5FEFA

Crystal structure of the allergen profilin (zea m 12)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
132
structure length
132
Chain Sequence
GMSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVERLGDYLIEQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Profilin-5
publication title Structural insights into the IgE mediated responses induced by the allergens Hev b 8 and Zea m 12 in their dimeric forms.
pubmed doi rcsb
source organism Zea mays
total genus 35
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 5fefA00
1CJFA 1SZVA 1VEUB 3CPTA 1G5UA 5EV0A 2ZL1B 5FDSA 1FIKA 1PRQA 1A0KA 1CQAA 3MS6A 2ACGA 1J3WA 4X1MA 2HZ5A 4D60A 1ACFA 3LEQA 4QWOA 3NECA 5FEGA 3L7HA 1AWIA 2PBDP 1Y4OA 4X25A 1VETB 3T1XA 1SKOB 2JKGA 1F2KA 2ZL1A 3UB5P 3T12B 1HLUP 1FILA 3T1QB 3U4LP 5EM0A 3NULA 2BTFP 3DAVA 2VK3A 4ESPA 1VETA 1VEUA 5EVEA 1YPRA 3KYEA 2PAVP 1PNEA 1CF0A 2V8CA 3T1RA 5EM1A 2JKFA 1PFLA 4X1LA 5FEFA 1Z09A 2PRFA 2E8JA 3T1SA 3CHWP 1D1JA 1SKOA 3CPTB 3D9YA 4FUWA 4FTXA 3MSHA 1K0KA 2B95A 3LGOA 2V8FA 3L9KA
chains in the Genus database with same CATH superfamily
3VP2A 2O9AA 3PTEA 1KVMA 5IU1A 5M19A 2HJ9C 4S2NC 3RXXA 1YLZA 4HEFA 3Q7VA 2EA9A 2I9VA 3OOVA 4FCFA 5DVAA 3F1PA 3EQUA 3CITA 4X25A 4E3NA 5A91A 5KIZA 3IQAA 3DTMA 1EROA 3UE1A 3QP1A 5F5YA 1IKIA 5EM0A 3MR0A 1LL8A 4KZ7A 3T4TA 3OPRA 4P85A 3EWKA 2PHYA 5M18A 3WRZA 4WYYA 2Y4AA 4OH0A 2PU2A 5CTMA 3ZHHA 3CUEA 1HD8A 5TJJA 3HJIA 1S4RA 4OOLA 1XP4A 2IA2A 2WGIA 2DRWA 5KMWA 3VOYA 1RGZA 1FCOA 1XXMA 4LRYC 5FI7A 2E8JA 4Y13A 2QKPA 5JYPA 3A0SA 3QP8A 4QHCA 5L2FA 3N8RA 4P6ZS 3IF6A 4KENB 1JWZA 3LO7A 2QJ7A 4NXGA 3Q7VB 3LGOA 1KE4A 1ONHA 2X71A 3BFCA 2Y8HA 5GHYA 4L9EA 2XRNA 4E6WA 1G5UA 1OPXA 3BJNA 1G6AA 4N1HA 1H8MA 5L09A 2ZQ9A 3C30A 2W3GA 2K2NA 4X1MA 5KSHA 2JKRM 1TS7A 2HGVA 1S67L 2ZC4B 3E4QA 4YOFA 2ZMAA 5IHVA 2JCHA 1Y54A 3HLFA 3HLWA 2XD5A 1P0ZA 4WMCD 4I38A 1HLUP 4X56A 1YSQA 3E98A 1NXYA 1FSWA 3M6BA 3F1OA 1L0EA 5TR7A 3NOPC 2ZC7A 1IKGA 1PYYA 4G3VA 4ZAMA 5CHMA 1YPRA 4LV1A 1E3UA 3UO9A 2OWJA 4FH4A 1K56A 2R9WA 4XT2A 1CK3A 2JKFA 3ZVWA 3QNCA 1SHVA 1ESIA 1XA1A 2Q9NA 4HIAA 2BLSA 4E3OA 3CJMA 1ERMA 4UA9A 4ARZA 5EFWA 1SKOA 4WZ5A 4GHIA 1BTLA 2JC7A 3C5AA 1ESUA 4BL2A 3IXDA 4QY5A 4EEUA 2D01A 4QPRA 2P08A 4MBFA 3FPWA 1RGYA 1YLTA 3TJZC 1LI0A 4MDZA 4S2KA 3C7VA 4HH2A 2B18A 4U0XA 3F1OB 2WKEA 2V20A 1LHYA 5HAQA 2HF6A 4HJ4A 3ZYTA 2XGNA 2HP9A 4PPRA 4QY6A 2QMIA 1GHMA 2GJ3A 2OLUA 1BYWA 2RL3A 4Q0JA 2QHKA 3E2KA 5A92A 4DXBA 3C8CA 3ZFZA 1F9IA 4XT2B 1DY6A 3BM6A 2WGVA 3BYDA 5F83A 4KZ3A 1OTBA 2J9PA 3MQOA 1LL9A 2Y2HA 3ZNYA 3BY8A 5EVEA 4Y0TA 2INWA 2L1MA 1FR6A 2O0YA 1XJ6A 4R4SA 3LIDA 2XLNA 4HP4A 4K0WA 5EM1A 3HJKA 3OCNA 3WWXA 2WAEA 4FOFA 2UV0E 4Y0OA 3MQQA 1DRMA 1S1ZA 3A0VA 3LY3A 1W63M 4GD8A 1MKIA 5AQBA 1E25A 2VX8A 4YWZA 1K38A 5EPHA 5L07A 3UPPA 4XXRA 4HNBA 4MCWA 3IT9A 1BLCA 1JWPA 4B88A 1VHMA 1OTIA 3L9KA 4GS9A 2ZC5B 1WE4A 1TS8A 3LR5A 4GB7A 5FDSA 4MN7A 3CWFA 4KQOA 4S2NA 1J9MA 1NLYA 1YM1A 3M6HA 3ZNTA 4D60A 3ZQ5A 2M7UA 3IS2B 3KYQA 4KG5A 4EBLA 2BG1A 3MKFA 4DJ3A 1H3QA 1K54C 3IF5A 3T4KA 5TBMB 1DJBA 4ME4A 3CMZA 4Y0UA 4XUZA 3O86A 1KVLA 1SDEA 3QNBA 5EVLA 4QD4A 4CLCD 1NYMA 3UY6A 1BSGA 2QZ6A 2HPBA 4EESA 3B47A 5DTSA 4KZ6A 4PHTA 4Q8IA 4C3QA 3VSKA 3A3EA 1BLHA 3H7WB 1XKZA 4BBUA 4I39A 3VE3A 5FQ9A 1TEMA 3ZG5A 4Q0HA 4K91A 3KO6A 1KGEA 4EBPA 1XPBA 5E2HA 1HZOA 2V1AA 1EW0A 4H6JA 5K5BA 4Q0IA 2PR6A 5A8BA 4YINA 1W7FA 2G2WA 4IVIA 5J8XA 4OLGA 3UN7A 2J3WA 3WS1A 5FSRA 4OQHA 1TD5A 4R23A 4BENA 5F1FA 3O88A 3W4PA 1MBLA 4WN5A 3K2NA 4I3AA 4WL9A 4MBHA 4OQ0A 5CX7A 4GD6A 1JTDA 