;  1ERO A;  4FH4 A;  3UO9 A;  3VSK A;  3PBO A;  1BLH A;  3BFD A;  4QHC A;  4OH0 A;  4S2P A;  5EVI C;  4LV3 A;  4ZAM A;  3JYI A;  3UPN A;  4LV0 A;  5KSH A;  1E25 A;  1ESI A;  4E3M A;  4JF5 A;  5EVL A;  4E3L A;  2HPB A;  4WBG A;  4IVI A;  3WRZ A;  4X69 A;  5CHU A;  1QME A;  2IWC A;  3G2Y A;  3NC8 A;  4LCL A;  1MPL A;  4OVD A;  3ZFZ A;  4WEL A;  3V39 A;  3W4Q A;  5A90 A;  1K4F A;  1PI5 A;  4H8R A;  1XP4 A;  3BM6 A;  1IYO A;  2WKI A;  3UE3 A;  3D4F A;  1S6R A;  1XXM A;  4FD8 A;  4WMC A;  2XR0 A;  3IH9 A;  1IEL A;  5BOH A;  1N9B A;  4N1X A;  1YLY A;  1PWC A;  5GHY A;  4KZ5 A;  2WKE A;  3OPR A;  5FI7 A;  1O07 A;  1YLP A;  1ZG6 A;  4EBP A;  3WS5 A;  4D2O A;  5IHV A;  1MWR A;  1JTD A;  4Q8I A;  4JXV A;  3IHA A;  2XH9 A;  2EX8 A;  2OSU A;  3PAE A;  4KQO A;  3NIA A;  5J8X A;  1MBL A;  1CK3 A;  3NDE A;  5CGW A;  1G6A A;  1TVF A;  1E3U D;  3W4P A;  2ZM2 A; 
#chains in the Genus database with same CATH topology
 1TD5 A;  4OQG A;  1KGG A;  2ZC4 B;  5FDS A;  3KYE A;  3BEB A;  2ZQA A;  5F82 A;  4WEK A;  2L1M A;  3FPW A;  2H10 A;  1YSQ A;  5L10 A;  2XFT A;  3S7P A;  4BL2 A;  3AGD A;  2VKS A;  1W8Q A;  5A8B A;  1JNU A;  2V9A A;  2X71 A;  4HES A;  3VP3 A;  5AQ7 A;  4GD6 A;  4EUZ A;  3A0R A;  3TG9 A;  3T1S A;  2C6W B;  4FUW A;  1ESU A;  5FAT A;  4CLC E;  1ALQ A;  3BJN A;  2FFY A;  4QD4 A;  1BYW A;  3ZG5 A;  2VV7 A;  4GD8 A;  2ZC7 A;  3HJK A;  5EOO A;  2J7V A;  4JBF A;  4UAA A;  3UDX A;  3BFF A;  5DTT A;  3MXR A;  4BL3 A;  3BLM A;  4S2O A;  3T1X A;  3HLC A;  2QJ5 A;  4PAU A;  3VSL A;  2WKQ A;  4FSF A;  4PM7 A;  3IF5 A;  4G3V A;  1YLJ A;  3IQA A;  4U3T A;  3FKW A;  4GHI B;  3LR4 A;  1G5U A;  1LL8 A;  3R7W B;  3LIF A;  4WYY A;  1K57 A;  1NRJ A;  3DAV A;  4O7D A;  3CZD A;  5G4Z A;  2ZM8 A;  1YLW A;  1MWT A;  4EU0 A;  1YM1 A;  1HVB A;  2Y2G A;  2Z6C A;  2EXB A;  1A0K A;  2ZJ9 A;  4P85 A;  1GHP A;  1ZKJ A;  1Y54 A;  1IEM A;  1W7F A;  3TE8 A;  2XSS A;  2WYX A;  3VP1 A;  3QP4 A;  2C5W B;  4F94 A;  4GCZ A;  1L2S A;  1GCE A;  1MWS A;  4KUO A;  5LBR A;  2W3G A;  1IKG A;  1ES2 A;  3Q07 A;  3UE0 A;  1PWD A;  3HUM A;  4WF0 A;  2ZC3 B;  3IS2 B;  1KGF A;  4N9K A;  1Z6F A;  4ME4 A;  1LL5 A;  4Y13 A;  2XFS A;  4IBX A;  1LSV A;  2Y2N A;  4KG2 A;  4E3K A;  2WKP A;  3MR0 A;  3UE1 A;  5J7E A;  3KO6 A;  4MEZ A;  2ZC5 B;  2A3U A;  3BQ8 A;  3LY4 A;  4DE2 A;  2P04 A;  5EOE A;  3EEA A;  4I39 A;  5TBM B;  1S1Y A;  3A0S A;  3ZYT A;  3HLF A;  2HZ5 A;  2Y2M A;  2WAF A;  3CMZ A;  1QMF A;  4EBN A;  1NY0 A;  3BWL A;  5FDH A;  4OQI A;  2ZOI A;  4M3K A;  1YMX A;  3B47 A;  3UDF A;  4DE3 A;  3LCE A;  3SS5 A;  5A92 A;  5HAQ A;  4KZ3 A;  5E2F A;  1V9Y A;  1IKI A;  1DP8 A;  3I7J A;  1ZHH B;  2PR5 A;  2WZZ A;  2PD8 A;  2V20 A;  1KDS A;  4HY8 A;  1KE0 A;  1G68 A;  3IXH A;  2WKR A;  3HCY A;  4LV1 A;  3LIB A;  4HIA A;  4JGP A;  1LI9 A;  4HBU A;  3VOY A;  3VV4 A;  1BUL A;  3E2L A;  2XLN A;  2ZQC A;  1LHY A;  3BW6 A;  1FCM A;  2D02 A;  1VEU A;  3MBZ A;  1WYB A;  5CX7 A;  4E3I A;  4R38 A;  1L0D A;  1W63 Q;  3BEC A;  3RH8 B;  3TW8 A;  3IBR A;  2Y55 