5FDSA

Crystal structure of the monomeric allergen profilin (hev b 8)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
131
Chain Sequence
MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Profilin-2
publication title Structural insights into the IgE mediated responses induced by the allergens Hev b 8 and Zea m 12 in their dimeric forms.
pubmed doi rcsb
source organism Hevea brasiliensis
total genus 36
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 5fdsA00
5FEFA 4X1MA 1SKOA 4X1LA 1FILA 3NECA 1SZVA 3T12B 3NULA 3CPTB 3L9KA 2B95A 2JKFA 1CQAA 3MS6A 1CF0A 5EM0A 3T1SA 4FTXA 5FDSA 1VEUA 1YPRA 3T1QB 1G5UA 5EM1A 3T1RA 2E8JA 1VETA 1AWIA 4X25A 2ACGA 4D60A 1A0KA 1FIKA 3DAVA 3LEQA 2ZL1A 2VK3A 2PBDP 1PRQA 1VEUB 1SKOB 1ACFA 1HLUP 2JKGA 3LGOA 1Z09A 1K0KA 3CPTA 2HZ5A 2PAVP 2V8FA 3U4LP 5FEGA 4FUWA 2PRFA 1J3WA 1CJFA 2ZL1B 3KYEA 3CHWP 1F2KA 3L7HA 1D1JA 2BTFP 5EV0A 1PNEA 1VETB 3UB5P 1PFLA 4QWOA 3MSHA 3T1XA 2V8CA 5EVEA 1Y4OA 3D9YA 4ESPA
chains in the Genus database with same CATH superfamily
2EWVA 2XEPA 1EW0A 3NOUC 2ZMVA 3SZTA 1RP5A 3S7OA 1GHPA 4Q0IA 4QPRA 4ZJ3A 1FOFA 2VGKA 2KX6A 1K55A 3BJNA 3PBTA 5GLCA 3E4QA 2B02A 2WGVA 2HDRA 5F5YA 5EVID 1NZOA 3LICA 1KE0A 1L0EA 2O99A 4UQIS 1MPLA 3HLWA 4DKIA 1K6RA 1CEFA 4PPRA 4QJGA 2NUPC 1E4DA 1TS7A 1H8ZA 2GNXA 2GX5A 4WZ5C 3M6HA 3ZG7B 1PI5A 2C5WB 3BFGA 2A3UA 2QYBA 4EWFA 1PRQA 4Y3IA 3FKWA 4K91A 5HSQA 4KZ7A 4QHCA 1JTGA 3LIAA 3VOYA 3E2LA 2VKSA 2J9PA 1K54A 1BYWA 3N4IA 4ID4A 4EQIA 2BTFP 3IX4A 3S7QA 3LUQA 1E3UA 3T1XA 2WKPA 5FAPA 2PR5A 1QMFA 3MF0A 2Y4AA 3FWLA 2P74A 5CGSA 2KLIA 3A0VA 5HPFA 1IEMA 2WKHA 3Q1FA 5AVEA 3VSKA 4FH2A 1DJBA 3UO9A 3HLBA 5HAPA 3MKEA 3V50A 1W63M 3EEHA 5CX7A 4OH0A 2W1RA 2C6WB 3IBJA 2K31A 3SW1A 3UPNA 3T4QA 1H8MA 3SS5A 2VA0A 1S4RA 4LFUA 2ZM0A 3G6OA 3ULFA 3K3CA 1YSQA 5GLAA 1PWCA 2VX8A 5FATA 1W8QA 3OPPA 5DFXA 2JHEA 4WYYA 1SKOB 4JF6A 3T4JA 4WLAA 4Z1WA 4EBNA 3O87A 1F5MA 1IYOA 1TD5A 4I39A 1PYYA 3T4KA 1K0KA 5HZHA 5CRFA 4OQHA 4OONA 4BL3A 2WK0A 2ZMAA 2J3TC 1ES3A 3Q81A 1ONGA 3ZG8B 2ZC4B 3QP6A 5DVAA 2Y2PA 3TG9A 1IFQA 3Q7VB 1BLHA 5HL1A 5TR7A 2OWHA 3OOVA 2HDQA 1CK3A 1NLZA 3HJIA 5EFWA 5E2FA 2HV1A 3K2NA 2OLUA 3HLGA 2JE5A 2INWA 3O86A 4Y13A 3UN7A 1SKOA 3QNCA 4X68A 1MC0A 2YKHA 1AXBA 2Y2MA 4KQQA 3BFDA 5HD3A 2Y2OA 1PIOA 4Q8IA 4WBGA 1EWZA 1ES2A 3GVBA 4X55A 5HAIA 3ZCZA 5FDSA 2EFXA 2J3TD 5M1AA 5J4EA 4CJNA 3P09A 3PBRA 1VEUA 2PT7A 3PBNA 5GLBA 1K25A 2WKQA 3C4PA 1W5DA 4NXGA 1PZPA 1O7EA 3D4FA 4HQAA 4LCLA 3LEQA 1TS8A 2GZAA 3IHBA 2PBDP 5AVFA 3CLOA 3EGXC 3HUNA 4DE3A 1NZUA 1XP4A 3DTMA 3MKFA 2A49A 3UDFA 3E4PA 4IVIA 2JKTM 4ETZA 4ZJ1A 1T19A 4OPRA 4KZ6A 5TFQA 1F9IA 3KYEA 1RCJA 5CEDA 3CG5A 3HCYA 3O5YA 4BMWA 3C38A 3VFHA 2FH5A 4R3JA 5EV0A 1VETB 2P08A 4E3MA 2Y59A 4MCWA 1K56A 1OPXA 2V8CA 3H7WB 2ZJ9A 4R23A 5F83A 3IX3A 4EBLA 1YQSA 3ZQ5A 4HH3A 3D3OA 1TEMA 5FAQA 4ARZB 1NY0A 4WL9A 3DW0A 4B88A 3MZEA 4HP9A 4GDNA 1IYSA 3B42A 5D3OA 4DDYA 1N9OA 5JYPA 2X71A 2WZXA 4LCMA 5HX9A 3G4PA 3IXDA 1NRJA 2UWXA 4QD4A 3MBZA 5HPIA 1PWDA 3IF6B 5EM1A 4X53A 1L0DA 1VETA 3BEBA 3GDIA 5A8BA 2K2NA 1MKMA 5EPHA 1D7EA 3H7WA 5DFYA 1PW8A 4O01A 5EVLA 3KO6A 1XGJA 4O7DA 3MXSA 3ISGA 4ARZA 5HL6A 4OPZA 1ERMA 4QY5A 3HVFA 2BLSA 4KG5A 1JTDA 5AQAA 2W1TB 2V1AA 1CI8A 2XA7S 3HLCA 5IU1A 3LIDA 3OCNA 2WGWA 2V1ZA 5HWWA 2H10A 4GD8A 3CJMA 2IWCA 5IS1A 2A24B 1TDLA 1NXYA 5F82A 1E3UD 2ZQDA 4WZ4A 2Y2JA 3IF6A 3TJZC 2JKRI 4E3LA 1BLPA 1C3BA 3KX0X 5DKLA 4XUZA 2X01A 2ZMFA 4RQ9A 1PW1A 4L9FA 5J8XA 1IYPA 5FEFA 1LI0A 3E4OA 3HREA 2M7UA 1SDEA 3V3SA 3NC8A 3NECA 3ZNTA 5EECA 2WAFA 