3FKVA 5EE8A 2Q9MA 5L8MA 2Y59A 1ZHHB 3GTCA 3AGDA 3P98A 2GNXA 2W1TA 3M2KA 2FFYA 2ZM8A 3ZG0A 4KQDA 4QB8A 5DF7A 1ONGA 4HY8A 4S2IA 5F69A 1K57A 2ZQ7A 4JXGA 1FOFA 2PBDP 1K25A 4M4XA 2Z6DA 3T1XA 1NZUA 3MXRA 1KOUA 1F2KA 3NOUC 2PYPA 3PBTA 2ZD8A 3C38A 4X55A 2V1BA 2QYBA 4OQIA 3WS2A 4ZDXA 2QJ5A 3DAVA 4B4XA 1MWRA 3BFDA 1D7EA 1YMXA 4JGOA 4HH3A 1YLYA 2XQZA 2WADA 2EWVA 5GHZA 5CERA 2IWCA 3PHYA 3B33A 5GL9A 3EGDC 2Y91A 1MPLA 2YKHA 4FUWA 3PYPA 4ZJ2A 1TS6A 2H0YA 2KX6A 3MSHA 3K3DA 2VV8A 1QMEA 1K0KA 3IH9A 3TW8A 3LY4A 3D3OA 5HDDA 2LB9A 3I7JA 4JPMA 2M1CA 2OSUA 5DKLA 1FIKA 4N92A 3CG5A 1Y28A 3VP4A 4E3MA 2HZ5A 3NIAA 1KE3A 1H0MA 2FZ0A 3OPLA 5TGFA 4BMWA 4DE2A 1P9WA 1GSXA 1T1CA 3R4KA 4HOIA 4JXSA 2C6WB 5IT5A 4GCZA 3HL9A 3SZTA 3UPNA 5FQKA 2JN7A 4MN6A 1DJCA 3G6OA 2BTFP 3SW1A 2ZQDA 4EQ1A 1BLPA 3FYZA 5CGSA 3IBRA 5GLBA 2JE5A 3ZG7B 2G2UA 3PAGA 4JF5A 4CLCC 4JBFA 3HVFA 2OAQ1 3IHBA 1LL5A 3VP1A 3RXWA 4DJ2A 3V3RA 3ZDJA 3OPPA 1JTGA 1N4OA 4DDYA 5EVID 3K3CA 1XGJA 4IJGA 2PR5A 3VMAA 4RX3A 1I2SA 3LIBA 4Y17A 4ZTKA 3ZVTA 5FEFA 1W5DA 1GHIA 1XFQA 4HJ6A 3BY9A 1IEMA 1VQQA 4N9KA 1NLZA 1TS0A 5CHUA 1ZG6A 4L0LA 5CECA 3BEBA 2JKRI 1M40A 2X02A 2W1RA 1PW8A 1PZPA 4IUHA 4OPRA 3KX0X 4B4ZA 4G3KA 4OLDA 4E3IA 3C7UA 1I2WA 5EV0A 4WEKA 5CTNA 3MXSA 1YKDA 5HDCA 3BW6A 1V9YA 3DW0A 1PWCA 2ACGA 3LR3A 2XSSA 4ZBEA 4BWIA 1YLWA 3MZFA 2V1ZA 1MWTA 3Q82A 2XR0A 3PR6A 2ZMVA 3IWOA 2VA0A 2WGWA 4UQIS 3PAEA 3QP2A 2V0UA 5U47A 1G28A 2W3DA 4WLAA 1N9OA 3ZCZA 3LICA 4WMCA 1S4SA 2Z2LB 2KLIA 3GR2A 3OLOA 3NOTC 2VGLM 1VB6A 1L0DA 3T4OA 2EX6A 3E0YA 3UDXA 4GZBA 4GJ4A 4EXOA 3FV7A 3QP5A 3OC2A 3PBOA 1DP8A 4MN5A 2HP6A 4KUOA 3UMEA 3SOIA 3WS0A 3T4JA 2HP5A 1ZTUA 3H9WA 2PU4A 4EQIA 3EEHA 3IXHA 2Z2MB 1ES2A 3P09A 4UEYA 3Q81A 1S66L 4GLQA 2CMNA 5EUAA 2IWDA 5EOOA 3D72A 4B93A 4G3WA 3C4OA 4LENA 2X01A 4Y5FA 4I3JA 2P04A 5C5KA 4CLCE 2BASA 3LUQA 1LSVA 1CI8A 4HJ3A 3FKWA 2V8FA 4EERA 2P74A 4O01A 4MNRA 3UB6A 1SZVA 2G7UA 2WGWB 3VFFA 3IX3A 1ZG4A 4JXVA 1MZUA 1V9ZA 1MXOA 2W0NA 5FASA 4DE3A 3N6IA 5FEGA 4MMNA 2WKIA 2Y2MA 3GQZA 1NJ4A 1L0FA 3BLSA 2L0WA 1JNUA 1PI5A 3FZCA 4M3KA 4LCLA 2ZL1A 1KDWA 2KOIA 2XROA 4DXCA 1FILA 4JGRA 3IBJA 4OKPA 5FQQA 3FPVA 3G4PA 3T4QA 1K4FA 5FAPA 1MWSA 2A3UA 3T50A 1KE0A 1W63Q 3V67A 3MXQA 4EUZA 1VETA 1TF1A 3SH8A 4Y3IA 2ZC6B 4I3IA 3RTYA 5GLDA 5HWVA 3VOLA 3Q1FA 3LEZA 1L3LA 4KUKA 3HLDA 1CF0A 4XUXA 4HBTA 1S6RA 1JVJA 3IS2A 4P6ZM 4KQQA 4JXWA 3UE0A 5EVIC 3V39A 2R78A 1OTEA 5TBMA 3DWZA 3S22A 4PM8A 3PBRA 1MY8A 2XFTA 4PM6A 2ZOHA 4UQIM 5J7EA 1MC0A 5HAIA 3LIEA 4MLLA 4YNRA 2ZOIA 5HL1A 3H7WA 4N9LA 5DFYA 2EXBA 2DNSA 3G34A 2ZL1B 1PI4A 2D02A 3N8LA 2W3HA 4BBVA 2Y2KA 1J3WA 3LIFA 1MKMA 3AGFA 1M6KA 5J4EA 4WUJA 3RJUA 1TVFA 4R3JA 4OOYA 2WKHA 5FI2A 5HD5A 1Y4OA 1VETB 2C5WB 2ZLYA 2PDRA 2OAP1 3UNWA 1DP6A 1NWZA 4KQRA 4OONA 4BLMA 2NUTC 3UE3A 1H5XA 3GRJA 3CUEC 4JGPA 2OV5A 2CC1A 3SS4A 3VFHA 3CZDA 4JF6A 1CEGA 5CRFA 3D4FA 3JPUA 4BD1A 4KG6A 4F3LA 3IWIA 1TDGA 2JBFA 1YLJA 3OBFA 3QP4A 3IF6C 3P7NA 4D2OA 3LFVA 3IHAA 4PKYA 4P87A 4DMZA 4BL3A 2VV6A 4KZ5A 1BT5A 5F1GA 4OPYA 4UA6A 1D06A 5HPFA 3BLMA 4IBRA 5FQJA 1ZKJA 3G31A 4HQAA 3BRMA 3LR4A 4EU0A 1BLSA 3V50A 4EV4A 1NYYA 5G4ZA 1CJFA 2HDQA 3NY4A 1L0GA 4LGWA 1BZAA 1NZOA 1CQAA 2JKTM 4IVKA 1QMFA 4BBTA 4GDNA 5CGWA 4PM5A 2GDNA 2ZMFA 2WYXA 2HDRA 2V9AA 2FH5A 4L9GA 4B9OA 4CLCB 2XDMA 1GSWA 1WYCA 2H5SA 1OT9A 3W4QA 2QPNA 4F3LB 2PBYA 1CEFA 2AVXA 2Y2IA 3OCLA 2W3FA 4S2JA 2ZC3B 1OTDA 5FAOA 4N1XA 5DFXA 4GN2A 2HDSA 4HBUA 1K4EA 2J80A 3HLBA 4X68A 5E2EA 4IHQA 5TFQA 3MF0A 5FQIA 2XEPA 1Z6FA 2P9VA 2ZQCA 4U0TA 4IUKA 4WBGA 4WZ5C 3MZEA 1SCWA 1Q2PA 