A;  1H5X A;  3S1Y A;  1KVM A;  4RX2 A;  3GV9 A;  2JCH A;  3EGD C;  1K54 A;  1KE3 A;  4JLF A;  3PBN A;  3ITA A;  3QNB A;  5I5L A;  4EBL A;  5DJU A;  2HP5 A;  4HOI A;  1OME A;  1XJ4 A;  3G2Z A;  1WYC A;  3SS3 A;  4EUV A;  3DTE A;  2XRN A;  4MBF A;  1G6O A;  1DY6 A;  1CEF A;  3IXG A;  3SOI A;  5HFO A;  3BFG A;  5DKL A;  2JHE A;  4OOY A;  3E0Y A;  4FCF A;  3MKE A;  2XGN A;  2O9A A;  3VP4 A;  4KZB A;  1JTG A;  1PW1 A;  1N9N A;  1HLU P;  3F1O A;  3WS1 A;  4IUK A;  1K55 C;  2I9V A;  3PTE A;  4OPR A;  4E6X A;  3ZGA B;  1PI4 A;  1ERM A;  2EFU A;  3ZVT A;  3LR3 A;  4HHD A;  2ZQ8 A;  4OP5 A;  4I3J A;  1ONH A;  5GLA A;  5EV0 A;  5M18 A;  1RGZ A;  1CJF A;  4CPK A;  4CLC A;  1J9M A;  1ERQ A;  2DRW A;  5CEC A;  4CLC B;  4PM6 A;  4S2J A;  1TDL A;  2RL3 A;  2W3H A;  2YKH A;  3HUN A;  4DDS A;  4Y0O A;  3LR5 A;  1T1A A;  4KG5 A;  3A0V A;  3QP1 A;  4E6W A;  3SH9 A;  3PBR A;  3OPP A;  5GL9 A;  2Y91 A;  3IT9 A;  2FZ0 A;  3MQO A;  5FQQ A;  1NYM A;  4OOL A;  3MXQ A;  3O88 A;  5HPI A;  3B33 A;  2G2U A;  2A24 A;  5FA7 A;  3HLD A;  5GHZ A;  2WZX A;  3CUE C;  4DE0 A;  2A24 B;  3UB8 A;  3UO9 A;  3PBO A;  1E25 A;  4IVI A;  1QME A;  3G2Y A;  3QP5 A;  1TF1 A;  2PT7 A;  4WEL A;  3V39 A;  3W4Q A;  1PI5 A;  4II7 A;  1EW0 A;  4H8R A;  1XP4 A;  3LIE A;  1LSX A;  3BM6 A;  2WKI A;  1S6R A;  1XXM A;  2VZW A;  2HF6 A;  4FTX A;  5L07 A;  3NOP C;  2W1T B;  4R3A A;  2P08 A;  4KQO A;  3NIA A;  4IUH A;  1MBL A;  1CK3 A;  5CGW A;  1G6A A;  1IOU A;  4MN5 A;  1E3U D;  5TR7 A;  3MQ0 A;  3PBT A;  3W4P A;  1PZP A;  3HUO A;  3OOV A;  1VQQ A;  1ACF A;  1FCN A;  4BQM A;  5DFY A;  1DJC A;  1Y28 A;  3CIT A;  4R1G A;  1KOU A;  2VGL S;  4MN7 A;  4ID4 A;  1K6S A;  2PYR A;  4E3N A;  5TFQ A;  1FQG A;  1CQA A;  5FL3 A;  2J8Y A;  4HQA A;  1OTA A;  1C3B A;  3UB5 P;  2XA7 M;  3Q7V B;  2ZMV A;  3FKV A;  4KZ7 A;  3V3R A;  4BEN A;  4Y7P A;  3T4Q A;  4B93 A;  2JE5 A;  3HLB A;  2V0W A;  2OLV A;  2XF3 A;  5GLD A;  5L09 A;  2PRF A;  4ETZ A;  4WMC D;  5A91 A;  2IWD A;  4HJ4 A;  5FAQ A;  1XPB A;  1H3Q A;  3MKF A;  5F69 A;  2W3D A;  4H6J A;  4Q0J A;  4LEN A;  1MXO A;  4H6J B;  2E8I A;  2P74 A;  3HLW A;  3TSG A;  1X0O A;  2GNX A;  2HP6 A;  3BLS A;  2EX9 A;  5CGS A;  2R9W A;  3U2A A;  4P87 A;  1NRF A;  3DWK A;  1GA0 A;  4HH2 A;  5AQB A;  2Y4A A;  1UWP X;  4YIN A;  2Y2H A;  5HSQ A;  2INW A;  1YQS A;  4EWF A;  4EEP A;  1P0Z A;  2ZLY A;  3KYZ A;  2ZC6 B;  4O01 A;  3NJA A;  3GRJ A;  4D60 A;  5KZH A;  2L4R A;  2EFX A;  3NDG A;  1YT4 A;  1XA7 A;  4OOM A;  3LID A;  3IHB A;  3RXX A;  3CWF A;  3PXP A;  3D72 A;  3P09 A;  3IX4 A;  3UB6 A;  3NBL A;  1CF0 A;  4X53 A;  3D9Y A;  5AQA A;  1MC0 A;  4MLL A;  1E4D A;  4WLA A;  1NWZ A;  3GVB A;  3BFC A;  4MCW A;  4X55 A;  5F83 A;  2V2F F;  1OTE A;  1PNE A;  4R23 A;  1TDG A;  4GKU A;  4EW7 A;  3S7O A;  5HW3 A;  3IX8 A;  1U60 A;  1SDN A;  2PU4 A;  1HZO A;  5HAP A;  1YAX A;  5JYO A;  1H0M A;  4G3W A;  5HZH A;  4KQR A;  2VK3 A;  2Y59 A;  2EXA A;  1OTB A;  2VA0 A;  5HL1 A;  3T4T A;  4BD1 A;  2M7U A;  4OKP A;  1N9L A;  3JVU A;  4XUZ A;  4B88 A;  2XA7 S;  3UB9 A;  3F1N A;  4IHQ A;  2R9X A;  3VE3 A;  1BSG A;  1BUE A;  4JF6 A;  3OCL A;  3O86 A;  4UEY A;  4OPZ A;  2Q9M A;  5HDD A;  1TEM A;  5FAP A;  2HDQ A;  5DVA A;  3ZVW A;  1YLT A;  1FSW A;  4RVA A;  4BWI A;  2NUP C;  4BBU A;  2Y2K A;  5HD5 A;  2NUT C;  3DTI A;  4KEN B;  4XXR A;  4DE1 A;  3N8S A;  4NG2 A;  1SDE A;  4PM9 A;  3LUQ A;  2H5S A;  3RFB A;  1D06 A;  5GLB A;  2EX6 A;  1IYQ A;  3M6H A;  1IYP A;  3Q7Z A;  4NXG A;  1DRM A;  1D1J A;  3ZG0 A;  3CG5 A;  2O99 A;  5DTK A;  3IX3 A;  4I5S A;  4RX3 A;  3HLE A;  4K08 A;  3NOT C;  4YNR A;  4OLD A;  2PDR A;  3QP2 A;  4IBR A;  3MS6 A;  2OAQ 1;  4JF4 A;  3OPH A;  1ES4 A;  1ZTU A;  2B02 A;  1V9Z A;  2Y2L A;  4GLQ A;  5CTM A;  2V8F A;  1XKZ A;  3C5A A;  2XRO A;  3Q81 A;  1YKD A;  4QB8 A;  5HPF A;  5EVE A;  1F2K A;  1NXY A;  3A3F A;  3LFV A;  1XJ6 A;  4HI4 A;  3IF6 A;  3DTM A;  2HDU A;  3ZNY A;  4EQI A;  3VOL A;  3IF6 B;  4MDZ A;  4F3L A;  1DJB A;  1N4O A;  4S2N A;  4B4Z A;  1K56 D;  4F3L B;  4PKY A;  5FQM A;  2H0T A;  4XUX A;  3SH7 A;  5CGX A;  4PPR A;  1LL9 A;  5FQ9 A;  2J3T C;  5HL6 A;  2HP9 A;  2ZOH A;  3NCK A;  5EVI A;  2OLU A;  1EWZ A;  3ZG9 B;  4IJG A;  5EVI B;  4DJ2 A;  3C7U A;  4C3Q A;  3UN7 A;  2QZ6 A;  3JVV A;  1F98 A;  3ZG7 B;  3LIC A;  3U4L P;  3UDI A;  1ZG4 A;  4GZB A;  5F5Y A;  4YFM A;  2IA2 A;  4UA6 A;  1OT9 A;  3LI8 A;  4WM9 A;  2P9V A;  2J3W A;  4ZJ1 A;  2GZA A;  5HX9 A;  2P9V B;  2D01 A;  3C38 A;  1AXB A;  4HBT A;  3W4O A;  5CHM A;  1VEU B;  3EOI A;  3N8L A;  5F6A A;  2J3T D;  4PKY G;  3BFD A;  4S2P A;  3JYI A;  1ESI A;  4ARZ A;  2M7V A;  2UV0 E;  5J3W A;  3NEC A;  4ARZ B;  1VB6 A;  2QYB A;  5IU1 A;  1K4F A;  2V8C A;  3UE3 A;  3D4F A;  1D7E A;  4FD8 A;  2XR0 A;  3IH9 A;  5BOH A;  1N9B A;  2JKT I;  1PWC A;  1W63 M;  4Z1W A;  4ESP A;  5FI7 A;  1YLP A;  1WA9 A;  4D2O A;  1JTD A;  4JXV A;  3T4O A;  4JGO A;  3NDE A;  1T1B A;  3ULF A;  2VJW A;  1GSX A;  3QP8 A;  1PW8 A;  4R0Q A;  3UME A;  2RCX A;  2XEP A;  5FI6 A;  1SCW A;  3CI6 A;  1IYS A;  2V0U A;  3G35 A;  3NY4 A;  2BLS A;  3QHY A;  4DN0 A;  1XA1 A;  3F1O B;  1K0K A;  3DWZ A;  4NXE A;  1YPR A;  4JXS A;  1BLS A;  2CMN A;  4HJ3 A;  4OQ0 A;  4KUK A;  4DXB A;  4PMA A;  1JWZ A;  3CPT A;  4QY5 A;  4MNR A;  3RJU A;  3W2Z A;  3CPT B;  4Q0H A;  3FC7 A;  4DKI A;  4GB7 A;  4P0M A;  3TRC A;  1N9O A;  3OPL A;  4M4X A;  1KGE A;  1J3W A;  1LI0 A;  5FQI A;  4MBH A;  3WS4 A;  2Q0O A;  1PZO A;  1LT0 A;  4S2M A;  5DKK A;  3DBA A;  3G4P A;  2Y2I A;  4E3O A;  4ZBE A;  3UMD A;  4KZ6 A;  5G18 A;  2GDN A;  1MWU A;  3O87 A;  1YMS A;  2EX2 A;  1M40 A;  3WS2 A;  4FOF A;  3L9K A;  5CER A;  4LRX C;  4L9G A;  2ZQ9 A;  4MMN A;  3KSF A;  2R78 A;  2EWW A;  2WKH A;  3ITB A;  2A2L A;  3MSH A;  3P01 A;  3T4K A;  3BRM A;  4GJ4 A;  4WL9 A;  2B5R A;  5TGF A;  3FPV A;  4JXW A;  2PAV P;  4S2I A;  5CRF A;  2A49 A;  1PYY A;  4LV2 A;  1M6K A;  2M1C A;  1BZA A;  4R4S A;  3EWK A;  2PYP A;  4HP9 A;  1GSW A;  3P98 A;  2ZD8 A;  4QU3 A;  5IT5 A;  3G32 A;  1IFQ A;  5E2E A;  2WAD A;  5DF9 A;  3TOI A;  