4I39A

Structures of ict and pr1 intermediates from time-resolved laue crystallography collected at 14id-b, aps
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Luminescent protein
total genus 39
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4i39A00
1DP9A 1GSWA 4I39A 2EA9A 4WL9A 3E4OA 2HV1A 4WUJA 2J80A 1S1YA 3LIAA 4R6LA 2KX6A 1TS6A 5HWWA 3KX0X 5F68A 2I9VA 2V0UA 4HOIA 4BBVA 5EFWA 5HWTA 4L9EA 5I5LA 2QJ7A 2VLGA 1JNUA 5AVFA 1N9OA 5HDDA 1P97A 3UE6A 3IBRA 1N9NA 3VE3A 5AVEA 4EERA 2WKPA 5F6AA 1GSXA 3EWKA 1N9LA 4I38A 2PR6A 1T1CA 3NOPC 3CAXA 3FC7A 1XJ2A 3C8CA 4R38A 4I3IA 4GW9A 1T18A 4NXGA 3F1OA 2VV7A 3ULFA 3H7WA 4LLOB 3UB9A 2W0NA 1OTIA 3B33A 3P7NA 3MFXA 2JHEA 2H28A 3NHQA 1P0ZA 4DJ2A 3G6OA 3OLOA 3RTYA 4NXEA 3FG8A 4XT2B 3CLOA 3NOUC 2A24A 4HH2A 3LI9A 2YKFA 4NXBA 5TBMB 2OWHA 1LT0A 2ZOIA 1UWNX 5HDSA 4F3LA 1XJ6A 5IU1A 4EW7A 4JGQA 1TS8A 4LRXC 2V9AA 5DKKA 1XJ3A 3H82B 5HDCA 4HJ6A 2PYPA 3F1NB 4YWZA 4BBTA 2PYRA 2VEAA 5KIZA 4H6JB 2R78A 3LIEA 1EW0A 3MR0A 3K3DA 3UMEA 3CWFA 2OWJA 4GHIB 4KUOA 2L4RA 1OTDA 4HNBA 5G4ZA 1OTAA 1T1AA 2D02A 3PYPA 4HJ4A 4HI4A 4K08A 4GS9B 4MN6A 1V9ZA 3HJKA 2L1MA 1UWPX 4JGRA 5DJUA 3F1PB 3LICA 1WA9A 3IS2B 4EXOA 2PHYA 2B02A 1DP8A 3MQQA 4L9FA 1OJ5A 1OT9A 4I3JA 1T19A 4HH3A 4PKYG 1Y28A 3UB6A 2K7SA 4M4XA 3C2WA 2CMNA 2WKRA 3NJAA 1BYWA 2VV8A 3MJQA 5DJTA 4LRYC 2M1CA 2PD8A 1OT6A 4NXFA 1KOUA 2GJ3A 1OJGA 2QKPA 2P7JA 4R70A 1NWZA 1GSVA 1XFNA 2JN7A 1T1BA 1G28A 2L0WA 3LIDA 1DRMA 2ZOHA 4HIAA 2YKHA 5A8BA 4L9GA 1S1ZA 4WLAA 2PDRA 2PD7A 3GDIA 5J4EA 5IS1A 5HSQA 3LIBA 3MXQA 3PHYA 3BWLA 4HHDA 1LSVA 3UB8A 3HJIA 5G4YA 2Z6DA 4WF0A 2OOLA 1S4SA 1ODVA 5F5YA 4I3AA 3E4PA 2QWSA 3A0SA 3LYXA 3E4QA 4LRZE 1OTEA 1S67L 1VB6A 1XFQA 3K3CA 3UB7A 3F1OB 3H7WB 4PKYA 5HD5A 5HWVA 5J7EA 5HD3A 3UMDA 5J3WA 4EEUA 4KUKA 4HP9A 4R3AA 1D7EA 3A0RA 2A24B 3GECA 4HQAA 1S66L 4XT2A 1TS7A 2INWA 4I5SA 3SW1A 4KQDA 