5FDSA

Crystal structure of the monomeric allergen profilin (hev b 8)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
131
Chain Sequence
b'MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin-2
publication title Structural insights into the IgE mediated responses induced by the allergens Hev b 8 and Zea m 12 in their dimeric forms.
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Allergen
total genus 36
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 5fdsA00
2V8FA 2JKFA 3L7HA 4X1LA 5FEGA 3MSHA 2HZ5A 4QWOA 1AWIA 3CHWP 3UB5P 1VETB 5FDSA 3T1QB 3CPTA 2BTFP 5EV0A 4FUWA 1PRQA 1K0KA 3LGOA 1CJFA 3T1XA 3KYEA 5EVEA 4FTXA 2V8CA 1G5UA 1FIKA 1VETA 3T1RA 4D60A 3NULA 1D1JA 3MS6A 2B95A 3NECA 2PBDP 3DAVA 4X1MA 1Y4OA 1YPRA 2ZL1B 1Z09A 1CF0A 5FEFA 1FILA 2VK3A 1J3WA 1A0KA 1SKOB 5EM1A 3LEQA 1PNEA 3T12B 1ACFA 2E8JA 4X25A 2ZL1A 1SZVA 3D9YA 2JKGA 3L9KA 1SKOA 1PFLA 5EM0A 3U4LP 1CQAA 2PAVP 1VEUA 4ESPA 2PRFA 3T1SA 1VEUB 1F2KA 1HLUP 3CPTB 2ACGA
chains in the Genus database with same CATH superfamily
3HL9A 4YOFA 2Y8HA 3UE6A 3B42A 3UNWA 3HVFA 5FQMA 4S2LA 4U0TA 4OONA 2V1AA 2J9OA 2V0WA 3VFHA 1IKIA 4B4ZA 4OQ0A 4DE1A 3NJAA 4S2KA 5GHYA 3O87A 3KX0X 3RH8B 2Z6DA 2D02A 4R6LA 2JCHA 1LSXA 2VZWA 1LSWA 4WN5A 3VE4A 4E3NA 3NI9A 3KYEA 4QB8A 4DXCA 5CECA 1O7EA 3FPWA 1DP8A 2W3DA 2VKSA 4EXOA 2M1CA 3MQOA 1M40A 3S7PA 4GN2A 4DMZA 2EWVA 2OWHA 1LI0A 2O99A 3E2LA 3RXWA 1M6KA 2PBDP 1J9MA 1EWZA 4JBFA 2A24B 3C38A 5GLCA 3UB6A 3K3CA 3WWXA 1MBLA 4R1GA 3HLGA 3IWQA 5L2FA 2ZQAA 1KVMA 3VP3A 4WEJA 5CGSA 1FQGA 1W8YA 1J3WA 1IELA 4KG5A 2QWSA 3UPNA 2WGIA 4DN0A 2JHEA 2OOLA 3KYZA 5TGFA 4E6XA 2JKGA 2DCFA 5FI2A 5G18A 1BLHA 3G4PA 4IVKA 1DJCA 1AXBA 1VEUA 4GS9B 1VHMA 3E2KA 3IH9A 2O0YA 1MKMA 3CG5A 3BYDA 3BQ8A 1IYPA 4HJ4A 4BQMA 5A90A 2VEAA 5FEGA 4OOYA 1K4EA 4Y13A 4GCZA 1H8ZA 4WZ5C 4EQIA 1JNUA 2PT7A 4X69A 3NC8A 2ZD8A 2PBYA 5FDSA 3OPRA 3ZNYA 2H0TA 5A92A 4KQDA 3SOIA 3UB9A 3KSGA 5DKLA 4FD8A 4HQAA 2E8IA 5FQ9A 3S7OA 5F6AA 1K56A 4MN7A 4OVDA 4LPZA 4KQQA 4UA7A 4PM8A 3GDIA 2W1RA 3WS0A 3S4XA 5IHVA 3IBJA 4O0PA 1ES3A 4ZRRA 4MBFA 2H0YA 3VOZA 1P9RA 3QP6A 5KSHA 4B93A 4HP4A 3PR6A 2VK3A 2J3TC 1A0KA 1TS6A 2JN7A 1HD8A 3ZG5A 4P6ZM 3MBZA 1XJ6A 3CUEA 4NXBA 3VOYA 3LI8A 4NKPA 3RJUA 2M7UA 3MMHA 2G7UA 4WZ4A 3N8RA 3D9YA 1IYSA 4OQIA 1YM1A 3ZQ5A 4DXBA 4L0LA 4MN5A 3HLFA 4E3IA 4C3QA 2ZQ8A 3CZDA 2ZLYA 1JWZA 3KSIA 4FSFA 3O88A 4S2OA 3WS2A 5I5LA 4KZ8A 2ZC3B 4X55A 4L9FA 3BFDA 4HJ6A 3E4PA 3BM6A 3VSLA 3LI9A 5FI7A 2J8YA 2L0WA 3T1QB 3EOIA 2BTFP 4OLGA 2H10A 4HBTA 4WZ5A 2WGVA 2ZBBA 4E3LA 1K54C 3OLOA 5HZHA 4LLOB 2G2UA 2G2WA 2HDSA 5EVEA 1STZA 4ZJ3A 4BD0A 3EQUA 1JTGA 3IS2A 5A8BA 5BOHA 1D1JA 4KENB 2XA7S 3FKVA 5AQAA 2ZC4B 1E25A 5DTTA 4H6JB 1CI8A 3FC7A 1S1YA 3HJKA 3QP8A 2HGVA 4CQHA 3UN7A 3G35A 3EQVA 3PBQA 2ZQ9A 1H8MA 4EBPA 5FAQA 2GJ3A 4MEZA 2QZ6A 3G30A 4QY6A 4BBUA 4Y0OA 2EA9A 4YWZA 3A3IA 1TEMA 2R78A 4EESA 3T1SA 1F2KA 1EI5A 2C5WB 3Q7VA 3V67A 4E6WA 4Y0TA 1IEMA 1YLZA 4PKYA 3BY8A 1YLJA 2J9PA 1PWDA 1KGEA 3LIEA 1S1ZA 1K55C 3JPUA 5TBMA 4HHDA 4LV0A 1PWGA 3BW6A 1KE4A 3CJMA 2J3TD 3PBRA 5HD5A 1CJFA 3VV4A 4CJNA 4Y17A 3G2ZA 4WLAA 5CX7A 2XFTA 2W3HA 1LT0A 1LI9A 3A3EA 4GLQA 4BBVA 4IEDA 5C5KA 2JKRM 3FPVA 1K54A 1KOUA 5FASA 3ISGA 4OKPA 1OTIA 3D4FA 3MQQA 4DDYA 5F1FA 4HJ3A 4B9OA 2B95A 4EERA 2EX8A 4ZBEA 2PDRA 1YSPA 2Y2HA 5F5YA 2WKPA 4LRZE 1K6RA 3LR0A 3HJIA 3VP4A 3EWKA 4GB7A 1TDLA 4E04A 2ZMVA 3IXGA 3IHAA 2W1TA 5HWTA 1ACFA 4E3MA 1GHPA 1PYYA 1G6OA 4RX3A 3H82A 4ETXA 2W3GA 4EV4A 4ZTKA 5E43A 1G68A 2Y2LA 4KZ7A 2PAVP 4DDSA 3MJQA 4Q0JA 4L9GA 