5FDSA

Crystal structure of the monomeric allergen profilin (hev b 8)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
131
Chain Sequence
MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin-2
publication title Structural insights into the IgE mediated responses induced by the allergens Hev b 8 and Zea m 12 in their dimeric forms.
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Allergen
total genus 36
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 5fdsA00
3T1SA 1CJFA 1VEUB 4FTXA 3T1RA 1SKOA 1AWIA 3KYEA 1J3WA 2B95A 3L9KA 2BTFP 2HZ5A 3U4LP 2JKGA 3CPTB 2JKFA 1F2KA 1FILA 1CQAA 1SKOB 1ACFA 1FIKA 1PNEA 1PRQA 3UB5P 5FDSA 4ESPA 2PAVP 3DAVA 1A0KA 3CPTA 1CF0A 4X25A 3CHWP 1HLUP 1YPRA 3T12B 5FEFA 2PBDP 4QWOA 3MSHA 4X1MA 2VK3A 3NULA 1VETB 2PRFA 2V8CA 2ZL1A 4D60A 3LEQA 4FUWA 1G5UA 1Y4OA 2ZL1B 1VETA 1SZVA 3T1XA 2ACGA 3LGOA 3D9YA 4X1LA 3NECA 1K0KA 3MS6A 1PFLA 5FEGA 2V8FA 5EM0A 1VEUA 2E8JA 1D1JA 1Z09A 5EVEA 3T1QB 3L7HA 5EV0A 5EM1A
chains in the Genus database with same CATH superfamily
4OP8A 1Z6FA 4QU3A 1NZOA 2WK0A 4RQ9A 2VX8A 1G6AA 4EV4A 3U4LP 3IX8A 4R70A 1NRJA 3VOZA 1YQSA 5CTNA 5GLDA 2WKPA 2Q9NA 1I5QA 2OOLA 4CLCB 3LEZA 3MKEA 1DJCA 4NG2A 4JKTA 5I94A 1F5MA 3VFFA 5GL9A 4X25A 2LB5A 1LI0A 2QJ5A 3C38A 1U60A 3S22A 3AGEA 4WUJA 4RVAA 1YLZA 5EECA 3NULA 3UDFA 2Y55A 5M1AA 3TG9A 2V8CA 3UB6A 3FC7A 3S4XA 1FCNA 2Y2GA 4FSFA 3EOIA 4FUWA 3KYQA 4FCFA 1YLJA 5GLAA 1N9OA 3DTIA 1EI5A 4HH3A 1K0KA 3LR5A 3UE0A 4Y7PA 2RL3A 1VEUA 2E8IA 4WZ4A 3OBFA 4IBRA 2WGWA 4L9FA 3L7HA 5HARA 3G2ZA 4FD8A 3OOVA 1PW1A 1JWVA 4PM5A 4KZ4A 1SKOA 3C7UA 1AWIA 1YMXA 3CJMA 3L9KA 2BTFP 1K6RA 2XGNA 4XT2B 1G6OA 2KOIA 1I2SA 3H7WB 2XDMA 3TRCA 1S1ZA 4Y2FA 3WRZA 4KZ5A 1CEGA 4EUVA 3F1OA 4WBGA 2ZOHA 3A3IA 1CF0A 4HOIA 2PBYA 2Y2NA 4R38A 1SHVA 3O3VA 3ZG8B 1S0WA 2O9AA 4ZJ3A 4E3OA 3WS0A 3MXRA 4QPRA 3TJZC 2XA7M 4X1MA 2EFXA 3IX4A 3UB9A 3LIFA 3UN7A 2DNSA 2G2UA 2ZC7A 5HL6A 2XRNA 4NXBA 2O9CA 5IU1A 1MBLA 2A24A 2O0YA 5E2EA 3BFCA 3HBRA 4JF5A 4KUOA 2WZXA 2XF3A 1XXMA 3B33A 4NXEA 2QJ7A 1SZVA 3GSGA 1XX2A 3E4PA 1IYQA 1PI5A 4I5SA 1BTLA 4OPYA 5HL1A 3LIAA 5HSQA 3R7WB 2Q9MA 3B3XA 2UV0E 4O7DA 1GA0A 4OQ0A 4DDYA 4XUZA 2VV7A 5CGWA 3UPPA 3V3RA 3TSGA 2PD7A 3GQZA 4MMNA 4WELA 2V9AA 5FEGA 3IXDA 1KGFA 2Y2QA 5EVLA 3FPWA 4RYEA 4S2OA 5TR7A 4OONA 2E8JA 2XR0A 2O9BA 2HP5A 2XD1A 3AGFA 5EM1A 3ZYTA 4MCWA 2W3HA 2YKFA 4EWFA 5F5YA 2ZQCA 4ID4A 3HLGA 4U0TA 3E4QA 1VHMA 1OPXA 4UQIM 3V3SA 3CPTB 3QNCA 1X0OA 2PU2A 4BBTA 1GSXA 2C5WB 1GHMA 3WS5A 5IHVA 2FFFB 1IYOA 2VKSA 4N9LA 3G6OA 2B18A 4L9GA 3R4KA 4KG6A 4MLLA 4LCLA 1E3UA 4DE0A 4CLCA 4KENB 4G3VA 5L10A 1TD5A 5LBRA 4EEPA 5FEFA 4C75A 4CLCC 3MR0A 4QWOA 1W63Q 3AGDA 2H0YA 3LR3A 3DTKA 3FG8A 2XH9A 2V1AA 2VK3A 5M19A 1M6KA 4QY5A 2X71A 5FQ9A 3OPHA 4MN6A 2VGKA 5A91A 3PXPA 1K56D 1T1AA 3OPRA 3ZFZA 1GHIA 3SS3A 3GV9A 3LO7A 1S4SA 3BFFA 2ZD8A 4HP9A 3UPNA 4H8RA 3HJKA 2VGJA 2Y2KA 1LHYA 3GTCA 4PMAA 3PBRA 1PI4A 4HJ4A 3UO9A 4DDSA 1NJ4A 4DXBA 4GN2A 4XUXA 3M6HA 3S7QA 3T1QB 1G28A 2FZ0A 1E25A 2INWA 2EX2A 3ITBA 3UDIA 1FSYA 3M2JA 2PR6A 2JKRM 3BQ8A 1H8MA 2H10A 5EE8A 4B88A 3N8LA 3ZNYA 2C6WB 3FPVA 4HESA 3K2NA 3PAGA 3Q7ZA 4HH2A 4EBLA 1VM1A 1XPBA 2W1RA 1TS7A 4ESPA 4YINA 2PAVP 3H7WA 4UA9A 4E3LA 2OAQ1 1MWTA 3N8SA 4E3NA 3NCKA 1K38A 1YM1A 3S1YA 3SH9A 1XP4A 1F9IA 1O07A 5F6AA 4KG5A 3BFEA 4E6XA 3CI6A 4OLDA 2W1TB 3VP4A 3PBOA 2EFUA 2ZL1A 2FH5A 3LFVA 1YLWA 4E3MA 3D3OA 1TVFA 2XSSA 3NI9A 1CI8A 1ODVA 4B4ZA 1H8ZA 1K6SA 4P0MA 1BT5A 4HQAA 1P9WA 2VJWA 1SDNA 4OPZA 3IHAA 3LI9A 2UWXA 4OVDA 3O5YA 2QWSA 5G4ZA 1N4OA 