5F69A 4EETB 5DKLA 1X0OA 3MQOA 1LL8A 2PR5A 3H9WA 5TBMA 2BASA 4F3LB 3D72A 3T50A 4HP4A 2Z6CA 3LIFA 4MN5A 1TS0A 2W27A 1UGUA 4EESA 4EEPA 3LI8A 1V9YA 4RQ9A 3H82A 4B9OA 3F1NA 3BY9A 3ZQ5A 3EEHA 4H6JA 2D01A 2V1AA 3RH8B 4DJ3A 3A0VA 1DP6A 4GHIA 2WKQA 1LSXA 4JGPA 1LSWA 4GCZA 4GS9A 1F98A 4JGOA 3VOLA 3F1PA 1D06A 2ZBBA 3IS2A 4LPZA 3VE4A 2VV6A 4HY8A 4BBUA 1XJ4A 3LUQA 3ICYA 3NOTC 4WN5A 4EQ1A 2QHKA 4HJ3A 1MZUA 1S4RA 3BY8A 5HZHA 4E04A 1OTBA 2V0WA 2KDKA 1F9IA 2V1BA 2QJ5A
chains in the Genus database with same CATH superfamily
1L2SA 4I39A 2EA9A 3BFDA 5FQQA 3C4PA 1PWCA 4WL9A 1ZG4A 4B88A 1BSGA 3UN7A 3G31A 3ZNYA 3PBTA 1TS6A 3OCNA 3ZVWA 4GN2A 4DE3A 1YLZA 2OV5A 2V0UA 4HOIA 4K0XA 1FCOA 2WGVA 3FZCA 1NZOA 5GHZA 4JF4A 4KZ3A 2Y2JA 4L9EA 1ONGA 2ZMVA 1LI9A 4IEDA 1VETB 1MC0A 4CQHA 4KZ5A 3HLEA 3FV7A 3NULA 4EERA 2V8CA 2HGVA 4A5RA 1YMSA 3MZFA 1ES3A 4WMCA 1N9LA 5E2EA 1JWVA 4UHUA 3EQVA 3ZDJA 5TR7A 3CAXA 3FC7A 2WGWB 3LO7A 3S7NA 2BG1A 5DFXA 2ZMFA 3OPLA 5A91A 2ZL1B 3UO9A 1E3UA 2O9CA 1PWGA 1T18A 1Q2PA 1E25A 1KDWA 1EWZA 3F1OA 5HL6A 3JYIA 3MSHA 5KZHA 2VV7A 1P9RA 1SKOA 4LLOB 3P7NA 5EVID 2WK0A 2JHEA 4BENA 3LR3A 3NHQA 4PM7A 4DJ2A 3OLOA 4B93A 5GHYA 4XT2B 1XA7A 5E2FA 2WYXA 2BTFP 4HH2A 3MXSA 3IX4A 3C5AA 2YKFA 4MDZA 3KO6A 2WADA 2ZQ8A 2H0TA 1LHYA 5F82A 1M6KA 3BQ8A 3OC2A 1UWNX 5HDSA 3OPPA 2RL3A 4JXVA 2J9OA 2VGLM 4EW7A 2J3TC 1H0MA 1TS8A 4UA9A 4FH2A 2V9AA 5GLCA 3BEBA 2JKFA 2VZWA 4N92A 3R7WA 3V3SA 5KIZA 4GZBA 1XGIA 1KGEA 5DVAA 4ZJ1A 1KGGA 3MR0A 4KUOA 2X71A 5G4ZA 1OTAA 3TRCA 3G34A 3VSKA 1V9ZA 4CPKA 3HJKA 2H0YA 4Z9QA 1MKMA 1L0GA 3LICA 4Y5FA 1RCJA 4LFUA 3VV4A 3CPTB 1K56A 1DP8A 2GDNA 1OJ5A 1T19A 3IH8A 1A0KA 2H5SA 5DF8A 4OLGA 1C3BA 3S7OA 3P98A 1FIKA 2XH9A 3W8KA 5KSCA 2WGIA 4WZ5C 2P08A 1BYWA 4R4RA 1NLZA 3SOIA 3BQAA 2VV8A 4QU3A 4LRYC 4RX2A 3UPPA 1OT6A 5EVIA 2ZQ9A 2EWWA 4GB7A 4UA6A 2K2NA 1T1BA 3PAEA 1G28A 2L0WA 3OOVA 1W79A 4MN7A 