3I7JA

Crystal structure of a beta-lactamase (mb2281c) from mycobacterium bovis, northeast structural genomics consortium target mbr246
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
273
structure length
273
Chain Sequence
TALEVLGGWPVPAAAAAVIGPAGVLATHGDTARVFALASVTKPLVARAAQVAVEEGVVNLDTPAGPPGSTVRHLLAHTSGLAMHSDQALARPGTRRMYSNYGFTVLAESVQRESGIEFGRYLTEAVCEPLGMVTTRLDGGPAAAGFGATSTVADLAVFAGDLLRPSTVSAQMHADATTVQFPGLDGVLPGYGVQRPNDWGLGFEIRNSKSPHWTGECNSTRTFGHFGQSGGFIWVDPKADLALVVLTARDFGDWALDLWPAISDAVLAEYTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target MbR246
rcsb
source organism Mycobacterium bovis
molecule tags Hydrolase
molecule keywords beta-lactamase Mb2281c
total genus 75
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3i7jA00
4UA6A 5KZHA 4GKUA 4OKPA 1PIOA 1IYPA 4LV3A 3PAEA 3MXRA 3EQUA 5EUAA 3EQVA 4S2LA 3ITBA 2BG1A 4IEDA 3ZHHA 4DE3A 1H5XA 1IYQA 3N6IA 3G30A 4C75A 1W8QA 4ZJ2A 3NDGA 3UPPA 3PBOA 4GB7A 4PM7A 5KSHA 4GD6A 5KSCA 1Y54A 2V1ZA 1ERQA 2Y55A 3OZHA 4WZ5C 3S1YA 5EPHA 3RJUA 2XLNA 4ZBEA 5HAIA 4OVDA 1XA7A 2BLSA 1YLYA 2FFYA 3Q7VB 4QU3A 2JC7A 3HLEA 5FAOA 2XD1A 2WUQA 4S2MA 3G31A 4DF6A 5U47A 1JWPA 2Y2HA 3MZFA 1K25A 4JXWA 1WYBA 4PPRA 5D3OA 1LI0A 3SH9A 1K4EA 3LY3A 4PMAA 5FQIA 3B3XA 4X53A 4MBKA 4N92A 3FKVA 5E2FA 3OPLA 1KE4A 2DCFA 1C3BA 1ZC2A 1DJBA 3UDFA 3VP3A 1GA9A 3ZG9B 1ZG4A 2WKEA 3MFDA 5F83A 2XD5A 3GRJA 5GLDA 2OLUA 4YFMA 3HUNA 2Y2NA 1CK3A 1JWVA 4NK3A 2ZD8A 2PBYA 1KGFA 5GL9A 4EBLA 4JKTA 1GHIA 5GLAA 2EX8A 2EXBA 3O87A 4GN2A 4K0WA 5HAPA 4R4SA 1KGGA 1SKFA 3GMWA 3NIAA 2A49A 1YT4A 2PU4A 1Q2QA 4S2NC 5AQ7A 1L0GA 1BULA 3P09A 3PTEA 4KZ4A 3W4QA 2CC1A 3WRTA 3GTCA 4K91A 2E8IA 4OQ0A 3TG9A 3UDXA 4C6YA 4ZJ1A 2HDSA 1XX2A 4WZ5A 2ZM0A 3TOIA 4QJGA 1G6AA 4WBGA 4B88A 2WKIA 4QB8A 1L0DA 2Y2PA 2Y91A 4JXGA 4MNRA 1HVBA 5HFOA 4K0XA 3GR2A 3HLBA 4WEJA 5M19A 5FQQA 3VFFA 1DJCA 2Y2KA 1BLSA 3ZVWA 1NRFA 4PM8A 5A93A 4X55A 1S0WA 4EV4A 2HDUA 4WM9A 5EVID 4E3OA 3PBTA 4ID4A 2Y2MA 1XKZA 3NCKA 5DVAA 3A3EA 5M18A 1IYSA 1BSGA 3G4PA 4GOGA 3IWQA 5HW3A 2WADA 5FI2A 4DDYA 3MKFA 4OLDA 3W4OA 3N4IA 4KZ8A 3FWLA 4Q8IA 3ZGAB 1ESUA 1ZG6A 2ZQCA 4XUXA 3Q7VA 4OQIA 3V3SA 2DRWA 4DE0A 2OV5A 4ZTKA 1RP5A 1CEGA 2IWCA 5F1FA 1L0EA 3C7VA 1PW1A 2IWBA 3VP0A 1GHPA 1L0FA 4X69A 1PZOA 4WMCD 3G32A 4BQMA 3VP4A 2XFSA 3GV9A 4GDNA 1XA1A 1M6KA 4E3JA 3P98A 5EVIB 3WS2A 3IT9A 1Z6FA 3SH7A 4QD4A 1W79A 1L2SA 3FV7A 2H0TA 3HVFA 4P6BA 5A91A 2ZQ7A 2Y2JA 3NY4A 2UWXA 1MXOA 3NBLA 4ZAMA 4LCLA 2Y2GA 2ZM8A 1KE3A 1E3UD 4U3TA 5CXWA 2EFUA 3IXDA 1MBLA 3O88A 4FH4A 4MLLA 4E3KA 4N1HA 4HESA 4R23A 4IBRA 3V3RA 3BFGA 3GQZA 1GHMA 1KVLA 2RCXA 2WGWA 4R3BA 3ZG7B 1KGEA 4HEFA 5EOEA 1BUEA 3M6HA 4S2JA 1PZPA 3E2KA 2Q9MA 1FR1A 3FKWA 5DTSA 3PAGA 4RX3A 4BL2A 3WS5A 3IF6C 2Y2LA 3HLDA 3WWXA 5CTMA 3GSGA 3PBNA 2QZ6A 2EX6A 3NDEA 3M2JA 2WAFA 3DWKA 5EOOA 2XH9A 4KG2A 3ZFZA 1NJ4A 1I5QA 5CHUA 3RXWA 5KMWA 2XQZA 3MKEA 3ITAA 3C4OA 3GVBA 1LL9A 4LV2A 5CGSA 3UNWA 3G2ZA 1QMFA 1XGIA 4KZAA 4OH0A 1IEMA 3A3DA 2I72A 3IXBA 2Y4AA 2ZC5B 3OPPA 4X56A 2C6WB 5J8XA 3UY6A 4U0TA 2X01A 1PI4A 2XR0A 3BFFA 3VOYA 3SS5A 3BM6A 3IWOA 3A3FA 4P85A 3VSKA 5DF7A 1OMEA 4R1GA 1LI9A 4LV1A 2H0YA 3JYIA 5FQJA 1IKGA 3IH8A 4L0LA 4EBNA 5EVIA 4E3IA 5HX9A 2OLVA 5AQAA 3WRZA 3VFHA 4KG6A 1SDNA 3BECA 5CRFA 5E43A 3OPRA 4KQRA 1YLJA 1K54C 4YINA 5FI7A 3BFEA 3VSLA 1PWDA 1YMSA 4MEZA 4Y7PA 3IF5A 4BJPA 1XGJA 2R9XA 3O3VA 1ALQA 5FI6A 1K57C 3VMAA 3SS4A 1IKIA 4OLGA 3PBQA 4E3MA 1YQSA 4OQGA 3QNBA 4FSFA 4JPMA 3OC2A 4WMCA 3UPNA 4KZ5A 4JXSA 3C7UA 3NC8A 5FSRA 4E6XA 2P9VB 3CJMA 1K57A 4PM9A 3QHYA 3ZVTA 4KENB 3ISGA 1DJAA 1BT5A 2J9PA 4UHUA 3LO7A 3ZG8B 1E4DA 3ZCZA 1MWUA 5HARA 4E3LA 1AXBA 1U60A 1K56A 1G68A 2X02A 4JF5A 3VP1A 2Q9NA 5L2FA 3HL9A 4UAAA 4OQHA 1YLWA 5IHVA 2XGNA 4O7DA 4BENA 3A3IA 1O07A 1TVFA 1WE4A 4PM6A 4XXRA 2P9VA 2J7VA 3IQAA 1PYYA 2H10A 4GD8A 5FQKA 1RGYA 2B5RA 1XP4A 2H5SA 1TDLA 3N8LA 3OCLA 4UA7A 5DTKA 5A92A 4BL3A 5EVLA 1BLHA 5I94A 4FCFA 3ZG5A 3MBZA 1J9MA 3OCNA 4OOLA 1K55C 1CEFA 3G2YA 4IVKA 3SOIA 1S6RA 5GHZA 5CHMA 4LV0A 3UDIA 3W8KA 1JWZA 5F1GA 1NZOA 1XXMA 2JBFA 1IYOA 2FFFB 4MBHA 4P87A 4OP5A 4LCMA 3WS0A 3ZG0A 3C5AA 3DW0A 4EUZA 4EWFA 3LCEA 1ES4A 2G2WA 4MBFA 1FCNA 1SCWA 5E2GA 5E2EA 4OPQA 1ZKJA 1TEMA 3Q82A 5HL1A 2EXAA 4GZBA 4N9LA 4E3NA 4Z9QA 5CHJA 4S2IA 4WZ4A 1H8ZA 2J9OA 2WZXA 3BEBA 2HDQA 2VGJA 2EX2A 3PBRA 5FASA 1BLCA 4KZ3A 4R3JA 3O86A 1GA0A 4EQIA 2Y2IA 4LENA 4QY6A 1SDEA 1PI5A 1BLPA 1DY6A 3UE1A 1LL5A 4KZBA 3MXSA 1K55A 1ES5A 1FCMA 4P0MA 2Y2QA 3AGEA 3BFDA 5FAPA 5FATA 2HP6A 2Y59A 1MWSA 1JVJA 3HBRA 4B4ZA 1FSYA 1K6RA 5CTNA 3V5MA 3IHAA 1K4FA 4IBXA 4KG5A 1H8YA 3TSGA 3LY4A 3QNCA 5GLBA 1N9BA 4KZ9A 1M40A 4OONA 1FQGA 3IF6A 3HLCA 4HBTA 2ZMAA 4RVAA 3V39A 3D4FA 3AGDA 3MZEA 2C5WB 2Z2MB 3Q07A 4ZDXA 3BYDA 4WYYA 2WGWB 3HUMA 3HREA 2WKHA 4DE1A 2WAEA 4JF4A 4CJNA 4F94A 5TGFA 2XFTA 5A90A 4QHCA 5TR7A 2WGVA 1EWZA 1O7EA 3AGFA 4HBUA 3FZCA 4EBPA 3Q1FA 2J8YA 4E6WA 5JYOA 1FR6A 4WELA 4UA9A 4KZ7A 1NYMA 1XPBA 4S2KA 4FH2A 3Q81A 4R4RA 5FQMA 3UO9A 4KQQA 2XF3A 5CGXA 3ZNTA 3ZNYA 2Y2OA 1MKIA 3UN7A 4NETA 5FQ9A 3UPOA 1VQQA 2HP9A 2IWDA 1W5DA 4JXVA 1JTGA 3UE3A 4M3KA 5FDHA 5TFQA 1I2SA 4A5RA 1LHYA 2RL3A 2ZQAA 4JBFA 2R9WA 4OP8A 4BD1A 4DKIA 1CI9A 5BOHA 3CZDA 4GDBA 2ZLYA 2VGKA 2G2UA 2GDNA 4JF6A 2XEPA 1GCEA 2XDMA 4ZJ3A 1BTLA 1NXYA 3W4PA 1CI8A 4WEKA 1E25A 4KZ6A 4Y0UA 3SH8A 4DDSA 3IHBA 2PU2A 3G34A 1ES3A 1KDWA 2V2FF 4CPKA 4H8RA 2WGIA 5EVIC 4OOMA 2HDRA 2OSUA 4S2OA 4B4XA 4JLFA 1K38A 5DF9A 2JE5A 3BLMA 2JCHA 2WZZA 3G35A 1TDGA 2WYXA 3PBSA 5CGWA 3V50A 5DF8A 2ZC7A 2QPNA 4FD8A 5CEDA 1K54A 3N7WA 5GHXA 2QMIA 5HAQA 5E2HA 4OPZA 1RCJA 3UE0A 4N1XA 3VP2A 1FCOA 1ESIA 3VOZA 1KDSA 2XK1A 2HPBA 2X71A 1VM1A 2ZC6B 5GHYA 1ONGA 5AQ9A 5FAQA 5EE8A 3HLWA 1K56D 3IXGA 4RX2A 4X68A 3SS3A 4Y0OA 3BRMA 1YLPA 2P74A 5DTTA 5JYPA 5CERA 4BLMA 4D2OA 4DE2A 2A3UA 1YLTA 4OOYA 1MPLA 5G18A 1K6SA 1E3UA 5CECA 3BLSA 1ONHA 2V20A 4IVIA 4U0XA 4RYEA 4XUZA 2ZM2A 3IXHA 1MWTA 5FA7A 2ZJ9A 4Y0TA 3WS4A 1YLZA 3NI9A 1HZOA 1QMEA 3CMZA 3IF6B 3MZDA 4N9KA 1I2WA 4DXBA 2ZQDA 3E2LA 1LLBA 3WS1A 5CEBA 3A3JA 2HP5A 3FYZA 4RA7A 1PW8A 1NY0A 1JTDA 1KVMA 4PM5A 2EFXA 3BFCA 3C4PA 1NYYA 1WYCA 2ZQ9A 4OPYA 4DRTA 1IELA 2EX9A 2ZQ8A 5F82A 3Q7ZA 1MWRA 1YM1A 1N4OA 4DXCA 5GLCA 1W7FA 3S4XA 3I7JA 1EROA 3LEZA 4QY5A 1PWGA 1FOFA 4OPRA 1BZAA 2WK0A 3M2KA 5AQBA 3DTMA 3HUOA 1NZUA 1ERMA 3N8RA 4BD0A 3ZDJA 1W8YA 4S2PA 2DNSA 1HD8A 4KQOA 3M6BA 3RXXA 5EECA 3HLFA 3IWIA 1YMXA 4GNUA 4S2NA 1FSWA 1PWCA 2ZC4B 2ZC3B 3IH9A 3S22A 3DWZA 4R0QA 4C3QA 2Z2LB 3HLGA 1HTZA 1ES2A 3CG5A 1EI5A 1SHVA 5M1AA 1MY8A 1Q2PA 3N8SA 4X6TA 1KE0A 3OPHA 1RGZA
chains in the Genus database with same CATH superfamily
