3I7JA

Crystal structure of a beta-lactamase (mb2281c) from mycobacterium bovis, northeast structural genomics consortium target mbr246
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
273
structure length
273
Chain Sequence
TALEVLGGWPVPAAAAAVIGPAGVLATHGDTARVFALASVTKPLVARAAQVAVEEGVVNLDTPAGPPGSTVRHLLAHTSGLAMHSDQALARPGTRRMYSNYGFTVLAESVQRESGIEFGRYLTEAVCEPLGMVTTRLDGGPAAAGFGATSTVADLAVFAGDLLRPSTVSAQMHADATTVQFPGLDGVLPGYGVQRPNDWGLGFEIRNSKSPHWTGECNSTRTFGHFGQSGGFIWVDPKADLALVVLTARDFGDWALDLWPAISDAVLAEYTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-lactamase Mb2281c
publication title Northeast Structural Genomics Consortium Target MbR246
rcsb
source organism Mycobacterium bovis
total genus 75
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3i7jA00
3FKVA 4QJGA 1BTLA 2XR0A 2QZ6A 2XLNA 1XA7A 4MBKA 4OPYA 4XUXA 5FASA 3D4FA 3UE0A 3VP1A 3GTCA 4CJNA 3C4PA 3VOZA 4OLDA 1HTZA 4LV3A 4E3MA 2Y2MA 2ZM2A 4P85A 5E2HA 3W4OA 4C6YA 2Y91A 1PWDA 4KZ5A 1PYYA 3IF6A 5CRFA 3N4IA 4N92A 1BZAA 1YLWA 3PAGA 1GCEA 3PTEA 2WADA 4JXGA 1MXOA 4X68A 1YMSA 3BYDA 5CHUA 3IWIA 2XFSA 4IBRA 4S2PA 3BFGA 1YLPA 5JYOA 4C75A 3TG9A 1SDEA 4QY6A 5M18A 3ZGAB 1ES5A 4WYYA 1K54A 2Y2KA 3WS5A 3ZG5A 4EBPA 1E3UA 2ZC6B 4WEKA 4GOGA 3UPNA 1K57A 1ZKJA 3LO7A 1CI8A 3MZFA 4FH4A 4JF6A 4MNRA 3RXWA 4EWFA 4HESA 1ERMA 5GHXA 1NJ4A 1QMEA 2Q9MA 4KQRA 3EQVA 3WS1A 1C3BA 4DDSA 2XQZA 5EVID 3WS0A 1O07A 4DE1A 2HPBA 5EVIA 2XDMA 3PBRA 3MXRA 4ZJ3A 1ESUA 1N9BA 1PIOA 4N1HA 2ZMAA 1RGZA 3MKFA 3VSKA 4OONA 2ZQDA 2EX9A 5GHYA 3Q7VB 5FI6A 1K38A 4X69A 5EPHA 3ZNTA 4CPKA 1JWPA 3IHBA 3P09A 3TSGA 2ZD8A 1CK3A 4EV4A 4WMCD 2FFFB 3BRMA 4FCFA 5GLAA 4OVDA 4WMCA 1IEMA 2A49A 3UE1A 4DE0A 1W79A 4XXRA 5IHVA 1L0FA 2X02A 2HDRA 5EUAA 1YMXA 2EX2A 4B4ZA 5HAIA 2H0TA 3Q1FA 1DJCA 2XGNA 5DTKA 5FQ9A 3WRTA 4PM6A 4BLMA 3NIAA 1XPBA 5L2FA 2V2FF 4FH2A 3UPOA 4JF4A 1H5XA 2H5SA 2ZC4B 4HEFA 4IVKA 4KG5A 3SH8A 4JKTA 4OPRA 5DTSA 5FI7A 1W8YA 1GHPA 2CC1A 1DJAA 1W5DA 2ZM8A 3HLEA 4DE3A 4JXSA 4DRTA 2VGKA 5I94A 2XFTA 1DJBA 1O7EA 4JF5A 5CGSA 4OQHA 4DDYA 1LI9A 4ZJ2A 1G6AA 5FQMA 2R9WA 3BECA 1PZPA 1KDWA 1DY6A 4RA7A 1ZG6A 3OPPA 3UDIA 1VM1A 1BT5A 3FKWA 4UHUA 3G4PA 4DXBA 1EI5A 4ZDXA 4MEZA 1YT4A 2JBFA 4RYEA 3OCLA 5DF9A 3UDXA 1ES2A 3NBLA 2P9VB 5FDHA 1SCWA 1PWCA 4WBGA 3DWKA 1KE4A 1U60A 1YLZA 3HLWA 2PBYA 3PBNA 1FOFA 2X01A 3IT9A 5DF8A 4S2NA 3VP4A 4BD1A 3N8LA 4KZ4A 5CTMA 1VQQA 3OZHA 2Y4AA 1HZOA 2Y2JA 4KQOA 4S2JA 4JBFA 3VOYA 4RX2A 5A91A 3FZCA 5HAQA 3BM6A 2Y2HA 2WGIA 3W8KA 4R23A 3IF6C 1KE0A 5F83A 2E8IA 1FCMA 5JYPA 1JTDA 3VMAA 3IF6B 5KZHA 1IYPA 4IBXA 1N4OA 2UWXA 1HD8A 3SOIA 4OQ0A 1Q2QA 2EXAA 3HLCA 1MWTA 2QPNA 2XK1A 1JTGA 2V20A 4GB7A 2WAEA 1K54C 5J8XA 3GV9A 1K57C 2IWDA 4LV0A 4O7DA 4NETA 3AGFA 3E2KA 4WEJA 3C5AA 4S2LA 2C6WB 1L0EA 3A3EA 4WZ4A 5KSCA 4OQGA 3DWZA 3V3RA 1NYMA 4X56A 2WKHA 3NDGA 2OLUA 5TGFA 4B88A 1BULA 1LL9A 3BLMA 5HX9A 5AQ9A 1FSYA 2JCHA 3NCKA 3E2LA 3M2KA 4LV2A 1ZC2A 4PM8A 4BD0A 5FQQA 5EVIC 2EX6A 3QHYA 4X55A 4DKIA 5EVIB 2B5RA 1BLPA 5EECA 2C5WB 2I72A 2Q9NA 4P87A 1LHYA 4IEDA 4E6XA 1Z6FA 1YLTA 3NY4A 5A93A 5FAOA 2WYXA 2H10A 5EVLA 1ALQA 1GHIA 2EX8A 5CTNA 2OLVA 4JPMA 4R4SA 3SH7A 4RVAA 5CXWA 1LLBA 3SH9A 4DXCA 5A92A 5HL1A 3OPRA 3PBTA 4JXWA 1IYOA 4N1XA 5CHJA 3UDFA 4BENA 3MBZA 4MBHA 3UO9A 1K25A 3GRJA 1WYBA 1ERQA 4S2KA 4OKPA 2WKIA 3GR2A 1KVMA 3QNBA 3NC8A 3UY6A 1W7FA 3HBRA 4R0QA 5EE8A 2BLSA 3VSLA 1RGYA 3CJMA 1BUEA 4E3OA 3WS2A 2EFXA 4E6WA 4UA7A 4BL2A 2QMIA 4KZ3A 3ZG0A 4UAAA 4PMAA 5CEDA 4JXVA 4MBFA 3IH8A 2DRWA 2ZQ9A 1AXBA 4OP8A 1L0DA 3BLSA 3MZEA 4X6TA 1SDNA 4B4XA 4GDBA 5AQAA 3PBQA 4ZJ1A 3IXDA 4QY5A 1IKGA 1BLCA 5GL9A 3HLGA 5GHZA 1M40A 4FSFA 5GLCA 1LL5A 3OCNA 2WUQA 2Y2IA 4GNUA 2XF3A 3G31A 4OPQA 5U47A 4KZAA 5HARA 3JYIA 2J9OA 1JWVA 1ZG4A 5HW3A 3PBOA 4ZAMA 3W4PA 4EQIA 2DNSA 4GKUA 3QNCA 4S2NC 3WRZA 2Y2OA 5E2EA 1NXYA 4GD6A 2PU2A 4QHCA 3SS4A 1LI0A 4FD8A 2Y2GA 3AGDA 4E3KA 1W8QA 4K0WA 1YQSA 1L0GA 4P0MA 1K4EA 1MBLA 2FFYA 4H8RA 4S2MA 3WWXA 4LCMA 2V1ZA 3TOIA 2HP5A 3G34A 3Q82A 4HBTA 4UA6A 3EQUA 4M3KA 3Q81A 4E3LA 1YLJA 2Z2LB 4KZ7A 1K55A 1TDGA 4OOLA 4OLGA 4Y7PA 3O87A 4OOYA 3UPPA 3A3IA 4DE2A 3SS5A 2XD1A 3IWOA 4KZ9A 2VGJA 1FQGA 1KDSA 3N6IA 1JWZA 3ZG7B 1IYQA 5EOOA 5TFQA 1PW8A 3V39A 3PAEA 5A90A 1XX2A 1SKFA 5FSRA 3FYZA 4OH0A 3S22A 1MPLA 2HDQA 5FQIA 2XEPA 4R3BA 4S2IA 4PPRA 1XA1A 5G18A 2JC7A 2ZQCA 1PW1A 1TEMA 2J9PA 2XD5A 5FA7A 4PM5A 3BFCA 1MWRA 3VP0A 3ZDJA 1KGFA 3ZCZA 2DCFA 1PI5A 3HVFA 2Y2PA 4EBNA 4K91A 2Y2QA 4Y0TA 1IYSA 3S1YA 1YM1A 4JLFA 2EFUA 3LCEA 4EBLA 3PBSA 3HLBA 3GVBA 5GLDA 3IWQA 2J8YA 5M1AA 3ZVTA 3MKEA 3V5MA 4X53A 3UN7A 1WYCA 1CI9A 4S2OA 1BLSA 5F1FA 2ZLYA 2PU4A 3C7UA 3VP3A 3M2JA 5E2GA 4DF6A 2ZQ7A 3IF5A 3HLDA 1NYYA 5FAQA 1KVLA 2ZJ9A 5TR7A 4BJPA 5HAPA 3W4QA 5AQBA 1FR1A 2HDUA 3C4OA 2X71A 4WZ5A 1FR6A 1CEFA 5CGXA 3ZHHA 3CMZA 3GMWA 4OOMA 1ESIA 1XGJA 1GHMA 2EXBA 3Q07A 2HDSA 1RP5A 3CZDA 3O88A 3OC2A 2Y55A 1I2SA 3VP2A 2OV5A 3BEBA 4MLLA 1ES3A 5M19A 3V3SA 1K56D 1EROA 3G35A 2P74A 3P98A 4R4RA 4A5RA 1K56A 2WK0A 1KE3A 3UNWA 2WGWA 4QD4A 4KENB 3N8SA 5E43A 1QMFA 4U3TA 3A3JA 3HLFA 1S0WA 3A3DA 4WELA 4Z9QA 2IWCA 1KGEA 3G2ZA 1JVJA 1XXMA 4E3JA 3V50A 3G2YA 1RCJA 3LEZA 5CGWA 2ZM0A 4XUZA 4GN2A 2WKEA 3IXHA 2G2WA 4PM7A 3VFFA 1E3UD 3OPHA 4UA9A 5F1GA 4BQMA 2RL3A 1Y54A 2A3UA 3NI9A 3O3VA 1EWZA 1OMEA 1SHVA 3NDEA 3O86A 1L2SA 3UE3A 1Q2PA 5HFOA 3A3FA 3OPLA 4U0XA 5FAPA 3I7JA 4C3QA 4L0LA 4GDNA 3BFEA 4OPZA 1IKIA 4ID4A 5CEBA 1HVBA 5F82A 1K55C 1PWGA 4N9KA 3ZNYA 1E25A 2WZZA 3G30A 4KG2A 4YINA 1BLHA 3IQAA 4P6BA 3C7VA 3SS3A 3ZFZA 1FSWA 4GZBA 5DF7A 2Y59A 3CG5A 1TVFA 2Z2MB 2HP6A 2ZQ8A 3BFDA 4K0XA 5E2FA 1I2WA 4ZTKA 3ITAA 1K6RA 4Q8IA 3G32A 4E3IA 1J9MA 4NK3A 3RJUA 3HL9A 1IELA 1WE4A 3DTMA 3ISGA 4Y0OA 5FI2A 2ZC7A 2BG1A 4QU3A 1XP4A 2OSUA 5CHMA 4F94A 3ZG9B 1NY0A 2J7VA 3B3XA 3MFDA 1GA0A 3IXBA 4WM9A 1H8ZA 3LY4A 3MZDA 5EOEA 3IHAA 3MXSA 4KZ6A 4R1GA 2ZC5B 3IH9A 4KG6A 2H0YA 5GLBA 3FV7A 3HREA 5CERA 3WS4A 1K4FA 1GA9A 1XKZA 3ZG8B 3LY3A 5CECA 2ZC3B 4IVIA 4OQIA 4YFMA 3Q7VA 2Y2LA 4RX3A 3VFHA 1PZOA 3IXGA 1S6RA 4R3JA 5DVAA 1MKIA 2JE5A 4D2OA 1MWSA 4N9LA 3HUMA 4KZBA 4BL3A 1PI4A 3BFFA 3ITBA 3Q7ZA 3HUOA 2ZQAA 1FCOA 4PM9A 1ES4A 5FATA 1NZUA 1NRFA 4KZ8A 4LCLA 2HP9A 5KMWA 2Y2NA 4Y0UA 5BOHA 2GDNA 4WZ5C 1XGIA 1K6SA 3N7WA 3M6BA 5D3OA 3RXXA 3HUNA 2IWBA 5AQ7A 2WZXA 3DW0A 1TDLA 4EUZA 1NZOA 1G68A 1MWUA 2G2UA 1CEGA 3AGEA 4QB8A 4E3NA 1KGGA 1YLYA 2WAFA 5KSHA 4OP5A 3S4XA 1ONGA 3ZVWA 1H8YA 4U0TA 3GSGA 4LV1A 1MY8A 1E4DA 2WGWB 3M6HA 5FQKA 4HBUA 1M6KA 1FCNA 1ONHA 3FWLA 4LENA 1BSGA 1I5QA 4GD8A 4KQQA 2WGVA 2XH9A 5FQJA 2R9XA 3N8RA 2P9VA 5DTTA 4ZBEA 2RCXA 3GQZA
chains in the Genus database with same CATH superfamily