1BSGA 4PM9A 1UWNX 4JGPA 4PMAA 1ZKJA 4S2PA 4WEKA 4UAAA 2W1TA 4I3IA 1L0GA 5EM0A 5FI6A 4FTXA 3A3JA 2ZOIA 2V20A 2XFTA 2XGNA 5KSHA 3CITA 4P87A 1XJ2A 3T1QB 1KOUA 1GSVA 4BD1A 4QU3A 3F1PA 4X25A 4ZDXA 4DXBA 1ZG4A 4L9GA 5F68A 3T4TA 2NUTC 5HDDA 4N9KA 2XRNA 4WN5A 2B18A 5CHMA 4NEED 5CXWA 1HLUP 2JKGA 1FR6A 3LFVA 5L09A 5A92A 2R78A 2HZ5A 1ZG6A 4KQRA 4CLCC 3W4OA 1WA9A 4X56A 2OAP1 1MWSA 2PRFA 1J3WA 2V0WA 4Y17A 4BLMA 1HVBA 3OPLA 4U0XA 2RCXA 4JF5A 3MMHA 3C4OA 4R0QA 4HJ6A 1MWUA 1TS6A 3JPUA 1LT0A 5G18A 4BD0A 2OSUA 3IT9A 5EVIC 3BLMA 1CI9A 4KZ4A 3ZVTA 4ESPA 5E2HA 4GNUA 1Q2PA 2J8YA 1GSWA 4GN2A 5HW3A 4E04A 3N8SA 1NLYA 1I2WA 3HUMA 3WS2A 3P98A 5FQJA 2HP5A 3CUEC 2J3WA 1LLBA 1TF1A 1W79A 3V3RA 3A3DA 1CQAA 1OTAA 1LL9A 3NHQA 4HESA 1NJ4A 1KGFA 4K0XA 5HWVA 2FZ0A 2KOIA 4U0TA 3N7WA 3SH9A 4KG6A 2PU4A 4K0WA 4KG2A 2L0WA 2WKEA 5M19A 2Q9NA 1RGZA 1JWZA 3HBRA 3WS5A 3F1NB 4S2OA 1YSPA 3BM6A 3DTEA 5A90A 4LV0A 3VP0A 4KZAA 3IQAA 4YOFA 1W8YA 5AQBA 4JXVA 2J7VA 3MJQA 4IVKA 4UQIM 2Q0OA 4DF6A 4WMCA 2VJWA 3NDEA 2D01A 5DKKA 1K56D 3BYDA 1KDWA 4E3NA 1S6RA 4EETB 3TOIA 1LSXA 1YLWA 3KYZA 2ZM8A 5HFOA 2ZLYA 3A3FA 4HI4A 3OZHA 3QP1A 1GCEA 4U3TA 3ZHHA 2ZBBA 4BBTA 1LL8A 3VOZA 4LPZA 1ESIA 3F1NA 4ETXA 3OC2A 1FSWA 5FASA 1SCWA 4X1LA 1K57A 1XX2A 3T12B 2HGVA 2VV8A 1YLYA 2B95A 3FZCA 2VV7A 4NXFA 2Y2LA 3NI9A 3M2JA 2UV0E 4MBKA 4IBRA 1CF0A 3T4OA 1S1YA 3T1SA 2ZD8A 4N92A 4OOMA 2WADA 1OTIA 5F1GA 3A3EA 3FYZA 1BLCA 2H5SA 2V2FF 3PBQA 1JNUA 1G5UA 2HDUA 5EOOA 2E8JA 2RL3A 4WM9A 2EWWA 2Z2LB 2Q9MA 4NK3A 5FDHA 3UDXA 3NOPC 1OTBA 3QP2A 4LRXC 2IWDA 3ZGAB 3ZG5A 1G68A 1YLPA 4GB7A 2XD1A 4QB8A 1XA7A 3G32A 3LI8A 3GECA 2XH9A 2BG1A 2ZC6B 2QJ5A 3IX8A 3H82B 4RVAA 3BW6A 4RA7A 2P04A 4MLLA 3VP2A 2QHKA 4FCFA 2W3EA 2PHYA 4IJGA 3UB5P 1T1CA 2JKTI 4IBXA 3JYIA 3E2KA 3T4LA 1LSWA 5CHJA 3MQQA 3NIAA 4R6LA 4BQMA 1STZA 2L1MA 1G6OA 4X6TA 3C7VA 1T1BA 5FQQA 4E6XA 1ESUA 1MWTA 1SZVA 4Y0TA 4KENB 3S7NA 5F1FA 4EV4A 2JKFA 4JBFA 3ITAA 3BQAA 2JN7A 3B47A 5M18A 1KE4A 4RX3A 3FC7A 3W4PA 1YT4A 3ZG0A 4P6BA 3HLEA 1X0OA 2YKFA 3BQ8A 5GL9A 3VE3A 1YPRA 2GDNA 3OPHA 2XROA 4A5RA 1AWIA 2DMWA 1LHYA 4S2IA 5C5KA 4HH2A 1FIKA 5FAOA 2XSSA 2CMNA 3TRCA 3CI6A 1M6KA 2BASA 3C8CA 2LB9A 1H3QA 3KSFA 3OCLA 2WKRA 5F6AA 3JVVA 4HP4A 3LGOA 4GD6A 3Q7VA 3G34A 3OLOA 4EEPA 2QPNA 4OLDA 5FEGA 1KGEA 3MR0A 3VSLA 3UE3A 1K55C 1HD8A 2VEAA 1W63Q 2WZZA 4ZAMA 3FPVA 3TSGA 5BOHA 4HY8A 4LGWA 2WYXA 1PFLA 3OPRA 4N9LA 4IHQA 1ES4A 4L9EA 1PI4A 4P85A 4DJ3A 3GTCA 1IOUA 3PAEA 5G4ZA 2J80A 3N8RA 4MEZA 2HDSA 3GMWA 4GDBA 2XF3A 3HJKA 2ZQ8A 4EXOA 2GJ3A 3GQZA 5DTKA 1P9RA 4AFIA 1GA9A 1OTEA 1YMSA 3BFFA 2XLNA 1FCMA 3VOLA 3WS1A 3WRTA 3BY9A 4GKUA 4R3AA 3LIEA 2W3GA 2O9CA 4OQIA 3NOTC 1K54C 1KVMA 3PTEA 3R4KA 2Y55A 4H8RA 2PDRA 4JF4A 1ZC2A 3G35A 4Y15A 1V9ZA 5TJJA 2XDMA 1OT9A 1K6SA 4M3KA 5DF7A 4ZBEA 5L10A 4P6ZS 1KVLA 1G6AA 2AVXA 1S66L 3IS2B 4HIAA 2VGLS 1BLSA 3DWKA 4WMCD 4R70A 1FSYA 4GZBA 4WZ5A 2QWSA 4FSFA 2Y2NA 4HBTA 4NETA 1F2KA 2PD8A 3OBFA 3P01A 3LIFA 3WRZA 5EVEA 3D9YA 3V67A 1DJCA 3R7WB 3FKVA 5G4YA 4L0LA 4XT2B 4DE1A 2KDKA 2O9AA 4IEDA 5TGFA 3HLFA 4DE0A 4F3LB 2ZOHA 5IT5A 3LCEA 1XJ4A 1L0FA 2XA7M 1JWPA 3BRMA 4N1HA 3SOIA 2EX8A 3AGDA 3DTKA 4JXSA 1D06A 5HWTA 5CGXA 3WS0A 2Y8HA 3RFBA 1OJ5A 1SDNA 4EW7A 5LBRA 4E6WA 4JGRA 3R7WA 1MBLA 2G2WA 5AQ7A 3TE8A 3GRJA 2FFFB 5E2EA 3IWIA 3MZDA 1IELA 4XT2A 2A24A 1T1AA 1XJ3A 1Y54A 4WF0A 3RTYA 3IXHA 3ZVWA 1Z6FA 4OPQA 5DJUA 3IBRA 1P9WA 1TDGA 2VLGA 2HF6A 4OQ0A 2R9WA 3F1OB 1IKGA 3RJUA 2ZL1B 1GSXA 1K4EA 4B4ZA 1UWPX 2G2UA 3SS4A 1D1JA 2V1BA 4QWOA 2PD7A 3G2ZA 2O0YA 4NXEA 4PHTA 1ES5A 3UB9A 1FCOA 2ZQAA 3UB7A 3IHAA 3BFEA 4B4XA 5HAQA 2HP6A 1ERQA 1O07A 3UE0A 5DF9A 4C75A 3EQUA 4X1MA 5FI7A 4WUJA 5DTSA 3W8KA 4JGOA 1V9YA 3BECA 4PM5A 3ITBA 4OPYA 1L2SA 3S4XA 1Q2QA 4PM7A 3AGEA 1KE3A 4LV1A 4OKPA 3EEAA 4JKTA 3VP4A 1DP8A 4KZ5A 3MFDA 3B33A 3F1OA 4S2KA 4ZTKA 1W7FA 3W2ZA 1BULA 3IWOA 3UY6A 1MXOA 5DF8A 4MDZA 1G28A 2OOLA 4Y0UA 3RXWA 1MWRA 5EE8A 2ZQ7A 3T1RA 4HOIA 3QP4A 5FQMA 3VP3A 2W3FA 4D60A 4E3OA 3O88A 1IKIA 3PHYA 3NY4A 3KSGA 2ZQ9A 2L4RA 2VK3A 2Y2QA 3A3IA 5AQ9A 5FA7A 3ZDJA 2HJ9C 4MNRA 5I94A 4M4XA 5FI2A 3BFCA 2FFYA 1OTDA 2W3HA 3IH8A 1ZHHB 4O8GA 4YFMA 4MN7A 4KUKA 2EXAA 3MXRA 3T4SA 3T50A 1WE4A 3LY3A 4LV3A 2VV6A 1BZAA 3SS3A 5FQ9A 4ZJ2A 2WAEA 1CEGA 3G2YA 4GHIB 5I5LA 1U60A 4IUKA 4LRYC 4CLCE 5L07A 1SHVA 5HD5A 1LL5A 3EQVA 2X02A 1FCNA 2QJ7A 3FV7A 1NWZA 3M6BA 1VM1A 4WELA 4PKYG 3GSGA 3VFFA 5CHUA 2OV5A 3ZG9B 3C2WA 1H5XA 3LI9A 3N6IA 3RH8B 4LLOB 3UE1A 3NULA 5DTTA 3QHYA 3LR0A 4Y0OA 2PYPA 3FPWA 3UB8A 3O3VA 1GHIA 4BBUA 4GW9A 3S22A 3Q7ZA 1DP6A 2G7UA 4GHIA 4HJ3A 1F98A 1QMEA 1P97A 2E8IA 1JWVA 2MJ6A 4OOYA 2VGJA 4Y5FA 4PM6A 2LB5A 3PBOA 1L3LA 1A0KA 5L8MA 3DAVA 3PBSA 3WWXA 3KSHA 2W0NA 3IF6C 1VB6A 1ACFA 4RYEA 1E25A 1ALQA 4GOGA 4GS9B 3E98A 4OP5A 3MFXA 3D72A 3PYPA 1S0WA 1P0ZA 4MN6A 1VHMA 4DMZA 5IHVA 4XXRA 1XGIA 1DJAA 3M2KA 4R4RA 4C3QA 3CHWP 4HHDA 2QMIA 2M1CA 2JBFA 1BT5A 2V9AA 3MQOA 4UHUA 3IF5A 1PNEA 4Z9QA 2WKIA 4G3WA 2ZC3B 1BTLA 5JYOA 4DXCA 2EFUA 1VQQA 2H0TA 3QP8A 4KUOA 5KSCA 1DP9A 4UA6A 3ZFZA 4S2NA 2PR6A 4BBVA 5EUAA 3W4QA 4GS9A 1S67L 4KQOA 2PU2A 1I5QA 1GA0A 2B5RA 3MS6A 1XKZA 4CQHA 5E2GA 2XR0A 1RGYA 1WYCA 3I7JA 2XQZA 3QP5A 2QKPA 4JXGA 3QNBA 2Y2HA 1YMXA 4I5SA 1N9NA 2ACGA 3BWLA 1M40A 2OAQ1 4OP8A 2V0UA 3U2AA 2I9VA 3NDGA 1DY6A 3H82A 3VV4A 4Q0HA 4CLCB 2OWJA 2P9VB 1VEUB 4R1GA 3UMDA 4BJPA 1LSVA 3G31A 2WGIA 4HBUA 4NXBA 4YNRA 1Z09A 3WS4A 1YM1A 1DRMA 1NRFA 1YLTA 3MQ0A 4G3KA 3Q82A 2R9XA 4OLGA 4R3BA 1XA1A 5EVIB 4YINA 3FG8A 4UA9A 1UGUA 4EESA 4DRTA 5GHXA 3NJAA 1Y4OA 4S2JA 4K08A 4EUVA 4UA7A 2ZC5B 2ZQCA 4CLCA 2P9VA 4Y2FA 3BLSA 5E43A 5F69A 3VP1A 3LEZA 3ZYTA 3LO7A 1MKIA 4EERA 4HJ4A 5GLDA 3Q07A 4DJ2A 5EVIA 4O0PA 2Z6CA 3A0SA 3LIBA 2HP9A 1KGGA 3PXPA 1TVFA 2CC1A 1N4OA 1XXMA 3DWZA 1YAXA 2IWBA 5KIZA 4X69A 3DTIA 2K7SA 4B9OA 5CGWA 5HDCA 1NYYA 4JLFA 4E3IA 3CUEA 5CTMA 2VZWA 1XPBA 2DNSA 3C30A 3UPOA 5FSRA 1YKDA 3SH7A 4PKYA 2Y79A 4DE2A 4DDSA 2W27A 2O9BA 3PR6A 2V8FA 4FUWA 5KMWA 1K57C 1CJFA 3KYQA 5EOEA 2M7VA 4PAUA 5FL3A 4H6JB 3H9WA 3B3XA 4IUHA 4FH4A 1ONHA 5HDSA 4FOFA 4HEFA 3HLDA 2ZC7A 3LR5A 1NYMA 1SKFA 4FD8A 1XFNA 4OOLA 2J9OA 3L7HA 2EA9A 2ZM2A 2PYRA 1FQGA 5FQKA 2HPBA 2WGWB 3UB6A 4C6YA 2Z2MB 3BY8A 4EUZA 4LV2A 4E3KA 4I38A 4KZ3A 2DRWA 4P6ZM 3CZDA 4KZ8A 4Y7PA 1PWGA 2A2LA 4YWZA 4Q0JA 2VGLM 1XJ6A 5CTNA 1T18A 4MN5A 4F94A 2PBYA 3GR2A 4H6JA 4ME4A 1TS0A 2Y91A 4N1XA 3A0RA 3UPPA 5GHYA 4PM8A 3LY4A 4R4SA 4LENA 4HNBA 1K4FA 2XD5A 1GHMA 3KSIA 4S2LA 3IS2A 4R38A 5K5BA 2H28A 4S2NC 4WEJA 5A93A 3NBLA 2I72A 1LI9A 1IYQA 3C7UA 4EEUA 5U47A 5GHZA 2EX9A 4GCZA 4GLQA 3UNWA 4DN0A 4NG2A 3CWFA 3V39A 3F1PB 5HARA 4RX2A 4D2OA 3MZFA 4KZ9A 3U4LP 5J7EA 1WYBA 4GJ4A 4EU0A 3IXGA 3JVUA 1OMEA 3EGDC 1N9LA 5AJGA 4BWIA 4MBFA 3UMEA 1EI5A 2XK1A 2W3DA 4F3LA 3VE4A 1H0MA 4XUXA 3CMZA 2EXBA 3CAXA 4CPKA 1ODVA 3MSHA 5FQIA 5CERA 2OLVA 1HZOA 3UE6A 5J3WA 4BL2A 1Y28A 3DBAA 3VMAA 2IA2A 3ICYA 1I2SA 2QZ6A 3G30A 4I3AA 2Y2GA 4BENA 3K3DA 3RXXA 3ZNYA 1FILA 3MXQA 3E0YA 3CPTB 3L9KA 5DJTA 2P7JA 2DCFA 1J9MA 3S7PA 4ZRRA 4JXWA 1PZOA 1OT6A 3IH9A 1HTZA 1S4SA 3IWQA 4MMNA 5CECA 3LYXA 5TBMB 1MY8A 3HUOA 2EX2A 1BUEA 1OJGA 4KZBA 3EOIA 4JGQA 3V5MA 3AGFA 2Y2IA 4KQDA 3S1YA 3SH8A 4B93A 2JC7A 4EQ1A 3GV9A 3NCKA 1K38A 1S1ZA 1YLZA 2H0YA 2ZL1A 4LRZE 4EBPA 5A91A 2D02A 4S2MA 2HJEA 5KZHA 3IXBA 3P7NA 2WUQA 3CPTA 2PAVP 1EROA 1YLJA 2JKRM 4E3JA 1H8YA 4P0MA 4MBHA 2EX6A 3HL9A 3LR3A 3EWKA 5CEBA 3LR4A 4OQGA 1XFQA 1FR1A 4OVDA 5TBMA 3UDIA 3N8LA 2JCHA 4QY6A 1MZUA 2Y2KA 3PAGA 4I3JA 4II7A 4NKPA 4JPMA 3C5AA 5L2FA 1N9BA 1JVJA 4CLCD 5MC7A 1ZTUA 2XFSA 4G3VA 1KDSA 2Z6DA 4UEYA 3TW8A