4UA6A 4GKUA 4LV3A 2L0WA 3ITBA 2OAQ1 4IEDA 3T1RA 1H5XA 4IUHA 3NDGA 4PM7A 4GB7A 5KSCA 4NEED 2V1ZA 3CWFA 2Y55A 5EPHA 5HAIA 1XA7A 2BLSA 2FFYA 2JC7A 2VZWA 4S2MA 3G31A 4GHIB 3IS2B 4PPRA 4PMAA 4MBKA 2PDRA 1KE4A 1LL8A 1ZG4A 3EWKA 3DBAA 3LUQA 3HUNA 5GL9A 4HJ6A 4BMWA 4GHIA 1GHIA 3GECA 4XT2B 1KGGA 3NIAA 4MN7A 1YT4A 4WF0A 3W4QA 2CC1A 3GTCA 3TG9A 3PXPA 1XJ2A 1G6AA 4B88A 4QB8A 4JXGA 1TS8A 2I9VA 4MNRA 4K08A 3GR2A 3MQ0A 4WEJA 1BLSA 3UMDA 2VV6A 3D9YA 2MJ6A 1ODVA 2HDUA 3E4PA 5EVID 4E3OA 2BASA 3PBTA 3S7PA 1G5UA 5DVAA 3G4PA 1BSGA 5HDCA 5DKKA 4MMNA 3W4OA 3N4IA 3C8CA 2ZQCA 3Q7VA 1L0EA 3V67A 1PW1A 2W3HA 2JKFA 4GDNA 4R70A 1M6KA 3WS2A 5EVEA 2NUPC 1W79A 3LIAA 2H0TA 5A91A 4U3TA 3GQZA 2OWHA 5EOEA 3TJZC 4S2JA 3PAGA 4BL2A 4GCZA 3HLDA 3FG8A 2O9BA 2INWA 4GW9A 3WWXA 2QZ6A 2PYRA 2ZL1A 1SKOB 3M2JA 2WAFA 1I5QA 5CHUA 3RXWA 3MKEA 3CHWP 3GVBA 3RFBA 1QMFA 1S66L 4KZAA 2B02A 1IEMA 3A3DA 2P04A 3BFFA 3BM6A 3A3FA 4L0LA 3WRZA 2OLVA 1PRQA 2O0YA 4Y13A 3T4LA 3BFEA 1YMSA 5J4EA 4QWOA 3LR0A 3LR3A 1K57C 3T50A 4OQGA 3A0RA 3OC2A 4KZ5A 3NC8A 2W3GA 1K57A 3U2AA 3QHYA 3ZVTA 5DJUA 1DJAA 3NOUC 1E4DA 2VLGA 1U60A 3ULFA 1HLUP 5L2FA 3HL9A 2W0NA 3C2WA 1CJFA 4PM6A 1WE4A 5EM1A 3T1QB 1XP4A 3N8LA 4X1LA 5I94A 1J9MA 2XROA 4IVKA 3SOIA 3DAVA 4B9OA 2J3TD 3UDIA 3W8KA 5F1GA 2XRNA 4MN5A 2VV7A 5MC7A 4EU0A 2W1TA 3WS0A 4MBFA 1SCWA 5E2EA 1ZKJA 4CQHA 1H8ZA 2J9OA 3BEBA 3PBRA 2EX2A 2B18A 3NHQA 4QY6A 4Q0HA 4KZBA 1FCMA 4O01A 3AGEA 3L7HA 5FAPA 2Y59A 3HBRA 5CTNA 4UQIM 1S4SA 3IHAA 3TSGA 4IBXA 5GLBA 1N9BA 3VE4A 1FQGA 1PNEA 4HBTA 2ZMAA 4B93A 1OT6A 1XFNA 3HREA 2WKHA 4DE1A 3VE3A 4CJNA 4F94A 5TGFA 4ETZA 3QP1A 1OTBA 4UA9A 1P0ZA 3Q81A 2XF3A 5CGXA 4JXVA 2IWDA 1JTGA 2HF6A 1NLZA 1H8MA 1G6OA 4YNRA 4M3KA 5FDHA 5FEFA 4ME4A 3B33A 4BD1A 1CI9A 3QP4A 4GDBA 1NXYA 1CI8A 1E25A 4KZ6A 2GJ3A 4Y0UA 3SH8A 2A24A 3IHBA 4DDSA 3G34A 4H8RA 5EVIC 2OSUA 4S2OA 2JE5A 2JCHA 2WZZA 1GSWA 3MQOA 5CEDA 2VA0A 2PHYA 3N7WA 4E04A 4OPZA 1RCJA 2JKTI 2PD8A 2XK1A 1S4RA 1VM1A 2X71A 2ZC6B 5IU1A 5EE8A 3SS3A 4HP9A 5EFWA 5CERA 4BLMA 1YKDA 4D2OA 2A3UA 1MPLA 1K6SA 3BLSA 2LB5A 4HIAA 4DJ3A 2ZM2A 1OT9A 4DMZA 5HSQA 1YLZA 1QMEA 3CMZA 4N9KA 4DXBA 2ZQDA 3E4OA 3DTKA 1PW8A 4PM5A 3BFCA 3C4PA 1WYCA 1TD5A 1OTIA 1MWRA 3S7NA 4DXCA 1W7FA 2QJ5A 1FOFA 1BZAA 3N8RA 4BD0A 1ERMA 3H82A 3UB5P 3LR5A 5EECA 2ZC4B 3IH9A 2KOIA 4R0QA 4C3QA 4PHTA 2Z2LB 5KZHA 1MC0A 4X1MA 3PAEA 3MXRA 4S2LA 2M7UA 1D06A 4C75A 1W8QA 4ZJ2A 1J3WA 4GD6A 3LEQA 3OZHA 4WZ5C 2XLNA 2JKGA 3HLEA 2WUQA 2HJ9C 2Y2HA 5D3OA 3SH9A 2EWVA 4X53A 3A0SA 4Y5FA 4N92A 3CITA 3LGOA 3OPLA 3VV4A 2DCFA 1DJBA 3VP3A 2QYBA 1YAXA 5GLDA 4YFMA 2HV1A 4EESA 4NK3A 5IS1A 1KGFA 2EXBA 3H9WA 2BTFP 1SKFA 2A49A 1Q2QA 3MS6A 5AQ7A 5FEGA 2V9AA 3PTEA 1OPXA 3WRTA 1OTAA 4OQ0A 3CAXA 1XX2A 1L0DA 1HVBA 5HFOA 5M19A 2ZOIA 5FQQA 1DJCA 5G4ZA 3ZVWA 1NRFA 2W3DA 4X55A 5L10A 4EV4A 1X0OA 2V1AA 2J3WA 3EEAA 1V9ZA 3MFXA 4Q0IA 2Y2MA 1XKZA 2WADA 5FI2A 4II7A 3MKFA 4OLDA 4KZ8A 5HD3A 2JKTM 1T1CA 1ZG6A 4EEPA 4XUXA 4I3IA 1RP5A 4HJ4A 2IWCA 5F1FA 3C7VA 1GHPA 1YSPA 2ZOHA 1L0FA 1F5MA 4X69A 3NULA 4WMCD 3G32A 1FILA 2XFSA 1XA1A 4WL9A 4E3JA 3QP6A 5HDSA 1Z6FA 5TJJA 1L2SA 4G3VA 4MCWA 2ZQ7A 2Y2JA 2UWXA 3NBLA 4ZAMA 4LCLA 1KE3A 1E3UD 2EFUA 1JNUA 4N1HA 4HESA 4R23A 4FOFA 4JGRA 5HZHA 2WGWA 1KVLA 4HHDA 1UWPX 1IOUA 4M4XA 4HY8A 1BUEA 3E2KA 2Q9MA 4UEYA 2QHKA 1T19A 3HJKA 3PYPA 1GSXA 4PKYA 2EX6A 3JVVA 3NDEA 3ZFZA 2QKPA 5KMWA 3BWLA 2XQZA 4WUJA 3QP8A 1LL9A 2XSSA 5CGSA 1XGIA 2Z6DA 1STZA 4JGPA 3IXBA 3OPPA 2C6WB 3UY6A 4U0TA 1PI4A 3VOYA 3SS5A 3IWOA 4R1GA 1LI9A 5FQJA 1IKGA 3IH8A 5EVIA 3VFHA 2GNXA 3EOIA 2CMNA 3LI9A 1Y28A 5FI7A 2M1CA 1PWDA 4Y7PA 2XA7S 4R3AA 2R9XA 1TS7A 3VMAA 1IKIA 3QNBA 4G3KA 2HZ5A 3UB6A 2OOLA 4WMCA 4JXSA 4E6XA 3BY8A 2P9VB 4PM9A 3ISGA 5HDDA 1BT5A 3BQAA 3KYZA 3LO7A 5HARA 1F98A 1YPRA 1K56A 1G68A 5F6AA 1O07A 1SZVA 4XXRA 3T4SA 2P9VA 1SKOA 4Y2FA 3O5YA 2R78A 3T12B 4NXGA 3MBZA 4OOLA 1K55C 3G2YA 4IHQA 3KO6A 3UB7A 5DJTA 2J80A 4GLQA 3H82B 3LIEA 4GS9A 1FCNA 5E2GA 3T4JA 1TEMA 4N9LA 4HH3A 4S2IA 4WZ4A 2FH5A 3KYQA 1N9OA 3LIFA 4G3WA 1ZHHB 1ES5A 4LRXC 5IT5A 2PYPA 1JVJA 4B4ZA 1FSYA 1K6RA 4KG5A 1H8YA 4P6ZM 4KZ9A 4OONA 4PKYG 3AGDA 2C5WB 4WYYA 2WGWB 1NWZA 2XFTA 5A90A 4QHCA 4H6JB 1EWZA 3AGFA 4EETB 1EW0A 1UGUA 2VEAA 3EGDC 3CUEA 4S2KA 1S1YA 4BBTA 3TE8A 4H6JA 4FH2A 3ZNYA 5FQMA 3ZNTA 4IUKA 3UN7A 3UPOA 2HP9A 4YWZA 3JVUA 1S67L 2RL3A 4DKIA 5BOHA 4JF6A 2VGKA 4JGOA 3E98A 3W4PA 3PHYA 4ARZA 2HDRA 3F1OB 1K38A 3BLMA 1TDGA 2ACGA 2WYXA 3QP2A 5DF8A 3F1PA 2L1MA 5GHXA 2QMIA 5HAQA 5E2HA 3UE0A 4N1XA 1ESIA 3VOZA 4EEUA 2VGLS 2HPBA 5AQ9A 3HLWA 3IXGA 4RX2A 4Y0OA 1T18A 3IX8A 3T4KA 4DE2A 4OOYA 3H7WA 3P7NA 4U0XA 3B42A 4RYEA 3UB9A 1V9YA 3IF6B 3H7WB 1I2WA 4KQDA 4ESPA 5CEBA 3A3JA 1W63M 2HP5A 3CI6A 1JTDA 1KVMA 1NYYA 2Y8HA 2ZQ8A 5F82A 1LSXA 3E4QA 3Q7ZA 1YM1A 5AJGA 3S4XA 2FZ0A 5AVEA 4QY5A 2WKRA 2WK0A 2HGVA 3M2KA 3HUOA 1NZUA 3DTEA 3ZDJA 4S2PA 2DNSA 4KQOA 3M6BA 3IWIA 2V8FA 4GNUA 4S2NA 2ZC3B 4BBUA 4HI4A 3MR0A 1MY8A 3B47A 1PFLA 4OKPA 1PIOA 5EUAA 3EQUA 3KSFA 2KDKA 1VHMA 4PAUA 3ZHHA 3U4LP 5LBRA 2VX8A 1VETA 3G30A 1KOUA 5KSHA 1Y54A 1Z09A 5HWTA 3S1YA 2D01A 4OVDA 1YLYA 3Q7VB 3NECA 5FAOA 2XD1A 5DKLA 1CQAA 4DF6A 5U47A 1JWPA 4BWIA 3EGXC 1K25A 1LI0A 1K4EA 5FQIA 3B3XA 5E2FA 3FKVA 3T4OA 4QPRA 1GA9A 3ZG9B 3MFDA 3OBFA 3DTIA 3GRJA 2W3FA 2Y2NA 1CK3A 4EBLA 4JKTA 3TRCA 3FPVA 5GLAA 2EX8A 3O87A 4K0WA 4GN2A 4R4SA 3GMWA 3UB8A 1L0GA 2ZMFA 5EM0A 4EERA 4K91A 3E0YA 2E8IA 1VEUB 4ZJ1A 4QJGA 2VV8A 2WKIA 2Y2PA 2PD7A 3VFFA 2Y2KA 1NRJA 1S1ZA 1Y4OA 5FDSA 1S0WA 4EQ1A 2V1BA 3IBJA 4ID4A 3NCKA 5M18A 4GOGA 3BQ8A 3F1NB 3L9KA 2EA9A 3FWLA 4Q8IA 3V3SA 4DE0A 1CEGA 3IX4A 3VP0A 1P9WA 4I3AA 3GDIA 1WA9A 2HJEA 2QWSA 1A0KA 4KUOA 3CUEC 4LLOB 4LFUA 2EWWA 3NY4A 1D1JA 1TS0A 1LSWA 3IXDA 3O88A 4MLLA 4E3KA 1OJ5A 3BFGA 1GHMA 3ZG7B 1KGEA 1NLYA 3M6HA 4I5SA 5DTSA 1ACFA 1FR1A 3FKWA 4MN6A 5CX7A 4RX3A 4P6ZS 2E8JA 5F69A 5FL3A 3WS5A 3IF6C 2Y2LA 5CTMA 3GSGA 3PBNA 4KUKA 4NXEA 4BBVA 5EOOA 3DWKA 2XH9A 1TS6A 4MDZA 5L07A 4HQAA 3C4OA 3G2ZA 3NOTC 4OH0A 2Y4AA 3CPTA 5J8XA 3R7WB 1N9NA 4DN0A 4P85A 5DF7A 1OMEA 5HPIA 2H0YA 4DJ2A 5G4YA 2AVXA 5HX9A 5TBMA 3T4QA 3D72A 3BECA 5CRFA 1XJ6A 3OPRA 1YLJA 1K54C 4KQRA 4YINA 4MEZA 4BJPA 3O3VA 5FI6A 1XJ4A 5DFXA 2Z6CA 3F1PB 2PAVP 1YQSA 4NKPA 5F5YA 5TBMB 3QP5A 3UPNA 1L3LA 2WKQA 4KENB 2J9PA 2K2NA 4HH2A 3ZG8B 1MWUA 1AXBA 2X02A 3VP1A 3SW1A 4NXBA 3HJIA 2XGNA 2M7VA 4BENA 3A3IA 1TVFA 3IQAA 1PYYA 5FQKA 1RGYA 2B5RA 1TDLA 3OCLA 5DTKA 4BL3A 5EVLA 1BLHA 3IBRA 4FCFA 3ZG5A 4HJ3A 1S6RA 5J7EA 2ZL1B 1UWNX 1BYWA 3RH8B 1OTDA 2JBFA 1IYOA 4MBHA 2PT7A 3ZG0A 3C5AA 3LICA 4CLCA 3ZYTA 2P08A 2A24B 3FC7A 2VK3A 4OPQA 2EXAA 4E3NA 1G28A 4Z9QA 5CHJA 2WZXA 2VGJA 5FASA 1BLCA 5L8MA 1XFQA 3LIDA 3O86A 1GA0A 4LENA 1PI5A 1DY6A 3MXSA 4P0MA 1W63Q 3BFDA 5FATA 3CLOA 5AVFA 1K4FA 5C5KA 1MKMA 3HLCA 4Y15A 4RVAA 1MZUA 3MZEA 3BYDA 5L09A 2WGVA 4HBUA 2J8YA 4E6WA 5JYOA 4WELA 3BW6A 3MXQA 2W27A 1NYMA 3K2NA 4R4RA 5K5BA 3UO9A 4KQQA 4EUVA 5FQ9A 1W5DA 2O99A 3R4KA 1I2SA 4JGQA 1LHYA 2ZQAA 4OP8A 2R9WA 3CZDA 2ZLYA 2G2UA 2GDNA 2XEPA 1GCEA 1BTLA 1AWIA 2YKFA 1FIKA 1OTEA 2V2FF 2WGIA 4OOMA 4B4XA 4JLFA 5DF9A 3PBSA 3G35A 4ETXA 2V8CA 2ZC7A 4F3LA 1K54A 3KSGA 2VKSA 3VP2A 4UQIS 1KDSA 2PR5A 