3KYEA 4QJGA 4MMNA 2XLNA 4OPYA 4MBKA 2L0WA 3UE0A 4LV3A 2ZM2A 1OTDA 3IF6A 2IA2A 1MXOA 2O99A 1YMSA 1STZA 1H8MA 5M18A 4ETXA 2Y2KA 4EBPA 4WEKA 3UPNA 4X1MA 4EWFA 1JNUA 3VE3A 5HD3A 4KQRA 3EQVA 4DDSA 3WS0A 1O07A 5EVIA 4KUOA 2W1RA 3MXRA 1ESUA 1OT6A 1YSQA 2ZMAA 4OONA 3T4LA 2ZQDA 2EX9A 3ZNTA 3Q7VB 5FI6A 5EPHA 1JWPA 2ZD8A 4X1LA 2FFFB 3BRMA 3IBJA 5GLAA 1VETA 3UE1A 1SKOB 1W79A 2E8JA 4PM6A 2V2FF 4QPRA 4CLCE 2J3TC 3UB7A 1A0KA 3VOLA 3F1OA 1W8YA 1OTBA 4XT2B 4L9FA 4DE3A 2ZM8A 4JXSA 5I94A 1DJBA 1O7EA 5CGSA 4OQHA 3NOTC 1G6AA 3QP4A 1KDWA 1DY6A 3A0VA 1ZG6A 3UDIA 1BYWA 1BT5A 1YT4A 1ODVA 2P9VB 5FDHA 4HP9A 1D7EA 3PYPA 4NXBA 4WBGA 2JHEA 2QJ7A 3DWKA 3PBNA 1P97A 5DF8A 3N8LA 5CTMA 2PAVP 2Y4AA 2AVXA 1G28A 1HZOA 3VOYA 3TE8A 2Y2HA 3H9WA 1FCMA 1IYPA 2LB5A 3SOIA 4OQ0A 2WAEA 2YKFA 1F98A 4LV0A 3AGFA 3C5AA 5L09A 1NYMA 3P01A 4B88A 2V9AA 1ZC2A 2B5RA 1YLTA 1ALQA 5CTNA 3SH7A 3F1PB 3KSIA 3SH9A 4KQDA 2V0WA 4N1XA 3MF0A 1VHMA 3UO9A 1K25A 3GRJA 1FILA 3CI6A 2Q0OA 1ERQA 4S2KA 3VV4A 4OKPA 5G4ZA 3KYZA 4R0QA 2L4RA 4EERA 3WS2A 4KZ3A 3HJIA 4UAAA 3ZG0A 2BASA 2NUTC 2KX6A 4GDBA 1EW0A 3IXDA 1IKGA 1BLCA 3HLGA 4FSFA 5GLCA 3OCNA 4OPQA 2W3FA 1JWVA 1ZG4A 2J80A 4LRZE 5HW3A 3PBOA 4ZAMA 4EQIA 3OOVA 1TS6A 4HNBA 3H7WA 1NXYA 4GD6A 1LI0A 4FD8A 5HZHA 4K0WA 4LGWA 1MBLA 2FFYA 1N9LA 2OWHA 2V1ZA 2OWJA 3Q81A 4KZ7A 4Y7PA 5F68A 1IYQA 3DTIA 1PW8A 5A90A 4F3LB 1SKFA 3FYZA 4I3JA 2W1TB 4OH0A 2J3WA 2O9CA 5FQIA 1LT0A 5G18A 3RFBA 1PW1A 5HWWA 1MWRA 2KDKA 3ZDJA 3ZCZA 2DCFA 1N9NA 4K91A 1PFLA 3S1YA 1YM1A 4EQ1A 3GVBA 3LR4A 5GLDA 3VE4A 5M1AA 2W3EA 4S2OA 4NG2A 4EEUA 2PU4A 2O9AA 3VP3A 1S4SA 4BJPA 5TR7A 3H82B 2HDUA 5EM0A 3QP8A 2EXBA 3VP2A 2OV5A 2VZWA 1ES3A 1GSWA 3V3SA 2P74A 2WK0A 3EWKA 1YKDA 4QD4A 1QMFA 1S0WA 2IWCA 1JVJA 1XXMA 3G2YA 1RCJA 4PHTA 4XUZA 2HV1A 2A3UA 1EWZA 2PRFA 2W27A 1SHVA 3NDEA 3O86A 3B33A 3A3FA 1S67L 2GX5A 4GDNA 4ID4A 1HVBA 1PWGA 3G30A 2VV8A 4YINA 3MS6A 3S7OA 5J4EA 1S1YA 3BY8A 4NKPA 3SS3A 3ZFZA 4GZBA 1TVFA 3LIDA 2Z2MB 1G6OA 2XA7S 5E2FA 2JKRM 4Q8IA 4E3IA 2P08A 2P7JA 1IELA 4BBVA 3FG8A 3ISGA 1T1AA 2BG1A 5CHMA 4F94A 1F9IA 3G6OA 2J7VA 1GA0A 3LY4A 5EOEA 1YSPA 2INWA 2ZC5B 3FV7A 3E4QA 4HIAA 4OQIA 1Y4OA 3JPUA 4YFMA 1ZTUA 4LRXC 2ZL1A 3ZQ5A 2W3GA 5C5KA 1MKIA 2JE5A 2PD7A 3FPVA 3ITBA 5A8BA 5FATA 2B95A 5KMWA 2V8CA 1T1BA 4WZ5C 1K6SA 3N7WA 2J3TD 5D3OA 2WKQA 5AQ7A 4EUZA 4E3NA 4Y3IA 1YLYA 4JGRA 2V1AA 3RH8B 4LV1A 4LENA 4KQQA 4GS9A 3N8RA 3GQZA 2M1CA 1BTLA 2XR0A 2QZ6A 1XA7A 3VP1A 2GZAA 1GSXA 4IUHA 4E3MA 2Y2MA 4P85A 4UEYA 2VA0A 2Y91A 1PYYA 3MQ0A 1YLWA 3NOPC 3PAGA 4LRYC 1GCEA 4JXGA 4X68A 3BYDA 1GSVA 4IBRA 1ES5A 3ZG5A 1K54A 3T4QA 3WS5A 1LL8A 1ZKJA 3MR0A 4JF6A 4HQAA 1QMEA 5GHXA 1F2KA 3T4OA 2QJ5A 5AVEA 3DTKA 2HPBA 2O9BA 3CUEA 1WA9A 4ZJ3A 1N9BA 4DJ3A 1RGZA 3CAXA 5GHYA 4HOIA 4R70A 3IHBA 1CK3A 4FCFA 1G5UA 4OVDA 4WMCA 1IEMA 5J7EA 3PHYA 1L0FA 2X02A 2HDRA 2A24A 5G4YA 2XGNA 4ARZA 4BLMA 5TBMB 3UPOA 4JF4A 2ACGA 1OTAA 1H3QA 4HEFA 4KG5A 5EVEA 3SH8A 4OPRA 5FI7A 1GHPA 3R7WA 3CLOA 4DRTA 2VGKA 2ZBBA 4JF5A 5FL3A 4ZJ2A 5FQMA 2R9WA 3LI9A 1PZPA 4RA7A 3OPPA 4O01A 4UQIM 1OJGA 4DXBA 1OTEA 4RYEA 2JBFA 3UDXA 3NBLA 5FDSA 1SCWA 1PWCA 1YLZA 4I3AA 1S1ZA 2JN7A 3VP4A 4KQOA 3FZCA 3BM6A 3T50A 4R23A 3IF6C 1KE0A 5F83A 3BWLA 5JYPA 3VMAA 3MJQA 4H6JB 4NXEA 2VLGA 1X0OA 2V20A 4IJGA 3NECA 4ME4A 1IFQA 4NETA 4WEJA 2W3HA 2C6WB 4OQGA 3U2AA 3NDGA 3LEQA 2FZ0A 3BLMA 5AQ9A 5F5YA 4BD0A 4LV2A 4PM8A 5FQQA 5EVIC 4X55A 4DKIA 4IEDA 1Z6FA 3NY4A 2H10A 5EVLA 1GHIA 2PHYA 3LIAA 4RQ9A 5CXWA 1LLBA 4GHIB 4D60A 3IX3A 3PBTA 1IYOA 3EOIA 3F1NA 4HJ6A 3O5YA 1WYBA 5HDDA 2PYRA 2WKIA 3GR2A 3QNBA 3EEAA 3QP5A 4M4XA 3CJMA 4GJ4A 2EFXA 4BL2A 2QMIA 5CEDA 1VB6A 2DRWA 1NWZA 2VX8A 2K2NA 1M40A 4GNUA 5L10A 4YOFA 5HARA 1J3WA 4HH2A 3W4PA 2DNSA 4GLQA 3ULFA 2EWVA 2NUPC 2Y2OA 2PU2A 3HJKA 2Y2GA 5DKLA 4MDZA 3U4LP 2HP5A 4UA6A 3EQUA 4M3KA 1K55A 4BBUA 3UPPA 4X25A 2XD1A 4E04A 5HPFA 3N6IA 3ZG7B 1CF0A 2PT7A 3OLOA 4I3IA 1XX2A 4QWOA 3T4TA 2XEPA 4S2IA 5FA7A 4PM5A 3VP0A 3HVFA 1V9YA 2Y2PA 3QP2A 2XSSA 5DFYA 2D01A 1OPXA 3TJZC 3LCEA 3PBSA 3HLBA 2KLIA 3KSFA 3ZVTA 1CI9A 2FH5A 5F1FA 3A0SA 2ZLYA 3C7UA 4DF6A 1YAXA 1NYYA 5FAQA 1KVLA 2ZJ9A 5L07A 3SW1A 1FR1A 2L1MA 5CGXA 4OOMA 1GHMA 1RP5A 3CZDA 3IS2A 1AWIA 4DMZA 1K56D 3LIFA 3E4OA 4IHQA 4KENB 3N8SA 3A3JA 4WELA 2PBDP 3CHWP 3GDIA 1KGEA 3CITA 3UB9A 5CGWA 4B93A 1UWPX 4GN2A 5KIZA 4PM7A 5EM1A 2K7SA 3HCYA 3OPHA 5F1GA 3NI9A 3O3VA 1L2SA 1Q2PA 2PD8A 4U0XA 5FAPA 4C3QA 3BFEA 2P04A 4KG2A 3RTYA 3IQAA 3UMDA 5IS1A 2Z6CA 4I39A 2ZQ8A 2ZL1B 3ITAA 4NK3A 1WE4A 1Z09A 3IX8A 2ZC7A 1XP4A 3MFDA 3B3XA 3IXBA 3MZDA 4R1GA 3BQAA 4KG6A 2H0YA 3WS4A 1XKZA 1GA9A 4EW7A 3LY3A 5HSQA 4IVIA 3Q7VA 4RX3A 4HJ3A 4R3JA 1D06A 4D2OA 2WKRA 1PI4A 2ZQAA 1NRFA 3FC7A 2HP9A 2H28A 1XGIA 3S7QA 2WZXA 4XT2A 1TDLA 1NZOA 2G2UA 1CEGA 1HLUP 3C2WA 2JKRI 3JVUA 4U0TA 2WGWB 4BWIA 5FQKA 1ONHA 3UB5P 4YWZA 3S7PA 3FWLA 4L9EA 2WGVA 2P9VA 5DTTA 4ZBEA 2RCXA 3FKVA 3LUQA 4NXFA 4XUXA 5FASA 3PXPA 3D4FA 4EEPA 2YKHA 3LI8A 4OLDA 3D72A 5HDSA 1HTZA 5E2HA 5J3WA 4C6YA 5HPIA 2CMNA 2VEAA 1FIKA 3BJNA 2VGLS 1BZAA 3PTEA 2WADA 4B9OA 5AJGA 3BFGA 4G3VA 5JYOA 4C75A 3TG9A 4QY6A 3ZGAB 4GOGA 1K57A 3LO7A 1CI8A 4FH4A 1KOUA 5LBRA 2A24B 1NJ4A 3WS1A 2PDRA 1C3BA 1VEUB 4WUJA 5EVID 3LR3A 2XDMA 3PBRA 4N1HA 3MKFA 2DMWA 1K38A 4X69A 3B42A 3P09A 4EV4A 3T4KA 1TD5A 3F1PA 3MSHA 2A49A 4XXRA 1P9RA 3L9KA 5HAIA 3Q1FA 1DJCA 3T4JA 5DTKA 5FQ9A 3WRTA 4ESPA 3NIAA 1XPBA 2H5SA 2ZC4B 1N9OA 4JKTA 4HJ4A 2XFTA 1Y28A 1MZUA 2QWSA 1K0KA 3S7NA 3CPTB 5AVFA 3FKWA 4UHUA 3G4PA 1EI5A 4ZDXA 4MEZA 3OCLA 1TS7A 4GW9A 5HDCA 1W63M 1KE4A 1U60A 3MQQA 2X01A 4S2NA 4BD1A 3OZHA 2Y2JA 2ZOIA 4Q0JA 5HAQA 3W8KA 2E8IA 4FTXA 3IF6B 5KZHA 1N4OA 4IUKA 2UWXA 1HD8A 4HHDA 1F5MA 5F69A 1LSXA 1CQAA 1Q2QA 2EXAA 1MWTA 3HLCA 3MXQA 2XK1A 4AFIA 3LICA 2QHKA 4GB7A 1K54C 3IBRA 2EA9A 3GV9A 4O7DA 4HY8A 4S2LA 4F3LA 1XFQA 5KSCA 2W1TA 3UMEA 3C8CA 5TGFA 2EWWA 1FSYA 3E2LA 3M2KA 4JGOA 3CUEC 3QHYA 5EVIB 2HJ9C 2Q9NA 4P87A 4E6XA 2WYXA 4EU0A 2EX8A 3EEHA 4CLCC 1S66L 4O8GA 1VETB 2I9VA 3D9YA 3QP6A 1KVMA 3F1OB 3NC8A 3UY6A 2GNXA 3H82A 5EE8A 2BLSA 4CQHA 3VSLA 1RGYA 1BUEA 4E3OA 5FEFA 3C38A 3T1QB 1XJ6A 2ZMFA 4PMAA 2V1BA 1LSVA 4JXVA 4CLCA 4MBFA 3IH8A 2PR5A 1AXBA 2ZQ9A 1L0DA 3MZEA 1SDNA 5AQAA 3R4KA 5GHZA 1LL5A 2WUQA 2Y2IA 2XF3A 5U47A 4KZAA 2J9OA 2K31A 3WRZA 4MN5A 5CX7A 3SS4A 3AGDA 4E3KA 5HD5A 1YQSA 1L0GA 4P0MA 4R3AA 4H8RA 4S2MA 3WWXA 3FPWA 4LCMA 2OAP1 1YLJA 2Z2LB 2VV7A 3O87A 4OOYA 5DFXA 3A3IA 4DE2A 3SS5A 3IWOA 2VGJA 2XA7M 5MC7A 3V39A 5FSRA 3MFXA 3S22A 4GCZA 1IOUA 4Y5FA 1XJ4A 1OTIA 4R6LA 1TEMA 2J9PA 1KGFA 3NOUC 2G7UA 4Y0TA 2Y2QA 1IYSA 4Y15A 2VKSA 4JLFA 2EFUA 4FOFA 3IWQA 1P0ZA 3MKEA 3V5MA 4X53A 1BLSA 2JKTM 3M2JA 2ZQ7A 3IF5A 3HLDA 3W4QA 1PNEA 2X71A 1FR6A 3ZHHA 3CMZA 3GMWA 1XGJA 3Q07A 2HDSA 2LB9A 3O88A 3OC2A 4L9GA 4WF0A 4MLLA 3IX4A 3G35A 3P98A 1L3LA 3A0RA 5E43A 3ICYA 4U3TA 4Z9QA 3G2ZA 4E3JA 4DJ2A 4I38A 2ZM0A 1MKMA 1TF1A 2WKEA 2G2WA 3IXHA 3KSHA 3VFFA 4EXOA 3H7WB 3K2NA 3BY9A 3KSGA 1UGUA 4KUKA 3UE3A 5HFOA 1PRQA 3I7JA 4L0LA 1IKIA 5CEBA 5F82A 1K55C 4G3WA 1BLHA 4I5SA 4P6BA 1FSWA 4MN6A 3CG5A 1W63Q 2W0NA 4K0XA 3G32A 1J9MA 3RJUA 3P7NA 3HL9A 3T1SA 4Y0OA 2OSUA 2HGVA 1DRMA 1LSWA 4WM9A 3E0YA 1H8ZA 