1YSP A;  4EER A;  2JBF A;  2H0Y A;  2KDK A;  4CQH A;  1SKF A;  4KZ9 A;  1I2S A;  4GS9 A;  2ZL1 A;  3S4X A;  3GEC A;  1K57 C;  4QJG A;  4GS9 B;  2JKR I;  5DTS A;  1W8Y A;  1LLB A;  2JN7 A;  5KIZ A;  5M19 A;  1SHV A;  3JPU A;  1K38 A;  1P97 A;  3Q1F A;  5HAR A;  2J9O A;  3PBQ A;  4UHU A;  2VGK A;  4Y0U A;  1HD8 A;  1Z09 A;  4KZ4 A;  2PBD P;  3IWI A;  4ZDX A;  4Y5F A;  5I94 A;  1JVJ A;  1MKI A;  5E43 A;  4HH3 A;  5EM1 A;  4KQD A;  2PBY A;  3PAG A;  1Q2P A;  4U0T A;  3V67 A;  4R3J A;  2OAP 1;  1PWG A;  2ZM0 A;  3C2W A;  5FEF A;  3SH8 A;  2BAS A;  2WGV A;  3S7Q A;  5FEG A;  3LYX A;  3GSG A;  3E2K A;  4Y17 A;  2JKF A;  2Z2L B;  2ZQ7 A;  4XT2 A;  3GQZ A;  4EES A;  5AQ9 A;  1VM1 A;  3LY3 A;  2VGJ A;  3G30 A;  4XT2 B;  3GMW A;  5FAS A;  3G6O A;  3IH8 A;  3ZQ5 A;  4Y0T A;  2ACG A;  2VV8 A;  1JWV A;  4R3B A;  2JKT M;  4DDY A;  2HDS A;  4GDN A;  5CED A;  4BMW A;  3R4K A;  3T4J A;  1PIO A;  4EXO A;  1FIK A;  4R6L A;  1KDW A;  5CTN A;  5EPH A;  2X01 A;  5L2F A;  1F5M A;  2AVX A;  3AGE A;  4JKT A;  1DP6 A;  1TS8 A;  3K3D A;  4PM5 A;  5L8M A;  5HWW A;  4BBT A;  5EFW A;  3ZHH A;  4GN2 A;  4BJP A;  2W27 A;  1S67 L;  3GR2 A;  2PR6 A;  3HLG A;  1YLZ A;  3OBF A;  1L0E A;  3M2J A;  2P7J A;  4DRT A;  1BTL A;  3G31 A;  3T12 B;  1W79 A;  5EUA A;  4OLG A;  3SW1 A;  1K55 A;  2LB9 A;  1XJ2 A;  1XFN A;  5K5B A;  4KZ8 A;  1EI5 A;  4QWO A;  2VX8 A;  1L0F A;  5GLC A;  2QWS A;  5GHX A;  2Z6D A;  1DJA A;  3C4P A;  5AJG A;  1XGJ A;  3C30 A;  3V3S A;  3HRE A;  2XD1 A;  5G4Y A;  2HGV A;  1NJ4 A;  5EVI D;  3BY8 A;  1OPX A;  3IXD A;  3C7V A;  3VP2 A;  1K54 C;  2WK0 A;  2GJ3 A;  3A3I A;  1T1C A;  3MZF A;  5DJT A;  3AGF A;  3CJM A;  1ES5 A;  4L9E A;  4ZRR A;  3VOZ A;  4R70 A;  1FSY A;  3B3X A;  5D3O A;  2O9B A;  3ICY A;  3H7W A;  3M2K A;  4FH2 A;  4RQ9 A;  2UWX A;  1KE4 A;  3O3V A;  3PR6 A;  2DCF A;  4IVK A;  3H7W B;  3D3O A;  2WGI A;  4WZ5 C;  4GW9 A;  2Z2M B;  3LEQ A;  4JXG A;  3GDI A;  3CAX A;  3A3J A;  3F1N B;  3CUE A;  1OTD A;  3UY6 A;  1UGU A;  3HJI A;  1E3U A;  5FSR A;  3PHY A;  1CI8 A;  2EA9 A;  5KMW A;  3HBR A;  1UWN X;  3G34 A;  4E04 A;  3EEH A;  4Q0I A;  3OCN A;  2I72 A;  3MZE A;  1MY8 A;  4X1M A;  1OJG A;  5DF7 A;  4P6B A;  4CLC C;  5AVE A;  4JPM A;  1NLY A;  3T4S A;  2O0Y A;  2JKR M;  4GHI A;  2Y2J A;  4PHT A;  3UB7 A;  1P9R A;  3R7W A;  1I5Q A;  3LO7 A;  5FI2 A;  3EGX C;  2GX5 A;  3VSK A;  5HDS A;  3CLO A;  3OLO A;  4QHC A;  5KSH A;  4ZAM A;  4LV0 A;  2YKF A;  2W3F A;  4JF5 A;  5EVL A;  4E3L A;  2HPB A;  4WBG A;  2OWJ A;  2HJE A;  3NC8 A;  5A90 A;  1GSV A;  1H8M A;  3LI9 A;  4WUJ A;  1OJ5 A;  4WMC A;  3T1Q B;  1IEL A;  3H9W A;  4N1X A;  4CLC D;  5GHY A;  4KZ5 A;  4EBP A;  3WS5 A;  5IHV A;  1MWR A;  3IHA A;  5TJJ A;  1L3L A;  2EX8 A;  2OSU A;  4DJ3 A;  5J8X A;  1AWI A;  1PRQ A;  1TS0 A;  4NKP A;  1TVF A;  1T18 A;  2ZM2 A;  1L0G A;  5F1F A;  3IS2 A;  4O8G A;  3S7N A;  4CJN A;  3BQA A;  5C5K A;  4EV4 A;  2B18 A;  3IXB A;  4OPQ A;  1GHM A;  5FQK A;  2WUQ A;  5FAO A;  4LRZ E;  2PD7 A;  1MZU A;  4HNB A;  3F1P A;  