4JF4A 1K55C 3SS3A 3EOIA 4NXFA 3HLCA 2W27A 2O9CA 3EEAA 3HCYA 1Z09A 3TOIA 1W79A 3C4PA 3U2AA 4RYEA 4IEDA 3MFDA 5HX9A 3PBSA 4GDBA 4E3LA 2ZQAA 4ZJ1A 3MBZA 4RA7A 4OPQA 3DWKA 3UB8A 3W4OA 1HTZA 4CQHA 2J7VA 4MEZA 1PWDA 5HD3A 1VEUB 1LI9A 4Y7PA 2J8YA 3HUNA 5HW3A 1RP5A 3EQVA 2J9OA 4ZRRA 1NRFA 1W8QA 4U3TA 2EX9A 1IOUA 1FCNA 3MKEA 4R3AA 5GLAA 4R4RA 3SS5A 5AVEA 4ZJ3A 5DF9A 2Q0OA 3E2LA 4UA7A 3L7HA 5FL3A 3VP0A 1AWIA 2P9VB 4EWFA 4UAAA 4NKPA 3KYZA 4S2LA 4CJNA 5HPIA 4L9FA 3G2ZA 5HFOA 2VEAA 1YT4A 2VK3A 3MFXA 4LRZE 4C75A 2B5RA 2J3TD 5FI6A 2YKFA 4JLFA 1Q2QA 1W8YA 2Y2GA 4DE1A 5E2GA 3SH7A 3IWQA 2W3EA 3S7NA 1PNEA 3T1RA 3TE8A 2K7SA 3VE4A 3W2ZA 3MZDA 5EVIA 4AFIA 3DTKA 4RVAA 3NDEA 3KSIA 3T1SA 1GA9A 1IELA 2NUPC 3T4SA 5DTKA 4R6LA 1FQGA 4JKTA 4NETA 3LI8A 4O7DA 5HAPA 1UWNX 3NJAA 1HVBA 4HHDA 4BJPA 1PW1A 3DTIA 2XA7S 2B95A 5FQMA 5J3WA 1PZOA 3H82B 1GSVA 4KZ4A 1G6OA 3TSGA 4EUVA 1ALQA 2EWWA 1PRQA 3A0RA 1EWZA 3VSLA 4E04A 3BWLA 3HLGA 1GA0A 1G68A 3IH8A 2GX5A 3NECA 3TRCA 4R1GA 1H8ZA 4PAUA 5EOEA 5AQ7A 4O8GA 1DJAA 2IWBA 3T12B 1YSPA 4OPZA 3LR0A 2QWSA 3B42A 2XH9A 3S7QA 5IS1A 4P6BA 5EECA 3A3DA 2PYRA 4X69A 4EW7A 1N9NA 1NRJA 2H0TA 5EVIB 1K54A 3UPOA 4OOMA 5AJGA 3UDIA 3MQ0A 2E8IA 3HLEA 5AVFA 4ETZA 2WKQA 4Z1WA 2EFUA 2VJWA 4K08A 4Y2FA 3T4LA 4KZ8A 4EBNA 4EETB 1CI9A 1FR1A 4JGQA 5CEDA 3JYIA 3IX4A 3G35A 2M7VA 4GNUA 3F1PB 2PRFA 4NXBA 1S0WA 3G30A 3IXBA 2ZM2A 3DBAA 2GZAA 1IYOA 3UE6A 3GMWA 3LIAA 4FSFA 3IX8A 2VZWA 5FAQA 4E3JA 2Y2LA 3BECA 1K57C 3B3XA 3DTEA 5A93A 1FSYA 1KDSA 4MBKA 4KG2A 1I5QA 1K6SA 1S1YA 2O99A 4RX2A 3GDIA 4O0PA 1TDLA 2WAFA 2V0WA 1A0KA 1IYSA 5F68A 4H8RA 2I72A 1MWUA 3LEQA 1ODVA 5HDSA 2OOLA 3FWLA 1UGUA 1LSXA 1YQSA 3S7OA 5HWTA 5FA7A 2DMWA 2XFSA 3IF6B 2Y2PA 4X6TA 1AXBA 3NULA 5AQAA 3KSHA 3G2YA 3SH9A 5CXWA 1E3UD 1H8YA 1VM1A 2EX8A 2K31A 2XA7M 1XA7A 1K56D 2OWHA 4E3KA 5I5LA 1K55A 3V3SA 3CI6A 2Y2NA 1XJ3A 3BQ8A 4OQGA 2J3TC 4P0MA 3W8KA 1XGIA 3QHYA 2Y79A 1OTAA 4GKUA 5HZHA 2DCFA 4PKYG 4GOGA 3TG9A 5DJTA 4Y15A 2Z6CA 3NHQA 3UB9A 3G32A 2B02A 3BFEA 3KSGA 4R0QA 3GVBA 1U60A 4LPZA 4NXEA 4S2MA 2H28A 2VKSA 2P7JA 1XJ2A 3E4PA 4R38A 4QU3A 5FATA 1OMEA 2A2LA 3N8SA 4YFMA 2Y2QA 2XF3A 3NCKA 3KSFA 3ULFA 3UMDA 5DF8A 4I5SA 2O9BA 1BUEA 2WZXA 4LFUA 4FD8A 4QWOA 4K0XA 1OT6A 4WELA 1O07A 1ZC2A 3NBLA 1WA9A 1LSWA 5F82A 4ARZB 3FG8A 1SKOB 5E43A 4GHIB 3ZG8B 4II7A 5F6AA 3GECA 2L4RA 4HP9A 3U4LP 4DDSA 4KZ9A 3R7WA 3E4OA 2HDUA 4ESPA 3MJQA 3O5YA 1KGGA 4HI4A 1PWGA 5I94A 1YMSA 3HREA 3WRTA 3P01A 2WKPA 3O87A 5HL6A 3JVVA 2KDKA 4C6YA 3PXPA 5E2FA 4PM9A 2PAVP 3ITAA 2V8CA 2XK1A 4WF0A 3LCEA 1O7EA 3ZG9B 4IBXA 1X0OA 4CLCA 4QJGA 1GHPA 3LI9A 5LBRA 1D1JA 3D9YA 3GSGA 3VOZA 3PBQA 2WKRA 4Z9QA 4PMAA 4X53A 2JKTI 1IFQA 1F98A 3FC7A 4NEED 4LV3A 4FH2A 3BFFA 2ZM0A 3PBNA 3ITBA 1FCMA 3GV9A 3OZHA 4ID4A 5CEBA 1ES3A 1DP9A 3NDGA 2RCXA 2PD7A 3CPTA 5BOHA 5FDHA 3ICYA 5HSQA 2OLVA 3HBRA 4BD0A 5KZHA 2HJEA 1OJ5A 3MS6A 1IYQA 1XX2A 5AQ9A 4LRXC 1ACFA 1XJ4A 2Y2OA 3N4IA 3R7WB 2EX2A 4NG2A 1C3BA 1F5MA 1T19A 1WYBA 3HUOA 2JHEA 1SKFA 3UB5P 3HUMA 4KZAA 4DKIA 3NI9A 2PD8A 4F94A 3T1QB 4S2PA 5KSCA 4DRTA 1BULA 3VV4A 1KGFA 2Y2JA 2EFXA 5L10A 1E4DA 1PIOA 3A3IA 4GS9B 3S7PA 3OPHA 1ES5A 1ERQA 5CHJA 2ZBBA 1VEUA 3ZGAB 3A3FA 3VP3A 3WS5A 2WUQA 3JVUA 1PFLA 3AGEA 4KZBA 1ES4A 4DF6A 1LT0A 5M1AA 3N7WA 3S4XA 3WS4A 3CPTB 2HV1A 4FTXA 1OJGA 4A5RA 5HARA 3BFGA 2PT7A 3BQAA 5GHXA 2A24A 5GLCA 2ZQ8A 3IXGA 1STZA 1YLPA 2FFFB 3NC8A 1JWVA 5MC7A 1YAXA 4R3BA 1LLBA 3RFBA 2V2FF 5DJUA 2XD1A 1GCEA 3MMHA 2LB5A 4CPKA 4GW9A 2VGKA 4ETXA 3UDFA 4LV0A 4WM9A 5A90A 1NY0A 2WZZA 5CGXA 3QP6A 2R9XA 2UWXA 3CLOA 4PM7A 5G4YA 2VLGA 5DKKA 4S2OA 5DTTA 4H6JB 3F1NA 3CAXA 5HWWA 1T1AA 1T1BA 4E6XA 3Q07A 3V5MA 1EI5A 2JKGA 2ZJ9A 1T18A 3C2WA 4LV2A 2Y55A 3UB7A 2MJ6A 1K6RA 4R70A 1XFNA 1P97A 4LCMA 3H82A 5D3OA 1UWPX 3A3JA 5JYOA 5G18A 2H10A 1RCJA 4WZ4A 2EXAA 3KYEA 2W1TB 4DN0A 1P9RA 4BQMA 2VGLS 2A24B 4NK3A 3M2JA 4X1LA 1IYPA 3O3VA 4UHUA 1N9LA 4WEJA 4RQ9A 3ISGA 3Q7ZA 4LLOB 4EEPA 3CHWP 4OP8A 2VV7A 3LYXA 4OP5A 1L2SA 4OVDA 1N9BA 2WK0A 2A49A 1SDNA 2VGJA 4HESA 4DE0A 3RH8B 3S1YA 3EGXC 3F1NB