3IHAA 4KZ6A 3BQ8A 5IU1A 5GLBA 3HREA 5HWTA 1P9WA 4BBTA 2ZC3B 3NJAA 1UWNX 1ACFA 3IXGA 3NULA 1S6RA 5DVAA 2MJ6A 3HUMA 4BL3A 3BFFA 3Q7ZA 4PM9A 4KZ8A 4LCLA 2Y2NA 4Y0UA 5TBMA 5BOHA 2GDNA 3B47A 1ZHHB 2OOLA 3RXXA 3HUNA 2IWBA 3DW0A 2Z6DA 2XRNA 1G68A 4QB8A 5KSHA 3S4XA 3ZVWA 1H8YA 3D3OA 1E4DA 3M6HA 4HBUA 1M6KA 1FCNA 2OAQ1 2R78A 2Y8HA 5HL6A 2R9XA 4Y2FA 5L8MA 3GTCA 4CJNA 3C4PA 3VOZA 1OT9A 3K3CA 3T12B 4LFUA 3W4OA 1PWDA 4KZ5A 5CRFA 3N4IA 4N92A 4H6JA 5CHUA 3IWIA 2XFSA 4S2PA 1YLPA 1SDEA 4WYYA 4P6ZS 1E3UA 2ZC6B 3MZFA 4MNRA 2HJEA 3RXWA 2V0UA 4HESA 1ERMA 2Q9MA 2M7UA 2XQZA 3C30A 4DE1A 3LIEA 4PKYA 3MQOA 3ZYTA 1PIOA 4MCWA 4WN5A 3VSKA 4CPKA 4NEED 4ZRRA 3NHQA 3TSGA 4CLCD 5F6AA 4WMCD 1V9ZA 1NLZA 4DE0A 4GHIA 3L7HA 5IHVA 5EUAA 4B4ZA 1YMXA 2EX2A 4JGPA 3W2ZA 2H0TA 4Y17A 3V67A 5L2FA 4FH2A 1H5XA 4IVKA 5DTSA 2CC1A 1DJAA 1W5DA 3HLEA 5DJTA 4DDYA 1LI9A 5DKKA 4BMWA 3BECA 1SKOA 4K08A 1VM1A 5IT5A 4LLOB 1H0MA 4GS9B 5DF9A 3TW8A 1ES2A 1XJ2A 3E4PA 4Z1WA 1NRJA 3HLWA 2PBYA 1FOFA 3IT9A 2ZMVA 4KZ4A 3DTEA 1VQQA 2W3DA 4S2JA 4JBFA 4RX2A 5A91A 2WGIA 1JTDA 3OBFA 4IBXA 3LFVA 2QPNA 2O0YA 1JTGA 1XFNA 3KYQA 5J8XA 1K57C 2IWDA 1SZVA 3E2KA 1L0EA 3A3EA 4WZ4A 3DWZA 3V3RA 4X56A 2WKHA 4FUWA 2OLUA 1BULA 1LL9A 5HX9A 2JCHA 3NCKA 3EGDC 2EX6A 1BLPA 5EECA 2C5WB 2I72A 3DBAA 1LHYA 5A93A 5FAOA 4PAUA 2D02A 4R38A 4WLAA 2OLVA 4JPMA 4R4SA 4CLCB 4RVAA 4DXCA 5A92A 5HL1A 2BTFP 3OPRA 4MN7A 3LR5A 4JXWA 5CHJA 2XROA 3UDFA 4BENA 3MBZA 4ARZB 4MBHA 3T1XA 5K5BA 3UB6A 1W7FA 3HBRA 3R7WB 2KOIA 2VK3A 4E6WA 4UA7A 3K3DA 1MC0A 4LPZA 4EETB 3PR6A 4Q0IA 4OP8A 4X6TA 3BLSA 4B4XA 3PBQA 4ZJ1A 4QY5A 4UQIS 5GL9A 3G31A 3JYIA 3GECA 5EV0A 5HWVA 3JVVA 4GKUA 4NXGA 4P6ZM 3QNCA 4S2NC 3T4SA 5E2EA 4QHCA 1XJ3A 1W8QA 5I5LA 1K4EA 4HP4A 1DP8A 3TOIA 3G34A 3Q82A 1NLYA 4HBTA 4E3LA 4OOLA 1TDGA 4OLGA 2V8FA 4KZ9A 1FQGA 1KDSA 4Q0HA 1JWZA 5EOOA 5TFQA 1DP9A 2A2LA 3PAEA 5DJUA 1TS0A 3T1RA 1DP6A 1MPLA 2HDQA 2QKPA 4R3BA 4PPRA 4HH3A 1XA1A 2JC7A 2ZQCA 3DAVA 2XD5A 2PR6A 3BFCA 2UV0E 3BW6A 1PI5A 4EBNA 3QP1A 4WL9A 4EBLA 3CWFA 2J8YA 3KX0X 1T18A 3UN7A 1WYCA 5FEGA 5E2GA 3F1NB 2GJ3A 5HAPA 2Y79A 5AQBA 3C4OA 4WZ5A 2JKFA 1CEFA 2HZ5A 1ESIA 2ZOHA 2Y55A 1I2SA 2M7VA 3BEBA 5M19A 1YPRA 1EROA 4R4RA 4A5RA 3KO6A 4DN0A 4HI4A 3UE6A 1K56A 1KE3A 3UNWA 2WGWA 1TS8A 4PKYG 3EGXC 3HLFA 3A3DA 4EUVA 3V50A 3LEZA 3UB8A 4EESA 4ETZA 4JGQA 1E3UD 4UA9A 1CJFA 2B18A 4BQMA 2RL3A 1Y54A 1OMEA 3TRCA 4Y13A 4II7A 3OPLA 2JKTI 3LIBA 4OPZA 2VGLM 4N9KA 3ZNYA 1E25A 2WZZA 2HF6A 5EFWA 3C7VA 2WKPA 5DF7A 2Y59A 2JKGA 1OJ5A 3SZTA 3LGOA 2HP6A 3BFDA 1I2WA 4ZTKA 3MMHA 1K6RA 3DTMA 2B02A 5FI2A 4QU3A 3ZG9B 1NY0A 1T19A 2QYBA 5TJJA 3MXSA 1VEUA 1S4RA 5CERA 1K4FA 2VV6A 3ZG8B 5CECA 2PYPA 4YNRA 4O0PA 2Y2LA 3VFHA 1PZOA 3LR0A 1MWSA 4N9LA 4KZBA 3HUOA 1FCOA 1ES4A 1NZUA 4G3KA 3M6BA 3IS2B 1MWUA 3AGEA 1KGGA 2VJWA 2WAFA 4OP5A 3LYXA 1ONGA 3GSGA 1MY8A 3E98A 3CPTA 1BSGA 1I5QA 4GD8A 1T1CA 2XH9A 1D1JA 5FQJA 3IH9A
chains in the Genus database with same CATH topology
3FKVA 4QJGA 1BTLA 2XR0A 2QZ6A 2XLNA 1XA7A 4MBKA 4OPYA 4XUXA 5FASA 3D4FA 3UE0A 3VP1A 3GTCA 4CJNA 3C4PA 3VOZA 4OLDA 1HTZA 4LV3A 4E3MA 2Y2MA 2ZM2A 4P85A 5E2HA 3W4OA 4C6YA 2Y91A 1PWDA 4KZ5A 1PYYA 3IF6A 5CRFA 3N4IA 4N92A 1BZAA 1YLWA 3PAGA 1GCEA 3PTEA 2WADA 4JXGA 1MXOA 4X68A 1YMSA 3BYDA 5CHUA 3IWIA 2XFSA 4IBRA 4S2PA 3BFGA 1YLPA 5JYOA 4C75A 3TG9A 1SDEA 4QY6A 5M18A 3ZGAB 1ES5A 4WYYA 1K54A 2Y2KA 3WS5A 3ZG5A 4EBPA 1E3UA 2ZC6B 4WEKA 4GOGA 3UPNA 1K57A 1ZKJA 3LO7A 1CI8A 3MZFA 4FH4A 4JF6A 4MNRA 3RXWA 4EWFA 4HESA 1ERMA 5GHXA 1NJ4A 1QMEA 2Q9MA 4KQRA 3EQVA 3WS1A 1C3BA 4DDSA 2XQZA 5EVID 3WS0A 1O07A 4DE1A 2HPBA 5EVIA 2XDMA 3PBRA 3MXRA 4ZJ3A 1ESUA 1N9BA 1PIOA 4N1HA 2ZMAA 1RGZA 3MKFA 3VSKA 4OONA 2ZQDA 2EX9A 5GHYA 3Q7VB 5FI6A 1K38A 4X69A 5EPHA 3ZNTA 4CPKA 1JWPA 3IHBA 3P09A 3TSGA 2ZD8A 1CK3A 4EV4A 4WMCD 2FFFB 3BRMA 4FCFA 5GLAA 4OVDA 4WMCA 1IEMA 2A49A 3UE1A 4DE0A 1W79A 4XXRA 5IHVA 1L0FA 2X02A 2HDRA 5EUAA 1YMXA 2EX2A 4B4ZA 5HAIA 2H0TA 3Q1FA 1DJCA 2XGNA 5DTKA 5FQ9A 3WRTA 4PM6A 4BLMA 3NIAA 1XPBA 5L2FA 2V2FF 4FH2A 3UPOA 4JF4A 1H5XA 2H5SA 2ZC4B 4HEFA 4IVKA 4KG5A 3SH8A 4JKTA 4OPRA 5DTSA 5FI7A 1W8YA 1GHPA 2CC1A 1DJAA 1W5DA 2ZM8A 3HLEA 4DE3A 4JXSA 4DRTA 2VGKA 5I94A 2XFTA 1DJBA 1O7EA 4JF5A 5CGSA 4OQHA 4DDYA 1LI9A 4ZJ2A 1G6AA 5FQMA 2R9WA 3BECA 1PZPA 1KDWA 1DY6A 4RA7A 1ZG6A 3OPPA 3UDIA 1VM1A 1BT5A 3FKWA 4UHUA 3G4PA 4DXBA 1EI5A 4ZDXA 4MEZA 1YT4A 2JBFA 4RYEA 3OCLA 5DF9A 3UDXA 1ES2A 3NBLA 2P9VB 5FDHA 1SCWA 1PWCA 4WBGA 3DWKA 1KE4A 1U60A 1YLZA 3HLWA 2PBYA 3PBNA 1FOFA 2X01A 3IT9A 5DF8A 4S2NA 3VP4A 4BD1A 3N8LA 4KZ4A 5CTMA 1VQQA 3OZHA 2Y4AA 1HZOA 2Y2JA 4KQOA 4S2JA 4JBFA 3VOYA 4RX2A 5A91A 3FZCA 5HAQA 3BM6A 2Y2HA 2WGIA 3W8KA 4R23A 3IF6C 1KE0A 5F83A 2E8IA 1FCMA 5JYPA 1JTDA 3VMAA 3IF6B 5KZHA 1IYPA 4IBXA 1N4OA 2UWXA 1HD8A 3SOIA 4OQ0A 1Q2QA 2EXAA 3HLCA 1MWTA 2QPNA 2XK1A 1JTGA 2V20A 4GB7A 2WAEA 1K54C 5J8XA 3GV9A 1K57C 2IWDA 4LV0A 4O7DA 4NETA 3AGFA 3E2KA 4WEJA 3C5AA 4S2LA 2C6WB 1L0EA 3A3EA 4WZ4A 5KSCA 4OQGA 3DWZA 3V3RA 1NYMA 4X56A 2WKHA 3NDGA 2OLUA 5TGFA 4B88A 1BULA 1LL9A 3BLMA 5HX9A 5AQ9A 1FSYA 2JCHA 3NCKA 3E2LA 3M2KA 4LV2A 1ZC2A 4PM8A 4BD0A 5FQQA 5EVIC 2EX6A 3QHYA 4X55A 4DKIA 5EVIB 2B5RA 1BLPA 5EECA 2C5WB 2I72A 2Q9NA 4P87A 1LHYA 4IEDA 4E6XA 1Z6FA 1YLTA 3NY4A 5A93A 5FAOA 2WYXA 2H10A 5EVLA 1ALQA 1GHIA 2EX8A 5CTNA 2OLVA 4JPMA 4R4SA 3SH7A 4RVAA 5CXWA 1LLBA 3SH9A 4DXCA 5A92A 5HL1A 3OPRA 3PBTA 4JXWA 1IYOA 4N1XA 5CHJA 3UDFA 4BENA 3MBZA 4MBHA 3UO9A 1K25A 3GRJA 1WYBA 1ERQA 4S2KA 4OKPA 2WKIA 3GR2A 1KVMA 3QNBA 3NC8A 3UY6A 1W7FA 3HBRA 4R0QA 5EE8A 2BLSA 3VSLA 1RGYA 3CJMA 1BUEA 4E3OA 3WS2A 2EFXA 4E6WA 4UA7A 4BL2A 2QMIA 4KZ3A 3ZG0A 4UAAA 4PMAA 5CEDA 4JXVA 4MBFA 3IH8A 2DRWA 2ZQ9A 1AXBA 4OP8A 1L0DA 3BLSA 3MZEA 4X6TA 1SDNA 4B4XA 4GDBA 5AQAA 3PBQA 4ZJ1A 3IXDA 4QY5A 1IKGA 1BLCA 5GL9A 3HLGA 5GHZA 1M40A 4FSFA 5GLCA 1LL5A 3OCNA 2WUQA 2Y2IA 4GNUA 2XF3A 3G31A 4OPQA 5U47A 4KZAA 5HARA 3JYIA 2J9OA 1JWVA 1ZG4A 5HW3A 3PBOA 4ZAMA 3W4PA 4EQIA 2DNSA 4GKUA 3QNCA 4S2NC 3WRZA 2Y2OA 5E2EA 1NXYA 4GD6A 2PU2A 4QHCA 3SS4A 1LI0A 4FD8A 2Y2GA 3AGDA 4E3KA 1W8QA 4K0WA 1YQSA 1L0GA 4P0MA 1K4EA 1MBLA 2FFYA 4H8RA 4S2MA 3WWXA 4LCMA 2V1ZA 3TOIA 2HP5A 3G34A 3Q82A 4HBTA 4UA6A 3EQUA 4M3KA 3Q81A 4E3LA 1YLJA 2Z2LB 4KZ7A 1K55A 1TDGA 4OOLA 4OLGA 4Y7PA 3O87A 4OOYA 3UPPA 3A3IA 4DE2A 3SS5A 2XD1A 3IWOA 4KZ9A 2VGJA 1FQGA 1KDSA 3N6IA 1JWZA 3ZG7B 1IYQA 5EOOA 5TFQA 1PW8A 3V39A 3PAEA 5A90A 1XX2A 1SKFA 5FSRA 3FYZA 4OH0A 3S22A 1MPLA 2HDQA 5FQIA 2XEPA 4R3BA 4S2IA 4PPRA 1XA1A 5G18A 2JC7A 2ZQCA 1PW1A 1TEMA 2J9PA 2XD5A 5FA7A 4PM5A 3BFCA 1MWRA 3VP0A 3ZDJA 1KGFA 3ZCZA 2DCFA 1PI5A 3HVFA 2Y2PA 4EBNA 4K91A 2Y2QA 4Y0TA 1IYSA 3S1YA 1YM1A 4JLFA 2EFUA 3LCEA 4EBLA 3PBSA 3HLBA 3GVBA 5GLDA 3IWQA 2J8YA 5M1AA 3ZVTA 3MKEA 3V5MA 4X53A 3UN7A 1WYCA 1CI9A 4S2OA 1BLSA 5F1FA 2ZLYA 2PU4A 3C7UA 3VP3A 3M2JA 5E2GA 4DF6A 2ZQ7A 3IF5A 3HLDA 1NYYA 5FAQA 1KVLA 2ZJ9A 5TR7A 4BJPA 5HAPA 3W4QA 