2KLIA 3UPOA 4Q8IA 1D7EA 2XFSA 3GVBA 3NOUC 1H5XA 3R7WA 1T1CA 3HLCA 1ERQA 4UEYA 3LR0A 5EFWA 4MN7A 3T1SA 3G34A 5J4EA 1VEUB 4R3AA 4WN5A 1TEMA 3EGDC 3MQ0A 2HDQA 3MQQA 1OJ5A 3A3JA 3KYEA 3O86A 3B47A 3W8KA 5J7EA 3G35A 4I3AA 4QJGA 2WKRA 1SKOB 3S7NA 2HP9A 5FDSA 4JGQA 2G2WA 5D3OA 3ZDJA 4I3IA 3CPTA 1PWGA 2J9OA 3DTEA 4AFIA 4LV0A 4Y5FA 1FR1A 3VE3A 3VSLA 4X55A 3HREA 5L09A 3T50A 1TS6A 3GDIA 1DJBA 3IS2A 4GD8A 4NK3A 1L3LA 5U47A 2YKHA 3N4IA 2ZJ9A 3O87A 4WM9A 2R9XA 1XA1A 4WLAA 2QYBA 2BG1A 4JXGA 4OPQA 4Y17A 1RCJA 5HZHA 1MWRA 4ZTKA 4MBHA 3BY9A 5GHXA 3GECA 2Y2LA 5HAQA 2MJ6A 3CWFA 4WMCD 3QP1A 3D72A 2ACGA 1XGIA 5EVIB 2G7UA 1BUEA 2GDNA 3OCNA 4LCMA 5AJGA 4HI4A 4ZJ2A 5AQAA 3TW8A 1E4DA 2Z2MB 2QMIA 1OTDA 4BD0A 1FCOA 1S4RA 3BFDA 3UE3A 2ZM0A 3Q81A 1FOFA 4S2LA 3IWIA 2V1ZA 2J3TC 5HPFA 4LV1A 4DKIA 2OV5A 5A90A 1Q2PA 4UA6A 3RH8B 1S1YA 1LI9A 5G4YA 1NZUA 4DXCA 3Q07A 3ZG5A 3ZG0A 3UB5P 1GA9A 3W2ZA 1YKDA 3MFXA 3JYIA 4S2NA 4BBUA 4HEFA 4S2NC 2JE5A 2WYXA 3IXBA 4GHIB 1UGUA 3IF6B 4JGOA 1ONHA 2PRFA 3E2LA 4KZ6A 1XJ4A 3MXQA 3FV7A 4C3QA 5AVFA 2W1TA 3T4TA 2ZC6B 3GRJA 4DE3A 1TDLA 3QP4A 1GHPA 3LGOA 1MWSA 2W3FA 3F1PB 3D9YA 4GOGA 1C3BA 3UE1A 3TE8A 1IYPA 3IX3A 2DMWA 2ZC3B 3G30A 1MXOA 2Y2HA 1DY6A 4LGWA 5F82A 4ARZA 3P7NA 4GB7A 1IKIA 4BENA 3V5MA 3UDXA 4NXGA 2IWDA 3PBNA 4BD1A 3T4SA 1XJ2A 3MBZA 5CERA 5HPIA 1TS0A 2M1CA 3GR2A 3S7OA 4Q0IA 1I2WA 1ZHHB 1CI9A 5CRFA 4B4XA 4O0PA 4KZ7A 3ZGAB 1K25A 2HV1A 4JXVA 4YWZA 2J80A 4DE2A 1STZA 2ZMFA 1PYYA 4Y0UA 1DP8A 2ZMAA 1H8YA 3K3CA 1ZG6A 1DRMA 2ZC5B 4MEZA 4BQMA 4EUZA 3IWOA 3FZCA 3E4OA 5CHUA 2VEAA 2ZL1B 2XD5A 1GSWA 4Z9QA 3N7WA 3FWLA 4Y0OA 5E2GA 2FFYA 4WEJA 3RTYA 2ZLYA 5JYOA 3A3DA 2WGVA 4NXFA 2I9VA 1GCEA 3NOTC 3P09A 4M4XA 3SOIA 4KZ9A 2ZQ8A 5EVIA 3IF5A 2D01A 4U3TA 3LIDA 2P74A 1ALQA 4GKUA 1OMEA 4EBNA 5EVIC 5EV0A 3LIEA 4ZAMA 3ZG9B 5F68A 2P04A 1CJFA 3E0YA 5EPHA 2QZ6A 5KZHA 2EXAA 4HBUA 3LY4A 3IXHA 4PKYG 2PU4A 3C4OA 4IVIA 5KSCA 1EWZA 2L4RA 2PDRA 5HDDA 1F98A 3K3DA 2PR5A 4EU0A 3WS4A 3HVFA 3UMEA 2M7VA 3VOLA 1ZC2A 1NY0A 5FAPA 1W5DA 2IWCA 1YSPA 3NJAA 4P87A 5J8XA 1YPRA 4WL9A 5FL3A 3VE4A 5M18A 4JF6A 4HP4A 3NBLA 1RP5A 4E3IA 5CHMA 3G31A 3V39A 4LRZE 4FH2A 5L8MA 2Y59A 2JC7A 2ZC4B 3KSIA 1LL8A 3IS2B 4BWIA 1ZG4A 3KSGA 1FCMA 1W7FA 3WRTA 5HAPA 2CMNA 1UWPX 2BLSA 4GHIA 1NYYA 3HJIA 4WZ5A 3IF6A 4WZ5C 3IF6C 1Y54A 4I38A 1LL5A 2DRWA 1L0FA 3A3EA 4GZBA 3H82A 1MC0A 1XGJA 4CQHA 2WKHA 5F1FA 1XFNA 2V20A 4EQ1A 1XJ6A 4EW7A 3F1PA 1MKIA 4P85A 4YNRA 4IUKA 2RCXA 4EEUA 5FSRA 1NXYA 2HGVA 5MC7A 3NIAA 4HHDA 5FATA 4IJGA 4NEED 1RGYA 2LB9A 5TJJA 4IBXA 3JVVA 3G32A 3MQOA 4R1GA 1H3QA 1F2KA 5HAIA 1FR6A 1CQAA 2J8YA 2R9WA 4PKYA 1W8QA 3LYXA 3HLBA 5FQQA 3B42A 2A3UA 3MXSA 1FIKA 1L2SA 5FQKA 3QHYA 4R3JA 5I5LA 4XXRA 4QY6A 3NDGA 2HPBA 3MF0A 5TGFA 3UB8A 3ZVTA 3SH8A 4GJ4A 1JNUA 3MSHA 3CUEA 4DN0A 2Y8HA 1UWNX 4EBPA 3ZQ5A 3CUEC 3DWKA 3VV4A 3KO6A 3LY3A 4KZ8A 1M40A 4LENA 3NC8A 3UY6A 3ZNTA 3ICYA 3T4JA 4N1XA 1FSWA 1HD8A 3CITA 1OTEA 5FI6A 1L0DA 4Y3IA 2ZBBA 1Y4OA 5GLCA 1WA9A 1ESIA 4FOFA 4YFMA 3M6BA 1K57A 4M3KA 1K57C 4U0XA 4X69A 1W8YA 3N6IA 2XROA 1LSVA 3MS6A 4S2KA 5TBMA 4IUHA 4MN5A 1DJAA 3DW0A 4B93A 1D1JA 2W3DA 4WEKA 3ISGA 1NWZA 3C8CA 3BYDA 2PYPA 5F1GA 1N9NA 3Q7VA 3NOPC 2VV8A 4EQIA 3QP8A 1MPLA 2X02A 4ETXA 4ARZB 2HZ5A 3MMHA 4LLOB 1K55A 4ZDXA 2B5RA 3BY8A 2GNXA 4H6JA 1K55C 2JHEA 1ES3A 3OPLA 1HVBA 1PNEA 3N8RA 2Y4AA 2ZQAA 5CTMA 1ES5A 4K0WA 3SS5A 4S2MA 4GLQA 2J9PA 5GHZA 4O01A 4X68A 3UNWA 3LR4A 2I72A 2PD8A 5DKLA 3BQAA 3LIBA 2PYRA 2Y2PA 5KIZA 3C30A 2Y2OA 4Q0JA 1HTZA 4G3WA 3IBRA 3W4QA 2ZM2A 3BLMA 4LRXC 1VETB 4JLFA 