3I7JA

Crystal structure of a beta-lactamase (mb2281c) from mycobacterium bovis, northeast structural genomics consortium target mbr246
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
273
structure length
273
Chain Sequence
TALEVLGGWPVPAAAAAVIGPAGVLATHGDTARVFALASVTKPLVARAAQVAVEEGVVNLDTPAGPPGSTVRHLLAHTSGLAMHSDQALARPGTRRMYSNYGFTVLAESVQRESGIEFGRYLTEAVCEPLGMVTTRLDGGPAAAGFGATSTVADLAVFAGDLLRPSTVSAQMHADATTVQFPGLDGVLPGYGVQRPNDWGLGFEIRNSKSPHWTGECNSTRTFGHFGQSGGFIWVDPKADLALVVLTARDFGDWALDLWPAISDAVLAEYTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactamase Mb2281c
publication title Northeast Structural Genomics Consortium Target MbR246
rcsb
source organism Mycobacterium bovis
molecule tags Hydrolase
total genus 75
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3i7jA00
5DVAA 1MXOA 4OOMA 1XGIA 3UDXA 4S2IA 4JXGA 3WRZA 3AGDA 1LLBA 3BRMA 5HAPA 2WGVA 2WKEA 2ZM2A 1IKGA 1KGEA 4HEFA 3OPRA 3WS2A 4WEJA 1GA9A 1TEMA 4R1GA 4OQIA 2A49A 2EXBA 4QY5A 3M2JA 4BLMA 5AQAA 5FSRA 2Y2LA 4U0XA 1PW8A 5KSHA 4KZ4A 4FSFA 1CEFA 3NBLA 5CGXA 4DXCA 3Q7ZA 2XFTA 1TVFA 1E25A 1BLCA 1EI5A 4GD6A 2HDSA 4GNUA 1H8ZA 1GHMA 1JTGA 2XK1A 1ES4A 4B88A 5E2GA 3Q07A 4FH2A 4IVIA 4QB8A 3D4FA 4PM9A 1XPBA 4B4XA 2HDQA 2WGIA 3WS5A 1HD8A 3QNBA 4R4RA 1H5XA 2V1ZA 3WS1A 1HVBA 4GKUA 3VOZA 1MPLA 3A3IA 1YM1A 4QHCA 5FAPA 5FQKA 3VMAA 5AQ9A 1Q2PA 5EVIA 4PM6A 4JBFA 3SH8A 4KZAA 5EVIB 3CZDA 4DDYA 5EECA 2H5SA 1IKIA 4KZ9A 2XQZA 2G2UA 5CERA 3CG5A 1FCNA 1KVLA 3VP0A 2FFYA 3FKVA 5I94A 4XXRA 1BTLA 1ES5A 1NZOA 3O88A 4E3KA 4WYYA 3LY3A 3C4OA 4OKPA 3IXDA 1Y54A 1K57C 1MWRA 4X68A 1KE4A 3MBZA 3LCEA 1KGGA 2Y55A 1CEGA 2ZQCA 1QMEA 4C3QA 2XDMA 3IT9A 1BLSA 2WAEA 4KZ3A 4CPKA 3HREA 3G2ZA 1E3UA 1JWPA 5EVIC 4R0QA 4K91A 2BG1A 1W79A 5D3OA 2ZC5B 3ZVWA 4CJNA 1CI9A 4IEDA 2VGJA 1L2SA 5CGWA 3N4IA 5CHJA 1KE3A 4N1XA 4JXWA 4DKIA 4XUXA 5GHXA 4RX2A 4A5RA 3C4PA 1O7EA 5DTSA 2CC1A 1ONHA 2G2WA 1W5DA 3AGEA 3W4PA 2EX9A 1SDNA 4S2KA 4YFMA 3TSGA 4IBRA 1E4DA 3Q7VA 4JF6A 2IWCA 3S1YA 3WS4A 1YLYA 3UNWA 1RCJA 2J9PA 5M18A 2XEPA 3GTCA 4WBGA 1LI0A 1ZKJA 3OZHA 3Q7VB 3RJUA 4EUZA 2HP5A 5FQIA 1K55A 1NYYA 2DCFA 2R9XA 3NC8A 3IWQA 3CJMA 1AXBA 4M3KA 4R23A 3VSKA 4OQGA 2EX6A 4R4SA 4EWFA 3A3EA 3VP4A 4X6TA 3SS5A 1K56A 4E6XA 1I2WA 4QY6A 4C75A 3PTEA 1YT4A 2OLUA 4U3TA 3HLWA 1PI4A 4OQ0A 4K0WA 1NRFA 4OVDA 5CHUA 2HP6A 2Y2JA 3G31A 4K0XA 4JXSA 4OLGA 5GLAA 4E3JA 4LV2A 2OLVA 2Z2MB 3E2LA 4JF5A 2WYXA 1FSWA 3G32A 4KZ8A 4X69A 3FWLA 3OC2A 5J8XA 2V20A 3LEZA 5CRFA 1JTDA 2WGWA 1K55C 1M40A 2J8YA 3IWIA 1NZUA 5GL9A 5U47A 3PBTA 4S2OA 1IEMA 1O07A 3HBRA 1HTZA 3ITBA 2EX2A 2Y2IA 3GRJA 1BLPA 4S2MA 2P9VB 1WE4A 1K54C 4WEKA 1TDLA 3GV9A 1BLHA 4GDBA 1SKFA 1EWZA 3G34A 2WK0A 3PBSA 4WZ5A 1DJBA 4MBFA 3M6BA 5F1FA 2JBFA 2Y2GA 4EBPA 3AGFA 3LY4A 3QNCA 3BLMA 5CEBA 3VFFA 5FASA 4X55A 3FV7A 5DF7A 1LI9A 1GHPA 3N8LA 3ZG8B 5CEDA 1XKZA 2XF3A 3DWZA 3NIAA 2HDRA 1VQQA 3MKFA 4Y0TA 5EOOA 3V5MA 3W4OA 1FOFA 1K6SA 4RX3A 1NY0A 3A3FA 4F94A 5FI2A 5FI7A 4LV1A 1XP4A 2H0TA 4OONA 4OP5A 4LV0A 3DW0A 4DE1A 4X56A 5FAQA 5FAOA 1LHYA 2V2FF 3HLFA 3ZHHA 4DE2A 5G18A 3IF6B 2ZC4B 3P09A 4KG6A 2Y2KA 1ES2A 3QHYA 4BL2A 4BJPA 4WZ5C 1K57A 3BFCA 4ZJ2A 1DJCA 3DWKA 5EVID 2BLSA 3GSGA 1K4FA 2WZZA 3N6IA 3WRTA 4E3MA 4DXBA 2ZC3B 3OCNA 4S2NA 5EPHA 1SHVA 2XD1A 2X02A 2PBYA 4PPRA 5E2HA 5EOEA 1LL5A 3MXSA 3BYDA 1N9BA 1S0WA 2A3UA 4GN2A 4OH0A 3V50A 1ALQA 3VP3A 3JYIA 2Y4AA 3HLDA 4MNRA 2XD5A 1QMFA 1J9MA 4IVKA 3OPLA 3IF5A 3ZG7B 3UPOA 3IF6C 2WUQA 1BZAA 1GA0A 5GLCA 3ZVTA 2ZM0A 3M2KA 3LO7A 4ZJ1A 5TFQA 4D2OA 1ZG4A 1DJAA 5GHZA 4BENA 4BD0A 3BM6A 1IYSA 4Y0UA 3VFHA 3NCKA 3ZNTA 2Y2QA 1E3UD 2E8IA 4WELA 1MBLA 2H10A 2ZLYA 2ZM8A 5GHYA 2UWXA 4BQMA 5KMWA 3SH9A 4S2NC 2Y2OA 5F83A 5KSCA 4N9LA 4O7DA 1XA7A 1PZOA 3N8RA 2HP9A 3BLSA 1KVMA 2XGNA 4MBHA 4LCLA 4FD8A 3UN7A 3PAGA 2ZC7A 5EE8A 3IHAA 4OOLA 3M6HA 4KZBA 2DNSA 5E43A 3UE1A 3GVBA 4KQQA 4E3NA 4UA6A 4OLDA 3IH8A 1YLZA 5JYPA 3HL9A 2ZJ9A 2WZXA 3UE3A 1KDWA 3O3VA 1JWVA 4OP8A 1M6KA 1ESIA 3SH7A 5DTTA 1G6AA 3GR2A 4LCMA 3MXRA 1MY8A 4E3IA 2Y59A 5FQMA 5HARA 2EX8A 4GD8A 3ZGAB 4BD1A 2DRWA 1BSGA 2ZQ7A 3B3XA 1K56D 2ZMAA 4KENB 5FATA 3ZFZA 2XR0A 2Y91A 4OPYA 2OSUA 1ERMA 4QD4A 1ESUA 5DF9A 3UE0A 5FI6A 1K54A 4FCFA 3ZNYA 4JPMA 2ZQ9A 3UDIA 5FDHA 4P6BA 1Z6FA 3OPPA 1XX2A 4UA9A 1RP5A 3O87A 4JKTA 4C6YA 1YLJA 1CK3A 3ISGA 1YMXA 2R9WA 2FFFB 1VM1A 1YLWA 3VP1A 5EUAA 1PIOA 4DRTA 3NDEA 4P85A 1XXMA 3SOIA 4KZ6A 2HDUA 3SS3A 1NJ4A 3HLBA 2EFUA 2P9VA 3BFEA 4RYEA 3TOIA 2PU2A 3N8SA 4PM5A 1PI5A 5CTMA 4PM7A 3G4PA 3IXGA 3IWOA 4P0MA 2B5RA 3UY6A 4E6WA 4B4ZA 4LENA 4PM8A 2VGKA 4EQIA 5M19A 4HBUA 1JVJA 4WMCA 1L0EA 3HLGA 3FZCA 4OQHA 3PAEA 1FR6A 1YMSA 5TGFA 4KG5A 3IXHA 4LV3A 2ZD8A 4N9KA 3MZEA 5CECA 4ZTKA 3TG9A 3MFDA 3C7UA 4ZBEA 4NETA 1C3BA 3IF6A 1ES3A 3VOYA 2Y2MA 3ZG9B 4GDNA 3Q82A 3WWXA 1CI8A 4UA7A 4Y7PA 3UDFA 4KQRA 1K4EA 3ZDJA 4OPQA 2RCXA 4JXVA 3Q81A 3MZDA 4E3LA 4DE0A 5A93A 1L0FA 1I5QA 4MEZA 2XLNA 3PBOA 3BECA 5DF8A 5A90A 1U60A 4IBXA 4S2LA 1PWDA 1XGJA 1YQSA 2XFSA 2IWBA 2GDNA 3O86A 4WM9A 4ZAMA 5KZHA 1JWZA 1IYPA 3PBQA 4QJGA 5JYOA 4Y0OA 4KZ5A 4QU3A 1W8YA 1I2SA 3HLEA 3OPHA 5CTNA 1GHIA 5HW3A 3P98A 5HAQA 4HESA 1LL9A 4JLFA 3W4QA 4X53A 4E3OA 1FCOA 2QMIA 1MWSA 2EXAA 3G2YA 4DF6A 4DE3A 1WYCA 1IELA 3I7JA 5GLDA 5A92A 1MWUA 3NY4A 4Q8IA 1G68A 3HLCA 2OV5A 2HPBA 4L0LA 1YLPA 3FKWA 5E2EA 4NK3A 3BFDA 1EROA 1RGYA 4GZBA 3PBRA 2ZQDA 1W8QA 2JCHA 1ERQA 3CMZA 3IQAA 1SCWA 5HX9A 1L0GA 1XA1A 4EV4A 1RGZA 2ZC6B 2Y2NA 3V3SA 3UO9A 4ID4A 2JC7A 3Q1FA 5E2FA 5M1AA 5FQQA 1IYQA 5HAIA 1FR1A 3GMWA 2Y2HA 3V39A 5DTKA 3VSLA 4XUZA 4N1HA 4OOYA 4KZ7A 3BEBA 1ZC2A 3RXWA 1PWGA 2X01A 2I72A 1KDSA 1Q2QA 3HUMA 5F82A 3S22A 3OCLA 3UPPA 3RXXA 1FQGA 2ZQ8A 2XH9A 4R3JA 3ZG0A 2WKIA 4S2PA 1TDGA 2H0YA 3W8KA 4OPZA 3UPNA 5AQ7A 5F1GA 3NDGA 3A3DA 1N4OA 5EVLA 4UAAA 5FA7A 4N92A 3IHBA 2X71A 1PWCA 2J9OA 1BT5A 1MKIA 4DDSA 3EQVA 1L0DA 1PW1A 3G35A 2P74A 1OMEA 1ZG6A 1H8YA 5A91A 4ZJ3A 1W7FA 4OPRA 5CGSA 3C5AA 1PZPA 2WAFA 3MKEA 4H8RA 3G30A 3IH9A 5HFOA 3E2KA 1BULA 2IWDA 4JF4A 4YINA 3N7WA 5CXWA 3VP2A 2QZ6A 2PU4A 3WS0A 2C6WB 2RL3A 3HVFA 5HL1A 3NI9A 4EBNA 4Z9QA 2Q9NA 4R3BA 3BFFA 1GCEA 1KE0A 1DY6A 5BOHA 1HZOA 3HUOA 1NXYA 5AQBA 1S6RA 2Z2LB 5FQ9A 3ZCZA 5IHVA 4U0TA 1ONGA 4RVAA 1FSYA 2ZQAA 3S4XA 5TR7A 4BL3A 1IYOA 4GB7A 2C5WB 4WZ4A 1WYBA 4P87A 4PMAA 3PBNA 3ZG5A 1K25A 4WMCD 1MWTA 3A3JA 3ITAA 4ZDXA 2JE5A 4HBTA 1FCMA 1SDEA 3HUNA 4UHUA 3C7VA 3IXBA 2Y2PA 3FYZA 5CHMA 4MLLA 1K38A 1K6RA 3BFGA 1YLTA 3DTMA 4KQOA 3MZFA 4MBKA 2EFXA 1NYMA 3EQUA 3GQZA 3SS4A 2WKHA 2J7VA 4RA7A 4EBLA 4S2JA 4FH4A 1KGFA 1PYYA 1BUEA 3V3RA 5L2FA 2WADA 5GLBA 2QPNA 2Q9MA 5FQJA 4KG2A 2WGWB 4GOGA
chains in the Genus database with same CATH superfamily
1MXOA 3UDXA 2M1CA 2W3HA 5HAPA 1IOUA 1G28A 1TEMA 4OQIA 2XROA 3LIDA 1TF1A 4U0XA 3E0YA 4EESA 2XFTA 3T50A 2XK1A 1ES4A 5E2GA 2K2NA 5LBRA 4IVIA 2G7UA 4QB8A 1XPBA 2VJWA 2HDQA 1HD8A 3PHYA 4R4RA 2V1ZA 3VOZA 1MPLA 4QHCA 5EVIA 4PM6A 4JBFA 3ICYA 3TE8A 4LGWA 3CZDA 2H5SA 3A0RA 2FFYA 5I94A 2PHYA 2D01A 4E3KA 3LY3A 1KE4A 1KGGA 1QMEA 1GSWA 4EXOA 2K31A 4GHIB 1E3UA 1W79A 5D3OA 3FC7A 1CI9A 2I9VA 3N4IA 4A5RA 3W4PA 3E4QA 1W63M 1SDNA 3S1YA 2IWCA 3QP4A 2J9PA 1K55A 2DCFA 4M3KA 3VSKA 2Y79A 4BBUA 3O5YA 1I2WA 3HLWA 2HF6A 5CHUA 2HP6A 3T4LA 4E3JA 5EVEA 2WYXA 4KZ8A 4X69A 3FWLA 3OC2A 5CRFA 1M40A 4H6JA 2HJ9C 5GL9A 2EX2A 2Y2IA 1OTAA 1TDLA 4PAUA 5HDSA 2JKTM 3JPUA 3CI6A 1N9OA 3FV7A 5DF7A 4HJ4A 5CEDA 1XKZA 4Y0TA 3MKFA 3KSHA 3A3FA 5FI7A 1XP4A 4OONA 1V9ZA 3F1PA 3R7WB 2Y2KA 3QHYA 3BFCA 4GS9B 4ZJ2A 5EVID 3GSGA 3ULFA 4LFUA 2ZC3B 3T4JA 2QJ5A 4GN2A 1VHMA 2A3UA 3BYDA 3V50A 2LB9A 1OT6A 1LSWA 3IF5A 3ZG7B 4HP9A 3C30A 4QPRA 2VZWA 3LO7A 4ZJ1A 4PHTA 3BM6A 4Y0UA 2HJEA 4GHIA 1E3UD 5IT5A 4Q0JA 1MBLA 3SH9A 4S2NC 4FOFA 4P6ZM 5IU1A 1XA7A 3UB5P 3A0VA 2HV1A 2ZC7A 1VETA 3PAGA 3M6HA 4UA6A 1KDWA 2ZMVA 1M6KA 4IJGA 1G6AA 3MXRA 1MY8A 4E3IA 2Y59A 4I38A 5HARA 3B3XA 5FATA 4Z1WA 4UQIM 4OPYA 1SKOB 2OSUA 1ERMA 4QD4A 3UE0A 5FDHA 1Z6FA 3OPPA 3JVVA 4C6YA 1CK3A 1Z09A 2R9WA 3OLOA 1YKDA 3S7OA 3IS2B 3C2WA 1PIOA 4DRTA 3KSIA 4X1LA 3SOIA 2HDUA 3S7NA 3EEHA 3HLBA 3BFEA 1DP8A 3N8SA 2Q0OA 5CTMA 2ZMFA 4PM7A 5FEGA 2B5RA 4PM8A 2YKFA 3OBFA 4WMCA 1L0EA 2V0WA 3OOVA 1YMSA 5TGFA 4N9KA 2ZD8A 3MZEA 5CECA 4ZTKA 4G3WA 4HOIA 3R7WA 1ES3A 2Y2MA 4UA7A 4JGPA 4GS9A 1VB6A 1L0FA 1F2KA 4MEZA 5FDSA 5HD3A 4IBXA 4S2LA 1PWDA 1YQSA 1OT9A 4O0PA 3PBQA 4WLAA 5JYOA 1W8YA 4EEPA 3CUEC 2V1BA 2GZAA 2QYBA 3P98A 4HESA 4BMWA 4X53A 5HAQA 4DF6A 4CQHA 4DE3A 3I7JA 1AWIA 1FIKA 3HLCA 2OV5A 2P04A 2DMWA 3T1RA 1RGYA 2VA0A 3IQAA 1W8QA 1EW0A 4ID4A 3Q1FA 5TBMB 3U2AA 1FR1A 2Y2HA 5DTKA 1UGUA 3LGOA 1ZC2A 4X1MA 2X01A 2I72A 4S2PA 3RH8B 2NUTC 3T1XA 4MCWA 4M4XA 4OPZA 4IUHA 5CX7A 3A3DA 4YOFA 1PWCA 1BT5A 1PW1A 3G35A 1V9YA 1ZG6A 5CGSA 4G3VA 3DTIA 3C5AA 3F1OA 3N7WA 2XRNA 4HI4A 1NWZA 3NI9A 4PKYG 4Z9QA 4KUOA 5L07A 2KX6A 5BOHA 4DJ2A 5FQ9A 5IHVA 2ZQAA 3S4XA 3T4TA 5TR7A 4BL3A 1IYOA 4P87A 3ZG5A 3PBNA 1K25A 4WMCD 4EU0A 2W3EA 2BASA 1SDEA 3IXBA 4I5SA 4MLLA 1K6RA 2KOIA 2P7JA 2EFXA 3GQZA 4S2JA 1KGFA 4R70A 1PYYA 1BUEA 5GLBA 2Q9MA 4KG2A 2WGWB 5IS1A 4LRZE 3NOTC 4JXGA 3WRZA 1LLBA 2ZBBA 3BRMA 2WGVA 2WKEA 1KGEA 4BBTA 1YPRA 2NUPC 4R1GA 4MN5A 2A49A 2EXBA 3HJKA 4BLMA 2M7VA 5AQAA 5KSHA 1S1YA 1CEFA 5CGXA 3Q7ZA 3NOUC 2HDSA 2PBDP 3Q07A 3P01A 2LB5A 3WS5A 3WS1A 4NG2A 1HVBA 4GKUA 1YM1A 2JKRI 5FQKA 3KYQA 3R4KA 5AQ9A 4KZAA 3E98A 2O9CA 5EVIB 5G4ZA 2V1AA 5EECA 1IKIA 2XQZA 2G2UA 3H82B 3FKVA 3JVUA 4XXRA 3EEAA 3TJZC 1K57C 4X68A 5DKLA 4EUVA 4CPKA 3HREA 3G2ZA 5HDCA 3TRCA 3KO6A 4R0QA 5EVIC 2BG1A 1Y4OA 2ZC5B 3ZVWA 3B47A 4CJNA 4IEDA 5CGWA 1KE3A 4JXWA 4XUXA 1LL8A 5GHXA 1GSXA 1O7EA 4NKPA 2CC1A 2L1MA 1W5DA 3AGEA 4YFMA 3TSGA 1E4DA 3DTEA 1NLYA 5M18A 3FPVA 4WBGA 1LI0A 5FQIA 1NYYA 3NC8A 2OWJA 3UE6A 4OQGA 1G6OA 1OTEA 3LYXA 4EWFA 3VP4A 4LRYC 5HD5A 4QY6A 3CHWP 3PTEA 1YT4A 2JKGA 1D06A 4OVDA 4K0WA 1NRFA 2Y2JA 4HP4A 5GLAA 4LV2A 2OLVA 3G32A 2PT7A 5J8XA 3BQAA 3KYZA 2WGWA 1K55C 1DP9A 1NZUA 3PBTA 4S2OA 1O07A 1HTZA 3ITBA 4H6JB 3GRJA 2P9VB 1K54C 3GV9A 1SKFA 4WZ5A 1CF0A 3NOPC 5F1FA 3MR0A 3AGFA 5EM0A 3HJIA 4X55A 4NXFA 2XF3A 3DWZA 3NIAA 1VQQA 2JHEA 5EOOA 3V5MA 3W4OA 4LV1A 3MSHA 4OP5A 4DE1A 5FAQA 5FAOA 2V2FF 4DE2A 5G18A 4KG6A 3D72A 3F1PB 4FTXA 1K57A 5DFXA 4EQ1A 1DJCA 3DWKA 5J4EA 2PD8A 4WUJA 2MJ6A 3OCNA 2XD1A 3MMHA 1LL5A 1S1ZA 1N9BA 1S0WA 2XA7M 1ALQA 2VV8A 2Y4AA 3H82A 2XD5A 1QMFA 1J9MA 3OPLA 5TFQA 2GX5A 1T1BA 1ZG4A 1IYSA 3ZNTA 3MS6A 2OOLA 2ZLYA 2ZM8A 3RTYA 5KMWA 2Y2OA 4G3KA 5KSCA 1PZOA 3F1NB 4MBHA 2V9AA 5EE8A 3IHAA 4OOLA 4KZBA 3GVBA 4KQQA 1VETB 3C38A 4OLDA 3HL9A 2ZJ9A 4OP8A 3SH7A 4DMZA 3UMEA 4CLCB 4GD8A 4BD1A 1BSGA 2ZMAA 5J7EA 3QP5A 3W2ZA 1F9IA 3IX4A 1ESUA 5FI6A 1K54A 4FCFA 2ZQ9A 3UDIA 1P9WA 5A8BA 2PDRA 3SZTA 3ISGA 1YMXA 4CLCC 1VM1A 1J3WA 2HZ5A 3KYEA 2OAP1 4KZ6A 3SS3A 1NJ4A 2P9VA 4PM5A 2INWA 3G4PA 3IXGA 3IWOA 4B4ZA 2OAQ1 2VGKA 1MC0A 5HPFA 3T4QA 3HLGA 3FZCA 2OWHA 3ZYTA 3MFDA 2KLIA 4NETA 1C3BA 4HQAA 1NLZA 2RCXA 4OPQA 3MZDA 3LICA 1I5QA 2XLNA 3PBOA 4HJ3A 5A90A 1XGJA 2XFSA 4ZAMA 5KZHA 1F98A 3LFVA 1PRQA 1IYPA 4Y0OA 2VEAA 4JGOA 4QU3A 1I2SA 4F3LB 3OPHA 5FL3A 3W4QA 2YKHA 3G2YA 2EXAA 2A24B 2Z6CA 1P97A 1T1AA 4Q8IA 2HPBA 3QP1A 4I3JA 5E2EA 4NK3A 3BFDA 4GZBA 5HX9A 2CMNA 1LT0A 4ETZA 1STZA 1T18A 3F1NA 3UO9A 5E2FA 2PR5A 2XSSA 3GMWA 3VSLA 3RXWA 2VLGA 4RQ9A 1PWGA 3HUMA 5EM1A 1Q2QA 3OCLA 3RXXA 3LEQA 1X0OA 4YWZA 2H0YA 2JN7A 4CLCA 4HY8A 5F1GA 2ZL1A 2D02A 4N92A 2VX8A 3IHBA 5A91A 4OPRA 4NEED 2WAFA 3G30A 3MF0A 2V8CA 2V0UA 4YINA 5CXWA 3VP2A 2QZ6A 2PU4A 2RL3A 2B95A 4E04A 3HVFA 3F1OB 3QP8A 2Q9NA 3NULA 3LI8A 3HUOA 1NXYA 5AQBA 3ZCZA 4JGRA 5L8MA 3VE4A 5HSQA 1ONGA 1FSYA 2VKSA 4PMAA 3CLOA 1T19A 1MWTA 3ITAA 2B18A 3HUNA 2Y2PA 3FYZA 5CHMA 2FZ0A 1K38A 3UB7A 3BFGA 4MDZA 4KQOA 3V67A 1NYMA 3EQUA 2WKHA 1PFLA 1YAXA 2J7VA 1K0KA 3UB6A 5FQJA 4HJ6A 5DVAA 4ESPA 3MQOA 4OOMA 1XGIA 3VOLA 4ME4A 1G5UA 4HEFA 3H9WA 4AFIA 3OPRA 2VV6A 4WEJA 2J3TC 1H3QA 3LR3A 5FSRA 4Y13A 2Y2LA 1PW8A 3L7HA 4GJ4A 4F3LA 2J3WA 4FSFA 4DXCA 1TVFA 1E25A 2Z6DA 1EI5A 4GNUA 1H8ZA 2A24A 4B88A 4R38A 2W1TA 4PM9A 4R6LA 5KIZA 1XJ2A 3EOIA 3QNBA 1H5XA 3A3IA 5FAPA 3CAXA 1Q2PA 2PD7A 3SH8A 1XJ3A 3E4PA 4DDYA 4O8GA 3CG5A 1KVLA 3VP0A 4I3AA 3KX0X 4QWOA 1BTLA 4LLOB 1ES5A 1LSVA 1NZOA 4WYYA 4CLCD 4OKPA 3IXDA 1N9LA 1Y54A 3MBZA 3LCEA 2Y55A 1CEGA 2XDMA 3IT9A 2WAEA 4IHQA 1CJFA 4K91A 4BWIA 4DN0A 5CHJA 4DKIA 2EA9A 4RX2A 3C4PA 1ONHA 3BW6A 5AJGA 4IBRA 3Q7VA 1OJ5A 3WS4A 1CQAA 1S67L 1RCJA 2XEPA 3GTCA 5AVFA 5AVEA 2HP5A 2M7UA 2R9XA 3CJMA 1AXBA 3BWLA 3GECA 4R4SA 3SS5A 4C75A 3BQ8A 4OQ0A 4O01A 3HCYA 4JXSA 3MQ0A 1HLUP 2Z2MB 3E2LA 4JF5A 3A0SA 1T1CA 2J8YA 2QWSA 1IEMA 3HBRA 3LUQA 4WEKA 5L09A 1BLHA 2GNXA 4GDBA 3LIBA 1EWZA 3G34A 3PBSA 1NRJA 2Y2GA 4EBPA 3LY4A 2H28A 5FASA 3CPTA 3QP6A 1LI9A 1GHPA 3ZG8B 3T4SA 3TW8A 1FOFA 1K6SA 1Y28A 5FI2A 3SW1A 2H0TA 4LV0A 3DW0A 4X56A 3HLFA 3ZHHA 2ZC4B 1ES2A 1ACFA 4WZ5C 4Y3IA 2BLSA 4Y5FA 3N6IA 5HDDA 1SHVA 4WF0A 4PPRA 4NXBA 5J3WA 4OH0A 4DJ3A 3IX8A 1JNUA 3HLDA 4MNRA 1TS8A 4KUKA 2WUQA 5HZHA 1BZAA 3UMDA 3ZVTA 4BENA 1TS0A 5GHZA 4BD0A 4UEYA 3NCKA 2E8IA 2HGVA 4WELA 2J80A 3MXQA 2H10A 5GHYA 4BQMA 4ARZB 5DJUA 4YNRA 1TD5A 4O7DA 2HP9A 3BLSA 1KVMA 4LCLA 3LR5A 3T1SA 5I5LA 5E43A 3UE1A 4E3NA 3IH8A 3UE3A 2WZXA 3O3VA 5DKKA 1TS7A 1JWVA 1ESIA 5DTTA 2QHKA 2EX8A 3ZGAB 2DRWA 2ZOIA 2XR0A 2EWVA 1MZUA 5DJTA 3EWKA 3ZNYA 4P6BA 1XX2A 4EW7A 4MMNA 1RP5A 2J3TD 3O87A 4JKTA 1YLJA 4UQIS 4D60A 3UB8A 1YLWA 2QJ7A 2AVXA 1XXMA 1OPXA 4KQDA 1PI5A 4CLCE 4P0MA 1W63Q 4LENA 4XT2B 4HBUA 1JVJA 4OQHA 2KDKA 2W1RA 3PAEA 2W0NA 3IXHA 4LV3A 3VV4A 3D3OA 3TG9A 3VE3A 4EERA 4ZBEA 4B9OA 5F69A 3Q82A 1CI8A 3FPWA 4DE0A 2O9AA 1P9RA 3LIFA 3BECA 5C5KA 5DF8A 1U60A 4Y2FA 3O86A 2PYPA 3D9YA 1JWZA 3NHQA 3RFBA 4QJGA 1H0MA 1XFNA 1GHIA 1LL9A 4E3OA 1FCOA 2QMIA 1XFQA 5A92A 1G68A 4WN5A 4L0LA 3FKWA 4ARZA 3PBRA 1YSQA 2JCHA 2JKRM 2ZQDA 1XA1A 1RGZA 3LIAA 2JC7A 1DP6A 5FQQA 1IYQA 3NJAA 5HAIA 