chains in the Genus database with same CATH topology
1CJFA 1SZVA 1VEUB 3CPTA 1G5UA 5EV0A 2ZL1B 5FDSA 1FIKA 1PRQA 1A0KA 1CQAA 3MS6A 2ACGA 1J3WA 4X1MA 2HZ5A 4D60A 1ACFA 3LEQA 4QWOA 3NECA 5FEGA 3L7HA 1AWIA 2PBDP 1Y4OA 4X25A 1VETB 3T1XA 1SKOB 2JKGA 1F2KA 2ZL1A 3UB5P 3T12B 1HLUP 1FILA 3T1QB 3U4LP 5EM0A 3NULA 2BTFP 3DAVA 2VK3A 4ESPA 1VETA 1VEUA 5EVEA 1YPRA 3KYEA 2PAVP 1PNEA 1CF0A 2V8CA 3T1RA 5EM1A 2JKFA 1PFLA 4X1LA 5FEFA 1Z09A 2PRFA 2E8JA 3T1SA 3CHWP 1D1JA 1SKOA 3CPTB 3D9YA 4FUWA 4FTXA 3MSHA 1K0KA 2B95A 3LGOA 2V8FA 3L9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJF A;  1SZV A;  1VEU B;  3CPT A;  1G5U A;  5EV0 A;  2ZL1 B;  5FDS A;  1FIK A;  1PRQ A;  1A0K A;  1CQA A;  3MS6 A;  2ACG A;  1J3W A;  4X1M A;  2HZ5 A;  4D60 A;  1ACF A;  3LEQ A;  4QWO A;  3NEC A;  5FEG A;  3L7H A;  1AWI A;  2PBD P;  1Y4O A;  4X25 A;  1VET B;  3T1X A;  1SKO B;  2JKG A;  1F2K A;  2ZL1 A;  3UB5 P;  3T12 B;  1HLU P;  1FIL A;  3T1Q B;  3U4L P;  5EM0 A;  3NUL A;  2BTF P;  3DAV A;  2VK3 A;  4ESP A;  1VET A;  1VEU A;  5EVE A;  1YPR A;  3KYE A;  2PAV P;  1PNE A;  1CF0 A;  2V8C A;  3T1R A;  5EM1 A;  2JKF A;  1PFL A;  4X1L A;  5FEF A;  1Z09 A;  2PRF A;  2E8J A;  3T1S A;  3CHW P;  1D1J A;  1SKO A;  3CPT B;  3D9Y A;  4FUW A;  4FTX A;  3MSH A;  1K0K A;  2B95 A;  3LGO A;  2V8F A;  3L9K A; 
#chains in the Genus database with same CATH topology
 3VP2 A;  2O9A A;  3PTE A;  1KVM A;  5IU1 A;  5M19 A;  2HJ9 C;  4S2N C;  3RXX A;  1YLZ A;  4HEF A;  3Q7V A;  2EA9 A;  2I9V A;  3OOV A;  4FCF A;  5DVA A;  3F1P A;  3EQU A;  3CIT A;  4X25 A;  4E3N A;  5A91 A;  5KIZ A;  3IQA A;  3DTM A;  1ERO A;  3UE1 A;  3QP1 A;  5F5Y A;  1IKI A;  5EM0 A;  3MR0 A;  1LL8 A;  4KZ7 A;  3T4T A;  3OPR A;  4P85 A;  3EWK A;  2PHY A;  5M18 A;  3WRZ A;  4WYY A;  2Y4A A;  4OH0 A;  2PU2 A;  5CTM A;  3ZHH A;  3CUE A;  1HD8 A;  5TJJ A;  3HJI A;  1S4R A;  4OOL A;  1XP4 A;  2IA2 A;  2WGI A;  2DRW A;  5KMW A;  3VOY A;  1RGZ A;  1FCO A;  1XXM A;  4LRY C;  5FI7 A;  2E8J A;  4Y13 A;  2QKP A;  5JYP A;  3A0S A;  3QP8 A;  4QHC A;  5L2F A;  3N8R A;  4P6Z S;  3IF6 A;  4KEN B;  1JWZ A;  3LO7 A;  2QJ7 A;  4NXG A;  3Q7V B;  3LGO A;  1KE4 A;  1ONH A;  2X71 A;  3BFC A;  2Y8H A;  5GHY A;  4L9E A;  2XRN A;  4E6W A;  1G5U A;  1OPX A;  3BJN A;  1G6A A;  4N1H A;  1H8M A;  5L09 A;  2ZQ9 A;  3C30 A;  2W3G A;  2K2N A;  4X1M A;  5KSH A;  2JKR M;  1TS7 A;  2HGV A;  1S67 L;  2ZC4 B;  3E4Q A;  4YOF A;  2ZMA A;  5IHV A;  2JCH A;  1Y54 A;  3HLF A;  3HLW A;  2XD5 A;  1P0Z A;  4WMC D;  4I38 A;  1HLU P;  4X56 A;  1YSQ A;  3E98 A;  1NXY A;  1FSW A;  3M6B A;  3F1O A;  1L0E A;  5TR7 A;  3NOP C;  2ZC7 A;  1IKG A;  1PYY A;  4G3V A;  4ZAM A;  5CHM A;  1YPR A;  4LV1 A;  1E3U A;  3UO9 A;  2OWJ A;  4FH4 A;  1K56 A;  2R9W A;  4XT2 A;  1CK3 A;  2JKF A;  3ZVW A;  3QNC A;  1SHV A;  1ESI A;  1XA1 A;  2Q9N A;  4HIA A;  2BLS A;  4E3O A;  3CJM A;  1ERM A;  4UA9 A;  4ARZ A;  5EFW A;  1SKO A;  4WZ5 A;  4GHI A;  1BTL A;  2JC7 A;  3C5A A;  1ESU A;  4BL2 A;  3IXD A;  4QY5 A;  4EEU A;  2D01 A;  