3QP6A 1XA7A 5JYPA 4D60A 3G2YA 3U2AA 4ME4A 4ETZA 3ZHHA 3MKFA 1Y28A 3BM6A 4OKPA 3VOYA 3KX0X 1GSVA 4N9KA 5DTSA 1ZKJA 1K56A 4X6TA 4JPMA 3ZCZA 5KSHA 2Y2MA 2K2NA 2ZQ7A 4Q0HA 3WWXA 1YAXA 4OOMA 4E6WA 2V8FA 1IYSA 2OWHA 3I7JA 1YLPA 1AXBA 5CHJA 4PAUA 3VP3A 1YLTA 2JKTM 5DTKA 2XEPA 4I39A 4NKPA 3PHYA 3HLEA 2AVXA 2K7SA 2Y2JA 4DJ2A 3CLOA 2HJEA 4DE1A 2JKGA 1NLYA 2WUQA 3DWZA 2WKIA 3WS1A 1TF1A 2ZQDA 1MZUA 5L07A 3HLDA 3JPUA 2WKEA 3BFGA 2V1BA 1IOUA 1MWUA 1NYMA 2EWVA 3CHWP 3A0SA 1BSGA 2Y91A 1KDWA 1KE3A 1Q2QA 4JXSA 1LLBA 4LRYC 2R78A 1OT9A 4R23A 4S2IA 2D02A 4II7A 1XFQA 1ONGA 3E98A 1KGGA 4JGPA 5A8BA 3W4OA 4GDBA 1BLHA 3FKVA 4BMWA 2HP6A 3TOIA 1G5UA 3Q1FA 3BECA 5CEDA 3VP1A 2XQZA 3IT9A 4E3KA 4CJNA 4E04A 5E2FA 5DJUA 4F3LA 1LT0A 3EGXC 4OQGA 2ZOIA 3C7VA 1PFLA 3IH9A 4R4SA 4S2JA 1EW0A 5EM0A 3H82B 2OLUA 5EVEA 4HIAA 4F94A 3RJUA 2WKQA 1OTBA 2JKRI 2JCHA 2Z6DA 3G4PA 4RA7A 3T4LA 4K91A 2B95A 2EXBA 4CLCE 3HUNA 2EX9A 3A0VA 1XKZA 5IS1A 4MBKA 3HCYA 2JKFA 4IVKA 2P9VB 3VP2A 1VB6A 1E3UD 4CLCD 4HJ3A 1RGZA 2W27A 1S66L 4PM6A 3DAVA 1IKGA 3PAEA 4NETA 1KVLA 5CEBA 4UAAA 4QHCA 4MBFA 1DP6A 3WS2A 2B02A 5DKKA 4UHUA 2ZM8A 4OOLA 2DCFA 3F1NB 5EUAA 1MY8A 1BLSA 5L2FA 2IWBA 2QKPA 1FQGA 2L0WA 4PM7A 1OT6A 3DBAA 4KZAA 1VETA 2V0WA 3QP5A 3P98A 3PYPA 4X53A 3LUQA 1O7EA 2O99A 2EWWA 2IA2A 3KYZA 3D4FA 4X1LA 2WZZA 4ZJ1A 4ZBEA 4WMCA 1W79A 2PT7A 3C4PA 1OJGA 5FI2A 1IEMA 5AQBA 1OTAA 3Q82A 2J7VA 5TBMB 1ERMA 4MDZA 4K08A 4FTXA 3LICA 4B9OA 5KMWA 4HJ6A 3A3FA 5AVEA 2HJ9C 3OC2A 4JF4A 5DF7A 3EQUA 3T1RA 3PBTA 3CG5A 4P6BA 1KVMA 3PR6A 3HLWA 3ITAA 3Q7VB 2V2FF 5F83A 4HNBA 1WE4A 2A2LA 5BOHA 1FILA 3EEAA 5F69A 4IHQA 5HWTA 3QNBA 4JGRA 4KZ3A 5CGSA 4DMZA 4H6JB 5AQ9A 1CK3A 3ZG7B 4I3JA 2XA7S 4DF6A 2ZQ9A 3PBQA 4C6YA 1W63M 3PTEA 4EXOA 5FQMA 5DVAA 5FAOA 4OP5A 2PBDP 4L9EA 1LSXA 3RXWA 5DTTA 5K5BA 4R0QA 1IFQA 1PWDA 4X56A 3E2KA 5HDCA 3IHBA 3QP2A 1K4FA 3EWKA 4P6ZM 4UA7A 3UMDA 1YMSA 2GZAA 3FKWA 4A5RA 4KZBA 5A92A 4OPRA 2BASA 2JKTI 5FASA 5CX7A 4KG2A 3BJNA 3LI8A 3ZVWA 4Z1WA 2Y2IA 1QMEA 3PBSA 4G3KA 1JWPA 4P6ZS 1PW8A 4O8GA 5EOEA 5CXWA 4GCZA 4ZRRA 1N9LA 4PPRA 3BWLA 3C5AA 3C2WA 1XJ3A 4GNUA 3RFBA 4R3BA 1BULA 3UB7A 2OAP1 3HUMA 4GS9B 4UQIS 3MZEA 1L0EA 1YSQA 4E3JA 4KQDA 1V9YA 1J3WA 3IBJA 3T4KA 4S2PA 3BRMA 2OLVA 4JXWA 2QHKA 4MNRA 4OQHA 4BL2A 2EX8A 2VLGA 3ULFA 1PRQA 4Y15A 4IEDA 4OH0A 3MZFA 1YT4A 1T18A 2WGIA 1TDGA 2EX6A 3MJQA 4K0XA 4N92A 3NY4A 4YOFA 1JVJA 4N1HA 1HLUP 2P9VA 1NLZA 4EETB 1JWZA 1TS8A 1LSWA 3FYZA 3V50A 2ZMVA 2WADA 1QMFA 4KQRA 2L1MA 1H0MA 4OQIA 2NUTC 4OOYA 5DF8A 5G18A 1WYCA 2P08A 3BW6A 1HZOA 5HFOA 4D2OA 3SS4A 3LEQA 1P0ZA 3VP0A 4JBFA 1T1BA 3OLOA 3F1NA 4QB8A 1JTGA 3LCEA 4EESA 3T1XA 5HWVA 1NRFA 4HY8A 1K54A 4DRTA 3NECA 1J9MA 3DTMA 1SKFA 4CPKA 1K54C 4LPZA 1P97A 2GX5A 2J3TD 2VZWA 3EEHA 1N9BA 5HD3A 1Z09A 5FDHA 4F3LB 3NHQA 2WAFA 5AQ7A 4RX2A 5HD5A 2CC1A 2Z6CA 2W3GA 4WF0A 4LV3A 4GW9A 4XT2A 3SH7A 3VMAA 1VQQA 2OWJA 4R6LA 1IELA 2K31A 3CAXA 3KSFA 3VSKA 3OCLA 4HBTA 1DP9A 3HUOA 3JVUA 5DJTA 1V9ZA 2JN7A 1ACFA 3O88A 1JTDA 5TFQA 5FA7A 2NUPC 2WAEA 1PZPA 1SDEA 1ES2A 4PHTA 4BBVA 1WYBA 2GJ3A 5A93A 3SZTA 2Y79A 3BEBA 1OTIA 2HDSA 3IWQA 1ESUA 2W3EA 2HF6A 4WYYA 5DFYA 5CECA 4LFUA 3BLSA 2A49A 1KE0A 2HDUA 2M7UA 4L0LA 4OLGA 2H5SA 4RX3A 1KDSA 3IXGA 3RXXA 3KSHA 3HLFA 1MKMA 4GD6A 4GDNA 1L0GA 3CMZA 3OPPA 2HDRA 2XLNA 2X01A 5GHYA 3UE6A 5DF9A 2WGWB 4KQOA 5HX9A 5E43A 1CEFA 5J3WA 2Q0OA 2EA9A 3IH8A 1PIOA 2VA0A 5CGXA 5FAQA 2H0TA 4FH4A 2XFTA 1KOUA 1PZOA 2KDKA 4PM9A 3CZDA 3W4PA 1SCWA 5E2HA 1BZAA 5DFXA 4DJ3A 5HDSA 1BLCA 3V67A 3IQAA 1ES4A 3F1OB 4EERA 3H9WA 1K4EA 5FQJA 3A0RA 4GS9A 5HW3A 1LL9A 4BJPA 1P9RA 2V0UA 5EOOA 1YLYA 1A0KA 3MZDA 2H28A 5FI7A 3T12B 1G68A 3EQVA 3MFDA 1KE4A 2A24B 2P7JA 3GMWA 4QD4A 2VGLM 4Y13A 3M2KA 1BLPA 1BYWA 1D06A 3T4QA 5HWWA 4BL3A 1T19A 4R4RA 2J3WA 1EROA 2OSUA 3T4OA 2XK1A 2VV6A 2VGLS 3VFHA 4KUKA 4KQQA 3HL9A 1PWCA 3P01A 3OZHA 5C5KA 4BLMA 2KX6A 1ZTUA 4Y0TA 2JBFA 4PM8A 5EVID 2Z2LB 2PHYA 3NDEA 5GLBA 3SW1A 1S6RA 5IT5A 5FQIA 1S67L 2W0NA 4LV2A 1KGEA 2QPNA 3S7PA