5AQBA 1FR1A 2HDUA 3C4OA 2X71A 4WZ5A 1FR6A 1CEFA 5CGXA 3ZHHA 3CMZA 3GMWA 4OOMA 1ESIA 1XGJA 1GHMA 2EXBA 3Q07A 2HDSA 1RP5A 3CZDA 3O88A 3OC2A 2Y55A 1I2SA 3VP2A 2OV5A 3BEBA 4MLLA 1ES3A 5M19A 3V3SA 1K56D 1EROA 3G35A 2P74A 3P98A 4R4RA 4A5RA 1K56A 2WK0A 1KE3A 3UNWA 2WGWA 4QD4A 4KENB 3N8SA 5E43A 1QMFA 4U3TA 3A3JA 3HLFA 1S0WA 3A3DA 4WELA 4Z9QA 2IWCA 1KGEA 3G2ZA 1JVJA 1XXMA 4E3JA 3V50A 3G2YA 1RCJA 3LEZA 5CGWA 2ZM0A 4XUZA 4GN2A 2WKEA 3IXHA 2G2WA 4PM7A 3VFFA 1E3UD 3OPHA 4UA9A 5F1GA 4BQMA 2RL3A 1Y54A 2A3UA 3NI9A 3O3VA 1EWZA 1OMEA 1SHVA 3NDEA 3O86A 1L2SA 3UE3A 1Q2PA 5HFOA 3A3FA 3OPLA 4U0XA 5FAPA 3I7JA 4C3QA 4L0LA 4GDNA 3BFEA 4OPZA 1IKIA 4ID4A 5CEBA 1HVBA 5F82A 1K55C 1PWGA 4N9KA 3ZNYA 1E25A 2WZZA 3G30A 4KG2A 4YINA 1BLHA 3IQAA 4P6BA 3C7VA 3SS3A 3ZFZA 1FSWA 4GZBA 5DF7A 2Y59A 3CG5A 1TVFA 2Z2MB 2HP6A 2ZQ8A 3BFDA 4K0XA 5E2FA 1I2WA 4ZTKA 3ITAA 1K6RA 4Q8IA 3G32A 4E3IA 1J9MA 4NK3A 3RJUA 3HL9A 1IELA 1WE4A 3DTMA 3ISGA 4Y0OA 5FI2A 2ZC7A 2BG1A 4QU3A 1XP4A 2OSUA 5CHMA 4F94A 3ZG9B 1NY0A 2J7VA 3B3XA 3MFDA 1GA0A 3IXBA 4WM9A 1H8ZA 3LY4A 3MZDA 5EOEA 3IHAA 3MXSA 4KZ6A 4R1GA 2ZC5B 3IH9A 4KG6A 2H0YA 5GLBA 3FV7A 3HREA 5CERA 3WS4A 1K4FA 1GA9A 1XKZA 3ZG8B 3LY3A 5CECA 2ZC3B 4IVIA 4OQIA 4YFMA 3Q7VA 2Y2LA 4RX3A 3VFHA 1PZOA 3IXGA 1S6RA 4R3JA 5DVAA 1MKIA 2JE5A 4D2OA 1MWSA 4N9LA 3HUMA 4KZBA 4BL3A 1PI4A 3BFFA 3ITBA 3Q7ZA 3HUOA 2ZQAA 1FCOA 4PM9A 1ES4A 5FATA 1NZUA 1NRFA 4KZ8A 4LCLA 2HP9A 5KMWA 2Y2NA 4Y0UA 5BOHA 2GDNA 4WZ5C 1XGIA 1K6SA 3N7WA 3M6BA 5D3OA 3RXXA 3HUNA 2IWBA 5AQ7A 2WZXA 3DW0A 1TDLA 4EUZA 1NZOA 1G68A 1MWUA 2G2UA 1CEGA 3AGEA 4QB8A 4E3NA 1KGGA 1YLYA 2WAFA 5KSHA 4OP5A 3S4XA 1ONGA 3ZVWA 1H8YA 4U0TA 3GSGA 4LV1A 1MY8A 1E4DA 2WGWB 3M6HA 5FQKA 4HBUA 1M6KA 1FCNA 1ONHA 3FWLA 4LENA 1BSGA 1I5QA 4GD8A 4KQQA 2WGVA 2XH9A 5FQJA 2R9XA 3N8RA 2P9VA 5DTTA 4ZBEA 2RCXA 3GQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKV A;  4QJG A;  1BTL A;  2XR0 A;  2QZ6 A;  2XLN A;  1XA7 A;  4MBK A;  4OPY A;  4XUX A;  5FAS A;  3D4F A;  3UE0 A;  3VP1 A;  3GTC A;  4CJN A;  3C4P A;  3VOZ A;  4OLD A;  1HTZ A;  4LV3 A;  4E3M A;  2Y2M A;  2ZM2 A;  4P85 A;  5E2H A;  3W4O A;  4C6Y A;  2Y91 A;  1PWD A;  4KZ5 A;  1PYY A;  3IF6 A;  5CRF A;  3N4I A;  4N92 A;  1BZA A;  1YLW A;  3PAG A;  1GCE A;  3PTE A;  2WAD A;  4JXG A;  1MXO A;  4X68 A;  1YMS A;  3BYD A;  5CHU A;  3IWI A;  2XFS A;  4IBR A;  4S2P A;  3BFG A;  1YLP A;  5JYO A;  4C75 A;  3TG9 A;  1SDE A;  4QY6 A;  5M18 A;  3ZGA B;  1ES5 A;  4WYY A;  1K54 A;  2Y2K A;  3WS5 A;  3ZG5 A;  4EBP A;  1E3U A;  2ZC6 B;  4WEK A;  4GOG A;  3UPN A;  1K57 A;  1ZKJ A;  3LO7 A;  1CI8 A;  3MZF A;  4FH4 A;  4JF6 A;  4MNR A;  3RXW A;  4EWF A;  4HES A;  1ERM A;  5GHX A;  1NJ4 A;  1QME A;  2Q9M A;  4KQR A;  3EQV A;  3WS1 A;  1C3B A;  4DDS A;  2XQZ A;  5EVI D;  3WS0 A;  1O07 A;  4DE1 A;  2HPB A;  5EVI A;  2XDM A;  3PBR A;  3MXR A;  4ZJ3 A;  1ESU A;  1N9B A;  1PIO A;  4N1H A;  2ZMA A;  1RGZ A;  3MKF A;  3VSK A;  4OON A;  2ZQD A;  2EX9 A;  5GHY A;  3Q7V B;  5FI6 A;  1K38 A;  4X69 A;  5EPH A;  3ZNT A;  4CPK A;  1JWP A;  3IHB A;  3P09 A;  3TSG A;  2ZD8 A;  1CK3 A;  4EV4 A;  4WMC D;  2FFF B;  3BRM A;  4FCF A;  5GLA A;  4OVD A;  4WMC A;  1IEM A;  2A49 A;  3UE1 A;  4DE0 A;  1W79 A;  4XXR A;  5IHV A;  1L0F A;  2X02 A;  2HDR A;  5EUA A;  1YMX A;  2EX2 A;  4B4Z A;  5HAI A;  2H0T A;  3Q1F A;  1DJC A;  2XGN A;  5DTK A;  5FQ9 A;  3WRT A;  4PM6 A;  4BLM A;  3NIA A;  1XPB A;  5L2F A;  2V2F F;  4FH2 A;  3UPO A;  4JF4 A;  1H5X A;  2H5S A;  2ZC4 B;  4HEF A;  4IVK A;  4KG5 A;  3SH8 A;  4JKT A;  4OPR A;  5DTS A;  5FI7 A;  1W8Y A;  1GHP A;  2CC1 A;  1DJA A;  1W5D A;  2ZM8 A;  3HLE A;  4DE3 A;  4JXS A;  4DRT A;  2VGK A;  5I94 A;  2XFT A;  1DJB A;  1O7E A;  4JF5 A;  5CGS A;  4OQH A;  4DDY A;  1LI9 A;  4ZJ2 A;  1G6A A;  5FQM A;  2R9W A;  3BEC A;  1PZP A;  1KDW A;  1DY6 A;  4RA7 A;  1ZG6 A;  3OPP A;  3UDI A;  1VM1 A;  1BT5 A;  3FKW A;  4UHU A;  3G4P A;  4DXB A;  1EI5 A;  4ZDX A;  4MEZ A;  1YT4 A;  2JBF A;  4RYE A;  3OCL A;  5DF9 A;  3UDX A;  1ES2 A;  3NBL A;  2P9V B;  5FDH A;  1SCW A;  1PWC A;  4WBG A;  3DWK A;  1KE4 A;  1U60 A;  1YLZ A;  3HLW A;  2PBY A;  3PBN A;  1FOF A;  2X01 A;  3IT9 A;  5DF8 A;  4S2N A;  3VP4 A;  4BD1 A;  3N8L A;  4KZ4 A;  5CTM A;  1VQQ A;  3OZH A;  2Y4A A;  1HZO A;  2Y2J A;  4KQO A;  4S2J A;  4JBF A;  3VOY A;  4RX2 A;  5A91 A;  3FZC A;  5HAQ A;  3BM6 A;  2Y2H A;  2WGI A;  3W8K A;  4R23 A;  3IF6 C;  1KE0 A;  5F83 A;  2E8I A;  1FCM A;  5JYP A;  1JTD A;  3VMA A;  3IF6 B;  5KZH A;  1IYP A;  4IBX A;  1N4O A;  2UWX A;  1HD8 A;  3SOI A;  4OQ0 A;  1Q2Q A;  2EXA A;  3HLC A;  1MWT A;  2QPN A;  2XK1 A;  1JTG A;  2V20 A;  4GB7 A;  2WAE A;  1K54 C;  5J8X A;  3GV9 A;  1K57 C;  2IWD A;  4LV0 A;  4O7D A;  4NET A;  3AGF A;  3E2K A;  4WEJ A;  3C5A A;  4S2L A;  2C6W B;  1L0E A;  3A3E A;  4WZ4 A;  5KSC A;  4OQG A;  3DWZ A;  3V3R A;  1NYM A;  4X56 A;  2WKH A;  3NDG A;  2OLU A;  5TGF A;  4B88 A;  1BUL A;  1LL9 A;  3BLM A;  5HX9 A;  5AQ9 A;  1FSY A;  2JCH A;  3NCK A;  3E2L A;  3M2K A;  4LV2 A;  1ZC2 A;  4PM8 A;  4BD0 A;  5FQQ A;  5EVI C;  2EX6 A;  3QHY A;  4X55 A;  4DKI A;  5EVI B;  2B5R A;  1BLP A;  5EEC A;  2C5W B;  2I72 A;  2Q9N A;  4P87 A;  1LHY A;  4IED A;  4E6X A;  1Z6F A;  1YLT A;  3NY4 A;  5A93 A;  5FAO A;  2WYX A;  2H10 A;  5EVL A;  1ALQ A;  1GHI A;  2EX8 A;  5CTN A;  2OLV A;  4JPM A;  4R4S A;  3SH7 A;  4RVA A;  5CXW A;  1LLB A;  3SH9 A;  4DXC A;  5A92 A;  5HL1 A;  3OPR A;  3PBT A;  4JXW A;  1IYO A;  4N1X A;  5CHJ A;  3UDF A;  4BEN A;  3MBZ A;  4MBH A;  3UO9 A;  1K25 A;  3GRJ A;  1WYB A;  1ERQ A;  4S2K A;  4OKP A;  2WKI A;  3GR2 A;  1KVM A;  3QNB A;  3NC8 A;  3UY6 A;  1W7F A;  3HBR A;  4R0Q A;  5EE8 A;  2BLS A;  3VSL A;  1RGY A;  3CJM A;  1BUE A;  4E3O A;  3WS2 A;  2EFX A;  4E6W A;  4UA7 A;  4BL2 A;  2QMI A;  4KZ3 A;  3ZG0 A;  4UAA A;  4PMA A;  5CED A;  4JXV A;  4MBF A;  3IH8 A;  2DRW A;  2ZQ9 A;  1AXB A;  4OP8 A;  1L0D A;  3BLS A;  3MZE A;  4X6T A;  1SDN A;  4B4X A;  4GDB A;  5AQA A;  3PBQ A;  4ZJ1 A;  3IXD A;  4QY5 A;  1IKG A;  1BLC A;  5GL9 A;  3HLG A;  5GHZ A;  1M40 A;  4FSF A;  5GLC A;  1LL5 A;  3OCN A;  2WUQ A;  2Y2I A;  4GNU A;  2XF3 A;  3G31 A;  4OPQ A;  5U47 A;  4KZA A;  5HAR A;  3JYI A;  2J9O A;  1JWV A;  1ZG4 A;  5HW3 A;  3PBO A;  4ZAM A;  3W4P A;  4EQI A;  2DNS A;  4GKU A;  3QNC A;  4S2N C;  3WRZ A;  2Y2O A;  5E2E A;  1NXY A;  4GD6 A;  2PU2 A;  4QHC A;  3SS4 A;  1LI0 A;  4FD8 A;  2Y2G A;  3AGD A;  4E3K A;  1W8Q A;  4K0W A;  1YQS A;  1L0G A;  4P0M A;  1K4E A;  1MBL A;  2FFY A;  4H8R A;  4S2M A;  3WWX A;  4LCM A;  2V1Z A;  3TOI A;  2HP5 A;  3G34 A;  3Q82 A;  4HBT A;  4UA6 A;  3EQU A;  4M3K A;  3Q81 A;  4E3L A;  1YLJ A;  2Z2L B;  4KZ7 A;  1K55 A;  1TDG A;  4OOL A;  4OLG A;  4Y7P A;  3O87 A;  4OOY A;  3UPP A;  3A3I A;  4DE2 A;  3SS5 A;  2XD1 A;  3IWO A;  