3BJNA 2Y79A 5FAQA 1K56D 1YLPA 5CECA 4NG2A 2V20A 3IXHA 1MWTA 1DP8A 5FA7A 2ZJ9A 4Y0TA 3UMEA 3WS4A 3NI9A 1HZOA 3MZDA 4LGWA 1LLBA 4DRTA 2ZMVA 1IELA 2EX9A 4XT2A 2K31A 4HP4A 2O9AA 2JN7A 2Q0OA 3I7JA 1PWGA 4OPRA 2VJWA 5AQBA 3DTMA 3RXXA 1HD8A 3HLFA 1YMXA 4FUWA 3S22A 3PR6A 1DP6A 5HWWA 2PBDP 1HTZA 1EI5A 1Q2PA 4X6TA 4P87A 3OPHA 1RGZA 1IYPA 3EQVA 2BG1A 4DE3A 1IYQA 3D3OA 3N6IA 3UPPA 3PBOA 1ERQA 3RJUA 4ZBEA 3TW8A 2ZBBA 2G7UA 4QU3A 4I39A 2W3EA 3MZFA 4JXWA 1WYBA 5DFYA 3LY3A 4FTXA 2V0WA 1C3BA 1ZC2A 3UDFA 4HNBA 2WKEA 5F83A 2XD5A 3S7QA 2OLUA 1JWVA 2OWJA 2ZD8A 2PBYA 5HL6A 1CF0A 5HAPA 2PU4A 4S2NC 5KIZA 1BULA 3ZQ5A 3P09A 4KZ4A 2QJ7A 3P01A 3UDXA 4C6YA 3FPWA 2HDSA 4WZ5A 2ZM0A 3TOIA 4WBGA 4O8GA 4D60A 1H3QA 2Y91A 4K0XA 3HLBA 4IJGA 2GX5A 4PM8A 5A93A 1F2KA 5A8BA 2L4RA 4WM9A 3A3EA 1IYSA 3IWQA 3LFVA 5HW3A 4DDYA 1T1BA 2XA7M 4WLAA 3ZGAB 1ESUA 5HWVA 4OQIA 2DRWA 2OV5A 4ZTKA 4EW7A 2H28A 2LB9A 3BY9A 2IWBA 5EV0A 1T1AA 4CLCB 3VOLA 1PZOA 4BQMA 3VP4A 1F9IA 3GV9A 5HD5A 3P98A 5EVIB 3K3DA 3IT9A 3SH7A 2O9CA 4QD4A 4YOFA 3FV7A 3HVFA 4P6BA 1MXOA 2Y2GA 2ZM8A 5CXWA 5HPFA 1MBLA 4FH4A 1P9RA 1DRMA 4IBRA 3V3RA 4HOIA 3C38A 2RCXA 2P7JA 4R3BA 4HEFA 4Q0JA 3W2ZA 1PZPA 4CLCC 4EXOA 2K7SA 3T1SA 3K3CA 4KG2A 1NJ4A 1YSQA 3ITAA 4LV2A 3S7OA 4F3LB 3UNWA 2W1TB 2I72A 2ZC5B 4X56A 4X25A 3F1OA 3IX3A 2X01A 2XR0A 1OJGA 3VSKA 4L9FA 4LV1A 2B95A 3JYIA 4EBNA 2PR6A 4E3IA 5AQAA 4KG6A 1SDNA 5E43A 2JKRM 3VSLA 3IS2A 3IF5A 1XGJA 1ALQA 3SS4A 4OLGA 3PBQA 2D02A 4E3MA 3NJAA 4FSFA 3RTYA 4JPMA 3C30A 3MMHA 3MF0A 2JHEA 3C7UA 5FSRA 3KSIA 4CLCD 3CJMA 3ICYA 4UHUA 3ZCZA 4E3LA 1VB6A 4JF5A 2Q9NA 2KX6A 4UAAA 4OQHA 1YLWA 5IHVA 4O7DA 1DP9A 4LRZE 2J7VA 2GZAA 2IA2A 2H10A 4GD8A 2W1RA 2H5SA 4UA7A 5A92A 4AFIA 4O0PA 3OCNA 1CEFA 4I3JA 5GHZA 5CHMA 3LIBA 4LV0A 2YKHA 1JWZA 1NZOA 1XXMA 2NUTC 2FFFB 4OP5A 4LCMA 3DW0A 4EUZA 4EWFA 3LCEA 1ES4A 2G2WA 3T4TA 3Q82A 3EEHA 5HL1A 4GZBA 3JPUA 1XJ3A 4GJ4A 2VGLM 2OAP1 2HDQA 1ZTUA 4KZ3A 4R3JA 4LPZA 4EQIA 1N9LA 4WN5A 2Y2IA 2PRFA 4L9GA 1SDEA 1BLPA 1TF1A 3UE1A 1LL5A 3LYXA 3R7WA 1K55A 5F68A 2Y2QA 2UV0E 2HP6A 1MWSA 3V5MA 3LR4A 3LY4A 2V0UA 3QNCA 1M40A 3IF6A 3V39A 3D4FA 1LT0A 2Z2MB 1VEUA 3Q07A 4ZDXA 3MQQA 3HUMA 2WAEA 4JF4A 3KYEA 3T1XA 5TR7A 4Y17A 5I5LA 4R6LA 1O7EA 3FZCA 4EBPA 3Q1FA 1FR6A 4KZ7A 1XPBA 2Y2OA 1MKIA 4NETA 1VQQA 3UE3A 5TFQA 4A5RA 4RQ9A 4JBFA 2XDMA 4ZJ3A 5J3WA 4WEKA 3A0VA 4NXFA 4L9EA 2PU2A 1ES3A 1KDWA 4CPKA 2J3TC 3UE6A 4R38A 5CGWA 3V50A 1H0MA 4FD8A 2QPNA 2DMWA 3F1NA 3KX0X 1D7EA 1FCOA 1P97A 5GHYA 1ONGA 1LSVA 2JKRI 3G6OA 4X68A 2KLIA 3BRMA 2P74A 5DTTA 5JYPA 3NOPC 4CLCE 1YLTA 5G18A 1E3UA 1GSVA 4Z1WA 1ONHA 4I38A 4IVIA 4XUZA 3OOVA 2WKPA 4Y3IA 1VETB 3E2LA 3WS1A 3FYZA 4RA7A 1IFQA 2A2LA 1NY0A 4ZRRA 2EFXA 2ZQ9A 3HCYA 4OPYA 3MSHA 1N4OA 5GLCA 3SZTA 1EROA 3LEZA 4LRYC 1W8YA 3LI8A 3KSHA 3MJQA 1FSWA 1PWCA 3DWZA 3OLOA 3HLGA 1ES2A 3CPTB 3CG5A 1SHVA 5M1AA 1K0KA 3N8SA 4GS9B 4ARZB 1KE0A
chains in the Genus database with same CATH topology
4UA6A 5KZHA 4GKUA 4OKPA 1PIOA 1IYPA 4LV3A 3PAEA 3MXRA 3EQUA 5EUAA 3EQVA 4S2LA 3ITBA 2BG1A 4IEDA 3ZHHA 4DE3A 1H5XA 1IYQA 3N6IA 3G30A 4C75A 1W8QA 4ZJ2A 3NDGA 3UPPA 3PBOA 4GB7A 4PM7A 5KSHA 4GD6A 5KSCA 1Y54A 2V1ZA 1ERQA 2Y55A 3OZHA 4WZ5C 3S1YA 5EPHA 3RJUA 2XLNA 4ZBEA 5HAIA 4OVDA 1XA7A 2BLSA 1YLYA 2FFYA 3Q7VB 4QU3A 2JC7A 3HLEA 5FAOA 2XD1A 2WUQA 4S2MA 3G31A 4DF6A 5U47A 1JWPA 2Y2HA 3MZFA 1K25A 4JXWA 1WYBA 4PPRA 5D3OA 1LI0A 3SH9A 1K4EA 3LY3A 4PMAA 5FQIA 3B3XA 4X53A 4MBKA 4N92A 3FKVA 5E2FA 3OPLA 1KE4A 2DCFA 1C3BA 1ZC2A 1DJBA 3UDFA 3VP3A 1GA9A 3ZG9B 1ZG4A 2WKEA 3MFDA 5F83A 2XD5A 3GRJA 5GLDA 2OLUA 4YFMA 3HUNA 2Y2NA 1CK3A 1JWVA 4NK3A 2ZD8A 2PBYA 1KGFA 5GL9A 4EBLA 4JKTA 1GHIA 5GLAA 2EX8A 2EXBA 3O87A 4GN2A 4K0WA 5HAPA 4R4SA 1KGGA 1SKFA 3GMWA 3NIAA 2A49A 1YT4A 2PU4A 1Q2QA 4S2NC 5AQ7A 1L0GA 1BULA 3P09A 3PTEA 4KZ4A 3W4QA 2CC1A 3WRTA 3GTCA 4K91A 2E8IA 4OQ0A 3TG9A 3UDXA 4C6YA 4ZJ1A 2HDSA 1XX2A 4WZ5A 2ZM0A 3TOIA 4QJGA 1G6AA 4WBGA 4B88A 2WKIA 4QB8A 1L0DA 2Y2PA 2Y91A 4JXGA 4MNRA 1HVBA 5HFOA 4K0XA 3GR2A 3HLBA 4WEJA 5M19A 5FQQA 3VFFA 1DJCA 2Y2KA 1BLSA 3ZVWA 1NRFA 4PM8A 5A93A 4X55A 1S0WA 4EV4A 2HDUA 4WM9A 5EVID 4E3OA 3PBTA 4ID4A 2Y2MA 1XKZA 3NCKA 5DVAA 3A3EA 5M18A 1IYSA 1BSGA 3G4PA 4GOGA 3IWQA 5HW3A 2WADA 5FI2A 4DDYA 3MKFA 4OLDA 3W4OA 3N4IA 4KZ8A 3FWLA 4Q8IA 3ZGAB 1ESUA 1ZG6A 2ZQCA 4XUXA 3Q7VA 4OQIA 3V3SA 2DRWA 4DE0A 2OV5A 4ZTKA 1RP5A 1CEGA 2IWCA 5F1FA 1L0EA 3C7VA 1PW1A 2IWBA 3VP0A 1GHPA 1L0FA 4X69A 1PZOA 4WMCD 3G32A 4BQMA 3VP4A 2XFSA 3GV9A 4GDNA 1XA1A 1M6KA 4E3JA 3P98A 5EVIB 3WS2A 3IT9A 1Z6FA 3SH7A 4QD4A 1W79A 1L2SA 3FV7A 2H0TA 3HVFA 4P6BA 5A91A 2ZQ7A 2Y2JA 3NY4A 2UWXA 1MXOA 3NBLA 4ZAMA 4LCLA 2Y2GA 2ZM8A 1KE3A 1E3UD 4U3TA 5CXWA 2EFUA 3IXDA 1MBLA 3O88A 4FH4A 4MLLA 4E3KA 4N1HA 4HESA 4R23A 4IBRA 3V3RA 3BFGA 3GQZA 1GHMA 1KVLA 2RCXA 2WGWA 4R3BA 3ZG7B 1KGEA 4HEFA 5EOEA 1BUEA 3M6HA 4S2JA 1PZPA 3E2KA 2Q9MA 1FR1A 3FKWA 5DTSA 3PAGA 4RX3A 4BL2A 3WS5A 3IF6C 2Y2LA 3HLDA 3WWXA 5CTMA 3GSGA 3PBNA 2QZ6A 2EX6A 3NDEA 3M2JA 2WAFA 3DWKA 5EOOA 2XH9A 4KG2A 3ZFZA 1NJ4A 1I5QA 5CHUA 3RXWA 5KMWA 2XQZA 3MKEA 3ITAA 3C4OA 3GVBA 1LL9A 4LV2A 5CGSA 3UNWA 3G2ZA 1QMFA 1XGIA 4KZAA 4OH0A 1IEMA 3A3DA 2I72A 3IXBA 2Y4AA 2ZC5B 3OPPA 4X56A 2C6WB 5J8XA 3UY6A 4U0TA 2X01A 1PI4A 2XR0A 3BFFA 3VOYA 3SS5A 3BM6A 3IWOA 3A3FA 4P85A 3VSKA 5DF7A 1OMEA 4R1GA 1LI9A 4LV1A 2H0YA 3JYIA 5FQJA 1IKGA 3IH8A 4L0LA 4EBNA 5EVIA 4E3IA 5HX9A 2OLVA 5AQAA 3WRZA 3VFHA 4KG6A 1SDNA 3BECA 5CRFA 5E43A 3OPRA 4KQRA 1YLJA 1K54C 4YINA 5FI7A 3BFEA 3VSLA 1PWDA 1YMSA 4MEZA 4Y7PA 3IF5A 4BJPA 1XGJA 2R9XA 3O3VA 1ALQA 5FI6A 1K57C 3VMAA 3SS4A 1IKIA 4OLGA 3PBQA 4E3MA 1YQSA 4OQGA 3QNBA 4FSFA 4JPMA 3OC2A 4WMCA 3UPNA 4KZ5A 4JXSA 3C7UA 3NC8A 5FSRA 4E6XA 2P9VB 3CJMA 1K57A 4PM9A 3QHYA 3ZVTA 4KENB 3ISGA 1DJAA 1BT5A 2J9PA 4UHUA 3LO7A 3ZG8B 1E4DA 3ZCZA 1MWUA 5HARA 4E3LA 1AXBA 1U60A 1K56A 1G68A 2X02A 4JF5A 3VP1A 2Q9NA 5L2FA 3HL9A 4UAAA 4OQHA 1YLWA 5IHVA 2XGNA 4O7DA 4BENA 3A3IA 1O07A 1TVFA 1WE4A 4PM6A 4XXRA 2P9VA 2J7VA 3IQAA 1PYYA 2H10A 4GD8A 5FQKA 1RGYA 2B5RA 1XP4A 2H5SA 1TDLA 3N8LA 3OCLA 4UA7A 5DTKA 5A92A 4BL3A 5EVLA 1BLHA 5I94A 4FCFA 3ZG5A 3MBZA 1J9MA 3OCNA 4OOLA 1K55C 1CEFA 3G2YA 4IVKA 3SOIA 1S6RA 5GHZA 5CHMA 4LV0A 3UDIA 3W8KA 1JWZA 5F1GA 1NZOA 1XXMA 2JBFA 1IYOA 2FFFB 4MBHA 4P87A 4OP5A 4LCMA 3WS0A 3ZG0A 3C5AA 3DW0A 4EUZA 4EWFA 3LCEA 1ES4A 2G2WA 4MBFA 1FCNA 1SCWA 5E2GA 5E2EA 4OPQA 1ZKJA 1TEMA 3Q82A 5HL1A 2EXAA 4GZBA 4N9LA 4E3NA 4Z9QA 5CHJA 4S2IA 4WZ4A 1H8ZA 2J9OA 2WZXA 3BEBA 2HDQA 2VGJA 2EX2A 3PBRA 5FASA 1BLCA 4KZ3A 4R3JA 3O86A 1GA0A 4EQIA 2Y2IA 4LENA 4QY6A 1SDEA 1PI5A 1BLPA 1DY6A 3UE1A 1LL5A 4KZBA 3MXSA 1K55A 1ES5A 1FCMA 4P0MA 2Y2QA 3AGEA 3BFDA 5FAPA 5FATA 2HP6A 2Y59A 1MWSA 1JVJA 3HBRA 4B4ZA 1FSYA 1K6RA 5CTNA 3V5MA 3IHAA 1K4FA 4IBXA 4KG5A 1H8YA 3TSGA 3LY4A 3QNCA 5GLBA 1N9BA 4KZ9A 1M40A 4OONA 1FQGA 3IF6A 3HLCA 4HBTA 2ZMAA 4RVAA 3V39A 3D4FA 3AGDA 3MZEA 2C5WB 2Z2MB 3Q07A 