chains in the Genus database with same CATH topology
3T1SA 1CJFA 1VEUB 4FTXA 3T1RA 1SKOA 1AWIA 3KYEA 1J3WA 2B95A 3L9KA 2BTFP 2HZ5A 3U4LP 2JKGA 3CPTB 2JKFA 1F2KA 1FILA 1CQAA 1SKOB 1ACFA 1FIKA 1PNEA 1PRQA 3UB5P 5FDSA 4ESPA 2PAVP 3DAVA 1A0KA 3CPTA 1CF0A 4X25A 3CHWP 1HLUP 1YPRA 3T12B 5FEFA 2PBDP 4QWOA 3MSHA 4X1MA 2VK3A 3NULA 1VETB 2PRFA 2V8CA 2ZL1A 4D60A 3LEQA 4FUWA 1G5UA 1Y4OA 2ZL1B 1VETA 1SZVA 3T1XA 2ACGA 3LGOA 3D9YA 4X1LA 3NECA 1K0KA 3MS6A 1PFLA 5FEGA 2V8FA 5EM0A 1VEUA 2E8JA 1D1JA 1Z09A 5EVEA 3T1QB 3L7HA 5EV0A 5EM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1S A;  1CJF A;  1VEU B;  4FTX A;  3T1R A;  1SKO A;  1AWI A;  3KYE A;  1J3W A;  2B95 A;  3L9K A;  2BTF P;  2HZ5 A;  3U4L P;  2JKG A;  3CPT B;  2JKF A;  1F2K A;  1FIL A;  1CQA A;  1SKO B;  1ACF A;  1FIK A;  1PNE A;  1PRQ A;  3UB5 P;  5FDS A;  4ESP A;  2PAV P;  3DAV A;  1A0K A;  3CPT A;  1CF0 A;  4X25 A;  3CHW P;  1HLU P;  1YPR A;  3T12 B;  5FEF A;  2PBD P;  4QWO A;  3MSH A;  4X1M A;  2VK3 A;  3NUL A;  1VET B;  2PRF A;  2V8C A;  2ZL1 A;  4D60 A;  3LEQ A;  4FUW A;  1G5U A;  1Y4O A;  2ZL1 B;  1VET A;  1SZV A;  3T1X A;  2ACG A;  3LGO A;  3D9Y A;  4X1L A;  3NEC A;  1K0K A;  3MS6 A;  1PFL A;  5FEG A;  2V8F A;  5EM0 A;  1VEU A;  2E8J A;  1D1J A;  1Z09 A;  5EVE A;  3T1Q B;  3L7H A;  5EV0 A;  5EM1 A; 
#chains in the Genus database with same CATH topology
 4OP8 A;  1Z6F A;  4QU3 A;  1NZO A;  2WK0 A;  4RQ9 A;  2VX8 A;  1G6A A;  4EV4 A;  3U4L P;  3IX8 A;  4R70 A;  1NRJ A;  3VOZ A;  1YQS A;  5CTN A;  5GLD A;  2WKP A;  2Q9N A;  1I5Q A;  2OOL A;  4CLC B;  3LEZ A;  3MKE A;  1DJC A;  4NG2 A;  4JKT A;  5I94 A;  1F5M A;  3VFF A;  5GL9 A;  4X25 A;  2LB5 A;  1LI0 A;  2QJ5 A;  3C38 A;  1U60 A;  3S22 A;  3AGE A;  4WUJ A;  4RVA A;  1YLZ A;  5EEC A;  3NUL A;  3UDF A;  2Y55 A;  5M1A A;  3TG9 A;  2V8C A;  3UB6 A;  3FC7 A;  3S4X A;  1FCN A;  2Y2G A;  4FSF A;  3EOI A;  4FUW A;  3KYQ A;  4FCF A;  1YLJ A;  5GLA A;  1N9O A;  3DTI A;  1EI5 A;  4HH3 A;  1K0K A;  3LR5 A;  3UE0 A;  4Y7P A;  2RL3 A;  1VEU A;  2E8I A;  4WZ4 A;  3OBF A;  4IBR A;  2WGW A;  4L9F A;  3L7H A;  5HAR A;  3G2Z A;  4FD8 A;  3OOV A;  1PW1 A;  1JWV A;  4PM5 A;  4KZ4 A;  1SKO A;  3C7U A;  1AWI A;  1YMX A;  3CJM A;  3L9K A;  2BTF P;  1K6R A;  2XGN A;  4XT2 B;  1G6O A;  2KOI A;  1I2S A;  3H7W B;  2XDM A;  3TRC A;  1S1Z A;  4Y2F A;  3WRZ A;  4KZ5 A;  1CEG A;  4EUV A;  3F1O A;  4WBG A;  2ZOH A;  3A3I A;  1CF0 A;  4HOI A;  2PBY A;  2Y2N A;  4R38 A;  1SHV A;  3O3V A;  3ZG8 B;  1S0W A;  2O9A A;  4ZJ3 A;  4E3O A;  3WS0 A;  3MXR A;  4QPR A;  3TJZ C;  2XA7 M;  4X1M A;  2EFX A;  3IX4 A;  3UB9 A;  3LIF A;  3UN7 A;  2DNS A;  2G2U A;  2ZC7 A;  5HL6 A;  2XRN A;  4NXB A;  2O9C A;  5IU1 A;  1MBL A;  2A24 A;  2O0Y A;  5E2E A;  3BFC A;  3HBR A;  4JF5 A;  4KUO A;  2WZX A;  2XF3 A;  1XXM A;  3B33 A;  4NXE A;  2QJ7 A;  1SZV A;  3GSG A;  1XX2 A;  3E4P A;  1IYQ A;  1PI5 A;  4I5S A;  1BTL A;  4OPY A;  5HL1 A;  3LIA A;  5HSQ A;  3R7W B;  2Q9M A;  3B3X A;  2UV0 E;  4O7D A;  1GA0 A;  4OQ0 A;  4DDY A;  4XUZ A;  2VV7 A;  5CGW