4QPR A;  2P08 A;  4MBF A;  3FPW A;  1RGY A;  1YLT A;  3TJZ C;  1LI0 A;  4MDZ A;  4S2K A;  3C7V A;  4HH2 A;  2B18 A;  4U0X A;  3F1O B;  2WKE A;  2V20 A;  1LHY A;  5HAQ A;  2HF6 A;  4HJ4 A;  3ZYT A;  2XGN A;  2HP9 A;  4PPR A;  4QY6 A;  2QMI A;  1GHM A;  2GJ3 A;  2OLU A;  1BYW A;  2RL3 A;  4Q0J A;  2QHK A;  3E2K A;  5A92 A;  4DXB A;  3C8C A;  3ZFZ A;  1F9I A;  4XT2 B;  1DY6 A;  3BM6 A;  2WGV A;  3BYD A;  5F83 A;  4KZ3 A;  1OTB A;  2J9P A;  3MQO A;  1LL9 A;  2Y2H A;  3ZNY A;  3BY8 A;  5EVE A;  4Y0T A;  2INW A;  2L1M A;  1FR6 A;  2O0Y A;  1XJ6 A;  4R4S A;  3LID A;  2XLN A;  4HP4 A;  4K0W A;  5EM1 A;  3HJK A;  3OCN A;  3WWX A;  2WAE A;  4FOF A;  2UV0 E;  4Y0O A;  3MQQ A;  1DRM A;  1S1Z A;  3A0V A;  3LY3 A;  1W63 M;  4GD8 A;  1MKI A;  5AQB A;  1E25 A;  2VX8 A;  4YWZ A;  1K38 A;  5EPH A;  5L07 A;  3UPP A;  4XXR A;  4HNB A;  4MCW A;  3IT9 A;  1BLC A;  1JWP A;  4B88 A;  1VHM A;  1OTI A;  3L9K A;  4GS9 A;  2ZC5 B;  1WE4 A;  1TS8 A;  3LR5 A;  4GB7 A;  5FDS A;  4MN7 A;  3CWF A;  4KQO A;  4S2N A;  1J9M A;  1NLY A;  1YM1 A;  3M6H A;  3ZNT A;  4D60 A;  3ZQ5 A;  2M7U A;  3IS2 B;  3KYQ A;  4KG5 A;  4EBL A;  2BG1 A;  3MKF A;  4DJ3 A;  1H3Q A;  1K54 C;  3IF5 A;  3T4K A;  5TBM B;  1DJB A;  4ME4 A;  3CMZ A;  4Y0U A;  4XUZ A;  3O86 A;  1KVL A;  1SDE A;  3QNB A;  5EVL A;  4QD4 A;  4CLC D;  1NYM A;  3UY6 A;  1BSG A;  2QZ6 A;  2HPB A;  4EES A;  3B47 A;  5DTS A;  4KZ6 A;  4PHT A;  4Q8I A;  4C3Q A;  3VSK A;  3A3E A;  1BLH A;  3H7W B;  1XKZ A;  4BBU A;  4I39 A;  3VE3 A;  5FQ9 A;  1TEM A;  3ZG5 A;  4Q0H A;  4K91 A;  3KO6 A;  1KGE A;  4EBP A;  1XPB A;  5E2H A;  1HZO A;  2V1A A;  1EW0 A;  4H6J A;  5K5B A;  4Q0I A;  2PR6 A;  5A8B A;  4YIN A;  1W7F A;  2G2W A;  4IVI A;  5J8X A;  4OLG A;  3UN7 A;  2J3W A;  3WS1 A;  5FSR A;  4OQH A;  1TD5 A;  4R23 A;  4BEN A;  5F1F A;  3O88 A;  3W4P A;  1MBL A;  4WN5 A;  3K2N A;  4I3A A;  4WL9 A;  4MBH A;  4OQ0 A;  5CX7 A;  4GD6 A;  1JTD A;  3FKV A;  5EE8 A;  2Q9M A;  5L8M A;  2Y59 A;  1ZHH B;  3GTC A;  3AGD A;  3P98 A;  2GNX A;  2W1T A;  3M2K A;  2FFY A;  2ZM8 A;  3ZG0 A;  4KQD A;  4QB8 A;  5DF7 A;  1ONG A;  4HY8 A;  4S2I A;  5F69 A;  1K57 A;  2ZQ7 A;  4JXG A;  1FOF A;  2PBD P;  1K25 A;  4M4X A;  2Z6D A;  3T1X A;  1NZU A;  3MXR A;  1KOU A;  1F2K A;  3NOU C;  2PYP A;  3PBT A;  2ZD8 A;  3C38 A;  4X55 A;  2V1B A;  2QYB A;  4OQI A;  3WS2 A;  4ZDX A;  2QJ5 A;  3DAV A;  4B4X A;  1MWR A;  3BFD A;  1D7E A;  1YMX A;  4JGO A;  4HH3 A;  1YLY A;  2XQZ A;  2WAD A;  2EWV A;  5GHZ A;  5CER A;  2IWC A;  3PHY A;  3B33 A;  5GL9 A;  3EGD C;  2Y91 A;  1MPL A;  2YKH A;  4FUW A;  3PYP A;  4ZJ2 A;  1TS6 A;  2H0Y A;  2KX6 A;  3MSH A;  3K3D A;  2VV8 A;  1QME A;  1K0K A;  3IH9 A;  3TW8 A;  3LY4 A;  3D3O A;  5HDD A;  2LB9 A;  3I7J A;  4JPM A;  2M1C A;  2OSU A;  5DKL A;  1FIK A;  4N92 A;  3CG5 A;  1Y28 A;  3VP4 A;  4E3M A;  2HZ5 A;  3NIA A;  1KE3 A;  1H0M A;  2FZ0 A;  3OPL A;  5TGF A;  4BMW A;  4DE2 A;  1P9W A;  1GSX A;  1T1C A;  3R4K A;  4HOI A;  4JXS A;  2C6W B;  5IT5 A;  4GCZ A;  3HL9 A;  3SZT A;  3UPN A;  5FQK A;  2JN7 A;  4MN6 A;  1DJC A;  3G6O A;  2BTF P;  3SW1 A;  2ZQD A;  4EQ1 A;  1BLP A;  3FYZ A;  5CGS A;  3IBR A;  5GLB A;  2JE5 A;  3ZG7 B;  2G2U A;  3PAG A;  4JF5 A;  4CLC C;  4JBF A;  3HVF A;  2OAQ 1;  3IHB A;  1LL5 A;  3VP1 A;  3RXW A;  4DJ2 A;  3V3R A;  3ZDJ A;  3OPP A;  1JTG A;  1N4O A;  4DDY A;  5EVI D;  3K3C A;  1XGJ A;  4IJG A;  2PR5 A;  3VMA A;  4RX3 A;  1I2S A;  3LIB A;  4Y17 A;  4ZTK A;  3ZVT A;  5FEF A;  1W5D A;  1GHI