4K91 A;  5DF8 A;  4GDB A;  4DXC A;  3F1P B;  4LLO B;  2W1R A;  3FYZ A;  4BLM A;  4WZ4 A;  2O9C A;  3FZC A;  1S4S A;  1TS6 A;  2EWV A;  3Q82 A;  1K6R A;  3NHQ A;  4ZJ2 A;  5TBM A;  4MN6 A;  3RTY A;  3ISG A;  3KYQ A;  3L7H A;  2XDM A;  1DP9 A;  2ZBB A;  5HWT A;  2WAE A;  3NI9 A;  4X6T A;  2Y2Q A;  1XFQ A;  4UQI M;  3VFH A;  5A93 A;  2W3E A;  2XK1 A;  3E4P A;  5CXW A;  4Z9Q A;  3KSI A;  2VLG A;  2OOL A;  1ONG A;  1RP5 A;  3K2N A;  3LGO A;  3WWX A;  3LEZ A;  4BBV A;  3E4O A;  4B9O A;  3NUL A;  5CHJ A;  4O0P A;  4OPY A;  1H8Y A;  2V1A A;  2HDR A;  2G2W A;  2FH5 A;  1NZO A;  4OP8 A;  3HL9 A;  2Q9N A;  1JWP A;  2PU2 A;  4IED A;  4P6Z M;  2DNS A;  3WS0 A;  1I2W A;  1HTZ A;  2KX6 A;  1OTI A;  4K0X A;  4YWZ A;  1FR6 A;  1GHI A;  3N7W A;  2QHK A;  2J9P A;  1BLC A;  1LSW A;  1Q2Q A;  2KLI A;  4EQ1 A;  3N8R A;  1SZV A;  4A5R A;  1S4R A;  3C4O A;  4GNU A;  1ES3 A;  1STZ A;  5F68 A;  1OT6 A;  4HEF A;  3MF0 A;  3QP6 A;  4X68 A;  5IS1 A;  2LB5 A;  4RYE A;  4YOF A;  2DMW A;  5KSC A;  3N6I A;  3IBJ A;  3MZD A;  2K31 A;  2JKG A;  4S2K A;  4EEU A;  3ZNT A;  2VGL M;  4WZ5 A;  3EQV A;  2K7S A;  4Y3I A;  1K25 A;  2OV5 A;  3MXS A;  3KSG A;  3WRT A;  4I3I A;  1NLZ A;  2BG1 A;  1GA9 A;  5FQJ A;  3SZT A;  2HV1 A;  4ZJ3 A;  5M1A A;  2FFF B;  3UPO A;  3GTC A;  3PBS A;  3C8C A;  2WGW A;  2MJ6 A;  1PFL A;  3NOU C;  4NK3 A;  3T4L A;  1FOF A;  4N92 A;  3FWL A;  5CEB A;  2WGW B;  4C75 A;  3KX0 X;  1S66 L;  1WE4 A;  3T1R A;  5MC7 A;  4Y2F A;  4DF6 A;  4KQQ A;  3EQU A;  5J4E A;  4AFI A;  3BFE A;  2BTF P;  4NEE D;  4JGQ A;  4UQI S;  2ZQD A;  2Y8H A;  3T50 A;  2Y2P A;  3IWO A;  3LIA A;  1SKO A;  1G28 A;  2QPN A;  1VHM A;  1KVL A;  4LGW A;  4BD0 A;  3M6B A;  5E2H A;  3V5M A;  2VV6 A;  4X1L A;  1P9W A;  4I3A A;  5HD3 A;  4ETX A;  5HWV A;  1SKO B;  3DTK A;  3ZDJ A;  4L0L A;  3CHW P;  5E2G A;  2ZMA A;  5F1G A;  3QNC A;  4WEJ A;  4EET B;  4Y15 A;  4LPZ A;  5JYP A;  1FIL A;  4KG6 A;  1K56 A;  2QJ7 A;  3BY9 A;  2V1Z A;  1MKM A;  3VP0 A;  1CEG A;  4K0W A;  1H8Z A;  3N4I A;  3MFD A;  3SS4 A;  3IWQ A;  1K4E A;  1XJ3 A;  4P6Z S;  4R4R A;  2PHY A;  4NXB A;  3OZH A;  3S22 A;  4RA7 A;  1BLP A;  5EEC A;  2OWH A;  4N9L A;  1XX2 A;  2W1T A;  3VFF A;  4B4X A;  2X02 A;  1O7E A;  3P7N A;  3PYP A;  3A3D A;  4QY6 A;  2CC1 A;  3E4Q A;  2ZL1 B;  4X56 A;  2XD5 A;  4UA7 A;  2XQZ A;  2QKP A;  3MJQ A;  3ZG8 B;  2V1B A;  1VET A;  4I38 A;  1W5D A;  4LCM A;  1S0W A;  1FCO A;  3V50 A;  4UA9 A;  1BT5 A;  1VET B;  4DMZ A;  2HJ9 C;  4NXF A;  4NET A;  2IWB A;  3RXW A;  3UE6 A;  4U0X A;  1F9I A;  4E3J A;  3VE4 A;  5EE8 A;  2L0W A;  4OQH A;  1S1Z A;  4G3K A;  3BYD A;  2VEA A;  2H28 A;  4N1H A;  1XGI A;  3W8K A;  1RCJ A;  5U47 A;  4ZTK A;  4PM8 A;  4C6Y A;  3Q7V A;  3H82 A;  4HJ6 A;  5EM0 A;  5HDC A;  4X25 A;  1TS7 A;  4GOG A;  4LRY C;  3DW0 A;  3MMH A;  3H82 B;  2G7U A;  3K3C A;  2JC7 A;  2ZMF A;  3LR0 A;  3ZCZ A;  1ZC2 A;  4WN5 A;  2B95 A;  3IF6 C;  1Y4O A;  4L9F A;  1NYY A;  3E98 A;  1CI9 A;  4S2L A;  3MFX A;  5AVF A;  4MBK A;  2QMI A;  5HAI A;  3A3E A;  