chains in the Genus database with same CATH topology
5FEFA 4X1MA 1SKOA 4X1LA 1FILA 3NECA 1SZVA 3T12B 3NULA 3CPTB 3L9KA 2B95A 2JKFA 1CQAA 3MS6A 1CF0A 5EM0A 3T1SA 4FTXA 5FDSA 1VEUA 1YPRA 3T1QB 1G5UA 5EM1A 3T1RA 2E8JA 1VETA 1AWIA 4X25A 2ACGA 4D60A 1A0KA 1FIKA 3DAVA 3LEQA 2ZL1A 2VK3A 2PBDP 1PRQA 1VEUB 1SKOB 1ACFA 1HLUP 2JKGA 3LGOA 1Z09A 1K0KA 3CPTA 2HZ5A 2PAVP 2V8FA 3U4LP 5FEGA 4FUWA 2PRFA 1J3WA 1CJFA 2ZL1B 3KYEA 3CHWP 1F2KA 3L7HA 1D1JA 2BTFP 5EV0A 1PNEA 1VETB 3UB5P 1PFLA 4QWOA 3MSHA 3T1XA 2V8CA 5EVEA 1Y4OA 3D9YA 4ESPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FEF A;  4X1M A;  1SKO A;  4X1L A;  1FIL A;  3NEC A;  1SZV A;  3T12 B;  3NUL A;  3CPT B;  3L9K A;  2B95 A;  2JKF A;  1CQA A;  3MS6 A;  1CF0 A;  5EM0 A;  3T1S A;  4FTX A;  5FDS A;  1VEU A;  1YPR A;  3T1Q B;  1G5U A;  5EM1 A;  3T1R A;  2E8J A;  1VET A;  1AWI A;  4X25 A;  2ACG A;  4D60 A;  1A0K A;  1FIK A;  3DAV A;  3LEQ A;  2ZL1 A;  2VK3 A;  2PBD P;  1PRQ A;  1VEU B;  1SKO B;  1ACF A;  1HLU P;  2JKG A;  3LGO A;  1Z09 A;  1K0K A;  3CPT A;  2HZ5 A;  2PAV P;  2V8F A;  3U4L P;  5FEG A;  4FUW A;  2PRF A;  1J3W A;  1CJF A;  2ZL1 B;  3KYE A;  3CHW P;  1F2K A;  3L7H A;  1D1J A;  2BTF P;  5EV0 A;  1PNE A;  1VET B;  3UB5 P;  1PFL A;  4QWO A;  3MSH A;  3T1X A;  2V8C A;  5EVE A;  1Y4O A;  3D9Y A;  4ESP A; 
#chains in the Genus database with same CATH topology
 2EWV A;  2XEP A;  1EW0 A;  3NOU C;  2ZMV A;  3SZT A;  1RP5 A;  3S7O A;  1GHP A;  4Q0I A;  4QPR A;  4ZJ3 A;  1FOF A;  2VGK A;  2KX6 A;  1K55 A;  3BJN A;  3PBT A;  5GLC A;  3E4Q A;  2B02 A;  2WGV A;  2HDR A;  5F5Y A;  5EVI D;  1NZO A;  3LIC A;  1KE0 A;  1L0E A;  2O99 A;  4UQI S;  1MPL A;  3HLW A;  4DKI A;  1K6R A;  1CEF A;  4PPR A;  4QJG A;  2NUP C;  1E4D A;  1TS7 A;  1H8Z A;  2GNX A;  2GX5 A;  4WZ5 C;  3M6H A;  3ZG7 B;  1PI5 A;  2C5W B;  3BFG A;  2A3U A;  2QYB A;  4EWF A;  1PRQ A;  4Y3I A;  3FKW A;  4K91 A;  5HSQ A;  4KZ7 A;  4QHC A;  1JTG A;  3LIA A;  3VOY A;  3E2L A;  2VKS A;  2J9P A;  1K54 A;  1BYW A;  3N4I A;  4ID4 A;  4EQI A;  2BTF P;  3IX4 A;  3S7Q A;  3LUQ A;  1E3U A;  3T1X A;  2WKP A;  5FAP A;  2PR5 A;  1QMF A;  3MF0 A;  2Y4A A;  3FWL A;  2P74 A;  5CGS A;  2KLI A;  3A0V A;  5HPF A;  1IEM A;  2WKH A;  3Q1F A;  5AVE A;  3VSK A;  4FH2 A;  1DJB A;  3UO9 A;  3HLB A;  5HAP A;  3MKE A;  3V50 A;  1W63 M;  3EEH A;  5CX7 A;  4OH0 A;  2W1R A;  2C6W B;  3IBJ A;  2K31 A;  3SW1 A;  3UPN A;  3T4Q A;  1H8M A;  3SS5 A;  2VA0 A;  1S4R A;  4LFU A;  2ZM0 A;  3G6O A;  3ULF A;  3K3C A;  1YSQ A;  5GLA A;  1PWC A;  2VX8 A;  5FAT A;  1W8Q A;  3OPP A;  5DFX A;  2JHE A;  4WYY A;  1SKO B;  4JF6 A;  3T4J A;  4WLA A;  4Z1W A;  4EBN A;  3O87 A;  1F5M A;  1IYO A;  1TD5 A;  4I39 A;  1PYY A;  3T4K A;  1K0K A;  5HZH A;  5CRF A;  4OQH A;  4OON A;  4BL3 A;  2WK0 A;  2ZMA A;  2J3T C;  1ES3 A;  3Q81 A;  1ONG A;  3ZG8 B;  2ZC4 B;  3QP6 A;  5DVA A;  2Y2P A;  3TG9 A;  1IFQ A;  3Q7V B;  1BLH A;  5HL1 A;  5TR7 A;  2OWH A;  3OOV A;  2HDQ A;  1CK3 A;  1NLZ A;  3HJI A;  5EFW A;  5E2F A;  2HV1 A;  3K2N A;  2OLU A;  3HLG A;  2JE5 