2ZQAA

Cefotaxime acyl-intermediate structure of class a beta-lacta toho-1 e166a/r274n/r276n triple mutant
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase Toho-1
publication title Structural Basis of Extend Spectrum Beta-Lactamase in Correlation of Enzymatic Kinetics and Thermal Stability of Acyl-Intermediates
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zqaA00
4S2KA 1PI4A 4OQGA 1WYCA 4RA7A 3SS5A 5A92A 4KG6A 2P74A 2Z2LB 1SDNA 1MWSA 4E3KA 4E6XA 4U0XA 3V5MA 1ZG4A 5FI6A 5FAQA 1XXMA 3UNWA 5F1GA 3AGFA 1NZUA 1CI9A 1PZOA 1K55A 2Y59A 2R9XA 3V3RA 2ZLYA 2OV5A 4F94A 4PM5A 4GNUA 5GLDA 4B88A 5HL1A 2C5WB 5EOEA 3I7JA 4OONA 4EWFA 5JYOA 4DE3A 5CRFA 1K54A 3UE0A 2Y2HA 1E4DA 3RJUA 2XH9A 3BM6A 5CGWA 3VFHA 3IXGA 3SOIA 1GHMA 3NDEA 3A3FA 2HPBA 2J8YA 5HX9A 3A3IA 3VSKA 3CZDA 1LLBA 5CEDA 1G68A 1RP5A 4PM7A 1ES2A 1AXBA 3LCEA 3HLWA 4N1HA 3HLBA 4IEDA 4WZ5C 4RYEA 4MNRA 3M6HA 3W8KA 1VM1A 5E2FA 3PAEA 4KG2A 1DJBA 4WYYA 4DDYA 3OPRA 5CGXA 3MZEA 4S2NC 1FQGA 4OP8A 4QY6A 1K57C 3GRJA 3NI9A 3G35A 1FOFA 3QHYA 4KZ5A 3ZG8B 4EBLA 3ZG0A 1S0WA 3BFGA 4KZBA 2XQZA 4OLGA 1L0FA 1IYOA 3G31A 3SH7A 1BULA 4GZBA 3CJMA 3GVBA 3C7VA 5IHVA 4BD1A 4GD6A 3BEBA 3IF5A 1FCMA 2OLVA 4DE0A 3LO7A 1XGJA 4BQMA 4EV4A 1VQQA 4YFMA 4E6WA 3A3DA 3MZDA 3BYDA 3WS1A 4ID4A 3UPPA 4OQIA 5AQBA 4UAAA 1KGGA 4NK3A 1KDSA 3C4PA 2PU2A 2PBYA 3EQVA 2VGJA 5D3OA 4E3IA 3HLCA 4OQHA 3NBLA 5FATA 2H10A 4S2LA 1K54C 3UDXA 4LENA 4DXCA 4C6YA 2H0TA 3Q07A 3BFCA 1GA9A 4R4SA 4P0MA 3FZCA 2EX2A 2WADA 3QNBA 2Y2PA 1NYMA 4KZ6A 3FYZA 3HLGA 4OOMA 3S4XA 1K56A 4BJPA 5U47A 5EVIA 1ES5A 2HP5A 1JTDA 2JC7A 1ESUA 4JF6A 3CG5A 5DF8A 2ZQ8A 5GLAA 3ZVTA 4JXSA 4UHUA 4BL3A 2HP6A 5EVIB 1KE4A 2Y2LA 5FQ9A 3UN7A 3WS2A 4QD4A 3ZHHA 3N8LA 4OOYA 4E3OA 3C4OA 2EX6A 4ZTKA 4LV2A 4KG5A 5KSCA 3PBRA 5A93A 1FR1A 4WEJA 2EFXA 3G34A 4JKTA 1FCOA 1HZOA 4N1XA 3DW0A 2FFYA 3ZGAB 1HTZA 3MBZA 2WKHA 1Q2QA 2WUQA 3IHBA 4RX3A 1GCEA 2WK0A 4K0XA 2XD1A 1FSYA 2EXBA 4R0QA 5EVID 1SHVA 3WS5A 2G2UA 3MZFA 1M6KA 4QY5A 4XUZA 3S22A 5FA7A 1GA0A 3ZFZA 5F1FA 1KGEA 3SH9A 4KZ3A 4MLLA 3IT9A 5AQ9A 5FI7A 1PWDA 2Y2JA 5CXWA 5E2HA 4A5RA 1L0GA 4DXBA 3ITBA 3G32A 4JF4A 3Q82A 3GQZA 5AQ7A 4KZ9A 4GB7A 3UE3A 3ZG7B 5GHYA 4EUZA 1WE4A 4FH4A 2XDMA 1NY0A 2Y91A 4JBFA 5CHUA 2WZXA 5EVIC 3VOZA 5DTKA 5CHMA 4R4RA 1XA1A 3D4FA 2ZC5B 3Q1FA 1XPBA 3GMWA 2EXAA 2DCFA 2HDRA 2IWCA 3DWZA 1BT5A 5KSHA 5EOOA 5HAQA 3VP0A 2FFFB 1WYBA 1Q2PA 3N6IA 1EI5A 2JBFA 1H8ZA 1K6RA 1ES4A 1MWUA 2WKEA 1PW8A 1L2SA 4KQOA 2Y2QA 5FAPA 5HARA 5HW3A 5BOHA 1KDWA 4S2JA 4IBRA 3FKVA 1W8QA 1JWZA 1QMEA 2XFTA 3HLDA 5J8XA 3P09A 5CTMA 3UY6A 1K25A 1XKZA 2WZZA 3MXSA 4MBKA 3V50A 4OOLA 4HBUA 3OPLA 1YLWA 4X53A 1H5XA 2DRWA 4XXRA 4B4ZA 2WGVA 3B3XA 2ZC7A 2ZD8A 3HVFA 3O88A 4WZ4A 3UDIA 3HLFA 4JLFA 3FKWA 2HP9A 3NC8A 2XF3A 4QHCA 4OH0A 1SKFA 1XP4A 2P9VB 5DF7A 1QMFA 3IXDA 3FWLA 1W7FA 5TGFA 1ONGA 3UPNA 3IQAA 2ZQDA 5FQQA 3V39A 1YM1A 1BZAA 4LCMA 3VOYA 5A91A 1DJAA 2E8IA 1PYYA 1C3BA 3BFEA 2B5RA 4N9KA 1O07A 5HAPA 4GDNA 4DKIA 1GHPA 4IVKA 3IXBA 4KZ7A 1JTGA 1YLPA 2ZC4B 2IWDA 3C5AA 3WRTA 2HDUA 3OC2A 3PBTA 4U0TA 5CTNA 4X56A 4JXGA 4OPYA 3IH8A 4EQIA 5A90A 2VGKA 4M3KA 3BECA 4FSFA 3QNCA 3HBRA 4PM8A 3VMAA 3EQUA 5FI2A 5KMWA 3IF6B 1K38A 1BUEA 1ESIA 1YQSA 2ZM2A 1RGZA 3HUOA 3NY4A 3E2KA 1TVFA 2I72A 3GR2A 4NETA 4PMAA 1XGIA 4S2MA 4ZJ2A 5HFOA 1HD8A 3M2JA 2BG1A 4PM9A 5DVAA 5M18A 3O3VA 1S6RA 1XX2A 2Y2IA 3C7UA 1ZC2A 4DF6A 3VSLA 4P6BA 3ZNYA 1BLCA 2ZQ9A 3W4PA 1LHYA 1RGYA 1LI0A 1Z6FA 2H5SA 4FH2A 3CMZA 1ERMA 4OPZA 4CPKA 4RX2A 3N8RA 5CERA 1IYQA 2WAEA 3BLSA 3WS0A 1J9MA 2XEPA 5GLCA 3GTCA 4R3JA 3G2YA 4PM6A 4IVIA 1YT4A 1IKIA 4LV0A 5AQAA 3ZG9B 3M6BA 1BLPA 3A3JA 1SDEA 4KZ8A 5DTTA 1YLYA 1MXOA 4WMCD 3HUNA 2Y2GA 5EE8A 1W79A 4KENB 1PWGA 3N4IA 3PBSA 2Y2KA 4Y0UA 4E3JA 2V2FF 2ZM0A 3VP1A 1IYPA 4LV1A 4RVAA 2Q9MA 5FQIA 1E25A 1ERQA 4XUXA 2WAFA 4QU3A 3WWXA 1MY8A 4JXWA 1E3UD 3HUMA 5FASA 3BRMA 2QPNA 1BLHA 2JE5A 4P87A 2X02A 4JF5A 2EFUA 1YLTA 2WGWB 1MWTA 3ZG5A 4N92A 2HDQA 2ZQ7A 2XGNA 3PBQA 4OQ0A 2QMIA 5HAIA 1I2SA 4S2OA 1CI8A 3AGEA 2EX9A 3MFDA 4Y0OA 3VP3A 5M19A 5EECA 2HDSA 4OKPA 4H8RA 4LV3A 4ZDXA 1MKIA 1DY6A 1TDLA 2J9OA 5CEBA 4GN2A 3ZDJA 1LI9A 4WBGA 2JCHA 4X6TA 1JVJA 2GDNA 1GHIA 3ISGA 1PW1A 1DJCA 5EUAA 4JXVA 4S2IA 1YMXA 3IWIA 3O86A 4MBHA 3OPPA 4KQQA 3WRZA 2X71A 4OPQA 3AGDA 5GHZA 3OCLA 1O7EA 4UA9A 3OCNA 1FR6A 5DTSA 3E2LA 5TFQA 1BSGA 5FDHA 4Y0TA 3SS3A 3SH8A 3TSGA 5GL9A 3ZVWA 4QJGA 1ZG6A 3VP4A 2Y55A 4FD8A 4EBPA 2ZC3B 2P9VA 4KZ4A 5CECA 2EX8A 4GOGA 1NXYA 1LL5A 5JYPA 3ZCZA 3IHAA 4HESA 1PZPA 1XA7A 1KE3A 2V20A 1FCNA 1NJ4A 1Y54A 3RXXA 1NYYA 1N4OA 5DF9A 4X55A 1HVBA 4ZBEA 4D2OA 1BTLA 2CC1A 1IELA 2RCXA 5FQMA 5M1AA 3PBNA 3OZHA 1I2WA 2G2WA 4KZAA 4HBTA 2XK1A 3TG9A 2ZJ9A 5E2EA 3W4OA 3G2ZA 1IYSA 4Z9QA 4B4XA 4JPMA 1NZOA 3HL9A 3PAGA 1RCJA 3N8SA 4OP5A 5FAOA 2RL3A 4YINA 4C3QA 3BFFA 1ALQA 3V3SA 3G30A 2A3UA 4BENA 3IWOA 2J7VA 3N7WA 3IF6A 4ZJ1A 1MPLA 2C6WB 1CEFA 1U60A 1H8YA 4BD0A 2R9WA 3UO9A 1N9BA 3UPOA 3JYIA 3ZNTA 3MXRA 3OPHA 2V1ZA 5GHXA 1MBLA 4UA6A 1EROA 2J9PA 2WGIA 4LCLA 4E3NA 1OMEA 4R1GA 5TR7A 2ZM8A 5CHJA 5E43A 2BLSA 3VP2A 3LY4A 4WMCA 4Q8IA 3MKEA 2Y2NA 3SS4A 2Y2MA 4GKUA 2IWBA 2Y4AA 3BFDA 2Y2OA 5FQKA 2OSUA 4OLDA 1K55C 1BLSA 3NDGA 4BLMA 4WM9A 3Q7ZA 1KE0A 1L0EA 2ZC6B 5GLBA 4DDSA 4WEKA 4IBXA 1E3UA 1LL9A 4WELA 4MBFA 3P98A 1MWRA 2XD5A 1YMSA 2XLNA 1JWPA 1CEGA 2ZMAA 2H0YA 4QB8A 4GD8A 3NCKA 4C75A 2PU4A 1I5QA 4N9LA 4E3MA 4MEZA 1YLZA 1JWVA 1W5DA 3G4PA 4X69A 3W4QA 2XR0A 4PPRA 4BL2A 3O87A 1KVLA 4P85A 1ES3A 3DTMA 3UE1A 3VFFA 4HEFA 3UDFA 3TOIA 3PTEA 5F82A 4O7DA 4UA7A 5EVLA 3FV7A 3HLEA 3BLMA 1K4EA 3S1YA 1TDGA 3IF6C 3HREA 2WGWA 5I94A 1KVMA 1K6SA 4OVDA 5L2FA 1W8YA 2Q9NA 3GV9A 2A49A 1L0DA 5G18A 1PWCA 1NRFA 5KZHA 4DE2A 5EPHA 4S2PA 1KGFA 2X01A 5FSRA 4X68A 2XFSA 4FCFA 3DWKA 3Q7VA 4E3LA 4KQRA 4OPRA 2DNSA 3GSGA 5CGSA 4U3TA 3A3EA 1EWZA 3WS4A 1IKGA 1PIOA 4EBNA 1FSWA 1IEMA 1K4FA 3Q81A 1K56D 1CK3A 3MKFA 2ZQCA 3LEZA 4DRTA 4Y7PA 1G6AA 5E2GA 4GDBA 2WYXA 4WZ5A 3Q7VB 1M40A 4K91A 3LY3A 5FQJA 3M2KA 3RXWA 3PBOA 1ZKJA 4R3BA 4CJNA 4L0LA 4DE1A 2UWXA 2Z2MB 1PI5A 2QZ6A 3IH9A 5F83A 1ONHA 4S2NA 3NIAA 2OLUA 4R23A 1K57A 1SCWA 2WKIA 2ZQAA 1TEMA 1YLJA 3IWQA 4K0WA 4ZAMA 4ZJ3A 3IXHA 3ITAA
chains in the Genus database with same CATH superfamily