A;  3UPP A;  3V3R A;  3TSG A;  2PD7 A;  3GQZ A;  4MMN A;  4WEL A;  2V9A A;  5FEG A;  3IXD A;  1KGF A;  2Y2Q A;  5EVL A;  3FPW A;  4RYE A;  4S2O A;  5TR7 A;  4OON A;  2E8J A;  2XR0 A;  2O9B A;  2HP5 A;  2XD1 A;  3AGF A;  5EM1 A;  3ZYT A;  4MCW A;  2W3H A;  2YKF A;  4EWF A;  5F5Y A;  2ZQC A;  4ID4 A;  3HLG A;  4U0T A;  3E4Q A;  1VHM A;  1OPX A;  4UQI M;  3V3S A;  3CPT B;  3QNC A;  1X0O A;  2PU2 A;  4BBT A;  1GSX A;  2C5W B;  1GHM A;  3WS5 A;  5IHV A;  2FFF B;  1IYO A;  2VKS A;  4N9L A;  3G6O A;  2B18 A;  4L9G A;  3R4K A;  4KG6 A;  4MLL A;  4LCL A;  1E3U A;  4DE0 A;  4CLC A;  4KEN B;  4G3V A;  5L10 A;  1TD5 A;  5LBR A;  4EEP A;  5FEF A;  4C75 A;  4CLC C;  3MR0 A;  4QWO A;  1W63 Q;  3AGD A;  2H0Y A;  3LR3 A;  3DTK A;  3FG8 A;  2XH9 A;  2V1A A;  2VK3 A;  5M19 A;  1M6K A;  4QY5 A;  2X71 A;  5FQ9 A;  3OPH A;  4MN6 A;  2VGK A;  5A91 A;  3PXP A;  1K56 D;  1T1A A;  3OPR A;  3ZFZ A;  1GHI A;  3SS3 A;  3GV9 A;  3LO7 A;  1S4S A;  3BFF A;  2ZD8 A;  4HP9 A;  3UPN A;  4H8R A;  3HJK A;  2VGJ A;  2Y2K A;  1LHY A;  3GTC A;  4PMA A;  3PBR A;  1PI4 A;  4HJ4 A;  3UO9 A;  4DDS A;  1NJ4 A;  4DXB A;  4GN2 A;  4XUX A;  3M6H A;  3S7Q A;  3T1Q B;  1G28 A;  2FZ0 A;  1E25 A;  2INW A;  2EX2 A;  3ITB A;  3UDI A;  1FSY A;  3M2J A;  2PR6 A;  2JKR M;  3BQ8 A;  1H8M A;  2H10 A;  5EE8 A;  4B88 A;  3N8L A;  3ZNY A;  2C6W B;  3FPV A;  4HES A;  3K2N A;  3PAG A;  3Q7Z A;  4HH2 A;  4EBL A;  1VM1 A;  1XPB A;  2W1R A;  1TS7 A;  4ESP A;  4YIN A;  2PAV P;  3H7W A;  4UA9 A;  4E3L A;  2OAQ 1;  1MWT A;  3N8S A;  4E3N A;  3NCK A;  1K38 A;  1YM1 A;  3S1Y A;  3SH9 A;  1XP4 A;  1F9I A;  1O07 A;  5F6A A;  4KG5 A;  3BFE A;  4E6X A;  3CI6 A;  4OLD A;  2W1T B;  3VP4 A;  3PBO A;  2EFU A;  2ZL1 A;  2FH5 A;  3LFV A;  1YLW A;  4E3M A;  3D3O A;  1TVF A;  2XSS A;  3NI9 A;  1CI8 A;  1ODV A;  4B4Z A;  1H8Z A;  1K6S A;  4P0M A;  1BT5 A;  4HQA A;  1P9W A;  2VJW A;  1SDN A;  4OPZ A;  3IHA A;  3LI9 A;  2UWX A;  4OVD A;  3O5Y A;  2QWS A;  5G4Z A;  1N4O A;  2KLI A;  3UPO A;  4Q8I A;  1D7E A;  2XFS A;  3GVB A;  3NOU C;  1H5X A;  3R7W A;  1T1C A;  3HLC A;  1ERQ A;  4UEY A;  3LR0 A;  5EFW A;  4MN7 A;  3T1S A;  3G34 A;  5J4E A;  1VEU B;  4R3A A;  4WN5 A;  1TEM A;  3EGD C;  3MQ0 A;  2HDQ A;  3MQQ A;  1OJ5 A;  3A3J A;  3KYE A;  3O86 A;  3B47 A;  3W8K A;  5J7E A;  3G35 A;  4I3A A;  4QJG A;  2WKR A;  1SKO B;  3S7N A;  2HP9 A;  5FDS A;  4JGQ A;  2G2W A;  5D3O A;  3ZDJ A;  4I3I A;  3CPT A;  1PWG A;  2J9O A;  3DTE A;  4AFI A;  4LV0 A;  4Y5F A;  1FR1 A;  3VE3 A;  3VSL A;  4X55 A;  3HRE A;  5L09 A;  3T50 A;  1TS6 A;  3GDI A;  1DJB A;  3IS2 A;  4GD8 A;  4NK3 A;  1L3L A;  5U47 A;  2YKH A;  3N4I A;  2ZJ9 A;  3O87 A;  4WM9 A;  2R9X A;  1XA1 A;  4WLA A;  2QYB A;  2BG1 A;  4JXG A;  4OPQ A;  4Y17 A;  1RCJ A;  5HZH A;  1MWR A;  4ZTK A;  4MBH A;  3BY9 A;  5GHX A;  3GEC A;  2Y2L A;  5HAQ A;  2MJ6 A;  3CWF A;  4WMC D;  3QP1 A;  3D72 A;  2ACG A;  1XGI A;  5EVI B;  2G7U A;  1BUE A;  2GDN A;  3OCN A;  4LCM A;  5AJG A;  4HI4 A;  4ZJ2 A;  5AQA A;  3TW8 A;  1E4D A;  2Z2M B;  2QMI A;  1OTD A;  4BD0 A;  1FCO A;  1S4R A;  3BFD A;  3UE3 A;  2ZM0 A;  3Q81 A;  1FOF A;  4S2L A;  3IWI A;  2V1Z A;  2J3T C;  5HPF A;  4LV1 A;  4DKI A;  2OV5 A;  5A90 A;  1Q2P A;  4UA6 A;  3RH8 B;  1S1Y A;  1LI9 A;  5G4Y A;  1NZU A;  4DXC A;  3Q07 A;  3ZG5 A;  3ZG0 A;  3UB5 P;  1GA9 A;  3W2Z A;  1YKD A;  3MFX A;  3JYI A;  4S2N A;  4BBU A;  4HEF A;  4S2N C;  2JE5 A;  2WYX A;  3IXB A;  4GHI B;  1UGU A;  3IF6 B;  4JGO A;  1ONH A;  2PRF