5FDSA

Crystal structure of the monomeric allergen profilin (hev b 8)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
131
Chain Sequence
MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin-2
publication title Structural insights into the IgE mediated responses induced by the allergens Hev b 8 and Zea m 12 in their dimeric forms.
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Allergen
total genus 36
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 5fdsA00
2JKFA 3T12B 3MS6A 1VEUB 3NECA 2PRFA 2VK3A 2PAVP 4X1LA 5EM0A 1PNEA 5FEFA 1CJFA 3CPTA 3D9YA 3CHWP 3T1RA 3T1SA 4X25A 3L9KA 4FUWA 1Z09A 2HZ5A 4ESPA 1VETB 2V8FA 1ACFA 1CF0A 1G5UA 2E8JA 1AWIA 2ACGA 5FDSA 1PFLA 3T1XA 1VEUA 3T1QB 2V8CA 3LGOA 3L7HA 5FEGA 1HLUP 1SZVA 3UB5P 3CPTB 2ZL1B 1PRQA 1YPRA 1SKOB 1FILA 1F2KA 1D1JA 1K0KA 3DAVA 2JKGA 1VETA 3NULA 1FIKA 3U4LP 3MSHA 2BTFP 2PBDP 4QWOA 4FTXA 3LEQA 3KYEA 4D60A 1J3WA 5EV0A 2ZL1A 1Y4OA 5EVEA 1A0KA 1SKOA 5EM1A 2B95A 4X1MA 1CQAA
chains in the Genus database with same CATH superfamily
4IEDA 4KZ4A 1C3BA 1E3UA 4Y15A 3MXQA 1XJ3A 2HV1A 4BBVA 2VEAA 4HOIA 3F1OA 1V9YA 2V20A 3E0YA 1JTDA 2DNSA 4LRXC 4KZAA 4DXBA 2Y2NA 1YAXA 1NLYA 1FQGA 1ERMA 4ARZB 5CGXA 4QJGA 5HDDA 4FUWA 1I5QA 2H28A 4S2MA 2HDQA 2VJWA 3MKFA 1KGFA 4DJ3A 3PTEA 1ONGA 5EECA 4JXWA 4OPZA 4BBUA 2XDMA 1K55C 1KGEA 3QP5A 3KSIA 1JWVA 2G2WA 3ZG5A 5A92A 2WUQA 2A2LA 3ZVWA 3V3RA 3ZHHA 5FAQA 2V0UA 4PKYG 5HFOA 1KGGA 1SKOB 1E3UD 1K56A 2HDSA 2HDUA 2A24A 4KZ6A 2FZ0A 1LSXA 1S67L 2Y8HA 3K2NA 3HJIA 4WEKA 1XA7A 3M2JA 2W3GA 1DP8A 1L0FA 3E4QA 4OOMA 4I3IA 2R9XA 4R4SA 1DP9A 4EW7A 5AQBA 3JPUA 2XK1A 2BASA 1P9WA 1MWSA 4KG6A 3ITBA 2OAQ1 3LIEA 4Z1WA 3C7UA 4N9KA 1P9RA 4JF6A 5CEDA 4E04A 5HX9A 2HP6A 1H8MA 3DTEA 3OPLA 4NXEA 3WS2A 1DJCA 3OLOA 4X1LA 4OOLA 1K56D 3HLFA 1NRFA 4WL9A 3TG9A 2WKEA 3G32A 1ESUA 1NZOA 4ZJ2A 2A24B 4HJ3A 4NXFA 3KX0X 4BWIA 4OLDA 2D01A 2K7SA 2P9VA 4Q0IA 4PMAA 2E8JA 3D3OA 1YLYA 3T1XA 4EU0A 2V8CA 3L7HA 1YSPA 2J7VA 4OP5A 4QY6A 3W4PA 1KVMA 4NETA 2ZM8A 1OMEA 4M3KA 1N9BA 2KDKA 4KQDA 4L9FA 1CI8A 4CLCD 3HJKA 4I3JA 2W3HA 3GTCA 4K91A 3S4XA 4YNRA 3VV4A 3M6BA 3ZG7B 1Y54A 4LCLA 2GX5A 4S2PA 4D2OA 2A3UA 1K38A 4P6ZM 1UGUA 4PM7A 3N6IA 1OTAA 3OCLA 3VOLA 1PZPA 4WZ5A 4Y0UA 4EUZA 3KO6A 1CEFA 2C6WB 1J3WA 4KG5A 2FH5A 2BG1A 2PDRA 3SS5A 4HNBA 3LR3A 4JKTA 3JYIA 2YKFA 1ES3A 2VV7A 4I39A 4K0WA 1JTGA 3ULFA 3ZVTA 5AQ7A 2VV8A 3VE4A 5MC7A 3UB7A 4GDBA 3OBFA 3O3VA 3D9YA 3IF5A 4E3JA 3IH8A 4F94A 1S4RA 2V1AA 2HDRA 4WUJA 4ZDXA 1OJ5A 3QP1A 3P01A 2ZQ8A 5HSQA 1EI5A 5CRFA 3W2ZA 4NG2A 3S7PA 1LI0A 1RGZA 4UA9A 2V0WA 1GHIA 5EVIA 3UE3A 3UY6A 2P04A 3T4SA 4UEYA 3VSKA 3U2AA 5GHYA 3N7WA 3GR2A 5AJGA 3E2KA 3K3CA 1MWUA 3SH7A 1YT4A 3CPTB 2ZQCA 5KIZA 1P0ZA 4S2OA 1YPRA 4KZBA 1HD8A 4F3LA 2WYXA 2W27A 4Q0HA 2Q9MA 2WGIA 2CC1A 4YINA 1S4SA 5G4YA 3BM6A 1OPXA 4UHUA 4DE3A 5HW3A 1YM1A 3GRJA 4DN0A 2PR5A 3LIDA 1CK3A 4GHIA 2QMIA 5DKLA 3E4PA 1J9MA 4KUKA 5DF9A 2XD5A 3UNWA 1BLCA 5FI7A 2Y2QA 4BD1A 1XGIA 1ZHHB 1WYBA 5FA7A 3GMWA 5AVFA 4EUVA 3OOVA 1A0KA 4GDNA 2B95A 1N4OA 5EVID 3NDEA 3UB9A 4EETB 2HF6A 3BEBA 4S2NA 4GW9A 1LLBA 4QY5A 2JHEA 1VM1A 4CQHA 4I5SA 2PAVP 3EQUA 1XGJA 1ZC2A 2ZMVA 4GB7A 4KENB 1BLSA 4MNRA 4N92A 1TDLA 4F3LB 3T1SA 3EGXC 1HZOA 4B4XA 1PIOA 2J80A 1ACFA 4HQAA 3IXDA 2VA0A 3QP2A 4OVDA 4WLAA 3S1YA 4GHIB 3WS1A 2ACGA 1PFLA 3C7VA 4ZTKA 3V3SA 2Q0OA 1LSVA 3SOIA 3ZFZA 4WMCD 4WEJA 3FZCA 4B93A 5GLCA 4L9GA 1OJGA 1W7FA 2Q9NA 2O9BA 3PAEA 2B18A 5AQAA 2Y55A 4HH3A 4B9OA 1XJ4A 1SDNA 3O88A 4Y13A 1O07A 2PR6A 3G4PA 4HY8A 4P0MA 4KUOA 5FATA 1F5MA 