4N1HA 4KZ7A 1D7EA 3BEBA 3IBRA 3S22A 4ETXA 4R3JA 3ZG0A 1TDGA 5DFYA 3W8KA 1N9NA 3T4KA 4MN7A 5AQ7A 1N4OA 5FA7A 5HWVA 2X71A 2ZL1B 1MKIA 4DDSA 3EQVA 2P74A 3QP2A 1H8YA 1W7FA 4K08A 1PZPA 3MKEA 4H8RA 5HFOA 2Y8HA 3WS0A 2VK3A 5HL1A 3LI9A 4R3BA 4HIAA 3IBJA 2R78A 3PR6A 2EWWA 5HPIA 1KE0A 1DY6A 3BY8A 4L9EA 1UWNX 4Q0HA 3KSFA 2WKRA 2C5WB 4WZ4A 4XT2A 3H7WA 4HBTA 4Q0IA 3MZFA 2BTFP 1P0ZA 3T4OA 4EBLA 4FH4A 3V3RA 5L2FA 3DTKA 1SZVA 3WWXA 4GOGA 2WKPA 4S2IA 3AGDA 2ZM2A 1IKGA 3K2NA 3WS2A 1GA9A 2IA2A 4QY5A 3M2JA 3GDIA 1S4RA 4KZ4A 3NBLA 1BLCA 4GD6A 5FEFA 1GHMA 1JTGA 4FUWA 4FH2A 3S7PA 3D4FA 4B4XA 1KOUA 1VEUB 2WGIA 2W1TB 3VMAA 1PNEA 2FH5A 4NXGA 4GW9A 4KZ9A 4L9FA 5CERA 1FCNA 3B33A 2ACGA 2P08A 3O88A 4MN6A 3C4OA 2A2LA 1MWRA 3C8CA 2ZQCA 5F68A 4C3QA 1BLSA 4KZ3A 3LIEA 1JWPA 1OTDA 3L9KA 4PKYA 3K3DA 4LRXC 3BY9A 1MKMA 2VGJA 1L2SA 4N1XA 2VGLS 5DTSA 2G2WA 4HHDA 5HL6A 1TS6A 2ZOHA 2EX9A 3B42A 4JF6A 2W3GA 1YLYA 1S66L 3UNWA 1ZKJA 3RJUA 3OZHA 3Q7VB 3DAVA 3IWQA 4R23A 2EX6A 4L9GA 1FILA 3A3EA 4X6TA 1K56A 4E6XA 2OLUA 4U3TA 1PI4A 3G31A 4K0XA 4OLGA 2L0WA 3S7QA 2PYRA 1FSWA 4B93A 2V20A 3LEZA 1JTDA 1OTIA 3IWIA 5U47A 2V8FA 1BLPA 4S2MA 1WE4A 3LR0A 3P7NA 4X25A 2WK0A 1DJBA 4MBFA 3MQQA 3M6BA 2JBFA 4I3IA 3QNCA 3BLMA 5CEBA 3VFFA 1IFQA 1ZHHB 3N8LA 4HNBA 3CPTB 2HDRA 4RX3A 1NY0A 4F94A 4ZRRA 1L3LA 2K7SA 1LHYA 1S4SA 3IF6B 3P09A 1VEUA 4BL2A 4BJPA 1K4FA 2WZZA 3WRTA 4E3MA 4DXBA 4S2NA 4BBVA 5EPHA 5HWTA 1ZTUA 2X02A 2PBYA 4Y17A 5E2HA 5EOEA 2B02A 3MXSA 3CITA 5G4YA 1OJGA 3MFXA 3VP3A 3JYIA 4IVKA 3UPOA 3IF6C 3FG8A 1DRMA 4GLQA 1GA0A 5GLCA 2ZM0A 3M2KA 4D2OA 1DJAA 2XA7S 3VFHA 2Y2QA 2UWXA 2WKQA 5EFWA 5F83A 4N9LA 3N8RA 2XGNA 5MC7A 1XJ6A 4FD8A 3UN7A 1UWPX 2DNSA 3ZQ5A 1YLZA 5JYPA 4Y15A 2QKPA 3GR2A 4LCMA 2JKFA 2PR6A 5FQMA 2ZQ7A 1SKOA 1K56D 4KENB 2E8JA 4EETB 3ZFZA 2Y91A 4I39A 5HWWA 5DF9A 4JPMA 1BYWA 3EGXC 4UA9A 4NXEA 3IS2A 3VP1A 2FFFB 2O9BA 5EUAA 3NDEA 3UB9A 4P85A 2EFUA 3TOIA 4RYEA 2PU2A 5K5BA 3LR4A 3U4LP 3E4OA 2O99A 3UY6A 4E6WA 2W3DA 2VV7A 4WL9A 3MJQA 2O0YA 4EQIA 5M19A 3IX3A 1FR6A 4KG5A 4HH2A 2GJ3A 4IUKA 3C7UA 3CUEA 3PXPA 3PYPA 5EV0A 3IF6A 3VOYA 3ZG9B 4GDNA 4Y7PA 3UDFA 4KQRA 1K4EA 3ZDJA 4JXVA 3Q81A 5F6AA 4E3LA 5A93A 2L4RA 2W27A 2IWBA 2GDNA 4WM9A 4JGQA 4KZ5A 3HLEA 5CTNA 2UV0E 3T1QB 5HW3A 4JLFA 1MWSA 1WYCA 1IELA 1OTBA 5GLDA 1WA9A 2W3FA 1MWUA 3NY4A 5TJJA 3EGDC 1YLPA 3DBAA 1EROA 4S2KA 1ERQA 3KSGA 3CMZA 1SCWA 1L0GA 4EV4A 5TBMA 2ZC6B 2Y2NA 3V3SA 5M1AA 3NECA 3V39A 4XUZA 4OOYA 4EUZA 5F82A 1KDSA 3UPPA 1FQGA 2ZQ8A 2XH9A 4P6ZS 2WKIA 3UPNA 3G6OA 2VGLM 3NDGA 5EVLA 4UAAA 2PRFA 1XJ4A 2J9OA 1A0KA 1L0DA 1F5MA 1OMEA 3BJNA 1LSXA 4ZJ3A 3IH9A 3E2KA 1BULA 2IWDA 4JF4A 2C6WB 3T12B 4R3AA 1H8MA 4EBNA 3BFFA 3CWFA 4GCZA 1GCEA 1ODVA 1HZOA 1S6RA 2Z2LB 1YSPA 2PAVP 4U0TA 4RVAA 1GSVA 5L10A 4II7A 4GB7A 4EEUA 1WYBA 3A3JA 4ZDXA 2JE5A 1FCMA 4UHUA 2JKTI 3C7VA 3K3CA 4LPZA 4HH3A 3H7WB 4MBKA 1YLTA 3DTMA 3SS4A 1D1JA 5F5YA 4RA7A 2WADA 2QPNA
chains in the Genus database with same CATH topology
5DVAA 1MXOA 4OOMA 1XGIA 3UDXA 4S2IA 4JXGA 3WRZA 3AGDA 1LLBA 3BRMA 5HAPA 2WGVA 2WKEA 2ZM2A 1IKGA 1KGEA 4HEFA 3OPRA 3WS2A 4WEJA 1GA9A 1TEMA 4R1GA 4OQIA 2A49A 2EXBA 4QY5A 3M2JA 4BLMA 5AQAA 5FSRA 2Y2LA 4U0XA 1PW8A 5KSHA 4KZ4A 4FSFA 1CEFA 3NBLA 5CGXA 4DXCA 3Q7ZA 2XFTA 1TVFA 1E25A 1BLCA 1EI5A 4GD6A 2HDSA 4GNUA 1H8ZA 1GHMA 1JTGA 2XK1A 1ES4A 4B88A 5E2GA 3Q07A 4FH2A 4IVIA 4QB8A 3D4FA 4PM9A 1XPBA 4B4XA 2HDQA 2WGIA 3WS5A 1HD8A 3QNBA 4R4RA 1H5XA 2V1ZA 3WS1A 1HVBA 4GKUA 3VOZA 1MPLA 3A3IA 1YM1A 4QHCA 5FAPA 5FQKA 3VMAA 5AQ9A 1Q2PA 5EVIA 4PM6A 4JBFA 3SH8A 4KZAA 5EVIB 3CZDA 4DDYA 5EECA 2H5SA 1IKIA 4KZ9A 2XQZA 2G2UA 5CERA 3CG5A 1FCNA 1KVLA 3VP0A 2FFYA 3FKVA 5I94A 4XXRA 1BTLA 1ES5A 1NZOA 3O88A 4E3KA 4WYYA 3LY3A 3C4OA 4OKPA 3IXDA 1Y54A 1K57C 1MWRA 4X68A 1KE4A 3MBZA 3LCEA 1KGGA 2Y55A 1CEGA 2ZQCA 1QMEA 4C3QA 2XDMA 3IT9A 1BLSA 2WAEA 4KZ3A 4CPKA 3HREA 3G2ZA 1E3UA 1JWPA 5EVIC 4R0QA 4K91A 2BG1A 1W79A 5D3OA 2ZC5B 3ZVWA 4CJNA 1CI9A 4IEDA 2VGJA 1L2SA 5CGWA 3N4IA 5CHJA 1KE3A 4N1XA 4JXWA 4DKIA 4XUXA 5GHXA 4RX2A 4A5RA 3C4PA 1O7EA 5DTSA 2CC1A 1ONHA 2G2WA 1W5DA 3AGEA 3W4PA 2EX9A 1SDNA 4S2KA 4YFMA 3TSGA 4IBRA 1E4DA 3Q7VA 4JF6A 2IWCA 3S1YA 3WS4A 1YLYA 3UNWA 1RCJA 2J9PA 5M18A 2XEPA 3GTCA 4WBGA 1LI0A 1ZKJA 3OZHA 3Q7VB 3RJUA 4EUZA 2HP5A 5FQIA 1K55A 1NYYA 2DCFA 2R9XA 3NC8A 3IWQA 3CJMA 1AXBA 4M3KA 4R23A 3VSKA 4OQGA 2EX6A 4R4SA 4EWFA 3A3EA 3VP4A 4X6TA 3SS5A 1K56A 4E6XA 1I2WA 4QY6A 4C75A 3PTEA 1YT4A 2OLUA 4U3TA 3HLWA 1PI4A 4OQ0A 4K0WA 1NRFA 4OVDA 5CHUA 2HP6A 2Y2JA 3G31A 4K0XA 4JXSA 4OLGA 5GLAA 4E3JA 4LV2A 2OLVA 2Z2MB 3E2LA 4JF5A 2WYXA 1FSWA 3G32A 4KZ8A 4X69A 3FWLA 3OC2A 5J8XA 2V20A 3LEZA 5CRFA 1JTDA 2WGWA 1K55C 1M40A 2J8YA 3IWIA 1NZUA 5GL9A 5U47A 3PBTA 4S2OA 1IEMA 1O07A 3HBRA 1HTZA 3ITBA 2EX2A 2Y2IA 3GRJA 1BLPA 4S2MA 2P9VB 1WE4A 1K54C 4WEKA 1TDLA 3GV9A 1BLHA 4GDBA 1SKFA 1EWZA 3G34A 2WK0A 3PBSA 4WZ5A 1DJBA 4MBFA 3M6BA 5F1FA 2JBFA 2Y2GA 4EBPA 3AGFA 3LY4A 3QNCA 3BLMA 5CEBA 3VFFA 5FASA 4X55A 3FV7A 5DF7A 1LI9A 1GHPA 3N8LA 3ZG8B 5CEDA 1XKZA 2XF3A 3DWZA 3NIAA 2HDRA 1VQQA 3MKFA 4Y0TA 5EOOA 3V5MA 3W4OA 1FOFA 1K6SA 4RX3A 1NY0A 3A3FA 4F94A 5FI2A 5FI7A 4LV1A 1XP4A 2H0TA 4OONA 4OP5A 4LV0A 3DW0A 4DE1A 4X56A 5FAQA 5FAOA 1LHYA 2V2FF 3HLFA 3ZHHA 4DE2A 5G18A 3IF6B 2ZC4B 3P09A 4KG6A 2Y2KA 1ES2A 3QHYA 4BL2A 4BJPA 4WZ5C 1K57A 3BFCA 4ZJ2A 1DJCA 3DWKA 5EVID 2BLSA 3GSGA 1K4FA 2WZZA 3N6IA 3WRTA 4E3MA 4DXBA 2ZC3B 3OCNA 4S2NA 5EPHA 1SHVA 2XD1A 2X02A 2PBYA 4PPRA 5E2HA 5EOEA 1LL5A 3MXSA 3BYDA 1N9BA 1S0WA 2A3UA 4GN2A 4OH0A 3V50A 1ALQA 3VP3A 3JYIA 2Y4AA 3HLDA 4MNRA 2XD5A 1QMFA 1J9MA 4IVKA 3OPLA 3IF5A 3ZG7B 3UPOA 3IF6C 2WUQA 1BZAA 1GA0A 5GLCA 3ZVTA 2ZM0A 3M2KA 3LO7A 4ZJ1A 5TFQA 4D2OA 1ZG4A 1DJAA 5GHZA 4BENA 4BD0A 3BM6A 1IYSA 4Y0UA 3VFHA 3NCKA 3ZNTA 2Y2QA 1E3UD 2E8IA 4WELA 1MBLA 2H10A 2ZLYA 2ZM8A 5GHYA 2UWXA 4BQMA 5KMWA 3SH9A 4S2NC 2Y2OA 5F83A 5KSCA 4N9LA 4O7DA 1XA7A 1PZOA 3N8RA 2HP9A 3BLSA 1KVMA 2XGNA 4MBHA 4LCLA 4FD8A 3UN7A 3PAGA 2ZC7A 5EE8A 3IHAA 4OOLA 3M6HA 4KZBA 2DNSA 5E43A 3UE1A 3GVBA 4KQQA 4E3NA 4UA6A 4OLDA 3IH8A 1YLZA 5JYPA 3HL9A 2ZJ9A 2WZXA 3UE3A 1KDWA 3O3VA 1JWVA 4OP8A 1M6KA 1ESIA 3SH7A 5DTTA 1G6AA 3GR2A 4LCMA 3MXRA 1MY8A 4E3IA 2Y59A 5FQMA 5HARA 2EX8A 4GD8A 3ZGAB 4BD1A 2DRWA 1BSGA 2ZQ7A 3B3XA 1K56D 2ZMAA 4KENB 5FATA 3ZFZA 2XR0A 2Y91A 4OPYA 2OSUA 1ERMA 4QD4A 1ESUA 5DF9A 3UE0A 5FI6A 1K54A 4FCFA 3ZNYA 4JPMA 2ZQ9A 3UDIA 5FDHA 4P6BA 1Z6FA 3OPPA 1XX2A 4UA9A 1RP5A 3O87A 4JKTA 4C6YA 1YLJA 1CK3A 3ISGA 1YMXA 2R9WA 2FFFB 1VM1A 1YLWA 3VP1A 5EUAA 1PIOA 4DRTA 3NDEA 4P85A 1XXMA 3SOIA 4KZ6A 2HDUA 3SS3A 1NJ4A 3HLBA 2EFUA 2P9VA 3BFEA 4RYEA 3TOIA 2PU2A 3N8SA 4PM5A 1PI5A 5CTMA 4PM7A 3G4PA 3IXGA 3IWOA 4P0MA 2B5RA 3UY6A 4E6WA 4B4ZA 4LENA 4PM8A 2VGKA 4EQIA 5M19A 4HBUA 1JVJA 4WMCA 1L0EA 3HLGA 3FZCA 4OQHA 3PAEA 1FR6A 1YMSA 5TGFA 4KG5A 3IXHA 4LV3A 2ZD8A 4N9KA 3MZEA 5CECA 4ZTKA 3TG9A 3MFDA 3C7UA 4ZBEA 4NETA 1C3BA 3IF6A 