A;  1XFQ A;  4HJ6 A;  3BY9 A;  1IEM A;  1VQQ A;  4N9K A;  1NLZ A;  1TS0 A;  5CHU A;  1ZG6 A;  4L0L A;  5CEC A;  3BEB A;  2JKR I;  1M40 A;  2X02 A;  2W1R A;  1PW8 A;  1PZP A;  4IUH A;  4OPR A;  3KX0 X;  4B4Z A;  4G3K A;  4OLD A;  4E3I A;  3C7U A;  1I2W A;  5EV0 A;  4WEK A;  5CTN A;  3MXS A;  1YKD A;  5HDC A;  3BW6 A;  1V9Y A;  3DW0 A;  1PWC A;  2ACG A;  3LR3 A;  2XSS A;  4ZBE A;  4BWI A;  1YLW A;  3MZF A;  2V1Z A;  1MWT A;  3Q82 A;  2XR0 A;  3PR6 A;  2ZMV A;  3IWO A;  2VA0 A;  2WGW A;  4UQI S;  3PAE A;  3QP2 A;  2V0U A;  5U47 A;  1G28 A;  2W3D A;  4WLA A;  1N9O A;  3ZCZ A;  3LIC A;  4WMC A;  1S4S A;  2Z2L B;  2KLI A;  3GR2 A;  3OLO A;  3NOT C;  2VGL M;  1VB6 A;  1L0D A;  3T4O A;  2EX6 A;  3E0Y A;  3UDX A;  4GZB A;  4GJ4 A;  4EXO A;  3FV7 A;  3QP5 A;  3OC2 A;  3PBO A;  1DP8 A;  4MN5 A;  2HP6 A;  4KUO A;  3UME A;  3SOI A;  3WS0 A;  3T4J A;  2HP5 A;  1ZTU A;  3H9W A;  2PU4 A;  4EQI A;  3EEH A;  3IXH A;  2Z2M B;  1ES2 A;  3P09 A;  4UEY A;  3Q81 A;  1S66 L;  4GLQ A;  2CMN A;  5EUA A;  2IWD A;  5EOO A;  3D72 A;  4B93 A;  4G3W A;  3C4O A;  4LEN A;  2X01 A;  4Y5F A;  4I3J A;  2P04 A;  5C5K A;  4CLC E;  2BAS A;  3LUQ A;  1LSV A;  1CI8 A;  4HJ3 A;  3FKW A;  2V8F A;  4EER A;  2P74 A;  4O01 A;  4MNR A;  3UB6 A;  1SZV A;  2G7U A;  2WGW B;  3VFF A;  3IX3 A;  1ZG4 A;  4JXV A;  1MZU A;  1V9Z A;  1MXO A;  2W0N A;  5FAS A;  4DE3 A;  3N6I A;  5FEG A;  4MMN A;  2WKI A;  2Y2M A;  3GQZ A;  1NJ4 A;  1L0F A;  3BLS A;  2L0W A;  1JNU A;  1PI5 A;  3FZC A;  4M3K A;  4LCL A;  2ZL1 A;  1KDW A;  2KOI A;  2XRO A;  4DXC A;  1FIL A;  4JGR A;  3IBJ A;  4OKP A;  5FQQ A;  3FPV A;  3G4P A;  3T4Q A;  1K4F A;  5FAP A;  1MWS A;  2A3U A;  3T50 A;  1KE0 A;  1W63 Q;  3V67 A;  3MXQ A;  4EUZ A;  1VET A;  1TF1 A;  3SH8 A;  4Y3I A;  2ZC6 B;  4I3I A;  3RTY A;  5GLD A;  5HWV A;  3VOL A;  3Q1F A;  3LEZ A;  1L3L A;  4KUK A;  3HLD A;  1CF0 A;  4XUX A;  4HBT A;  1S6R A;  1JVJ A;  3IS2 A;  4P6Z M;  4KQQ A;  4JXW A;  3UE0 A;  5EVI C;  3V39 A;  2R78 A;  1OTE A;  5TBM A;  3DWZ A;  3S22 A;  4PM8 A;  3PBR A;  1MY8 A;  2XFT A;  4PM6 A;  2ZOH A;  4UQI M;  5J7E A;  1MC0 A;  5HAI A;  3LIE A;  4MLL A;  4YNR A;  2ZOI A;  5HL1 A;  3H7W A;  4N9L A;  5DFY A;  2EXB A;  2DNS A;  3G34 A;  2ZL1 B;  1PI4 A;  2D02 A;  3N8L A;  2W3H A;  4BBV A;  2Y2K A;  1J3W A;  3LIF A;  1MKM A;  3AGF A;  1M6K A;  5J4E A;  4WUJ A;  3RJU A;  1TVF A;  4R3J A;  4OOY A;  2WKH A;  5FI2 A;  5HD5 A;  1Y4O A;  1VET B;  2C5W B;  2ZLY A;  2PDR A;  2OAP 1;  3UNW A;  1DP6 A;  1NWZ A;  4KQR A;  4OON A;  4BLM A;  2NUT C;  3UE3 A;  1H5X A;  3GRJ A;  3CUE C;  4JGP A;  2OV5 A;  2CC1 A;  3SS4 A;  3VFH A;  3CZD A;  4JF6 A;  1CEG A;  5CRF A;  3D4F A;  3JPU A;  4BD1 A;  4KG6 A;  4F3L A;  3IWI A;  1TDG A;  2JBF A;  1YLJ A;  3OBF A;  3QP4 A;  3IF6 C;  3P7N A;  4D2O A;  3LFV A;  3IHA A;  4PKY A;  4P87 A;  4DMZ A;  4BL3 A;  2VV6 A;  4KZ5 A;  1BT5 A;  5F1G A;  4OPY A;  4UA6 A;  1D06 A;  5HPF A;  3BLM A;  4IBR A;  5FQJ A;  1ZKJ A;  3G31 A;  4HQA A;  3BRM A;  3LR4 A;  4EU0 A;  1BLS A;  3V50 A;  4EV4 A;  1NYY A;  5G4Z A;  1CJF A;  2HDQ A;  3NY4 A;  1L0G A;  4LGW A;  1BZA A;  1NZO A;  1CQA A;  2JKT M;  4IVK A;  1QMF A;  4BBT A;  4GDN A;  5CGW A;  4PM5 A;  2GDN A;  2ZMF A;  2WYX A;  2HDR A;  2V9A A;  2FH5 A;  4L9G A;  4B9O A;  4CLC B;  2XDM A;  1GSW A;  1WYC A;  2H5S A;  1OT9 A;  3W4Q A;  2QPN A;  4F3L B;  2PBY A;  1CEF A;  2AVX A;  2Y2I A;  3OCL A;  2W3F A;  4S2J A;  2ZC3 B;  1OTD A;  5FAO A;  4N1X A;  5DFX A;  4GN2 A;  2HDS A;  4HBU