3MZDA 2Y91A 3IS2B 4E3IA 2OLVA 3Q07A 4GD8A 5J8XA 1M6KA 4DDSA 2ZC4B 2DMWA 4FD8A 3DTMA 3ZG9B 1ES4A 1IEMA 4GCZA 3JVVA 4X55A 2QHKA 1U60A 1MBLA 2W3DA 3OPRA 5FAPA 4HI4A 1OTEA 3BRMA 2JKRM 4KZ3A 1KE0A 4C75A 1H0MA 3MMHA 5L07A 3OC2A 1XX2A 3MKEA 1Y28A 1K25A 2HJEA 4DE2A 4WZ5C 4NK3A 4HH2A 3LGOA 5DTKA 1LI9A 2X71A 4ZJ3A 2BLSA 2WGWB 4ME4A 2ZBBA 1ES5A 2JCHA 2M1CA 4XUXA 3K3DA 1GA9A 1SHVA 1OTBA 1YMSA 3PR6A 4E3MA 3LO7A 3B3XA 4PKYA 4RQ9A 4ZAMA 1HTZA 1S1ZA 5J7EA 1IFQA 4EBPA 4JGOA 1E25A 3PBRA 2JKGA 4O8GA 1K6RA 3Q7VA 4RVAA 3UE6A 5JYOA 4RX3A 4I38A 2DRWA 2MJ6A 3NBLA 5GL9A 4ARZA 3QNCA 4JGPA 3RTYA 3BFEA 1OTIA 1KDWA 3F1NB 1W8YA 4S2IA 5A90A 5HD5A 3BFDA 3T4JA 1MWRA 4ZJ1A 5F6AA 4OPRA 3DTIA 4HP9A 3VSLA 1GSWA 4NEED 1NXYA 3A0SA 1BLHA 1GSVA 5HAQA 3WWXA 4YOFA 4PM5A 1OT6A 3P98A 4LGWA 2WADA 4S2JA 2K31A 3H7WB 1MWTA 1DRMA 1EW0A 2XQZA 2V1ZA 2W1TA 3GVBA 1K57C 4Y17A 5KZHA 2WKRA 2D02A 4CPKA 2QPNA 2XR0A 5M1AA 2XD1A 3Q7VB 1TS6A 2YKHA 4QB8A 5EVLA 3UDIA 5CHMA 1HVBA 2VGLM 1LT0A 5KMWA 4P87A 3MFDA 2QWSA 4EEUA 4Q8IA 1Q2QA 4OP8A 2WKIA 5LBRA 4S2LA 1K54A 4BLMA 5FQMA 2W3FA 1SCWA 3T4KA 4L9EA 2IWBA 1BSGA 4DRTA 4S2NC 2Y79A 3ZYTA 4UA6A 1L0DA 5DF8A 5FQJA 4N1XA 4EV4A 3IBJA 4WF0A 3ZQ5A 5EFWA 4KG2A 2P7JA 4U0XA 1YLWA 1G6AA 4R70A 2W1TB 1BULA 2WK0A 3D4FA 2CMNA 5GLDA 1G28A 3AGFA 3C4OA 4KZ7A 2HJ9C 2AVXA 1MC0A 3C30A 3GSGA 3HLBA 1XJ6A 2OLUA 2PYRA 2Z2MB 3BYDA 2O9AA 3MBZA 4R3JA 3B33A 3P09A 2W0NA 4LENA 1BTLA 1PWCA 4IUHA 2VK3A 5EM0A 4DF6A 3G30A 2WGVA 5HL6A 4LV3A 4NXBA 4HIAA 3IT9A 1W63M 4LFUA 5A8BA 1TS8A 2H5SA 4L0LA 4KQQA 1G68A 3QP6A 4O0PA 4A5RA 3PBTA 2XROA 4E3KA 2JE5A 3MQOA 1PI5A 4C3QA 1PW1A 2H0TA 1VEUA 3T1QB 3UMDA 1L2SA 3B42A 3VP2A 5EUAA 2QJ7A 1ALQA 1MXOA 2XFTA 5FI2A 3UB5P 1LL5A 3RH8B 1PRQA 1W79A 3A3IA 3NIAA 5DTTA 3QHYA 4EEPA 5DFXA 1XP4A 1P97A 4R3AA 4GJ4A 3LIAA 3NI9A 4M4XA 4IJGA 3NOPC 3IF6B 4DE1A 3PXPA 1UWPX 3KYEA 4JGQA 4HEFA 4D60A 3LY4A 3CJMA 4BL2A 1AXBA 4X6TA 3NJAA 2G2UA 1GCEA 5E2GA 4R4RA 1ONHA 4GKUA 3VP1A 2J3WA 4OQGA 5CERA 1K4EA 3PHYA 1ES2A 5CECA 4G3KA 1VEUB 1S66L 3LICA 1ZKJA 3ZG8B 5E2EA 3G2YA 2J3TD 2K2NA 2KOIA 3CLOA 5L10A 5GLBA 5FDHA 1PNEA 1GHMA 4CLCE 3CPTA 3RJUA 4KZ8A 2LB9A 4KQRA 4BJPA 3FC7A 4JXSA 3HUNA 2UV0E 5TJJA 4JXGA 3W4QA 1Z09A 2HZ5A 3PBQA 5E2HA 3HREA 2OSUA 4PAUA 1QMFA 4JPMA 1T1AA 2GNXA 4JF5A 3LCEA 2ZC7A 5IHVA 1G5UA 3FPWA 1TS0A 2ZMFA 2WKHA 3FG8A 4Y7PA 3S7NA 4RYEA 2ZQDA 4ETXA 4C6YA 1CEGA 4BQMA 1TVFA 4KZ9A 1UWNX 4ZBEA 2IA2A 5FQQA 2E8IA 2GZAA 2PU2A 1YLTA 3ISGA 3PBOA 4JGRA 3N8RA 3G2ZA 3KYZA 3G6OA 3HLWA 3NULA 5CGWA 3PYPA 3UE1A 4GN2A 2GJ3A 5TBMA 1KOUA 3TJZC 1ODVA 3UDFA 5HZHA 4R3BA 4P6ZS 2PBDP 5TR7A 2HPBA 3G35A 4BL3A 3TOIA 1K57A 1TS7A 1WA9A 3CWFA 3HUMA 2EX2A 3Q1FA 2I72A 1F98A 2VZWA 3IX3A 5HPFA 5EVEA 5HWVA 3A0VA 5HAPA 4Z9QA 3V5MA 4NXGA 4OPYA 1IKIA 3NECA 1TEMA 2PRFA 1QMEA 3CMZA 3CI6A 5G4ZA 1K54C 4OKPA 4GD6A 5TFQA 3LEZA 3IWIA 3EEAA 2VGJA 3DBAA 2ZOHA 3WRTA 2V8FA 4P6BA 3MFXA 1V9ZA 4PM9A 2JN7A 4AFIA 2Y2MA 4LRZE 5TBMB 4FSFA 3LY3A 1T1CA 4R23A 2Y4AA 2WZXA 3MXRA 3A3EA 5CTMA 3UDXA 3BY8A 3MZEA 2XA7M 4Y2FA 2LB5A 2ZQAA 1FCMA 4OLGA 4WYYA 1G6OA 2XLNA 3BW6A 1NYMA 4R6LA 3A0RA 1T1BA 2X01A 4LLOB 1XXMA 4PPRA 3IS2A 3HUOA 4E6XA 4Y5FA 3DW0A 3GQZA 1ERQA 4ETZA 2BTFP 3BLMA 3C5AA 3HLDA 5F5YA 3CZDA 3LEQA 2J9PA 3BQAA 1D06A 3OPPA 3KSHA 2NUPC 2O99A 4MEZA 4FH4A 2Y2PA 1D7EA 4MCWA 1T18A 3UO9A 5F68A 1W63Q 1W8QA 3SS4A 2WGWA 4LPZA 5D3OA 1K4FA 4FH2A 2J3TC 5A91A 2L4RA 3VFFA 1FCOA 2XA7S 4X56A 3ZDJA 1YLZA 1EROA 3QP8A 3O5YA 4E3OA 4GNUA 3DWZA 5J3WA 3IQAA 3T4LA 3AGDA 5I94A 3MQ0A 2XRNA 1AWIA 1I2WA 3VE3A 4HHDA 5AVEA 3W8KA 