1PI4A 5EM0A 3C38A 2ZOHA 5L07A 4GLQA 1SDNA 1MWSA 4U0XA 1ZG4A 5FI6A 5FAQA 3AGFA 1PZOA 2R9XA 2ZLYA 5AVFA 5GLDA 4B88A 4OONA 5JYOA 1DP8A 5CRFA 2Y8HA 1OT9A 5HX9A 3VSKA 3CZDA 3TJZC 4GS9A 4IEDA 2O9CA 5E2FA 4WYYA 4DDYA 3OPRA 5CGXA 3MZEA 3RFBA 1FOFA 1YPRA 4EBLA 5TBMB 4KZBA 1L0FA 4HP9A 2NUPC 3SZTA 3G31A 5IHVA 4NG2A 3LR4A 1FCMA 4DE0A 5CX7A 1D06A 1VQQA 3A3DA 4ID4A 3UPPA 4UAAA 3T4JA 5D3OA 1OTIA 3NBLA 1NRJA 2H0TA 5HPIA 1GA9A 1V9YA 4EU0A 4KZ6A 4OOMA 3FYZA 3HLGA 1ES5A 5HSQA 1JTDA 3R4KA 5DF8A 1N9OA 4BL3A 2Y2LA 2VGLS 4E3OA 3CUEC 5KSCA 4WEJA 3T4SA 1S67L 1HZOA 3ZGAB 2WK0A 2XD1A 5EVID 2J80A 3A0SA 3WS5A 2OAP1 4QY5A 4XUZA 5FA7A 3IT9A 2Y2JA 4Y2FA 3Q82A 3GQZA 4KZ9A 2JKTM 2D02A 4EUZA 5CHUA 2WZXA 5DTKA 4R4RA 1XA1A 4HIAA 4GW9A 1XPBA 3CAXA 4PAUA 2DCFA 2HDRA 5C5KA 1OTBA 4Q0JA 5HAQA 2KX6A 3VP0A 5AVEA 4KQOA 1PW8A 1L2SA 1T1CA 5FAPA 1PNEA 3FKVA 3P09A 1T1AA 1D1JA 4HBUA 1YLWA 2DRWA 4B4ZA 3B3XA 2ZD8A 3HVFA 5TBMA 3MSHA 1XP4A 3K3DA 2VA0A 3IQAA 2VGLM 2ZQDA 3V39A 1YM1A 1DJAA 2FZ0A 3BFEA 2B5RA 4IVKA 3FPWA 5G4ZA 3WRTA 2HDUA 3PBTA 4F3LB 3IH8A 3S7NA 4MN6A 5FI2A 1K38A 3KSHA 3LICA 4YNRA 1TVFA 2QHKA 5HDDA 3M2JA 3O3VA 4DF6A 1BLCA 1Z6FA 2H5SA 4EUVA 2VX8A 3N8RA 2XRNA 4PM6A 4LV0A 3IX4A 5AQAA 1BLPA 1XFNA 3PYPA 1PWGA 1VEUA 2ZM0A 4RVAA 5FQIA 3LIAA 1IOUA 1XFQA 4GJ4A 1OJ5A 3E0YA 4O0PA 1BLHA 2Y79A 3NULA 5DKKA 2ZQ7A 5L10A 1YKDA 4Y0OA 1OT6A 5EECA 4LV3A 4H6JB 4ZDXA 3E4PA 1P0ZA 3ZDJA 3F1OB 2GDNA 3B42A 2BASA 3IWIA 3O86A 4CLCD 3DTIA 2D01A 3AGDA 4OPQA 4HJ6A 3UE6A 3E2LA 2QJ5A 2HV1A 3SS3A 3TSGA 4DJ2A 3VP4A 5HZHA 5CECA 2W3GA 5JYPA 3IHAA 1KE3A 2PT7A 1NYYA 2JKGA 3E4OA 2RCXA 4Z1WA 5FQMA 1I2WA 2G2WA 2XK1A 4MDZA 3UB7A 4B4XA 3PAGA 1F9IA 1RCJA 2RL3A 4C3QA 4Y5FA 4PKYA 3G30A 4WUJA 2J7VA 2R9WA 2WKRA 3T1RA 1N9BA 3JYIA 5FEGA 2V1ZA 4E3NA 3B33A 2ZM8A 1OPXA 5CHJA 3VP2A 1P9RA 5EM1A 2Y2MA 4GKUA 2IWBA 1G28A 2Y4AA 3BFDA 4Y13A 2OSUA 4OLDA 4BLMA 1KE0A 4WEKA 4IBXA 1E3UA 3OOVA 2ZMAA 3O5YA 2V9AA 3G4PA 2XR0A 4BL2A 1KVLA 4P85A 2OOLA 2Q0OA 2VV6A 4O7DA 3ULFA 3BLMA 3PHYA 4PKYG 1S1ZA 1KVMA 2PYPA 1K6SA 5L2FA 1LSWA 5EPHA 3C2WA 4E3LA 3F1PB 4KQRA 3GSGA 4H6JA 5CGSA 3A3EA 3Q81A 1FSWA 1IEMA 2ZQCA 3F1OA 4WZ5A 4K91A 4CJNA 3BWLA 4DE1A 3E98A 2QZ6A 4S2NA 4ZJ3A 3ITAA 4S2KA 1LL8A 3V5MA 4O8GA 4NKPA 1TS8A 1XXMA 2P08A 5HL1A 3I7JA 4EWFA 4DE3A 3CI6A 2Y2HA 3RJUA 3BM6A 3VFHA 1VETA 4ESPA 2JKFA 2HZ5A 4PM7A 1ES2A 1AXBA 3HLWA 4WZ5C 4MNRA 3D3OA 2VEAA 3EWKA 4GS9B 5K5BA 4S2NC 5G4YA 3BJNA 4OP8A 4QY6A 5HL6A 3NI9A 2VKSA 3ZG8B 1IYOA 4HY8A 4GD6A 3UMDA 3LO7A 1XGJA 3HCYA 3LUQA 4YFMA 1TS7A 3VE4A 3MZDA 3EEHA 1KGGA 4NK3A 1W63M 4JGPA 2PU2A 3U4LP 3EQVA 2H10A 3ZQ5A 4DXCA 3BFCA 4P0MA 1EW0A 3QNBA 2WADA 1NYMA 3KO6A 1K56A 1F2KA 5EVIA 5U47A 2HP5A 3CG5A 2ZQ8A 5GLAA 3UN7A 3KSFA 3ZHHA 4ZTKA 5A93A 1FR1A 3G34A 3D9YA 5F68A 5L8MA 3DW0A 5L09A 1HTZA 3LR3A 3QP2A 1Q2QA 1OTDA 4RX3A 1GCEA 4K0XA 1FSYA 2G2UA 3S22A 1GA0A 3SH9A 5AQ9A 5E2HA 1T18A 3G32A 4L9FA 5EFWA 4NXFA 3UE3A 1WE4A 4FH4A 1NY0A 4GHIA 3F1NB 5EVIC 5CHMA 2ZC5B 3GMWA 2V1AA 2IWCA 3DWZA 1BT5A 5KSHA 1P97A 4ME4A 1WYBA 2W3HA 4RYEA 2WKEA 1H8ZA 2VLGA 1UGUA 2W3FA 2Y2QA 2XA7S 1W8QA 2A2LA 3HLDA 4WN5A 5I5LA 1XKZA 4MBKA 3TE8A 1H5XA 2WKQA 2P7JA 5DKLA 2WGVA 3LEQA 3UB9A 2AVXA 4I5SA 3FKWA 2HP9A 2XF3A 1H3QA 5FDSA 4QHCA 4OH0A 1W7FA 1ONGA 2INWA 4Y3IA 3CUEA 3VOYA 2E8IA 1PYYA 1C3BA 3T12B 1YSQA 2DMWA 1O07A 5HAPA 4DKIA 2VZWA 2PDRA 3MS6A 3IXBA 1JTGA 4IHQA 1YLPA 2ZC4B 2YKHA 2HJEA 2IWDA 2O99A 3C5AA 4LPZA 4JXGA 3VMAA 3EQUA 3KYZA 4MMNA 1YQSA 3LR0A 3NY4A 1F5MA 3UB5P 2I72A 4NETA 1F98A 4S2MA 2BG1A 4PM9A 3IS2B 1XX2A 1ZC2A 3KYQA 1GSVA 1LI0A 4OPZA 4FH2A 4CPKA 4HQAA 3LIFA 3BLSA 2XA7M 3T4QA 4R3JA 3G2YA 3IX3A 4IVIA 3ZG9B 1X0OA 3M6BA 1ZHHB 4KZ8A 5DTTA 4X1MA 5EE8A 4I38A 3ZYTA 4E3JA 2V2FF 2R78A 2Q9MA 1UWNX 1ERQA 4XUXA 2M7VA 2WAFA 4E04A 1MY8A 4JXWA 5FASA 2QPNA 1VEUB 4P87A 3F1NA 2WGWB 1MWTA 2H28A 2HDQA 1TS0A 2Z6DA 2XGNA 3PBQA 1I2SA 2EX9A 5M19A 3VP3A 2M1CA 2V1BA 4D60A 2J9OA 4WBGA 2W1TA 4X6TA 4Q0IA 3MXQA 1H0MA 4X25A 1ZTUA 2PRFA 4MBHA 4KQQA 2I9VA 2B95A 3S7PA 5GHZA 2MJ6A 3OCNA 5FDHA 2QWSA 3ZVWA 1ZG6A 2Y55A 3LFVA 3KYEA 5IS1A 1LL5A 3ZCZA 1H8MA 2GZAA 1Y54A 4X55A 4ZBEA 4D2OA 2LB5A 5M1AA 3PBNA 3W4OA 1IYSA 2CMNA 2O9BA 3N8SA 4OP5A 3IBRA 2ZL1A 3V3SA 2A3UA 3IWOA 5DFXA 1MPLA 2C6WB 3MXRA 2J3TC 4UA6A 1EROA 1T1BA 2WGIA 3IS2A 4ARZB 4R1GA 2PR5A 4WMCA 4BBUA 1S4RA 3SS4A 2K31A 2HF6A 4HJ4A 1PFLA 1K55C 1BLSA 3HJIA 5GLBA 4L9GA 3E4QA 3H82B 3TW8A 4EETB 2XD5A 3CLOA 3T1SA 3MR0A 1CEGA 4HP4A 4C75A 4GD8A 3NCKA 2PU4A 4MEZA 3W4QA 4PPRA 5EVEA 3P7NA 1OTAA 1ES3A 3UE1A 4HEFA 3UDFA 3PTEA 3FV7A 5HWTA 1TDGA 2WGWA 2JHEA 5KZHA 4S2PA 3ICYA 1KGFA 3PXPA 2X01A 4X68A 4FCFA 3DWKA 1IKGA 1K4FA 1BYWA 3LEZA 5E2GA 2A24B 4GDBA 1M40A 3LY3A 4HH3A 5FQJA 4IJGA 2VJWA 3IH9A 4LRXC 3T4LA 5F83A 1Y4OA 2ZOIA 4RQ9A 4ZAMA 3IWQA 1AWIA 3VE3A 1WYCA 4RA7A 3MF0A 2P74A 2O9AA 4CQHA 4E6XA 3UNWA 4AFIA 1NZUA 1CI9A 2Y59A 3V3RA 4F94A 2C5WB 5EOEA 2W3EA 3UE0A 1E4DA 5CGWA 4P6ZS 3SOIA 1GHMA 3NDEA 3A3FA 3A3IA 5CEDA 1LLBA 1G68A 3LCEA 1VETB 3JVVA 3M6HA 1VM1A 3PAEA 2JKTI 2QYBA 2BTFP 1S4SA 4ARZA 3GRJA 4KZ5A 3ZG0A 1S0WA 3BFGA 2XQZA 4LRZE 3MQ0A 3SH7A 4GZBA 3MQOA 3C7VA 3IF5A 3T1QB 4BQMA 3FC7A 4CLCE 3H82A 3BYDA 4OQIA 2KDKA 1KDSA 2JKRM 3C4PA 4M4XA 4E3IA 2VGJA 3HLCA 1ODVA 1PRQA 2W1RA 3Q07A 4R4SA 4ETXA 2QJ7A 3FZCA 2EX2A 2Y2PA 3LI8A 3S4XA 4EW7A 1YAXA 4BMWA 3NOPC 1ESUA 3CHWP 3ZVTA 4UHUA 4KQDA 2HP6A 5EVIB 1KE4A 5FQ9A 4DN0A 2GX5A 4QD4A 3N8LA 4OOYA 2XROA 1DP6A 4KG5A 3PBRA 2EFXA 4JKTA 2B18A 4N1XA 4HOIA 2A24A 1CQAA 4P6ZM 1ACFA 2WKHA 3DTEA 3QP6A 3NOUC 3SW1A 3ZFZA 1KGEA 3BQ8A 5CXWA 1XJ4A 3ITBA 4GB7A 5HWWA 4EXOA 4LGWA 3ZG7B 4I3JA 4JBFA 3D4FA 2EXAA 4GHIB 3NHQA 2KLIA 2FFFB 3T4TA 1Q2PA 1MWUA 2JBFA 2XSSA 1ES4A 1TF1A 5HARA 5HW3A 4B9OA 1KDWA 1NWZA 4FTXA 1JWZA 1QMEA 2EA9A 2XFTA 5J8XA 2VK3A 5CTMA 3MJQA 3MXSA 3V50A 4OOLA 1W63Q 3QP1A 4XXRA 2ZMFA 4WZ4A 3UDIA 3HLFA 3NC8A 4B93A 5DF7A 2P9VB 3PR6A 1QMFA 3IXDA 3FWLA 1L3LA 5TGFA 3UPNA 4UQIS 1P9WA 5FQQA 4LCMA 5HD5A 3K3CA 1S66L 5A91A 3FPVA 1MC0A 2Z6CA 2WKPA 1GHPA 1STZA 3LYXA 2O0YA 4KZ7A 3QP5A 3L9KA 3OC2A 4U0TA 1T19A 2K2NA 3R7WB 4X56A 5A90A 4OPYA 5J7EA 5DJUA 2VGKA 4M3KA 3C30A 3T4KA 4FSFA 4PM8A 1IFQA 5KMWA 3HJKA 4R38A 1BUEA 2PD8A 1CF0A 2ZM2A 3HUOA 3E2KA 1G6OA 4PMAA 3GR2A 1XGIA 4ZJ2A 5DVAA 5M18A 5AJGA 1N9NA 4GCZA 2Y2IA 4JGRA 3C7UA 3VSLA 3ZNYA 4JGOA 3CPTA 2ZQ9A 4FOFA 3W4PA 1LHYA 1ERMA 4RX2A 1XJ3A 1DP9A 2WAEA 3WS0A 5GLCA 1YT4A 1IKIA 4MN7A 3A3JA 1SDEA 1MXOA 3HUNA 2Y2GA 4KENB 2Y2KA 1IYPA 4LV1A 4EERA 2GNXA 4Y17A 3WWXA 1E3UD 2K7SA 3HUMA 4ETZA 3S7QA 2J3WA 4UQIM 3ZG5A 3JVUA 4N92A 4CLCB 1LT0A 4S2OA 3AGEA 4R70A 4HI4A 2HDSA 5LBRA 1TDLA 4KUKA 2JCHA 1PW1A 1DJCA 3A0VA 5EUAA 4JXVA 2W1TB 3OPPA 3NECA 2X71A 1XJ2A 5DTSA 3LIEA 4QJGA 5GL9A 4FD8A 4EBPA 2ZC3B 2P9VA 2V0UA 2EX8A 1NXYA 1VB6A 5HDCA 5FEFA 3LIBA 1XA7A 1NJ4A 5DF9A 1LSVA 1HVBA 5HD3A 1BTLA 2CC1A 2PD7A 3OZHA 3QP8A 5DFYA 3C8CA 2ZJ9A 5E2EA 1SZVA 3G2ZA 4JPMA 1NZOA 4XT2B 5FAOA 4YINA 1KOUA 3R7WA 4IUKA 1ALQA 3N7WA 1U60A 3H9WA 3GDIA 1H8YA 2ZL1B 3UO9A 3A0RA 3ZNTA 3BW6A 4WF0A 5GHXA 1MBLA 3MMHA 2ZMVA 4DMZA 5TR7A 2OAQ1 1S1YA 2BLSA 1TD5A 4EEPA 5F69A 3Q7ZA 4DDSA 1LL9A 4MBFA 1SKOA 1YMSA 1JWPA 2H0YA 4QB8A 1I5QA 4N9LA 1YLZA 1JWVA 4X69A 4R6LA 3O87A 3DTMA 3VFFA 3UB8A 3T1XA 1K4EA 3EOIA 3HREA 4OVDA 4CLCA 2A49A 1NRFA 5FSRA 2XFSA 3Q7VA 2DNSA 3VOLA 1EWZA 1PIOA 3IX8A 1K56D 3MKFA 1G6AA 3TRCA 3PBOA 4R3BA 1PI5A 2EWVA 4I39A 1ONHA 2QKPA 2E8JA 2OLUA 1K57A 1SCWA 2ZQAA 1TEMA 1YLJA 4EQ1A 4K0WA 3IXHA 4OQGA 3SS5A 5A92A 4KG6A 