4IJGA 3OZHA 5FI2A 5A8BA 4O7DA 4LV2A 4R0QA 4MCWA 2ZQCA 2E8JA 5IS1A 1J9MA 2VJWA 5HSQA 1IKIA 1U60A 1JWZA 4BWIA 3IF5A 3BWLA 4HHDA 4LV0A 3GRJA 3ZG8B 3NCKA 4PM5A 1SDNA 5M1AA 5FL3A 5AQAA 4BD0A 1ODVA 4NK3A 3HVFA 5F5YA 2PRFA 4DE1A 3N8SA 2Q9NA 4IUHA 4Y17A 4U0TA 4WZ5A 3FPVA 1OTEA 2ZC7A 5FATA 1XPBA 1P9WA 1SZVA 4P87A 2XFTA 1HVBA 2WAFA 4YFMA 2XD5A 2DMWA 4MMNA 5FDSA 1L0DA 4WEKA 1RGZA 1PWDA 2B5RA 5HD3A 4GD8A 3S7QA 3ZVTA 2HJ9C 5FAPA 2O9BA 4EEUA 1LL9A 3N8LA 1GA9A 4R3AA 3E98A 1JWPA 4LGWA 3O3VA 3V5MA 3K2NA 4P85A 2A24B 3KYEA 2W1TB 1TS7A 2INWA 2PU2A 3PR6A 3SW1A 4K0WA 4KQDA 4EETB 1W63M 4JXSA 3ZG5A 1YLWA 2ZLYA 4ZJ2A 3H9WA 5L09A 2WKEA 1ES4A 3LR5A 5FDHA 5IHVA 4N1XA 5CERA 2LB5A 4KG6A 3G2ZA 2BASA 2ZM0A 4OP8A 1NRFA 4R3JA 4E3KA 4YNRA 3NIAA 2Z6CA 1TS0A 3W2ZA 3O88A 4EESA 3WS0A 2K31A 2MJ6A 4OQGA 3ZNTA 4B9OA 3F1NA 1W8QA 3L7HA 3MZDA 1K38A 3RFBA 4H6JA 2OLUA 1ZTUA 3RH8B 2P9VB 2W1RA 5GLBA 2ZJ9A 3VOYA 2VKSA 3T4JA 1VEUA 2XROA 1K6RA 4GHIA 2WKQA 4CLCC 4JGPA 4OPYA 1G5UA 2KLIA 3NC8A 4GCZA 1FQGA 3NECA 1F98A 5D3OA 3HLGA 5AJGA 1MBLA 3ITAA 3VOLA 3MF0A 5F83A 4FSFA 4BD1A 2PBDP 3F1PA 1G6AA 4Y15A 4N1HA 2VV6A 4HY8A 3DTEA 3LR4A 3LUQA 5M18A 3BECA 3CG5A 3O86A 1WYBA 1EI5A 3M6HA 3Q1FA 5JYPA 5DTTA 3BFCA 5CGSA 1FCMA 1F2KA 1KGFA 3Q7VB 3UE1A 1DJAA 3VSLA 3PBQA 1K55C 1RP5A 3M2KA 4PAUA 3LIAA 3WRTA 4R6LA 5FSRA 3LY4A 4S2IA 3LCEA 4S2PA 3G2YA 1NYMA 1QMEA 4CLCA 4OOMA 2W3GA 1S6RA 3NBLA 2IA2A 3WRZA 4N9LA 3IF6C 2C6WB 3B3XA 1Q2QA 4ZTKA 4ARZA 5HWTA 1DJBA 3AGFA 4OOYA 5EUAA 3NI9A 1KE0A 4X56A 2VLGA 2AVXA 4Q0JA 4MBKA 4PM8A 5TJJA 2O0YA 1P97A 3UE6A 1N9NA 2ACGA 5AVEA 1H8YA 3VFHA 2ZC4B 2WKPA 3S1YA 4PPRA 3HBRA 4X1LA 1VQQA 4NKPA 3NOPC 3MQ0A 4DDSA 2W3FA 2XD1A 3TOIA 5FI6A 1XJ2A 4BJPA 3BFFA 1HD8A 3C8CA 5FQKA 4R38A 2VGLS 1KE3A 2HDRA 3NY4A 5CX7A 2FFYA 5DF9A 3RXXA 1GHPA 3PBRA 2W0NA 1OTIA 2KOIA 3B33A 1L3LA 5IT5A 2PBYA 2X02A 1MWTA 1YLTA 2VA0A 1KVLA 