2XFSA 4ESPA 4CLCC 1K57C 1ZKJA 2PYRA 4WM9A 1DP9A 1W63Q 4Z1WA 2JE5A 4B4XA 1XFNA 4E3OA 2EX2A 2Y79A 1RP5A 2QYBA 3WRTA 3IF6C 2A3UA 3ZYTA 4QPRA 4P87A 3M6BA 3NOPC 3C30A 2WYXA 3HLWA 4R4SA 3R4KA 4OPQA 3OPLA 1K55A 3A3FA 3PXPA 4HIAA 3CLOA 4KG2A 1F9IA 1HTZA 4PM9A 4JXSA 3F1NA 3N8SA 3F1OA 2P7JA 3UB7A 4NEED 4X68A 5L07A 1YKDA 4XUZA 3T1RA 5EVIC 1ES5A 1XFQA 4R23A 4G3WA 1Y4OA 1IFQA 2ZMFA 1GSXA 3GVBA 2A49A 3UE1A 1XGIA 3QP2A 3WRZA 5A93A 3T12B 3SW1A 1NRFA 1XX2A 3R7WA 2QMIA 3ZFZA 5HD3A 3RXXA 2LB5A 2Y2QA 3VP0A 2HJEA 3C5AA 1TS7A 1YLWA 1ODVA 4FOFA 4WEKA 3SZTA 3IX8A 4FH4A 3NDEA 1NYYA 1G6AA 3DTMA 4JGPA 2Y91A 5A91A 2WUQA 3E4OA 5FAOA 3H7WA 3L7HA 4UAAA 4CLCA 4NG2A 3G6OA 5KMWA 1S66L 5J7EA 3S7QA 5HPFA 1V9YA 1AWIA 3N6IA 3CITA 1BZAA 1PI4A 4YNRA 4LV3A 3IF6A 4GOGA 4WUJA 4ARZB 4KQOA 2Q0OA 4P6ZS 3GECA 3JVUA 4JXGA 3T1XA 1ESIA 1S67L 1T1CA 4IHQA 2EX9A 3NCKA 5G4ZA 4P6BA 1DRMA 1TD5A 2WKHA 4D60A 2WGWB 1GA9A 4CLCD 4PAUA 3OOVA 2HDQA 2DRWA 3JVVA 5DVAA 2HDRA 5EVIA 2FH5A 2M7VA 5DF7A 3P01A 4M3KA 2XQZA 4I3AA 5FEFA 3EGXC 3T4LA 1KVLA 4ZDXA 3FKWA 4BLMA 1P9WA 3LEQA 3GRJA 3S7NA 1WYCA 4C75A 3PHYA 4WL9A 2E8JA 4EU0A 5CGXA 4DE3A 4KZ4A 4MLLA 2ZL1A 3UMEA 1MZUA 3HREA 3PAGA 3E4QA 3G2YA 2RL3A 3PBTA 3V3SA 1ONGA 4M4XA 3T50A 1S0WA 3B33A 4GHIA 3RTYA 5EVID 1MXOA 1HVBA 4QY5A 3V3RA 1Q2QA 3DW0A 2Y2JA 1PWCA 5F82A 3FG8A 2ZC6B 4B88A 2R9WA 5L09A 4I3IA 5TFQA 4DE0A 4PM6A 1W7FA 4QWOA 3S1YA 3O5YA 3LO7A 4HESA 1GSVA 1ZTUA 5FQQA 5EOEA 4A5RA 1GSWA 2XLNA 3SH7A 3ZG0A 1UWNX 2ZQ7A 5CRFA 4II7A 3SS3A 3W4PA 5HW3A 2WZXA 3KSFA 1OJ5A 5TJJA 1Y28A 4EQ1A 1ERMA 1OTDA 1OTBA 2XR0A 3HUOA 3IXDA 2ZMAA 5CTNA 3TRCA 3BECA 2OLVA 2VV6A 4KUKA 2XF3A 1JTDA 3UE0A 1K4FA 1TS0A 2EWWA 1MWSA 5J3WA 4BMWA 1XKZA 1O07A 2K7SA 2IWDA 3MXQA 4K91A 5L10A 2W27A 3TG9A 5DF8A 3LCEA 3VP2A 4HEFA 3TW8A 2W3FA 1LLBA 3Q1FA 3OPHA 1P97A 2PR6A 5HL1A 3M2JA 1YLYA 4I39A 3MR0A 3AGFA 3A0RA 4O8GA 1JWPA 2J3WA 5CHUA 2GDNA 4RA7A 1MPLA 1XXMA 2JC7A 1YSQA 3LR4A 4GDNA 2Y2KA 3KYQA 4GS9A 4PHTA 1SCWA 2W0NA 1BTLA 4XUXA 5DFYA 3UPOA 3LEZA 1ZG6A 4KQRA 2V1BA 5HDSA 2PR5A 2ZM2A 4PMAA 4OH0A 1FR1A 4N1XA 3KO6A 3LYXA 3HUNA 2WK0A 1UWPX 4KZAA 2PHYA 2UWXA 4X53A 3IH8A 2EXAA 3IS2B 3NY4A 3MFXA 3MZDA 4WBGA 2QJ5A 3E0YA 3QP5A 2FZ0A 5CXWA 1FCMA 1D06A 3LR3A 2V0UA 5FQKA 3OBFA 4KZ9A 3ZVTA 4BBTA 1LSVA 5M18A 4P85A 3GV9A 4XT2A 3MKFA 4QHCA 4C6YA 4X1MA 3AGEA 4OOMA 4S2NC 1W63M 1ZG4A 1N9NA 2Y59A 3C7UA 4IUHA 3PBOA 2VX8A 2WKRA 5KIZA 2X02A 3FV7A 3IF5A 3O86A 3M2KA 3IX4A 3B47A 2VV7A 2V1ZA 5FA7A 4IBRA 3Q07A 1MWRA 3IX3A 4OPYA 3V50A 1TS8A 4DJ2A 4O01A 2ZM0A 3DTIA 4OPZA 5DTKA 3SH8A 5HL6A 1OT9A 3LY3A 2D01A 4HH2A 3MSHA 2UV0E 1MKIA 3FYZA 3A0VA 3Q7ZA 3CMZA 3SH9A 1L0EA 3GMWA 5E2GA 1FSWA 5JYOA 3CPTA 4WF0A 5HWWA 2HP6A 1E4DA 3C2WA 1BULA 3S22A 3PYPA 1FIKA 2H5SA 1VETA 1RCJA 2VV8A 1IOUA 3G32A 4EW7A 3Q82A 4EETB 4EWFA 1W5DA 2W1TB 3K3DA 1JWVA 4H6JA 3QNCA 4LRYC 1Y54A 3P98A 1D7EA 3ZG9B 2BG1A 2Q9NA 1OJGA 2OSUA 2Y2IA 3MF0A 1GA0A 1L0GA 3QNBA 3IWIA 4S2NA 2FFYA 2XGNA 2JKTM 3HUMA 4FCFA 2IWCA 2R9XA 4XXRA 1ESUA 5LBRA 3HLEA 1NLYA 1QMEA 5JYPA 2ZOIA 5CERA 2Z6CA 2WADA 4I5SA 3MXSA 1YQSA 5F83A 1V9ZA 3MZEA 3JYIA 5FAPA 2VA0A 1DY6A 2HP5A 4NXGA 2PU4A 2JKFA 2Y2GA 4D2OA 2B18A 3N8LA 3A3JA 1Q2PA 3IWOA 4R3JA 5EOOA 2Z2LB 4F3LA 3CHWP 1FCOA 3GSGA 2LB9A 4MMNA 4LCMA 4KZ5A 2Q9MA 2XRNA 2VGJA 1SDEA 1CK3A 5CEBA 2PD7A 4WMCA 5AQ7A 4N92A 1TF1A 5CEDA 2WAFA 2X01A 1OMEA 4FTXA 2Z2MB 4MNRA 3VE3A 2JKTI 2ZOHA 5DFXA 2Y55A 4WELA 3ZGAB 2WKIA 1NLZA 4HNBA 1YMSA 3W8KA 1JVJA 4AFIA 4EUVA 4KG6A 1W79A 2XH9A 3ZHHA 1GCEA 1IYQA 4E3JA 3W2ZA 4QD4A 3MKEA 5EM1A 3D72A 1N9LA 