5FQIA 1FR1A 1SKFA 4FOFA 3F1NA 3JVUA 1IELA 1XPBA 3W4OA 1IYSA 2H0YA 3EOIA 4U3TA 1NZUA 3IWOA 3VP3A 3DTKA 3KSFA 1WYCA 3ZG0A 3ICYA 3IXHA 1H8YA 3HLCA 2WAEA 5J4EA 4Y3IA 3UN7A 1VHMA 4MBKA 1XFQA 3H7WA 4YWZA 2OV5A 4FTXA 3SZTA 2R78A 5HD3A 2V9AA 3ZNYA 4KZ5A 2Y59A 3BFGA 4DE0A 1F9IA 4YFMA 2Y2KA 4HBTA 3GDIA 5EM1A 1FCNA 3RXXA 2JKFA 1FR6A 3HVFA 1W5DA 3P7NA 3WS5A 4IUKA 1JWZA 2L0WA 1N9NA 4Q0JA 4UQIM 2EFUA 2W1RA 2WKQA 5I5LA 1KE3A 4LCMA 1MKMA 4S2KA 3UB6A 3IXBA 1MZUA 3FKVA 2ZC6B 1XFNA 4IVKA 3NOUC 3CHWP 2B5RA 4BENA 3T1RA 1YKDA 5E2FA 2VKSA 3Q82A 3L9KA 5EPHA 4IHQA 3WRZA 3S7OA 3SH9A 3CITA 4PHTA 3BLSA 3T4QA 2JKTI 1GA0A 2INWA 2HP9A 1CI9A 4QPRA 2ZQ7A 3C4PA 2WZZA 3BWLA 3NCKA 4RX2A 5DJTA 2ZD8A 3LR5A 3CAXA 3VP0A 1SZVA 2PBYA 3LFVA 2EFXA 3OCNA 5FQKA 1FILA 2KLIA 1BT5A 1PWDA 3ZNTA 3CUEA 2KX6A 3DAVA 1VETA 4OOYA 1RCJA 1BLPA 3NHQA 1FIKA 2XSSA 5CTNA 5F69A 3U4LP 5M19A 4GZBA 2EX6A 5M18A 2JKRI 4UQIS 4EBNA 3BJNA 5EOEA 3EWKA 4ZRRA 3N8LA 3LR4A 2ZM2A 4HJ6A 5C5KA 2XF3A 2VX8A 2ZL1A 2DCFA 4WN5A 2QKPA 4X1MA 3T12B 4HESA 5DJUA 3S7QA 1STZA 5CX7A 5F82A 3V50A 1YQSA 2PD8A 3UPOA 4EQIA 5EE8A 1PZOA 3BY9A 3IBRA 1EWZA 2ZMAA 4B88A 1PW8A 1BUEA 4LV1A 4PM6A 5FAOA 2QZ6A 2Z6DA 1YLJA 3T4OA 1VETB 4ESPA 3UPPA 3BQ8A 2WKPA 1XKZA 2ZC3B 2FFYA 4LV0A 4X69A 3A3JA 5FDSA 2GDNA 2VGLS 3FV7A 5HAIA 4UAAA 3IF6A 3F1OB 3T4TA 1E4DA 4II7A 2G7UA 2EXAA 4G3VA 4WBGA 4X53A 4X68A 1PI4A 1LL8A 2EWWA 2ZL1B 4U0TA 1L3LA 1BYWA 1TF1A 5IU1A 2X02A 1PYYA 3LI9A 2JBFA 1LSWA 2A49A 5GLAA 3FYZA 3FWLA 2Y2LA 4PM8A 3MSHA 1I2SA 4CLCA 5HARA 2EXBA 4E3NA 4HBUA 3M6HA 3MQQA 4N9LA 3S22A 5F1GA 5HPIA 4EQ1A 1NWZA 3KSGA 2XFSA 1L0EA 1FOFA 2VLGA 4OONA 2Y2OA 4R1GA 5EV0A 3UMEA 2V1BA 2EA9A 5TGFA 1S1YA 4BBTA 5E43A 4WZ4A 3LI8A 1GSXA 4OQHA 4E6WA 1XJ2A 3WS0A 4JF4A 1Q2PA 3NC8A 2HGVA 3GECA 4QU3A 4FCFA 2Y2GA 2XEPA 1DJBA 1SDEA 3F1PA 3O86A 3Q7ZA 5L09A 3IWQA 3OPHA 4DXCA 1IYPA 1NLZA 1NRJA 3SH8A 1X0OA 5FL3A 1NY0A 4P85A 1PWGA 1JWPA 4CLCB 2ZM0A 3HL9A 3IH9A 4MDZA 1MKIA 4OH0A 1NJ4A 1ZG4A 5FEGA 2EX9A 3NOTC 5HDCA 1IKGA 5FSRA 3IHAA 2Z6CA 3VOYA 3KYQA 2I9VA 2OWJA 3LR0A 3IHBA 5EOOA 4DKIA 5FI6A 4MBHA 5BOHA 1T19A 3D72A 2EWVA 4MN5A 3CG5A 3N4IA 2IWCA 2ZQ9A 2P9VB 4EESA 1KVLA 2V2FF 2QYBA 3MXSA 4GS9A 1OT9A 2EX8A 4IBXA 3T50A 3F1PB 4G3WA 3N8SA 5GHZA 1IOUA 5CHUA 2J8YA 1YSQA 3PBSA 5JYPA 4JXVA 2FFFB 4QHCA 1Y4OA 4LV2A 2Y2IA 4R0QA 1ZTUA 5DF7A 3VFHA 2OWHA 3PAGA 4I3AA 3G31A 3ZGAB 2RL3A 3LUQA 3SW1A 3H9WA 4DDYA 5FEFA 1CJFA 2QJ5A 4Y0OA 1FSYA 4OPQA 3CUEC 1DJAA 5CHJA 1H5XA 1NYYA 4MMNA 1RGYA 2L1MA 4O7DA 4CJNA 4XXRA 2J9OA 4JLFA 4GS9B 3QNBA 2B02A 3C8CA 3H82A 1DY6A 4LRYC 2Y2JA 3C38A 5F1FA 3MR0A 2ZJ9A 3R7WA 3OZHA 4EBLA 1YMXA 4MLLA 1M40A 1D1JA 4O01A 3HLEA 3RXWA 1H8ZA 4OQ0A 5DFYA 4QD4A 4GLQA 4WMCA 1JNUA 2ZC5B 1XA1A 1H3QA 1ZG6A 3NY4A 5EVIB 5HWWA 2H10A 4RA7A 5FQ9A 4QWOA 1MPLA 1K55A 5CEBA 4E3LA 3LYXA 4N1HA 5U47A 4XT2A 3UPNA 3MZFA 3AGEA 3A3DA 4EXOA 3A3FA 4K08A 3V67A 2Y2HA 5KSCA 2O9CA 3MS6A 4B4ZA 5FASA 5L2FA 4H6JA 3IF6C 3QP4A 3H82B 5DVAA 3V39A 3HCYA 5DTSA 1GHPA 2PHYA 4HP4A 3R7WB 1RP5A 3FPVA 2PT7A 4X25A 2IWDA 3B47A 5A93A 5IT5A 3ZCZA 3E98A 4XUZA 3TRCA 4CLCC 3E4OA 3UB8A 3IXGA 1S6RA 4R38A 5G18A 3EGDC 1OTDA 1Z6FA 5CXWA 1HLUP 4H8RA 1IYQA 4UA7A 4XT2B 3BFFA 2UWXA 2JKTM 3VP4A 3VMAA 2R9WA 4H6JB 1K0KA 4MN6A 3IX4A 1S0WA 5CGSA 2ZOIA 1KDSA 4KQOA 2NUTC 5KSHA 4DMZA 5HWTA 5K5BA 2PU4A 2M7VA 4JBFA 4EERA 3I7JA 4DJ2A 4IBRA 4BMWA 2PYPA 2VV6A 3G34A 5DKKA 3GV9A 3SS3A 1VB6A 3EEHA 4EWFA 2W3EA 1LL9A 5HL1A 4MN7A 3E2LA 1IYOA 5GHXA 4WM9A 2ZLYA 3LIBA 5HDSA 2XH9A 3EQVA 1BZAA 2HP5A 1N9LA 4Y0TA 3RFBA 3UE0A 3IX8A 3MJQA 1ESIA 3ITAA 4ID4A 1DP6A 3M2KA 1K6SA 1LHYA 3TW8A 4WELA 3NDGA 3HBRA 1WE4A 3R4KA 2PD7A 1YLPA 2P08A 2JC7A 4OQIA 1CF0A 1FSWA 2M7UA 3O87A 3LIFA 4BD0A 1KE4A 2RCXA 1JVJA 1O7EA 2WAFA 4MBFA 4NKPA 2Z2LB 3HLGA 3C2WA 3TSGA 3DWKA 1VQQA 5F83A 1F2KA 4HJ4A 1N9OA 2P74A 5IS1A 5L8MA 2VGKA 4K0XA 1MY8A 2OAP1 2O0YA 5EVIC 3BFCA 1L0GA 5AQ9A 3WS4A 3FKWA 2XGNA 4GOGA 4IVIA 3Q81A 2OOLA 3VOZA 3TE8A 3BECA 1TD5A 2C5WB 3MF0A 3PBNA 1SKOA 1TDGA 1CQAA