1ES3A 3VOYA 2Y2MA 3ZG9B 4GDNA 3Q82A 3WWXA 1CI8A 4UA7A 4Y7PA 3UDFA 4KQRA 1K4EA 3ZDJA 4OPQA 2RCXA 4JXVA 3Q81A 3MZDA 4E3LA 4DE0A 5A93A 1L0FA 1I5QA 4MEZA 2XLNA 3PBOA 3BECA 5DF8A 5A90A 1U60A 4IBXA 4S2LA 1PWDA 1XGJA 1YQSA 2XFSA 2IWBA 2GDNA 3O86A 4WM9A 4ZAMA 5KZHA 1JWZA 1IYPA 3PBQA 4QJGA 5JYOA 4Y0OA 4KZ5A 4QU3A 1W8YA 1I2SA 3HLEA 3OPHA 5CTNA 1GHIA 5HW3A 3P98A 5HAQA 4HESA 1LL9A 4JLFA 3W4QA 4X53A 4E3OA 1FCOA 2QMIA 1MWSA 2EXAA 3G2YA 4DF6A 4DE3A 1WYCA 1IELA 3I7JA 5GLDA 5A92A 1MWUA 3NY4A 4Q8IA 1G68A 3HLCA 2OV5A 2HPBA 4L0LA 1YLPA 3FKWA 5E2EA 4NK3A 3BFDA 1EROA 1RGYA 4GZBA 3PBRA 2ZQDA 1W8QA 2JCHA 1ERQA 3CMZA 3IQAA 1SCWA 5HX9A 1L0GA 1XA1A 4EV4A 1RGZA 2ZC6B 2Y2NA 3V3SA 3UO9A 4ID4A 2JC7A 3Q1FA 5E2FA 5M1AA 5FQQA 1IYQA 5HAIA 1FR1A 3GMWA 2Y2HA 3V39A 5DTKA 3VSLA 4XUZA 4N1HA 4OOYA 4KZ7A 3BEBA 1ZC2A 3RXWA 1PWGA 2X01A 2I72A 1KDSA 1Q2QA 3HUMA 5F82A 3S22A 3OCLA 3UPPA 3RXXA 1FQGA 2ZQ8A 2XH9A 4R3JA 3ZG0A 2WKIA 4S2PA 1TDGA 2H0YA 3W8KA 4OPZA 3UPNA 5AQ7A 5F1GA 3NDGA 3A3DA 1N4OA 5EVLA 4UAAA 5FA7A 4N92A 3IHBA 2X71A 1PWCA 2J9OA 1BT5A 1MKIA 4DDSA 3EQVA 1L0DA 1PW1A 3G35A 2P74A 1OMEA 1ZG6A 1H8YA 5A91A 4ZJ3A 1W7FA 4OPRA 5CGSA 3C5AA 1PZPA 2WAFA 3MKEA 4H8RA 3G30A 3IH9A 5HFOA 3E2KA 1BULA 2IWDA 4JF4A 4YINA 3N7WA 5CXWA 3VP2A 2QZ6A 2PU4A 3WS0A 2C6WB 2RL3A 3HVFA 5HL1A 3NI9A 4EBNA 4Z9QA 2Q9NA 4R3BA 3BFFA 1GCEA 1KE0A 1DY6A 5BOHA 1HZOA 3HUOA 1NXYA 5AQBA 1S6RA 2Z2LB 5FQ9A 3ZCZA 5IHVA 4U0TA 1ONGA 4RVAA 1FSYA 2ZQAA 3S4XA 5TR7A 4BL3A 1IYOA 4GB7A 2C5WB 4WZ4A 1WYBA 4P87A 4PMAA 3PBNA 3ZG5A 1K25A 4WMCD 1MWTA 3A3JA 3ITAA 4ZDXA 2JE5A 4HBTA 1FCMA 1SDEA 3HUNA 4UHUA 3C7VA 3IXBA 2Y2PA 3FYZA 5CHMA 4MLLA 1K38A 1K6RA 3BFGA 1YLTA 3DTMA 4KQOA 3MZFA 4MBKA 2EFXA 1NYMA 3EQUA 3GQZA 3SS4A 2WKHA 2J7VA 4RA7A 4EBLA 4S2JA 4FH4A 1KGFA 1PYYA 1BUEA 3V3RA 5L2FA 2WADA 5GLBA 2QPNA 2Q9MA 5FQJA 4KG2A 2WGWB 4GOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DVA A;  1MXO A;  4OOM A;  1XGI A;  3UDX A;  4S2I A;  4JXG A;  3WRZ A;  3AGD A;  1LLB A;  3BRM A;  5HAP A;  2WGV A;  2WKE A;  2ZM2 A;  1IKG A;  1KGE A;  4HEF A;  3OPR A;  3WS2 A;  4WEJ A;  1GA9 A;  1TEM A;  4R1G A;  4OQI A;  2A49 A;  2EXB A;  4QY5 A;  3M2J A;  4BLM A;  5AQA A;  5FSR A;  2Y2L A;  4U0X A;  1PW8 A;  5KSH A;  4KZ4 A;  4FSF A;  1CEF A;  3NBL A;  5CGX A;  4DXC A;  3Q7Z A;  2XFT A;  1TVF A;  1E25 A;  1BLC A;  1EI5 A;  4GD6 A;  2HDS A;  4GNU A;  1H8Z A;  1GHM A;  1JTG A;  2XK1 A;  1ES4 A;  4B88 A;  5E2G A;  3Q07 A;  4FH2 A;  4IVI A;  4QB8 A;  3D4F A;  4PM9 A;  1XPB A;  4B4X A;  2HDQ A;  2WGI A;  3WS5 A;  1HD8 A;  3QNB A;  4R4R A;  1H5X A;  2V1Z A;  3WS1 A;  1HVB A;  4GKU A;  3VOZ A;  1MPL A;  3A3I A;  1YM1 A;  4QHC A;  5FAP A;  5FQK A;  3VMA A;  5AQ9 A;  1Q2P A;  5EVI A;  4PM6 A;  4JBF A;  3SH8 A;  4KZA A;  5EVI B;  3CZD A;  4DDY A;  5EEC A;  2H5S A;  1IKI A;  4KZ9 A;  2XQZ A;  2G2U A;  5CER A;  3CG5 A;  1FCN A;  1KVL A;  3VP0 A;  2FFY A;  3FKV A;  5I94 A;  4XXR A;  1BTL A;  1ES5 A;  1NZO A;  3O88 A;  4E3K A;  4WYY A;  3LY3 A;  3C4O A;  4OKP A;  3IXD A;  1Y54 A;  1K57 C;  1MWR A;  4X68 A;  1KE4 A;  3MBZ A;  3LCE A;  1KGG A;  2Y55 A;  1CEG A;  2ZQC A;  1QME A;  4C3Q A;  2XDM A;  3IT9 A;  1BLS A;  2WAE A;  4KZ3 A;  4CPK A;  3HRE A;  3G2Z A;  1E3U A;  1JWP A;  5EVI C;  4R0Q A;  4K91 A;  2BG1 A;  1W79 A;  5D3O A;  2ZC5 B;  3ZVW A;  4CJN A;  1CI9 A;  4IED A;  2VGJ A;  1L2S A;  5CGW A;  3N4I A;  5CHJ A;  1KE3 A;  4N1X A;  4JXW A;  4DKI A;  4XUX A;  5GHX A;  4RX2 A;  4A5R A;  3C4P A;  1O7E A;  5DTS A;  2CC1 A;  1ONH A;  2G2W A;  1W5D A;  3AGE A;  3W4P A;  2EX9 A;  1SDN A;  4S2K A;  4YFM A;  3TSG A;  4IBR A;  1E4D A;  3Q7V A;  4JF6 A;  2IWC A;  3S1Y A;  3WS4 A;  1YLY A;  3UNW A;  1RCJ A;  2J9P A;  5M18 A;  2XEP A;  3GTC A;  4WBG A;  1LI0 A;  1ZKJ A;  3OZH A;  3Q7V B;  3RJU A;  4EUZ A;  2HP5 A;  5FQI A;  1K55 A;  1NYY A;  2DCF A;  2R9X A;  3NC8 A;  3IWQ A;  3CJM A;  1AXB A;  4M3K A;  4R23 A;  3VSK A;  4OQG A;  2EX6 A;  4R4S A;  4EWF A;  3A3E A;  3VP4 A;  4X6T A;  3SS5 A;  1K56 A;  4E6X A;  1I2W A;  4QY6 A;  4C75 A;  3PTE A;  1YT4 A;  2OLU A;  4U3T A;  3HLW A;  1PI4 A;  4OQ0 A;  4K0W A;  1NRF A;  4OVD A;  5CHU A;  2HP6 A;  2Y2J A;  3G31 A;  4K0X A;  4JXS A;  4OLG A;  5GLA A;  4E3J A;  4LV2 A;  2OLV A;  2Z2M B;  3E2L A;  4JF5 A;  2WYX A;  1FSW A;  3G32 A;  4KZ8 A;  4X69 A;  3FWL A;  3OC2 A;  5J8X A;  2V20 A;  3LEZ A;  5CRF A;  1JTD A;  2WGW A;  1K55 C;  1M40 A;  2J8Y A;  3IWI A;  1NZU A;  5GL9 A;  5U47 A;  3PBT A;  4S2O A;  1IEM A;  1O07 A;  3HBR A;  1HTZ A;  3ITB A;  2EX2 A;  2Y2I A;  3GRJ A;  1BLP A;  4S2M A;  2P9V B;  1WE4 A;  1K54 C;  4WEK A;  1TDL A;  3GV9 A;  1BLH A;  4GDB A;  1SKF A;  1EWZ A;  3G34 A;  2WK0 A;  3PBS A;  4WZ5 A;  1DJB A;  4MBF A;  3M6B A;  5F1F A;  2JBF A;  2Y2G A;  4EBP A;  3AGF A;  3LY4 A;  3QNC A;  3BLM A;  5CEB A;  3VFF A;  5FAS A;  4X55 A;  3FV7 A;  5DF7 A;  1LI9 A;  1GHP A;  3N8L A;  3ZG8 B;  5CED A;  1XKZ A;  2XF3 A;  3DWZ A;  3NIA A;  2HDR A;  1VQQ A;  3MKF A;  4Y0T A;  5EOO A;  3V5M A;  3W4O A;  1FOF A;  1K6S A;  4RX3 A;  1NY0 A;  3A3F A;  4F94 A;  5FI2 A;  5FI7 A;  4LV1 A;  1XP4 A;  2H0T A;  4OON A;  4OP5 A;  4LV0 A;  3DW0 A;  4DE1 A;  4X56 A;  5FAQ A;  5FAO A;  1LHY A;  2V2F F;  3HLF A;  3ZHH A;  4DE2 A;  5G18 A;  3IF6 B;  2ZC4 B;  3P09 A;  4KG6 A;  2Y2K A;  1ES2 A;  3QHY A;  4BL2 A;  4BJP A;  4WZ5 C;  1K57 A;  3BFC A;  4ZJ2 A;  1DJC A;  3DWK A;  5EVI D;  2BLS A;  3GSG A;  1K4F A;  2WZZ A;  3N6I A;  3WRT A;  4E3M A;  4DXB A;  2ZC3 B;  3OCN A;  4S2N A;  5EPH A;  1SHV A;  2XD1 A;  2X02 A;  2PBY A;  4PPR A;  5E2H A;  5EOE A;  1LL5 A;  3MXS A;  3BYD A;  1N9B A;  1S0W A;  2A3U A;  4GN2 A;  4OH0 A;  3V50 A;  1ALQ A;  3VP3 A;  3JYI A;  2Y4A A;  3HLD A;  4MNR A;  2XD5 A;  1QMF A;  1J9M A;  4IVK A;  3OPL A;  3IF5 A;  3ZG7 B;  3UPO A;  3IF6 C;  2WUQ A;  1BZA A;  1GA0 A;  5GLC A;  3ZVT A;  2ZM0 A;  3M2K A;  3LO7 A;  4ZJ1 A;  5TFQ A;  4D2O A;  1ZG4 A;  1DJA A;  5GHZ A;  4BEN A;  4BD0 A;  3BM6 A;  1IYS A;  4Y0U A;  3VFH A;  3NCK A;  3ZNT A;  2Y2Q A;  1E3U D;  2E8I A;  4WEL A;  1MBL A;  2H10 A;  2ZLY A;  2ZM8 A;  5GHY A;  2UWX A;  4BQM A;  5KMW A;  3SH9 A;  4S2N C;  2Y2O A;  5F83 A;  5KSC A;  4N9L A;  4O7D A;  1XA7 A;  1PZO A;  3N8R A;  2HP9 A;  3BLS A;  1KVM A;  2XGN A;  4MBH A;  4LCL A;  4FD8 A;  3UN7 A;  3PAG A;  2ZC7 A;  5EE8 A;  3IHA A;  4OOL A;  3M6H A;  4KZB A;  2DNS A;  5E43 A;  3UE1 A;  3GVB A;  4KQQ A;  4E3N A;  4UA6 A;  4OLD A;  3IH8 A;  1YLZ A;  5JYP A;  3HL9 A;  2ZJ9 A;  2WZX A;  3UE3 A;  1KDW A;  3O3V A;  1JWV A;  4OP8 A;  1M6K A;  1ESI A;  3SH7 A;  5DTT A;  1G6A A;  3GR2 A;  4LCM A;  3MXR A;  1MY8 A;  4E3I A;  2Y59 A;  5FQM A;  5HAR A;  2EX8 A;  4GD8 A;  3ZGA B;  4BD1 A;  2DRW A;  1BSG A;  2ZQ7 A;  3B3X A;  1K56 D;  2ZMA A;  4KEN B;  5FAT A;  3ZFZ A;  2XR0 A;  2Y91 A;  4OPY A;  2OSU A;  1ERM