3VSKA 3PBSA 3LICA 4RQ9A 3LFVA 4WMCD 1GHMA 2PU2A 2RCXA 3UY6A 2O9AA 1XJ2A 3T4KA 1PFLA 1SKOA 4YINA 3U4LP 3LIBA 3G34A 5KZHA 5CHJA 3K2NA 1BYWA 2PRFA 2K31A 2ZQCA 2B5RA 2IWBA 4Y5FA 4N9KA 3W4OA 4OQGA 2NUPC 4KZBA 4X1LA 4GNUA 3F1PA 2KLIA 2WKEA 4IUKA 1KE0A 5J4EA 3DTKA 2VLGA 2FFFB 4UQIM 3ITAA 3SS4A 1MC0A 2QKPA 3T4QA 4NXEA 4LCLA 2WZZA 2V20A 4IVIA 5EFWA 1S4RA 1K57A 2KOIA 3ZG7B 3WS4A 1G5UA 3ULFA 3T4SA 5D3OA 2DMWA 1WYBA 4Z9QA 2VJWA 3IBRA 3NECA 1OT6A 4DRTA 3DAVA 4EBLA 4CPKA 1BT5A 1IKGA 5HARA 3LIDA 1NZUA 2ZL1B 1ALQA 2EX6A 5IU1A 1Z09A 1PI5A 4KZ6A 3T4JA 1XPBA 4PKYG 1NXYA 2VGLM 4GHIB 1CI9A 3IT9A 4LFUA 5FQIA 4R3BA 4EEUA 2P9VA 1U60A 5AJGA 1PZPA 3H9WA 4IBXA 4LV1A 4JGOA 4ME4A 4R4RA 4G3VA 2KX6A 1VEUB 1CEFA 2OAP1 2XDMA 4GD8A 2P08A 2V8FA 4GZBA 4H8RA 3DWZA 3CWFA 5HWVA 1BSGA 2OWJA 1ERQA 3QP4A 4EUZA 2HZ5A 2P04A 1OTAA 4U3TA 4JF6A 1KGGA 4P0MA 1EW0A 4ARZA 4PM7A 2XD1A 2L4RA 5M19A 5EVLA 2ZJ9A 1VM1A 3FZCA 2X71A 2C6WB 3CUEC 5GLAA 1KGFA 1VB6A 3W4QA 1FCNA 4WYYA 3T4TA 4HH3A 2WGWA 3ZNTA 5E2EA 5HDDA 5HDCA 4UA9A 1BLPA 1K25A 3WS5A 4S2IA 1SKFA 5HAIA 2EFXA 3B3XA 3MFDA 4LV2A 3IQAA 1YMXA 2B02A 3BLSA 3MXRA 3DBAA 3TSGA 1PNEA 1K38A 1OPXA 3LY4A 2A24A 2NUTC 4R70A 1FR6A 3L9KA 1ZHHB 5E2HA 5E2FA 5DJUA 1NZOA 4S2PA 3C7VA 2BLSA 5HAQA 2A2LA 4F94A 3N4IA 2MJ6A 1KDWA 4JGQA 3PTEA 4GJ4A 4KZ3A 5K5BA 3M6HA 3BWLA 3C4OA 3VFFA 1EROA 2O9BA 2IA2A 4OOLA 2XROA 1PW1A 1VQQA 4JLFA 2GZAA 4JF5A 3ICYA 4S2MA 3UB5P 5AVEA 1DJAA 3CAXA 3IXHA 4XT2B 3LUQA 1OTEA 1MWUA 1MY8A 4JXVA 5GLBA 1P0ZA 1XJ3A 3AGDA 2J7VA 5M1AA 2VGKA 5FI6A 4OLDA 4DE2A 4DKIA 4EBNA 2DNSA 4RVAA 5TR7A 3UO9A 3I7JA 1H5XA 5CGWA 4BWIA 4K0WA 4JKTA 2I9VA 2HPBA 3NOUC 3UE3A 3HLBA 3HLCA 4R0QA 1DP6A 3CI6A 2Y2PA 2OAQ1 4MDZA 2GX5A 3BFEA 2K2NA 2QPNA 1K56D 5GHXA 2ZC7A 4O7DA 1C3BA 3SS5A 1Z6FA 3UDFA 3EGDC 5HFOA 1N9OA 3QHYA 4Y3IA 4X25A 5GHZA 3HBRA 1SZVA 3HCYA 4I38A 1SDNA 4K08A 1H3QA 4N9LA 5J8XA 4HI4A 3A3DA 3VMAA 3TOIA 3VOLA 4OP5A 2QJ7A 4ETZA 1PIOA 3P7NA 1GHIA 1YLPA 1YLTA 4LRXC 2CC1A 1DJBA 3CPTB 4Y7PA 4RYEA 2ACGA 2OV5A 3N7WA 4Y2FA 1MWTA 2ZQDA 3Q7VB 4ID4A 3BJNA 5FATA 5F1GA 5FSRA 1K6SA 2Y2OA 4NK3A 4JF4A 4Q0HA 4CLCE 1KE3A 5TBMB 5CTMA 3U2AA 1VETB 1TDGA 3OPPA 4GKUA 2HDUA 3BEBA 4OQHA 3KSHA 1LL9A 1BUEA 1T19A 4UEYA 3BRMA 1PZOA 1F5MA 4QJGA 4RX2A 2L1MA 5EE8A 1LHYA 4X56A 2OLUA 3ZDJA 4BD1A 1F98A 3PBNA 1N4OA 2P74A 2ZC5B 3UDXA 1NY0A 3UB8A 3BLMA 2Y2NA 1XP4A 1YT4A 3BFFA 5U47A 5FQJA 2J80A 5EECA 1CF0A 3FWLA 2WKQA 1LL5A 1N9BA 3NBLA 1E3UA 3RFBA 4I3JA 1NWZA 1XA1A 2V2FF 3ZG8B 2V9AA 4UQIS 1FOFA 3A0SA 5EPHA 4GDBA 2W3EA 4PPRA 5FL3A 3H82B 1RGZA 4GW9A 5F69A 4LGWA 3TE8A 5EUAA 4QU3A 2YKHA 1KDSA 1S4SA 1CQAA 4F3LB 2I72A 3V5MA 4HBUA 1XA7A 3LIAA 3C8CA 3BY9A 4DJ3A 2O9CA 5GL9A 2WAEA 3G31A 3D3OA 4G3KA 3UMDA 4Y15A 1L2SA 2EXBA 1E3UD 4JPMA 5L8MA 5HX9A 3UDIA 4K0XA 5MC7A 4MCWA 1G28A 3BFCA 4Q8IA 1L0DA 3OCLA 1YAXA 2XSSA 3OCNA 4R3AA 5EV0A 1PRQA 2HV1A 1K0KA 4MBHA 2Y4AA 2VGLS 2ZM8A 5I94A 4HP9A 4U0XA 1HZOA 3DWKA 3UPPA 3MQ0A 4OP8A 5DKKA 3F1NB 3F1OB 3LR5A 4N1HA 1WA9A 5DJTA 3V39A 3QP1A 3NHQA 3GTCA 3MS6A 1X0OA 2JBFA 1ES2A 1T1BA 3MZFA 1XJ4A 4E3KA 4Y0UA 4ZJ1A 2BASA 3NOTC 4ZJ2A 4JXWA 2CMNA 3IXBA 1SKOB 4BL2A 2PYPA 1BLSA 3C4PA 3LIFA 1BLCA 4Q0IA 1UGUA 5DTSA 2JKRI 1I5QA 2GNXA 2QHKA 3R7WB 1IYOA 2HF6A 4HY8A 3TJZC 1TVFA 3GR2A 4BJPA 3F1PB 5EM0A 3NDGA 2XA7M 1FSYA 4HOIA 4NETA 3OZHA 4MBKA 1ONHA 4GD6A 4L9EA 4OPRA 1NYMA 3GQZA 1XGJA 4FH2A 1PW8A 3EEAA 4LENA 4YFMA 3H7WB 3P09A 4CLCB 2INWA 3PAEA 4BENA 2KDKA 5G4YA 5AQBA 3Q81A 4S2JA 3BFGA 4FUWA 3IF6B 1WE4A 5CHMA 5DF9A 3LGOA 1H8YA 4EEPA 1LL8A 4IJGA 2V8CA 4ZAMA 4R38A 5F68A 1NRJA 2PD8A 4UHUA 2EFUA 1I2SA 1NJ4A 1H0MA 3E98A 3ZCZA 5FDHA 3NULA 3EEHA 1L3LA 1ES4A 1L0FA 5KSCA 1ZC2A 4BL3A 1YPRA 3OC2A 2HP9A 1SHVA 5EVIB 3IHBA 1I2WA 4JGRA 5AVFA 2P9VB 2YKFA 3O3VA 1FILA 5IS1A 5IT5A 3ZVWA 3WS1A 1QMFA 3VP1A 3DTEA 2XK1A 4NXFA 1S6RA 1CEGA 5HAPA 4KUOA 2XD5A 4X6TA 5HSQA 1T1AA 3HLDA 3NIAA 5GLDA 2H28A 1T18A 4DF6A 1W8QA 4MN6A 2AVXA 1RGYA 2XEPA 2HJ9C 3ITBA 5AQ9A 3BQAA 5HPIA 4PM5A 4UA6A 1HLUP 2Y2MA 3T4OA