2Z2LB 2GJ3A 4E3KA 4G3KA 4UEYA 3MQQA 5F1GA 1Z09A 1K55A 4X1LA 2OV5A 4PM5A 4GNUA 4CLCC 5MC7A 4XT2A 4BBTA 3K2NA 1K54A 2VV8A 3H7WB 2XH9A 3IXGA 2EWWA 1WA9A 2HPBA 2J8YA 5J4EA 1FIKA 1RP5A 4N1HA 3HLBA 4K08A 4JGQA 3W8KA 4L9EA 2W27A 4KG2A 1DJBA 3UMEA 1FQGA 3OBFA 1K57C 3QHYA 3G35A 4OLGA 2PYRA 1BULA 3RH8B 3CJMA 3GVBA 1K0KA 4BD1A 1Y28A 3BEBA 2OLVA 4QWOA 3KSGA 4EV4A 4E6WA 4MCWA 3FG8A 3WS1A 4WL9A 5AQBA 3T4OA 3P01A 2KOIA 2PBYA 4OQHA 5FATA 2PHYA 3D72A 3BY8A 4S2LA 1K54C 3UDXA 4LENA 4O01A 4C6YA 3LI9A 3EGXC 4EEUA 4BJPA 1FILA 2JC7A 4JF6A 4DJ3A 1N9LA 4NEED 4JXSA 1J3WA 3NJAA 4NXBA 1GSWA 3WS2A 5HWVA 3C4OA 2EX6A 4LV2A 3G6OA 2PBDP 2HJ9C 1FCOA 4LLOB 2FFYA 3RTYA 3MBZA 4HH2A 1LSXA 2WUQA 3IHBA 2EXBA 4R0QA 1SHVA 2OWHA 4Y15A 1DRMA 3MZFA 1V9ZA 1M6KA 5F1FA 5DJTA 2UV0E 4KZ3A 4MLLA 3L7HA 5FI7A 1PWDA 1NLZA 4A5RA 1L0GA 4DXBA 2JN7A 4JF4A 5AQ7A 4PHTA 3W2ZA 1GSXA 5GHYA 2XDMA 2Y91A 3U2AA 3VOZA 5FL3A 3Q1FA 5EOOA 2B02A 3H7WA 2L4RA 3N6IA 1EI5A 1K6RA 5BOHA 3T50A 4S2JA 4IBRA 3EEAA 3UY6A 1K25A 2WZZA 4I3AA 4X53A 3OPLA 2VV7A 2ZC7A 3O88A 4JLFA 2PAVP 1SKFA 1A0KA 1G5UA 1XJ6A 4NXEA 1BZAA 2J3TD 5F5YA 4N9KA 2IA2A 4GDNA 4QPRA 4F3LA 3QP4A 4G3VA 5CTNA 4EQIA 3BECA 3UB6A 2V8FA 3HBRA 3QNCA 3IF6B 3LIDA 5TJJA 1ESIA 1UWPX 1RGZA 1TS6A 3KSIA 3BQAA 5HFOA 2LB9A 1HD8A 1S6RA 4P6BA 1RGYA 3CMZA 5J3WA 5CERA 1IYQA 1J9MA 2OWJA 2M7UA 2XEPA 4NXGA 3GTCA 3CPTB 3LR5A 5KIZA 5IU1A 1YLYA 4WMCD 1W79A 3N4IA 1HLUP 3PBSA 4Y0UA 3VP1A 1VHMA 2HGVA 3OLOA 1E25A 2L0WA 4QU3A 2W3DA 2NUTC 3BRMA 4IUHA 2JE5A 2X02A 4JF5A 2EFUA 1YLTA 5F6AA 3VV4A 5HPFA 1OJGA 2V8CA 4OQ0A 4YOFA 2QMIA 5HAIA 1CI8A 3MFDA 4OKPA 4H8RA 1MKIA 1DY6A 3JPUA 5CEBA 4GN2A 4HHDA 1LI9A 2YKFA 4FUWA 1JVJA 1GHIA 3ISGA 4S2IA 1YMXA 5IT5A 4G3WA 3WRZA 3OCLA 1O7EA 4UA9A 1FR6A 5TFQA 1BSGA 4Y0TA 3SH8A 4KZ4A 3NOTC 4GOGA 2W0NA 5A8BA 3IBJA 5HDSA 4ZRRA 4HESA 1PZPA 4I3IA 2V20A 1FCNA 2PR6A 3RXXA 4BWIA 1N4OA 4HJ3A 1D7EA 1IELA 4KZAA 4HBTA 3TG9A 3S7OA 4Z9QA 4KUOA 3HL9A 2P04A 2ZBBA 3BFFA 1NLYA 4BENA 3IF6A 4ZJ1A 1CEFA 4BD0A 1YSPA 3UPOA 3OPHA 2FH5A 3DTKA 2J9PA 4LCLA 1OMEA 2ACGA 5E43A 3LY4A 3BY9A 4Q8IA 3MKEA 2Y2NA 1MZUA 3GECA 2Y2OA 5FQKA 3NDGA 3LGOA 4WM9A 1L0EA 2ZC6B 3V67A 4WELA 3B47A 3P98A 1MWRA 4II7A 2XLNA 3MFXA 1JNUA 4R3AA 4YWZA 4E3MA 1SKOB 1W5DA 5EV0A 4Q0HA 4MN5A 4BBVA 3TOIA 5F82A 1MKMA 4LRYC 4UA7A 5EVLA 4EESA 3HLEA 3DAVA 3S1YA 3IF6C 5I94A 3F1PA 1W8YA 2Q9NA 3GV9A 1L0DA 5G18A 3DBAA 1PWCA 4HNBA 2V0WA 4DE2A 4WLAA 4OPRA 4U3TA 1OTEA 2G7UA 4EBNA 3WS4A 2JKRI 1CK3A 4DRTA 3KX0X 4Y7PA 2L1MA 2WYXA 3Q7VB 3CWFA 3M2KA 3EGDC 3RXWA 1ZKJA 4L0LA 2UWXA 2Z2MB 4LFUA 3NIAA 4R23A 2WKIA 3CITA 1CJFA
chains in the Genus database with same CATH topology
4S2KA 1PI4A 4OQGA 1WYCA 4RA7A 3SS5A 5A92A 4KG6A 2P74A 2Z2LB 1SDNA 1MWSA 4E3KA 4E6XA 4U0XA 3V5MA 1ZG4A 5FI6A 5FAQA 1XXMA 3UNWA 5F1GA 3AGFA 1NZUA 1CI9A 1PZOA 1K55A 2Y59A 2R9XA 3V3RA 2ZLYA 2OV5A 4F94A 4PM5A 4GNUA 5GLDA 4B88A 5HL1A 2C5WB 5EOEA 3I7JA 4OONA 4EWFA 5JYOA 4DE3A 5CRFA 1K54A 3UE0A 2Y2HA 1E4DA 3RJUA 2XH9A 3BM6A 5CGWA 3VFHA 3IXGA 3SOIA 1GHMA 3NDEA 3A3FA 2HPBA 2J8YA 5HX9A 3A3IA 3VSKA 3CZDA 1LLBA 5CEDA 1G68A 1RP5A 4PM7A 1ES2A 1AXBA 3LCEA 3HLWA 4N1HA 3HLBA 4IEDA 4WZ5C 4RYEA 4MNRA 3M6HA 3W8KA 1VM1A 5E2FA 3PAEA 4KG2A 1DJBA 4WYYA 4DDYA 3OPRA 5CGXA 3MZEA 4S2NC 1FQGA 4OP8A 4QY6A 1K57C 3GRJA 3NI9A 3G35A 1FOFA 3QHYA 4KZ5A 3ZG8B 4EBLA 3ZG0A 1S0WA 3BFGA 4KZBA 2XQZA 4OLGA 1L0FA 1IYOA 3G31A 3SH7A 1BULA 4GZBA 3CJMA 3GVBA 3C7VA 5IHVA 4BD1A 4GD6A 3BEBA 3IF5A 1FCMA 2OLVA 4DE0A 3LO7A 1XGJA 4BQMA 4EV4A 1VQQA 4YFMA 4E6WA 3A3DA 3MZDA 3BYDA 3WS1A 4ID4A 3UPPA 4OQIA 5AQBA 4UAAA 1KGGA 4NK3A 1KDSA 3C4PA 2PU2A 2PBYA 3EQVA 2VGJA 5D3OA 4E3IA 3HLCA 4OQHA 3NBLA 5FATA 2H10A 4S2LA 1K54C 3UDXA 4LENA 4DXCA 4C6YA 2H0TA 3Q07A 3BFCA 1GA9A 4R4SA 4P0MA 3FZCA 2EX2A 2WADA 3QNBA 2Y2PA 1NYMA 4KZ6A 3FYZA 3HLGA 4OOMA 3S4XA 1K56A 4BJPA 5U47A 5EVIA 1ES5A 2HP5A 1JTDA 2JC7A 1ESUA 4JF6A 3CG5A 5DF8A 2ZQ8A 5GLAA 3ZVTA 4JXSA 4UHUA 4BL3A 2HP6A 5EVIB 1KE4A 2Y2LA 5FQ9A 3UN7A 3WS2A 4QD4A 3ZHHA 3N8LA 4OOYA 4E3OA 3C4OA 2EX6A 4ZTKA 4LV2A 4KG5A 5KSCA 3PBRA 5A93A 1FR1A 4WEJA 2EFXA 3G34A 4JKTA 1FCOA 1HZOA 4N1XA 3DW0A 2FFYA 3ZGAB 1HTZA 3MBZA 2WKHA 1Q2QA 2WUQA 3IHBA 4RX3A 1GCEA 2WK0A 4K0XA 2XD1A 1FSYA 2EXBA 4R0QA 5EVID 1SHVA 3WS5A 2G2UA 3MZFA 1M6KA 4QY5A 4XUZA 3S22A 5FA7A 1GA0A 3ZFZA 5F1FA 1KGEA 3SH9A 4KZ3A 4MLLA 3IT9A 5AQ9A 5FI7A 1PWDA 2Y2JA 5CXWA 5E2HA 4A5RA 1L0GA 4DXBA 3ITBA 3G32A 4JF4A 3Q82A 3GQZA 5AQ7A 4KZ9A 4GB7A 3UE3A 3ZG7B 5GHYA 4EUZA 1WE4A 4FH4A 2XDMA 1NY0A 2Y91A 4JBFA 5CHUA 2WZXA 5EVIC 3VOZA 5DTKA 5CHMA 4R4RA 1XA1A 3D4FA 2ZC5B 3Q1FA 1XPBA 3GMWA 2EXAA 2DCFA 2HDRA 2IWCA 3DWZA 1BT5A 5KSHA 5EOOA 5HAQA 3VP0A 2FFFB 1WYBA 1Q2PA 3N6IA 1EI5A 2JBFA 1H8ZA 1K6RA 1ES4A 1MWUA 2WKEA 1PW8A 1L2SA 4KQOA 2Y2QA 5FAPA 5HARA 5HW3A 5BOHA 1KDWA 4S2JA 4IBRA 3FKVA 1W8QA 1JWZA 1QMEA 2XFTA 3HLDA 5J8XA 3P09A 5CTMA 3UY6A 1K25A 1XKZA 2WZZA 3MXSA 4MBKA 3V50A 4OOLA 4HBUA 3OPLA 1YLWA 4X53A 1H5XA 2DRWA 4XXRA 4B4ZA 2WGVA 3B3XA 2ZC7A 2ZD8A 3HVFA 3O88A 4WZ4A 3UDIA 3HLFA 4JLFA 3FKWA 2HP9A 3NC8A 2XF3A 4QHCA 4OH0A 1SKFA 1XP4A 2P9VB 5DF7A 1QMFA 3IXDA 3FWLA 1W7FA 5TGFA 1ONGA 3UPNA 3IQAA 2ZQDA 5FQQA 3V39A 1YM1A 1BZAA 4LCMA 3VOYA 5A91A 1DJAA 2E8IA 1PYYA 1C3BA 3BFEA 2B5RA 4N9KA 1O07A 5HAPA 4GDNA 4DKIA 1GHPA 4IVKA 3IXBA 4KZ7A 1JTGA 1YLPA 2ZC4B 2IWDA 3C5AA 3WRTA 2HDUA 3OC2A 3PBTA 4U0TA 5CTNA 4X56A 4JXGA 4OPYA 3IH8A 4EQIA 5A90A 2VGKA 4M3KA 3BECA 4FSFA 3QNCA 3HBRA 4PM8A 3VMAA 3EQUA 5FI2A 5KMWA 3IF6B 1K38A 1BUEA 1ESIA 1YQSA 2ZM2A 1RGZA 3HUOA 3NY4A 3E2KA 1TVFA 2I72A 3GR2A 4NETA 4PMAA 1XGIA 4S2MA 4ZJ2A 5HFOA 1HD8A 3M2JA 2BG1A 4PM9A 5DVAA 5M18A 3O3VA 1S6RA 1XX2A 2Y2IA 3C7UA 1ZC2A 4DF6A 3VSLA 4P6BA 3ZNYA 1BLCA 2ZQ9A 3W4PA 1LHYA 1RGYA 1LI0A 1Z6FA 2H5SA 4FH2A 3CMZA 1ERMA 4OPZA 4CPKA 4RX2A 3N8RA 5CERA 1IYQA 2WAEA 3BLSA 3WS0A 1J9MA 2XEPA 5GLCA 3GTCA 4R3JA 3G2YA 4PM6A 4IVIA 1YT4A 1IKIA 4LV0A 5AQAA 3ZG9B 3M6BA 1BLPA 3A3JA 1SDEA 4KZ8A 5DTTA 1YLYA 1MXOA 4WMCD 3HUNA 2Y2GA 5EE8A 1W79A 4KENB 1PWGA 3N4IA 3PBSA 2Y2KA 4Y0UA 4E3JA 2V2FF 2ZM0A 3VP1A 1IYPA 4LV1A 4RVAA 2Q9MA 5FQIA 1E25A 1ERQA 4XUXA 2WAFA 4QU3A 3WWXA 1MY8A 4JXWA 1E3UD 3HUMA 5FASA 3BRMA 2QPNA 1BLHA 2JE5A 4P87A 2X02A 4JF5A 2EFUA 1YLTA 2WGWB 1MWTA 3ZG5A 4N92A 2HDQA 2ZQ7A 2XGNA 3PBQA 4OQ0A 2QMIA 5HAIA 1I2SA 4S2OA 1CI8A 3AGEA 2EX9A 3MFDA 4Y0OA 3VP3A 5M19A 5EECA 2HDSA 4OKPA 4H8RA 4LV3A 4ZDXA 1MKIA 1DY6A 1TDLA 2J9OA 5CEBA 4GN2A 3ZDJA 1LI9A 4WBGA 2JCHA 4X6TA 1JVJA 2GDNA 1GHIA 3ISGA 1PW1A 1DJCA 5EUAA 4JXVA 4S2IA 1YMXA 3IWIA 3O86A 4MBHA 3OPPA 4KQQA 3WRZA 2X71A 4OPQA 3AGDA 5GHZA 3OCLA 1O7EA 4UA9A 3OCNA 1FR6A 5DTSA 3E2LA 5TFQA 1BSGA 5FDHA 4Y0TA 3SS3A 3SH8A 3TSGA 5GL9A 3ZVWA 4QJGA 1ZG6A 3VP4A 2Y55A 4FD8A 4EBPA 2ZC3B 2P9VA 4KZ4A 5CECA 2EX8A 4GOGA 1NXYA 1LL5A 5JYPA 3ZCZA 3IHAA 4HESA 1PZPA 1XA7A 1KE3A 2V20A 1FCNA 1NJ4A 1Y54A 3RXXA 1NYYA 1N4OA 5DF9A 