A;  1K4E A;  2J80 A;  3HLB A;  4X68 A;  5E2E A;  4IHQ A;  5TFQ A;  3MF0 A;  5FQI A;  2XEP A;  1Z6F A;  2P9V A;  2ZQC A;  4U0T A;  4IUK A;  4WBG A;  4WZ5 C;  3MZE A;  1SCW A;  1Q2P A;  4JF4 A;  1K55 C;  3SS3 A;  3EOI A;  4NXF A;  3HLC A;  2W27 A;  2O9C A;  3EEA A;  3HCY A;  1Z09 A;  3TOI A;  1W79 A;  3C4P A;  3U2A A;  4RYE A;  4IED A;  3MFD A;  5HX9 A;  3PBS A;  4GDB A;  4E3L A;  2ZQA A;  4ZJ1 A;  3MBZ A;  4RA7 A;  4OPQ A;  3DWK A;  3UB8 A;  3W4O A;  1HTZ A;  4CQH A;  2J7V A;  4MEZ A;  1PWD A;  5HD3 A;  1VEU B;  1LI9 A;  4Y7P A;  2J8Y A;  3HUN A;  5HW3 A;  1RP5 A;  3EQV A;  2J9O A;  4ZRR A;  1NRF A;  1W8Q A;  4U3T A;  2EX9 A;  1IOU A;  1FCN A;  3MKE A;  4R3A A;  5GLA A;  4R4R A;  3SS5 A;  5AVE A;  4ZJ3 A;  5DF9 A;  2Q0O A;  3E2L A;  4UA7 A;  3L7H A;  5FL3 A;  3VP0 A;  1AWI A;  2P9V B;  4EWF A;  4UAA A;  4NKP A;  3KYZ A;  4S2L A;  4CJN A;  5HPI A;  4L9F A;  3G2Z A;  5HFO A;  2VEA A;  1YT4 A;  2VK3 A;  3MFX A;  4LRZ E;  4C75 A;  2B5R A;  2J3T D;  5FI6 A;  2YKF A;  4JLF A;  1Q2Q A;  1W8Y A;  2Y2G A;  4DE1 A;  5E2G A;  3SH7 A;  3IWQ A;  2W3E A;  3S7N A;  1PNE A;  3T1R A;  3TE8 A;  2K7S A;  3VE4 A;  3W2Z A;  3MZD A;  5EVI A;  4AFI A;  3DTK A;  4RVA A;  3NDE A;  3KSI A;  3T1S A;  1GA9 A;  1IEL A;  2NUP C;  3T4S A;  5DTK A;  4R6L A;  1FQG A;  4JKT A;  4NET A;  3LI8 A;  4O7D A;  5HAP A;  1UWN X;  3NJA A;  1HVB A;  4HHD A;  4BJP A;  1PW1 A;  3DTI A;  2XA7 S;  2B95 A;  5FQM A;  5J3W A;  1PZO A;  3H82 B;  1GSV A;  4KZ4 A;  1G6O A;  3TSG A;  4EUV A;  1ALQ A;  2EWW A;  1PRQ A;  3A0R A;  1EWZ A;  3VSL A;  4E04 A;  3BWL A;  3HLG A;  1GA0 A;  1G68 A;  3IH8 A;  2GX5 A;  3NEC A;  3TRC A;  4R1G A;  1H8Z A;  4PAU A;  5EOE A;  5AQ7 A;  4O8G A;  1DJA A;  2IWB A;  3T12 B;  1YSP A;  4OPZ A;  3LR0 A;  2QWS A;  3B42 A;  2XH9 A;  3S7Q A;  5IS1 A;  4P6B A;  5EEC A;  3A3D A;  2PYR A;  4X69 A;  4EW7 A;  1N9N A;  1NRJ A;  2H0T A;  5EVI B;  1K54 A;  3UPO A;  4OOM A;  5AJG A;  3UDI A;  3MQ0 A;  2E8I A;  3HLE A;  5AVF A;  4ETZ A;  2WKQ A;  4Z1W A;  2EFU A;  2VJW A;  4K08 A;  4Y2F A;  3T4L A;  4KZ8 A;  4EBN A;  4EET B;  1CI9 A;  1FR1 A;  4JGQ A;  5CED A;  3JYI A;  3IX4 A;  3G35 A;  2M7V A;  4GNU A;  3F1P B;  2PRF A;  4NXB A;  1S0W A;  3G30 A;  3IXB A;  2ZM2 A;  3DBA A;  2GZA A;  1IYO A;  3UE6 A;  3GMW A;  3LIA A;  4FSF A;  3IX8 A;  2VZW A;  5FAQ A;  4E3J A;  2Y2L A;  3BEC A;  1K57 C;  3B3X A;  3DTE A;  5A93 A;  1FSY A;  1KDS A;  4MBK A;  4KG2 A;  1I5Q A;  1K6S A;  1S1Y A;  2O99 A;  4RX2 A;  3GDI A;  4O0P A;  1TDL A;  2WAF A;  2V0W A;  1A0K A;  1IYS A;  5F68 A;  4H8R A;  2I72 A;  1MWU A;  3LEQ A;  1ODV A;  5HDS A;  2OOL A;  3FWL A;  1UGU A;  1LSX A;  1YQS A;  3S7O A;  5HWT A;  5FA7 A;  2DMW A;  2XFS A;  3IF6 B;  2Y2P A;  4X6T A;  1AXB A;  3NUL A;  5AQA A;  3KSH A;  3G2Y A;  3SH9 A;  5CXW A;  1E3U D;  1H8Y A;  1VM1 A;  2EX8 A;  2K31 A;  2XA7 M;  1XA7 A;  1K56 D;  2OWH A;  4E3K A;  5I5L A;  1K55 A;  3V3S A;  3CI6 A;  2Y2N A;  1XJ3 A;  3BQ8 A;  4OQG A;  2J3T C;  4P0M A;  3W8K A;  1XGI A;  3QHY A;  2Y79 A;  1OTA A;  4GKU A;  5HZH A;  2DCF A;  4PKY G;  4GOG A;  3TG9 A;  5DJT A;  4Y15 A;  2Z6C A;  3NHQ A;  3UB9 A;  3G32 A;  2B02 A;  3BFE A;  3KSG A;  4R0Q A;  3GVB A;  1U60 A;  4LPZ A;  4NXE A;  4S2M A;  2H28 A;  2VKS A;  2P7J A;  1XJ2 A;  3E4P A;  4R38 A;  4QU3 A;  5FAT A;  1OME A;  2A2L A;  3N8S A;  4YFM A;  2Y2Q A;  2XF3 A;  3NCK A;  3KSF A;  3ULF A;  3UMD A;  5DF8 A;  4I5S A;  2O9B A;  1BUE A;  2WZX A;  4LFU A;  4FD8 A;  4QWO A;  4K0X A;  1OT6 A;  