chains in the Genus database with same CATH topology
2V8FA 2JKFA 3L7HA 4X1LA 5FEGA 3MSHA 2HZ5A 4QWOA 1AWIA 3CHWP 3UB5P 1VETB 5FDSA 3T1QB 3CPTA 2BTFP 5EV0A 4FUWA 1PRQA 1K0KA 3LGOA 1CJFA 3T1XA 3KYEA 5EVEA 4FTXA 2V8CA 1G5UA 1FIKA 1VETA 3T1RA 4D60A 3NULA 1D1JA 3MS6A 2B95A 3NECA 2PBDP 3DAVA 4X1MA 1Y4OA 1YPRA 2ZL1B 1Z09A 1CF0A 5FEFA 1FILA 2VK3A 1J3WA 1A0KA 1SKOB 5EM1A 3LEQA 1PNEA 3T12B 1ACFA 2E8JA 4X25A 2ZL1A 1SZVA 3D9YA 2JKGA 3L9KA 1SKOA 1PFLA 5EM0A 3U4LP 1CQAA 2PAVP 1VEUA 4ESPA 2PRFA 3T1SA 1VEUB 1F2KA 1HLUP 3CPTB 2ACGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8F A;  2JKF A;  3L7H A;  4X1L A;  5FEG A;  3MSH A;  2HZ5 A;  4QWO A;  1AWI A;  3CHW P;  3UB5 P;  1VET B;  5FDS A;  3T1Q B;  3CPT A;  2BTF P;  5EV0 A;  4FUW A;  1PRQ A;  1K0K A;  3LGO A;  1CJF A;  3T1X A;  3KYE A;  5EVE A;  4FTX A;  2V8C A;  1G5U A;  1FIK A;  1VET A;  3T1R A;  4D60 A;  3NUL A;  1D1J A;  3MS6 A;  2B95 A;  3NEC A;  2PBD P;  3DAV A;  4X1M A;  1Y4O A;  1YPR A;  2ZL1 B;  1Z09 A;  1CF0 A;  5FEF A;  1FIL A;  2VK3 A;  1J3W A;  1A0K A;  1SKO B;  5EM1 A;  3LEQ A;  1PNE A;  3T12 B;  1ACF A;  2E8J A;  4X25 A;  2ZL1 A;  1SZV A;  3D9Y A;  2JKG A;  3L9K A;  1SKO A;  1PFL A;  5EM0 A;  3U4L P;  1CQA A;  2PAV P;  1VEU A;  4ESP A;  2PRF A;  3T1S A;  1VEU B;  1F2K A;  1HLU P;  3CPT B;  2ACG A; 
#chains in the Genus database with same CATH topology
 3HL9 A;  4YOF A;  2Y8H A;  3UE6 A;  3B42 A;  3UNW A;  3HVF A;  5FQM A;  4S2L A;  4U0T A;  4OON A;  2V1A A;  2J9O A;  2V0W A;  3VFH A;  1IKI A;  4B4Z A;  4OQ0 A;  4DE1 A;  3NJA A;  4S2K A;  5GHY A;  3O87 A;  3KX0 X;  3RH8 B;  2Z6D A;  2D02 A;  4R6L A;  2JCH A;  1LSX A;  2VZW A;  1LSW A;  4WN5 A;  3VE4 A;  4E3N A;  3NI9 A;  3KYE A;  4QB8 A;  4DXC A;  5CEC A;  1O7E A;  3FPW A;  1DP8 A;  2W3D A;  2VKS A;  4EXO A;  2M1C A;  3MQO A;  1M40 A;  3S7P A;  4GN2 A;  4DMZ A;  2EWV A;  2OWH A;  1LI0 A;  2O99 A;  3E2L A;  3RXW A;  1M6K A;  2PBD P;  1J9M A;  1EWZ A;  4JBF A;  2A24 B;  3C38 A;  5GLC A;  3UB6 A;  3K3C A;  3WWX A;  1MBL A;  4R1G A;  3HLG A;  3IWQ A;  5L2F A;  2ZQA A;  1KVM A;  3VP3 A;  4WEJ A;  5CGS A;  1FQG A;  1W8Y A;  1J3W A;  1IEL A;  4KG5 A;  2QWS A;  3UPN A;  2WGI A;  4DN0 A;  2JHE A;  2OOL A;  3KYZ A;  5TGF A;  4E6X A;  2JKG A;  2DCF A;  5FI2 A;  5G18 A;  1BLH A;  3G4P A;  4IVK A;  1DJC A;  1AXB A;  1VEU A;  4GS9 B;  1VHM A;  3E2K A;  3IH9 A;  2O0Y A;  1MKM A;  3CG5 A;  3BYD A;  3BQ8 A;  1IYP A;  4HJ4 A;  4BQM A;  5A90 A;  2VEA A;  5FEG A;  4OOY A;  1K4E A;  4Y13 A;  4GCZ A;  1H8Z A;  4WZ5 C;  4EQI A;  1JNU A;  2PT7 A;  4X69 A;  3NC8 A;  2ZD8 A;  2PBY A;  5FDS A;  3OPR A;  3ZNY A;  2H0T A;  5A92 A;  4KQD A;  3SOI A;  3UB9 A;  3KSG A;  5DKL A;  4FD8 A;  4HQA A;  2E8I A;  5FQ9 A;  3S7O A;  5F6A A;  1K56 A;  4MN7 A;  4OVD A;  4LPZ A;  4KQQ A;  4UA7 A;  4PM8 A;  3GDI A;  2W1R A;  3WS0 A;  3S4X A;  5IHV A;  3IBJ A;  4O0P A;  1ES3 A;  4ZRR A;  4MBF A;  2H0Y A;  3VOZ A;  1P9R A;  3QP6 A;  5KSH A;  4B93 A;  4HP4 A;  3PR6 A;  2VK3 A;  2J3T C;  1A0K A;  1TS6 A;  2JN7 A;  1HD8 A;  3ZG5 A;  4P6Z