4X55A 1HVBA 4ZBEA 4D2OA 1BTLA 2CC1A 1IELA 2RCXA 5FQMA 5M1AA 3PBNA 3OZHA 1I2WA 2G2WA 4KZAA 4HBTA 2XK1A 3TG9A 2ZJ9A 5E2EA 3W4OA 3G2ZA 1IYSA 4Z9QA 4B4XA 4JPMA 1NZOA 3HL9A 3PAGA 1RCJA 3N8SA 4OP5A 5FAOA 2RL3A 4YINA 4C3QA 3BFFA 1ALQA 3V3SA 3G30A 2A3UA 4BENA 3IWOA 2J7VA 3N7WA 3IF6A 4ZJ1A 1MPLA 2C6WB 1CEFA 1U60A 1H8YA 4BD0A 2R9WA 3UO9A 1N9BA 3UPOA 3JYIA 3ZNTA 3MXRA 3OPHA 2V1ZA 5GHXA 1MBLA 4UA6A 1EROA 2J9PA 2WGIA 4LCLA 4E3NA 1OMEA 4R1GA 5TR7A 2ZM8A 5CHJA 5E43A 2BLSA 3VP2A 3LY4A 4WMCA 4Q8IA 3MKEA 2Y2NA 3SS4A 2Y2MA 4GKUA 2IWBA 2Y4AA 3BFDA 2Y2OA 5FQKA 2OSUA 4OLDA 1K55C 1BLSA 3NDGA 4BLMA 4WM9A 3Q7ZA 1KE0A 1L0EA 2ZC6B 5GLBA 4DDSA 4WEKA 4IBXA 1E3UA 1LL9A 4WELA 4MBFA 3P98A 1MWRA 2XD5A 1YMSA 2XLNA 1JWPA 1CEGA 2ZMAA 2H0YA 4QB8A 4GD8A 3NCKA 4C75A 2PU4A 1I5QA 4N9LA 4E3MA 4MEZA 1YLZA 1JWVA 1W5DA 3G4PA 4X69A 3W4QA 2XR0A 4PPRA 4BL2A 3O87A 1KVLA 4P85A 1ES3A 3DTMA 3UE1A 3VFFA 4HEFA 3UDFA 3TOIA 3PTEA 5F82A 4O7DA 4UA7A 5EVLA 3FV7A 3HLEA 3BLMA 1K4EA 3S1YA 1TDGA 3IF6C 3HREA 2WGWA 5I94A 1KVMA 1K6SA 4OVDA 5L2FA 1W8YA 2Q9NA 3GV9A 2A49A 1L0DA 5G18A 1PWCA 1NRFA 5KZHA 4DE2A 5EPHA 4S2PA 1KGFA 2X01A 5FSRA 4X68A 2XFSA 4FCFA 3DWKA 3Q7VA 4E3LA 4KQRA 4OPRA 2DNSA 3GSGA 5CGSA 4U3TA 3A3EA 1EWZA 3WS4A 1IKGA 1PIOA 4EBNA 1FSWA 1IEMA 1K4FA 3Q81A 1K56D 1CK3A 3MKFA 2ZQCA 3LEZA 4DRTA 4Y7PA 1G6AA 5E2GA 4GDBA 2WYXA 4WZ5A 3Q7VB 1M40A 4K91A 3LY3A 5FQJA 3M2KA 3RXWA 3PBOA 1ZKJA 4R3BA 4CJNA 4L0LA 4DE1A 2UWXA 2Z2MB 1PI5A 2QZ6A 3IH9A 5F83A 1ONHA 4S2NA 3NIAA 2OLUA 4R23A 1K57A 1SCWA 2WKIA 2ZQAA 1TEMA 1YLJA 3IWQA 4K0WA 4ZAMA 4ZJ3A 3IXHA 3ITAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S2K A;  1PI4 A;  4OQG A;  1WYC A;  4RA7 A;  3SS5 A;  5A92 A;  4KG6 A;  2P74 A;  2Z2L B;  1SDN A;  1MWS A;  4E3K A;  4E6X A;  4U0X A;  3V5M A;  1ZG4 A;  5FI6 A;  5FAQ A;  1XXM A;  3UNW A;  5F1G A;  3AGF A;  1NZU A;  1CI9 A;  1PZO A;  1K55 A;  2Y59 A;  2R9X A;  3V3R A;  2ZLY A;  2OV5 A;  4F94 A;  4PM5 A;  4GNU A;  5GLD A;  4B88 A;  5HL1 A;  2C5W B;  5EOE A;  3I7J A;  4OON A;  4EWF A;  5JYO A;  4DE3 A;  5CRF A;  1K54 A;  3UE0 A;  2Y2H A;  1E4D A;  3RJU A;  2XH9 A;  3BM6 A;  5CGW A;  3VFH A;  3IXG A;  3SOI A;  1GHM A;  3NDE A;  3A3F A;  2HPB A;  2J8Y A;  5HX9 A;  3A3I A;  3VSK A;  3CZD A;  1LLB A;  5CED A;  1G68 A;  1RP5 A;  4PM7 A;  1ES2 A;  1AXB A;  3LCE A;  3HLW A;  4N1H A;  3HLB A;  4IED A;  4WZ5 C;  4RYE A;  4MNR A;  3M6H A;  3W8K A;  1VM1 A;  5E2F A;  3PAE A;  4KG2 A;  1DJB A;  4WYY A;  4DDY A;  3OPR A;  5CGX A;  3MZE A;  4S2N C;  1FQG A;  4OP8 A;  4QY6 A;  1K57 C;  3GRJ A;  3NI9 A;  3G35 A;  1FOF A;  3QHY A;  4KZ5 A;  3ZG8 B;  4EBL A;  3ZG0 A;  1S0W A;  3BFG A;  4KZB A;  2XQZ A;  4OLG A;  1L0F A;  1IYO A;  3G31 A;  3SH7 A;  1BUL A;  4GZB A;  3CJM A;  3GVB A;  3C7V A;  5IHV A;  4BD1 A;  4GD6 A;  3BEB A;  3IF5 A;  1FCM A;  2OLV A;  4DE0 A;  3LO7 A;  1XGJ A;  4BQM A;  4EV4 A;  1VQQ A;  4YFM A;  4E6W A;  3A3D A;  3MZD A;  3BYD A;  3WS1 A;  4ID4 A;  3UPP A;  4OQI A;  5AQB A;  4UAA A;  1KGG A;  4NK3 A;  1KDS A;  3C4P A;  2PU2 A;  2PBY A;  3EQV A;  2VGJ A;  5D3O A;  4E3I A;  3HLC A;  4OQH A;  3NBL A;  5FAT A;  2H10 A;  4S2L A;  1K54 C;  3UDX A;  4LEN A;  4DXC A;  4C6Y A;  2H0T A;  3Q07 A;  3BFC A;  1GA9 A;  4R4S A;  4P0M A;  3FZC A;  2EX2 A;  2WAD A;  3QNB A;  2Y2P A;  1NYM A;  4KZ6 A;  3FYZ A;  3HLG A;  4OOM A;  3S4X A;  1K56 A;  4BJP A;  5U47 A;  5EVI A;  1ES5 A;  2HP5 A;  1JTD A;  2JC7 A;  1ESU A;  4JF6 A;  3CG5 A;  5DF8 A;  2ZQ8 A;  5GLA A;  3ZVT A;  4JXS A;  4UHU A;  4BL3 A;  2HP6 A;  5EVI B;  1KE4 A;  2Y2L A;  5FQ9 A;  3UN7 A;  3WS2 A;  4QD4 A;  3ZHH A;  3N8L A;  4OOY A;  4E3O A;  3C4O A;  2EX6 A;  4ZTK A;  4LV2 A;  4KG5 A;  5KSC A;  3PBR A;  5A93 A;  1FR1 A;  4WEJ A;  2EFX A;  3G34 A;  4JKT A;  1FCO A;  1HZO A;  4N1X A;  3DW0 A;  2FFY A;  3ZGA B;  1HTZ A;  3MBZ A;  2WKH A;  1Q2Q A;  2WUQ A;  3IHB A;  4RX3 A;  1GCE A;  2WK0 A;  4K0X A;  2XD1 A;  1FSY A;  2EXB A;  4R0Q A;  5EVI D;  1SHV A;  3WS5 A;  2G2U A;  3MZF A;  1M6K A;  4QY5 A;  4XUZ A;  3S22 A;  5FA7 A;  1GA0 A;  3ZFZ A;  5F1F A;  1KGE A;  3SH9 A;  4KZ3 A;  4MLL A;  3IT9 A;  5AQ9 A;  5FI7 A;  1PWD A;  2Y2J A;  5CXW A;  5E2H A;  4A5R A;  1L0G A;  4DXB A;  3ITB A;  3G32 A;  4JF4 A;  3Q82 A;  3GQZ A;  5AQ7 A;  4KZ9 A;  4GB7 A;  3UE3 A;  3ZG7 B;  5GHY A;  4EUZ A;  1WE4 A;  4FH4 A;  2XDM A;  1NY0 A;  2Y91 A;  4JBF A;  5CHU A;  2WZX A;  5EVI C;  3VOZ A;  5DTK A;  5CHM A;  4R4R A;  1XA1 A;  3D4F A;  2ZC5 B;  3Q1F A;  1XPB A;  3GMW A;  2EXA A;  2DCF A;  2HDR A;  2IWC A;  3DWZ A;  1BT5 A;  5KSH A;  5EOO A;  5HAQ A;  3VP0 A;  2FFF B;  1WYB A;  1Q2P A;  3N6I A;  1EI5 A;  2JBF A;  1H8Z A;  1K6R A;  1ES4 A;  1MWU A;  2WKE A;  1PW8 A;  1L2S A;  4KQO A;  2Y2Q A;  5FAP A;  5HAR A;  5HW3 A;  5BOH A;  1KDW A;  4S2J A;  4IBR A;  3FKV A;  1W8Q A;  1JWZ A;  1QME A;  2XFT A;  3HLD A;  5J8X A;  3P09 A;  5CTM A;  3UY6 A;  1K25 A;  1XKZ A;  2WZZ A;  3MXS A;  4MBK A;  3V50 A;  4OOL A;  4HBU A;  3OPL A;  1YLW A;  4X53 A;  1H5X A;  2DRW A;  4XXR A;  4B4Z A;  2WGV A;  3B3X A;  2ZC7 A;  2ZD8 A;  3HVF A;  3O88 A;  4WZ4 A;  3UDI A;  3HLF A;  4JLF A;  3FKW A;  2HP9 A;  3NC8 A;  2XF3 A;  4QHC A;  4OH0 A;  1SKF A;  1XP4 A;  2P9V B;  5DF7 A;  1QMF A;  3IXD A;  3FWL A;  1W7F A;  5TGF A;  1ONG A;  3UPN A;  3IQA A;  2ZQD A;  5FQQ A;  3V39 A;  1YM1 A;  1BZA A;  4LCM A;  3VOY A;  5A91 A;  1DJA A;  2E8I A;  1PYY A;  1C3B A;  3BFE A;  2B5R A;  4N9K A;  1O07 A;  5HAP A;  4GDN A;  4DKI A;  1GHP A;  4IVK A;  3IXB A;  4KZ7 A;  1JTG A;  1YLP A;  2ZC4 B;  2IWD A;  3C5A A;  3WRT A;  2HDU A;  3OC2 A;  3PBT A;  4U0T A;  5CTN A;  4X56 A;  4JXG A;  4OPY A;  3IH8 A;  4EQI A;  5A90 A;  2VGK A;  4M3K A;  3BEC A;  4FSF A;  3QNC A;  3HBR A;  4PM8 A;  3VMA A;  3EQU A;  5FI2 A;  5KMW A;  3IF6 B;  1K38 A;  1BUE A;  1ESI A;  1YQS A;  2ZM2 A;  1RGZ A;  3HUO A;  3NY4 A;  3E2K A;  1TVF A;  2I72 A;  3GR2 A;  4NET A;  4PMA A;  1XGI A;  4S2M A;  4ZJ2 A;  5HFO A;  1HD8 A;  3M2J A;  2BG1 A;  4PM9 A;  5DVA A;  5M18 A;  3O3V A;  1S6R A;  1XX2 A;  2Y2I A;  3C7U A;  1ZC2 A;  4DF6 A;  3VSL A;  4P6B A;  3ZNY A;  1BLC A;  2ZQ9 A;  3W4P A;  1LHY A;  1RGY A;  1LI0 A;  1Z6F A;  2H5S A;  4FH2 A;  3CMZ A;  1ERM A;  4OPZ A;  4CPK A;  4RX2 A;  3N8R A;  5CER A;  1IYQ A;  2WAE A;  3BLS A;  3WS0 A;  1J9M A;  2XEP A;  5GLC A;  3GTC A;  4R3J A;  3G2Y A;  4PM6 A;  4IVI A;  1YT4 A;  1IKI A;  4LV0 A;  5AQA A;  3ZG9 B;  3M6B A;  1BLP A;  3A3J A;  1SDE A;  4KZ8 A;  5DTT A;  1YLY A;  1MXO A;  4WMC D;  3HUN A;  2Y2G A;  5EE8 A;  1W79 A;  4KEN B;  1PWG A;  3N4I A;  3PBS A;  2Y2K A;  4Y0U A;  4E3J A;  2V2F F;  2ZM0 A;  3VP1 A;  1IYP A;  4LV1 A;  4RVA A;  2Q9M A;  5FQI A;  1E25 A;  1ERQ A;  4XUX A;  2WAF A;  4QU3 A;  3WWX A;  1MY8 A;  4JXW A;  1E3U D;  3HUM A;  