4ZDXA 3BYDA 4WYYA 2WGWB 3HUMA 3HREA 2WKHA 4DE1A 2WAEA 4JF4A 4CJNA 4F94A 5TGFA 2XFTA 5A90A 4QHCA 5TR7A 2WGVA 1EWZA 1O7EA 3AGFA 4HBUA 3FZCA 4EBPA 3Q1FA 2J8YA 4E6WA 5JYOA 1FR6A 4WELA 4UA9A 4KZ7A 1NYMA 1XPBA 4S2KA 4FH2A 3Q81A 4R4RA 5FQMA 3UO9A 4KQQA 2XF3A 5CGXA 3ZNTA 3ZNYA 2Y2OA 1MKIA 3UN7A 4NETA 5FQ9A 3UPOA 1VQQA 2HP9A 2IWDA 1W5DA 4JXVA 1JTGA 3UE3A 4M3KA 5FDHA 5TFQA 1I2SA 4A5RA 1LHYA 2RL3A 2ZQAA 4JBFA 2R9WA 4OP8A 4BD1A 4DKIA 1CI9A 5BOHA 3CZDA 4GDBA 2ZLYA 2VGKA 2G2UA 2GDNA 4JF6A 2XEPA 1GCEA 2XDMA 4ZJ3A 1BTLA 1NXYA 3W4PA 1CI8A 4WEKA 1E25A 4KZ6A 4Y0UA 3SH8A 4DDSA 3IHBA 2PU2A 3G34A 1ES3A 1KDWA 2V2FF 4CPKA 4H8RA 2WGIA 5EVIC 4OOMA 2HDRA 2OSUA 4S2OA 4B4XA 4JLFA 1K38A 5DF9A 2JE5A 3BLMA 2JCHA 2WZZA 3G35A 1TDGA 2WYXA 3PBSA 5CGWA 3V50A 5DF8A 2ZC7A 2QPNA 4FD8A 5CEDA 1K54A 3N7WA 5GHXA 2QMIA 5HAQA 5E2HA 4OPZA 1RCJA 3UE0A 4N1XA 3VP2A 1FCOA 1ESIA 3VOZA 1KDSA 2XK1A 2HPBA 2X71A 1VM1A 2ZC6B 5GHYA 1ONGA 5AQ9A 5FAQA 5EE8A 3HLWA 1K56D 3IXGA 4RX2A 4X68A 3SS3A 4Y0OA 3BRMA 1YLPA 2P74A 5DTTA 5JYPA 5CERA 4BLMA 4D2OA 4DE2A 2A3UA 1YLTA 4OOYA 1MPLA 5G18A 1K6SA 1E3UA 5CECA 3BLSA 1ONHA 2V20A 4IVIA 4U0XA 4RYEA 4XUZA 2ZM2A 3IXHA 1MWTA 5FA7A 2ZJ9A 4Y0TA 3WS4A 1YLZA 3NI9A 1HZOA 1QMEA 3CMZA 3IF6B 3MZDA 4N9KA 1I2WA 4DXBA 2ZQDA 3E2LA 1LLBA 3WS1A 5CEBA 3A3JA 2HP5A 3FYZA 4RA7A 1PW8A 1NY0A 1JTDA 1KVMA 4PM5A 2EFXA 3BFCA 3C4PA 1NYYA 1WYCA 2ZQ9A 4OPYA 4DRTA 1IELA 2EX9A 2ZQ8A 5F82A 3Q7ZA 1MWRA 1YM1A 1N4OA 4DXCA 5GLCA 1W7FA 3S4XA 3I7JA 1EROA 3LEZA 4QY5A 1PWGA 1FOFA 4OPRA 1BZAA 2WK0A 3M2KA 5AQBA 3DTMA 3HUOA 1NZUA 1ERMA 3N8RA 4BD0A 3ZDJA 1W8YA 4S2PA 2DNSA 1HD8A 4KQOA 3M6BA 3RXXA 5EECA 3HLFA 3IWIA 1YMXA 4GNUA 4S2NA 1FSWA 1PWCA 2ZC4B 2ZC3B 3IH9A 3S22A 3DWZA 4R0QA 4C3QA 2Z2LB 3HLGA 1HTZA 1ES2A 3CG5A 1EI5A 1SHVA 5M1AA 1MY8A 1Q2PA 3N8SA 4X6TA 1KE0A 3OPHA 1RGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UA6 A;  5KZH A;  4GKU A;  4OKP A;  1PIO A;  1IYP A;  4LV3 A;  3PAE A;  3MXR A;  3EQU A;  5EUA A;  3EQV A;  4S2L A;  3ITB A;  2BG1 A;  4IED A;  3ZHH A;  4DE3 A;  1H5X A;  1IYQ A;  3N6I A;  3G30 A;  4C75 A;  1W8Q A;  4ZJ2 A;  3NDG A;  3UPP A;  3PBO A;  4GB7 A;  4PM7 A;  5KSH A;  4GD6 A;  5KSC A;  1Y54 A;  2V1Z A;  1ERQ A;  2Y55 A;  3OZH A;  4WZ5 C;  3S1Y A;  5EPH A;  3RJU A;  2XLN A;  4ZBE A;  5HAI A;  4OVD A;  1XA7 A;  2BLS A;  1YLY A;  2FFY A;  3Q7V B;  4QU3 A;  2JC7 A;  3HLE A;  5FAO A;  2XD1 A;  2WUQ A;  4S2M A;  3G31 A;  4DF6 A;  5U47 A;  1JWP A;  2Y2H A;  3MZF A;  1K25 A;  4JXW A;  1WYB A;  4PPR A;  5D3O A;  1LI0 A;  3SH9 A;  1K4E A;  3LY3 A;  4PMA A;  5FQI A;  3B3X A;  4X53 A;  4MBK A;  4N92 A;  3FKV A;  5E2F A;  3OPL A;  1KE4 A;  2DCF A;  1C3B A;  1ZC2 A;  1DJB A;  3UDF A;  3VP3 A;  1GA9 A;  3ZG9 B;  1ZG4 A;  2WKE A;  3MFD A;  5F83 A;  2XD5 A;  3GRJ A;  5GLD A;  2OLU A;  4YFM A;  3HUN A;  2Y2N A;  1CK3 A;  1JWV A;  4NK3 A;  2ZD8 A;  2PBY A;  1KGF A;  5GL9 A;  4EBL A;  4JKT A;  1GHI A;  5GLA A;  2EX8 A;  2EXB A;  3O87 A;  4GN2 A;  4K0W A;  5HAP A;  4R4S A;  1KGG A;  1SKF A;  3GMW A;  3NIA A;  2A49 A;  1YT4 A;  2PU4 A;  1Q2Q A;  4S2N C;  5AQ7 A;  1L0G A;  1BUL A;  3P09 A;  3PTE A;  4KZ4 A;  3W4Q A;  2CC1 A;  3WRT A;  3GTC A;  4K91 A;  2E8I A;  4OQ0 A;  3TG9 A;  3UDX A;  4C6Y A;  4ZJ1 A;  2HDS A;  1XX2 A;  4WZ5 A;  2ZM0 A;  3TOI A;  4QJG A;  1G6A A;  4WBG A;  4B88 A;  2WKI A;  4QB8 A;  1L0D A;  2Y2P A;  2Y91 A;  4JXG A;  4MNR A;  1HVB A;  5HFO A;  4K0X A;  3GR2 A;  3HLB A;  4WEJ A;  5M19 A;  5FQQ A;  3VFF A;  1DJC A;  2Y2K A;  1BLS A;  3ZVW A;  1NRF A;  4PM8 A;  5A93 A;  4X55 A;  1S0W A;  4EV4 A;  2HDU A;  4WM9 A;  5EVI D;  4E3O A;  3PBT A;  4ID4 A;  2Y2M A;  1XKZ A;  3NCK A;  5DVA A;  3A3E A;  5M18 A;  1IYS A;  1BSG A;  3G4P A;  4GOG A;  3IWQ A;  5HW3 A;  2WAD A;  5FI2 A;  4DDY A;  3MKF A;  4OLD A;  3W4O A;  3N4I A;  4KZ8 A;  3FWL A;  4Q8I A;  3ZGA B;  1ESU A;  1ZG6 A;  2ZQC A;  4XUX A;  3Q7V A;  4OQI A;  3V3S A;  2DRW A;  4DE0 A;  2OV5 A;  4ZTK A;  1RP5 A;  1CEG A;  2IWC A;  5F1F A;  1L0E A;  3C7V A;  1PW1 A;  2IWB A;  3VP0 A;  1GHP A;  1L0F A;  4X69 A;  1PZO A;  4WMC D;  3G32 A;  4BQM A;  3VP4 A;  2XFS A;  3GV9 A;  4GDN A;  1XA1 A;  1M6K A;  4E3J A;  3P98 A;  5EVI B;  3WS2 A;  3IT9 A;  1Z6F A;  3SH7 A;  4QD4 A;  1W79 A;  1L2S A;  3FV7 A;  2H0T A;  3HVF A;  4P6B A;  5A91 A;  2ZQ7 A;  2Y2J A;  3NY4 A;  2UWX A;  1MXO A;  3NBL A;  4ZAM A;  4LCL A;  2Y2G A;  2ZM8 A;  1KE3 A;  1E3U D;  4U3T A;  5CXW A;  2EFU A;  3IXD A;  1MBL A;  3O88 A;  4FH4 A;  4MLL A;  4E3K A;  4N1H A;  4HES A;  4R23 A;  4IBR A;  3V3R A;  3BFG A;  3GQZ A;  1GHM A;  1KVL A;  2RCX A;  2WGW A;  4R3B A;  3ZG7 B;  1KGE A;  4HEF A;  5EOE A;  1BUE A;  3M6H A;  4S2J A;  1PZP A;  3E2K A;  2Q9M A;  1FR1 A;  3FKW A;  5DTS A;  3PAG A;  4RX3 A;  4BL2 A;  3WS5 A;  3IF6 C;  2Y2L A;  3HLD A;  3WWX A;  5CTM A;  3GSG A;  3PBN A;  2QZ6 A;  2EX6 A;  3NDE A;  3M2J A;  2WAF A;  3DWK A;  5EOO A;  2XH9 A;  4KG2 A;  3ZFZ A;  1NJ4 A;  1I5Q A;  5CHU A;  3RXW A;  5KMW A;  2XQZ A;  3MKE A;  3ITA A;  3C4O A;  3GVB A;  1LL9 A;  4LV2 A;  5CGS A;  3UNW A;  3G2Z A;  1QMF A;  1XGI A;  4KZA A;  4OH0 A;  1IEM A;  3A3D A;  2I72 A;  3IXB A;  2Y4A A;  2ZC5 B;  3OPP A;  4X56 A;  2C6W B;  5J8X A;  3UY6 A;  4U0T A;  2X01 A;  1PI4 A;  2XR0 A;  3BFF A;  3VOY A;  3SS5 A;  3BM6 A;  3IWO A;  3A3F A;  4P85 A;  3VSK A;  5DF7 A;  1OME A;  4R1G A;  1LI9 A;  4LV1 A;  2H0Y A;  3JYI A;  5FQJ A;  1IKG A;  3IH8 A;  4L0L A;  4EBN A;  5EVI A;  4E3I A;  5HX9 A;  2OLV A;  5AQA A;  3WRZ A;  3VFH A;  4KG6 A;  1SDN A;  3BEC A;  5CRF A;  5E43 A;  3OPR A;  4KQR A;  1YLJ A;  1K54 C;  4YIN A;  5FI7 A;  3BFE A;  3VSL A;  1PWD A;  1YMS A;  4MEZ A;  4Y7P A;  3IF5 A;  4BJP A;  1XGJ A;  2R9X A;  3O3V A;  1ALQ A;  5FI6 A;  1K57 C;  3VMA A;  3SS4 A;  1IKI A;  4OLG A;  3PBQ A;  4E3M A;  1YQS A;  4OQG A;  3QNB A;  4FSF A;  4JPM A;  3OC2 A;  4WMC A;  3UPN A;  4KZ5 A;  4JXS A;  3C7U A;  3NC8 A;  5FSR A;  4E6X A;  2P9V B;  3CJM A;  1K57 A;  4PM9 A;  3QHY A;  3ZVT A;  4KEN B;  3ISG A;  1DJA A;  1BT5 A;  2J9P A;  4UHU A;  3LO7 A;  3ZG8 B;  1E4D A;  3ZCZ A;  1MWU A;  5HAR A;  4E3L A;  1AXB A;  1U60 A;  1K56 A;  1G68 A;  2X02 A;  4JF5 A;  3VP1 A;  2Q9N A;  5L2F A;  3HL9 A;  4UAA A;  4OQH A;  1YLW A;  5IHV A;  2XGN A;  4O7D A;  4BEN A;  3A3I A;  1O07 A;  1TVF A;  1WE4 A;  4PM6 A;  4XXR A;  2P9V A;  2J7V A;  3IQA A;  1PYY A;  2H10 A;  4GD8 A;  5FQK A;  1RGY A;  2B5R A;  1XP4 A;  2H5S A;  1TDL A;  3N8L A;  3OCL A;  4UA7 A;  5DTK A;  5A92 A;  4BL3 A;  5EVL A;  1BLH A;  5I94 A;  4FCF A;  3ZG5 A;  3MBZ A;  1J9M A;  3OCN A;  4OOL A;  1K55 C;  1CEF A;  3G2Y A;  4IVK A;  3SOI A;  1S6R A;  5GHZ A;  5CHM A;  4LV0 A;  3UDI A;  3W8K A;  1JWZ A;  5F1G A;  1NZO A;  1XXM A;  2JBF A;  1IYO A;  2FFF B;  4MBH A;  4P87 A;  4OP5 A;  4LCM A;  3WS0 A;  3ZG0 A;  3C5A A;  3DW0 