A;  2INW A;  3O86 A;  4Y13 A;  3UN7 A;  1SKO A;  3QNC A;  4X68 A;  1MC0 A;  2YKH A;  1AXB A;  2Y2M A;  4KQQ A;  3BFD A;  5HD3 A;  2Y2O A;  1PIO A;  4Q8I A;  4WBG A;  1EWZ A;  1ES2 A;  3GVB A;  4X55 A;  5HAI A;  3ZCZ A;  5FDS A;  2EFX A;  2J3T D;  5M1A A;  5J4E A;  4CJN A;  3P09 A;  3PBR A;  1VEU A;  2PT7 A;  3PBN A;  5GLB A;  1K25 A;  2WKQ A;  3C4P A;  1W5D A;  4NXG A;  1PZP A;  1O7E A;  3D4F A;  4HQA A;  4LCL A;  3LEQ A;  1TS8 A;  2GZA A;  3IHB A;  2PBD P;  5AVF A;  3CLO A;  3EGX C;  3HUN A;  4DE3 A;  1NZU A;  1XP4 A;  3DTM A;  3MKF A;  2A49 A;  3UDF A;  3E4P A;  4IVI A;  2JKT M;  4ETZ A;  4ZJ1 A;  1T19 A;  4OPR A;  4KZ6 A;  5TFQ A;  1F9I A;  3KYE A;  1RCJ A;  5CED A;  3CG5 A;  3HCY A;  3O5Y A;  4BMW A;  3C38 A;  3VFH A;  2FH5 A;  4R3J A;  5EV0 A;  1VET B;  2P08 A;  4E3M A;  2Y59 A;  4MCW A;  1K56 A;  1OPX A;  2V8C A;  3H7W B;  2ZJ9 A;  4R23 A;  5F83 A;  3IX3 A;  4EBL A;  1YQS A;  3ZQ5 A;  4HH3 A;  3D3O A;  1TEM A;  5FAQ A;  4ARZ B;  1NY0 A;  4WL9 A;  3DW0 A;  4B88 A;  3MZE A;  4HP9 A;  4GDN A;  1IYS A;  3B42 A;  5D3O A;  4DDY A;  1N9O A;  5JYP A;  2X71 A;  2WZX A;  4LCM A;  5HX9 A;  3G4P A;  3IXD A;  1NRJ A;  2UWX A;  4QD4 A;  3MBZ A;  5HPI A;  1PWD A;  3IF6 B;  5EM1 A;  4X53 A;  1L0D A;  1VET A;  3BEB A;  3GDI A;  5A8B A;  2K2N A;  1MKM A;  5EPH A;  1D7E A;  3H7W A;  5DFY A;  1PW8 A;  4O01 A;  5EVL A;  3KO6 A;  1XGJ A;  4O7D A;  3MXS A;  3ISG A;  4ARZ A;  5HL6 A;  4OPZ A;  1ERM A;  4QY5 A;  3HVF A;  2BLS A;  4KG5 A;  1JTD A;  5AQA A;  2W1T B;  2V1A A;  1CI8 A;  2XA7 S;  3HLC A;  5IU1 A;  3LID A;  3OCN A;  2WGW A;  2V1Z A;  5HWW A;  2H10 A;  4GD8 A;  3CJM A;  2IWC A;  5IS1 A;  2A24 B;  1TDL A;  1NXY A;  5F82 A;  1E3U D;  2ZQD A;  4WZ4 A;  2Y2J A;  3IF6 A;  3TJZ C;  2JKR I;  4E3L A;  1BLP A;  1C3B A;  3KX0 X;  5DKL A;  4XUZ A;  2X01 A;  2ZMF A;  4RQ9 A;  1PW1 A;  4L9F A;  5J8X A;  1IYP A;  5FEF A;  1LI0 A;  3E4O A;  3HRE A;  2M7U A;  1SDE A;  3V3S A;  3NC8 A;  3NEC A;  3ZNT A;  5EEC A;  2WAF A;  1BSG A;  4PM9 A;  1UWN X;  4JGP A;  4PMA A;  1ZKJ A;  4S2P A;  4WEK A;  4UAA A;  2W1T A;  4I3I A;  1L0G A;  5EM0 A;  5FI6 A;  4FTX A;  3A3J A;  2ZOI A;  2V20 A;  2XFT A;  2XGN A;  5KSH A;  3CIT A;  4P87 A;  1XJ2 A;  3T1Q B;  1KOU A;  1GSV A;  4BD1 A;  4QU3 A;  3F1P A;  4X25 A;  4ZDX A;  4DXB A;  1ZG4 A;  4L9G A;  5F68 A;  3T4T A;  2NUT C;  5HDD A;  4N9K A;  2XRN A;  4WN5 A;  2B18 A;  5CHM A;  4NEE D;  5CXW A;  1HLU P;  2JKG A;  1FR6 A;  3LFV A;  5L09 A;  5A92 A;  2R78 A;  2HZ5 A;  1ZG6 A;  4KQR A;  4CLC C;  3W4O A;  1WA9 A;  4X56 A;  2OAP 1;  1MWS A;  2PRF A;  1J3W A;  2V0W A;  4Y17 A;  4BLM A;  1HVB A;  3OPL A;  4U0X A;  2RCX A;  4JF5 A;  3MMH A;  3C4O A;  4R0Q A;  4HJ6 A;  1MWU A;  1TS6 A;  3JPU A;  1LT0 A;  5G18 A;  4BD0 A;  2OSU A;  3IT9 A;  5EVI C;  3BLM A;  1CI9 A;  4KZ4 A;  3ZVT A;  4ESP A;  5E2H A;  4GNU A;  1Q2P A;  2J8Y A;  1GSW A;  4GN2 A;  5HW3 A;  4E04 A;  3N8S A;  1NLY A;  1I2W A;  3HUM A;  3WS2 A;  3P98 A;  5FQJ A;  2HP5 A;  3CUE C;  2J3W A;  1LLB A;  1TF1 A;  1W79 A;  3V3R A;  3A3D A;  1CQA A;  1OTA A;  1LL9 A;  3NHQ A;  4HES A;  1NJ4 A;  1KGF A;  4K0X A;  5HWV A;  2FZ0 A;  2KOI A;  4U0T A;  3N7W A;  3SH9 A;  4KG6 A;  2PU4 A;  4K0W A;  4KG2 A;  2L0W A;  2WKE A;  5M19 A;  2Q9N A;  1RGZ A;  1JWZ A;  3HBR A;  3WS5 A;  3F1N B;  4S2O A;  1YSP A;  3BM6 A;  3DTE A;  5A90 A;  4LV0 A;  3VP0 A;  4KZA A;  3IQA A;  4YOF A;  1W8Y A;  5AQB A;  4JXV A;  2J7V A;  3MJQ A;  4IVK A;  4UQI M;  2Q0O A;  4DF6 A;  4WMC