M;  3MBZ A;  1XJ6 A;  3CUE A;  4NXB A;  3VOY A;  3LI8 A;  4NKP A;  3RJU A;  2M7U A;  3MMH A;  2G7U A;  4WZ4 A;  3N8R A;  3D9Y A;  1IYS A;  4OQI A;  1YM1 A;  3ZQ5 A;  4DXB A;  4L0L A;  4MN5 A;  3HLF A;  4E3I A;  4C3Q A;  2ZQ8 A;  3CZD A;  2ZLY A;  1JWZ A;  3KSI A;  4FSF A;  3O88 A;  4S2O A;  3WS2 A;  5I5L A;  4KZ8 A;  2ZC3 B;  4X55 A;  4L9F A;  3BFD A;  4HJ6 A;  3E4P A;  3BM6 A;  3VSL A;  3LI9 A;  5FI7 A;  2J8Y A;  2L0W A;  3T1Q B;  3EOI A;  2BTF P;  4OLG A;  2H10 A;  4HBT A;  4WZ5 A;  2WGV A;  2ZBB A;  4E3L A;  1K54 C;  3OLO A;  5HZH A;  4LLO B;  2G2U A;  2G2W A;  2HDS A;  5EVE A;  1STZ A;  4ZJ3 A;  4BD0 A;  3EQU A;  1JTG A;  3IS2 A;  5A8B A;  5BOH A;  1D1J A;  4KEN B;  2XA7 S;  3FKV A;  5AQA A;  2ZC4 B;  1E25 A;  5DTT A;  4H6J B;  1CI8 A;  3FC7 A;  1S1Y A;  3HJK A;  3QP8 A;  2HGV A;  4CQH A;  3UN7 A;  3G35 A;  3EQV A;  3PBQ A;  2ZQ9 A;  1H8M A;  4EBP A;  5FAQ A;  2GJ3 A;  4MEZ A;  2QZ6 A;  3G30 A;  4QY6 A;  4BBU A;  4Y0O A;  2EA9 A;  4YWZ A;  3A3I A;  1TEM A;  2R78 A;  4EES A;  3T1S A;  1F2K A;  1EI5 A;  2C5W B;  3Q7V A;  3V67 A;  4E6W A;  4Y0T A;  1IEM A;  1YLZ A;  4PKY A;  3BY8 A;  1YLJ A;  2J9P A;  1PWD A;  1KGE A;  3LIE A;  1S1Z A;  1K55 C;  3JPU A;  5TBM A;  4HHD A;  4LV0 A;  1PWG A;  3BW6 A;  1KE4 A;  3CJM A;  2J3T D;  3PBR A;  5HD5 A;  1CJF A;  3VV4 A;  4CJN A;  4Y17 A;  3G2Z A;  4WLA A;  5CX7 A;  2XFT A;  2W3H A;  1LT0 A;  1LI9 A;  3A3E A;  4GLQ A;  4BBV A;  4IED A;  5C5K A;  2JKR M;  3FPV A;  1K54 A;  1KOU A;  5FAS A;  3ISG A;  4OKP A;  1OTI A;  3D4F A;  3MQQ A;  4DDY A;  5F1F A;  4HJ3 A;  4B9O A;  2B95 A;  4EER A;  2EX8 A;  4ZBE A;  2PDR A;  1YSP A;  2Y2H A;  5F5Y A;  2WKP A;  4LRZ E;  1K6R A;  3LR0 A;  3HJI A;  3VP4 A;  3EWK A;  4GB7 A;  1TDL A;  4E04 A;  2ZMV A;  3IXG A;  3IHA A;  2W1T A;  5HWT A;  1ACF A;  4E3M A;  1GHP A;  1PYY A;  1G6O A;  4RX3 A;  3H82 A;  4ETX A;  2W3G A;  4EV4 A;  4ZTK A;  5E43 A;  1G68 A;  2Y2L A;  4KZ7 A;  2PAV P;  4DDS A;  3MJQ A;  4Q0J A;  4L9G A;  2XFS A;  4ESP A;  4CLC C;  1K57 C;  1ZKJ A;  2PYR A;  4WM9 A;  1DP9 A;  1W63 Q;  4Z1W A;  2JE5 A;  4B4X A;  1XFN A;  4E3O A;  2EX2 A;  2Y79 A;  1RP5 A;  2QYB A;  3WRT A;  3IF6 C;  2A3U A;  3ZYT A;  4QPR A;  4P87 A;  3M6B A;  3NOP C;  3C30 A;  2WYX A;  3HLW A;  4R4S A;  3R4K A;  4OPQ A;  3OPL A;  1K55 A;  3A3F A;  3PXP A;  4HIA A;  3CLO A;  4KG2 A;  1F9I A;  1HTZ A;  4PM9 A;  4JXS A;  3F1N A;  3N8S A;  3F1O A;  2P7J A;  3UB7 A;  4NEE D;  4X68 A;  5L07 A;  1YKD A;  4XUZ A;  3T1R A;  5EVI C;  1ES5 A;  1XFQ A;  4R23 A;  4G3W A;  1Y4O A;  1IFQ A;  2ZMF A;  1GSX A;  3GVB A;  2A49 A;  3UE1 A;  1XGI A;  3QP2 A;  3WRZ A;  5A93 A;  3T12 B;  3SW1 A;  1NRF A;  1XX2 A;  3R7W A;  2QMI A;  3ZFZ A;  5HD3 A;  3RXX A;  2LB5 A;  2Y2Q A;  3VP0 A;  2HJE A;  3C5A A;  1TS7 A;  1YLW A;  1ODV A;  4FOF A;  4WEK A;  3SZT A;  3IX8 A;  4FH4 A;  3NDE A;  1NYY A;  1G6A A;  3DTM A;  4JGP A;  2Y91 A;  5A91 A;  2WUQ A;  3E4O A;  5FAO A;  3H7W A;  3L7H A;  4UAA A;  4CLC A;  4NG2 A;  3G6O A;  5KMW A;  1S66 L;  5J7E A;  3S7Q A;  5HPF A;  1V9Y A;  1AWI A;  3N6I A;  3CIT A;  1BZA A;  1PI4 A;  4YNR A;  4LV3 A;  3IF6 A;  4GOG A;  4WUJ A;  4ARZ B;  4KQO A;  2Q0O A;  4P6Z S;  3GEC A;  3JVU A;  4JXG A;  3T1X A;  1ESI A;  1S67 L;  1T1C A;  4IHQ A;  2EX9 A;  3NCK A;  5G4Z A;  4P6B A;  1DRM A;  1TD5 A;  2WKH A;  4D60 A;  2WGW B;  1GA9 A;  4CLC D;  4PAU A;  3OOV A;  2HDQ A;  2DRW A;  3JVV A;  5DVA A;  2HDR A;  5EVI A;  2FH5 A;  2M7V A;  5DF7 A;  3P01 A;  4M3K A;  