1BLCA 3IF6A 4R1GA 4IVKA 3LI9A 1ERQA 4NXBA 2JCHA 4UAAA 1PIOA 5TBMB 2Y91A 2OWHA 2ZOIA 3CMZA 4FTXA 3UDIA 3T4KA 4O8GA 1ACFA 4F3LA 2Z2MB 3OBFA 4AFIA 5HAQA 1GA0A 4JGQA 1BT5A 5MC7A 1G6OA 4FOFA 5CRFA 3O5YA 4JF6A 2PYPA 1BZAA 2XLNA 4YWZA 1K54C 2Y55A 2PYRA 5FQIA 1FILA 3KYQA 3RJUA 2R78A 2ZQAA 2OWJA 5FEGA 1MWUA 3PBOA 5C5KA 4HBTA 2EWVA 1OTDA 2B18A 2CC1A 1YLYA 3S22A 1H3QA 5DTSA 1T1AA 1LLBA 2HDUA 3KSIA 2EXBA 4HI4A 4GS9B 4MN6A 3C30A 2XFSA 5E2HA 4JGRA 5DJUA 5FI7A 3IS2B 3CITA 2IWBA 3GV9A 5CHUA 3FPWA 1YT4A 4HH3A 1BLSA 4M4XA 4OKPA 3EOIA 3LEQA 2J7VA 2EX8A 2XF3A 2WKRA 2A2LA 4JF5A 4C75A 3IT9A 5GHXA 3MJQA 1K54A 4MBHA 5CGWA 2M1CA 2QKPA 1TDLA 4R70A 2Y2PA 3LGOA 4PM6A 2HDQA 4PHTA 3C38A 1NYYA 1WYCA 1D1JA 1LI0A 5EM0A 1QMFA 1FOFA 1BLHA 2Y2MA 2ZOHA 4HIAA 4DXCA 4MBFA 4L9GA 5BOHA 1S1ZA 1DJCA 3G35A 2WUQA 4JPMA 2W3HA 3IBJA 3VP2A 1YMXA 3TW8A 4OP5A 3PHYA 3DBAA 4KG2A 2I72A 1LSVA 4EWFA 3P01A 4G3KA 1STZA 5GLDA 4DMZA 4WF0A 1S4SA 4PM9A 3B47A 1IYSA 4ESPA 3HLWA 4WYYA 3VP0A 4ZAMA 3PBSA 5EVIC 3G4PA 3V67A 3ZHHA 2FH5A 2FZ0A 1AXBA 2V8FA 1XFQA 3K3CA 4II7A 3ZFZA 1MPLA 2BLSA 3UDXA 1CEGA 3F1OB 1ESIA 4E3LA 1CK3A 1SKOB 4PKYA 5HWVA 5J7EA 2LB9A 3M2JA 4D2OA 3DTMA 4JBFA 4HP9A 1D7EA 3A0RA 3GECA 4ZJ3A 1GHIA 2WZZA 3TG9A 4WELA 5F69A 3B42A 5DF7A 3D4FA 4L0LA 1LL8A 1W5DA 1ZKJA 1XX2A 4HEFA 5TGFA 3T50A 2OLVA 2XA7M 4GDBA 4HP4A 4HESA 2EXAA 4OPZA 1BTLA 3LIFA 3GVBA 4Y2FA 5LBRA 2W27A 5FEFA 3IHAA 5FQMA 4EEPA 5KMWA 4S2JA 3BM6A 1V9YA 3QP2A 1ES2A 3H82A 5HPIA 3W4QA 4UA7A 3R7WB 3BY9A 1YLPA 1YQSA 1SHVA 4EV4A 2HZ5A 4DJ3A 3A0VA 5EPHA 1DP6A 2ZQ7A 4KG5A 3I7JA 4QD4A 2R9XA 5HAIA 1CF0A 3D3OA 2WAEA 3SZTA 3TJZC 3E0YA 2VX8A 2J8YA 2O9AA 1GCEA 5EVEA 4HBUA 1NY0A 2XQZA 5EM1A 3T4SA 2ZBBA 3HCYA 4LPZA 3VE4A 2ZQDA 2X01A 1K0KA 3OPRA 4QY6A 4Q0IA 1XJ4A 2VK3A 1MZUA 4D60A 1S4RA 3EQUA 5HZHA 3GSGA 1IKGA 3T4QA 4RA7A 4Y0OA 1OTBA 2KDKA 1M40A 1F9IA 2V1BA 1BUEA 4FD8A 3BFGA 