A;  4EUZ A;  4EWF A;  3LCE A;  1ES4 A;  2G2W A;  4MBF A;  1FCN A;  1SCW A;  5E2G A;  5E2E A;  4OPQ A;  1ZKJ A;  1TEM A;  3Q82 A;  5HL1 A;  2EXA A;  4GZB A;  4N9L A;  4E3N A;  4Z9Q A;  5CHJ A;  4S2I A;  4WZ4 A;  1H8Z A;  2J9O A;  2WZX A;  3BEB A;  2HDQ A;  2VGJ A;  2EX2 A;  3PBR A;  5FAS A;  1BLC A;  4KZ3 A;  4R3J A;  3O86 A;  1GA0 A;  4EQI A;  2Y2I A;  4LEN A;  4QY6 A;  1SDE A;  1PI5 A;  1BLP A;  1DY6 A;  3UE1 A;  1LL5 A;  4KZB A;  3MXS A;  1K55 A;  1ES5 A;  1FCM A;  4P0M A;  2Y2Q A;  3AGE A;  3BFD A;  5FAP A;  5FAT A;  2HP6 A;  2Y59 A;  1MWS A;  1JVJ A;  3HBR A;  4B4Z A;  1FSY A;  1K6R A;  5CTN A;  3V5M A;  3IHA A;  1K4F A;  4IBX A;  4KG5 A;  1H8Y A;  3TSG A;  3LY4 A;  3QNC A;  5GLB A;  1N9B A;  4KZ9 A;  1M40 A;  4OON A;  1FQG A;  3IF6 A;  3HLC A;  4HBT A;  2ZMA A;  4RVA A;  3V39 A;  3D4F A;  3AGD A;  3MZE A;  2C5W B;  2Z2M B;  3Q07 A;  4ZDX A;  3BYD A;  4WYY A;  2WGW B;  3HUM A;  3HRE A;  2WKH A;  4DE1 A;  2WAE A;  4JF4 A;  4CJN A;  4F94 A;  5TGF A;  2XFT A;  5A90 A;  4QHC A;  5TR7 A;  2WGV A;  1EWZ A;  1O7E A;  3AGF A;  4HBU A;  3FZC A;  4EBP A;  3Q1F A;  2J8Y A;  4E6W A;  5JYO A;  1FR6 A;  4WEL A;  4UA9 A;  4KZ7 A;  1NYM A;  1XPB A;  4S2K A;  4FH2 A;  3Q81 A;  4R4R A;  5FQM A;  3UO9 A;  4KQQ A;  2XF3 A;  5CGX A;  3ZNT A;  3ZNY A;  2Y2O A;  1MKI A;  3UN7 A;  4NET A;  5FQ9 A;  3UPO A;  1VQQ A;  2HP9 A;  2IWD A;  1W5D A;  4JXV A;  1JTG A;  3UE3 A;  4M3K A;  5FDH A;  5TFQ A;  1I2S A;  4A5R A;  1LHY A;  2RL3 A;  2ZQA A;  4JBF A;  2R9W A;  4OP8 A;  4BD1 A;  4DKI A;  1CI9 A;  5BOH A;  3CZD A;  4GDB A;  2ZLY A;  2VGK A;  2G2U A;  2GDN A;  4JF6 A;  2XEP A;  1GCE A;  2XDM A;  4ZJ3 A;  1BTL A;  1NXY A;  3W4P A;  1CI8 A;  4WEK A;  1E25 A;  4KZ6 A;  4Y0U A;  3SH8 A;  4DDS A;  3IHB A;  2PU2 A;  3G34 A;  1ES3 A;  1KDW A;  2V2F F;  4CPK A;  4H8R A;  2WGI A;  5EVI C;  4OOM A;  2HDR A;  2OSU A;  4S2O A;  4B4X A;  4JLF A;  1K38 A;  5DF9 A;  2JE5 A;  3BLM A;  2JCH A;  2WZZ A;  3G35 A;  1TDG A;  2WYX A;  3PBS A;  5CGW A;  3V50 A;  5DF8 A;  2ZC7 A;  2QPN A;  4FD8 A;  5CED A;  1K54 A;  3N7W A;  5GHX A;  2QMI A;  5HAQ A;  5E2H A;  4OPZ A;  1RCJ A;  3UE0 A;  4N1X A;  3VP2 A;  1FCO A;  1ESI A;  3VOZ A;  1KDS A;  2XK1 A;  2HPB A;  2X71 A;  1VM1 A;  2ZC6 B;  5GHY A;  1ONG A;  5AQ9 A;  5FAQ A;  5EE8 A;  3HLW A;  1K56 D;  3IXG A;  4RX2 A;  4X68 A;  3SS3 A;  4Y0O A;  3BRM A;  1YLP A;  2P74 A;  5DTT A;  5JYP A;  5CER A;  4BLM A;  4D2O A;  4DE2 A;  2A3U A;  1YLT A;  4OOY A;  1MPL A;  5G18 A;  1K6S A;  1E3U A;  5CEC A;  3BLS A;  1ONH A;  2V20 A;  4IVI A;  4U0X A;  4RYE A;  4XUZ A;  2ZM2 A;  3IXH A;  1MWT A;  5FA7 A;  2ZJ9 A;  4Y0T A;  3WS4 A;  1YLZ A;  3NI9 A;  1HZO A;  1QME A;  3CMZ A;  3IF6 B;  3MZD A;  4N9K A;  1I2W A;  4DXB A;  2ZQD A;  3E2L A;  1LLB A;  3WS1 A;  5CEB A;  3A3J A;  2HP5 A;  3FYZ A;  4RA7 A;  1PW8 A;  1NY0 A;  1JTD A;  1KVM A;  4PM5 A;  2EFX A;  3BFC A;  3C4P A;  1NYY A;  1WYC A;  2ZQ9 A;  4OPY A;  4DRT A;  1IEL A;  2EX9 A;  2ZQ8 A;  5F82 A;  3Q7Z A;  1MWR A;  1YM1 A;  1N4O A;  4DXC A;  5GLC A;  1W7F A;  3S4X A;  3I7J A;  1ERO A;  3LEZ A;  4QY5 A;  1PWG A;  1FOF A;  4OPR A;  1BZA A;  2WK0 A;  3M2K A;  5AQB A;  3DTM A;  3HUO A;  1NZU A;  1ERM A;  3N8R A;  4BD0 A;  3ZDJ A;  1W8Y A;  4S2P A;  2DNS A;  1HD8 A;  4KQO A;  3M6B A;  3RXX A;  5EEC A;  3HLF A;  3IWI A;  1YMX A;  4GNU A;  4S2N A;  1FSW A;  1PWC A;  2ZC4 B;  2ZC3 B;  3IH9 A;  3S22 A;  3DWZ A;  4R0Q A;  4C3Q A;  2Z2L B;  3HLG A;  1HTZ A;  1ES2 A;  3CG5 A;  1EI5 A;  1SHV A;  5M1A A;  1MY8 A;  1Q2P A;  3N8S A;  4X6T A;  1KE0 A;  3OPH A;  1RGZ A; 
#chains in the Genus database with same CATH topology
 4UA6 A;  4GKU A;  4LV3 A;  2L0W A;  3ITB A;  2OAQ 1;  4IED A;  3T1R A;  1H5X A;  4IUH A;  3NDG A;  4PM7 A;  4GB7 A;  5KSC A;  4NEE D;  2V1Z A;  3CWF A;  2Y55 A;  5EPH A;  5HAI A;  1XA7 A;  2BLS A;  2FFY A;  2JC7 A;  2VZW A;  4S2M A;  3G31 A;  4GHI B;  3IS2 B;  4PPR A;  4PMA A;  4MBK A;  2PDR A;  1KE4 A;  1LL8 A;  1ZG4 A;  3EWK A;  3DBA A;  3LUQ A;  3HUN A;  5GL9 A;  4HJ6 A;  4BMW A;  4GHI A;  1GHI A;  3GEC A;  4XT2 B;  1KGG A;  3NIA A;  4MN7 A;  1YT4 A;  4WF0 A;  3W4Q A;  2CC1 A;  3GTC A;  3TG9 A;  3PXP A;  1XJ2 A;  1G6A A;  4B88 A;  4QB8 A;  4JXG A;  1TS8 A;  2I9V A;  4MNR A;  4K08 A;  3GR2 A;  3MQ0 A;  4WEJ A;  1BLS A;  3UMD A;  2VV6 A;  3D9Y A;  2MJ6 A;  1ODV A;  2HDU A;  3E4P A;  5EVI D;  4E3O A;  2BAS A;  3PBT A;  3S7P A;  1G5U A;  5DVA A;  3G4P A;  1BSG A;  5HDC A;  5DKK A;  4MMN A;  3W4O A;  3N4I A;  3C8C A;  2ZQC A;  3Q7V A;  1L0E A;  3V67 A;  1PW1 A;  2W3H A;  2JKF A;  4GDN A;  4R70 A;  1M6K A;  3WS2 A;  5EVE A;  2NUP C;  1W79 A;  3LIA A;  2H0T A;  5A91 A;  4U3T A;  3GQZ A;  2OWH A;  5EOE A;  3TJZ C;  4S2J A;  3PAG A;  4BL2 A;  4GCZ A;  3HLD A;  3FG8 A;  2O9B A;  2INW A;  4GW9 A;  3WWX A;  2QZ6 A;  2PYR A;  2ZL1 A;  1SKO B;  3M2J A;  2WAF A;  1I5Q A;  5CHU A;  3RXW A;  3MKE A;  3CHW P;  3GVB A;  3RFB A;  1QMF A;  1S66 L;  4KZA A;  2B02 A;  1IEM A;  3A3D A;  2P04 A;  3BFF A;  3BM6 A;  3A3F A;  4L0L A;  3WRZ A;  2OLV A;  1PRQ A;  2O0Y A;  4Y13 A;  3T4L A;  3BFE A;  1YMS A;  5J4E A;  4QWO A;  3LR0 A;  3LR3 A;  1K57 C;  3T50 A;  4OQG A;  3A0R A;  3OC2 A;  4KZ5 A;  3NC8 A;  2W3G A;  1K57 A;  3U2A A;  3QHY A;  3ZVT A;  5DJU A;  1DJA A;  3NOU C;  1E4D A;  2VLG A;  1U60 A;  3ULF A;  1HLU P;  5L2F A;  3HL9 A;  2W0N A;  3C2W A;  1CJF A;  4PM6 A;  1WE4 A;  5EM1 A;  3T1Q B;  1XP4 A;  3N8L A;  4X1L A;  5I94 A;  1J9M A;  2XRO A;  4IVK A;  3SOI A;  3DAV A;  4B9O A;  2J3T D;  3UDI A;  3W8K A;  5F1G A;  2XRN A;  4MN5 A;  2VV7 A;  5MC7 A;  4EU0 A;  2W1T A;  3WS0 A;  4MBF A;  1SCW A;  5E2E A;  1ZKJ A;  4CQH A;  1H8Z A;  2J9O A;  3BEB A;  3PBR A;  2EX2 A;  2B18 A;  3NHQ A;  4QY6 A;  4Q0H A;  4KZB A;  1FCM A;  4O01 A;  3AGE A;  3L7H A;  5FAP A;  2Y59 A;  3HBR A;  5CTN A;  4UQI M;  1S4S A;  3IHA A;  3TSG A;  4IBX A;  5GLB A;  1N9B A;  3VE4 A;  1FQG A;  1PNE A;  4HBT A;  2ZMA A;  4B93 A;  1OT6 A;  1XFN A;  3HRE A;  2WKH A;  4DE1 A;  3VE3 A;  4CJN A;  4F94 A;  5TGF A;  4ETZ A;  3QP1 A;  1OTB A;  4UA9 A;  1P0Z A;  3Q81 A;  2XF3 A;  5CGX A;  4JXV A;  2IWD A;  1JTG A;  2HF6 A;  1NLZ A;  1H8M A;  1G6O A;  4YNR A;  4M3K A;  5FDH A;  5FEF A;  4ME4 A;  3B33 A;  4BD1 A;  1CI9 A;  3QP4 A;  4GDB A;  1NXY A;  1CI8 A;  1E25 A;  4KZ6 A;  2GJ3 A;  4Y0U A;  3SH8 A;  2A24 A;  3IHB A;  4DDS A;  3G34 A;  4H8R A;  5EVI C;  2OSU A;  4S2O A;  2JE5 A;  2JCH A;  2WZZ A;  1GSW A;  3MQO A;  5CED A;  2VA0 A;  2PHY A;  3N7W A;  4E04 A;  4OPZ A;  1RCJ A;  2JKT I;  2PD8 A;  2XK1 A;  1S4R A;  1VM1 A;  2X71 A;  2ZC6 B;  5IU1 A;  5EE8 A;  3SS3 A;  4HP9 A;  5EFW A;  5CER A;  4BLM A;  1YKD A;  4D2O A;  2A3U A;  1MPL A;  1K6S A;  3BLS A;  2LB5 A;  4HIA A;  4DJ3 A;  2ZM2 A;  1OT9 A;  4DMZ A;  5HSQ A;  1YLZ A;  1QME A;  3CMZ A;  4N9K A;  4DXB A;  2ZQD A;  3E4O A;  3DTK A;  1PW8 A;  4PM5 A;  3BFC A;  3C4P A;  1WYC A;  1TD5 A;  1OTI A;  1MWR A;  3S7N A;  4DXC A;  1W7F A;  2QJ5 A;  1FOF A;  1BZA A;  3N8R A;  4BD0 A;  1ERM A;  3H82 A;  3UB5 P;  3LR5 A;  5EEC A;  2ZC4 B;  3IH9 A;  2KOI A;  4R0Q A;  4C3Q A;  4PHT A;  2Z2L B;  5KZH A;  1MC0 A;  4X1M A;  3PAE A;  3MXR A;  4S2L A;  2M7U A;  1D06 A;  4C75 A;  1W8Q A;  4ZJ2 A;  1J3W A;  4GD6 A;  3LEQ A;  3OZH A;  4WZ5 C;  2XLN A;  2JKG A;  3HLE A;  2WUQ A;  2HJ9 C;  2Y2H A;  5D3O A;  3SH9 A;  2EWV A;  4X53 A;  3A0S A;  4Y5F A;  4N92 A;  3CIT A;  3LGO A;  3OPL A;  3VV4 A;  2DCF A;  1DJB A;  3VP3 A;  2QYB A;  1YAX A;  5GLD A;  4YFM A;  2HV1 A;  4EES A;  4NK3 A;  5IS1 A;  1KGF A;  2EXB A;  3H9W A;  2BTF P;  1SKF A;  2A49 A;  1Q2Q A;  3MS6 A;  5AQ7 A;  5FEG A;  2V9A A;  3PTE A;  1OPX A;  3WRT A;  1OTA A;  4OQ0 A;  3CAX A;  1XX2 A;  1L0D A;  1HVB A;  5HFO A;  5M19 A;  2ZOI A;  5FQQ A;  1DJC A;  5G4Z A;  3ZVW A;  1NRF A;  2W3D A;  4X55 A;  5L10 A;  4EV4 A;  1X0O A;  2V1A A;  2J3W A;  3EEA A;  1V9Z A;  3MFX A;  4Q0I A;  2Y2M A;  1XKZ A;  2WAD A;  5FI2 A;  4II7 A;  3MKF A;  4OLD A;  4KZ8 A;  5HD3 A;  2JKT M;  1T1C A;  1ZG6 A;  4EEP A;  4XUX A;  4I3I A;  1RP5 A;  4HJ4 A;  2IWC A;  5F1F A;  3C7V A;  1GHP A;  1YSP A;  2ZOH A;  1L0F A;  1F5M A;  4X69 A;  3NUL A;  4WMC D;  3G32 A;  1FIL A;  2XFS A;  1XA1 A;  4WL9 A;  4E3J A;  3QP6 A;  5HDS A;  1Z6F A;  5TJJ A;  1L2S A;  4G3V A;  4MCW A;  2ZQ7 A;  2Y2J A;  2UWX A;  3NBL A;  4ZAM A;  4LCL A;  1KE3 A;  1E3U D;  2EFU A;  1JNU A;  4N1H A;  4HES A;  4R23 A;  4FOF A;  4JGR A;  5HZH A;  2WGW A;  1KVL A;  4HHD A;  1UWP X;  1IOU A;  4M4X A;  4HY8 A;  1BUE A;  3E2K A;  2Q9M A;  4UEY A;  2QHK A;  1T19 A;  3HJK A;  3PYP A;  1GSX A;  4PKY A;  2EX6 A;  3JVV A;  3NDE A;  3ZFZ A;  2QKP A;  5KMW A;  3BWL A;  2XQZ A;  4WUJ A;  3QP8 A;  1LL9 A;  2XSS A;  5CGS A;  1XGI A;  2Z6D A;  1STZ A;  4JGP A;  3IXB A;  3OPP A;  2C6W B;  3UY6 A;  4U0T A;  1PI4 A;  3VOY A;  3SS5 A;  3IWO A;  4R1G A;  1LI9 A;  5FQJ A;  1IKG A;  3IH8 A;  5EVI A;  3VFH A;  2GNX A;  3EOI A;  2CMN A;  3LI9 A;  1Y28 A;  5FI7 A;  2M1C A;  1PWD A;  4Y7P A;  2XA7 S;  4R3A A;  2R9X A;  1TS7 A;  3VMA A;  1IKI A;  3QNB A;  4G3K A;  2HZ5 A;  3UB6 A;  2OOL A;  4WMC A;  4JXS A;  4E6X A;  3BY8 A;  2P9V B;  4PM9 A;  3ISG A;  5HDD A;  1BT5 A;  3BQA A;  3KYZ A;  3LO7 A;  5HAR A;  1F98 A;  1YPR A;  1K56 A;  1G68 A;  5F6A A;  1O07 A;  1SZV A;  4XXR A;  3T4S A;  2P9V A;  1SKO A;  4Y2F A;  3O5Y A;  2R78 A;  3T12 B;  4NXG A;  3MBZ A;  4OOL A;  1K55 C;  3G2Y A;  4IHQ A;  3KO6 A;  3UB7 A;  5DJT A;  2J80 A;  4GLQ A;  3H82 B;  3LIE A;  4GS9 A;  1FCN A;  5E2G A;  3T4J A;  1TEM A;  4N9L A;  4HH3 A;  4S2I A;  4WZ4 A;  2FH5 A;  3KYQ A;  1N9O A;  3LIF A;  4G3W A;  1ZHH B;  1ES5 A;  4LRX C;  5IT5 A;  2PYP A;  1JVJ A;  4B4Z A;  1FSY A;  1K6R A;  4KG5 A;  1H8Y A;  4P6Z M;  4KZ9 A;  4OON A;  4PKY G;  3AGD A;  2C5W B;  4WYY A;  2WGW B;  1NWZ A;  2XFT A;  5A90 A;  4QHC A;  4H6J B;  1EWZ A;  3AGF A;  4EET B;  1EW0 A;  1UGU A;  2VEA A;  3EGD C;  3CUE A;  4S2K A;  1S1Y A;  4BBT A;  3TE8 A;  4H6J A;  4FH2 A;  3ZNY A;  5FQM A;  3ZNT A;  4IUK A;  3UN7 A;  3UPO A;  2HP9 A;  4YWZ A;  3JVU A;  1S67 L;  2RL3 A;  4DKI A;  5BOH A;  4JF6 A;  2VGK A;  4JGO A;  3E98 A;  3W4P A;  3PHY A;  4ARZ A;  2HDR A;  3F1O B;  1K38 A;  3BLM A;  1TDG A;  2ACG A;  2WYX A;  3QP2 A;  5DF8 A;  3F1P A;  2L1M A;  5GHX A;  2QMI A;  5HAQ A;  5E2H A;  3UE0 A;  4N1X A;  1ESI A;  3VOZ A;  4EEU A;  2VGL S;  2HPB A;  5AQ9 A;  3HLW A;  3IXG A;  4RX2 A;  4Y0O A;  1T18 A;  3IX8 A;  3T4K A;  4DE2 A;  4OOY A;  3H7W A;  3P7N A;  4U0X A;  3B42 A;  4RYE A;  3UB9 A;  1V9Y A;  3IF6 B;  3H7W B;  1I2W A;  4KQD A;  4ESP A;  5CEB A;  3A3J A;  1W63 M;  2HP5 A;  3CI6 A;  1JTD A;  1KVM A;  1NYY A;  2Y8H A;  2ZQ8 A;  5F82 A;  1LSX A;  3E4Q A;  3Q7Z A;  1YM1 A;  5AJG A;  3S4X A;  2FZ0 A;  5AVE A;  4QY5 A;  2WKR A;  2WK0 A;  2HGV A;  3M2K A;  3HUO A;  1NZU A;  3DTE A;  3ZDJ A;  4S2P A;  2DNS A;  4KQO A;  3M6B A;  3IWI A;  2V8F A;  4GNU A;  4S2N A;  2ZC3 B;  4BBU A;  4HI4 A;  3MR0 A;  1MY8 A;  3B47 A;  1PFL A;  4OKP A;  1PIO A;  5EUA A;  3EQU A;  3KSF A;  2KDK A;  1VHM A;  4PAU A;  3ZHH A;  3U4L P;  5LBR A;  2VX8 A;  1VET A;  3G30 A;  1KOU A;  5KSH A;  1Y54 A;  1Z09 A;  5HWT A;  3S1Y A;  2D01 A;  4OVD A;  1YLY A;  3Q7V B;  3NEC A;  5FAO A;  2XD1 A;  5DKL A;  1CQA A;  4DF6 A;  5U47 A;  1JWP A;  4BWI A;  3EGX C;  1K25 A;  1LI0 A;  1K4E A;  5FQI A;  3B3X A;  5E2F A;  3FKV A;  3T4O A;  4QPR A;  1GA9 A;  3ZG9 B;  3MFD A;  3OBF A;  3DTI A;  3GRJ A;  2W3F A;  2Y2N A;  1CK3 A;  4EBL A;  4JKT A;  3TRC A;  3FPV A;  5GLA A;  2EX8 A;  3O87 A;  4K0W A;  4GN2 A;  4R4S A;  3GMW A;  3UB8 A;  1L0G A;  2ZMF A;  5EM0 A;  4EER A;  4K91 A;  3E0Y A;  2E8I A;  1VEU B;  4ZJ1 A;  4QJG A;  2VV8 A;  2WKI A;  2Y2P A;  2PD7 A;  3VFF A;  2Y2K A;  1NRJ A;  1S1Z A;  1Y4O A;  5FDS A;  1S0W A;  4EQ1 A;  2V1B A;  3IBJ A;  4ID4 A;  3NCK A;  5M18 A;  4GOG A;  3BQ8 A;  3F1N B;  3L9K A;  2EA9 A;  3FWL A;  4Q8I A;  3V3S A;  4DE0 A;  1CEG A;  3IX4 A;  3VP0 A;  1P9W A;  4I3A A;  3GDI A;  1WA9 A;  2HJE A;  2QWS A;  1A0K A;  4KUO A;  3CUE C;  4LLO B;  4LFU A;  2EWW A;  3NY4 A;  1D1J A;  1TS0 A;  1LSW A;  3IXD A;  3O88 A;  4MLL A;  4E3K A;  1OJ5 A;  3BFG A;  1GHM A;  3ZG7 B;  1KGE A;  1NLY A;  3M6H A;  4I5S A;  5DTS A;  1ACF A;  1FR1 A;  3FKW A;  4MN6 A;  5CX7 A;  4RX3 A;  4P6Z S;  2E8J A;  5F69 A;  5FL3 A;  3WS5 A;  3IF6 C;  2Y2L A;  5CTM A;  3GSG A;  3PBN A;  4KUK A;  4NXE A;  4BBV A;  5EOO A;  3DWK A;  2XH9 A;  1TS6 A;  4MDZ A;  5L07 A;  4HQA A;  3C4O A;  3G2Z A;  3NOT C;  4OH0 A;  2Y4A A;  3CPT A;  5J8X A;  3R7W B;  1N9N A;  4DN0 A;  4P85 A;  5DF7 A;  1OME A;  5HPI A;  2H0Y A;  4DJ2 A;  5G4Y A;  2AVX A;  5HX9 A;  5TBM A;  3T4Q A;  3D72 A;  3BEC A;  5CRF A;  1XJ6 A;  3OPR A;  1YLJ A;  1K54 C;  4KQR A;  4YIN A;  4MEZ A;  4BJP A;  3O3V A;  5FI6 A;  1XJ4 A;  5DFX A;  2Z6C A;  3F1P B;  2PAV P;  1YQS A;  4NKP A;  5F5Y A;  5TBM B;  3QP5 A;  3UPN A;  1L3L A;  2WKQ A;  4KEN B;  2J9P A;  2K2N A;  4HH2 A;  3ZG8 B;  1MWU A;  1AXB A;  2X02 A;  3VP1 A;  3SW1 A;  4NXB A;  3HJI A;  2XGN A;  2M7V A;  4BEN A;  3A3I A;  1TVF A;  3IQA A;  1PYY A;  5FQK A;  1RGY A;  2B5R A;  1TDL A;  3OCL A;  5DTK A;  4BL3 A;  5EVL A;  1BLH A;  3IBR A;  4FCF A;  3ZG5 A;  4HJ3 A;  1S6R A;  5J7E A;  2ZL1 B;  1UWN X;  1BYW A;  3RH8 B;  1OTD A;  2JBF A;  1IYO A;  4MBH A;  2PT7 A;  3ZG0 A;  3C5A A;  3LIC A;  4CLC A;  3ZYT A;  2P08 A;  2A24 B;  3FC7 A;  2VK3 A;  4OPQ A;  2EXA A;  4E3N A;  1G28 A;  4Z9Q A;  5CHJ A;  2WZX A;  2VGJ A;  5FAS A;  1BLC A;  5L8M A;  1XFQ A;  3LID A;  3O86 A;  1GA0 A;  4LEN A;  1PI5 A;  1DY6 A;  3MXS A;  4P0M A;  1W63 Q;  