3FV7 A;  3HVF A;  4S2N C;  4OON A;  3VMA A;  2W0N A;  3OC2 A;  3UNW A;  1ODV A;  4HP4 A;  2Y2O A;  1RGY A;  3B42 A;  4KZA A;  3UPP A;  1FR1 A;  1NZU A;  1ERO A;  4FH4 A;  3KSH A;  1BLH A;  4OH0 A;  5EVI C;  4LV3 A;  3UPN A;  3TJZ C;  3MQQ A;  4E3M A;  2KOI A;  2K2N A;  3WRZ A;  4X69 A;  5CHU A;  2IWC A;  4LCL A;  2Y79 A;  1MPL A;  4OVD A;  3ZFZ A;  4QPR A;  4LFU A;  1IYO A;  1T19 A;  1YLY A;  2WKE A;  3OPR A;  2J80 A;  1O07 A;  1ZG6 A;  2E8J A;  4Q8I A;  3O5Y A;  2XH9 A;  5DFX A;  3PAE A;  3FG8 A;  4JGR A; 
#chains in the Genus database with same CATH homology
 5F1F A;  1PZP A;  3HUO A;  1PW8 A;  4OQG A;  1VQQ A;  4R0Q A;  4CJN A;  2RCX A;  2XEP A;  5FI6 A;  4EV4 A;  3IXB A;  1FCN A;  1GHM A;  4OPQ A;  4BQM A;  1KGG A;  2ZC4 B;  1SCW A;  1IYS A;  5FQK A;  2WUQ A;  3BEB A;  2ZQA A;  3G35 A;  5FAO A;  3NY4 A;  2BLS A;  1DJC A;  3QHY A;  5F82 A;  4R1G A;  4WEK A;  1XA1 A;  3DWZ A;  4K91 A;  5DF8 A;  4JXS A;  4GDB A;  1BLS A;  4DXC A;  4OQ0 A;  4ID4 A;  2H10 A;  1K6S A;  4DXB A;  4PMA A;  1JWZ A;  2XFT A;  4E3N A;  4QY5 A;  4BL2 A;  4MNR A;  3RJU A;  3FYZ A;  3AGD A;  4BLM A;  5TFQ A;  4WZ4 A;  1FQG A;  3FZC A;  1W8Q A;  3Q82 A;  4DKI A;  1K6R A;  4GB7 A;  4ZJ2 A;  4P0M A;  3ISG A;  2X71 A;  4HES A;  2J8Y A;  3VP3 A;  5AQ7 A;  2XDM A;  4GD6 A;  4EUZ A;  3OPL A;  1C3B A;  1KGE A;  1LI0 A;  5FQI A;  3TG9 A;  3Q7V B;  2WAE A;  3NI9 A;  2C6W B;  2Y2Q A;  4MBH A;  4X6T A;  3FKV A;  1ESU A;  5FAT A;  1PZO A;  3WS4 A;  4KZ7 A;  4S2M A;  1ALQ A;  3V3R A;  3VFH A;  5A93 A;  4BEN A;  3G4P A;  4Y7P A;  2Y2I A;  2FFY A;  2JE5 A;  4E3O A;  4QD4 A;  2XK1 A;  4ZBE A;  3HLB A;  2OLV A;  2XF3 A;  4KZ6 A;  5GLD A;  5CXW A;  3ZG5 A;  4GD8 A;  4Z9Q A;  5G18 A;  2ZC7 A;  1ONG A;  2GDN A;  5EOO A;  1MWU A;  2J7V A;  1RP5 A;  3O87 A;  1YMS A;  4WMC D;  5A91 A;  2IWD A;  4JBF A;  5FAQ A;  3WWX A;  1XPB A;  3LEZ A;  4UAA A;  2EX2 A;  1M40 A;  3UDX A;  3WS2 A;  3BFF A;  3MKF A;  5DTT A;  5CER A;  3MXR A;  4BL3 A;  3BLM A;  4S2O A;  2ZQ9 A;  3HLC A;  5CHJ A;  2WKH A;  3VSL A;  3ITB A;  4OPY A;  4FSF A;  4PM7 A;  3IF5 A;  1H8Y A;  1YLJ A;  2HDR A;  2G2W A;  3IQA A;  4LEN A;  4U3T A;  3FKW A;  3BRM A;  1MXO A;  1NZO A;  4OP8 A;  2B5R A;  3HL9 A;  5TGF A;  2E8I A;  2Q9N A;  4WYY A;  4JXW A;  1K57 A;  1JWP A;  2PU2 A;  2P74 A;  3HLW A;  4IED A;  2A49 A;  3CZD A;  4O7D A;  4S2I A;  5CRF A;  3TSG A;  2DNS A;  3WS0 A;  1I2W A;  1YLW A;  2ZM8 A;  1PYY A;  1HTZ A;  1MWT A;  4LV2 A;  2HP6 A;  1M6K A;  1YM1 A;  3BLS A;  2EX9 A;  1BZA A;  5CGS A;  2R9W A;  4K0X A;  4P87 A;  1NRF A;  3DWK A;  1HVB A;  2Y2G A;  4R4S A;  5TR7 A;  2EXB A;  2ZJ9 A;  1GA0 A;  1FR6 A;  4P85 A;  5AQB A;  1GHP A;  1ZKJ A;  2Y4A A;  1Y54 A;  1GHI A;  3N7W A;  4YIN A;  1IEM A;  1W7F A;  2Y2H A;  3P98 A;  2J9P A;  2ZD8 A;  4QU3 A;  1YQS A;  4EWF A;  3G32 A;  1BLC A;  5E2E A;  2WYX A;  2ZLY A;  1Q2Q A;  3VP1 A;  2WAD A;  5DF9 A;  3N8R A;  3TOI A;  2C5W B;  2JBF A;  2H0Y A;  4F94 A;  4A5R A;  2ZC6 B;  1L2S A;  1GCE A;  3C4O A;  1MWS A;  1SKF A;  4KZ9 