A;  4QD4 A;  1ESU A;  5DF9 A;  3UE0 A;  5FI6 A;  1K54 A;  4FCF A;  3ZNY A;  4JPM A;  2ZQ9 A;  3UDI A;  5FDH A;  4P6B A;  1Z6F A;  3OPP A;  1XX2 A;  4UA9 A;  1RP5 A;  3O87 A;  4JKT A;  4C6Y A;  1YLJ A;  1CK3 A;  3ISG A;  1YMX A;  2R9W A;  2FFF B;  1VM1 A;  1YLW A;  3VP1 A;  5EUA A;  1PIO A;  4DRT A;  3NDE A;  4P85 A;  1XXM A;  3SOI A;  4KZ6 A;  2HDU A;  3SS3 A;  1NJ4 A;  3HLB A;  2EFU A;  2P9V A;  3BFE A;  4RYE A;  3TOI A;  2PU2 A;  3N8S A;  4PM5 A;  1PI5 A;  5CTM A;  4PM7 A;  3G4P A;  3IXG A;  3IWO A;  4P0M A;  2B5R A;  3UY6 A;  4E6W A;  4B4Z A;  4LEN A;  4PM8 A;  2VGK A;  4EQI A;  5M19 A;  4HBU A;  1JVJ A;  4WMC A;  1L0E A;  3HLG A;  3FZC A;  4OQH A;  3PAE A;  1FR6 A;  1YMS A;  5TGF A;  4KG5 A;  3IXH A;  4LV3 A;  2ZD8 A;  4N9K A;  3MZE A;  5CEC A;  4ZTK A;  3TG9 A;  3MFD A;  3C7U A;  4ZBE A;  4NET A;  1C3B A;  3IF6 A;  1ES3 A;  3VOY A;  2Y2M A;  3ZG9 B;  4GDN A;  3Q82 A;  3WWX A;  1CI8 A;  4UA7 A;  4Y7P A;  3UDF A;  4KQR A;  1K4E A;  3ZDJ A;  4OPQ A;  2RCX A;  4JXV A;  3Q81 A;  3MZD A;  4E3L A;  4DE0 A;  5A93 A;  1L0F A;  1I5Q A;  4MEZ A;  2XLN A;  3PBO A;  3BEC A;  5DF8 A;  5A90 A;  1U60 A;  4IBX A;  4S2L A;  1PWD A;  1XGJ A;  1YQS A;  2XFS A;  2IWB A;  2GDN A;  3O86 A;  4WM9 A;  4ZAM A;  5KZH A;  1JWZ A;  1IYP A;  3PBQ A;  4QJG A;  5JYO A;  4Y0O A;  4KZ5 A;  4QU3 A;  1W8Y A;  1I2S A;  3HLE A;  3OPH A;  5CTN A;  1GHI A;  5HW3 A;  3P98 A;  5HAQ A;  4HES A;  1LL9 A;  4JLF A;  3W4Q A;  4X53 A;  4E3O A;  1FCO A;  2QMI A;  1MWS A;  2EXA A;  3G2Y A;  4DF6 A;  4DE3 A;  1WYC A;  1IEL A;  3I7J A;  5GLD A;  5A92 A;  1MWU A;  3NY4 A;  4Q8I A;  1G68 A;  3HLC A;  2OV5 A;  2HPB A;  4L0L A;  1YLP A;  3FKW A;  5E2E A;  4NK3 A;  3BFD A;  1ERO A;  1RGY A;  4GZB A;  3PBR A;  2ZQD A;  1W8Q A;  2JCH A;  1ERQ A;  3CMZ A;  3IQA A;  1SCW A;  5HX9 A;  1L0G A;  1XA1 A;  4EV4 A;  1RGZ A;  2ZC6 B;  2Y2N A;  3V3S A;  3UO9 A;  4ID4 A;  2JC7 A;  3Q1F A;  5E2F A;  5M1A A;  5FQQ A;  1IYQ A;  5HAI A;  1FR1 A;  3GMW A;  2Y2H A;  3V39 A;  5DTK A;  3VSL A;  4XUZ A;  4N1H A;  4OOY A;  4KZ7 A;  3BEB A;  1ZC2 A;  3RXW A;  1PWG A;  2X01 A;  2I72 A;  1KDS A;  1Q2Q A;  3HUM A;  5F82 A;  3S22 A;  3OCL A;  3UPP A;  3RXX A;  1FQG A;  2ZQ8 A;  2XH9 A;  4R3J A;  3ZG0 A;  2WKI A;  4S2P A;  1TDG A;  2H0Y A;  3W8K A;  4OPZ A;  3UPN A;  5AQ7 A;  5F1G A;  3NDG A;  3A3D A;  1N4O A;  5EVL A;  4UAA A;  5FA7 A;  4N92 A;  3IHB A;  2X71 A;  1PWC A;  2J9O A;  1BT5 A;  1MKI A;  4DDS A;  3EQV A;  1L0D A;  1PW1 A;  3G35 A;  2P74 A;  1OME A;  1ZG6 A;  1H8Y A;  5A91 A;  4ZJ3 A;  1W7F A;  4OPR A;  5CGS A;  3C5A A;  1PZP A;  2WAF A;  3MKE A;  4H8R A;  3G30 A;  3IH9 A;  5HFO A;  3E2K A;  1BUL A;  2IWD A;  4JF4 A;  4YIN A;  3N7W A;  5CXW A;  3VP2 A;  2QZ6 A;  2PU4 A;  3WS0 A;  2C6W B;  2RL3 A;  3HVF A;  5HL1 A;  3NI9 A;  4EBN A;  4Z9Q A;  2Q9N A;  4R3B A;  3BFF A;  1GCE A;  1KE0 A;  1DY6 A;  5BOH A;  1HZO A;  3HUO A;  1NXY A;  5AQB A;  1S6R A;  2Z2L B;  5FQ9 A;  3ZCZ A;  5IHV A;  4U0T A;  1ONG A;  4RVA A;  1FSY A;  2ZQA A;  3S4X A;  5TR7 A;  4BL3 A;  1IYO A;  4GB7 A;  2C5W B;  4WZ4 A;  1WYB A;  4P87 A;  4PMA A;  3PBN A;  3ZG5 A;  1K25 A;  4WMC D;  1MWT A;  3A3J A;  3ITA A;  4ZDX A;  2JE5 A;  4HBT A;  1FCM A;  1SDE A;  3HUN A;  4UHU A;  3C7V A;  3IXB A;  2Y2P A;  3FYZ A;  5CHM A;  4MLL A;  1K38 A;  1K6R A;  3BFG A;  1YLT A;  3DTM A;  4KQO A;  3MZF A;  4MBK A;  2EFX A;  1NYM A;  3EQU A;  3GQZ A;  3SS4 A;  2WKH A;  2J7V A;  4RA7 A;  4EBL A;  4S2J A;  4FH4 A;  1KGF A;  1PYY A;  1BUE A;  3V3R A;  5L2F A;  2WAD A;  5GLB A;  2QPN A;  2Q9M A;  5FQJ A;  4KG2 A;  2WGW B;  4GOG A; 
#chains in the Genus database with same CATH topology
 1MXO A;  3UDX A;  2M1C A;  2W3H A;  5HAP A;  1IOU A;  1G28 A;  1TEM A;  4OQI A;  2XRO A;  3LID A;  1TF1 A;  4U0X A;  3E0Y A;  4EES A;  2XFT A;  3T50 A;  2XK1 A;  1ES4 A;  5E2G A;  2K2N A;  5LBR A;  4IVI A;  2G7U A;  4QB8 A;  1XPB A;  2VJW A;  2HDQ A;  1HD8 A;  3PHY A;  4R4R A;  2V1Z A;  3VOZ A;  1MPL A;  4QHC A;  5EVI A;  4PM6 A;  4JBF A;  3ICY A;  3TE8 A;  4LGW A;  3CZD A;  2H5S A;  3A0R A;  2FFY A;  5I94 A;  2PHY A;  2D01 A;  4E3K A;  3LY3 A;  1KE4 A;  1KGG A;  1QME A;  1GSW A;  4EXO A;  2K31 A;  4GHI B;  1E3U A;  1W79 A;  5D3O A;  3FC7 A;  1CI9 A;  2I9V A;  3N4I A;  4A5R A;  3W4P A;  3E4Q A;  1W63 M;  1SDN A;  3S1Y A;  2IWC A;  3QP4 A;  2J9P A;  1K55 A;  2DCF A;  4M3K A;  3VSK A;  2Y79 A;  4BBU A;  3O5Y A;  1I2W A;  3HLW A;  2HF6 A;  5CHU A;  2HP6 A;  3T4L A;  4E3J A;  5EVE A;  2WYX A;  4KZ8 A;  4X69 A;  3FWL A;  3OC2 A;  5CRF A;  1M40 A;  4H6J A;  2HJ9 C;  5GL9 A;  2EX2 A;  2Y2I A;  1OTA A;  1TDL A;  4PAU A;  5HDS A;  2JKT M;  3JPU A;  3CI6 A;  1N9O A;  3FV7 A;  5DF7 A;  4HJ4 A;  5CED A;  1XKZ A;  4Y0T A;  3MKF A;  3KSH A;  3A3F A;  5FI7 A;  1XP4 A;  4OON A;  1V9Z A;  3F1P A;  3R7W B;  2Y2K A;  3QHY A;  3BFC A;  4GS9 B;  4ZJ2 A;  5EVI D;  3GSG A;  3ULF A;  4LFU A;  2ZC3 B;  3T4J A;  2QJ5 A;  4GN2 A;  1VHM A;  2A3U A;  3BYD A;  3V50 A;  2LB9 A;  1OT6 A;  1LSW A;  3IF5 A;  3ZG7 B;  4HP9 A;  3C30 A;  4QPR A;  2VZW A;  3LO7 A;  4ZJ1 A;  4PHT A;  3BM6 A;  4Y0U A;  2HJE A;  4GHI A;  1E3U D;  5IT5 A;  4Q0J A;  1MBL A;  3SH9 A;  4S2N C;  4FOF A;  4P6Z M;  5IU1 A;  1XA7 A;  3UB5 P;  3A0V A;  2HV1 A;  2ZC7 A;  1VET A;  3PAG A;  3M6H A;  4UA6 A;  1KDW A;  2ZMV A;  1M6K A;  4IJG A;  1G6A A;  3MXR A;  1MY8 A;  4E3I A;  2Y59 A;  4I38 A;  5HAR A;  3B3X A;  5FAT A;  4Z1W A;  4UQI M;  4OPY A;  1SKO B;  2OSU A;  1ERM A;  4QD4 A;  3UE0 A;  5FDH A;  1Z6F A;  3OPP A;  3JVV A;  4C6Y A;  1CK3 A;  1Z09 A;  2R9W A;  3OLO A;  1YKD A;  3S7O A;  3IS2 B;  3C2W A;  1PIO A;  4DRT A;  3KSI A;  4X1L A;  3SOI A;  2HDU A;  3S7N A;  3EEH A;  3HLB A;  3BFE A;  1DP8 A;  3N8S A;  2Q0O A;  5CTM A;  2ZMF A;  4PM7 A;  5FEG A;  2B5R A;  4PM8 A;  2YKF A;  3OBF A;  4WMC A;  1L0E A;  2V0W A;  3OOV A;  1YMS A;  5TGF A;  4N9K A;  2ZD8 A;  3MZE A;  5CEC A;  4ZTK A;  4G3W A;  4HOI A;  3R7W A;  1ES3 A;  2Y2M A;  4UA7 A;  4JGP A;  4GS9 A;  1VB6 A;  1L0F A;  1F2K A;  4MEZ A;  5FDS A;  5HD3 A;  4IBX A;  4S2L A;  1PWD A;  1YQS A;  1OT9 A;  4O0P A;  3PBQ A;  4WLA A;  5JYO A;  1W8Y A;  4EEP A;  3CUE C;  2V1B A;  2GZA A;  2QYB A;  3P98 A;  4HES A;  4BMW A;  4X53 A;  5HAQ A;  4DF6 A;  4CQH A;  4DE3 A;  3I7J A;  1AWI A;  1FIK A;  3HLC A;  2OV5 A;  2P04 A;  2DMW A;  3T1R A;  1RGY A;  2VA0 A;  3IQA A;  1W8Q A;  1EW0 A;  4ID4 A;  3Q1F A;  5TBM B;  3U2A A;  1FR1 A;  2Y2H A;  5DTK A;  1UGU A;  3LGO A;  1ZC2 A;  4X1M A;  2X01 A;  2I72 A;  4S2P A;  3RH8 B;  2NUT C;  3T1X A;  4MCW A;  4M4X A;  4OPZ A;  4IUH A;  5CX7 A;  3A3D A;  4YOF A;  1PWC A;  1BT5 A;  1PW1 A;  3G35 A;  1V9Y A;  1ZG6 A;  5CGS A;  4G3V A;  3DTI A;  3C5A A;  3F1O A;  3N7W A;  2XRN A;  4HI4 A;  1NWZ A;  3NI9 A;  4PKY G;  4Z9Q A;  4KUO A;  