A;  2VJW A;  3NDE A;  2D01 A;  5DKK A;  1K56 D;  3BYD A;  1KDW A;  4E3N A;  1S6R A;  4EET B;  3TOI A;  1LSX A;  1YLW A;  3KYZ A;  2ZM8 A;  5HFO A;  2ZLY A;  3A3F A;  4HI4 A;  3OZH A;  3QP1 A;  1GCE A;  4U3T A;  3ZHH A;  2ZBB A;  4BBT A;  1LL8 A;  3VOZ A;  4LPZ A;  1ESI A;  3F1N A;  4ETX A;  3OC2 A;  1FSW A;  5FAS A;  1SCW A;  4X1L A;  1K57 A;  1XX2 A;  3T12 B;  2HGV A;  2VV8 A;  1YLY A;  2B95 A;  3FZC A;  2VV7 A;  4NXF A;  2Y2L A;  3NI9 A;  3M2J A;  2UV0 E;  4MBK A;  4IBR A;  1CF0 A;  3T4O A;  1S1Y A;  3T1S A;  2ZD8 A;  4N92 A;  4OOM A;  2WAD A;  1OTI A;  5F1G A;  3A3E A;  3FYZ A;  1BLC A;  2H5S A;  2V2F F;  3PBQ A;  1JNU A;  1G5U A;  2HDU A;  5EOO A;  2E8J A;  2RL3 A;  4WM9 A;  2EWW A;  2Z2L B;  2Q9M A;  4NK3 A;  5FDH A;  3UDX A;  3NOP C;  1OTB A;  3QP2 A;  4LRX C;  2IWD A;  3ZGA B;  3ZG5 A;  1G68 A;  1YLP A;  4GB7 A;  2XD1 A;  4QB8 A;  1XA7 A;  3G32 A;  3LI8 A;  3GEC A;  2XH9 A;  2BG1 A;  2ZC6 B;  2QJ5 A;  3IX8 A;  3H82 B;  4RVA A;  3BW6 A;  4RA7 A;  2P04 A;  4MLL A;  3VP2 A;  2QHK A;  4FCF A;  2W3E A;  2PHY A;  4IJG A;  3UB5 P;  1T1C A;  2JKT I;  4IBX A;  3JYI A;  3E2K A;  3T4L A;  1LSW A;  5CHJ A;  3MQQ A;  3NIA A;  4R6L A;  4BQM A;  1STZ A;  2L1M A;  1G6O A;  4X6T A;  3C7V A;  1T1B A;  5FQQ A;  4E6X A;  1ESU A;  1MWT A;  1SZV A;  4Y0T A;  4KEN B;  3S7N A;  5F1F A;  4EV4 A;  2JKF A;  4JBF A;  3ITA A;  3BQA A;  2JN7 A;  3B47 A;  5M18 A;  1KE4 A;  4RX3 A;  3FC7 A;  3W4P A;  1YT4 A;  3ZG0 A;  4P6B A;  3HLE A;  1X0O A;  2YKF A;  3BQ8 A;  5GL9 A;  3VE3 A;  1YPR A;  2GDN A;  3OPH A;  2XRO A;  4A5R A;  1AWI A;  2DMW A;  1LHY A;  4S2I A;  5C5K A;  4HH2 A;  1FIK A;  5FAO A;  2XSS A;  2CMN A;  3TRC A;  3CI6 A;  1M6K A;  2BAS A;  3C8C A;  2LB9 A;  1H3Q A;  3KSF A;  3OCL A;  2WKR A;  5F6A A;  3JVV A;  4HP4 A;  3LGO A;  4GD6 A;  3Q7V A;  3G34 A;  3OLO A;  4EEP A;  2QPN A;  4OLD A;  5FEG A;  1KGE A;  3MR0 A;  3VSL A;  3UE3 A;  1K55 C;  1HD8 A;  2VEA A;  1W63 Q;  2WZZ A;  4ZAM A;  3FPV A;  3TSG A;  5BOH A;  4HY8 A;  4LGW A;  2WYX A;  1PFL A;  3OPR A;  4N9L A;  4IHQ A;  1ES4 A;  4L9E A;  1PI4 A;  4P85 A;  4DJ3 A;  3GTC A;  1IOU A;  3PAE A;  5G4Z A;  2J80 A;  3N8R A;  4MEZ A;  2HDS A;  3GMW A;  4GDB A;  2XF3 A;  3HJK A;  2ZQ8 A;  4EXO A;  2GJ3 A;  3GQZ A;  5DTK A;  1P9R A;  4AFI A;  1GA9 A;  1OTE A;  1YMS A;  3BFF A;  2XLN A;  1FCM A;  3VOL A;  3WS1 A;  3WRT A;  3BY9 A;  4GKU A;  4R3A A;  3LIE A;  2W3G A;  2O9C A;  4OQI A;  3NOT C;  1K54 C;  1KVM A;  3PTE A;  3R4K A;  2Y55 A;  4H8R A;  2PDR A;  4JF4 A;  1ZC2 A;  3G35 A;  4Y15 A;  1V9Z A;  5TJJ A;  2XDM A;  1OT9 A;  1K6S A;  4M3K A;  5DF7 A;  4ZBE A;  5L10 A;  4P6Z S;  1KVL A;  1G6A A;  2AVX A;  1S66 L;  3IS2 B;  4HIA A;  2VGL S;  1BLS A;  3DWK A;  4WMC D;  4R70 A;  1FSY A;  4GZB A;  4WZ5 A;  2QWS A;  4FSF A;  2Y2N A;  4HBT A;  4NET A;  1F2K A;  2PD8 A;  3OBF A;  3P01 A;  3LIF A;  3WRZ A;  5EVE A;  3D9Y A;  3V67 A;  1DJC A;  3R7W B;  3FKV A;  5G4Y A;  4L0L A;  4XT2 B;  4DE1 A;  2KDK A;  2O9A A;  4IED A;  5TGF A;  3HLF A;  4DE0 A;  4F3L B;  2ZOH A;  5IT5 A;  3LCE A;  1XJ4 A;  1L0F A;  2XA7 M;  1JWP A;  3BRM A;  4N1H A;  3SOI A;  2EX8 A;  3AGD A;  3DTK A;  4JXS A;  1D06 A;  5HWT A;  5CGX A;  3WS0 A;  2Y8H A;  3RFB A;  1OJ5 A;  1SDN A;  4EW7 A;  5LBR A;  4E6W A;  4JGR A;  3R7W A;  1MBL A;  2G2W A;  5AQ7 A;  3TE8 A;  3GRJ A;  2FFF B;  5E2E A;  3IWI A;  3MZD A;  1IEL A;  4XT2 A;  2A24 A;  1T1A A;  1XJ3 A;  1Y54 A;  4WF0 A;  3RTY A;  3IXH A;  3ZVW A;  1Z6F A;  4OPQ A;  