4WEL A;  1O07 A;  1ZC2 A;  3NBL A;  1WA9 A;  1LSW A;  5F82 A;  4ARZ B;  3FG8 A;  1SKO B;  5E43 A;  4GHI B;  3ZG8 B;  4II7 A;  5F6A A;  3GEC A;  2L4R A;  4HP9 A;  3U4L P;  4DDS A;  4KZ9 A;  3R7W A;  3E4O A;  2HDU A;  4ESP A;  3MJQ A;  3O5Y A;  1KGG A;  4HI4 A;  1PWG A;  5I94 A;  1YMS A;  3HRE A;  3WRT A;  3P01 A;  2WKP A;  3O87 A;  5HL6 A;  3JVV A;  2KDK A;  4C6Y A;  3PXP A;  5E2F A;  4PM9 A;  2PAV P;  3ITA A;  2V8C A;  2XK1 A;  4WF0 A;  3LCE A;  1O7E A;  3ZG9 B;  4IBX A;  1X0O A;  4CLC A;  4QJG A;  1GHP A;  3LI9 A;  5LBR A;  1D1J A;  3D9Y A;  3GSG A;  3VOZ A;  3PBQ A;  2WKR A;  4Z9Q A;  4PMA A;  4X53 A;  2JKT I;  1IFQ A;  1F98 A;  3FC7 A;  4NEE D;  4LV3 A;  4FH2 A;  3BFF A;  2ZM0 A;  3PBN A;  3ITB A;  1FCM A;  3GV9 A;  3OZH A;  4ID4 A;  5CEB A;  1ES3 A;  1DP9 A;  3NDG A;  2RCX A;  2PD7 A;  3CPT A;  5BOH A;  5FDH A;  3ICY A;  5HSQ A;  2OLV A;  3HBR A;  4BD0 A;  5KZH A;  2HJE A;  1OJ5 A;  3MS6 A;  1IYQ A;  1XX2 A;  5AQ9 A;  4LRX C;  1ACF A;  1XJ4 A;  2Y2O A;  3N4I A;  3R7W B;  2EX2 A;  4NG2 A;  1C3B A;  1F5M A;  1T19 A;  1WYB A;  3HUO A;  2JHE A;  1SKF A;  3UB5 P;  3HUM A;  4KZA A;  4DKI A;  3NI9 A;  2PD8 A;  4F94 A;  3T1Q B;  4S2P A;  5KSC A;  4DRT A;  1BUL A;  3VV4 A;  1KGF A;  2Y2J A;  2EFX A;  5L10 A;  1E4D A;  1PIO A;  3A3I A;  4GS9 B;  3S7P A;  3OPH A;  1ES5 A;  1ERQ A;  5CHJ A;  2ZBB A;  1VEU A;  3ZGA B;  3A3F A;  3VP3 A;  3WS5 A;  2WUQ A;  3JVU A;  1PFL A;  3AGE A;  4KZB A;  1ES4 A;  4DF6 A;  1LT0 A;  5M1A A;  3N7W A;  3S4X A;  3WS4 A;  3CPT B;  2HV1 A;  4FTX A;  1OJG A;  4A5R A;  5HAR A;  3BFG A;  2PT7 A;  3BQA A;  5GHX A;  2A24 A;  5GLC A;  2ZQ8 A;  3IXG A;  1STZ A;  1YLP A;  2FFF B;  3NC8 A;  1JWV A;  5MC7 A;  1YAX A;  4R3B A;  1LLB A;  3RFB A;  2V2F F;  5DJU A;  2XD1 A;  1GCE A;  3MMH A;  2LB5 A;  4CPK A;  4GW9 A;  2VGK A;  4ETX A;  3UDF A;  4LV0 A;  4WM9 A;  5A90 A;  1NY0 A;  2WZZ A;  5CGX A;  3QP6 A;  2R9X A;  2UWX A;  3CLO A;  4PM7 A;  5G4Y A;  2VLG A;  5DKK A;  4S2O A;  5DTT A;  4H6J B;  3F1N A;  3CAX A;  5HWW A;  1T1A A;  1T1B A;  4E6X A;  3Q07 A;  3V5M A;  1EI5 A;  2JKG A;  2ZJ9 A;  1T18 A;  3C2W A;  4LV2 A;  2Y55 A;  3UB7 A;  2MJ6 A;  1K6R A;  4R70 A;  1XFN A;  1P97 A;  4LCM A;  3H82 A;  5D3O A;  1UWP X;  3A3J A;  5JYO A;  5G18 A;  2H10 A;  1RCJ A;  4WZ4 A;  2EXA A;  3KYE A;  2W1T B;  4DN0 A;  1P9R A;  4BQM A;  2VGL S;  2A24 B;  4NK3 A;  3M2J A;  4X1L A;  1IYP A;  3O3V A;  4UHU A;  1N9L A;  4WEJ A;  4RQ9 A;  3ISG A;  3Q7Z A;  4LLO B;  4EEP A;  3CHW P;  4OP8 A;  2VV7 A;  3LYX A;  4OP5 A;  1L2S A;  4OVD A;  1N9B A;  2WK0 A;  2A49 A;  1SDN A;  2VGJ A;  4HES A;  4DE0 A;  3RH8 B;  3S1Y A;  3EGX C;  3F1N B; 
#chains in the Genus database with same CATH homology
 1CJF A;  1SZV A;  1VEU B;  3CPT A;  1G5U A;  5EV0 A;  2ZL1 B;  5FDS A;  1FIK A;  1PRQ A;  1A0K A;  1CQA A;  3MS6 A;  2ACG A;  1J3W A;  4X1M A;  2HZ5 A;  4D60 A;  1ACF A;  3LEQ A;  4QWO A;  3NEC A;  5FEG A;  3L7H A;  1AWI A;  2PBD P;  1Y4O A;  4X25 A;  1VET B;  3T1X A;  1SKO B;  2JKG A;  1F2K A;  2ZL1 A;  3UB5 P;  3T12 B;  1HLU P;  1FIL A;  3T1Q B;  3U4L P;  5EM0 A;  3NUL A;  2BTF P;  3DAV A;  2VK3 A;  4ESP A;  1VET A;  1VEU A;  5EVE A;  1YPR A;  3KYE A;  2PAV P;  1PNE A;  1CF0 A;  2V8C A;  3T1R A;  5EM1 A;  2JKF A;  1PFL A;  4X1L A;  5FEF A;  1Z09 A;  2PRF A;  2E8J A;  3T1S A;  3CHW P;  1D1J A;  1SKO A;  3CPT B;  3D9Y A;  4FUW A;  4FTX A;  3MSH A;  1K0K A;  2B95 A;  3LGO A;  2V8F A;  3L9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...