4KZ9 A;  2VGJ A;  1FQG A;  1KDS A;  3N6I A;  1JWZ A;  3ZG7 B;  1IYQ A;  5EOO A;  5TFQ A;  1PW8 A;  3V39 A;  3PAE A;  5A90 A;  1XX2 A;  1SKF A;  5FSR A;  3FYZ A;  4OH0 A;  3S22 A;  1MPL A;  2HDQ A;  5FQI A;  2XEP A;  4R3B A;  4S2I A;  4PPR A;  1XA1 A;  5G18 A;  2JC7 A;  2ZQC A;  1PW1 A;  1TEM A;  2J9P A;  2XD5 A;  5FA7 A;  4PM5 A;  3BFC A;  1MWR A;  3VP0 A;  3ZDJ A;  1KGF A;  3ZCZ A;  2DCF A;  1PI5 A;  3HVF A;  2Y2P A;  4EBN A;  4K91 A;  2Y2Q A;  4Y0T A;  1IYS A;  3S1Y A;  1YM1 A;  4JLF A;  2EFU A;  3LCE A;  4EBL A;  3PBS A;  3HLB A;  3GVB A;  5GLD A;  3IWQ A;  2J8Y A;  5M1A A;  3ZVT A;  3MKE A;  3V5M A;  4X53 A;  3UN7 A;  1WYC A;  1CI9 A;  4S2O A;  1BLS A;  5F1F A;  2ZLY A;  2PU4 A;  3C7U A;  3VP3 A;  3M2J A;  5E2G A;  4DF6 A;  2ZQ7 A;  3IF5 A;  3HLD A;  1NYY A;  5FAQ A;  1KVL A;  2ZJ9 A;  5TR7 A;  4BJP A;  5HAP A;  3W4Q A;  5AQB A;  1FR1 A;  2HDU A;  3C4O A;  2X71 A;  4WZ5 A;  1FR6 A;  1CEF A;  5CGX A;  3ZHH A;  3CMZ A;  3GMW A;  4OOM A;  1ESI A;  1XGJ A;  1GHM A;  2EXB A;  3Q07 A;  2HDS A;  1RP5 A;  3CZD A;  3O88 A;  3OC2 A;  2Y55 A;  1I2S A;  3VP2 A;  2OV5 A;  3BEB A;  4MLL A;  1ES3 A;  5M19 A;  3V3S A;  1K56 D;  1ERO A;  3G35 A;  2P74 A;  3P98 A;  4R4R A;  4A5R A;  1K56 A;  2WK0 A;  1KE3 A;  3UNW A;  2WGW A;  4QD4 A;  4KEN B;  3N8S A;  5E43 A;  1QMF A;  4U3T A;  3A3J A;  3HLF A;  1S0W A;  3A3D A;  4WEL A;  4Z9Q A;  2IWC A;  1KGE A;  3G2Z A;  1JVJ A;  1XXM A;  4E3J A;  3V50 A;  3G2Y A;  1RCJ A;  3LEZ A;  5CGW A;  2ZM0 A;  4XUZ A;  4GN2 A;  2WKE A;  3IXH A;  2G2W A;  4PM7 A;  3VFF A;  1E3U D;  3OPH A;  4UA9 A;  5F1G A;  4BQM A;  2RL3 A;  1Y54 A;  2A3U A;  3NI9 A;  3O3V A;  1EWZ A;  1OME A;  1SHV A;  3NDE A;  3O86 A;  1L2S A;  3UE3 A;  1Q2P A;  5HFO A;  3A3F A;  3OPL A;  4U0X A;  5FAP A;  3I7J A;  4C3Q A;  4L0L A;  4GDN A;  3BFE A;  4OPZ A;  1IKI A;  4ID4 A;  5CEB A;  1HVB A;  5F82 A;  1K55 C;  1PWG A;  4N9K A;  3ZNY A;  1E25 A;  2WZZ A;  3G30 A;  4KG2 A;  4YIN A;  1BLH A;  3IQA A;  4P6B A;  3C7V A;  3SS3 A;  3ZFZ A;  1FSW A;  4GZB A;  5DF7 A;  2Y59 A;  3CG5 A;  1TVF A;  2Z2M B;  2HP6 A;  2ZQ8 A;  3BFD A;  4K0X A;  5E2F A;  1I2W A;  4ZTK A;  3ITA A;  1K6R A;  4Q8I A;  3G32 A;  4E3I A;  1J9M A;  4NK3 A;  3RJU A;  3HL9 A;  1IEL A;  1WE4 A;  3DTM A;  3ISG A;  4Y0O A;  5FI2 A;  2ZC7 A;  2BG1 A;  4QU3 A;  1XP4 A;  2OSU A;  5CHM A;  4F94 A;  3ZG9 B;  1NY0 A;  2J7V A;  3B3X A;  3MFD A;  1GA0 A;  3IXB A;  4WM9 A;  1H8Z A;  3LY4 A;  3MZD A;  5EOE A;  3IHA A;  3MXS A;  4KZ6 A;  4R1G A;  2ZC5 B;  3IH9 A;  4KG6 A;  2H0Y A;  5GLB A;  3FV7 A;  3HRE A;  5CER A;  3WS4 A;  1K4F A;  1GA9 A;  1XKZ A;  3ZG8 B;  3LY3 A;  5CEC A;  2ZC3 B;  4IVI A;  4OQI A;  4YFM A;  3Q7V A;  2Y2L A;  4RX3 A;  3VFH A;  1PZO A;  3IXG A;  1S6R A;  4R3J A;  5DVA A;  1MKI A;  2JE5 A;  4D2O A;  1MWS A;  4N9L A;  3HUM A;  4KZB A;  4BL3 A;  1PI4 A;  3BFF A;  3ITB A;  3Q7Z A;  3HUO A;  2ZQA A;  1FCO A;  4PM9 A;  1ES4 A;  5FAT A;  1NZU A;  1NRF A;  4KZ8 A;  4LCL A;  2HP9 A;  5KMW A;  2Y2N A;  4Y0U A;  5BOH A;  2GDN A;  4WZ5 C;  1XGI A;  1K6S A;  3N7W A;  3M6B A;  5D3O A;  3RXX A;  3HUN A;  2IWB A;  5AQ7 A;  2WZX A;  3DW0 A;  1TDL A;  4EUZ A;  1NZO A;  1G68 A;  1MWU A;  2G2U A;  1CEG A;  3AGE A;  4QB8 A;  4E3N A;  1KGG A;  1YLY A;  2WAF A;  5KSH A;  4OP5 A;  3S4X A;  1ONG A;  3ZVW A;  1H8Y A;  4U0T A;  3GSG A;  4LV1 A;  1MY8 A;  1E4D A;  2WGW B;  3M6H A;  5FQK A;  4HBU A;  1M6K A;  1FCN A;  1ONH A;  3FWL A;  4LEN A;  1BSG A;  1I5Q A;  4GD8 A;  4KQQ A;  2WGV A;  2XH9 A;  5FQJ A;  2R9X A;  3N8R A;  2P9V A;  5DTT A;  4ZBE A;  2RCX A;  3GQZ A; 
#chains in the Genus database with same CATH topology
 3KYE A;  4QJG A;  4MMN A;  2XLN A;  4OPY A;  4MBK A;  2L0W A;  3UE0 A;  4LV3 A;  2ZM2 A;  1OTD A;  3IF6 A;  2IA2 A;  1MXO A;  2O99 A;  1YMS A;  1STZ A;  1H8M A;  5M18 A;  4ETX A;  2Y2K A;  4EBP A;  4WEK A;  3UPN A;  4X1M A;  4EWF A;  1JNU A;  3VE3 A;  5HD3 A;  4KQR A;  3EQV A;  4DDS A;  3WS0 A;  1O07 A;  5EVI A;  4KUO A;  2W1R A;  3MXR A;  1ESU A;  1OT6 A;  1YSQ A;  2ZMA A;  4OON A;  3T4L A;  2ZQD A;  2EX9 A;  3ZNT A;  3Q7V B;  5FI6 A;  5EPH A;  1JWP A;  2ZD8 A;  4X1L A;  2FFF B;  3BRM A;  3IBJ A;  5GLA A;  1VET A;  3UE1 A;  1SKO B;  1W79 A;  2E8J A;  4PM6 A;  2V2F F;  4QPR A;  4CLC E;  2J3T C;  3UB7 A;  1A0K A;  3VOL A;  3F1O A;  1W8Y A;  1OTB A;  4XT2 B;  4L9F A;  4DE3 A;  2ZM8 A;  4JXS A;  5I94 A;  1DJB A;  1O7E A;  5CGS A;  4OQH A;  3NOT C;  1G6A A;  3QP4 A;  1KDW A;  1DY6 A;  3A0V A;  1ZG6 A;  3UDI A;  1BYW A;  1BT5 A;  1YT4 A;  1ODV A;  2P9V B;  5FDH A;  4HP9 A;  1D7E A;  3PYP A;  4NXB A;  4WBG A;  2JHE A;  2QJ7 A;  3DWK A;  3PBN A;  1P97 A;  5DF8 A;  3N8L A;  5CTM A;  2PAV P;  2Y4A A;  2AVX A;  1G28 A;  1HZO A;  3VOY A;  3TE8 A;  2Y2H A;  3H9W A;  1FCM A;  1IYP A;  2LB5 A;  3SOI A;  4OQ0 A;  2WAE A;  2YKF A;  1F98 A;  4LV0 A;  3AGF A;  3C5A A;  5L09 A;  1NYM A;  3P01 A;  4B88 A;  2V9A A;  1ZC2 A;  2B5R A;  1YLT A;  1ALQ A;  5CTN A;  3SH7 A;  3F1P B;  3KSI A;  3SH9 A;  4KQD A;  2V0W A;  4N1X A;  3MF0 A;  1VHM A;  3UO9 A;  1K25 A;  3GRJ A;  1FIL A;  3CI6 A;  2Q0O A;  1ERQ A;  4S2K A;  3VV4 A;  4OKP A;  5G4Z A;  3KYZ A;  4R0Q A;  2L4R A;  4EER A;  3WS2 A;  4KZ3 A;  3HJI A;  4UAA A;  3ZG0 A;  2BAS A;  2NUT C;  2KX6 A;  4GDB A;  1EW0 A;  3IXD A;  1IKG A;  1BLC A;  3HLG A;  4FSF A;  5GLC A;  3OCN A;  4OPQ A;  2W3F A;  1JWV A;  1ZG4 A;  2J80 A;  4LRZ E;  5HW3 A;  3PBO A;  4ZAM A;  4EQI A;  3OOV A;  1TS6 A;  4HNB A;  3H7W A;  1NXY A;  4GD6 A;  1LI0 A;  4FD8 A;  5HZH A;  4K0W A;  4LGW A;  1MBL A;  2FFY A;  1N9L A;  2OWH A;  2V1Z A;  2OWJ A;  3Q81 A;  4KZ7 A;  4Y7P A;  5F68 A;  1IYQ A;  3DTI A;  1PW8 A;  5A90 A;  4F3L B;  1SKF A;  3FYZ A;  4I3J A;  2W1T B;  4OH0 A;  2J3W A;  2O9C A;  5FQI A;  1LT0 A;  5G18 A;  3RFB A;  1PW1 A;  5HWW A;  1MWR A;  2KDK A;  3ZDJ A;  3ZCZ A;  2DCF A;  1N9N A;  4K91 A;  1PFL A;  3S1Y A;  1YM1 A;  4EQ1 A;  3GVB A;  3LR4 A;  5GLD A;  3VE4 A;  5M1A A;  2W3E A;  4S2O A;  4NG2 A;  4EEU A;  2PU4 A;  2O9A A;  3VP3 A;  1S4S A;  4BJP A;  5TR7 A;  3H82 B;  2HDU A;  5EM0 A;  3QP8 A;  2EXB A;  3VP2 A;  2OV5 A;  2VZW A;  1ES3 A;  1GSW A;  3V3S A;  2P74 A;  2WK0 A;  3EWK A;  1YKD A;  4QD4 A;  1QMF A;  1S0W A;  2IWC A;  1JVJ A;  1XXM A;  3G2Y A;  1RCJ A;  4PHT A;  4XUZ A;  2HV1 A;  2A3U A;  1EWZ A;  2PRF A;  2W27 A;  1SHV A;  3NDE A;  3O86 A;  3B33 A;  3A3F A;  1S67 L;  2GX5 A;  4GDN A;  4ID4 A;  1HVB A;  1PWG A;  3G30 A;  2VV8 A;  4YIN A;  3MS6 A;  3S7O A;  5J4E A;  1S1Y A;  3BY8 A;  4NKP A;  3SS3 A;  3ZFZ A;  4GZB A;  1TVF A;  3LID A;  2Z2M B;  1G6O A;  2XA7 S;  5E2F A;  2JKR M;  4Q8I A;  4E3I A;  2P08 A;  2P7J A;  1IEL A;  4BBV A;  3FG8 A;  3ISG A;  1T1A A;  2BG1 A;  5CHM A;  4F94 A;  1F9I A;  3G6O A;  2J7V A;  1GA0 A;  3LY4 A;  5EOE A;  