5DJU A;  3IBR A;  1P9W A;  1TDG A;  2VLG A;  2HF6 A;  4OQ0 A;  2R9W A;  3F1O B;  1IKG A;  3RJU A;  2ZL1 B;  1GSX A;  1K4E A;  4B4Z A;  1UWP X;  2G2U A;  3SS4 A;  1D1J A;  2V1B A;  4QWO A;  2PD7 A;  3G2Z A;  2O0Y A;  4NXE A;  4PHT A;  1ES5 A;  3UB9 A;  1FCO A;  2ZQA A;  3UB7 A;  3IHA A;  3BFE A;  4B4X A;  5HAQ A;  2HP6 A;  1ERQ A;  1O07 A;  3UE0 A;  5DF9 A;  4C75 A;  3EQU A;  4X1M A;  5FI7 A;  4WUJ A;  5DTS A;  3W8K A;  4JGO A;  1V9Y A;  3BEC A;  4PM5 A;  3ITB A;  4OPY A;  1L2S A;  3S4X A;  1Q2Q A;  4PM7 A;  3AGE A;  1KE3 A;  4LV1 A;  4OKP A;  3EEA A;  4JKT A;  3VP4 A;  1DP8 A;  4KZ5 A;  3MFD A;  3B33 A;  3F1O A;  4S2K A;  4ZTK A;  1W7F A;  3W2Z A;  1BUL A;  3IWO A;  3UY6 A;  1MXO A;  5DF8 A;  4MDZ A;  1G28 A;  2OOL A;  4Y0U A;  3RXW A;  1MWR A;  5EE8 A;  2ZQ7 A;  3T1R A;  4HOI A;  3QP4 A;  5FQM A;  3VP3 A;  2W3F A;  4D60 A;  4E3O A;  3O88 A;  1IKI A;  3PHY A;  3NY4 A;  3KSG A;  2ZQ9 A;  2L4R A;  2VK3 A;  2Y2Q A;  3A3I A;  5AQ9 A;  5FA7 A;  3ZDJ A;  2HJ9 C;  4MNR A;  5I94 A;  4M4X A;  5FI2 A;  3BFC A;  2FFY A;  1OTD A;  2W3H A;  3IH8 A;  1ZHH B;  4O8G A;  4YFM A;  4MN7 A;  4KUK A;  2EXA A;  3MXR A;  3T4S A;  3T50 A;  1WE4 A;  3LY3 A;  4LV3 A;  2VV6 A;  1BZA A;  3SS3 A;  5FQ9 A;  4ZJ2 A;  2WAE A;  1CEG A;  3G2Y A;  4GHI B;  5I5L A;  1U60 A;  4IUK A;  4LRY C;  4CLC E;  5L07 A;  1SHV A;  5HD5 A;  1LL5 A;  3EQV A;  2X02 A;  1FCN A;  2QJ7 A;  3FV7 A;  1NWZ A;  3M6B A;  1VM1 A;  4WEL A;  4PKY G;  3GSG A;  3VFF A;  5CHU A;  2OV5 A;  3ZG9 B;  3C2W A;  1H5X A;  3LI9 A;  3N6I A;  3RH8 B;  4LLO B;  3UE1 A;  3NUL A;  5DTT A;  3QHY A;  3LR0 A;  4Y0O A;  2PYP A;  3FPW A;  3UB8 A;  3O3V A;  1GHI A;  4BBU A;  4GW9 A;  3S22 A;  3Q7Z A;  1DP6 A;  2G7U A;  4GHI A;  4HJ3 A;  1F98 A;  1QME A;  1P97 A;  2E8I A;  1JWV A;  2MJ6 A;  4OOY A;  2VGJ A;  4Y5F A;  4PM6 A;  2LB5 A;  3PBO A;  1L3L A;  1A0K A;  5L8M A;  3DAV A;  3PBS A;  3WWX A;  3KSH A;  2W0N A;  3IF6 C;  1VB6 A;  1ACF A;  4RYE A;  1E25 A;  1ALQ A;  4GOG A;  4GS9 B;  3E98 A;  4OP5 A;  3MFX A;  3D72 A;  3PYP A;  1S0W A;  1P0Z A;  4MN6 A;  1VHM A;  4DMZ A;  5IHV A;  4XXR A;  1XGI A;  1DJA A;  3M2K A;  4R4R A;  4C3Q A;  3CHW P;  4HHD A;  2QMI A;  2M1C A;  2JBF A;  1BT5 A;  2V9A A;  3MQO A;  4UHU A;  3IF5 A;  1PNE A;  4Z9Q A;  2WKI A;  4G3W A;  2ZC3 B;  1BTL A;  5JYO A;  4DXC A;  2EFU A;  1VQQ A;  2H0T A;  3QP8 A;  4KUO A;  5KSC A;  1DP9 A;  4UA6 A;  3ZFZ A;  4S2N A;  2PR6 A;  4BBV A;  5EUA A;  3W4Q A;  4GS9 A;  1S67 L;  4KQO A;  2PU2 A;  1I5Q A;  1GA0 A;  2B5R A;  3MS6 A;  1XKZ A;  4CQH A;  5E2G A;  2XR0 A;  1RGY A;  1WYC A;  3I7J A;  2XQZ A;  3QP5 A;  2QKP A;  4JXG A;  3QNB A;  2Y2H A;  1YMX A;  4I5S A;  1N9N A;  2ACG A;  3BWL A;  1M40 A;  2OAQ 1;  4OP8 A;  2V0U A;  3U2A A;  2I9V A;  3NDG A;  1DY6 A;  3H82 A;  3VV4 A;  4Q0H A;  4CLC B;  2OWJ A;  2P9V B;  1VEU B;  4R1G A;  3UMD A;  4BJP A;  1LSV A;  3G31 A;  2WGI A;  4HBU A;  4NXB A;  4YNR A;  1Z09 A;  3WS4 A;  1YM1 A;  1DRM A;  1NRF A;  1YLT A;  3MQ0 A;  4G3K A;  3Q82 A;  2R9X A;  4OLG A;  4R3B A;  1XA1 A;  5EVI B;  4YIN A;  3FG8 A;  4UA9 A;  1UGU A;  4EES A;  4DRT A;  5GHX A;  3NJA A;  1Y4O A;  4S2J A;  4K08 A;  4EUV A;  4UA7 A;  2ZC5 B;  2ZQC A;  4CLC A;  2P9V A;  4Y2F A;  3BLS A;  5E43 A;  5F69 A;  3VP1 A;  3LEZ A;  3ZYT A;  3LO7 A;  1MKI A;  4EER A;  4HJ4 A;  5GLD A;  3Q07 A;  4DJ2 A;  5EVI A;  4O0P A;  2Z6C A;  3A0S A;  3LIB A;  2HP9 A;  1KGG A;  3PXP A;  1TVF A;  2CC1 A;  1N4O A;  1XXM A;  3DWZ A;  1YAX A;  2IWB A;  