chains in the Genus database with same CATH topology
2JKFA 3T12B 3MS6A 1VEUB 3NECA 2PRFA 2VK3A 2PAVP 4X1LA 5EM0A 1PNEA 5FEFA 1CJFA 3CPTA 3D9YA 3CHWP 3T1RA 3T1SA 4X25A 3L9KA 4FUWA 1Z09A 2HZ5A 4ESPA 1VETB 2V8FA 1ACFA 1CF0A 1G5UA 2E8JA 1AWIA 2ACGA 5FDSA 1PFLA 3T1XA 1VEUA 3T1QB 2V8CA 3LGOA 3L7HA 5FEGA 1HLUP 1SZVA 3UB5P 3CPTB 2ZL1B 1PRQA 1YPRA 1SKOB 1FILA 1F2KA 1D1JA 1K0KA 3DAVA 2JKGA 1VETA 3NULA 1FIKA 3U4LP 3MSHA 2BTFP 2PBDP 4QWOA 4FTXA 3LEQA 3KYEA 4D60A 1J3WA 5EV0A 2ZL1A 1Y4OA 5EVEA 1A0KA 1SKOA 5EM1A 2B95A 4X1MA 1CQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JKF A;  3T12 B;  3MS6 A;  1VEU B;  3NEC A;  2PRF A;  2VK3 A;  2PAV P;  4X1L A;  5EM0 A;  1PNE A;  5FEF A;  1CJF A;  3CPT A;  3D9Y A;  3CHW P;  3T1R A;  3T1S A;  4X25 A;  3L9K A;  4FUW A;  1Z09 A;  2HZ5 A;  4ESP A;  1VET B;  2V8F A;  1ACF A;  1CF0 A;  1G5U A;  2E8J A;  1AWI A;  2ACG A;  5FDS A;  1PFL A;  3T1X A;  1VEU A;  3T1Q B;  2V8C A;  3LGO A;  3L7H A;  5FEG A;  1HLU P;  1SZV A;  3UB5 P;  3CPT B;  2ZL1 B;  1PRQ A;  1YPR A;  1SKO B;  1FIL A;  1F2K A;  1D1J A;  1K0K A;  3DAV A;  2JKG A;  1VET A;  3NUL A;  1FIK A;  3U4L P;  3MSH A;  2BTF P;  2PBD P;  4QWO A;  4FTX A;  3LEQ A;  3KYE A;  4D60 A;  1J3W A;  5EV0 A;  2ZL1 A;  1Y4O A;  5EVE A;  1A0K A;  1SKO A;  5EM1 A;  2B95 A;  4X1M A;  1CQA A; 
#chains in the Genus database with same CATH topology
 4IED A;  4KZ4 A;  1C3B A;  1E3U A;  4Y15 A;  3MXQ A;  1XJ3 A;  2HV1 A;  4BBV A;  2VEA A;  4HOI A;  3F1O A;  1V9Y A;  2V20 A;  3E0Y A;  1JTD A;  2DNS A;  4LRX C;  4KZA A;  4DXB A;  2Y2N A;  1YAX A;  1NLY A;  1FQG A;  1ERM A;  4ARZ B;  5CGX A;  4QJG A;  5HDD A;  4FUW A;  1I5Q A;  2H28 A;  4S2M A;  2HDQ A;  2VJW A;  3MKF A;  1KGF A;  4DJ3 A;  3PTE A;  1ONG A;  5EEC A;  4JXW A;  4OPZ A;  4BBU A;  2XDM A;  1K55 C;  1KGE A;  3QP5 A;  3KSI A;  1JWV A;  2G2W A;  3ZG5 A;  5A92 A;  2WUQ A;  2A2L A;  3ZVW A;  3V3R A;  3ZHH A;  5FAQ A;  2V0U A;  4PKY G;  5HFO A;  1KGG A;  1SKO B;  1E3U D;  1K56 A;  2HDS A;  2HDU A;  2A24 A;  4KZ6 A;  2FZ0 A;  1LSX A;  1S67 L;  2Y8H A;  3K2N A;  3HJI A;  4WEK A;  1XA7 A;  3M2J A;  2W3G A;  1DP8 A;  1L0F A;  3E4Q A;  4OOM A;  4I3I A;  2R9X A;  4R4S A;  1DP9 A;  4EW7 A;  5AQB A;  3JPU A;  2XK1 A;  2BAS A;  1P9W A;  1MWS A;  4KG6 A;  3ITB A;  2OAQ 1;  3LIE A;  4Z1W A;  3C7U A;  4N9K A;  1P9R A;  4JF6 A;  5CED A;  4E04 A;  5HX9 A;  2HP6 A;  1H8M A;  3DTE A;  3OPL A;  4NXE A;  3WS2 A;  1DJC A;  3OLO A;  4X1L A;  4OOL A;  1K56 D;  3HLF A;  1NRF A;  4WL9 A;  3TG9 A;  2WKE A;  3G32 A;  1ESU A;  1NZO A;  4ZJ2 A;  2A24 B;  4HJ3 A;  4NXF A;  3KX0 X;  4BWI A;  4OLD A;  2D01 A;  2K7S A;  2P9V A;  4Q0I A;  4PMA A;  2E8J A;  3D3O A;  1YLY A;  3T1X A;  4EU0 A;  2V8C A;  3L7H A;  1YSP A;  2J7V A;  4OP5 A;  4QY6 A;  3W4P A;  1KVM A;  4NET A;  2ZM8 A;  1OME A;  4M3K A;  1N9B A;  2KDK A;  4KQD A;  4L9F A;  1CI8 A;  4CLC D;  3HJK A;  4I3J A;  2W3H A;  3GTC A;  4K91 A;  3S4X A;  4YNR A;  3VV4 A;  3M6B A;  3ZG7 B;  1Y54 A;  4LCL A;  2GX5 A;  4S2P A;  4D2O A;  2A3U A;  1K38 A;  4P6Z M;  1UGU