A;  3E2L A;  4KZ6 A;  1XJ4 A;  3MXQ A;  3FV7 A;  4C3Q A;  5AVF A;  2W1T A;  3T4T A;  2ZC6 B;  3GRJ A;  4DE3 A;  1TDL A;  3QP4 A;  1GHP A;  3LGO A;  1MWS A;  2W3F A;  3F1P B;  3D9Y A;  4GOG A;  1C3B A;  3UE1 A;  3TE8 A;  1IYP A;  3IX3 A;  2DMW A;  2ZC3 B;  3G30 A;  1MXO A;  2Y2H A;  1DY6 A;  4LGW A;  5F82 A;  4ARZ A;  3P7N A;  4GB7 A;  1IKI A;  4BEN A;  3V5M A;  3UDX A;  4NXG A;  2IWD A;  3PBN A;  4BD1 A;  3T4S A;  1XJ2 A;  3MBZ A;  5CER A;  5HPI A;  1TS0 A;  2M1C A;  3GR2 A;  3S7O A;  4Q0I A;  1I2W A;  1ZHH B;  1CI9 A;  5CRF A;  4B4X A;  4O0P A;  4KZ7 A;  3ZGA B;  1K25 A;  2HV1 A;  4JXV A;  4YWZ A;  2J80 A;  4DE2 A;  1STZ A;  2ZMF A;  1PYY A;  4Y0U A;  1DP8 A;  2ZMA A;  1H8Y A;  3K3C A;  1ZG6 A;  1DRM A;  2ZC5 B;  4MEZ A;  4BQM A;  4EUZ A;  3IWO A;  3FZC A;  3E4O A;  5CHU A;  2VEA A;  2ZL1 B;  2XD5 A;  1GSW A;  4Z9Q A;  3N7W A;  3FWL A;  4Y0O A;  5E2G A;  2FFY A;  4WEJ A;  3RTY A;  2ZLY A;  5JYO A;  3A3D A;  2WGV A;  4NXF A;  2I9V A;  1GCE A;  3NOT C;  3P09 A;  4M4X A;  3SOI A;  4KZ9 A;  2ZQ8 A;  5EVI A;  3IF5 A;  2D01 A;  4U3T A;  3LID A;  2P74 A;  1ALQ A;  4GKU A;  1OME A;  4EBN A;  5EVI C;  5EV0 A;  3LIE A;  4ZAM A;  3ZG9 B;  5F68 A;  2P04 A;  1CJF A;  3E0Y A;  5EPH A;  2QZ6 A;  5KZH A;  2EXA A;  4HBU A;  3LY4 A;  3IXH A;  4PKY G;  2PU4 A;  3C4O A;  4IVI A;  5KSC A;  1EWZ A;  2L4R A;  2PDR A;  5HDD A;  1F98 A;  3K3D A;  2PR5 A;  4EU0 A;  3WS4 A;  3HVF A;  3UME A;  2M7V A;  3VOL A;  1ZC2 A;  1NY0 A;  5FAP A;  1W5D A;  2IWC A;  1YSP A;  3NJA A;  4P87 A;  5J8X A;  1YPR A;  4WL9 A;  5FL3 A;  3VE4 A;  5M18 A;  4JF6 A;  4HP4 A;  3NBL A;  1RP5 A;  4E3I A;  5CHM A;  3G31 A;  3V39 A;  4LRZ E;  4FH2 A;  5L8M A;  2Y59 A;  2JC7 A;  2ZC4 B;  3KSI A;  1LL8 A;  3IS2 B;  4BWI A;  1ZG4 A;  3KSG A;  1FCM A;  1W7F A;  3WRT A;  5HAP A;  2CMN A;  1UWP X;  2BLS A;  4GHI A;  1NYY A;  3HJI A;  4WZ5 A;  3IF6 A;  4WZ5 C;  3IF6 C;  1Y54 A;  4I38 A;  1LL5 A;  2DRW A;  1L0F A;  3A3E A;  4GZB A;  3H82 A;  1MC0 A;  1XGJ A;  4CQH A;  2WKH A;  5F1F A;  1XFN A;  2V20 A;  4EQ1 A;  1XJ6 A;  4EW7 A;  3F1P A;  1MKI A;  4P85 A;  4YNR A;  4IUK A;  2RCX A;  4EEU A;  5FSR A;  1NXY A;  2HGV A;  5MC7 A;  3NIA A;  4HHD A;  5FAT A;  4IJG A;  4NEE D;  1RGY A;  2LB9 A;  5TJJ A;  4IBX A;  3JVV A;  3G32 A;  3MQO A;  4R1G A;  1H3Q A;  1F2K A;  5HAI A;  1FR6 A;  1CQA A;  2J8Y A;  2R9W A;  4PKY A;  1W8Q A;  3LYX A;  3HLB A;  5FQQ A;  3B42 A;  2A3U A;  3MXS A;  1FIK A;  1L2S A;  5FQK A;  3QHY A;  4R3J A;  5I5L A;  4XXR A;  4QY6 A;  3NDG A;  2HPB A;  3MF0 A;  5TGF A;  3UB8 A;  3ZVT A;  3SH8 A;  4GJ4 A;  1JNU A;  3MSH A;  3CUE A;  4DN0 A;  2Y8H A;  1UWN X;  4EBP A;  3ZQ5 A;  3CUE C;  3DWK A;  3VV4 A;  3KO6 A;  3LY3 A;  4KZ8 A;  1M40 A;  4LEN A;  3NC8 A;  3UY6 A;  3ZNT A;  3ICY A;  3T4J A;  4N1X A;  1FSW A;  1HD8 A;  3CIT A;  1OTE A;  5FI6 A;  1L0D A;  4Y3I A;  2ZBB A;  1Y4O A;  5GLC A;  1WA9 A;  1ESI A;  4FOF A;  4YFM A;  3M6B A;  1K57 A;  4M3K A;  1K57 C;  4U0X A;  4X69 A;  1W8Y A;  3N6I A;  2XRO A;  1LSV A;  3MS6 A;  4S2K A;  5TBM A;  4IUH A;  4MN5 A;  1DJA A;  3DW0 A;  4B93 A;  1D1J A;  2W3D A;  4WEK A;  3ISG A;  1NWZ A;  3C8C A;  3BYD A;  2PYP A;  5F1G A;  1N9N A;  3Q7V A;  3NOP C;  2VV8 A;  4EQI A;  3QP8 A;  1MPL A;  2X02 A;  4ETX A;  4ARZ B;  2HZ5 A;  3MMH A;  4LLO B;  1K55 A;  4ZDX A;  2B5R A;  3BY8 A;  2GNX A;  4H6J A;  1K55 C;  2JHE A;  1ES3 A;  3OPL A;  1HVB A;  1PNE A;  3N8R A;  2Y4A A;  2ZQA A;  5CTM A;  1ES5 A;  4K0W A;  3SS5 A;  4S2M A;  