2XQZ A;  4I3A A;  5FEF A;  3EGX C;  3T4L A;  1KVL A;  4ZDX A;  3FKW A;  4BLM A;  1P9W A;  3LEQ A;  3GRJ A;  3S7N A;  1WYC A;  4C75 A;  3PHY A;  4WL9 A;  2E8J A;  4EU0 A;  5CGX A;  4DE3 A;  4KZ4 A;  4MLL A;  2ZL1 A;  3UME A;  1MZU A;  3HRE A;  3PAG A;  3E4Q A;  3G2Y A;  2RL3 A;  3PBT A;  3V3S A;  1ONG A;  4M4X A;  3T50 A;  1S0W A;  3B33 A;  4GHI A;  3RTY A;  5EVI D;  1MXO A;  1HVB A;  4QY5 A;  3V3R A;  1Q2Q A;  3DW0 A;  2Y2J A;  1PWC A;  5F82 A;  3FG8 A;  2ZC6 B;  4B88 A;  2R9W A;  5L09 A;  4I3I A;  5TFQ A;  4DE0 A;  4PM6 A;  1W7F A;  4QWO A;  3S1Y A;  3O5Y A;  3LO7 A;  4HES A;  1GSV A;  1ZTU A;  5FQQ A;  5EOE A;  4A5R A;  1GSW A;  2XLN A;  3SH7 A;  3ZG0 A;  1UWN X;  2ZQ7 A;  5CRF A;  4II7 A;  3SS3 A;  3W4P A;  5HW3 A;  2WZX A;  3KSF A;  1OJ5 A;  5TJJ A;  1Y28 A;  4EQ1 A;  1ERM A;  1OTD A;  1OTB A;  2XR0 A;  3HUO A;  3IXD A;  2ZMA A;  5CTN A;  3TRC A;  3BEC A;  2OLV A;  2VV6 A;  4KUK A;  2XF3 A;  1JTD A;  3UE0 A;  1K4F A;  1TS0 A;  2EWW A;  1MWS A;  5J3W A;  4BMW A;  1XKZ A;  1O07 A;  2K7S A;  2IWD A;  3MXQ A;  4K91 A;  5L10 A;  2W27 A;  3TG9 A;  5DF8 A;  3LCE A;  3VP2 A;  4HEF A;  3TW8 A;  2W3F A;  1LLB A;  3Q1F A;  3OPH A;  1P97 A;  2PR6 A;  5HL1 A;  3M2J A;  1YLY A;  4I39 A;  3MR0 A;  3AGF A;  3A0R A;  4O8G A;  1JWP A;  2J3W A;  5CHU A;  2GDN A;  4RA7 A;  1MPL A;  1XXM A;  2JC7 A;  1YSQ A;  3LR4 A;  4GDN A;  2Y2K A;  3KYQ A;  4GS9 A;  4PHT A;  1SCW A;  2W0N A;  1BTL A;  4XUX A;  5DFY A;  3UPO A;  3LEZ A;  1ZG6 A;  4KQR A;  2V1B A;  5HDS A;  2PR5 A;  2ZM2 A;  4PMA A;  4OH0 A;  1FR1 A;  4N1X A;  3KO6 A;  3LYX A;  3HUN A;  2WK0 A;  1UWP X;  4KZA A;  2PHY A;  2UWX A;  4X53 A;  3IH8 A;  2EXA A;  3IS2 B;  3NY4 A;  3MFX A;  3MZD A;  4WBG A;  2QJ5 A;  3E0Y A;  3QP5 A;  2FZ0 A;  5CXW A;  1FCM A;  1D06 A;  3LR3 A;  2V0U A;  5FQK A;  3OBF A;  4KZ9 A;  3ZVT A;  4BBT A;  1LSV A;  5M18 A;  4P85 A;  3GV9 A;  4XT2 A;  3MKF A;  4QHC A;  4C6Y A;  4X1M A;  3AGE A;  4OOM A;  4S2N C;  1W63 M;  1ZG4 A;  1N9N A;  2Y59 A;  3C7U A;  4IUH A;  3PBO A;  2VX8 A;  2WKR A;  5KIZ A;  2X02 A;  3FV7 A;  3IF5 A;  3O86 A;  3M2K A;  3IX4 A;  3B47 A;  2VV7 A;  2V1Z A;  5FA7 A;  4IBR A;  3Q07 A;  1MWR A;  3IX3 A;  4OPY A;  3V50 A;  1TS8 A;  4DJ2 A;  4O01 A;  2ZM0 A;  3DTI A;  4OPZ A;  5DTK A;  3SH8 A;  5HL6 A;  1OT9 A;  3LY3 A;  2D01 A;  4HH2 A;  3MSH A;  2UV0 E;  1MKI A;  3FYZ A;  3A0V A;  3Q7Z A;  3CMZ A;  3SH9 A;  1L0E A;  3GMW A;  5E2G A;  1FSW A;  5JYO A;  3CPT A;  4WF0 A;  5HWW A;  2HP6 A;  1E4D A;  3C2W A;  1BUL A;  3S22 A;  3PYP A;  1FIK A;  2H5S A;  1VET A;  1RCJ A;  2VV8 A;  1IOU A;  3G32 A;  4EW7 A;  3Q82 A;  4EET B;  4EWF A;  1W5D A;  2W1T B;  3K3D A;  1JWV A;  4H6J A;  3QNC A;  4LRY C;  1Y54 A;  3P98 A;  1D7E A;  3ZG9 B;  2BG1 A;  2Q9N A;  1OJG A;  2OSU A;  2Y2I A;  3MF0 A;  1GA0 A;  1L0G A;  3QNB A;  3IWI A;  4S2N A;  2FFY A;  2XGN A;  2JKT M;  3HUM A;  4FCF A;  2IWC A;  2R9X A;  4XXR A;  1ESU A;  5LBR A;  3HLE A;  1NLY A;  1QME A;  5JYP A;  2ZOI A;  5CER A;  2Z6C A;  2WAD A;  4I5S A;  3MXS A;  1YQS A;  5F83 A;  1V9Z A;  3MZE A;  3JYI A;  5FAP A;  2VA0 A;  1DY6 A;  2HP5 A;  4NXG A;  2PU4 A;  2JKF A;  2Y2G A;  4D2O A;  2B18 A;  3N8L A;  3A3J A;  1Q2P A;  3IWO A;  4R3J A;  5EOO A;  2Z2L B;  4F3L A;  3CHW P;  1FCO A;  3GSG A;  2LB9 A;  4MMN A;  4LCM A;  4KZ5 A;  2Q9M A;  2XRN A;  2VGJ A;  1SDE A;  1CK3 A;  5CEB A;  2PD7 A;  4WMC A;  5AQ7 A;  4N92 A;  1TF1 A;  5CED A;  2WAF A;  2X01 A;  1OME A;  4FTX A;  2Z2M B;  4MNR A;  3VE3 A;  