A;  1I2S A;  4GNU A;  1ES3 A;  1IKG A;  3GRJ A;  3S4X A;  1ES2 A;  3Q07 A;  5KZH A;  3UE0 A;  1K57 C;  1PWD A;  4QJG A;  2EFX A;  3NDG A;  3HUM A;  1YT4 A;  1XA7 A;  4HEF A;  4OOM A;  4X68 A;  2ZC3 B;  5DTS A;  1KGF A;  4N9K A;  3IHB A;  1W8Y A;  4RYE A;  3RXX A;  1LLB A;  5KSC A;  3P09 A;  3N6I A;  5M19 A;  1Z6F A;  1SHV A;  3MZD A;  1LL5 A;  3NBL A;  2XFS A;  4S2K A;  4IBX A;  1K38 A;  4X53 A;  3ZNT A;  2Y2N A;  4KG2 A;  5AQA A;  4E3K A;  4WZ5 A;  3EQV A;  3Q1F A;  5HAR A;  4MLL A;  1E4D A;  2J9O A;  3GVB A;  3PBQ A;  1K25 A;  2OV5 A;  3UE1 A;  4UHU A;  2VGK A;  3MXS A;  3BFC A;  4MEZ A;  4X55 A;  1HD8 A;  4Y0U A;  2V2F F;  5F83 A;  3WRT A;  2BG1 A;  5FQJ A;  1GA9 A;  2ZC5 B;  2A3U A;  4KZ4 A;  3IWI A;  4R23 A;  1TDG A;  4ZDX A;  3LY4 A;  4GKU A;  4ZJ3 A;  5M1A A;  2FFF B;  5I94 A;  1JVJ A;  4DE2 A;  5HW3 A;  3UPO A;  1MKI A;  3GTC A;  5E43 A;  3PBS A;  1U60 A;  5EOE A;  1SDN A;  2PU4 A;  1HZO A;  2PBY A;  2WGW A;  5HAP A;  5JYO A;  3PAG A;  4NK3 A;  3HLF A;  1FOF A;  1Q2P A;  4N92 A;  4U0T A;  4R3J A;  3FWL A;  1PWG A;  2ZM0 A;  4KQR A;  5CEB A;  2Y59 A;  2Y2M A;  2WGW B;  2WAF A;  2EXA A;  3SH8 A;  3CMZ A;  4C75 A;  2WGV A;  5HL1 A;  1QMF A;  1WE4 A;  4EBN A;  3GSG A;  3E2K A;  1NY0 A;  5FDH A;  4BD1 A;  4OKP A;  4XUZ A;  4B88 A;  4DF6 A;  4KQQ A;  4OQI A;  3EQU A;  4M3K A;  1YMX A;  2Z2L B;  2ZQ7 A;  3UDF A;  2R9X A;  4DE3 A;  3LCE A;  3SS5 A;  3GQZ A;  5A92 A;  3BFE A;  5HAQ A;  1BSG A;  1VM1 A;  5AQ9 A;  4KZ3 A;  1BUE A;  3LY3 A;  4JF6 A;  3OCL A;  2VGJ A;  2ZQD A;  3G30 A;  3O86 A;  3GMW A;  2Y2P A;  3IWO A;  5E2F A;  5FAS A;  3IH8 A;  1IKI A;  4Y0T A;  4OPZ A;  2QPN A;  1KVL A;  4BD0 A;  3I7J A;  3M6B A;  1JWV A;  2Q9M A;  5E2H A;  4R3B A;  3V5M A;  2WZZ A;  2V20 A;  1TEM A;  1KDS A;  5FAP A;  4DDY A;  2HDQ A;  2HDS A;  4GDN A;  5DVA A;  5CED A;  3ZVW A;  1YLT A;  1KE0 A;  1FSW A;  1PIO A;  1G68 A;  4RVA A;  1KDW A;  5CTN A;  3IXH A;  5EPH A;  2X01 A;  4L0L A;  3ZDJ A;  5L2F A;  5E2G A;  2ZMA A;  4LV1 A;  5F1G A;  3QNC A;  4WEJ A;  1LI9 A;  4HBU A;  3VOY A;  3AGE A;  1BUL A;  2Y2K A;  4JKT A;  3E2L A;  2XLN A;  2ZQC A;  1LHY A;  5JYP A;  4KEN B;  4XXR A;  1FCM A;  4PM5 A;  4DE1 A;  4KG6 A;  3MBZ A;  3ZHH A;  1K56 A;  1WYB A;  3N8S A;  2V1Z A;  4E3I A;  3VP0 A;  4GN2 A;  1CEG A;  1SDE A;  4PM9 A;  4BJP A;  1L0D A;  3BEC A;  4K0W A;  1H8Z A;  2H5S A;  3N4I A;  3GR2 A;  3MFD A;  3SS4 A;  3HLG A;  2Y55 A;  1H5X A;  3IWQ A;  3S1Y A;  1K4E A;  1KVM A;  1YLZ A;  1L0E A;  2EX6 A;  3M2J A;  4RX2 A;  1IYQ A;  5GLB A;  1BTL A;  3G31 A;  3GV9 A;  3M6H A;  4R4R A;  4DRT A;  1IYP A;  1W79 A;  2JCH A;  3Q7Z A;  3OZH A;  3S22 A;  4RA7 A;  1BLP A;  5EEC A;  1K54 A;  5EUA A;  4OLG A;  3ZG0 A;  1KE3 A;  3CG5 A;  1K55 A;  4N9L A;  5DTK A;  4JLF A;  1XX2 A;  3PBN A;  4RX3 A;  3HLE A;  3ITA A;  3QNB A;  2X02 A;  1EI5 A;  1O7E A;  4KZ8 A;  3VFF A;  4B4X A;  4EBL A;  2HP5 A;  1L0F A;  1OME A;  5GLC A;  4OLD A;  5GHX A;  3G2Z A;  1WYC A;  3A3D A;  4IBR A;  4QY6 A;  3SS3 A;  2CC1 A;  4MBF A;  1DJA