4GLQ A;  2J9P A;  5GHZ A;  4O01 A;  4X68 A;  3UNW A;  3LR4 A;  2I72 A;  2PD8 A;  5DKL A;  3BQA A;  3LIB A;  2PYR A;  2Y2P A;  5KIZ A;  3C30 A;  2Y2O A;  4Q0J A;  1HTZ A;  4G3W A;  3IBR A;  3W4Q A;  2ZM2 A;  3BLM A;  4LRX C;  1VET B;  4JLF A;  3QP6 A;  1XA7 A;  5JYP A;  4D60 A;  3G2Y A;  3U2A A;  4ME4 A;  4ETZ A;  3ZHH A;  3MKF A;  1Y28 A;  3BM6 A;  4OKP A;  3VOY A;  3KX0 X;  1GSV A;  4N9K A;  5DTS A;  1ZKJ A;  1K56 A;  4X6T A;  4JPM A;  3ZCZ A;  5KSH A;  2Y2M A;  2K2N A;  2ZQ7 A;  4Q0H A;  3WWX A;  1YAX A;  4OOM A;  4E6W A;  2V8F A;  1IYS A;  2OWH A;  3I7J A;  1YLP A;  1AXB A;  5CHJ A;  4PAU A;  3VP3 A;  1YLT A;  2JKT M;  5DTK A;  2XEP A;  4I39 A;  4NKP A;  3PHY A;  3HLE A;  2AVX A;  2K7S A;  2Y2J A;  4DJ2 A;  3CLO A;  2HJE A;  4DE1 A;  2JKG A;  1NLY A;  2WUQ A;  3DWZ A;  2WKI A;  3WS1 A;  1TF1 A;  2ZQD A;  1MZU A;  5L07 A;  3HLD A;  3JPU A;  2WKE A;  3BFG A;  2V1B A;  1IOU A;  1MWU A;  1NYM A;  2EWV A;  3CHW P;  3A0S A;  1BSG A;  2Y91 A;  1KDW A;  1KE3 A;  1Q2Q A;  4JXS A;  1LLB A;  4LRY C;  2R78 A;  1OT9 A;  4R23 A;  4S2I A;  2D02 A;  4II7 A;  1XFQ A;  1ONG A;  3E98 A;  1KGG A;  4JGP A;  5A8B A;  3W4O A;  4GDB A;  1BLH A;  3FKV A;  4BMW A;  2HP6 A;  3TOI A;  1G5U A;  3Q1F A;  3BEC A;  5CED A;  3VP1 A;  2XQZ A;  3IT9 A;  4E3K A;  4CJN A;  4E04 A;  5E2F A;  5DJU A;  4F3L A;  1LT0 A;  3EGX C;  4OQG A;  2ZOI A;  3C7V A;  1PFL A;  3IH9 A;  4R4S A;  4S2J A;  1EW0 A;  5EM0 A;  3H82 B;  2OLU A;  5EVE A;  4HIA A;  4F94 A;  3RJU A;  2WKQ A;  1OTB A;  2JKR I;  2JCH A;  2Z6D A;  3G4P A;  4RA7 A;  3T4L A;  4K91 A;  2B95 A;  2EXB A;  4CLC E;  3HUN A;  2EX9 A;  3A0V A;  1XKZ A;  5IS1 A;  4MBK A;  3HCY A;  2JKF A;  4IVK A;  2P9V B;  3VP2 A;  1VB6 A;  1E3U D;  4CLC D;  4HJ3 A;  1RGZ A;  2W27 A;  1S66 L;  4PM6 A;  3DAV A;  1IKG A;  3PAE A;  4NET A;  1KVL A;  5CEB A;  4UAA A;  4QHC A;  4MBF A;  1DP6 A;  3WS2 A;  2B02 A;  5DKK A;  4UHU A;  2ZM8 A;  4OOL A;  2DCF A;  3F1N B;  5EUA A;  1MY8 A;  1BLS A;  5L2F A;  2IWB A;  2QKP A;  1FQG A;  2L0W A;  4PM7 A;  1OT6 A;  3DBA A;  4KZA A;  1VET A;  2V0W A;  3QP5 A;  3P98 A;  3PYP A;  4X53 A;  3LUQ A;  1O7E A;  2O99 A;  2EWW A;  2IA2 A;  3KYZ A;  3D4F A;  4X1L A;  2WZZ A;  4ZJ1 A;  4ZBE A;  4WMC A;  1W79 A;  2PT7 A;  3C4P A;  1OJG A;  5FI2 A;  1IEM A;  5AQB A;  1OTA A;  3Q82 A;  2J7V A;  5TBM B;  1ERM A;  4MDZ A;  4K08 A;  4FTX A;  3LIC A;  4B9O A;  5KMW A;  4HJ6 A;  3A3F A;  5AVE A;  2HJ9 C;  3OC2 A;  4JF4 A;  5DF7 A;  3EQU A;  3T1R A;  3PBT A;  3CG5 A;  4P6B A;  1KVM A;  3PR6 A;  3HLW A;  3ITA A;  3Q7V B;  2V2F F;  5F83 A;  4HNB A;  1WE4 A;  2A2L A;  5BOH A;  1FIL A;  3EEA A;  5F69 A;  4IHQ A;  5HWT A;  3QNB A;  4JGR A;  4KZ3 A;  5CGS A;  4DMZ A;  4H6J B;  5AQ9 A;  1CK3 A;  3ZG7 B;  4I3J A;  2XA7 S;  4DF6 A;  2ZQ9 A;  3PBQ A;  4C6Y A;  1W63 M;  3PTE A;  4EXO A;  5FQM A;  5DVA A;  5FAO A;  4OP5 A;  2PBD P;  4L9E A;  1LSX A;  3RXW A;  5DTT A;  5K5B A;  4R0Q A;  1IFQ A;  1PWD A;  4X56 A;  3E2K A;  5HDC A;  3IHB A;  3QP2 A;  1K4F A;  3EWK A;  4P6Z M;  4UA7 A;  3UMD A;  1YMS A;  2GZA A;  3FKW A;  4A5R A;  4KZB A;  5A92 A;  4OPR A;  2BAS A;  2JKT I;  5FAS A;  5CX7 A;  4KG2 A;  3BJN A;  3LI8 A;  3ZVW A;  4Z1W A;  2Y2I A;  1QME A;  3PBS A;  4G3K A;  1JWP A;  4P6Z S;  1PW8 A;  4O8G A;  5EOE A;  5CXW A;  4GCZ A;  4ZRR A;  1N9L A;  4PPR A;  3BWL A;  3C5A A;  3C2W A;  1XJ3 A;  4GNU A;  3RFB A;  4R3B A;  1BUL A;  3UB7 A;  2OAP 1;  3HUM A;  4GS9 B;  4UQI S;  3MZE A;  1L0E A;  1YSQ A;  4E3J A;  