2JKT I;  2ZOH A;  5DFX A;  2Y55 A;  4WEL A;  3ZGA B;  2WKI A;  1NLZ A;  4HNB A;  1YMS A;  3W8K A;  1JVJ A;  4AFI A;  4EUV A;  4KG6 A;  1W79 A;  2XH9 A;  3ZHH A;  1GCE A;  1IYQ A;  4E3J A;  3W2Z A;  4QD4 A;  3MKE A;  5EM1 A;  3D72 A;  1N9L A;  3VSK A;  3PBS A;  3LIC A;  4RQ9 A;  3LFV A;  4WMC D;  1GHM A;  2PU2 A;  2RCX A;  3UY6 A;  2O9A A;  1XJ2 A;  3T4K A;  1PFL A;  1SKO A;  4YIN A;  3U4L P;  3LIB A;  3G34 A;  5KZH A;  5CHJ A;  3K2N A;  1BYW A;  2PRF A;  2K31 A;  2ZQC A;  2B5R A;  2IWB A;  4Y5F A;  4N9K A;  3W4O A;  4OQG A;  2NUP C;  4KZB A;  4X1L A;  4GNU A;  3F1P A;  2KLI A;  2WKE A;  4IUK A;  1KE0 A;  5J4E A;  3DTK A;  2VLG A;  2FFF B;  4UQI M;  3ITA A;  3SS4 A;  1MC0 A;  2QKP A;  3T4Q A;  4NXE A;  4LCL A;  2WZZ A;  2V20 A;  4IVI A;  5EFW A;  1S4R A;  1K57 A;  2KOI A;  3ZG7 B;  3WS4 A;  1G5U A;  3ULF A;  3T4S A;  5D3O A;  2DMW A;  1WYB A;  4Z9Q A;  2VJW A;  3IBR A;  3NEC A;  1OT6 A;  4DRT A;  3DAV A;  4EBL A;  4CPK A;  1BT5 A;  1IKG A;  5HAR A;  3LID A;  1NZU A;  2ZL1 B;  1ALQ A;  2EX6 A;  5IU1 A;  1Z09 A;  1PI5 A;  4KZ6 A;  3T4J A;  1XPB A;  4PKY G;  1NXY A;  2VGL M;  4GHI B;  1CI9 A;  3IT9 A;  4LFU A;  5FQI A;  4R3B A;  4EEU A;  2P9V A;  1U60 A;  5AJG A;  1PZP A;  3H9W A;  4IBX A;  4LV1 A;  4JGO A;  4ME4 A;  4R4R A;  4G3V A;  2KX6 A;  1VEU B;  1CEF A;  2OAP 1;  2XDM A;  4GD8 A;  2P08 A;  2V8F A;  4GZB A;  4H8R A;  3DWZ A;  3CWF A;  5HWV A;  1BSG A;  2OWJ A;  1ERQ A;  3QP4 A;  4EUZ A;  2HZ5 A;  2P04 A;  1OTA A;  4U3T A;  4JF6 A;  1KGG A;  4P0M A;  1EW0 A;  4ARZ A;  4PM7 A;  2XD1 A;  2L4R A;  5M19 A;  5EVL A;  2ZJ9 A;  1VM1 A;  3FZC A;  2X71 A;  2C6W B;  3CUE C;  5GLA A;  1KGF A;  1VB6 A;  3W4Q A;  1FCN A;  4WYY A;  3T4T A;  4HH3 A;  2WGW A;  3ZNT A;  5E2E A;  5HDD A;  5HDC A;  4UA9 A;  1BLP A;  1K25 A;  3WS5 A;  4S2I A;  1SKF A;  5HAI A;  2EFX A;  3B3X A;  3MFD A;  4LV2 A;  3IQA A;  1YMX A;  2B02 A;  3BLS A;  3MXR A;  3DBA A;  3TSG A;  1PNE A;  1K38 A;  1OPX A;  3LY4 A;  2A24 A;  2NUT C;  4R70 A;  1FR6 A;  3L9K A;  1ZHH B;  5E2H A;  5E2F A;  5DJU A;  1NZO A;  4S2P A;  3C7V A;  2BLS A;  5HAQ A;  2A2L A;  4F94 A;  3N4I A;  2MJ6 A;  1KDW A;  4JGQ A;  3PTE A;  4GJ4 A;  4KZ3 A;  5K5B A;  3M6H A;  3BWL A;  3C4O A;  3VFF A;  1ERO A;  2O9B A;  2IA2 A;  4OOL A;  2XRO A;  1PW1 A;  1VQQ A;  4JLF A;  2GZA A;  4JF5 A;  3ICY A;  4S2M A;  3UB5 P;  5AVE A;  1DJA A;  3CAX A;  3IXH A;  4XT2 B;  3LUQ A;  1OTE A;  1MWU A;  1MY8 A;  4JXV A;  5GLB A;  1P0Z A;  1XJ3 A;  3AGD A;  2J7V A;  5M1A A;  2VGK A;  5FI6 A;  4OLD A;  4DE2 A;  4DKI A;  4EBN A;  2DNS A;  4RVA A;  5TR7 A;  3UO9 A;  3I7J A;  1H5X A;  5CGW A;  4BWI A;  4K0W A;  4JKT A;  2I9V A;  2HPB A;  3NOU C;  3UE3 A;  3HLB A;  3HLC A;  4R0Q A;  1DP6 A;  3CI6 A;  2Y2P A;  2OAQ 1;  4MDZ A;  2GX5 A;  3BFE A;  2K2N A;  2QPN A;  1K56 D;  5GHX A;  2ZC7 A;  4O7D A;  1C3B A;  3SS5 A;  1Z6F A;  3UDF A;  3EGD C;  5HFO A;  1N9O A;  3QHY A;  4Y3I A;  4X25 A;  5GHZ A;  3HBR A;  1SZV A;  3HCY A;  4I38 A;  1SDN A;  4K08 A;  1H3Q A;  4N9L A;  5J8X A;  4HI4 A;  3A3D A;  3VMA A;  3TOI A;  3VOL A;  4OP5 A;  2QJ7 A;  4ETZ A;  1PIO A;  3P7N A;  1GHI A;  1YLP A;  1YLT A;  4LRX C;  2CC1 A;  1DJB A;  3CPT B;  4Y7P A;  4RYE A;  2ACG A;  2OV5 A;  3N7W A;  4Y2F A;  1MWT A;  2ZQD A;  3Q7V B;  4ID4 A;  3BJN A;  5FAT A;  5F1G A;  5FSR A;  1K6S A;  2Y2O A;  4NK3 A;  4JF4 A;  4Q0H A;  4CLC E;  1KE3 A;  5TBM B;  5CTM A;  3U2A A;  1VET B;  1TDG A;  3OPP A;  4GKU A;  2HDU A;  3BEB A;  4OQH A;  3KSH A;  