1YSP A;  2INW A;  2ZC5 B;  3FV7 A;  3E4Q A;  4HIA A;  4OQI A;  1Y4O A;  3JPU A;  4YFM A;  1ZTU A;  4LRX C;  2ZL1 A;  3ZQ5 A;  2W3G A;  5C5K A;  1MKI A;  2JE5 A;  2PD7 A;  3FPV A;  3ITB A;  5A8B A;  5FAT A;  2B95 A;  5KMW A;  2V8C A;  1T1B A;  4WZ5 C;  1K6S A;  3N7W A;  2J3T D;  5D3O A;  2WKQ A;  5AQ7 A;  4EUZ A;  4E3N A;  4Y3I A;  1YLY A;  4JGR A;  2V1A A;  3RH8 B;  4LV1 A;  4LEN A;  4KQQ A;  4GS9 A;  3N8R A;  3GQZ A;  2M1C A;  1BTL A;  2XR0 A;  2QZ6 A;  1XA7 A;  3VP1 A;  2GZA A;  1GSX A;  4IUH A;  4E3M A;  2Y2M A;  4P85 A;  4UEY A;  2VA0 A;  2Y91 A;  1PYY A;  3MQ0 A;  1YLW A;  3NOP C;  3PAG A;  4LRY C;  1GCE A;  4JXG A;  4X68 A;  3BYD A;  1GSV A;  4IBR A;  1ES5 A;  3ZG5 A;  1K54 A;  3T4Q A;  3WS5 A;  1LL8 A;  1ZKJ A;  3MR0 A;  4JF6 A;  4HQA A;  1QME A;  5GHX A;  1F2K A;  3T4O A;  2QJ5 A;  5AVE A;  3DTK A;  2HPB A;  2O9B A;  3CUE A;  1WA9 A;  4ZJ3 A;  1N9B A;  4DJ3 A;  1RGZ A;  3CAX A;  5GHY A;  4HOI A;  4R70 A;  3IHB A;  1CK3 A;  4FCF A;  1G5U A;  4OVD A;  4WMC A;  1IEM A;  5J7E A;  3PHY A;  1L0F A;  2X02 A;  2HDR A;  2A24 A;  5G4Y A;  2XGN A;  4ARZ A;  4BLM A;  5TBM B;  3UPO A;  4JF4 A;  2ACG A;  1OTA A;  1H3Q A;  4HEF A;  4KG5 A;  5EVE A;  3SH8 A;  4OPR A;  5FI7 A;  1GHP A;  3R7W A;  3CLO A;  4DRT A;  2VGK A;  2ZBB A;  4JF5 A;  5FL3 A;  4ZJ2 A;  5FQM A;  2R9W A;  3LI9 A;  1PZP A;  4RA7 A;  3OPP A;  4O01 A;  4UQI M;  1OJG A;  4DXB A;  1OTE A;  4RYE A;  2JBF A;  3UDX A;  3NBL A;  5FDS A;  1SCW A;  1PWC A;  1YLZ A;  4I3A A;  1S1Z A;  2JN7 A;  3VP4 A;  4KQO A;  3FZC A;  3BM6 A;  3T50 A;  4R23 A;  3IF6 C;  1KE0 A;  5F83 A;  3BWL A;  5JYP A;  3VMA A;  3MJQ A;  4H6J B;  4NXE A;  2VLG A;  1X0O A;  2V20 A;  4IJG A;  3NEC A;  4ME4 A;  1IFQ A;  4NET A;  4WEJ A;  2W3H A;  2C6W B;  4OQG A;  3U2A A;  3NDG A;  3LEQ A;  2FZ0 A;  3BLM A;  5AQ9 A;  5F5Y A;  4BD0 A;  4LV2 A;  4PM8 A;  5FQQ A;  5EVI C;  4X55 A;  4DKI A;  4IED A;  1Z6F A;  3NY4 A;  2H10 A;  5EVL A;  1GHI A;  2PHY A;  3LIA A;  4RQ9 A;  5CXW A;  1LLB A;  4GHI B;  4D60 A;  3IX3 A;  3PBT A;  1IYO A;  3EOI A;  3F1N A;  4HJ6 A;  3O5Y A;  1WYB A;  5HDD A;  2PYR A;  2WKI A;  3GR2 A;  3QNB A;  3EEA A;  3QP5 A;  4M4X A;  3CJM A;  4GJ4 A;  2EFX A;  4BL2 A;  2QMI A;  5CED A;  1VB6 A;  2DRW A;  1NWZ A;  2VX8 A;  2K2N A;  1M40 A;  4GNU A;  5L10 A;  4YOF A;  5HAR A;  1J3W A;  4HH2 A;  3W4P A;  2DNS A;  4GLQ A;  3ULF A;  2EWV A;  2NUP C;  2Y2O A;  2PU2 A;  3HJK A;  2Y2G A;  5DKL A;  4MDZ A;  3U4L P;  2HP5 A;  4UA6 A;  3EQU A;  4M3K A;  1K55 A;  4BBU A;  3UPP A;  4X25 A;  2XD1 A;  4E04 A;  5HPF A;  3N6I A;  3ZG7 B;  1CF0 A;  2PT7 A;  3OLO A;  4I3I A;  1XX2 A;  4QWO A;  3T4T A;  2XEP A;  4S2I A;  5FA7 A;  4PM5 A;  3VP0 A;  3HVF A;  1V9Y A;  2Y2P A;  3QP2 A;  2XSS A;  5DFY A;  2D01 A;  1OPX A;  3TJZ C;  3LCE A;  3PBS A;  3HLB A;  2KLI A;  3KSF A;  3ZVT A;  1CI9 A;  2FH5 A;  5F1F A;  3A0S A;  2ZLY A;  3C7U A;  4DF6 A;  1YAX A;  1NYY A;  5FAQ A;  1KVL A;  2ZJ9 A;  5L07 A;  3SW1 A;  1FR1 A;  2L1M A;  5CGX A;  4OOM A;  1GHM A;  1RP5 A;  3CZD A;  3IS2 A;  1AWI A;  4DMZ A;  1K56 D;  3LIF A;  3E4O A;  4IHQ A;  4KEN B;  3N8S A;  3A3J A;  4WEL A;  2PBD P;  3CHW P;  3GDI A;  1KGE A;  3CIT A;  3UB9 A;  5CGW A;  4B93 A;  1UWP X;  4GN2 A;  5KIZ A;  4PM7 A;  5EM1 A;  2K7S A;  3HCY A;  3OPH A;  5F1G A;  3NI9 A;  3O3V A;  1L2S A;  1Q2P A;  2PD8 A;  4U0X A;  5FAP A;  4C3Q A;  3BFE A;  2P04 A;  4KG2 A;  3RTY A;  3IQA A;  3UMD A;  5IS1 A;  2Z6C A;  4I39 A;  2ZQ8 A;  2ZL1 B;  3ITA A;  4NK3 A;  1WE4 A;  1Z09 A;  3IX8 A;  2ZC7 A;  1XP4 A;  3MFD A;  3B3X A;  3IXB A;  3MZD A;  4R1G A;  3BQA A;  4KG6 A;  2H0Y A;  3WS4 A;  1XKZ A;  1GA9 A;  4EW7 A;  3LY3 A;  5HSQ A;  4IVI A;  3Q7V A;  4RX3 A;  4HJ3 A;  4R3J A;  1D06 A;  4D2O A;  2WKR A;  1PI4 A;  2ZQA A;  1NRF A;  3FC7 A;  2HP9 A;  2H28 A;  1XGI A;  3S7Q A;  2WZX A;  4XT2 A;  1TDL A;  1NZO A;  2G2U A;  1CEG A;  1HLU P;  3C2W A;  2JKR I;  3JVU A;  4U0T A;  2WGW B;  4BWI A;  5FQK A;  1ONH A;  3UB5 P;  4YWZ A;  3S7P A;  3FWL A;  4L9E A;  2WGV A;  2P9V A;  5DTT A;  4ZBE A;  2RCX A;  3FKV A;  3LUQ A;  4NXF A;  4XUX A;  5FAS A;  3PXP A;  3D4F A;  4EEP A;  2YKH A;  3LI8 A;  4OLD A;  3D72 A;  5HDS A;  1HTZ A;  5E2H A;  5J3W A;  4C6Y A;  5HPI A;  2CMN A;  2VEA A;  1FIK A;  3BJN A;  2VGL S;  1BZA A;  3PTE A;  2WAD A;  4B9O A;  5AJG A;  3BFG A;  4G3V A;  5JYO A;  4C75 A;  3TG9 A;  4QY6 A;  3ZGA B;  4GOG A;  1K57 A;  3LO7 A;  1CI8 A;  4FH4 A;  1KOU A;  5LBR A;  2A24 B;  1NJ4 A;  3WS1 A;  2PDR A;  1C3B A;  1VEU B;  4WUJ A;  5EVI D;  3LR3 A;  2XDM A;  3PBR A;  4N1H A;  3MKF A;  2DMW A;  1K38 A;  4X69 A;  3B42 A;  3P09 A;  4EV4 A;  3T4K A;  1TD5 A;  3F1P A;  3MSH A;  2A49 A;  4XXR A;  1P9R A;  3L9K A;  5HAI A;  3Q1F A;  1DJC A;  3T4J A;  5DTK A;  5FQ9 A;  3WRT A;  4ESP A;  3NIA A;  1XPB A;  2H5S A;  2ZC4 B;  1N9O A;  4JKT A;  4HJ4 A;  2XFT A;  1Y28 A;  1MZU A;  2QWS A;  1K0K A;  3S7N A;  3CPT B;  5AVF A;  3FKW A;  4UHU A;  3G4P A;  1EI5 A;  4ZDX A;  4MEZ A;  3OCL A;  1TS7 A;  4GW9 A;  5HDC A;  1W63 M;  1KE4 A;  1U60 A;  3MQQ A;  2X01 A;  4S2N A;  4BD1 A;  3OZH A;  2Y2J A;  2ZOI A;  4Q0J A;  5HAQ A;  3W8K A;  2E8I A;  4FTX A;  3IF6 B;  5KZH A;  1N4O A;  4IUK A;  2UWX A;  1HD8 A;  4HHD A;  1F5M A;  5F69 A;  1LSX A;  1CQA A;  1Q2Q A;  2EXA A;  1MWT A;  3HLC A;  3MXQ A;  2XK1 A;  4AFI A;  3LIC A;  2QHK A;  4GB7 A;  1K54 C;  3IBR A;  2EA9 A;  3GV9 A;  4O7D A;  4HY8 A;  4S2L A;  4F3L A;  1XFQ A;  5KSC A;  2W1T A;  3UME A;  3C8C A;  5TGF A;  2EWW A;  1FSY A;  3E2L A;  3M2K A;  4JGO A;  3CUE C;  3QHY A;  5EVI B;  2HJ9 C;  2Q9N A;  4P87 A;  4E6X A;  2WYX A;  4EU0 A;  2EX8 A;  3EEH A;  4CLC C;  1S66 L;  4O8G A;  1VET B;  2I9V A;  3D9Y A;  3QP6 A;  1KVM A;  3F1O B;  3NC8 A;  3UY6 A;  2GNX A;  3H82 A;  5EE8 A;  2BLS A;  4CQH A;  3VSL A;  1RGY A;  1BUE A;  4E3O A;  5FEF A;  3C38 A;  3T1Q B;  1XJ6 A;  2ZMF A;  4PMA A;  2V1B A;  1LSV A;  4JXV A;  4CLC A;  4MBF A;  3IH8 A;  2PR5 A;  1AXB A;  2ZQ9 A;  1L0D A;  3MZE A;  1SDN A;  5AQA A;  3R4K A;  5GHZ A;  1LL5 A;  2WUQ A;  2Y2I A;  2XF3 A;  5U47 A;  4KZA A;  2J9O A;  2K31 A;  3WRZ A;  4MN5 A;  5CX7 A;  3SS4 A;  3AGD A;  4E3K A;  5HD5 A;  1YQS A;  1L0G A;  4P0M A;  4R3A A;  4H8R A;  4S2M A;  3WWX A;  3FPW A;  4LCM A;  2OAP 1;  1YLJ A;  2Z2L B;  2VV7 A;  3O87 A;  4OOY A;  5DFX A;  3A3I A;  4DE2 A;  3SS5 A;  3IWO A;  2VGJ A;  2XA7 M;  5MC7 A;  3V39 A;  5FSR A;  3MFX A;  3S22 A;  4GCZ A;  1IOU A;  4Y5F A;  1XJ4 A;  1OTI A;  4R6L A;  1TEM A;  2J9P A;  1KGF A;  3NOU C;  2G7U A;  4Y0T A;  2Y2Q A;  1IYS A;  4Y15 A;  2VKS A;  4JLF A;  2EFU A;  4FOF A;  3IWQ A;  1P0Z A;  3MKE A;  3V5M A;  4X53 A;  1BLS A;  2JKT M;  3M2J A;  2ZQ7 A;  3IF5 A;  3HLD A;  3W4Q A;  1PNE A;  2X71 A;  1FR6 A;  3ZHH A;  3CMZ A;  3GMW A;  1XGJ A;  3Q07 