5FAS A;  3BRM A;  2QPN A;  1BLH A;  2JE5 A;  4P87 A;  2X02 A;  4JF5 A;  2EFU A;  1YLT A;  2WGW B;  1MWT A;  3ZG5 A;  4N92 A;  2HDQ A;  2ZQ7 A;  2XGN A;  3PBQ A;  4OQ0 A;  2QMI A;  5HAI A;  1I2S A;  4S2O A;  1CI8 A;  3AGE A;  2EX9 A;  3MFD A;  4Y0O A;  3VP3 A;  5M19 A;  5EEC A;  2HDS A;  4OKP A;  4H8R A;  4LV3 A;  4ZDX A;  1MKI A;  1DY6 A;  1TDL A;  2J9O A;  5CEB A;  4GN2 A;  3ZDJ A;  1LI9 A;  4WBG A;  2JCH A;  4X6T A;  1JVJ A;  2GDN A;  1GHI A;  3ISG A;  1PW1 A;  1DJC A;  5EUA A;  4JXV A;  4S2I A;  1YMX A;  3IWI A;  3O86 A;  4MBH A;  3OPP A;  4KQQ A;  3WRZ A;  2X71 A;  4OPQ A;  3AGD A;  5GHZ A;  3OCL A;  1O7E A;  4UA9 A;  3OCN A;  1FR6 A;  5DTS A;  3E2L A;  5TFQ A;  1BSG A;  5FDH A;  4Y0T A;  3SS3 A;  3SH8 A;  3TSG A;  5GL9 A;  3ZVW A;  4QJG A;  1ZG6 A;  3VP4 A;  2Y55 A;  4FD8 A;  4EBP A;  2ZC3 B;  2P9V A;  4KZ4 A;  5CEC A;  2EX8 A;  4GOG A;  1NXY A;  1LL5 A;  5JYP A;  3ZCZ A;  3IHA A;  4HES A;  1PZP A;  1XA7 A;  1KE3 A;  2V20 A;  1FCN A;  1NJ4 A;  1Y54 A;  3RXX A;  1NYY A;  1N4O A;  5DF9 A;  4X55 A;  1HVB A;  4ZBE A;  4D2O A;  1BTL A;  2CC1 A;  1IEL A;  2RCX A;  5FQM A;  5M1A A;  3PBN A;  3OZH A;  1I2W A;  2G2W A;  4KZA A;  4HBT A;  2XK1 A;  3TG9 A;  2ZJ9 A;  5E2E A;  3W4O A;  3G2Z A;  1IYS A;  4Z9Q A;  4B4X A;  4JPM A;  1NZO A;  3HL9 A;  3PAG A;  1RCJ A;  3N8S A;  4OP5 A;  5FAO A;  2RL3 A;  4YIN A;  4C3Q A;  3BFF A;  1ALQ A;  3V3S A;  3G30 A;  2A3U A;  4BEN A;  3IWO A;  2J7V A;  3N7W A;  3IF6 A;  4ZJ1 A;  1MPL A;  2C6W B;  1CEF A;  1U60 A;  1H8Y A;  4BD0 A;  2R9W A;  3UO9 A;  1N9B A;  3UPO A;  3JYI A;  3ZNT A;  3MXR A;  3OPH A;  2V1Z A;  5GHX A;  1MBL A;  4UA6 A;  1ERO A;  2J9P A;  2WGI A;  4LCL A;  4E3N A;  1OME A;  4R1G A;  5TR7 A;  2ZM8 A;  5CHJ A;  5E43 A;  2BLS A;  3VP2 A;  3LY4 A;  4WMC A;  4Q8I A;  3MKE A;  2Y2N A;  3SS4 A;  2Y2M A;  4GKU A;  2IWB A;  2Y4A A;  3BFD A;  2Y2O A;  5FQK A;  2OSU A;  4OLD A;  1K55 C;  1BLS A;  3NDG A;  4BLM A;  4WM9 A;  3Q7Z A;  1KE0 A;  1L0E A;  2ZC6 B;  5GLB A;  4DDS A;  4WEK A;  4IBX A;  1E3U A;  1LL9 A;  4WEL A;  4MBF A;  3P98 A;  1MWR A;  2XD5 A;  1YMS A;  2XLN A;  1JWP A;  1CEG A;  2ZMA A;  2H0Y A;  4QB8 A;  4GD8 A;  3NCK A;  4C75 A;  2PU4 A;  1I5Q A;  4N9L A;  4E3M A;  4MEZ A;  1YLZ A;  1JWV A;  1W5D A;  3G4P A;  4X69 A;  3W4Q A;  2XR0 A;  4PPR A;  4BL2 A;  3O87 A;  1KVL A;  4P85 A;  1ES3 A;  3DTM A;  3UE1 A;  3VFF A;  4HEF A;  3UDF A;  3TOI A;  3PTE A;  5F82 A;  4O7D A;  4UA7 A;  5EVL A;  3FV7 A;  3HLE A;  3BLM A;  1K4E A;  3S1Y A;  1TDG A;  3IF6 C;  3HRE A;  2WGW A;  5I94 A;  1KVM A;  1K6S A;  4OVD A;  5L2F A;  1W8Y A;  2Q9N A;  3GV9 A;  2A49 A;  1L0D A;  5G18 A;  1PWC A;  1NRF A;  5KZH A;  4DE2 A;  5EPH A;  4S2P A;  1KGF A;  2X01 A;  5FSR A;  4X68 A;  2XFS A;  4FCF A;  3DWK A;  3Q7V A;  4E3L A;  4KQR A;  4OPR A;  2DNS A;  3GSG A;  5CGS A;  4U3T A;  3A3E A;  1EWZ A;  3WS4 A;  1IKG A;  1PIO A;  4EBN A;  1FSW A;  1IEM A;  1K4F A;  3Q81 A;  1K56 D;  1CK3 A;  3MKF A;  2ZQC A;  3LEZ A;  4DRT A;  4Y7P A;  1G6A A;  5E2G A;  4GDB A;  2WYX A;  4WZ5 A;  3Q7V B;  1M40 A;  4K91 A;  3LY3 A;  5FQJ A;  3M2K A;  3RXW A;  3PBO A;  1ZKJ A;  4R3B A;  4CJN A;  4L0L A;  4DE1 A;  2UWX A;  2Z2M B;  1PI5 A;  2QZ6 A;  3IH9 A;  5F83 A;  1ONH A;  4S2N A;  3NIA A;  2OLU A;  4R23 A;  1K57 A;  1SCW A;  2WKI A;  2ZQA A;  1TEM A;  1YLJ A;  3IWQ A;  4K0W A;  4ZAM A;  4ZJ3 A;  3IXH A;  3ITA A; 
#chains in the Genus database with same CATH topology
 1PI4 A;  5EM0 A;  3C38 A;  2ZOH A;  5L07 A;  4GLQ A;  1SDN A;  1MWS A;  4U0X A;  1ZG4 A;  5FI6 A;  5FAQ A;  3AGF A;  1PZO A;  2R9X A;  2ZLY A;  5AVF A;  5GLD A;  4B88 A;  4OON A;  5JYO A;  1DP8 A;  5CRF A;  2Y8H A;  1OT9 A;  5HX9 A;  3VSK A;  3CZD A;  3TJZ C;  4GS9 A;  4IED A;  2O9C A;  5E2F A;  4WYY A;  4DDY A;  3OPR A;  5CGX A;  3MZE A;  3RFB A;  1FOF A;  1YPR A;  4EBL A;  5TBM B;  4KZB A;  1L0F A;  4HP9 A;  2NUP C;  3SZT A;  3G31 A;  5IHV A;  4NG2 A;  3LR4 A;  1FCM A;  4DE0 A;  5CX7 A;  1D06 A;  1VQQ A;  3A3D A;  4ID4 A;  3UPP A;  4UAA A;  3T4J A;  5D3O A;  1OTI A;  3NBL A;  1NRJ A;  2H0T A;  5HPI A;  1GA9 A;  1V9Y A;  4EU0 A;  4KZ6 A;  4OOM A;  3FYZ A;  3HLG A;  1ES5 A;  5HSQ A;  1JTD A;  3R4K A;  5DF8 A;  1N9O A;  4BL3 A;  2Y2L A;  2VGL S;  4E3O A;  3CUE C;  5KSC A;  4WEJ A;  3T4S A;  1S67 L;  1HZO A;  3ZGA B;  2WK0 A;  2XD1 A;  5EVI D;  2J80 A;  3A0S A;  3WS5 A;  2OAP 1;  4QY5 A;  4XUZ A;  5FA7 A;  3IT9 A;  2Y2J A;  4Y2F A;  3Q82 A;  3GQZ A;  4KZ9 A;  2JKT M;  2D02 A;  4EUZ A;  5CHU A;  2WZX A;  5DTK A;  4R4R A;  1XA1 A;  4HIA A;  4GW9 A;  1XPB A;  3CAX A;  4PAU A;  2DCF A;  2HDR A;  5C5K A;  1OTB A;  4Q0J A;  5HAQ A;  2KX6 A;  3VP0 A;  5AVE A;  4KQO A;  1PW8 A;  1L2S A;  1T1C A;  5FAP A;  1PNE A;  3FKV A;  3P09 A;  1T1A A;  1D1J A;  4HBU A;  1YLW A;  2DRW A;  4B4Z A;  3B3X A;  2ZD8 A;  3HVF A;  5TBM A;  3MSH A;  1XP4 A;  3K3D A;  2VA0 A;  3IQA A;  2VGL M;  2ZQD A;  3V39 A;  1YM1 A;  1DJA A;  2FZ0 A;  3BFE A;  2B5R A;  4IVK A;  3FPW A;  5G4Z A;  3WRT A;  2HDU A;  3PBT A;  4F3L B;  3IH8 A;  3S7N A;  4MN6 A;  5FI2 A;  1K38 A;  3KSH A;  3LIC A;  4YNR A;  1TVF A;  2QHK A;  5HDD A;  3M2J A;  3O3V A;  4DF6 A;  1BLC A;  1Z6F A;  2H5S A;  4EUV A;  2VX8 A;  3N8R A;  2XRN A;  4PM6 A;  4LV0 A;  3IX4 A;  5AQA A;  1BLP A;  1XFN A;  3PYP A;  1PWG A;  1VEU A;  2ZM0 A;  4RVA A;  5FQI A;  3LIA A;  1IOU A;  1XFQ A;  4GJ4 A;  1OJ5 A;  3E0Y A;  4O0P A;  1BLH A;  2Y79 A;  3NUL A;  5DKK A;  2ZQ7 A;  5L10 A;  1YKD A;  4Y0O A;  1OT6 A;  5EEC A;  4LV3 A;  4H6J B;  4ZDX A;  3E4P A;  1P0Z A;  3ZDJ A;  3F1O B;  2GDN A;  3B42 A;  2BAS A;  3IWI A;  3O86 A;  4CLC D;  3DTI A;  2D01 A;  3AGD A;  4OPQ A;  4HJ6 A;  3UE6 A;  3E2L A;  2QJ5 A;  2HV1 A;  3SS3 A;  3TSG A;  4DJ2 A;  3VP4 A;  5HZH A;  5CEC A;  2W3G A;  5JYP A;  3IHA A;  1KE3 A;  2PT7 A;  1NYY A;  2JKG A;  3E4O A;  2RCX A;  4Z1W A;  5FQM A;  1I2W A;  2G2W A;  2XK1 A;  4MDZ A;  3UB7 A;  4B4X A;  3PAG A;  1F9I A;  1RCJ A;  2RL3 A;  4C3Q A;  4Y5F A;  4PKY A;  3G30 A;  4WUJ A;  2J7V A;  2R9W A;  2WKR A;  3T1R A;  1N9B A;  3JYI A;  5FEG A;  2V1Z A;  4E3N A;  3B33 A;  2ZM8 A;  1OPX A;  5CHJ A;  3VP2 A;  1P9R A;  5EM1 A;  2Y2M A;  4GKU A;  2IWB A;  1G28 A;  2Y4A A;  3BFD A;  4Y13 A;  2OSU A;  4OLD A;  4BLM A;  1KE0 A;  4WEK A;  4IBX A;  1E3U A;  3OOV A;  2ZMA A;  3O5Y A;  2V9A A;  3G4P A;  2XR0 A;  4BL2 A;  1KVL A;  4P85 A;  2OOL A;  2Q0O A;  2VV6 A;  4O7D A;  3ULF A;  3BLM A;  3PHY A;  4PKY G;  1S1Z A;  1KVM A;  2PYP A;  1K6S A;  5L2F A;  1LSW A;  5EPH A;  3C2W A;  4E3L A;  3F1P B;  4KQR A;  3GSG A;  4H6J A;  5CGS A;  3A3E A;  3Q81 A;  1FSW A;  1IEM A;  2ZQC A;  3F1O A;  4WZ5 A;  4K91 A;  4CJN A;  3BWL A;  4DE1 A;  3E98 A;  2QZ6 A;  4S2N A;  4ZJ3 A;  3ITA A;  4S2K