4KQD A;  1V9Y A;  1J3W A;  3IBJ A;  3T4K A;  4S2P A;  3BRM A;  2OLV A;  4JXW A;  2QHK A;  4MNR A;  4OQH A;  4BL2 A;  2EX8 A;  2VLG A;  3ULF A;  1PRQ A;  4Y15 A;  4IED A;  4OH0 A;  3MZF A;  1YT4 A;  1T18 A;  2WGI A;  1TDG A;  2EX6 A;  3MJQ A;  4K0X A;  4N92 A;  3NY4 A;  4YOF A;  1JVJ A;  4N1H A;  1HLU P;  2P9V A;  1NLZ A;  4EET B;  1JWZ A;  1TS8 A;  1LSW A;  3FYZ A;  3V50 A;  2ZMV A;  2WAD A;  1QMF A;  4KQR A;  2L1M A;  1H0M A;  4OQI A;  2NUT C;  4OOY A;  5DF8 A;  5G18 A;  1WYC A;  2P08 A;  3BW6 A;  1HZO A;  5HFO A;  4D2O A;  3SS4 A;  3LEQ A;  1P0Z A;  3VP0 A;  4JBF A;  1T1B A;  3OLO A;  3F1N A;  4QB8 A;  1JTG A;  3LCE A;  4EES A;  3T1X A;  5HWV A;  1NRF A;  4HY8 A;  1K54 A;  4DRT A;  3NEC A;  1J9M A;  3DTM A;  1SKF A;  4CPK A;  1K54 C;  4LPZ A;  1P97 A;  2GX5 A;  2J3T D;  2VZW A;  3EEH A;  1N9B A;  5HD3 A;  1Z09 A;  5FDH A;  4F3L B;  3NHQ A;  2WAF A;  5AQ7 A;  4RX2 A;  5HD5 A;  2CC1 A;  2Z6C A;  2W3G A;  4WF0 A;  4LV3 A;  4GW9 A;  4XT2 A;  3SH7 A;  3VMA A;  1VQQ A;  2OWJ A;  4R6L A;  1IEL A;  2K31 A;  3CAX A;  3KSF A;  3VSK A;  3OCL A;  4HBT A;  1DP9 A;  3HUO A;  3JVU A;  5DJT A;  1V9Z A;  2JN7 A;  1ACF A;  3O88 A;  1JTD A;  5TFQ A;  5FA7 A;  2NUP C;  2WAE A;  1PZP A;  1SDE A;  1ES2 A;  4PHT A;  4BBV A;  1WYB A;  2GJ3 A;  5A93 A;  3SZT A;  2Y79 A;  3BEB A;  1OTI A;  2HDS A;  3IWQ A;  1ESU A;  2W3E A;  2HF6 A;  4WYY A;  5DFY A;  5CEC A;  4LFU A;  3BLS A;  2A49 A;  1KE0 A;  2HDU A;  2M7U A;  4L0L A;  4OLG A;  2H5S A;  4RX3 A;  1KDS A;  3IXG A;  3RXX A;  3KSH A;  3HLF A;  1MKM A;  4GD6 A;  4GDN A;  1L0G A;  3CMZ A;  3OPP A;  2HDR A;  2XLN A;  2X01 A;  5GHY A;  3UE6 A;  5DF9 A;  2WGW B;  4KQO A;  5HX9 A;  5E43 A;  1CEF A;  5J3W A;  2Q0O A;  2EA9 A;  3IH8 A;  1PIO A;  2VA0 A;  5CGX A;  5FAQ A;  2H0T A;  4FH4 A;  2XFT A;  1KOU A;  1PZO A;  2KDK A;  4PM9 A;  3CZD A;  3W4P A;  1SCW A;  5E2H A;  1BZA A;  5DFX A;  4DJ3 A;  5HDS A;  1BLC A;  3V67 A;  3IQA A;  1ES4 A;  3F1O B;  4EER A;  3H9W A;  1K4E A;  5FQJ A;  3A0R A;  4GS9 A;  5HW3 A;  1LL9 A;  4BJP A;  1P9R A;  2V0U A;  5EOO A;  1YLY A;  1A0K A;  3MZD A;  2H28 A;  5FI7 A;  3T12 B;  1G68 A;  3EQV A;  3MFD A;  1KE4 A;  2A24 B;  2P7J A;  3GMW A;  4QD4 A;  2VGL M;  4Y13 A;  3M2K A;  1BLP A;  1BYW A;  1D06 A;  3T4Q A;  5HWW A;  4BL3 A;  1T19 A;  4R4R A;  2J3W A;  1ERO A;  2OSU A;  3T4O A;  2XK1 A;  2VV6 A;  2VGL S;  3VFH A;  4KUK A;  4KQQ A;  3HL9 A;  1PWC A;  3P01 A;  3OZH A;  5C5K A;  4BLM A;  2KX6 A;  1ZTU A;  4Y0T A;  2JBF A;  4PM8 A;  5EVI D;  2Z2L B;  2PHY A;  3NDE A;  5GLB A;  3SW1 A;  1S6R A;  5IT5 A;  5FQI A;  1S67 L;  2W0N A;  4LV2 A;  1KGE A;  2QPN A;  3S7P A; 
#chains in the Genus database with same CATH homology
 3T1S A;  1CJF A;  1VEU B;  4FTX A;  3T1R A;  1SKO A;  1AWI A;  3KYE A;  1J3W A;  2B95 A;  3L9K A;  2BTF P;  2HZ5 A;  3U4L P;  2JKG A;  3CPT B;  2JKF A;  1F2K A;  1FIL A;  1CQA A;  1SKO B;  1ACF A;  1FIK A;  1PNE A;  1PRQ A;  3UB5 P;  5FDS A;  4ESP A;  2PAV P;  3DAV A;  1A0K A;  3CPT A;  1CF0 A;  4X25 A;  3CHW P;  1HLU P;  1YPR A;  3T12 B;  5FEF A;  2PBD P;  4QWO A;  3MSH A;  4X1M A;  2VK3 A;  3NUL A;  1VET B;  2PRF A;  2V8C A;  2ZL1 A;  4D60 A;  3LEQ A;  4FUW A;  1G5U A;  1Y4O A;  2ZL1 B;  1VET A;  1SZV A;  3T1X A;  2ACG A;  3LGO A;  3D9Y A;  4X1L A;  3NEC A;  1K0K A;  3MS6 A;  1PFL A;  5FEG A;  2V8F A;  5EM0 A;  1VEU A;  2E8J A;  1D1J A;  1Z09 A;  5EVE A;  3T1Q B;  3L7H A;  5EV0 A;  5EM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...