A;  4PM7 A;  3N6I A;  1OTA A;  3OCL A;  3VOL A;  1PZP A;  4WZ5 A;  4Y0U A;  4EUZ A;  3KO6 A;  1CEF A;  2C6W B;  1J3W A;  4KG5 A;  2FH5 A;  2BG1 A;  2PDR A;  3SS5 A;  4HNB A;  3LR3 A;  4JKT A;  3JYI A;  2YKF A;  1ES3 A;  2VV7 A;  4I39 A;  4K0W A;  1JTG A;  3ULF A;  3ZVT A;  5AQ7 A;  2VV8 A;  3VE4 A;  5MC7 A;  3UB7 A;  4GDB A;  3OBF A;  3O3V A;  3D9Y A;  3IF5 A;  4E3J A;  3IH8 A;  4F94 A;  1S4R A;  2V1A A;  2HDR A;  4WUJ A;  4ZDX A;  1OJ5 A;  3QP1 A;  3P01 A;  2ZQ8 A;  5HSQ A;  1EI5 A;  5CRF A;  3W2Z A;  4NG2 A;  3S7P A;  1LI0 A;  1RGZ A;  4UA9 A;  2V0W A;  1GHI A;  5EVI A;  3UE3 A;  3UY6 A;  2P04 A;  3T4S A;  4UEY A;  3VSK A;  3U2A A;  5GHY A;  3N7W A;  3GR2 A;  5AJG A;  3E2K A;  3K3C A;  1MWU A;  3SH7 A;  1YT4 A;  3CPT B;  2ZQC A;  5KIZ A;  1P0Z A;  4S2O A;  1YPR A;  4KZB A;  1HD8 A;  4F3L A;  2WYX A;  2W27 A;  4Q0H A;  2Q9M A;  2WGI A;  2CC1 A;  4YIN A;  1S4S A;  5G4Y A;  3BM6 A;  1OPX A;  4UHU A;  4DE3 A;  5HW3 A;  1YM1 A;  3GRJ A;  4DN0 A;  2PR5 A;  3LID A;  1CK3 A;  4GHI A;  2QMI A;  5DKL A;  3E4P A;  1J9M A;  4KUK A;  5DF9 A;  2XD5 A;  3UNW A;  1BLC A;  5FI7 A;  2Y2Q A;  4BD1 A;  1XGI A;  1ZHH B;  1WYB A;  5FA7 A;  3GMW A;  5AVF A;  4EUV A;  3OOV A;  1A0K A;  4GDN A;  2B95 A;  1N4O A;  5EVI D;  3NDE A;  3UB9 A;  4EET B;  2HF6 A;  3BEB A;  4S2N A;  4GW9 A;  1LLB A;  4QY5 A;  2JHE A;  1VM1 A;  4CQH A;  4I5S A;  2PAV P;  3EQU A;  1XGJ A;  1ZC2 A;  2ZMV A;  4GB7 A;  4KEN B;  1BLS A;  4MNR A;  4N92 A;  1TDL A;  4F3L B;  3T1S A;  3EGX C;  1HZO A;  4B4X A;  1PIO A;  2J80 A;  1ACF A;  4HQA A;  3IXD A;  2VA0 A;  3QP2 A;  4OVD A;  4WLA A;  3S1Y A;  4GHI B;  3WS1 A;  2ACG A;  1PFL A;  3C7V A;  4ZTK A;  3V3S A;  2Q0O A;  1LSV A;  3SOI A;  3ZFZ A;  4WMC D;  4WEJ A;  3FZC A;  4B93 A;  5GLC A;  4L9G A;  1OJG A;  1W7F A;  2Q9N A;  2O9B A;  3PAE A;  2B18 A;  5AQA A;  2Y55 A;  4HH3 A;  4B9O A;  1XJ4 A;  1SDN A;  3O88 A;  4Y13 A;  1O07 A;  2PR6 A;  3G4P A;  4HY8 A;  4P0M A;  4KUO A;  5FAT A;  1F5M A;  3MZD A;  2Y91 A;  3IS2 B;  4E3I A;  2OLV A;  3Q07 A;  4GD8 A;  5J8X A;  1M6K A;  4DDS A;  2ZC4 B;  2DMW A;  4FD8 A;  3DTM A;  3ZG9 B;  1ES4 A;  1IEM A;  4GCZ A;  3JVV A;  4X55 A;  2QHK A;  1U60 A;  1MBL A;  2W3D A;  3OPR A;  5FAP A;  4HI4 A;  1OTE A;  3BRM A;  2JKR M;  4KZ3 A;  1KE0 A;  4C75 A;  1H0M A;  3MMH A;  5L07 A;  3OC2 A;  1XX2 A;  3MKE A;  1Y28 A;  1K25 A;  2HJE A;  4DE2 A;  4WZ5 C;  4NK3 A;  4HH2 A;  3LGO A;  5DTK A;  1LI9 A;  2X71 A;  4ZJ3 A;  2BLS A;  2WGW B;  4ME4 A;  2ZBB A;  1ES5 A;  2JCH A;  2M1C A;  4XUX A;  3K3D A;  1GA9 A;  1SHV A;  1OTB A;  1YMS A;  3PR6 A;  4E3M A;  3LO7 A;  3B3X A;  4PKY A;  4RQ9 A;  4ZAM A;  1HTZ A;  1S1Z A;  5J7E A;  1IFQ A;  4EBP A;  4JGO A;  1E25 A;  3PBR A;  2JKG A;  4O8G A;  1K6R A;  3Q7V A;  4RVA A;  3UE6 A;  5JYO A;  4RX3 A;  4I38 A;  2DRW A;  2MJ6 A;  3NBL A;  5GL9 A;  4ARZ A;  3QNC A;  4JGP A;  3RTY A;  3BFE A;  1OTI A;  1KDW A;  3F1N B;  1W8Y A;  4S2I A;  5A90 A;  5HD5 A;  3BFD A;  3T4J A;  1MWR A;  4ZJ1 A;  5F6A A;  4OPR A;  3DTI A;  4HP9 A;  3VSL A;  1GSW A;  4NEE D;  1NXY A;  3A0S A;  1BLH A;  1GSV A;  5HAQ A;  3WWX A;  4YOF A;  4PM5 A;  1OT6 A;  3P98 A;  4LGW A;  2WAD A;  4S2J A;  2K31 A;  3H7W B;  1MWT A;  1DRM A;  1EW0 A;  2XQZ A;  2V1Z A;  2W1T A;  3GVB A;  1K57 C;  4Y17 A;  5KZH A;  2WKR A;  2D02 A;  4CPK A;  2QPN A;  2XR0 A;  5M1A A;  2XD1 A;  3Q7V B;  1TS6 A;  2YKH A;  4QB8 A;  5EVL A;  3UDI A;  5CHM A;  1HVB A;  2VGL M;  1LT0 A;  5KMW A;  4P87 A;  3MFD A;  2QWS