3BFD A;  5FAT A;  3CLO A;  5AVF A;  1K4F A;  5C5K A;  1MKM A;  3HLC A;  4Y15 A;  4RVA A;  1MZU A;  3MZE A;  3BYD A;  5L09 A;  2WGV A;  4HBU A;  2J8Y A;  4E6W A;  5JYO A;  4WEL A;  3BW6 A;  3MXQ A;  2W27 A;  1NYM A;  3K2N A;  4R4R A;  5K5B A;  3UO9 A;  4KQQ A;  4EUV A;  5FQ9 A;  1W5D A;  2O99 A;  3R4K A;  1I2S A;  4JGQ A;  1LHY A;  2ZQA A;  4OP8 A;  2R9W A;  3CZD A;  2ZLY A;  2G2U A;  2GDN A;  2XEP A;  1GCE A;  1BTL A;  1AWI A;  2YKF A;  1FIK A;  1OTE A;  2V2F F;  2WGI A;  4OOM A;  4B4X A;  4JLF A;  5DF9 A;  3PBS A;  3G35 A;  4ETX A;  2V8C A;  2ZC7 A;  4F3L A;  1K54 A;  3KSG A;  2VKS A;  3VP2 A;  4UQI S;  1KDS A;  2PR5 A;  3BJN A;  2Y79 A;  5FAQ A;  1K56 D;  1YLP A;  5CEC A;  4NG2 A;  2V20 A;  3IXH A;  1MWT A;  1DP8 A;  5FA7 A;  2ZJ9 A;  4Y0T A;  3UME A;  3WS4 A;  3NI9 A;  1HZO A;  3MZD A;  4LGW A;  1LLB A;  4DRT A;  2ZMV A;  1IEL A;  2EX9 A;  4XT2 A;  2K31 A;  4HP4 A;  2O9A A;  2JN7 A;  2Q0O A;  3I7J A;  1PWG A;  4OPR A;  2VJW A;  5AQB A;  3DTM A;  3RXX A;  1HD8 A;  3HLF A;  1YMX A;  4FUW A;  3S22 A;  3PR6 A;  1DP6 A;  5HWW A;  2PBD P;  1HTZ A;  1EI5 A;  1Q2P A;  4X6T A;  4P87 A;  3OPH A;  1RGZ A;  1IYP A;  3EQV A;  2BG1 A;  4DE3 A;  1IYQ A;  3D3O A;  3N6I A;  3UPP A;  3PBO A;  1ERQ A;  3RJU A;  4ZBE A;  3TW8 A;  2ZBB A;  2G7U A;  4QU3 A;  4I39 A;  2W3E A;  3MZF A;  4JXW A;  1WYB A;  5DFY A;  3LY3 A;  4FTX A;  2V0W A;  1C3B A;  1ZC2 A;  3UDF A;  4HNB A;  2WKE A;  5F83 A;  2XD5 A;  3S7Q A;  2OLU A;  1JWV A;  2OWJ A;  2ZD8 A;  2PBY A;  5HL6 A;  1CF0 A;  5HAP A;  2PU4 A;  4S2N C;  5KIZ A;  1BUL A;  3ZQ5 A;  3P09 A;  4KZ4 A;  2QJ7 A;  3P01 A;  3UDX A;  4C6Y A;  3FPW A;  2HDS A;  4WZ5 A;  2ZM0 A;  3TOI A;  4WBG A;  4O8G A;  4D60 A;  1H3Q A;  2Y91 A;  4K0X A;  3HLB A;  4IJG A;  2GX5 A;  4PM8 A;  5A93 A;  1F2K A;  5A8B A;  2L4R A;  4WM9 A;  3A3E A;  1IYS A;  3IWQ A;  3LFV A;  5HW3 A;  4DDY A;  1T1B A;  2XA7 M;  4WLA A;  3ZGA B;  1ESU A;  5HWV A;  4OQI A;  2DRW A;  2OV5 A;  4ZTK A;  4EW7 A;  2H28 A;  2LB9 A;  3BY9 A;  2IWB A;  5EV0 A;  1T1A A;  4CLC B;  3VOL A;  1PZO A;  4BQM A;  3VP4 A;  1F9I A;  3GV9 A;  5HD5 A;  3P98 A;  5EVI B;  3K3D A;  3IT9 A;  3SH7 A;  2O9C A;  4QD4 A;  4YOF A;  3FV7 A;  3HVF A;  4P6B A;  1MXO A;  2Y2G A;  2ZM8 A;  5CXW A;  5HPF A;  1MBL A;  4FH4 A;  1P9R A;  1DRM A;  4IBR A;  3V3R A;  4HOI A;  3C38 A;  2RCX A;  2P7J A;  4R3B A;  4HEF A;  4Q0J A;  3W2Z A;  1PZP A;  4CLC C;  4EXO A;  2K7S A;  3T1S A;  3K3C A;  4KG2 A;  1NJ4 A;  1YSQ A;  3ITA A;  4LV2 A;  3S7O A;  4F3L B;  3UNW A;  2W1T B;  2I72 A;  2ZC5 B;  4X56 A;  4X25 A;  3F1O A;  3IX3 A;  2X01 A;  2XR0 A;  1OJG A;  3VSK A;  4L9F A;  4LV1 A;  2B95 A;  3JYI A;  4EBN A;  2PR6 A;  4E3I A;  5AQA A;  4KG6 A;  1SDN A;  5E43 A;  2JKR M;  3VSL A;  3IS2 A;  3IF5 A;  1XGJ A;  1ALQ A;  3SS4 A;  4OLG A;  3PBQ A;  2D02 A;  4E3M A;  3NJA A;  4FSF A;  3RTY A;  4JPM A;  3C30 A;  3MMH A;  3MF0 A;  2JHE A;  3C7U A;  5FSR A;  3KSI A;  4CLC D;  3CJM A;  3ICY A;  4UHU A;  3ZCZ A;  4E3L A;  1VB6 A;  4JF5 A;  2Q9N A;  2KX6 A;  4UAA A;  4OQH A;  1YLW A;  5IHV A;  4O7D A;  1DP9 A;  4LRZ E;  2J7V A;  2GZA A;  2IA2 A;  2H10 A;  4GD8 A;  2W1R A;  2H5S A;  4UA7 A;  5A92 A;  4AFI A;  4O0P A;  3OCN A;  1CEF A;  4I3J A;  5GHZ A;  5CHM A;  3LIB A;  4LV0 A;  2YKH A;  1JWZ A;  1NZO A;  1XXM A;  2NUT C;  2FFF B;  4OP5 A;  4LCM A;  3DW0 A;  4EUZ A;  4EWF A;  3LCE A;  1ES4 A;  2G2W A;  3T4T A;  3Q82 A;  3EEH A;  5HL1 A;  4GZB A;  3JPU A;  1XJ3 A;  4GJ4 A;  2VGL M;  2OAP 1;  2HDQ A;  1ZTU A;  4KZ3 A;  4R3J A;  4LPZ A;  4EQI A;  1N9L A;  4WN5 A;  2Y2I A;  2PRF A;  4L9G A;  1SDE A;  1BLP A;  1TF1 A;  3UE1 A;  1LL5 A;  3LYX A;  3R7W A;  1K55 A;  5F68 A;  2Y2Q A;  2UV0 E;  2HP6 A;  1MWS A;  3V5M A;  3LR4 A;  3LY4 A;  2V0U A;  3QNC A;  1M40 A;  3IF6 A;  3V39 A;  3D4F A;  1LT0 A;  2Z2M B;  1VEU A;  3Q07 A;  4ZDX A;  3MQQ A;  3HUM A;  2WAE A;  4JF4 A;  3KYE A;  3T1X A;  5TR7 A;  4Y17 A;  5I5L A;  4R6L A;  1O7E A;  3FZC A;  4EBP A;  3Q1F A;  1FR6 A;  4KZ7 A;  1XPB A;  2Y2O A;  1MKI A;  4NET A;  1VQQ A;  3UE3 A;  5TFQ A;  4A5R A;  4RQ9 A;  4JBF A;  2XDM A;  4ZJ3 A;  5J3W A;  4WEK A;  3A0V A;  4NXF A;  4L9E A;  2PU2 A;  1ES3 A;  1KDW A;  4CPK A;  2J3T C;  3UE6 A;  4R38 A;  5CGW A;  3V50 A;  1H0M A;  4FD8 A;  2QPN A;  2DMW A;  3F1N A;  3KX0 X;  1D7E A;  1FCO A;  1P97 A;  5GHY A;  1ONG A;  1LSV A;  2JKR I;  3G6O A;  4X68 A;  2KLI A;  3BRM A;  2P74 A;  5DTT A;  5JYP A;  3NOP C;  4CLC E;  1YLT A;  5G18 A;  1E3U A;  1GSV A;  4Z1W A;  1ONH A;  4I38 A;  4IVI A;  4XUZ A;  3OOV A;  2WKP A;  4Y3I A;  1VET B;  3E2L A;  3WS1 A;  3FYZ A;  4RA7 A;  1IFQ A;  2A2L A;  1NY0 A;  4ZRR A;  2EFX A;  2ZQ9 A;  3HCY A;  4OPY A;  3MSH A;  1N4O A;  5GLC A;  3SZT A;  1ERO A;  3LEZ A;  4LRY C;  1W8Y A;  3LI8 A;  3KSH A;  3MJQ A;  1FSW A;  1PWC A;  3DWZ A;  3OLO A;  3HLG A;  1ES2 A;  3CPT B;  3CG5 A;  1SHV A;  5M1A A;  1K0K A;  3N8S A;  4GS9 B;  4ARZ B;  1KE0 A; 
#chains in the Genus database with same CATH homology
 4UA6 A;  5KZH A;  4GKU A;  4OKP A;  1PIO A;  1IYP A;  4LV3 A;  3PAE A;  3MXR A;  3EQU A;  5EUA A;  3EQV A;  4S2L A;  3ITB A;  2BG1 A;  4IED A;  3ZHH A;  4DE3 A;  1H5X A;  1IYQ A;  3N6I A;  3G30 A;  4C75 A;  1W8Q A;  4ZJ2 A;  3NDG A;  3UPP A;  3PBO A;  4GB7 A;  4PM7 A;  5KSH A;  4GD6 A;  5KSC A;  1Y54 A;  2V1Z A;  1ERQ A;  2Y55 A;  3OZH A;  4WZ5 C;  3S1Y A;  5EPH A;  3RJU A;  2XLN A;  4ZBE A;  5HAI A;  4OVD A;  1XA7 A;  2BLS A;  1YLY A;  2FFY A;  3Q7V B;  4QU3 A;  2JC7 A;  3HLE A;  5FAO A;  2XD1 A;  2WUQ A;  4S2M A;  3G31 A;  4DF6 A;  5U47 A;  1JWP A;  2Y2H A;  3MZF A;  1K25 A;  4JXW A;  1WYB A;  4PPR A;  5D3O A;  1LI0 A;  3SH9 A;  1K4E A;  3LY3 A;  4PMA A;  5FQI A;  3B3X A;  4X53 A;  4MBK A;  4N92 A;  3FKV A;  5E2F A;  3OPL A;  1KE4 A;  2DCF A;  1C3B A;  1ZC2 A;  1DJB A;  3UDF A;  3VP3 A;  1GA9 A;  3ZG9 B;  1ZG4 A;  2WKE A;  3MFD A;  5F83 A;  2XD5 A;  3GRJ A;  5GLD A;  2OLU A;  4YFM A;  3HUN A;  2Y2N A;  1CK3 A;  1JWV A;  4NK3 A;  2ZD8 A;  2PBY A;  1KGF A;  5GL9 A;  4EBL A;  4JKT A;  1GHI A;  5GLA A;  2EX8 A;  2EXB A;  3O87 A;  4GN2 A;  4K0W A;  5HAP A;  4R4S A;  1KGG A;  1SKF A;  3GMW A;  3NIA A;  2A49 A;  1YT4 A;  2PU4 A;  1Q2Q A;  4S2N C;  5AQ7 A;  1L0G A;  1BUL A;  3P09 A;  3PTE A;  4KZ4 A;  3W4Q A;  2CC1 A;  3WRT A;  3GTC A;  4K91 A;  2E8I A;  4OQ0 A;  3TG9 A;  3UDX A;  4C6Y A;  4ZJ1 A;  2HDS A;  1XX2 A;  4WZ5 A;  2ZM0 A;  3TOI A;  4QJG A;  1G6A A;  4WBG A;  4B88 A;  2WKI A;  4QB8 A;  1L0D A;  2Y2P A;  2Y91 A;  4JXG A;  4MNR A;  1HVB A;  5HFO A;  4K0X A;  3GR2 A;  3HLB A;  4WEJ A;  5M19 A;  5FQQ A;  3VFF A;  1DJC A;  2Y2K A;  1BLS A;  3ZVW A;  1NRF A;  4PM8 A;  5A93 A;  4X55 A;  1S0W A;  4EV4 A;  2HDU A;  4WM9 A;  5EVI D;  4E3O A;  3PBT A;  4ID4 A;  2Y2M A;  1XKZ A;  3NCK A;  5DVA