1LL9 A;  1BUE A;  1T19 A;  4UEY A;  3BRM A;  1PZO A;  1F5M A;  4QJG A;  4RX2 A;  2L1M A;  5EE8 A;  1LHY A;  4X56 A;  2OLU A;  3ZDJ A;  4BD1 A;  1F98 A;  3PBN A;  1N4O A;  2P74 A;  2ZC5 B;  3UDX A;  1NY0 A;  3UB8 A;  3BLM A;  2Y2N A;  1XP4 A;  1YT4 A;  3BFF A;  5U47 A;  5FQJ A;  2J80 A;  5EEC A;  1CF0 A;  3FWL A;  2WKQ A;  1LL5 A;  1N9B A;  3NBL A;  1E3U A;  3RFB A;  4I3J A;  1NWZ A;  1XA1 A;  2V2F F;  3ZG8 B;  2V9A A;  4UQI S;  1FOF A;  3A0S A;  5EPH A;  4GDB A;  2W3E A;  4PPR A;  5FL3 A;  3H82 B;  1RGZ A;  4GW9 A;  5F69 A;  4LGW A;  3TE8 A;  5EUA A;  4QU3 A;  2YKH A;  1KDS A;  1S4S A;  1CQA A;  4F3L B;  2I72 A;  3V5M A;  4HBU A;  1XA7 A;  3LIA A;  3C8C A;  3BY9 A;  4DJ3 A;  2O9C A;  5GL9 A;  2WAE A;  3G31 A;  3D3O A;  4G3K A;  3UMD A;  4Y15 A;  1L2S A;  2EXB A;  1E3U D;  4JPM A;  5L8M A;  5HX9 A;  3UDI A;  4K0X A;  5MC7 A;  4MCW A;  1G28 A;  3BFC A;  4Q8I A;  1L0D A;  3OCL A;  1YAX A;  2XSS A;  3OCN A;  4R3A A;  5EV0 A;  1PRQ A;  2HV1 A;  1K0K A;  4MBH A;  2Y4A A;  2VGL S;  2ZM8 A;  5I94 A;  4HP9 A;  4U0X A;  1HZO A;  3DWK A;  3UPP A;  3MQ0 A;  4OP8 A;  5DKK A;  3F1N B;  3F1O B;  3LR5 A;  4N1H A;  1WA9 A;  5DJT A;  3V39 A;  3QP1 A;  3NHQ A;  3GTC A;  3MS6 A;  1X0O A;  2JBF A;  1ES2 A;  1T1B A;  3MZF A;  1XJ4 A;  4E3K A;  4Y0U A;  4ZJ1 A;  2BAS A;  3NOT C;  4ZJ2 A;  4JXW A;  2CMN A;  3IXB A;  1SKO B;  4BL2 A;  2PYP A;  1BLS A;  3C4P A;  3LIF A;  1BLC A;  4Q0I A;  1UGU A;  5DTS A;  2JKR I;  1I5Q A;  2GNX A;  2QHK A;  3R7W B;  1IYO A;  2HF6 A;  4HY8 A;  3TJZ C;  1TVF A;  3GR2 A;  4BJP A;  3F1P B;  5EM0 A;  3NDG A;  2XA7 M;  1FSY A;  4HOI A;  4NET A;  3OZH A;  4MBK A;  1ONH A;  4GD6 A;  4L9E A;  4OPR A;  1NYM A;  3GQZ A;  1XGJ A;  4FH2 A;  1PW8 A;  3EEA A;  4LEN A;  4YFM A;  3H7W B;  3P09 A;  4CLC B;  2INW A;  3PAE A;  4BEN A;  2KDK A;  5G4Y A;  5AQB A;  3Q81 A;  4S2J A;  3BFG A;  4FUW A;  3IF6 B;  1WE4 A;  5CHM A;  5DF9 A;  3LGO A;  1H8Y A;  4EEP A;  1LL8 A;  4IJG A;  2V8C A;  4ZAM A;  4R38 A;  5F68 A;  1NRJ A;  2PD8 A;  4UHU A;  2EFU A;  1I2S A;  1NJ4 A;  1H0M A;  3E98 A;  3ZCZ A;  5FDH A;  3NUL A;  3EEH A;  1L3L A;  1ES4 A;  1L0F A;  5KSC A;  1ZC2 A;  4BL3 A;  1YPR A;  3OC2 A;  2HP9 A;  1SHV A;  5EVI B;  3IHB A;  1I2W A;  4JGR A;  5AVF A;  2P9V B;  2YKF A;  3O3V A;  1FIL A;  5IS1 A;  5IT5 A;  3ZVW A;  3WS1 A;  1QMF A;  3VP1 A;  3DTE A;  2XK1 A;  4NXF A;  1S6R A;  1CEG A;  5HAP A;  4KUO A;  2XD5 A;  4X6T A;  5HSQ A;  1T1A A;  3HLD A;  3NIA A;  5GLD A;  2H28 A;  1T18 A;  4DF6 A;  1W8Q A;  4MN6 A;  2AVX A;  1RGY A;  2XEP A;  2HJ9 C;  3ITB A;  5AQ9 A;  3BQA A;  5HPI A;  4PM5 A;  4UA6 A;  1HLU P;  2Y2M A;  3T4O A; 
#chains in the Genus database with same CATH homology
 2V8F A;  2JKF A;  3L7H A;  4X1L A;  5FEG A;  3MSH A;  2HZ5 A;  4QWO A;  1AWI A;  3CHW P;  3UB5 P;  1VET B;  5FDS A;  3T1Q B;  3CPT A;  2BTF P;  5EV0 A;  4FUW A;  1PRQ A;  1K0K A;  3LGO A;  1CJF A;  3T1X A;  3KYE A;  5EVE A;  4FTX A;  2V8C A;  1G5U A;  1FIK A;  1VET A;  3T1R A;  4D60 A;  3NUL A;  1D1J A;  3MS6 A;  2B95 A;  3NEC A;  2PBD P;  3DAV A;  4X1M A;  1Y4O A;  1YPR A;  2ZL1 B;  1Z09 A;  1CF0 A;  5FEF A;  1FIL A;  2VK3 A;  1J3W A;  1A0K A;  1SKO B;  5EM1 A;  3LEQ A;  1PNE A;  3T12 B;  1ACF A;  2E8J A;  4X25 A;  2ZL1 A;  1SZV A;  3D9Y A;  2JKG A;  3L9K A;  1SKO A;  1PFL A;  5EM0 A;  3U4L P;  1CQA A;  2PAV P;  1VEU A;  4ESP A;  2PRF A;  3T1S A;  1VEU B;  1F2K A;  1HLU P;  3CPT B;  2ACG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...