A;  1LL8 A;  3V5M A;  4O8G A;  4NKP A;  1TS8 A;  1XXM A;  2P08 A;  5HL1 A;  3I7J A;  4EWF A;  4DE3 A;  3CI6 A;  2Y2H A;  3RJU A;  3BM6 A;  3VFH A;  1VET A;  4ESP A;  2JKF A;  2HZ5 A;  4PM7 A;  1ES2 A;  1AXB A;  3HLW A;  4WZ5 C;  4MNR A;  3D3O A;  2VEA A;  3EWK A;  4GS9 B;  5K5B A;  4S2N C;  5G4Y A;  3BJN A;  4OP8 A;  4QY6 A;  5HL6 A;  3NI9 A;  2VKS A;  3ZG8 B;  1IYO A;  4HY8 A;  4GD6 A;  3UMD A;  3LO7 A;  1XGJ A;  3HCY A;  3LUQ A;  4YFM A;  1TS7 A;  3VE4 A;  3MZD A;  3EEH A;  1KGG A;  4NK3 A;  1W63 M;  4JGP A;  2PU2 A;  3U4L P;  3EQV A;  2H10 A;  3ZQ5 A;  4DXC A;  3BFC A;  4P0M A;  1EW0 A;  3QNB A;  2WAD A;  1NYM A;  3KO6 A;  1K56 A;  1F2K A;  5EVI A;  5U47 A;  2HP5 A;  3CG5 A;  2ZQ8 A;  5GLA A;  3UN7 A;  3KSF A;  3ZHH A;  4ZTK A;  5A93 A;  1FR1 A;  3G34 A;  3D9Y A;  5F68 A;  5L8M A;  3DW0 A;  5L09 A;  1HTZ A;  3LR3 A;  3QP2 A;  1Q2Q A;  1OTD A;  4RX3 A;  1GCE A;  4K0X A;  1FSY A;  2G2U A;  3S22 A;  1GA0 A;  3SH9 A;  5AQ9 A;  5E2H A;  1T18 A;  3G32 A;  4L9F A;  5EFW A;  4NXF A;  3UE3 A;  1WE4 A;  4FH4 A;  1NY0 A;  4GHI A;  3F1N B;  5EVI C;  5CHM A;  2ZC5 B;  3GMW A;  2V1A A;  2IWC A;  3DWZ A;  1BT5 A;  5KSH A;  1P97 A;  4ME4 A;  1WYB A;  2W3H A;  4RYE A;  2WKE A;  1H8Z A;  2VLG A;  1UGU A;  2W3F A;  2Y2Q A;  2XA7 S;  1W8Q A;  2A2L A;  3HLD A;  4WN5 A;  5I5L A;  1XKZ A;  4MBK A;  3TE8 A;  1H5X A;  2WKQ A;  2P7J A;  5DKL A;  2WGV A;  3LEQ A;  3UB9 A;  2AVX A;  4I5S A;  3FKW A;  2HP9 A;  2XF3 A;  1H3Q A;  5FDS A;  4QHC A;  4OH0 A;  1W7F A;  1ONG A;  2INW A;  4Y3I A;  3CUE A;  3VOY A;  2E8I A;  1PYY A;  1C3B A;  3T12 B;  1YSQ A;  2DMW A;  1O07 A;  5HAP A;  4DKI A;  2VZW A;  2PDR A;  3MS6 A;  3IXB A;  1JTG A;  4IHQ A;  1YLP A;  2ZC4 B;  2YKH A;  2HJE A;  2IWD A;  2O99 A;  3C5A A;  4LPZ A;  4JXG A;  3VMA A;  3EQU A;  3KYZ A;  4MMN A;  1YQS A;  3LR0 A;  3NY4 A;  1F5M A;  3UB5 P;  2I72 A;  4NET A;  1F98 A;  4S2M A;  2BG1 A;  4PM9 A;  3IS2 B;  1XX2 A;  1ZC2 A;  3KYQ A;  1GSV A;  1LI0 A;  4OPZ A;  4FH2 A;  4CPK A;  4HQA A;  3LIF A;  3BLS A;  2XA7 M;  3T4Q A;  4R3J A;  3G2Y A;  3IX3 A;  4IVI A;  3ZG9 B;  1X0O A;  3M6B A;  1ZHH B;  4KZ8 A;  5DTT A;  4X1M A;  5EE8 A;  4I38 A;  3ZYT A;  4E3J A;  2V2F F;  2R78 A;  2Q9M A;  1UWN X;  1ERQ A;  4XUX A;  2M7V A;  2WAF A;  4E04 A;  1MY8 A;  4JXW A;  5FAS A;  2QPN A;  1VEU B;  4P87 A;  3F1N A;  2WGW B;  1MWT A;  2H28 A;  2HDQ A;  1TS0 A;  2Z6D A;  2XGN A;  3PBQ A;  1I2S A;  2EX9 A;  5M19 A;  3VP3 A;  2M1C A;  2V1B A;  4D60 A;  2J9O A;  4WBG A;  2W1T A;  4X6T A;  4Q0I A;  3MXQ A;  1H0M A;  4X25 A;  1ZTU A;  2PRF A;  4MBH A;  4KQQ A;  2I9V A;  2B95 A;  3S7P A;  5GHZ A;  2MJ6 A;  3OCN A;  5FDH A;  2QWS A;  3ZVW A;  1ZG6 A;  2Y55 A;  3LFV A;  3KYE A;  5IS1 A;  1LL5 A;  3ZCZ A;  1H8M A;  2GZA A;  1Y54 A;  4X55 A;  4ZBE A;  4D2O A;  2LB5 A;  5M1A A;  3PBN A;  3W4O A;  1IYS A;  2CMN A;  2O9B A;  3N8S A;  4OP5 A;  3IBR A;  2ZL1 A;  3V3S A;  2A3U A;  3IWO A;  5DFX A;  1MPL A;  2C6W B;  3MXR A;  2J3T C;  4UA6 A;  1ERO A;  1T1B A;  2WGI A;  3IS2 A;  4ARZ B;  4R1G A;  2PR5 A;  4WMC A;  4BBU A;  1S4R A;  3SS4 A;  2K31 A;  2HF6 A;  4HJ4 A;  1PFL A;  1K55 C;  1BLS A;  3HJI A;  5GLB A;  4L9G A;  3E4Q A;  3H82 B;  3TW8 A;  4EET B;  2XD5 A;  3CLO A;  3T1S A;  3MR0 A;  1CEG A;  4HP4 A;  4C75 A;  4GD8 A;  3NCK A;  2PU4 A;  4MEZ A;  3W4Q A;  4PPR A;  5EVE A;  3P7N A;  1OTA A;  1ES3 A;  3UE1 A;  4HEF A;  3UDF A;  3PTE A;  3FV7 A;  5HWT A;  1TDG A;  2WGW A;  2JHE A;  5KZH A;  4S2P A;  3ICY A;  1KGF A;  3PXP A;  2X01 A;  4X68 A;  4FCF A;  3DWK A;  1IKG A;  1K4F A;  1BYW A;  3LEZ A;  5E2G A;  2A24 B;  4GDB A;  1M40 A;  3LY3 A;  4HH3 A;  5FQJ A;  4IJG A;  2VJW A;  3IH9 A;  4LRX C;  3T4L A;  5F83 A;  1Y4O A;  2ZOI A;  4RQ9 A;  4ZAM A;  3IWQ A;  1AWI A;  3VE3 A;  1WYC A;  4RA7 A;  3MF0 A;  2P74 A;  2O9A A;  4CQH A;  4E6X A;  3UNW A;  4AFI A;  1NZU A;  1CI9 A;  2Y59 A;  3V3R A;  4F94 A;  2C5W B;  5EOE A;  2W3E A;  3UE0 A;  1E4D A;  5CGW A;  4P6Z S;  3SOI A;  1GHM A;  3NDE A;  3A3F A;  3A3I A;  5CED A;  1LLB A;  1G68 A;  3LCE A;  1VET B;  3JVV A;  3M6H A;  1VM1 A;  3PAE A;  2JKT I;  2QYB A;  2BTF P;  1S4S A;  4ARZ A;  3GRJ A;  4KZ5 A;  3ZG0 A;  1S0W A;  3BFG A;  2XQZ A;  4LRZ E;  3MQ0 A;  3SH7 A;  4GZB A;  3MQO A;  3C7V A;  3IF5 A;  3T1Q B;  4BQM A;  3FC7 A;  4CLC E;  3H82 A;  3BYD A;  4OQI A;  2KDK A;  1KDS A;  2JKR M;  3C4P A;  4M4X A;  4E3I A;  2VGJ A;  3HLC A;  1ODV A;  1PRQ A;  2W1R A;  3Q07 A;  4R4S A;  4ETX A;  2QJ7 A;  3FZC A;  2EX2 A;  2Y2P A;  3LI8 A;  3S4X A;  4EW7 A;  1YAX A;  4BMW A;  3NOP C;  1ESU A;  3CHW P;  3ZVT A;  4UHU A;  4KQD A;  2HP6 A;  5EVI B;  1KE4 A;  5FQ9 A;  4DN0 A;  2GX5 A;  4QD4 A;  3N8L A;  4OOY A;  2XRO A;  1DP6 A;  4KG5 A;  3PBR A;  2EFX A;  4JKT A;  2B18 A;  4N1X A;  4HOI A;  2A24 A;  1CQA A;  4P6Z M;  1ACF A;  2WKH A;  3DTE A;  3QP6 A;  3NOU C;  3SW1 A;  3ZFZ A;  1KGE A;  3BQ8 A;  5CXW A;  1XJ4 A;  3ITB A;  4GB7 A;  5HWW A;  4EXO A;  4LGW A;  3ZG7 B;  4I3J A;  4JBF A;  3D4F A;  2EXA A;  4GHI B;  3NHQ A;  2KLI A;  2FFF B;  3T4T A;  1Q2P A;  1MWU A;  2JBF A;  2XSS A;  1ES4 A;  1TF1 A;  5HAR A;  5HW3 A;  4B9O A;  1KDW A;  1NWZ A;  4FTX A;  1JWZ A;  1QME A;  2EA9 A;  2XFT A;  5J8X A;  2VK3 A;  5CTM A;  3MJQ A;  3MXS A;  3V50 A;  4OOL A;  1W63 Q;  3QP1 A;  4XXR A;  2ZMF A;  4WZ4 A;  3UDI A;  3HLF A;  3NC8 A;  4B93 A;  5DF7 A;  2P9V B;  3PR6 A;  1QMF A;  3IXD A;  3FWL A;  1L3L A;  5TGF A;  3UPN A;  4UQI S;  1P9W A;  5FQQ A;  4LCM A;  5HD5 A;  3K3C A;  1S66 L;  5A91 A;  3FPV A;  1MC0 A;  2Z6C A;  2WKP A;  1GHP A;  1STZ A;  3LYX A;  2O0Y A;  4KZ7 A;  3QP5 A;  3L9K A;  3OC2 A;  4U0T A;  1T19 A;  2K2N A;  3R7W B;  4X56 A;  5A90 A;  4OPY A;  5J7E A;  5DJU A;  2VGK A;  4M3K A;  3C30 A;  3T4K A;  4FSF A;  4PM8 A;  1IFQ A;  5KMW A;  3HJK A;  4R38 A;  1BUE A;  2PD8 A;  1CF0 A;  2ZM2 A;  3HUO A;  3E2K A;  1G6O A;  4PMA A;  3GR2 A;  1XGI A;  4ZJ2 A;  5DVA A;  5M18 A;  5AJG A;  1N9N A;  4GCZ A;  2Y2I A;  4JGR A;  3C7U A;  3VSL A;  3ZNY A;  4JGO A;  3CPT A;  2ZQ9 A;  4FOF A;  3W4P A;  1LHY A;  1ERM A;  4RX2 A;  1XJ3 A;  1DP9 A;  2WAE A;  3WS0 A;  5GLC A;  1YT4 A;  1IKI A;  4MN7 A;  3A3J A;  1SDE A;  1MXO A;  3HUN A;  2Y2G A;  4KEN B;  2Y2K A;  1IYP A;  4LV1 A;  4EER A;  2GNX A;  4Y17 A;  3WWX A;  1E3U D;  2K7S A;  3HUM A;  4ETZ A;  3S7Q A;  2J3W A;  4UQI M;  3ZG5 A;  3JVU A;  4N92 A;  4CLC B;  1LT0 A;  4S2O A;  3AGE A;  4R70 A;  4HI4 A;  2HDS A;  5LBR A;  1TDL A;  4KUK A;  2JCH A;  1PW1 A;  1DJC A;  3A0V A;  5EUA A;  4JXV A;  2W1T B;  3OPP A;  3NEC A;  2X71 A;  1XJ2 A;  5DTS A;  3LIE A;  4QJG A;  5GL9 A;  4FD8 A;  4EBP A;  2ZC3 B;  2P9V A;  2V0U A;  2EX8 A;  1NXY A;  1VB6 A;  5HDC A;  5FEF A;  3LIB A;  1XA7 A;  1NJ4 A;  5DF9 A;  1LSV