A;  2HDS A;  2LB9 A;  3O88 A;  3OC2 A;  4L9G A;  4WF0 A;  4MLL A;  3IX4 A;  3G35 A;  3P98 A;  1L3L A;  3A0R A;  5E43 A;  3ICY A;  4U3T A;  4Z9Q A;  3G2Z A;  4E3J A;  4DJ2 A;  4I38 A;  2ZM0 A;  1MKM A;  1TF1 A;  2WKE A;  2G2W A;  3IXH A;  3KSH A;  3VFF A;  4EXO A;  3H7W B;  3K2N A;  3BY9 A;  3KSG A;  1UGU A;  4KUK A;  3UE3 A;  5HFO A;  1PRQ A;  3I7J A;  4L0L A;  1IKI A;  5CEB A;  5F82 A;  1K55 C;  4G3W A;  1BLH A;  4I5S A;  4P6B A;  1FSW A;  4MN6 A;  3CG5 A;  1W63 Q;  2W0N A;  4K0X A;  3G32 A;  1J9M A;  3RJU A;  3P7N A;  3HL9 A;  3T1S A;  4Y0O A;  2OSU A;  2HGV A;  1DRM A;  1LSW A;  4WM9 A;  3E0Y A;  1H8Z A;  3IHA A;  4KZ6 A;  3BQ8 A;  5IU1 A;  5GLB A;  3HRE A;  5HWT A;  1P9W A;  4BBT A;  2ZC3 B;  3NJA A;  1UWN X;  1ACF A;  3IXG A;  3NUL A;  1S6R A;  5DVA A;  2MJ6 A;  3HUM A;  4BL3 A;  3BFF A;  3Q7Z A;  4PM9 A;  4KZ8 A;  4LCL A;  2Y2N A;  4Y0U A;  5TBM A;  5BOH A;  2GDN A;  3B47 A;  1ZHH B;  2OOL A;  3RXX A;  3HUN A;  2IWB A;  3DW0 A;  2Z6D A;  2XRN A;  1G68 A;  4QB8 A;  5KSH A;  3S4X A;  3ZVW A;  1H8Y A;  3D3O A;  1E4D A;  3M6H A;  4HBU A;  1M6K A;  1FCN A;  2OAQ 1;  2R78 A;  2Y8H A;  5HL6 A;  2R9X A;  4Y2F A;  5L8M A;  3GTC A;  4CJN A;  3C4P A;  3VOZ A;  1OT9 A;  3K3C A;  3T12 B;  4LFU A;  3W4O A;  1PWD A;  4KZ5 A;  5CRF A;  3N4I A;  4N92 A;  4H6J A;  5CHU A;  3IWI A;  2XFS A;  4S2P A;  1YLP A;  1SDE A;  4WYY A;  4P6Z S;  1E3U A;  2ZC6 B;  3MZF A;  4MNR A;  2HJE A;  3RXW A;  2V0U A;  4HES A;  1ERM A;  2Q9M A;  2M7U A;  2XQZ A;  3C30 A;  4DE1 A;  3LIE A;  4PKY A;  3MQO A;  3ZYT A;  1PIO A;  4MCW A;  4WN5 A;  3VSK A;  4CPK A;  4NEE D;  4ZRR A;  3NHQ A;  3TSG A;  4CLC D;  5F6A A;  4WMC D;  1V9Z A;  1NLZ A;  4DE0 A;  4GHI A;  3L7H A;  5IHV A;  5EUA A;  4B4Z A;  1YMX A;  2EX2 A;  4JGP A;  3W2Z A;  2H0T A;  4Y17 A;  3V67 A;  5L2F A;  4FH2 A;  1H5X A;  4IVK A;  5DTS A;  2CC1 A;  1DJA A;  1W5D A;  3HLE A;  5DJT A;  4DDY A;  1LI9 A;  5DKK A;  4BMW A;  3BEC A;  1SKO A;  4K08 A;  1VM1 A;  5IT5 A;  4LLO B;  1H0M A;  4GS9 B;  5DF9 A;  3TW8 A;  1ES2 A;  1XJ2 A;  3E4P A;  4Z1W A;  1NRJ A;  3HLW A;  2PBY A;  1FOF A;  3IT9 A;  2ZMV A;  4KZ4 A;  3DTE A;  1VQQ A;  2W3D A;  4S2J A;  4JBF A;  4RX2 A;  5A91 A;  2WGI A;  1JTD A;  3OBF A;  4IBX A;  3LFV A;  2QPN A;  2O0Y A;  1JTG A;  1XFN A;  3KYQ A;  5J8X A;  1K57 C;  2IWD A;  1SZV A;  3E2K A;  1L0E A;  3A3E A;  4WZ4 A;  3DWZ A;  3V3R A;  4X56 A;  2WKH A;  4FUW A;  2OLU A;  1BUL A;  1LL9 A;  5HX9 A;  2JCH A;  3NCK A;  3EGD C;  2EX6 A;  1BLP A;  5EEC A;  2C5W B;  2I72 A;  3DBA A;  1LHY A;  5A93 A;  5FAO A;  4PAU A;  2D02 A;  4R38 A;  4WLA A;  2OLV A;  4JPM A;  4R4S A;  4CLC B;  4RVA A;  4DXC A;  5A92 A;  5HL1 A;  2BTF P;  3OPR A;  4MN7 A;  3LR5 A;  4JXW A;  5CHJ A;  2XRO A;  3UDF A;  4BEN A;  3MBZ A;  4ARZ B;  4MBH A;  3T1X A;  5K5B A;  3UB6 A;  1W7F A;  3HBR A;  3R7W B;  2KOI A;  2VK3 A;  4E6W A;  4UA7 A;  3K3D A;  1MC0 A;  4LPZ A;  4EET B;  3PR6 A;  4Q0I A;  4OP8 A;  4X6T A;  3BLS A;  4B4X A;  3PBQ A;  4ZJ1 A;  4QY5 A;  4UQI S;  5GL9 A;  3G31 A;  3JYI A;  3GEC A;  5EV0 A;  5HWV A;  3JVV A;  4GKU A;  4NXG A;  4P6Z M;  3QNC A;  4S2N C;  3T4S A;  5E2E A;  4QHC A;  1XJ3 A;  1W8Q A;  5I5L A;  1K4E A;  4HP4 A;  1DP8 A;  3TOI A;  3G34 A;  3Q82 A;  1NLY A;  4HBT A;  4E3L A;  4OOL A;  1TDG A;  4OLG A;  2V8F A;  4KZ9 A;  1FQG A;  1KDS A;  4Q0H A;  1JWZ A;  5EOO A;  5TFQ A;  1DP9 A;  2A2L A;  3PAE A;  5DJU A;  1TS0 A;  3T1R A;  1DP6 A;  1MPL A;  2HDQ A;  2QKP A;  4R3B A;  4PPR A;  4HH3 A;  1XA1 A;  2JC7 A;  2ZQC A;  3DAV A;  2XD5 A;  2PR6 A;  3BFC A;  2UV0 E;  3BW6 A;  1PI5 A;  4EBN A;  3QP1 A;  4WL9 A;  4EBL A;  3CWF A;  2J8Y A;  3KX0 X;  1T18 A;  3UN7 A;  1WYC A;  5FEG A;  5E2G A;  3F1N B;  2GJ3 A;  5HAP A;  2Y79 A;  5AQB A;  3C4O A;  4WZ5 A;  2JKF A;  1CEF A;  2HZ5 A;  1ESI A;  2ZOH A;  2Y55 A;  1I2S A;  2M7V A;  3BEB A;  5M19 A;  1YPR A;  1ERO A;  4R4R A;  4A5R A;  3KO6 A;  4DN0 A;  4HI4 A;  3UE6 A;  1K56 A;  1KE3 A;  3UNW A;  2WGW A;  1TS8 A;  4PKY G;  3EGX C;  3HLF A;  3A3D A;  4EUV A;  3V50 A;  3LEZ A;  3UB8 A;  4EES A;  4ETZ A;  4JGQ A;  1E3U D;  4UA9 A;  1CJF A;  2B18 A;  4BQM A;  2RL3 A;  1Y54 A;  1OME A;  3TRC A;  4Y13 A;  4II7 A;  3OPL A;  2JKT I;  3LIB A;  4OPZ A;  2VGL M;  4N9K A;  3ZNY A;  1E25 A;  2WZZ A;  2HF6 A;  5EFW A;  3C7V A;  2WKP A;  5DF7 A;  2Y59 A;  2JKG A;  1OJ5 A;  3SZT A;  3LGO A;  2HP6 A;  3BFD A;  1I2W A;  4ZTK A;  3MMH A;  1K6R A;  3DTM A;  2B02 A;  5FI2 A;  4QU3 A;  3ZG9 B;  1NY0 A;  1T19 A;  2QYB A;  5TJJ A;  3MXS A;  1VEU A;  1S4R A;  5CER A;  1K4F A;  2VV6 A;  3ZG8 B;  5CEC A;  2PYP A;  4YNR A;  4O0P A;  2Y2L A;  3VFH A;  1PZO A;  3LR0 A;  1MWS A;  4N9L A;  4KZB A;  3HUO A;  1FCO A;  1ES4 A;  1NZU A;  4G3K A;  3M6B A;  3IS2 B;  1MWU A;  3AGE A;  1KGG A;  2VJW A;  2WAF A;  4OP5 A;  3LYX A;  1ONG A;  3GSG A;  1MY8 A;  3E98 A;  3CPT A;  1BSG A;  1I5Q A;  4GD8 A;  1T1C A;  2XH9 A;  1D1J A;  5FQJ A;  3IH9 A; 
#chains in the Genus database with same CATH homology
 3FKV A;  4QJG A;  1BTL A;  2XR0 A;  2QZ6 A;  2XLN A;  1XA7 A;  4MBK A;  4OPY A;  4XUX A;  5FAS A;  3D4F A;  3UE0 A;  3VP1 A;  3GTC A;  4CJN A;  3C4P A;  3VOZ A;  4OLD A;  1HTZ A;  4LV3 A;  4E3M A;  2Y2M A;  2ZM2 A;  4P85 A;  5E2H A;  3W4O A;  4C6Y A;  2Y91 A;  1PWD A;  4KZ5 A;  1PYY A;  3IF6 A;  5CRF A;  3N4I A;  4N92 A;  1BZA A;  1YLW A;  3PAG A;  1GCE A;  3PTE A;  2WAD A;  4JXG A;  1MXO A;  4X68 A;  1YMS A;  3BYD A;  5CHU A;  3IWI A;  2XFS A;  4IBR A;  4S2P A;  3BFG A;  1YLP A;  5JYO A;  4C75 A;  3TG9 A;  1SDE A;  4QY6 A;  5M18 A;  3ZGA B;  1ES5 A;  4WYY A;  1K54 A;  2Y2K A;  3WS5 A;  3ZG5 A;  4EBP A;  1E3U A;  2ZC6 B;  4WEK A;  4GOG A;  3UPN A;  1K57 A;  1ZKJ A;  3LO7 A;  1CI8 A;  3MZF A;  4FH4 A;  4JF6 A;  4MNR A;  3RXW A;  4EWF A;  4HES A;  1ERM A;  5GHX A;  1NJ4 A;  1QME A;  2Q9M A;  4KQR A;  3EQV A;  3WS1 A;  1C3B A;  4DDS A;  2XQZ A;  5EVI D;  3WS0 A;  1O07 A;  4DE1 A;  2HPB A;  5EVI A;  2XDM A;  3PBR A;  3MXR A;  4ZJ3 A;  1ESU A;  1N9B A;  1PIO A;  4N1H A;  2ZMA A;  1RGZ A;  3MKF A;  3VSK A;  4OON A;  2ZQD A;  2EX9 A;  5GHY A;  3Q7V B;  5FI6 A;  1K38 A;  4X69 A;  5EPH A;  3ZNT A;  4CPK A;  1JWP A;  3IHB A;  3P09 A;  3TSG A;  2ZD8 A;  1CK3 A;  4EV4 A;  4WMC D;  2FFF B;  3BRM A;  4FCF A;  5GLA A;  4OVD A;  4WMC A;  1IEM A;  2A49 A;  3UE1 A;  4DE0 A;  1W79 A;  4XXR A;  5IHV A;  1L0F A;  2X02 A;  2HDR A;  5EUA A;  1YMX A;  2EX2 A;  4B4Z A;  5HAI A;  2H0T A;  3Q1F A;  1DJC A;  2XGN A;  5DTK A;  5FQ9 A;  3WRT A;  4PM6 A;  4BLM A;  3NIA A;  1XPB A;  5L2F A;  2V2F F;  4FH2 A;  3UPO A;  4JF4 A;  1H5X A;  2H5S A;  2ZC4 B;  4HEF A;  4IVK A;  4KG5 A;  3SH8 A;  4JKT A;  4OPR A;  5DTS A;  5FI7 A;  1W8Y A;  1GHP A;  2CC1 A;  1DJA A;  1W5D A;  2ZM8 A;  3HLE A;  4DE3 A;  4JXS A;  4DRT A;  2VGK