A;  4EEU A;  4Q8I A;  1Q2Q A;  4OP8 A;  2WKI A;  5LBR A;  4S2L A;  1K54 A;  4BLM A;  5FQM A;  2W3F A;  1SCW A;  3T4K A;  4L9E A;  2IWB A;  1BSG A;  4DRT A;  4S2N C;  2Y79 A;  3ZYT A;  4UA6 A;  1L0D A;  5DF8 A;  5FQJ A;  4N1X A;  4EV4 A;  3IBJ A;  4WF0 A;  3ZQ5 A;  5EFW A;  4KG2 A;  2P7J A;  4U0X A;  1YLW A;  1G6A A;  4R70 A;  2W1T B;  1BUL A;  2WK0 A;  3D4F A;  2CMN A;  5GLD A;  1G28 A;  3AGF A;  3C4O A;  4KZ7 A;  2HJ9 C;  2AVX A;  1MC0 A;  3C30 A;  3GSG A;  3HLB A;  1XJ6 A;  2OLU A;  2PYR A;  2Z2M B;  3BYD A;  2O9A A;  3MBZ A;  4R3J A;  3B33 A;  3P09 A;  2W0N A;  4LEN A;  1BTL A;  1PWC A;  4IUH A;  2VK3 A;  5EM0 A;  4DF6 A;  3G30 A;  2WGV A;  5HL6 A;  4LV3 A;  4NXB A;  4HIA A;  3IT9 A;  1W63 M;  4LFU A;  5A8B A;  1TS8 A;  2H5S A;  4L0L A;  4KQQ A;  1G68 A;  3QP6 A;  4O0P A;  4A5R A;  3PBT A;  2XRO A;  4E3K A;  2JE5 A;  3MQO A;  1PI5 A;  4C3Q A;  1PW1 A;  2H0T A;  1VEU A;  3T1Q B;  3UMD A;  1L2S A;  3B42 A;  3VP2 A;  5EUA A;  2QJ7 A;  1ALQ A;  1MXO A;  2XFT A;  5FI2 A;  3UB5 P;  1LL5 A;  3RH8 B;  1PRQ A;  1W79 A;  3A3I A;  3NIA A;  5DTT A;  3QHY A;  4EEP A;  5DFX A;  1XP4 A;  1P97 A;  4R3A A;  4GJ4 A;  3LIA A;  3NI9 A;  4M4X A;  4IJG A;  3NOP C;  3IF6 B;  4DE1 A;  3PXP A;  1UWP X;  3KYE A;  4JGQ A;  4HEF A;  4D60 A;  3LY4 A;  3CJM A;  4BL2 A;  1AXB A;  4X6T A;  3NJA A;  2G2U A;  1GCE A;  5E2G A;  4R4R A;  1ONH A;  4GKU A;  3VP1 A;  2J3W A;  4OQG A;  5CER A;  1K4E A;  3PHY A;  1ES2 A;  5CEC A;  4G3K A;  1VEU B;  1S66 L;  3LIC A;  1ZKJ A;  3ZG8 B;  5E2E A;  3G2Y A;  2J3T D;  2K2N A;  2KOI A;  3CLO A;  5L10 A;  5GLB A;  5FDH A;  1PNE A;  1GHM A;  4CLC E;  3CPT A;  3RJU A;  4KZ8 A;  2LB9 A;  4KQR A;  4BJP A;  3FC7 A;  4JXS A;  3HUN A;  2UV0 E;  5TJJ A;  4JXG A;  3W4Q A;  1Z09 A;  2HZ5 A;  3PBQ A;  5E2H A;  3HRE A;  2OSU A;  4PAU A;  1QMF A;  4JPM A;  1T1A A;  2GNX A;  4JF5 A;  3LCE A;  2ZC7 A;  5IHV A;  1G5U A;  3FPW A;  1TS0 A;  2ZMF A;  2WKH A;  3FG8 A;  4Y7P A;  3S7N A;  4RYE A;  2ZQD A;  4ETX A;  4C6Y A;  1CEG A;  4BQM A;  1TVF A;  4KZ9 A;  1UWN X;  4ZBE A;  2IA2 A;  5FQQ A;  2E8I A;  2GZA A;  2PU2 A;  1YLT A;  3ISG A;  3PBO A;  4JGR A;  3N8R A;  3G2Z A;  3KYZ A;  3G6O A;  3HLW A;  3NUL A;  5CGW A;  3PYP A;  3UE1 A;  4GN2 A;  2GJ3 A;  5TBM A;  1KOU A;  3TJZ C;  1ODV A;  3UDF A;  5HZH A;  4R3B A;  4P6Z S;  2PBD P;  5TR7 A;  2HPB A;  3G35 A;  4BL3 A;  3TOI A;  1K57 A;  1TS7 A;  1WA9 A;  3CWF A;  3HUM A;  2EX2 A;  3Q1F A;  2I72 A;  1F98 A;  2VZW A;  3IX3 A;  5HPF A;  5EVE A;  5HWV A;  3A0V A;  5HAP A;  4Z9Q A;  3V5M A;  4NXG A;  4OPY A;  1IKI A;  3NEC A;  1TEM A;  2PRF A;  1QME A;  3CMZ A;  3CI6 A;  5G4Z A;  1K54 C;  4OKP A;  4GD6 A;  5TFQ A;  3LEZ A;  3IWI A;  3EEA A;  2VGJ A;  3DBA A;  2ZOH A;  3WRT A;  2V8F A;  4P6B A;  3MFX A;  1V9Z A;  4PM9 A;  2JN7 A;  4AFI A;  2Y2M A;  4LRZ E;  5TBM B;  4FSF A;  3LY3 A;  1T1C A;  4R23 A;  2Y4A A;  2WZX A;  3MXR A;  3A3E A;  5CTM A;  3UDX A;  3BY8 A;  3MZE A;  2XA7 M;  4Y2F A;  2LB5 A;  2ZQA A;  1FCM A;  4OLG A;  4WYY A;  1G6O A;  2XLN A;  3BW6 A;  1NYM A;  4R6L A;  3A0R A;  1T1B A;  2X01 A;  4LLO B;  1XXM A;  4PPR A;  3IS2 A;  3HUO A;  4E6X A;  4Y5F A;  3DW0 A;  3GQZ A;  1ERQ A;  4ETZ A;  2BTF P;  3BLM A;  3C5A A;  3HLD A;  5F5Y A;  3CZD A;  3LEQ A;  2J9P A;  3BQA A;  1D06 A;  3OPP A;  3KSH A;  2NUP C;  2O99 A;  4MEZ A;  4FH4 A;  2Y2P A;  1D7E A;  4MCW A;  1T18 A;  3UO9 A;  5F68 A;  1W63 Q;  1W8Q A;  3SS4 A;  2WGW A;  4LPZ A;  5D3O A;  1K4F A;  4FH2 A;  2J3T C;  