5KIZ A;  4X69 A;  3DTI A;  2K7S A;  4B9O A;  5CGW A;  5HDC A;  1NYY A;  4JLF A;  4E3I A;  3CUE A;  5CTM A;  2VZW A;  1XPB A;  2DNS A;  3C30 A;  3UPO A;  5FSR A;  1YKD A;  3SH7 A;  4PKY A;  2Y79 A;  4DE2 A;  4DDS A;  2W27 A;  2O9B A;  3PR6 A;  2V8F A;  4FUW A;  5KMW A;  1K57 C;  1CJF A;  3KYQ A;  5EOE A;  2M7V A;  4PAU A;  5FL3 A;  4H6J B;  3H9W A;  3B3X A;  4IUH A;  4FH4 A;  1ONH A;  5HDS A;  4FOF A;  4HEF A;  3HLD A;  2ZC7 A;  3LR5 A;  1NYM A;  1SKF A;  4FD8 A;  1XFN A;  4OOL A;  2J9O A;  3L7H A;  2EA9 A;  2ZM2 A;  2PYR A;  1FQG A;  5FQK A;  2HPB A;  2WGW B;  3UB6 A;  4C6Y A;  2Z2M B;  3BY8 A;  4EUZ A;  4LV2 A;  4E3K A;  4I38 A;  4KZ3 A;  2DRW A;  4P6Z M;  3CZD A;  4KZ8 A;  4Y7P A;  1PWG A;  2A2L A;  4YWZ A;  4Q0J A;  2VGL M;  1XJ6 A;  5CTN A;  1T18 A;  4MN5 A;  4F94 A;  2PBY A;  3GR2 A;  4H6J A;  4ME4 A;  1TS0 A;  2Y91 A;  4N1X A;  3A0R A;  3UPP A;  5GHY A;  4PM8 A;  3LY4 A;  4R4S A;  4LEN A;  4HNB A;  1K4F A;  2XD5 A;  1GHM A;  3KSI A;  4S2L A;  3IS2 A;  4R38 A;  5K5B A;  2H28 A;  4S2N C;  4WEJ A;  5A93 A;  3NBL A;  2I72 A;  1LI9 A;  1IYQ A;  3C7U A;  4EEU A;  5U47 A;  5GHZ A;  2EX9 A;  4GCZ A;  4GLQ A;  3UNW A;  4DN0 A;  4NG2 A;  3CWF A;  3V39 A;  3F1P B;  5HAR A;  4RX2 A;  4D2O A;  3MZF A;  4KZ9 A;  3U4L P;  5J7E A;  1WYB A;  4GJ4 A;  4EU0 A;  3IXG A;  3JVU A;  1OME A;  3EGD C;  1N9L A;  5AJG A;  4BWI A;  4MBF A;  3UME A;  1EI5 A;  2XK1 A;  2W3D A;  4F3L A;  3VE4 A;  1H0M A;  4XUX A;  3CMZ A;  2EXB A;  3CAX A;  4CPK A;  1ODV A;  3MSH A;  5FQI A;  5CER A;  2OLV A;  1HZO A;  3UE6 A;  5J3W A;  4BL2 A;  1Y28 A;  3DBA A;  3VMA A;  2IA2 A;  3ICY A;  1I2S A;  2QZ6 A;  3G30 A;  4I3A A;  2Y2G A;  4BEN A;  3K3D A;  3RXX A;  3ZNY A;  1FIL A;  3MXQ A;  3E0Y A;  3CPT B;  3L9K A;  5DJT A;  2P7J A;  2DCF A;  1J9M A;  3S7P A;  4ZRR A;  4JXW A;  1PZO A;  1OT6 A;  3IH9 A;  1HTZ A;  1S4S A;  3IWQ A;  4MMN A;  5CEC A;  3LYX A;  5TBM B;  1MY8 A;  3HUO A;  2EX2 A;  1BUE A;  1OJG A;  4KZB A;  3EOI A;  4JGQ A;  3V5M A;  3AGF A;  2Y2I A;  4KQD A;  3S1Y A;  3SH8 A;  4B93 A;  2JC7 A;  4EQ1 A;  3GV9 A;  3NCK A;  1K38 A;  1S1Z A;  1YLZ A;  2H0Y A;  2ZL1 A;  4LRZ E;  4EBP A;  5A91 A;  2D02 A;  4S2M A;  2HJE A;  5KZH A;  3IXB A;  3P7N A;  2WUQ A;  3CPT A;  2PAV P;  1ERO A;  1YLJ A;  2JKR M;  4E3J A;  1H8Y A;  4P0M A;  4MBH A;  2EX6 A;  3HL9 A;  3LR3 A;  3EWK A;  5CEB A;  3LR4 A;  4OQG A;  1XFQ A;  1FR1 A;  4OVD A;  5TBM A;  3UDI A;  3N8L A;  2JCH A;  4QY6 A;  1MZU A;  2Y2K A;  3PAG A;  4I3J A;  4II7 A;  4NKP A;  4JPM A;  3C5A A;  5L2F A;  1N9B A;  1JVJ A;  4CLC D;  5MC7 A;  1ZTU A;  2XFS A;  4G3V A;  1KDS A;  2Z6D A;  4UEY A;  3TW8 A; 
#chains in the Genus database with same CATH homology
 5FEF A;  4X1M A;  1SKO A;  4X1L A;  1FIL A;  3NEC A;  1SZV A;  3T12 B;  3NUL A;  3CPT B;  3L9K A;  2B95 A;  2JKF A;  1CQA A;  3MS6 A;  1CF0 A;  5EM0 A;  3T1S A;  4FTX A;  5FDS A;  1VEU A;  1YPR A;  3T1Q B;  1G5U A;  5EM1 A;  3T1R A;  2E8J A;  1VET A;  1AWI A;  4X25 A;  2ACG A;  4D60 A;  1A0K A;  1FIK A;  3DAV A;  3LEQ A;  2ZL1 A;  2VK3 A;  2PBD P;  1PRQ A;  1VEU B;  1SKO B;  1ACF A;  1HLU P;  2JKG A;  3LGO A;  1Z09 A;  1K0K A;  3CPT A;  2HZ5 A;  2PAV P;  2V8F A;  3U4L P;  5FEG A;  4FUW A;  2PRF A;  1J3W A;  1CJF A;  2ZL1 B;  3KYE A;  3CHW P;  1F2K A;  3L7H A;  1D1J A;  2BTF P;  5EV0 A;  1PNE A;  1VET B;  3UB5 P;  1PFL A;  4QWO A;  3MSH A;  3T1X A;  2V8C A;  5EVE A;  1Y4O A;  3D9Y A;  4ESP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...