A;  5I94 A;  2XFT A;  1DJB A;  1O7E A;  4JF5 A;  5CGS A;  4OQH A;  4DDY A;  1LI9 A;  4ZJ2 A;  1G6A A;  5FQM A;  2R9W A;  3BEC A;  1PZP A;  1KDW A;  1DY6 A;  4RA7 A;  1ZG6 A;  3OPP A;  3UDI A;  1VM1 A;  1BT5 A;  3FKW A;  4UHU A;  3G4P A;  4DXB A;  1EI5 A;  4ZDX A;  4MEZ A;  1YT4 A;  2JBF A;  4RYE A;  3OCL A;  5DF9 A;  3UDX A;  1ES2 A;  3NBL A;  2P9V B;  5FDH A;  1SCW A;  1PWC A;  4WBG A;  3DWK A;  1KE4 A;  1U60 A;  1YLZ A;  3HLW A;  2PBY A;  3PBN A;  1FOF A;  2X01 A;  3IT9 A;  5DF8 A;  4S2N A;  3VP4 A;  4BD1 A;  3N8L A;  4KZ4 A;  5CTM A;  1VQQ A;  3OZH A;  2Y4A A;  1HZO A;  2Y2J A;  4KQO A;  4S2J A;  4JBF A;  3VOY A;  4RX2 A;  5A91 A;  3FZC A;  5HAQ A;  3BM6 A;  2Y2H A;  2WGI A;  3W8K A;  4R23 A;  3IF6 C;  1KE0 A;  5F83 A;  2E8I A;  1FCM A;  5JYP A;  1JTD A;  3VMA A;  3IF6 B;  5KZH A;  1IYP A;  4IBX A;  1N4O A;  2UWX A;  1HD8 A;  3SOI A;  4OQ0 A;  1Q2Q A;  2EXA A;  3HLC A;  1MWT A;  2QPN A;  2XK1 A;  1JTG A;  2V20 A;  4GB7 A;  2WAE A;  1K54 C;  5J8X A;  3GV9 A;  1K57 C;  2IWD A;  4LV0 A;  4O7D A;  4NET A;  3AGF A;  3E2K A;  4WEJ A;  3C5A A;  4S2L A;  2C6W B;  1L0E A;  3A3E A;  4WZ4 A;  5KSC A;  4OQG A;  3DWZ A;  3V3R A;  1NYM A;  4X56 A;  2WKH A;  3NDG A;  2OLU A;  5TGF A;  4B88 A;  1BUL A;  1LL9 A;  3BLM A;  5HX9 A;  5AQ9 A;  1FSY A;  2JCH A;  3NCK A;  3E2L A;  3M2K A;  4LV2 A;  1ZC2 A;  4PM8 A;  4BD0 A;  5FQQ A;  5EVI C;  2EX6 A;  3QHY A;  4X55 A;  4DKI A;  5EVI B;  2B5R A;  1BLP A;  5EEC A;  2C5W B;  2I72 A;  2Q9N A;  4P87 A;  1LHY A;  4IED A;  4E6X A;  1Z6F A;  1YLT A;  3NY4 A;  5A93 A;  5FAO A;  2WYX A;  2H10 A;  5EVL A;  1ALQ A;  1GHI A;  2EX8 A;  5CTN A;  2OLV A;  4JPM A;  4R4S A;  3SH7 A;  4RVA A;  5CXW A;  1LLB A;  3SH9 A;  4DXC A;  5A92 A;  5HL1 A;  3OPR A;  3PBT A;  4JXW A;  1IYO A;  4N1X A;  5CHJ A;  3UDF A;  4BEN A;  3MBZ A;  4MBH A;  3UO9 A;  1K25 A;  3GRJ A;  1WYB A;  1ERQ A;  4S2K A;  4OKP A;  2WKI A;  3GR2 A;  1KVM A;  3QNB A;  3NC8 A;  3UY6 A;  1W7F A;  3HBR A;  4R0Q A;  5EE8 A;  2BLS A;  3VSL A;  1RGY A;  3CJM A;  1BUE A;  4E3O A;  3WS2 A;  2EFX A;  4E6W A;  4UA7 A;  4BL2 A;  2QMI A;  4KZ3 A;  3ZG0 A;  4UAA A;  4PMA A;  5CED A;  4JXV A;  4MBF A;  3IH8 A;  2DRW A;  2ZQ9 A;  1AXB A;  4OP8 A;  1L0D A;  3BLS A;  3MZE A;  4X6T A;  1SDN A;  4B4X A;  4GDB A;  5AQA A;  3PBQ A;  4ZJ1 A;  3IXD A;  4QY5 A;  1IKG A;  1BLC A;  5GL9 A;  3HLG A;  5GHZ A;  1M40 A;  4FSF A;  5GLC A;  1LL5 A;  3OCN A;  2WUQ A;  2Y2I A;  4GNU A;  2XF3 A;  3G31 A;  4OPQ A;  5U47 A;  4KZA A;  5HAR A;  3JYI A;  2J9O A;  1JWV A;  1ZG4 A;  5HW3 A;  3PBO A;  4ZAM A;  3W4P A;  4EQI A;  2DNS A;  4GKU A;  3QNC A;  4S2N C;  3WRZ A;  2Y2O A;  5E2E A;  1NXY A;  4GD6 A;  2PU2 A;  4QHC A;  3SS4 A;  1LI0 A;  4FD8 A;  2Y2G A;  3AGD A;  4E3K A;  1W8Q A;  4K0W A;  1YQS A;  1L0G A;  4P0M A;  1K4E A;  1MBL A;  2FFY A;  4H8R A;  4S2M A;  3WWX A;  4LCM A;  2V1Z A;  3TOI A;  2HP5 A;  3G34 A;  3Q82 A;  4HBT A;  4UA6 A;  3EQU A;  4M3K A;  3Q81 A;  4E3L A;  1YLJ A;  2Z2L B;  4KZ7 A;  1K55 A;  1TDG A;  4OOL A;  4OLG A;  4Y7P A;  3O87 A;  4OOY A;  3UPP A;  3A3I A;  4DE2 A;  3SS5 A;  2XD1 A;  3IWO A;  4KZ9 A;  2VGJ A;  1FQG A;  1KDS A;  3N6I A;  1JWZ A;  3ZG7 B;  1IYQ A;  5EOO A;  5TFQ A;  1PW8 A;  3V39 A;  3PAE A;  5A90 A;  1XX2 A;  1SKF A;  5FSR A;  3FYZ A;  4OH0 A;  3S22 A;  1MPL A;  2HDQ A;  5FQI A;  2XEP A;  4R3B A;  4S2I A;  4PPR A;  1XA1 A;  5G18 A;  2JC7 A;  2ZQC A;  1PW1 A;  1TEM A;  2J9P A;  2XD5 A;  5FA7 A;  4PM5 A;  3BFC A;  1MWR A;  3VP0 A;  3ZDJ A;  1KGF A;  3ZCZ A;  2DCF A;  1PI5 A;  3HVF A;  2Y2P A;  4EBN A;  4K91 A;  2Y2Q A;  4Y0T A;  1IYS A;  3S1Y A;  1YM1 A;  4JLF A;  2EFU A;  3LCE A;  4EBL A;  3PBS A;  3HLB A;  3GVB A;  5GLD A;  3IWQ A;  2J8Y A;  5M1A A;  3ZVT A;  3MKE A;  3V5M A;  4X53 A;  3UN7 A;  1WYC A;  1CI9 A;  4S2O A;  1BLS A;  5F1F A;  2ZLY A;  2PU4 A;  3C7U A;  3VP3 A;  3M2J A;  5E2G A;  4DF6 A;  2ZQ7 A;  3IF5 A;  3HLD A;  1NYY A;  5FAQ A;  1KVL A;  2ZJ9 A;  5TR7 A;  4BJP A;  5HAP A;  3W4Q A;  5AQB A;  1FR1 A;  2HDU A;  3C4O A;  2X71 A;  4WZ5 A;  1FR6 A;  1CEF A;  5CGX A;  3ZHH A;  3CMZ A;  3GMW A;  4OOM A;  1ESI A;  1XGJ A;  1GHM A;  2EXB A;  3Q07 A;  2HDS A;  1RP5 A;  3CZD A;  3O88 A;  3OC2 A;  2Y55 A;  1I2S A;  3VP2 A;  2OV5 A;  3BEB A;  4MLL A;  1ES3 A;  5M19 A;  3V3S A;  1K56 D;  1ERO A;  3G35 A;  2P74 A;  3P98 A;  4R4R A;  4A5R A;  1K56 A;  2WK0 A;  1KE3 A;  3UNW A;  2WGW A;  4QD4 A;  4KEN B;  3N8S A;  5E43 A;  1QMF A;  4U3T A;  3A3J A;  3HLF A;  1S0W A;  3A3D A;  4WEL A;  4Z9Q A;  2IWC A;  1KGE A;  3G2Z A;  1JVJ A;  1XXM A;  4E3J A;  3V50 A;  3G2Y A;  1RCJ A;  3LEZ A;  5CGW A;  2ZM0 A;  4XUZ A;  4GN2 A;  2WKE A;  3IXH A;  2G2W A;  4PM7 A;  3VFF A;  1E3U D;  3OPH A;  4UA9 A;  5F1G A;  4BQM A;  2RL3 A;  1Y54 A;  2A3U A;  3NI9 A;  3O3V A;  1EWZ A;  1OME A;  1SHV A;  3NDE A;  3O86 A;  1L2S A;  3UE3 A;  1Q2P A;  5HFO A;  3A3F A;  3OPL A;  4U0X A;  5FAP A;  3I7J A;  4C3Q A;  4L0L A;  4GDN A;  3BFE A;  4OPZ A;  1IKI A;  4ID4 A;  5CEB A;  1HVB A;  5F82 A;  1K55 C;  1PWG A;  4N9K A;  3ZNY A;  1E25 A;  2WZZ A;  3G30 A;  4KG2 A;  4YIN A;  1BLH A;  3IQA A;  4P6B A;  3C7V A;  3SS3 A;  3ZFZ A;  1FSW A;  4GZB A;  5DF7 A;  2Y59 A;  3CG5 A;  1TVF A;  2Z2M B;  2HP6 A;  2ZQ8 A;  3BFD A;  4K0X A;  5E2F A;  1I2W A;  4ZTK A;  3ITA A;  1K6R A;  4Q8I A;  3G32 A;  4E3I A;  1J9M A;  4NK3 A;  3RJU A;  3HL9 A;  1IEL A;  1WE4 A;  3DTM A;  3ISG A;  4Y0O A;  5FI2 A;  2ZC7 A;  2BG1 A;  4QU3 A;  1XP4 A;  2OSU A;  5CHM A;  4F94 A;  3ZG9 B;  1NY0 A;  2J7V A;  3B3X A;  3MFD A;  1GA0 A;  3IXB A;  4WM9 A;  1H8Z A;  3LY4 A;  3MZD A;  5EOE A;  3IHA A;  3MXS A;  4KZ6 A;  4R1G A;  2ZC5 B;  3IH9 A;  4KG6 A;  2H0Y A;  5GLB A;  3FV7 A;  3HRE A;  5CER A;  3WS4 A;  1K4F A;  1GA9 A;  1XKZ A;  3ZG8 B;  3LY3 A;  5CEC A;  2ZC3 B;  4IVI A;  4OQI A;  4YFM A;  3Q7V A;  2Y2L A;  4RX3 A;  3VFH A;  1PZO A;  3IXG A;  1S6R A;  4R3J A;  5DVA A;  1MKI A;  2JE5 A;  4D2O A;  1MWS A;  4N9L A;  3HUM A;  4KZB A;  4BL3 A;  1PI4 A;  3BFF A;  3ITB A;  3Q7Z A;  3HUO A;  2ZQA A;  1FCO A;  4PM9 A;  1ES4 A;  5FAT A;  1NZU A;  1NRF A;  4KZ8 A;  4LCL A;  2HP9 A;  5KMW A;  2Y2N A;  4Y0U A;  5BOH A;  2GDN A;  4WZ5 C;  1XGI A;  1K6S A;  3N7W A;  3M6B A;  5D3O A;  3RXX A;  3HUN A;  2IWB A;  5AQ7 A;  2WZX A;  3DW0 A;  1TDL A;  4EUZ A;  1NZO A;  1G68 A;  1MWU A;  2G2U A;  1CEG A;  3AGE A;  4QB8 A;  4E3N A;  1KGG A;  1YLY A;  2WAF A;  5KSH A;  4OP5 A;  3S4X A;  1ONG A;  3ZVW A;  1H8Y A;  4U0T A;  3GSG A;  4LV1 A;  1MY8 A;  1E4D A;  2WGW B;  3M6H A;  5FQK A;  4HBU A;  1M6K A;  1FCN A;  1ONH A;  3FWL A;  4LEN A;  1BSG A;  1I5Q A;  4GD8 A;  4KQQ A;  2WGV A;  2XH9 A;  5FQJ A;  2R9X A;  3N8R A;  2P9V A;  5DTT A;  4ZBE A;  2RCX A;  3GQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...