A;  1HVB A;  5HD3 A;  1BTL A;  2CC1 A;  2PD7 A;  3OZH A;  3QP8 A;  5DFY A;  3C8C A;  2ZJ9 A;  5E2E A;  1SZV A;  3G2Z A;  4JPM A;  1NZO A;  4XT2 B;  5FAO A;  4YIN A;  1KOU A;  3R7W A;  4IUK A;  1ALQ A;  3N7W A;  1U60 A;  3H9W A;  3GDI A;  1H8Y A;  2ZL1 B;  3UO9 A;  3A0R A;  3ZNT A;  3BW6 A;  4WF0 A;  5GHX A;  1MBL A;  3MMH A;  2ZMV A;  4DMZ A;  5TR7 A;  2OAQ 1;  1S1Y A;  2BLS A;  1TD5 A;  4EEP A;  5F69 A;  3Q7Z A;  4DDS A;  1LL9 A;  4MBF A;  1SKO A;  1YMS A;  1JWP A;  2H0Y A;  4QB8 A;  1I5Q A;  4N9L A;  1YLZ A;  1JWV A;  4X69 A;  4R6L A;  3O87 A;  3DTM A;  3VFF A;  3UB8 A;  3T1X A;  1K4E A;  3EOI A;  3HRE A;  4OVD A;  4CLC A;  2A49 A;  1NRF A;  5FSR A;  2XFS A;  3Q7V A;  2DNS A;  3VOL A;  1EWZ A;  1PIO A;  3IX8 A;  1K56 D;  3MKF A;  1G6A A;  3TRC A;  3PBO A;  4R3B A;  1PI5 A;  2EWV A;  4I39 A;  1ONH A;  2QKP A;  2E8J A;  2OLU A;  1K57 A;  1SCW A;  2ZQA A;  1TEM A;  1YLJ A;  4EQ1 A;  4K0W A;  3IXH A;  4OQG A;  3SS5 A;  5A92 A;  4KG6 A;  2Z2L B;  2GJ3 A;  4E3K A;  4G3K A;  4UEY A;  3MQQ A;  5F1G A;  1Z09 A;  1K55 A;  4X1L A;  2OV5 A;  4PM5 A;  4GNU A;  4CLC C;  5MC7 A;  4XT2 A;  4BBT A;  3K2N A;  1K54 A;  2VV8 A;  3H7W B;  2XH9 A;  3IXG A;  2EWW A;  1WA9 A;  2HPB A;  2J8Y A;  5J4E A;  1FIK A;  1RP5 A;  4N1H A;  3HLB A;  4K08 A;  4JGQ A;  3W8K A;  4L9E A;  2W27 A;  4KG2 A;  1DJB A;  3UME A;  1FQG A;  3OBF A;  1K57 C;  3QHY A;  3G35 A;  4OLG A;  2PYR A;  1BUL A;  3RH8 B;  3CJM A;  3GVB A;  1K0K A;  4BD1 A;  1Y28 A;  3BEB A;  2OLV A;  4QWO A;  3KSG A;  4EV4 A;  4E6W A;  4MCW A;  3FG8 A;  3WS1 A;  4WL9 A;  5AQB A;  3T4O A;  3P01 A;  2KOI A;  2PBY A;  4OQH A;  5FAT A;  2PHY A;  3D72 A;  3BY8 A;  4S2L A;  1K54 C;  3UDX A;  4LEN A;  4O01 A;  4C6Y A;  3LI9 A;  3EGX C;  4EEU A;  4BJP A;  1FIL A;  2JC7 A;  4JF6 A;  4DJ3 A;  1N9L A;  4NEE D;  4JXS A;  1J3W A;  3NJA A;  4NXB A;  1GSW A;  3WS2 A;  5HWV A;  3C4O A;  2EX6 A;  4LV2 A;  3G6O A;  2PBD P;  2HJ9 C;  1FCO A;  4LLO B;  2FFY A;  3RTY A;  3MBZ A;  4HH2 A;  1LSX A;  2WUQ A;  3IHB A;  2EXB A;  4R0Q A;  1SHV A;  2OWH A;  4Y15 A;  1DRM A;  3MZF A;  1V9Z A;  1M6K A;  5F1F A;  5DJT A;  2UV0 E;  4KZ3 A;  4MLL A;  3L7H A;  5FI7 A;  1PWD A;  1NLZ A;  4A5R A;  1L0G A;  4DXB A;  2JN7 A;  4JF4 A;  5AQ7 A;  4PHT A;  3W2Z A;  1GSX A;  5GHY A;  2XDM A;  2Y91 A;  3U2A A;  3VOZ A;  5FL3 A;  3Q1F A;  5EOO A;  2B02 A;  3H7W A;  2L4R A;  3N6I A;  1EI5 A;  1K6R A;  5BOH A;  3T50 A;  4S2J A;  4IBR A;  3EEA A;  3UY6 A;  1K25 A;  2WZZ A;  4I3A A;  4X53 A;  3OPL A;  2VV7 A;  2ZC7 A;  3O88 A;  4JLF A;  2PAV P;  1SKF A;  1A0K A;  1G5U A;  1XJ6 A;  4NXE A;  1BZA A;  2J3T D;  5F5Y A;  4N9K A;  2IA2 A;  4GDN A;  4QPR A;  4F3L A;  3QP4 A;  4G3V A;  5CTN A;  4EQI A;  3BEC A;  3UB6 A;  2V8F A;  3HBR A;  3QNC A;  3IF6 B;  3LID A;  5TJJ A;  1ESI A;  1UWP X;  1RGZ A;  1TS6 A;  3KSI A;  3BQA A;  5HFO A;  2LB9 A;  1HD8 A;  1S6R A;  4P6B A;  1RGY A;  3CMZ A;  5J3W A;  5CER A;  1IYQ A;  1J9M A;  2OWJ A;  2M7U A;  2XEP A;  4NXG A;  3GTC A;  3CPT B;  3LR5 A;  5KIZ A;  5IU1 A;  1YLY A;  4WMC D;  1W79 A;  3N4I A;  1HLU P;  3PBS A;  4Y0U A;  3VP1 A;  1VHM A;  2HGV A;  3OLO A;  1E25 A;  2L0W A;  4QU3 A;  2W3D A;  2NUT C;  3BRM A;  4IUH A;  2JE5 A;  2X02 A;  4JF5 A;  2EFU A;  1YLT A;  5F6A A;  3VV4 A;  5HPF A;  1OJG A;  2V8C A;  4OQ0 A;  4YOF A;  2QMI A;  5HAI A;  1CI8 A;  3MFD A;  4OKP A;  4H8R A;  1MKI A;  1DY6 A;  3JPU A;  5CEB A;  4GN2 A;  4HHD A;  1LI9 A;  2YKF A;  4FUW A;  1JVJ A;  1GHI A;  3ISG A;  4S2I A;  1YMX A;  5IT5 A;  4G3W A;  3WRZ A;  3OCL A;  1O7E A;  4UA9 A;  1FR6 A;  5TFQ A;  1BSG A;  4Y0T A;  3SH8 A;  4KZ4 A;  3NOT C;  4GOG A;  2W0N A;  5A8B A;  3IBJ A;  5HDS A;  4ZRR A;  4HES A;  1PZP A;  4I3I A;  2V20 A;  1FCN A;  2PR6 A;  3RXX A;  4BWI A;  1N4O A;  4HJ3 A;  1D7E A;  1IEL A;  4KZA A;  4HBT A;  3TG9 A;  3S7O A;  4Z9Q A;  4KUO A;  3HL9 A;  2P04 A;  2ZBB A;  3BFF A;  1NLY A;  4BEN A;  3IF6 A;  4ZJ1 A;  1CEF A;  4BD0 A;  1YSP A;  3UPO A;  3OPH A;  2FH5 A;  3DTK A;  2J9P A;  4LCL A;  1OME A;  2ACG A;  5E43 A;  3LY4 A;  3BY9 A;  4Q8I A;  3MKE A;  2Y2N A;  1MZU A;  3GEC A;  2Y2O A;  5FQK A;  3NDG A;  3LGO A;  4WM9 A;  1L0E A;  2ZC6 B;  3V67 A;  4WEL A;  3B47 A;  3P98 A;  1MWR A;  4II7 A;  2XLN A;  3MFX A;  1JNU A;  4R3A A;  4YWZ A;  4E3M A;  1SKO B;  1W5D A;  5EV0 A;  4Q0H A;  4MN5 A;  4BBV A;  3TOI A;  5F82 A;  1MKM A;  4LRY C;  4UA7 A;  5EVL A;  4EES A;  3HLE A;  3DAV A;  3S1Y A;  3IF6 C;  5I94 A;  3F1P A;  1W8Y A;  2Q9N A;  3GV9 A;  1L0D A;  5G18 A;  3DBA A;  1PWC A;  4HNB A;  2V0W A;  4DE2 A;  4WLA A;  4OPR A;  4U3T A;  1OTE A;  2G7U A;  4EBN A;  3WS4 A;  2JKR I;  1CK3 A;  4DRT A;  3KX0 X;  4Y7P A;  2L1M A;  2WYX A;  3Q7V B;  3CWF A;  3M2K A;  3EGD C;  3RXW A;  1ZKJ A;  4L0L A;  2UWX A;  2Z2M B;  4LFU A;  3NIA A;  4R23 A;  2WKI A;  3CIT A;  1CJF A; 
#chains in the Genus database with same CATH homology
 4S2K A;  1PI4 A;  4OQG A;  1WYC A;  4RA7 A;  3SS5 A;  5A92 A;  4KG6 A;  2P74 A;  2Z2L B;  1SDN A;  1MWS A;  4E3K A;  4E6X A;  4U0X A;  3V5M A;  1ZG4 A;  5FI6 A;  5FAQ A;  1XXM A;  3UNW A;  5F1G A;  3AGF A;  1NZU A;  1CI9 A;  1PZO A;  1K55 A;  2Y59 A;  2R9X A;  3V3R A;  2ZLY A;  2OV5 A;  4F94 A;  4PM5 A;  4GNU A;  5GLD A;  4B88 A;  5HL1 A;  2C5W B;  5EOE A;  3I7J A;  4OON A;  4EWF A;  5JYO A;  4DE3 A;  5CRF A;  1K54 A;  3UE0 A;  2Y2H A;  1E4D A;  3RJU A;  2XH9 A;  3BM6 A;  5CGW A;  3VFH A;  3IXG A;  3SOI A;  1GHM A;  3NDE A;  3A3F A;  2HPB A;  2J8Y A;  5HX9 A;  3A3I A;  3VSK A;  3CZD A;  1LLB A;  5CED A;  1G68 A;  1RP5 A;  4PM7 A;  1ES2 A;  1AXB A;  3LCE A;  3HLW A;  4N1H A;  3HLB A;  4IED A;  4WZ5 C;  4RYE A;  4MNR A;  3M6H A;  3W8K A;  1VM1 A;  5E2F A;  3PAE A;  4KG2 A;  1DJB A;  4WYY A;  4DDY A;  3OPR A;  5CGX A;  3MZE A;  4S2N C;  1FQG A;  4OP8 A;  4QY6 A;  1K57 C;  3GRJ A;  3NI9 A;  3G35 A;  1FOF A;  3QHY A;  4KZ5 A;  3ZG8 B;  4EBL A;  3ZG0 A;  1S0W A;  3BFG A;  4KZB A;  2XQZ A;  4OLG A;  1L0F A;  1IYO A;  3G31 A;  3SH7 A;  1BUL A;  4GZB A;  3CJM A;  3GVB A;  3C7V A;  5IHV A;  4BD1 A;  4GD6 A;  3BEB A;  3IF5 A;  1FCM A;  2OLV A;  4DE0 A;  3LO7 A;  1XGJ A;  4BQM A;  4EV4 A;  1VQQ A;  4YFM A;  4E6W A;  3A3D A;  3MZD A;  3BYD A;  3WS1 A;  4ID4 A;  3UPP A;  4OQI A;  5AQB A;  4UAA A;  1KGG A;  4NK3 A;  1KDS A;  3C4P A;  2PU2 A;  2PBY A;  3EQV A;  2VGJ A;  5D3O A;  4E3I A;  3HLC A;  4OQH A;  3NBL A;  5FAT A;  2H10 A;  4S2L A;  1K54 C;  3UDX A;  4LEN A;  4DXC A;  4C6Y A;  2H0T A;  3Q07 A;  3BFC A;  1GA9 A;  4R4S A;  4P0M A;  3FZC A;  2EX2 A;  2WAD A;  3QNB A;  2Y2P A;  1NYM A;  4KZ6 A;  3FYZ A;  3HLG A;  4OOM A;  3S4X A;  1K56 A;  4BJP A;  5U47 A;  5EVI A;  1ES5 A;  2HP5 A;  1JTD A;  2JC7 A;  1ESU A;  4JF6 A;  3CG5 A;  5DF8 A;  2ZQ8 A;  