5L07 A;  2KX6 A;  5BOH A;  4DJ2 A;  5FQ9 A;  5IHV A;  2ZQA A;  3S4X A;  3T4T A;  5TR7 A;  4BL3 A;  1IYO A;  4P87 A;  3ZG5 A;  3PBN A;  1K25 A;  4WMC D;  4EU0 A;  2W3E A;  2BAS A;  1SDE A;  3IXB A;  4I5S A;  4MLL A;  1K6R A;  2KOI A;  2P7J A;  2EFX A;  3GQZ A;  4S2J A;  1KGF A;  4R70 A;  1PYY A;  1BUE A;  5GLB A;  2Q9M A;  4KG2 A;  2WGW B;  5IS1 A;  4LRZ E;  3NOT C;  4JXG A;  3WRZ A;  1LLB A;  2ZBB A;  3BRM A;  2WGV A;  2WKE A;  1KGE A;  4BBT A;  1YPR A;  2NUP C;  4R1G A;  4MN5 A;  2A49 A;  2EXB A;  3HJK A;  4BLM A;  2M7V A;  5AQA A;  5KSH A;  1S1Y A;  1CEF A;  5CGX A;  3Q7Z A;  3NOU C;  2HDS A;  2PBD P;  3Q07 A;  3P01 A;  2LB5 A;  3WS5 A;  3WS1 A;  4NG2 A;  1HVB A;  4GKU A;  1YM1 A;  2JKR I;  5FQK A;  3KYQ A;  3R4K A;  5AQ9 A;  4KZA A;  3E98 A;  2O9C A;  5EVI B;  5G4Z A;  2V1A A;  5EEC A;  1IKI A;  2XQZ A;  2G2U A;  3H82 B;  3FKV A;  3JVU A;  4XXR A;  3EEA A;  3TJZ C;  1K57 C;  4X68 A;  5DKL A;  4EUV A;  4CPK A;  3HRE A;  3G2Z A;  5HDC A;  3TRC A;  3KO6 A;  4R0Q A;  5EVI C;  2BG1 A;  1Y4O A;  2ZC5 B;  3ZVW A;  3B47 A;  4CJN A;  4IED A;  5CGW A;  1KE3 A;  4JXW A;  4XUX A;  1LL8 A;  5GHX A;  1GSX A;  1O7E A;  4NKP A;  2CC1 A;  2L1M A;  1W5D A;  3AGE A;  4YFM A;  3TSG A;  1E4D A;  3DTE A;  1NLY A;  5M18 A;  3FPV A;  4WBG A;  1LI0 A;  5FQI A;  1NYY A;  3NC8 A;  2OWJ A;  3UE6 A;  4OQG A;  1G6O A;  1OTE A;  3LYX A;  4EWF A;  3VP4 A;  4LRY C;  5HD5 A;  4QY6 A;  3CHW P;  3PTE A;  1YT4 A;  2JKG A;  1D06 A;  4OVD A;  4K0W A;  1NRF A;  2Y2J A;  4HP4 A;  5GLA A;  4LV2 A;  2OLV A;  3G32 A;  2PT7 A;  5J8X A;  3BQA A;  3KYZ A;  2WGW A;  1K55 C;  1DP9 A;  1NZU A;  3PBT A;  4S2O A;  1O07 A;  1HTZ A;  3ITB A;  4H6J B;  3GRJ A;  2P9V B;  1K54 C;  3GV9 A;  1SKF A;  4WZ5 A;  1CF0 A;  3NOP C;  5F1F A;  3MR0 A;  3AGF A;  5EM0 A;  3HJI A;  4X55 A;  4NXF A;  2XF3 A;  3DWZ A;  3NIA A;  1VQQ A;  2JHE A;  5EOO A;  3V5M A;  3W4O A;  4LV1 A;  3MSH A;  4OP5 A;  4DE1 A;  5FAQ A;  5FAO A;  2V2F F;  4DE2 A;  5G18 A;  4KG6 A;  3D72 A;  3F1P B;  4FTX A;  1K57 A;  5DFX A;  4EQ1 A;  1DJC A;  3DWK A;  5J4E A;  2PD8 A;  4WUJ A;  2MJ6 A;  3OCN A;  2XD1 A;  3MMH A;  1LL5 A;  1S1Z A;  1N9B A;  1S0W A;  2XA7 M;  1ALQ A;  2VV8 A;  2Y4A A;  3H82 A;  2XD5 A;  1QMF A;  1J9M A;  3OPL A;  5TFQ A;  2GX5 A;  1T1B A;  1ZG4 A;  1IYS A;  3ZNT A;  3MS6 A;  2OOL A;  2ZLY A;  2ZM8 A;  3RTY A;  5KMW A;  2Y2O A;  4G3K A;  5KSC A;  1PZO A;  3F1N B;  4MBH A;  2V9A A;  5EE8 A;  3IHA A;  4OOL A;  4KZB A;  3GVB A;  4KQQ A;  1VET B;  3C38 A;  4OLD A;  3HL9 A;  2ZJ9 A;  4OP8 A;  3SH7 A;  4DMZ A;  3UME A;  4CLC B;  4GD8 A;  4BD1 A;  1BSG A;  2ZMA A;  5J7E A;  3QP5 A;  3W2Z A;  1F9I A;  3IX4 A;  1ESU A;  5FI6 A;  1K54 A;  4FCF A;  2ZQ9 A;  3UDI A;  1P9W A;  5A8B A;  2PDR A;  3SZT A;  3ISG A;  1YMX A;  4CLC C;  1VM1 A;  1J3W A;  2HZ5 A;  3KYE A;  2OAP 1;  4KZ6 A;  3SS3 A;  1NJ4 A;  2P9V A;  4PM5 A;  2INW A;  3G4P A;  3IXG A;  3IWO A;  4B4Z A;  2OAQ 1;  2VGK A;  1MC0 A;  5HPF A;  3T4Q A;  3HLG A;  3FZC A;  2OWH A;  3ZYT A;  3MFD A;  2KLI A;  4NET A;  1C3B A;  4HQA A;  1NLZ A;  2RCX A;  4OPQ A;  3MZD A;  3LIC A;  1I5Q A;  2XLN A;  3PBO A;  4HJ3 A;  5A90 A;  1XGJ A;  2XFS A;  4ZAM A;  5KZH A;  1F98 A;  3LFV A;  1PRQ A;  1IYP A;  4Y0O A;  2VEA A;  4JGO A;  4QU3 A;  1I2S A;  4F3L B;  3OPH A;  5FL3 A;  3W4Q A;  2YKH A;  3G2Y A;  2EXA A;  2A24 B;  2Z6C A;  1P97 A;  1T1A A;  4Q8I A;  2HPB A;  3QP1 A;  4I3J A;  5E2E A;  4NK3 A;  3BFD A;  4GZB A;  5HX9 A;  2CMN A;  1LT0 A;  4ETZ A;  1STZ A;  1T18 A;  3F1N A;  3UO9 A;  5E2F A;  2PR5 A;  2XSS A;  3GMW A;  3VSL A;  3RXW A;  2VLG A;  4RQ9 A;  1PWG A;  3HUM A;  5EM1 A;  1Q2Q A;  3OCL A;  3RXX A;  3LEQ A;  1X0O A;  4YWZ A;  2H0Y A;  2JN7 A;  4CLC A;  4HY8 A;  5F1G A;  2ZL1 A;  2D02 A;  4N92 A;  2VX8 A;  3IHB A;  5A91 A;  4OPR A;  4NEE D;  2WAF A;  3G30 A;  3MF0 A;  2V8C A;  2V0U A;  4YIN A;  5CXW A;  3VP2 A;  2QZ6 A;  2PU4 A;  2RL3 A;  2B95 A;  4E04 A;  3HVF A;  3F1O B;  3QP8 A;  2Q9N A;  3NUL A;  3LI8 A;  3HUO A;  1NXY A;  5AQB A;  3ZCZ A;  4JGR A;  5L8M A;  3VE4 A;  5HSQ A;  1ONG A;  1FSY A;  2VKS A;  4PMA A;  3CLO A;  1T19 A;  1MWT A;  3ITA A;  2B18 A;  3HUN A;  2Y2P A;  3FYZ A;  5CHM A;  2FZ0 A;  1K38 A;  3UB7 A;  3BFG A;  4MDZ A;  4KQO A;  3V67 A;  1NYM A;  3EQU A;  2WKH A;  1PFL A;  1YAX A;  2J7V A;  1K0K A;  3UB6 A;  5FQJ A;  4HJ6 A;  5DVA A;  4ESP A;  3MQO A;  4OOM A;  1XGI A;  3VOL A;  4ME4 A;  1G5U A;  4HEF A;  3H9W A;  4AFI A;  3OPR A;  2VV6 A;  4WEJ A;  2J3T C;  1H3Q A;  3LR3 A;  5FSR A;  4Y13 A;  2Y2L A;  1PW8 A;  3L7H A;  4GJ4 A;  4F3L A;  2J3W A;  4FSF A;  4DXC A;  1TVF A;  1E25 A;  2Z6D A;  1EI5 A;  4GNU A;  1H8Z A;  2A24 A;  4B88 A;  4R38 A;  2W1T A;  4PM9 A;  4R6L A;  5KIZ A;  1XJ2 A;  3EOI A;  3QNB A;  1H5X A;  3A3I A;  5FAP A;  3CAX A;  1Q2P A;  2PD7 A;  3SH8 A;  1XJ3 A;  3E4P A;  4DDY A;  4O8G A;  3CG5 A;  1KVL A;  3VP0 A;  4I3A A;  3KX0 X;  4QWO A;  1BTL A;  4LLO B;  1ES5 A;  1LSV A;  1NZO A;  4WYY A;  4CLC D;  4OKP A;  3IXD A;  1N9L A;  1Y54 A;  3MBZ A;  3LCE A;  2Y55 A;  1CEG A;  2XDM A;  3IT9 A;  2WAE A;  4IHQ A;  1CJF A;  4K91 A;  4BWI A;  4DN0 A;  5CHJ A;  4DKI A;  2EA9 A;  4RX2 A;  3C4P A;  1ONH A;  3BW6 A;  5AJG A;  4IBR A;  3Q7V A;  1OJ5 A;  3WS4 A;  1CQA A;  1S67 L;  1RCJ A;  2XEP A;  3GTC A;  5AVF A;  5AVE A;  2HP5 A;  2M7U A;  2R9X A;  3CJM A;  1AXB A;  3BWL A;  3GEC A;  4R4S A;  3SS5 A;  4C75 A;  3BQ8 A;  4OQ0 A;  4O01 A;  3HCY A;  4JXS A;  3MQ0 A;  1HLU P;  2Z2M B;  3E2L A;  4JF5 A;  3A0S A;  1T1C A;  2J8Y A;  2QWS A;  1IEM A;  3HBR A;  3LUQ A;  4WEK A;  5L09 A;  1BLH A;  2GNX A;  4GDB A;  3LIB A;  1EWZ A;  3G34 A;  3PBS A;  1NRJ A;  2Y2G A;  4EBP A;  3LY4 A;  2H28 A;  5FAS A;  3CPT A;  3QP6 A;  1LI9 A;  1GHP A;  3ZG8 B;  3T4S A;  3TW8 A;  1FOF A;  1K6S A;  1Y28 A;  5FI2 A;  3SW1 A;  2H0T A;  4LV0 A;  3DW0 A;  4X56 A;  3HLF A;  3ZHH A;  2ZC4 B;  1ES2 A;  1ACF A;  4WZ5 C;  4Y3I A;  2BLS A;  4Y5F A;  3N6I A;  5HDD A;  1SHV A;  4WF0 A;  4PPR A;  4NXB A;  5J3W A;  4OH0 A;  4DJ3 A;  3IX8 A;  1JNU A;  3HLD A;  4MNR A;  1TS8 A;  4KUK A;  2WUQ A;  5HZH A;  1BZA A;  3UMD A;  3ZVT A;  4BEN A;  1TS0 A;  5GHZ A;  4BD0 A;  4UEY A;  3NCK A;  2E8I A;  2HGV A;  4WEL A;  2J80 A;  3MXQ A;  2H10 A;  5GHY A;  4BQM A;  4ARZ B;  5DJU A;  4YNR A;  1TD5 A;  4O7D A;  2HP9 A;  3BLS A;  1KVM A;  4LCL A;  3LR5 A;  3T1S A;  5I5L A;  5E43 A;  3UE1 A;  4E3N A;  3IH8 A;  3UE3 A;  2WZX A;  3O3V A;  5DKK A;  1TS7 A;  1JWV A;  1ESI A;  5DTT A;  2QHK A;  2EX8 A;  3ZGA B;  2DRW A;  2ZOI A;  2XR0 A;  2EWV A;  1MZU A;  5DJT A;  3EWK A;  3ZNY A;  4P6B A;  1XX2 A;  4EW7 A;  4MMN A;  1RP5 A;  2J3T D;  3O87 A;  4JKT A;  1YLJ A;  4UQI S;  4D60 A;  3UB8 A;  1YLW A;  2QJ7 A;  2AVX A;  1XXM A;  1OPX A;  4KQD A;  1PI5 A;  4CLC E;  4P0M A;  