5A91 A;  2L4R A;  3VFF A;  1FCO A;  2XA7 S;  4X56 A;  3ZDJ A;  1YLZ A;  1ERO A;  3QP8 A;  3O5Y A;  4E3O A;  4GNU A;  3DWZ A;  5J3W A;  3IQA A;  3T4L A;  3AGD A;  5I94 A;  3MQ0 A;  2XRN A;  1AWI A;  1I2W A;  3VE3 A;  4HHD A;  5AVE A;  3W8K A;  5FQI A;  1FR1 A;  1SKF A;  4FOF A;  3F1N A;  3JVU A;  1IEL A;  1XPB A;  3W4O A;  1IYS A;  2H0Y A;  3EOI A;  4U3T A;  1NZU A;  3IWO A;  3VP3 A;  3DTK A;  3KSF A;  1WYC A;  3ZG0 A;  3ICY A;  3IXH A;  1H8Y A;  3HLC A;  2WAE A;  5J4E A;  4Y3I A;  3UN7 A;  1VHM A;  4MBK A;  1XFQ A;  3H7W A;  4YWZ A;  2OV5 A;  4FTX A;  3SZT A;  2R78 A;  5HD3 A;  2V9A A;  3ZNY A;  4KZ5 A;  2Y59 A;  3BFG A;  4DE0 A;  1F9I A;  4YFM A;  2Y2K A;  4HBT A;  3GDI A;  5EM1 A;  1FCN A;  3RXX A;  2JKF A;  1FR6 A;  3HVF A;  1W5D A;  3P7N A;  3WS5 A;  4IUK A;  1JWZ A;  2L0W A;  1N9N A;  4Q0J A;  4UQI M;  2EFU A;  2W1R A;  2WKQ A;  5I5L A;  1KE3 A;  4LCM A;  1MKM A;  4S2K A;  3UB6 A;  3IXB A;  1MZU A;  3FKV A;  2ZC6 B;  1XFN A;  4IVK A;  3NOU C;  3CHW P;  2B5R A;  4BEN A;  3T1R A;  1YKD A;  5E2F A;  2VKS A;  3Q82 A;  3L9K A;  5EPH A;  4IHQ A;  3WRZ A;  3S7O A;  3SH9 A;  3CIT A;  4PHT A;  3BLS A;  3T4Q A;  2JKT I;  1GA0 A;  2INW A;  2HP9 A;  1CI9 A;  4QPR A;  2ZQ7 A;  3C4P A;  2WZZ A;  3BWL A;  3NCK A;  4RX2 A;  5DJT A;  2ZD8 A;  3LR5 A;  3CAX A;  3VP0 A;  1SZV A;  2PBY A;  3LFV A;  2EFX A;  3OCN A;  5FQK A;  1FIL A;  2KLI A;  1BT5 A;  1PWD A;  3ZNT A;  3CUE A;  2KX6 A;  3DAV A;  1VET A;  4OOY A;  1RCJ A;  1BLP A;  3NHQ A;  1FIK A;  2XSS A;  5CTN A;  5F69 A;  3U4L P;  5M19 A;  4GZB A;  2EX6 A;  5M18 A;  2JKR I;  4UQI S;  4EBN A;  3BJN A;  5EOE A;  3EWK A;  4ZRR A;  3N8L A;  3LR4 A;  2ZM2 A;  4HJ6 A;  5C5K A;  2XF3 A;  2VX8 A;  2ZL1 A;  2DCF A;  4WN5 A;  2QKP A;  4X1M A;  3T12 B;  4HES A;  5DJU A;  3S7Q A;  1STZ A;  5CX7 A;  5F82 A;  3V50 A;  1YQS A;  2PD8 A;  3UPO A;  4EQI A;  5EE8 A;  1PZO A;  3BY9 A;  3IBR A;  1EWZ A;  2ZMA A;  4B88 A;  1PW8 A;  1BUE A;  4LV1 A;  4PM6 A;  5FAO A;  2QZ6 A;  2Z6D A;  1YLJ A;  3T4O A;  1VET B;  4ESP A;  3UPP A;  3BQ8 A;  2WKP A;  1XKZ A;  2ZC3 B;  2FFY A;  4LV0 A;  4X69 A;  3A3J A;  5FDS A;  2GDN A;  2VGL S;  3FV7 A;  5HAI A;  4UAA A;  3IF6 A;  3F1O B;  3T4T A;  1E4D A;  4II7 A;  2G7U A;  2EXA A;  4G3V A;  4WBG A;  4X53 A;  4X68 A;  1PI4 A;  1LL8 A;  2EWW A;  2ZL1 B;  4U0T A;  1L3L A;  1BYW A;  1TF1 A;  5IU1 A;  2X02 A;  1PYY A;  3LI9 A;  2JBF A;  1LSW A;  2A49 A;  5GLA A;  3FYZ A;  3FWL A;  2Y2L A;  4PM8 A;  3MSH A;  1I2S A;  4CLC A;  5HAR A;  2EXB A;  4E3N A;  4HBU A;  3M6H A;  3MQQ A;  4N9L A;  3S22 A;  5F1G A;  5HPI A;  4EQ1 A;  1NWZ A;  3KSG A;  2XFS A;  1L0E A;  1FOF A;  2VLG A;  4OON A;  2Y2O A;  4R1G A;  5EV0 A;  3UME A;  2V1B A;  2EA9 A;  5TGF A;  1S1Y A;  4BBT A;  5E43 A;  4WZ4 A;  3LI8 A;  1GSX A;  4OQH A;  4E6W A;  1XJ2 A;  3WS0 A;  4JF4 A;  1Q2P A;  3NC8 A;  2HGV A;  3GEC A;  4QU3 A;  4FCF A;  2Y2G A;  2XEP A;  1DJB A;  1SDE A;  3F1P A;  3O86 A;  3Q7Z A;  5L09 A;  3IWQ A;  3OPH A;  4DXC A;  1IYP A;  1NLZ A;  1NRJ A;  3SH8 A;  1X0O A;  5FL3 A;  1NY0 A;  4P85 A;  1PWG A;  1JWP A;  4CLC B;  2ZM0 A;  3HL9 A;  3IH9 A;  4MDZ A;  1MKI A;  4OH0 A;  1NJ4 A;  1ZG4 A;  5FEG A;  2EX9 A;  3NOT C;  5HDC A;  1IKG A;  5FSR A;  3IHA A;  2Z6C A;  3VOY A;  3KYQ A;  2I9V A;  2OWJ A;  3LR0 A;  3IHB A;  5EOO A;  4DKI A;  5FI6 A;  4MBH A;  5BOH A;  1T19 A;  3D72 A;  2EWV A;  4MN5 A;  3CG5 A;  3N4I A;  2IWC A;  2ZQ9 A;  2P9V B;  4EES A;  1KVL A;  2V2F F;  2QYB A;  3MXS A;  4GS9 A;  