A;  3A3E A;  5M18 A;  1IYS A;  1BSG A;  3G4P A;  4GOG A;  3IWQ A;  5HW3 A;  2WAD A;  5FI2 A;  4DDY A;  3MKF A;  4OLD A;  3W4O A;  3N4I A;  4KZ8 A;  3FWL A;  4Q8I A;  3ZGA B;  1ESU A;  1ZG6 A;  2ZQC A;  4XUX A;  3Q7V A;  4OQI A;  3V3S A;  2DRW A;  4DE0 A;  2OV5 A;  4ZTK A;  1RP5 A;  1CEG A;  2IWC A;  5F1F A;  1L0E A;  3C7V A;  1PW1 A;  2IWB A;  3VP0 A;  1GHP A;  1L0F A;  4X69 A;  1PZO A;  4WMC D;  3G32 A;  4BQM A;  3VP4 A;  2XFS A;  3GV9 A;  4GDN A;  1XA1 A;  1M6K A;  4E3J A;  3P98 A;  5EVI B;  3WS2 A;  3IT9 A;  1Z6F A;  3SH7 A;  4QD4 A;  1W79 A;  1L2S A;  3FV7 A;  2H0T A;  3HVF A;  4P6B A;  5A91 A;  2ZQ7 A;  2Y2J A;  3NY4 A;  2UWX A;  1MXO A;  3NBL A;  4ZAM A;  4LCL A;  2Y2G A;  2ZM8 A;  1KE3 A;  1E3U D;  4U3T A;  5CXW A;  2EFU A;  3IXD A;  1MBL A;  3O88 A;  4FH4 A;  4MLL A;  4E3K A;  4N1H A;  4HES A;  4R23 A;  4IBR A;  3V3R A;  3BFG A;  3GQZ A;  1GHM A;  1KVL A;  2RCX A;  2WGW A;  4R3B A;  3ZG7 B;  1KGE A;  4HEF A;  5EOE A;  1BUE A;  3M6H A;  4S2J A;  1PZP A;  3E2K A;  2Q9M A;  1FR1 A;  3FKW A;  5DTS A;  3PAG A;  4RX3 A;  4BL2 A;  3WS5 A;  3IF6 C;  2Y2L A;  3HLD A;  3WWX A;  5CTM A;  3GSG A;  3PBN A;  2QZ6 A;  2EX6 A;  3NDE A;  3M2J A;  2WAF A;  3DWK A;  5EOO A;  2XH9 A;  4KG2 A;  3ZFZ A;  1NJ4 A;  1I5Q A;  5CHU A;  3RXW A;  5KMW A;  2XQZ A;  3MKE A;  3ITA A;  3C4O A;  3GVB A;  1LL9 A;  4LV2 A;  5CGS A;  3UNW A;  3G2Z A;  1QMF A;  1XGI A;  4KZA A;  4OH0 A;  1IEM A;  3A3D A;  2I72 A;  3IXB A;  2Y4A A;  2ZC5 B;  3OPP A;  4X56 A;  2C6W B;  5J8X A;  3UY6 A;  4U0T A;  2X01 A;  1PI4 A;  2XR0 A;  3BFF A;  3VOY A;  3SS5 A;  3BM6 A;  3IWO A;  3A3F A;  4P85 A;  3VSK A;  5DF7 A;  1OME A;  4R1G A;  1LI9 A;  4LV1 A;  2H0Y A;  3JYI A;  5FQJ A;  1IKG A;  3IH8 A;  4L0L A;  4EBN A;  5EVI A;  4E3I A;  5HX9 A;  2OLV A;  5AQA A;  3WRZ A;  3VFH A;  4KG6 A;  1SDN A;  3BEC A;  5CRF A;  5E43 A;  3OPR A;  4KQR A;  1YLJ A;  1K54 C;  4YIN A;  5FI7 A;  3BFE A;  3VSL A;  1PWD A;  1YMS A;  4MEZ A;  4Y7P A;  3IF5 A;  4BJP A;  1XGJ A;  2R9X A;  3O3V A;  1ALQ A;  5FI6 A;  1K57 C;  3VMA A;  3SS4 A;  1IKI A;  4OLG A;  3PBQ A;  4E3M A;  1YQS A;  4OQG A;  3QNB A;  4FSF A;  4JPM A;  3OC2 A;  4WMC A;  3UPN A;  4KZ5 A;  4JXS A;  3C7U A;  3NC8 A;  5FSR A;  4E6X A;  2P9V B;  3CJM A;  1K57 A;  4PM9 A;  3QHY A;  3ZVT A;  4KEN B;  3ISG A;  1DJA A;  1BT5 A;  2J9P A;  4UHU A;  3LO7 A;  3ZG8 B;  1E4D A;  3ZCZ A;  1MWU A;  5HAR A;  4E3L A;  1AXB A;  1U60 A;  1K56 A;  1G68 A;  2X02 A;  4JF5 A;  3VP1 A;  2Q9N A;  5L2F A;  3HL9 A;  4UAA A;  4OQH A;  1YLW A;  5IHV A;  2XGN A;  4O7D A;  4BEN A;  3A3I A;  1O07 A;  1TVF A;  1WE4 A;  4PM6 A;  4XXR A;  2P9V A;  2J7V A;  3IQA A;  1PYY A;  2H10 A;  4GD8 A;  5FQK A;  1RGY A;  2B5R A;  1XP4 A;  2H5S A;  1TDL A;  3N8L A;  3OCL A;  4UA7 A;  5DTK A;  5A92 A;  4BL3 A;  5EVL A;  1BLH A;  5I94 A;  4FCF A;  3ZG5 A;  3MBZ A;  1J9M A;  3OCN A;  4OOL A;  1K55 C;  1CEF A;  3G2Y A;  4IVK A;  3SOI A;  1S6R A;  5GHZ A;  5CHM A;  4LV0 A;  3UDI A;  3W8K A;  1JWZ A;  5F1G A;  1NZO A;  1XXM A;  2JBF A;  1IYO A;  2FFF B;  4MBH A;  4P87 A;  4OP5 A;  4LCM A;  3WS0 A;  3ZG0 A;  3C5A A;  3DW0 A;  4EUZ A;  4EWF A;  3LCE A;  1ES4 A;  2G2W A;  4MBF A;  1FCN A;  1SCW A;  5E2G A;  5E2E A;  4OPQ A;  1ZKJ A;  1TEM A;  3Q82 A;  5HL1 A;  2EXA A;  4GZB A;  4N9L A;  4E3N A;  4Z9Q A;  5CHJ A;  4S2I A;  4WZ4 A;  1H8Z A;  2J9O A;  2WZX A;  3BEB A;  2HDQ A;  2VGJ A;  2EX2 A;  3PBR A;  5FAS A;  1BLC A;  4KZ3 A;  4R3J A;  3O86 A;  1GA0 A;  4EQI A;  2Y2I A;  4LEN A;  4QY6 A;  1SDE A;  1PI5 A;  1BLP A;  1DY6 A;  3UE1 A;  1LL5 A;  4KZB A;  3MXS A;  1K55 A;  1ES5 A;  1FCM A;  4P0M A;  2Y2Q A;  3AGE A;  3BFD A;  5FAP A;  5FAT A;  2HP6 A;  2Y59 A;  1MWS A;  1JVJ A;  3HBR A;  4B4Z A;  1FSY A;  1K6R A;  5CTN A;  3V5M A;  3IHA A;  1K4F A;  4IBX A;  4KG5 A;  1H8Y A;  3TSG A;  3LY4 A;  3QNC A;  5GLB A;  1N9B A;  4KZ9 A;  1M40 A;  4OON A;  1FQG A;  3IF6 A;  3HLC A;  4HBT A;  2ZMA A;  4RVA A;  3V39 A;  3D4F A;  3AGD A;  3MZE A;  2C5W B;  2Z2M B;  3Q07 A;  4ZDX A;  3BYD A;  4WYY A;  2WGW B;  3HUM A;  3HRE A;  2WKH A;  4DE1 A;  2WAE A;  4JF4 A;  4CJN A;  4F94 A;  5TGF A;  2XFT A;  5A90 A;  4QHC A;  5TR7 A;  2WGV A;  1EWZ A;  1O7E A;  3AGF A;  4HBU A;  3FZC A;  4EBP A;  3Q1F A;  2J8Y A;  4E6W A;  5JYO A;  1FR6 A;  4WEL A;  4UA9 A;  4KZ7 A;  1NYM A;  1XPB A;  4S2K A;  4FH2 A;  3Q81 A;  4R4R A;  5FQM A;  3UO9 A;  4KQQ A;  2XF3 A;  5CGX A;  3ZNT A;  3ZNY A;  2Y2O A;  1MKI A;  3UN7 A;  4NET A;  5FQ9 A;  3UPO A;  1VQQ A;  2HP9 A;  2IWD A;  1W5D A;  4JXV A;  1JTG A;  3UE3 A;  4M3K A;  5FDH A;  5TFQ A;  1I2S A;  4A5R A;  1LHY A;  2RL3 A;  2ZQA A;  4JBF A;  2R9W A;  4OP8 A;  4BD1 A;  4DKI A;  1CI9 A;  5BOH A;  3CZD A;  4GDB A;  2ZLY A;  2VGK A;  2G2U A;  2GDN A;  4JF6 A;  2XEP A;  1GCE A;  2XDM A;  4ZJ3 A;  1BTL A;  1NXY A;  3W4P A;  1CI8 A;  4WEK A;  1E25 A;  4KZ6 A;  4Y0U A;  3SH8 A;  4DDS A;  3IHB A;  2PU2 A;  3G34 A;  1ES3 A;  1KDW A;  2V2F F;  4CPK A;  4H8R A;  2WGI A;  5EVI C;  4OOM A;  2HDR A;  2OSU A;  4S2O A;  4B4X A;  4JLF A;  1K38 A;  5DF9 A;  2JE5 A;  3BLM A;  2JCH A;  2WZZ A;  3G35 A;  1TDG A;  2WYX A;  3PBS A;  5CGW A;  3V50 A;  5DF8 A;  2ZC7 A;  2QPN A;  4FD8 A;  5CED A;  1K54 A;  3N7W A;  5GHX A;  2QMI A;  5HAQ A;  5E2H A;  4OPZ A;  1RCJ A;  3UE0 A;  4N1X A;  3VP2 A;  1FCO A;  1ESI A;  3VOZ A;  1KDS A;  2XK1 A;  2HPB A;  2X71 A;  1VM1 A;  2ZC6 B;  5GHY A;  1ONG A;  5AQ9 A;  5FAQ A;  5EE8 A;  3HLW A;  1K56 D;  3IXG A;  4RX2 A;  4X68 A;  3SS3 A;  4Y0O A;  3BRM A;  1YLP A;  2P74 A;  5DTT A;  5JYP A;  5CER A;  4BLM A;  4D2O A;  4DE2 A;  2A3U A;  1YLT A;  4OOY A;  1MPL A;  5G18 A;  1K6S A;  1E3U A;  5CEC A;  3BLS A;  1ONH A;  2V20 A;  4IVI A;  4U0X A;  4RYE A;  4XUZ A;  2ZM2 A;  3IXH A;  1MWT A;  5FA7 A;  2ZJ9 A;  4Y0T A;  3WS4 A;  1YLZ A;  3NI9 A;  1HZO A;  1QME A;  3CMZ A;  3IF6 B;  3MZD A;  4N9K A;  1I2W A;  4DXB A;  2ZQD A;  3E2L A;  1LLB A;  3WS1 A;  5CEB A;  3A3J A;  2HP5 A;  3FYZ A;  4RA7 A;  1PW8 A;  1NY0 A;  1JTD A;  1KVM A;  4PM5 A;  2EFX A;  3BFC A;  3C4P A;  1NYY A;  1WYC A;  2ZQ9 A;  4OPY A;  4DRT A;  1IEL A;  2EX9 A;  2ZQ8 A;  5F82 A;  3Q7Z A;  1MWR A;  1YM1 A;  1N4O A;  4DXC A;  5GLC A;  1W7F A;  3S4X A;  3I7J A;  1ERO A;  3LEZ A;  4QY5 A;  1PWG A;  1FOF A;  4OPR A;  1BZA A;  2WK0 A;  3M2K A;  5AQB A;  3DTM A;  3HUO A;  1NZU A;  1ERM A;  3N8R A;  4BD0 A;  3ZDJ A;  1W8Y A;  4S2P A;  2DNS A;  1HD8 A;  4KQO A;  3M6B A;  3RXX A;  5EEC A;  3HLF A;  3IWI A;  1YMX A;  4GNU A;  4S2N A;  1FSW A;  1PWC A;  2ZC4 B;  2ZC3 B;  3IH9 A;  3S22 A;  3DWZ A;  4R0Q A;  4C3Q A;  2Z2L B;  3HLG A;  1HTZ A;  1ES2 A;  3CG5 A;  1EI5 A;  1SHV A;  5M1A A;  1MY8 A;  1Q2P A;  3N8S A;  4X6T A;  1KE0 A;  3OPH A;  1RGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...