1W63 Q;  4LEN A;  4XT2 B;  4HBU A;  1JVJ A;  4OQH A;  2KDK A;  2W1R A;  3PAE A;  2W0N A;  3IXH A;  4LV3 A;  3VV4 A;  3D3O A;  3TG9 A;  3VE3 A;  4EER A;  4ZBE A;  4B9O A;  5F69 A;  3Q82 A;  1CI8 A;  3FPW A;  4DE0 A;  2O9A A;  1P9R A;  3LIF A;  3BEC A;  5C5K A;  5DF8 A;  1U60 A;  4Y2F A;  3O86 A;  2PYP A;  3D9Y A;  1JWZ A;  3NHQ A;  3RFB A;  4QJG A;  1H0M A;  1XFN A;  1GHI A;  1LL9 A;  4E3O A;  1FCO A;  2QMI A;  1XFQ A;  5A92 A;  1G68 A;  4WN5 A;  4L0L A;  3FKW A;  4ARZ A;  3PBR A;  1YSQ A;  2JCH A;  2JKR M;  2ZQD A;  1XA1 A;  1RGZ A;  3LIA A;  2JC7 A;  1DP6 A;  5FQQ A;  1IYQ A;  3NJA A;  5HAI A;  4N1H A;  4KZ7 A;  1D7E A;  3BEB A;  3IBR A;  3S22 A;  4ETX A;  4R3J A;  3ZG0 A;  1TDG A;  5DFY A;  3W8K A;  1N9N A;  3T4K A;  4MN7 A;  5AQ7 A;  1N4O A;  5FA7 A;  5HWV A;  2X71 A;  2ZL1 B;  1MKI A;  4DDS A;  3EQV A;  2P74 A;  3QP2 A;  1H8Y A;  1W7F A;  4K08 A;  1PZP A;  3MKE A;  4H8R A;  5HFO A;  2Y8H A;  3WS0 A;  2VK3 A;  5HL1 A;  3LI9 A;  4R3B A;  4HIA A;  3IBJ A;  2R78 A;  3PR6 A;  2EWW A;  5HPI A;  1KE0 A;  1DY6 A;  3BY8 A;  4L9E A;  1UWN X;  4Q0H A;  3KSF A;  2WKR A;  2C5W B;  4WZ4 A;  4XT2 A;  3H7W A;  4HBT A;  4Q0I A;  3MZF A;  2BTF P;  1P0Z A;  3T4O A;  4EBL A;  4FH4 A;  3V3R A;  5L2F A;  3DTK A;  1SZV A;  3WWX A;  4GOG A;  2WKP A;  4S2I A;  3AGD A;  2ZM2 A;  1IKG A;  3K2N A;  3WS2 A;  1GA9 A;  2IA2 A;  4QY5 A;  3M2J A;  3GDI A;  1S4R A;  4KZ4 A;  3NBL A;  1BLC A;  4GD6 A;  5FEF A;  1GHM A;  1JTG A;  4FUW A;  4FH2 A;  3S7P A;  3D4F A;  4B4X A;  1KOU A;  1VEU B;  2WGI A;  2W1T B;  3VMA A;  1PNE A;  2FH5 A;  4NXG A;  4GW9 A;  4KZ9 A;  4L9F A;  5CER A;  1FCN A;  3B33 A;  2ACG A;  2P08 A;  3O88 A;  4MN6 A;  3C4O A;  2A2L A;  1MWR A;  3C8C A;  2ZQC A;  5F68 A;  4C3Q A;  1BLS A;  4KZ3 A;  3LIE A;  1JWP A;  1OTD A;  3L9K A;  4PKY A;  3K3D A;  4LRX C;  3BY9 A;  1MKM A;  2VGJ A;  1L2S A;  4N1X A;  2VGL S;  5DTS A;  2G2W A;  4HHD A;  5HL6 A;  1TS6 A;  2ZOH A;  2EX9 A;  3B42 A;  4JF6 A;  2W3G A;  1YLY A;  1S66 L;  3UNW A;  1ZKJ A;  3RJU A;  3OZH A;  3Q7V B;  3DAV A;  3IWQ A;  4R23 A;  2EX6 A;  4L9G A;  1FIL A;  3A3E A;  4X6T A;  1K56 A;  4E6X A;  2OLU A;  4U3T A;  1PI4 A;  3G31 A;  4K0X A;  4OLG A;  2L0W A;  3S7Q A;  2PYR A;  1FSW A;  4B93 A;  2V20 A;  3LEZ A;  1JTD A;  1OTI A;  3IWI A;  5U47 A;  2V8F A;  1BLP A;  4S2M A;  1WE4 A;  3LR0 A;  3P7N A;  4X25 A;  2WK0 A;  1DJB A;  4MBF A;  3MQQ A;  3M6B A;  2JBF A;  4I3I A;  3QNC A;  3BLM A;  5CEB A;  3VFF A;  1IFQ A;  1ZHH B;  3N8L A;  4HNB A;  3CPT B;  2HDR A;  4RX3 A;  1NY0 A;  4F94 A;  4ZRR A;  1L3L A;  2K7S A;  1LHY A;  1S4S A;  3IF6 B;  3P09 A;  1VEU A;  4BL2 A;  4BJP A;  1K4F A;  2WZZ A;  3WRT A;  4E3M A;  4DXB A;  4S2N A;  4BBV A;  5EPH A;  5HWT A;  1ZTU A;  2X02 A;  2PBY A;  4Y17 A;  5E2H A;  5EOE A;  2B02 A;  3MXS A;  3CIT A;  5G4Y A;  1OJG A;  3MFX A;  3VP3 A;  3JYI A;  4IVK A;  3UPO A;  3IF6 C;  3FG8 A;  1DRM A;  4GLQ A;  1GA0 A;  5GLC A;  2ZM0 A;  3M2K A;  4D2O A;  1DJA A;  2XA7 S;  3VFH A;  2Y2Q A;  2UWX A;  2WKQ A;  5EFW A;  5F83 A;  4N9L A;  3N8R A;  2XGN A;  5MC7 A;  1XJ6 A;  4FD8 A;  3UN7 A;  1UWP X;  2DNS A;  3ZQ5 A;  1YLZ A;  5JYP A;  4Y15 A;  2QKP A;  3GR2 A;  4LCM A;  2JKF A;  2PR6 A;  5FQM A;  2ZQ7 A;  1SKO A;  1K56 D;  4KEN B;  2E8J A;  4EET B;  3ZFZ A;  2Y91 A;  4I39 A;  5HWW A;  5DF9 A;  4JPM A;  1BYW A;  3EGX C;  4UA9 A;  4NXE A;  3IS2 A;  3VP1 A;  2FFF B;  2O9B A;  5EUA A;  3NDE A;  3UB9 A;  4P85 A;  2EFU A;  3TOI A;  4RYE A;  2PU2 A;  5K5B A;  3LR4 A;  3U4L P;  3E4O A;  2O99 A;  3UY6 A;  4E6W A;  2W3D A;  2VV7 A;  4WL9 A;  3MJQ A;  2O0Y A;  4EQI A;  5M19 A;  3IX3 A;  1FR6 A;  4KG5 A;  4HH2 A;  2GJ3 A;  4IUK A;  3C7U A;  3CUE A;  3PXP A;  3PYP A;  5EV0 A;  3IF6 A;  3VOY A;  3ZG9 B;  4GDN A;  4Y7P A;  3UDF A;  4KQR A;  1K4E A;  3ZDJ A;  4JXV A;  3Q81 A;  5F6A A;  4E3L A;  5A93 A;  2L4R A;  2W27 A;  2IWB A;  2GDN A;  4WM9 A;  4JGQ A;  4KZ5 A;  3HLE A;  5CTN A;  2UV0 E;  3T1Q B;  5HW3 A;  4JLF A;  1MWS A;  1WYC A;  1IEL A;  1OTB A;  5GLD A;  1WA9 A;  2W3F A;  1MWU A;  3NY4 A;  5TJJ A;  3EGD C;  1YLP A;  3DBA A;  1ERO A;  4S2K A;  1ERQ A;  3KSG A;  3CMZ A;  1SCW A;  1L0G A;  4EV4 A;  5TBM A;  2ZC6 B;  2Y2N A;  3V3S A;  5M1A A;  3NEC A;  3V39 A;  4XUZ A;  4OOY A;  4EUZ A;  5F82 A;  1KDS A;  3UPP A;  1FQG A;  2ZQ8 A;  2XH9 A;  4P6Z S;  2WKI A;  3UPN A;  3G6O A;  2VGL M;  3NDG A;  5EVL A;  4UAA A;  2PRF A;  1XJ4 A;  2J9O A;  1A0K A;  1L0D A;  1F5M A;  1OME A;  3BJN A;  1LSX A;  4ZJ3 A;  3IH9 A;  3E2K A;  1BUL A;  2IWD A;  4JF4 A;  2C6W B;  3T12 B;  4R3A A;  1H8M A;  4EBN A;  3BFF A;  3CWF A;  4GCZ A;  1GCE A;  1ODV A;  1HZO A;  1S6R A;  2Z2L B;  1YSP A;  2PAV P;  4U0T A;  4RVA A;  1GSV A;  5L10 A;  4II7 A;  4GB7 A;  4EEU A;  1WYB A;  3A3J A;  4ZDX A;  2JE5 A;  1FCM A;  4UHU A;  2JKT I;  3C7V A;  3K3C A;  4LPZ A;  4HH3 A;  3H7W B;  4MBK A;  1YLT A;  3DTM A;  3SS4 A;  1D1J A;  5F5Y A;  4RA7 A;  2WAD A;  2QPN A; 
#chains in the Genus database with same CATH homology
 5DVA A;  1MXO A;  4OOM A;  1XGI A;  3UDX A;  4S2I A;  4JXG A;  3WRZ A;  3AGD A;  1LLB A;  3BRM A;  5HAP A;  2WGV A;  2WKE A;  2ZM2 A;  1IKG A;  1KGE A;  4HEF A;  3OPR A;  3WS2 A;  4WEJ A;  1GA9 A;  1TEM A;  4R1G A;  4OQI A;  2A49 A;  2EXB A;  4QY5 A;  3M2J A;  4BLM A;  5AQA A;  5FSR A;  2Y2L A;  4U0X A;  1PW8 A;  5KSH A;  4KZ4 A;  4FSF A;  1CEF A;  3NBL A;  5CGX A;  4DXC A;  3Q7Z A;  2XFT A;  1TVF A;  1E25 A;  1BLC A;  1EI5 A;  4GD6 A;  2HDS A;  4GNU A;  1H8Z A;  1GHM A;  1JTG A;  2XK1 A;  1ES4 A;  4B88 A;  5E2G A;  3Q07 A;  4FH2 A;  4IVI A;  4QB8 A;  3D4F A;  4PM9 A;  1XPB A;  4B4X A;  2HDQ A;  2WGI A;  3WS5 A;  1HD8 A;  3QNB A;  4R4R A;  1H5X A;  2V1Z A;  3WS1 A;  1HVB A;  4GKU A;  3VOZ A;  1MPL A;  3A3I A;  1YM1 A;  4QHC A;  5FAP A;  5FQK A;  3VMA A;  5AQ9 A;  1Q2P A;  5EVI A;  4PM6 A;  4JBF A;  3SH8 A;  4KZA A;  5EVI B;  3CZD A;  4DDY A;  5EEC A;  2H5S A;  1IKI A;  4KZ9 A;  2XQZ A;  2G2U A;  5CER A;  3CG5 A;  1FCN A;  1KVL A;  3VP0 A;  2FFY A;  3FKV A;  5I94 A;  4XXR A;  1BTL A;  1ES5 A;  1NZO A;  3O88 A;  4E3K A;  4WYY A;  3LY3 A;  3C4O A;  4OKP A;  3IXD A;  1Y54 A;  1K57 C;  1MWR A;  4X68 A;  1KE4 A;  3MBZ A;  3LCE A;  1KGG A;  2Y55 A;  1CEG A;  2ZQC A;  1QME A;  4C3Q A;  2XDM A;  3IT9 A;  1BLS A;  2WAE A;  4KZ3 A;  4CPK A;  3HRE A;  3G2Z A;  1E3U A;  1JWP A;  5EVI C;  4R0Q A;  4K91 A;  2BG1 A;  1W79 A;  5D3O A;  2ZC5 B;  3ZVW A;  4CJN A;  1CI9 A;  4IED A;  2VGJ A;  1L2S A;  5CGW A;  3N4I A;  5CHJ A;  1KE3 A;  4N1X A;  4JXW A;  4DKI A;  4XUX A;  5GHX A;  4RX2 A;  4A5R A;  3C4P A;  1O7E A;  5DTS A;  2CC1 A;  1ONH A;  2G2W A;  1W5D A;  3AGE A;  3W4P A;  2EX9 A;  1SDN A;  4S2K A;  4YFM A;  3TSG A;  4IBR A;  1E4D A;  3Q7V A;  4JF6 A;  2IWC A;  3S1Y A;  3WS4 A;  1YLY A;  3UNW A;  