5GLA A;  3ZVT A;  4JXS A;  4UHU A;  4BL3 A;  2HP6 A;  5EVI B;  1KE4 A;  2Y2L A;  5FQ9 A;  3UN7 A;  3WS2 A;  4QD4 A;  3ZHH A;  3N8L A;  4OOY A;  4E3O A;  3C4O A;  2EX6 A;  4ZTK A;  4LV2 A;  4KG5 A;  5KSC A;  3PBR A;  5A93 A;  1FR1 A;  4WEJ A;  2EFX A;  3G34 A;  4JKT A;  1FCO A;  1HZO A;  4N1X A;  3DW0 A;  2FFY A;  3ZGA B;  1HTZ A;  3MBZ A;  2WKH A;  1Q2Q A;  2WUQ A;  3IHB A;  4RX3 A;  1GCE A;  2WK0 A;  4K0X A;  2XD1 A;  1FSY A;  2EXB A;  4R0Q A;  5EVI D;  1SHV A;  3WS5 A;  2G2U A;  3MZF A;  1M6K A;  4QY5 A;  4XUZ A;  3S22 A;  5FA7 A;  1GA0 A;  3ZFZ A;  5F1F A;  1KGE A;  3SH9 A;  4KZ3 A;  4MLL A;  3IT9 A;  5AQ9 A;  5FI7 A;  1PWD A;  2Y2J A;  5CXW A;  5E2H A;  4A5R A;  1L0G A;  4DXB A;  3ITB A;  3G32 A;  4JF4 A;  3Q82 A;  3GQZ A;  5AQ7 A;  4KZ9 A;  4GB7 A;  3UE3 A;  3ZG7 B;  5GHY A;  4EUZ A;  1WE4 A;  4FH4 A;  2XDM A;  1NY0 A;  2Y91 A;  4JBF A;  5CHU A;  2WZX A;  5EVI C;  3VOZ A;  5DTK A;  5CHM A;  4R4R A;  1XA1 A;  3D4F A;  2ZC5 B;  3Q1F A;  1XPB A;  3GMW A;  2EXA A;  2DCF A;  2HDR A;  2IWC A;  3DWZ A;  1BT5 A;  5KSH A;  5EOO A;  5HAQ A;  3VP0 A;  2FFF B;  1WYB A;  1Q2P A;  3N6I A;  1EI5 A;  2JBF A;  1H8Z A;  1K6R A;  1ES4 A;  1MWU A;  2WKE A;  1PW8 A;  1L2S A;  4KQO A;  2Y2Q A;  5FAP A;  5HAR A;  5HW3 A;  5BOH A;  1KDW A;  4S2J A;  4IBR A;  3FKV A;  1W8Q A;  1JWZ A;  1QME A;  2XFT A;  3HLD A;  5J8X A;  3P09 A;  5CTM A;  3UY6 A;  1K25 A;  1XKZ A;  2WZZ A;  3MXS A;  4MBK A;  3V50 A;  4OOL A;  4HBU A;  3OPL A;  1YLW A;  4X53 A;  1H5X A;  2DRW A;  4XXR A;  4B4Z A;  2WGV A;  3B3X A;  2ZC7 A;  2ZD8 A;  3HVF A;  3O88 A;  4WZ4 A;  3UDI A;  3HLF A;  4JLF A;  3FKW A;  2HP9 A;  3NC8 A;  2XF3 A;  4QHC A;  4OH0 A;  1SKF A;  1XP4 A;  2P9V B;  5DF7 A;  1QMF A;  3IXD A;  3FWL A;  1W7F A;  5TGF A;  1ONG A;  3UPN A;  3IQA A;  2ZQD A;  5FQQ A;  3V39 A;  1YM1 A;  1BZA A;  4LCM A;  3VOY A;  5A91 A;  1DJA A;  2E8I A;  1PYY A;  1C3B A;  3BFE A;  2B5R A;  4N9K A;  1O07 A;  5HAP A;  4GDN A;  4DKI A;  1GHP A;  4IVK A;  3IXB A;  4KZ7 A;  1JTG A;  1YLP A;  2ZC4 B;  2IWD A;  3C5A A;  3WRT A;  2HDU A;  3OC2 A;  3PBT A;  4U0T A;  5CTN A;  4X56 A;  4JXG A;  4OPY A;  3IH8 A;  4EQI A;  5A90 A;  2VGK A;  4M3K A;  3BEC A;  4FSF A;  3QNC A;  3HBR A;  4PM8 A;  3VMA A;  3EQU A;  5FI2 A;  5KMW A;  3IF6 B;  1K38 A;  1BUE A;  1ESI A;  1YQS A;  2ZM2 A;  1RGZ A;  3HUO A;  3NY4 A;  3E2K A;  1TVF A;  2I72 A;  3GR2 A;  4NET A;  4PMA A;  1XGI A;  4S2M A;  4ZJ2 A;  5HFO A;  1HD8 A;  3M2J A;  2BG1 A;  4PM9 A;  5DVA A;  5M18 A;  3O3V A;  1S6R A;  1XX2 A;  2Y2I A;  3C7U A;  1ZC2 A;  4DF6 A;  3VSL A;  4P6B A;  3ZNY A;  1BLC A;  2ZQ9 A;  3W4P A;  1LHY A;  1RGY A;  1LI0 A;  1Z6F A;  2H5S A;  4FH2 A;  3CMZ A;  1ERM A;  4OPZ A;  4CPK A;  4RX2 A;  3N8R A;  5CER A;  1IYQ A;  2WAE A;  3BLS A;  3WS0 A;  1J9M A;  2XEP A;  5GLC A;  3GTC A;  4R3J A;  3G2Y A;  4PM6 A;  4IVI A;  1YT4 A;  1IKI A;  4LV0 A;  5AQA A;  3ZG9 B;  3M6B A;  1BLP A;  3A3J A;  1SDE A;  4KZ8 A;  5DTT A;  1YLY A;  1MXO A;  4WMC D;  3HUN A;  2Y2G A;  5EE8 A;  1W79 A;  4KEN B;  1PWG A;  3N4I A;  3PBS A;  2Y2K A;  4Y0U A;  4E3J A;  2V2F F;  2ZM0 A;  3VP1 A;  1IYP A;  4LV1 A;  4RVA A;  2Q9M A;  5FQI A;  1E25 A;  1ERQ A;  4XUX A;  2WAF A;  4QU3 A;  3WWX A;  1MY8 A;  4JXW A;  1E3U D;  3HUM A;  5FAS A;  3BRM A;  2QPN A;  1BLH A;  2JE5 A;  4P87 A;  2X02 A;  4JF5 A;  2EFU A;  1YLT A;  2WGW B;  1MWT A;  3ZG5 A;  4N92 A;  2HDQ A;  2ZQ7 A;  2XGN A;  3PBQ A;  4OQ0 A;  2QMI A;  5HAI A;  1I2S A;  4S2O A;  1CI8 A;  3AGE A;  2EX9 A;  3MFD A;  4Y0O A;  3VP3 A;  5M19 A;  5EEC A;  2HDS A;  4OKP A;  4H8R A;  4LV3 A;  4ZDX A;  1MKI A;  1DY6 A;  1TDL A;  2J9O A;  5CEB A;  4GN2 A;  3ZDJ A;  1LI9 A;  4WBG A;  2JCH A;  4X6T A;  1JVJ A;  2GDN A;  1GHI A;  3ISG A;  1PW1 A;  1DJC A;  5EUA A;  4JXV A;  4S2I A;  1YMX A;  3IWI A;  3O86 A;  4MBH A;  3OPP A;  4KQQ A;  3WRZ A;  2X71 A;  4OPQ A;  3AGD A;  5GHZ A;  3OCL A;  1O7E A;  4UA9 A;  3OCN A;  1FR6 A;  5DTS A;  3E2L A;  5TFQ A;  1BSG A;  5FDH A;  4Y0T A;  3SS3 A;  3SH8 A;  3TSG A;  5GL9 A;  3ZVW A;  4QJG A;  1ZG6 A;  3VP4 A;  2Y55 A;  4FD8 A;  4EBP A;  2ZC3 B;  2P9V A;  4KZ4 A;  5CEC A;  2EX8 A;  4GOG A;  1NXY A;  1LL5 A;  5JYP A;  3ZCZ A;  3IHA A;  4HES A;  1PZP A;  1XA7 A;  1KE3 A;  2V20 A;  1FCN A;  1NJ4 A;  1Y54 A;  3RXX A;  1NYY A;  1N4O A;  5DF9 A;  4X55 A;  1HVB A;  4ZBE A;  4D2O A;  1BTL A;  2CC1 A;  1IEL A;  2RCX A;  5FQM A;  5M1A A;  3PBN A;  3OZH A;  1I2W A;  2G2W A;  4KZA A;  4HBT A;  2XK1 A;  3TG9 A;  2ZJ9 A;  5E2E A;  3W4O A;  3G2Z A;  1IYS A;  4Z9Q A;  4B4X A;  4JPM A;  1NZO A;  3HL9 A;  3PAG A;  1RCJ A;  3N8S A;  4OP5 A;  5FAO A;  2RL3 A;  4YIN A;  4C3Q A;  3BFF A;  1ALQ A;  3V3S A;  3G30 A;  2A3U A;  4BEN A;  3IWO A;  2J7V A;  3N7W A;  3IF6 A;  4ZJ1 A;  1MPL A;  2C6W B;  1CEF A;  1U60 A;  1H8Y A;  4BD0 A;  2R9W A;  3UO9 A;  1N9B A;  3UPO A;  3JYI A;  3ZNT A;  3MXR A;  3OPH A;  2V1Z A;  5GHX A;  1MBL A;  4UA6 A;  1ERO A;  2J9P A;  2WGI A;  4LCL A;  4E3N A;  1OME A;  4R1G A;  5TR7 A;  2ZM8 A;  5CHJ A;  5E43 A;  2BLS A;  3VP2 A;  3LY4 A;  4WMC A;  4Q8I A;  3MKE A;  2Y2N A;  3SS4 A;  2Y2M A;  4GKU A;  2IWB A;  2Y4A A;  3BFD A;  2Y2O A;  5FQK A;  2OSU A;  4OLD A;  1K55 C;  1BLS A;  3NDG A;  4BLM A;  4WM9 A;  3Q7Z A;  1KE0 A;  1L0E A;  2ZC6 B;  5GLB A;  4DDS A;  4WEK A;  4IBX A;  1E3U A;  1LL9 A;  4WEL A;  4MBF A;  3P98 A;  1MWR A;  2XD5 A;  1YMS A;  2XLN A;  1JWP A;  1CEG A;  2ZMA A;  2H0Y A;  4QB8 A;  4GD8 A;  3NCK A;  4C75 A;  2PU4 A;  1I5Q A;  4N9L A;  4E3M A;  4MEZ A;  1YLZ A;  1JWV A;  1W5D A;  3G4P A;  4X69 A;  3W4Q A;  2XR0 A;  4PPR A;  4BL2 A;  3O87 A;  1KVL A;  4P85 A;  1ES3 A;  3DTM A;  3UE1 A;  3VFF A;  4HEF A;  3UDF A;  3TOI A;  3PTE A;  5F82 A;  4O7D A;  4UA7 A;  5EVL A;  3FV7 A;  3HLE A;  3BLM A;  1K4E A;  3S1Y A;  1TDG A;  3IF6 C;  3HRE A;  2WGW A;  5I94 A;  1KVM A;  1K6S A;  4OVD A;  5L2F A;  1W8Y A;  2Q9N A;  3GV9 A;  2A49 A;  1L0D A;  5G18 A;  1PWC A;  1NRF A;  5KZH A;  4DE2 A;  5EPH A;  4S2P A;  1KGF A;  2X01 A;  5FSR A;  4X68 A;  2XFS A;  4FCF A;  3DWK A;  3Q7V A;  4E3L A;  4KQR A;  4OPR A;  2DNS A;  3GSG A;  5CGS A;  4U3T A;  3A3E A;  1EWZ A;  3WS4 A;  1IKG A;  1PIO A;  4EBN A;  1FSW A;  1IEM A;  1K4F A;  3Q81 A;  1K56 D;  1CK3 A;  3MKF A;  2ZQC A;  3LEZ A;  4DRT A;  4Y7P A;  1G6A A;  5E2G A;  4GDB A;  2WYX A;  4WZ5 A;  3Q7V B;  1M40 A;  4K91 A;  3LY3 A;  5FQJ A;  3M2K A;  3RXW A;  3PBO A;  1ZKJ A;  4R3B A;  4CJN A;  4L0L A;  4DE1 A;  2UWX A;  2Z2M B;  1PI5 A;  2QZ6 A;  3IH9 A;  5F83 A;  1ONH A;  4S2N A;  3NIA A;  2OLU A;  4R23 A;  1K57 A;  1SCW A;  2WKI A;  2ZQA A;  1TEM A;  1YLJ A;  3IWQ A;  4K0W A;  4ZAM A;  4ZJ3 A;  3IXH A;  3ITA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...