1OT9 A;  2EX8 A;  4IBX A;  3T50 A;  3F1P B;  4G3W A;  3N8S A;  5GHZ A;  1IOU A;  5CHU A;  2J8Y A;  1YSQ A;  3PBS A;  5JYP A;  4JXV A;  2FFF B;  4QHC A;  1Y4O A;  4LV2 A;  2Y2I A;  4R0Q A;  1ZTU A;  5DF7 A;  3VFH A;  2OWH A;  3PAG A;  4I3A A;  3G31 A;  3ZGA B;  2RL3 A;  3LUQ A;  3SW1 A;  3H9W A;  4DDY A;  5FEF A;  1CJF A;  2QJ5 A;  4Y0O A;  1FSY A;  4OPQ A;  3CUE C;  1DJA A;  5CHJ A;  1H5X A;  1NYY A;  4MMN A;  1RGY A;  2L1M A;  4O7D A;  4CJN A;  4XXR A;  2J9O A;  4JLF A;  4GS9 B;  3QNB A;  2B02 A;  3C8C A;  3H82 A;  1DY6 A;  4LRY C;  2Y2J A;  3C38 A;  5F1F A;  3MR0 A;  2ZJ9 A;  3R7W A;  3OZH A;  4EBL A;  1YMX A;  4MLL A;  1M40 A;  1D1J A;  4O01 A;  3HLE A;  3RXW A;  1H8Z A;  4OQ0 A;  5DFY A;  4QD4 A;  4GLQ A;  4WMC A;  1JNU A;  2ZC5 B;  1XA1 A;  1H3Q A;  1ZG6 A;  3NY4 A;  5EVI B;  5HWW A;  2H10 A;  4RA7 A;  5FQ9 A;  4QWO A;  1MPL A;  1K55 A;  5CEB A;  4E3L A;  3LYX A;  4N1H A;  5U47 A;  4XT2 A;  3UPN A;  3MZF A;  3AGE A;  3A3D A;  4EXO A;  3A3F A;  4K08 A;  3V67 A;  2Y2H A;  5KSC A;  2O9C A;  3MS6 A;  4B4Z A;  5FAS A;  5L2F A;  4H6J A;  3IF6 C;  3QP4 A;  3H82 B;  5DVA A;  3V39 A;  3HCY A;  5DTS A;  1GHP A;  2PHY A;  4HP4 A;  3R7W B;  1RP5 A;  3FPV A;  2PT7 A;  4X25 A;  2IWD A;  3B47 A;  5A93 A;  5IT5 A;  3ZCZ A;  3E98 A;  4XUZ A;  3TRC A;  4CLC C;  3E4O A;  3UB8 A;  3IXG A;  1S6R A;  4R38 A;  5G18 A;  3EGD C;  1OTD A;  1Z6F A;  5CXW A;  1HLU P;  4H8R A;  1IYQ A;  4UA7 A;  4XT2 B;  3BFF A;  2UWX A;  2JKT M;  3VP4 A;  3VMA A;  2R9W A;  4H6J B;  1K0K A;  4MN6 A;  3IX4 A;  1S0W A;  5CGS A;  2ZOI A;  1KDS A;  4KQO A;  2NUT C;  5KSH A;  4DMZ A;  5HWT A;  5K5B A;  2PU4 A;  2M7V A;  4JBF A;  4EER A;  3I7J A;  4DJ2 A;  4IBR A;  4BMW A;  2PYP A;  2VV6 A;  3G34 A;  5DKK A;  3GV9 A;  3SS3 A;  1VB6 A;  3EEH A;  4EWF A;  2W3E A;  1LL9 A;  5HL1 A;  4MN7 A;  3E2L A;  1IYO A;  5GHX A;  4WM9 A;  2ZLY A;  3LIB A;  5HDS A;  2XH9 A;  3EQV A;  1BZA A;  2HP5 A;  1N9L A;  4Y0T A;  3RFB A;  3UE0 A;  3IX8 A;  3MJQ A;  1ESI A;  3ITA A;  4ID4 A;  1DP6 A;  3M2K A;  1K6S A;  1LHY A;  3TW8 A;  4WEL A;  3NDG A;  3HBR A;  1WE4 A;  3R4K A;  2PD7 A;  1YLP A;  2P08 A;  2JC7 A;  4OQI A;  1CF0 A;  1FSW A;  2M7U A;  3O87 A;  3LIF A;  4BD0 A;  1KE4 A;  2RCX A;  1JVJ A;  1O7E A;  2WAF A;  4MBF A;  4NKP A;  2Z2L B;  3HLG A;  3C2W A;  3TSG A;  3DWK A;  1VQQ A;  5F83 A;  1F2K A;  4HJ4 A;  1N9O A;  2P74 A;  5IS1 A;  5L8M A;  2VGK A;  4K0X A;  1MY8 A;  2OAP 1;  2O0Y A;  5EVI C;  3BFC A;  1L0G A;  5AQ9 A;  3WS4 A;  3FKW A;  2XGN A;  4GOG A;  4IVI A;  3Q81 A;  2OOL A;  3VOZ A;  3TE8 A;  3BEC A;  1TD5 A;  2C5W B;  3MF0 A;  3PBN A;  1SKO A;  1TDG A;  1CQA A; 
#chains in the Genus database with same CATH homology
 2JKF A;  3T12 B;  3MS6 A;  1VEU B;  3NEC A;  2PRF A;  2VK3 A;  2PAV P;  4X1L A;  5EM0 A;  1PNE A;  5FEF A;  1CJF A;  3CPT A;  3D9Y A;  3CHW P;  3T1R A;  3T1S A;  4X25 A;  3L9K A;  4FUW A;  1Z09 A;  2HZ5 A;  4ESP A;  1VET B;  2V8F A;  1ACF A;  1CF0 A;  1G5U A;  2E8J A;  1AWI A;  2ACG A;  5FDS A;  1PFL A;  3T1X A;  1VEU A;  3T1Q B;  2V8C A;  3LGO A;  3L7H A;  5FEG A;  1HLU P;  1SZV A;  3UB5 P;  3CPT B;  2ZL1 B;  1PRQ A;  1YPR A;  1SKO B;  1FIL A;  1F2K A;  1D1J A;  1K0K A;  3DAV A;  2JKG A;  1VET A;  3NUL A;  1FIK A;  3U4L P;  3MSH A;  2BTF P;  2PBD P;  4QWO A;  4FTX A;  3LEQ A;  3KYE A;  4D60 A;  1J3W A;  5EV0 A;  2ZL1 A;  1Y4O A;  5EVE A;  1A0K A;  1SKO A;  5EM1 A;  2B95 A;  4X1M A;  1CQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...