1RCJ A;  2J9P A;  5M18 A;  2XEP A;  3GTC A;  4WBG A;  1LI0 A;  1ZKJ A;  3OZH A;  3Q7V B;  3RJU A;  4EUZ A;  2HP5 A;  5FQI A;  1K55 A;  1NYY A;  2DCF A;  2R9X A;  3NC8 A;  3IWQ A;  3CJM A;  1AXB A;  4M3K A;  4R23 A;  3VSK A;  4OQG A;  2EX6 A;  4R4S A;  4EWF A;  3A3E A;  3VP4 A;  4X6T A;  3SS5 A;  1K56 A;  4E6X A;  1I2W A;  4QY6 A;  4C75 A;  3PTE A;  1YT4 A;  2OLU A;  4U3T A;  3HLW A;  1PI4 A;  4OQ0 A;  4K0W A;  1NRF A;  4OVD A;  5CHU A;  2HP6 A;  2Y2J A;  3G31 A;  4K0X A;  4JXS A;  4OLG A;  5GLA A;  4E3J A;  4LV2 A;  2OLV A;  2Z2M B;  3E2L A;  4JF5 A;  2WYX A;  1FSW A;  3G32 A;  4KZ8 A;  4X69 A;  3FWL A;  3OC2 A;  5J8X A;  2V20 A;  3LEZ A;  5CRF A;  1JTD A;  2WGW A;  1K55 C;  1M40 A;  2J8Y A;  3IWI A;  1NZU A;  5GL9 A;  5U47 A;  3PBT A;  4S2O A;  1IEM A;  1O07 A;  3HBR A;  1HTZ A;  3ITB A;  2EX2 A;  2Y2I A;  3GRJ A;  1BLP A;  4S2M A;  2P9V B;  1WE4 A;  1K54 C;  4WEK A;  1TDL A;  3GV9 A;  1BLH A;  4GDB A;  1SKF A;  1EWZ A;  3G34 A;  2WK0 A;  3PBS A;  4WZ5 A;  1DJB A;  4MBF A;  3M6B A;  5F1F A;  2JBF A;  2Y2G A;  4EBP A;  3AGF A;  3LY4 A;  3QNC A;  3BLM A;  5CEB A;  3VFF A;  5FAS A;  4X55 A;  3FV7 A;  5DF7 A;  1LI9 A;  1GHP A;  3N8L A;  3ZG8 B;  5CED A;  1XKZ A;  2XF3 A;  3DWZ A;  3NIA A;  2HDR A;  1VQQ A;  3MKF A;  4Y0T A;  5EOO A;  3V5M A;  3W4O A;  1FOF A;  1K6S A;  4RX3 A;  1NY0 A;  3A3F A;  4F94 A;  5FI2 A;  5FI7 A;  4LV1 A;  1XP4 A;  2H0T A;  4OON A;  4OP5 A;  4LV0 A;  3DW0 A;  4DE1 A;  4X56 A;  5FAQ A;  5FAO A;  1LHY A;  2V2F F;  3HLF A;  3ZHH A;  4DE2 A;  5G18 A;  3IF6 B;  2ZC4 B;  3P09 A;  4KG6 A;  2Y2K A;  1ES2 A;  3QHY A;  4BL2 A;  4BJP A;  4WZ5 C;  1K57 A;  3BFC A;  4ZJ2 A;  1DJC A;  3DWK A;  5EVI D;  2BLS A;  3GSG A;  1K4F A;  2WZZ A;  3N6I A;  3WRT A;  4E3M A;  4DXB A;  2ZC3 B;  3OCN A;  4S2N A;  5EPH A;  1SHV A;  2XD1 A;  2X02 A;  2PBY A;  4PPR A;  5E2H A;  5EOE A;  1LL5 A;  3MXS A;  3BYD A;  1N9B A;  1S0W A;  2A3U A;  4GN2 A;  4OH0 A;  3V50 A;  1ALQ A;  3VP3 A;  3JYI A;  2Y4A A;  3HLD A;  4MNR A;  2XD5 A;  1QMF A;  1J9M A;  4IVK A;  3OPL A;  3IF5 A;  3ZG7 B;  3UPO A;  3IF6 C;  2WUQ A;  1BZA A;  1GA0 A;  5GLC A;  3ZVT A;  2ZM0 A;  3M2K A;  3LO7 A;  4ZJ1 A;  5TFQ A;  4D2O A;  1ZG4 A;  1DJA A;  5GHZ A;  4BEN A;  4BD0 A;  3BM6 A;  1IYS A;  4Y0U A;  3VFH A;  3NCK A;  3ZNT A;  2Y2Q A;  1E3U D;  2E8I A;  4WEL A;  1MBL A;  2H10 A;  2ZLY A;  2ZM8 A;  5GHY A;  2UWX A;  4BQM A;  5KMW A;  3SH9 A;  4S2N C;  2Y2O A;  5F83 A;  5KSC A;  4N9L A;  4O7D A;  1XA7 A;  1PZO A;  3N8R A;  2HP9 A;  3BLS A;  1KVM A;  2XGN A;  4MBH A;  4LCL A;  4FD8 A;  3UN7 A;  3PAG A;  2ZC7 A;  5EE8 A;  3IHA A;  4OOL A;  3M6H A;  4KZB A;  2DNS A;  5E43 A;  3UE1 A;  3GVB A;  4KQQ A;  4E3N A;  4UA6 A;  4OLD A;  3IH8 A;  1YLZ A;  5JYP A;  3HL9 A;  2ZJ9 A;  2WZX A;  3UE3 A;  1KDW A;  3O3V A;  1JWV A;  4OP8 A;  1M6K A;  1ESI A;  3SH7 A;  5DTT A;  1G6A A;  3GR2 A;  4LCM A;  3MXR A;  1MY8 A;  4E3I A;  2Y59 A;  5FQM A;  5HAR A;  2EX8 A;  4GD8 A;  3ZGA B;  4BD1 A;  2DRW A;  1BSG A;  2ZQ7 A;  3B3X A;  1K56 D;  2ZMA A;  4KEN B;  5FAT A;  3ZFZ A;  2XR0 A;  2Y91 A;  4OPY A;  2OSU A;  1ERM A;  4QD4 A;  1ESU A;  5DF9 A;  3UE0 A;  5FI6 A;  1K54 A;  4FCF A;  3ZNY A;  4JPM A;  2ZQ9 A;  3UDI A;  5FDH A;  4P6B A;  1Z6F A;  3OPP A;  1XX2 A;  4UA9 A;  1RP5 A;  3O87 A;  4JKT A;  4C6Y A;  1YLJ A;  1CK3 A;  3ISG A;  1YMX A;  2R9W A;  2FFF B;  1VM1 A;  1YLW A;  3VP1 A;  5EUA A;  1PIO A;  4DRT A;  3NDE A;  4P85 A;  1XXM A;  3SOI A;  4KZ6 A;  2HDU A;  3SS3 A;  1NJ4 A;  3HLB A;  2EFU A;  2P9V A;  3BFE A;  4RYE A;  3TOI A;  2PU2 A;  3N8S A;  4PM5 A;  1PI5 A;  5CTM A;  4PM7 A;  3G4P A;  3IXG A;  3IWO A;  4P0M A;  2B5R A;  3UY6 A;  4E6W A;  4B4Z A;  4LEN A;  4PM8 A;  2VGK A;  4EQI A;  5M19 A;  4HBU A;  1JVJ A;  4WMC A;  1L0E A;  3HLG A;  3FZC A;  4OQH A;  3PAE A;  1FR6 A;  1YMS A;  5TGF A;  4KG5 A;  3IXH A;  4LV3 A;  2ZD8 A;  4N9K A;  3MZE A;  5CEC A;  4ZTK A;  3TG9 A;  3MFD A;  3C7U A;  4ZBE A;  4NET A;  1C3B A;  3IF6 A;  1ES3 A;  3VOY A;  2Y2M A;  3ZG9 B;  4GDN A;  3Q82 A;  3WWX A;  1CI8 A;  4UA7 A;  4Y7P A;  3UDF A;  4KQR A;  1K4E A;  3ZDJ A;  4OPQ A;  2RCX A;  4JXV A;  3Q81 A;  3MZD A;  4E3L A;  4DE0 A;  5A93 A;  1L0F A;  1I5Q A;  4MEZ A;  2XLN A;  3PBO A;  3BEC A;  5DF8 A;  5A90 A;  1U60 A;  4IBX A;  4S2L A;  1PWD A;  1XGJ A;  1YQS A;  2XFS A;  2IWB A;  2GDN A;  3O86 A;  4WM9 A;  4ZAM A;  5KZH A;  1JWZ A;  1IYP A;  3PBQ A;  4QJG A;  5JYO A;  4Y0O A;  4KZ5 A;  4QU3 A;  1W8Y A;  1I2S A;  3HLE A;  3OPH A;  5CTN A;  1GHI A;  5HW3 A;  3P98 A;  5HAQ A;  4HES A;  1LL9 A;  4JLF A;  3W4Q A;  4X53 A;  4E3O A;  1FCO A;  2QMI A;  1MWS A;  2EXA A;  3G2Y A;  4DF6 A;  4DE3 A;  1WYC A;  1IEL A;  3I7J A;  5GLD A;  5A92 A;  1MWU A;  3NY4 A;  4Q8I A;  1G68 A;  3HLC A;  2OV5 A;  2HPB A;  4L0L A;  1YLP A;  3FKW A;  5E2E A;  4NK3 A;  3BFD A;  1ERO A;  1RGY A;  4GZB A;  3PBR A;  2ZQD A;  1W8Q A;  2JCH A;  1ERQ A;  3CMZ A;  3IQA A;  1SCW A;  5HX9 A;  1L0G A;  1XA1 A;  4EV4 A;  1RGZ A;  2ZC6 B;  2Y2N A;  3V3S A;  3UO9 A;  4ID4 A;  2JC7 A;  3Q1F A;  5E2F A;  5M1A A;  5FQQ A;  1IYQ A;  5HAI A;  1FR1 A;  3GMW A;  2Y2H A;  3V39 A;  5DTK A;  3VSL A;  4XUZ A;  4N1H A;  4OOY A;  4KZ7 A;  3BEB A;  1ZC2 A;  3RXW A;  1PWG A;  2X01 A;  2I72 A;  1KDS A;  1Q2Q A;  3HUM A;  5F82 A;  3S22 A;  3OCL A;  3UPP A;  3RXX A;  1FQG A;  2ZQ8 A;  2XH9 A;  4R3J A;  3ZG0 A;  2WKI A;  4S2P A;  1TDG A;  2H0Y A;  3W8K A;  4OPZ A;  3UPN A;  5AQ7 A;  5F1G A;  3NDG A;  3A3D A;  1N4O A;  5EVL A;  4UAA A;  5FA7 A;  4N92 A;  3IHB A;  2X71 A;  1PWC A;  2J9O A;  1BT5 A;  1MKI A;  4DDS A;  3EQV A;  1L0D A;  1PW1 A;  3G35 A;  2P74 A;  1OME A;  1ZG6 A;  1H8Y A;  5A91 A;  4ZJ3 A;  1W7F A;  4OPR A;  5CGS A;  3C5A A;  1PZP A;  2WAF A;  3MKE A;  4H8R A;  3G30 A;  3IH9 A;  5HFO A;  3E2K A;  1BUL A;  2IWD A;  4JF4 A;  4YIN A;  3N7W A;  5CXW A;  3VP2 A;  2QZ6 A;  2PU4 A;  3WS0 A;  2C6W B;  2RL3 A;  3HVF A;  5HL1 A;  3NI9 A;  4EBN A;  4Z9Q A;  2Q9N A;  4R3B A;  3BFF A;  1GCE A;  1KE0 A;  1DY6 A;  5BOH A;  1HZO A;  3HUO A;  1NXY A;  5AQB A;  1S6R A;  2Z2L B;  5FQ9 A;  3ZCZ A;  5IHV A;  4U0T A;  1ONG A;  4RVA A;  1FSY A;  2ZQA A;  3S4X A;  5TR7 A;  4BL3 A;  1IYO A;  4GB7 A;  2C5W B;  4WZ4 A;  1WYB A;  4P87 A;  4PMA A;  3PBN A;  3ZG5 A;  1K25 A;  4WMC D;  1MWT A;  3A3J A;  3ITA A;  4ZDX A;  2JE5 A;  4HBT A;  1FCM A;  1SDE A;  3HUN A;  4UHU A;  3C7V A;  3IXB A;  2Y2P A;  3FYZ A;  5CHM A;  4MLL A;  1K38 A;  1K6R A;  3BFG A;  1YLT A;  3DTM A;  4KQO A;  3MZF A;  4MBK A;  2EFX A;  1NYM A;  3EQU A;  3GQZ A;  3SS4 A;  2WKH A;  2J7V A;  4RA7 A;  4EBL A;  4S2J A;  4FH4 A;  1KGF A;  1PYY A;  1BUE A;  3V3R A;  5L2F A;  2WAD A;  5GLB A;  2QPN A;  2Q9M A;  5FQJ A;  4KG2 A;  2WGW B;  4GOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...