A;  1DY6 A;  4X56 A;  1CEF A;  2XD5 A;  3IXG A;  3OPH A;  4JF4 A;  3BFG A;  5HFO A;  3SOI A;  3C4P A;  1ES4 A;  4OOY A;  4UA7 A;  2XQZ A;  4FCF A;  3MKE A;  3ZG8 B;  1XGJ A;  2XGN A;  1W5D A;  4LCM A;  3HRE A;  3V3S A;  2Y2L A;  2XD1 A;  1S0W A;  1NJ4 A;  5EVI D;  1FCO A;  5CTM A;  3V50 A;  3VP4 A;  4KZB A;  1JTG A;  3IXD A;  1PW1 A;  1XKZ A;  3C7V A;  4UA9 A;  3VP2 A;  1BT5 A;  1K54 C;  2WK0 A;  3C5A A;  3WS1 A;  1K55 C;  3Q81 A;  3A3I A;  4NET A;  4QB8 A;  2IWB A;  1NXY A;  3MZF A;  3A3F A;  3RXW A;  3PTE A;  4OPR A;  1L0G A;  3AGF A;  3IF6 A;  4E6X A;  3ZGA B;  4U0X A;  1PI4 A;  3CJM A;  1ES5 A;  3VOZ A;  3DTM A;  2HDU A;  3ZNY A;  1FSY A;  1ERM A;  2EFU A;  4EQI A;  3ZVT A;  3B3X A;  4E3J A;  5EE8 A;  3IF6 B;  2ZQ8 A;  4OQH A;  3BYD A;  5D3O A;  4OP5 A;  1ONH A;  5GLA A;  1DJB A;  1N4O A;  4N1H A;  4S2N A;  4B4Z A;  1K56 D;  1XGI A;  3M2K A;  1RGZ A;  4FH2 A;  2UWX A;  5M18 A;  3W8K A;  1RCJ A;  5U47 A;  4ZTK A;  4PM8 A;  1J9M A;  1KE4 A;  4CPK A;  3O3V A;  5FQM A;  4C6Y A;  1ERQ A;  2DRW A;  2DCF A;  4IVK A;  2H0T A;  3Q7V A;  5CEC A;  4XUX A;  2WGI A;  4WZ5 C;  2Z2M B;  3PBT A;  4PM6 A;  4S2J A;  1TDL A;  4GOG A;  3SH7 A;  2RL3 A;  4JXG A;  3DW0 A;  3HUN A;  5CGX A;  4PPR A;  3A3J A;  1LL9 A;  5FQ9 A;  4DDS A;  3UY6 A;  4Y0O A;  1E3U A;  2JC7 A;  5FSR A;  2HP9 A;  4KG5 A;  3ZCZ A;  3NCK A;  5EVI A;  1CI8 A;  2OLU A;  5KMW A;  1EWZ A;  3HBR A;  1ZC2 A;  3SH9 A;  4E6W A;  3PBR A;  3OPP A;  3G34 A;  3IF6 C;  1NYY A;  5GL9 A;  3ZG9 B;  1CI9 A;  4S2L A;  5EVI B;  2Y91 A;  3IT9 A;  4MBK A;  3C7U A;  4C3Q A;  3UN7 A;  2QMI A;  5HAI A;  2QZ6 A;  3A3E A;  3ZG7 B;  3OCN A;  3UDI A;  5FQQ A;  3FV7 A;  1ZG4 A;  2I72 A;  1NYM A;  3MZE A;  4GZB A;  4YFM A;  1MY8 A;  4UA6 A;  3HVF A;  4S2N C;  4OON A;  4WM9 A;  4OOL A;  2P9V A;  5DF7 A;  3VMA A;  3O88 A;  4P6B A;  4ZJ1 A;  3OC2 A;  3UNW A;  4JPM A;  5HX9 A;  2P9V B;  2G2U A;  2Y2O A;  1RGY A;  1AXB A;  2Y2J A;  5FA7 A;  4KZA A;  4HBT A;  3UPP A;  3HLD A;  5GHZ A;  3W4O A;  5CHM A;  1I5Q A;  2WZX A;  3LO7 A;  5FI2 A;  4DE0 A;  3N8L A;  1FR1 A;  1NZU A;  1ERO A;  4FH4 A;  3UO9 A;  3VSK A;  3PBO A;  1BLH A;  3BFD A;  4QHC A;  4OH0 A;  4S2P A;  5EVI C;  4LV3 A;  4ZAM A;  3JYI A;  3UPN A;  4LV0 A;  5KSH A;  1E25 A;  1ESI A;  4E3M A;  4JF5 A;  5EVL A;  4E3L A;  2HPB A;  4WBG A;  4IVI A;  3WRZ A;  4X69 A;  5CHU A;  1QME A;  2IWC A;  3G2Y A;  3NC8 A;  4LCL A;  1MPL A;  4OVD A;  3ZFZ A;  4WEL A;  3V39 A;  3W4Q A;  5A90 A;  1K4F A;  1PI5 A;  4H8R A;  1XP4 A;  3BM6 A;  1IYO A;  2WKI A;  3UE3 A;  3D4F A;  1S6R A;  1XXM A;  4FD8 A;  4WMC A;  2XR0 A;  3IH9 A;  1IEL A;  5BOH A;  1N9B A;  4N1X A;  1YLY A;  1PWC A;  5GHY A;  4KZ5 A;  2WKE A;  3OPR A;  5FI7 A;  1O07 A;  1YLP A;  1ZG6 A;  4EBP A;  3WS5 A;  4D2O A;  5IHV A;  1MWR A;  1JTD A;  4Q8I A;  4JXV A;  3IHA A;  2XH9 A;  2EX8 A;  2OSU A;  3PAE A;  4KQO A;  3NIA A;  5J8X A;  1MBL A;  1CK3 A;  3NDE A;  5CGW A;  1G6A A;  1TVF A;  1E3U D;  3W4P A;  2ZM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...