3WS5A 3E4OA 4RX3A 1CI8A 2ZM2A 5EVIB 4IBXA 4WUJA 2J80A 1S1YA 3SS4A 3N4IA 4OOLA 4E6WA 1PZPA 3HUOA 4ZRRA 5HWWA 3KX0X 3AGDA 4OQ0A 5F68A 1PI5A 2ZM8A 4KQOA 2I9VA 4LV3A 4Y0UA 3CZDA 4OLDA 3N6IA 2V2FF 3GMWA 4KZBA 4E6XA 2Y2HA 3IWIA 3C7VA 3HLBA 3VP4A 3SH9A 1JNUA 1ONHA 5HDDA 3IBRA 2NUPC 3VE3A 4DRTA 4KZ4A 1K57C 4EU0A 3TE8A 4XXRA 1GSXA 3EWKA 5DFYA 3VMAA 4I38A 2PR6A 4UEYA 1T1CA 4ID4A 3V50A 2QPNA 1MKIA 5CHMA 4Y0TA 2DCFA 2XSSA 1E4DA 4X55A 4ME4A 2HP9A 3LEZA 1K4EA 1IFQA 4I3IA 2QMIA 5CXWA 5E43A 3IX3A 5CEDA 1IELA 3SH7A 4S2NC 4DN0A 4BQMA 1TVFA 4ZBEA 1SDEA 1XGJA 3ULFA 3H7WA 4O0PA 3Q7ZA 3MFXA 5CGXA 3IWQA 4OVDA 3WS4A 3NDEA 3MXRA 2H28A 1KDSA 1P0ZA 4P0MA 3CHWP 3DW0A 2WKHA 2Y79A 3GTCA 3NOUC 2XRNA 4Q8IA 5EV0A 3CUEC 3VP1A 3NDGA 2Y59A 2ZC3B 1W7FA 1I2SA 1H8ZA 1IEMA 4G3VA 1LT0A 1YPRA 1OMEA 2ZD8A 4KENB 1G68A 4BL3A 1K57A 4YINA 1XJ6A 5HAPA 3O87A 4IVIA 1JTGA 3MKFA 3UY6A 2Y2KA 4KZ8A 5DKKA 1IYQA 1PRQA 2HJEA 5EOOA 3F1NB 3FWLA 3QP4A 2XEPA 4OPQA 4BBTA 2VEAA 1ALQA 3EEAA 4UQIM 4H6JB 3KSHA 3LIEA 2H10A 1EW0A 4F94A 1NLYA 3K3DA 3CWFA 1VEUB 4S2NA 3QHYA 4GHIB 1MWRA 2VGKA 2L4RA 4XUZA 4HNBA 1NXYA 4EUVA 3N7WA 2GNXA 3VFFA 3PYPA 4HJ4A 3EGXC 4GLQA 1FCNA 4Y3IA 1XA1A 2L1MA 2UWXA 2Y2QA 1UWPX 3F1PB 2QZ6A 5HPFA 3CUEA 3V3RA 3R4KA 4EXOA 2B02A 3A3FA 1YKDA 3MQQA 2OAP1 4KQRA 4C6YA 1PW1A 2W3EA 1CJFA 4ZDXA 1K6SA 4PKYG 1Y28A 3UB6A 1BLPA 2CMNA 3C2WA 4CLCE 1NZUA 3DWKA 3A3DA 4DKIA 1IOUA 2P74A 4DE2A 1PYYA 1FSWA 3DWZA 5DJTA 3RXWA 5L8MA 5AQ7A 2PD8A 4S2MA 1Z6FA 3T1XA 2GJ3A 2JKTM 2A3UA 3JPUA 4XUXA 5CTMA 5A92A 1XFNA 4S2KA 4CLCB 3MFDA 3LIDA 2JC7A 1ZG6A 1E3UD 2NUTC 4QB8A 3VP3A 2YKHA 1O07A 4FCFA 5GL9A 5G18A 4ARZB 2WKIA 4ETZA 4WZ4A 3Q81A 3GDIA 5J4EA 5F1FA 2O99A 3QP5A 3LIBA 3MXQA 3T1RA 1VETA 1YSQA 3HJIA 5G4YA 2Z6DA 2OOLA 3DAVA 4I3AA 2WGWA 3E4PA 2EX2A 2QWSA 2XA7S 3A3EA 3W4OA 1WE4A 2ZL1A 3HUMA 5AQ9A 3OCLA 1FR1A 4KZ6A 1TF1A 1Y54A 3M6BA 4PMAA 1ZC2A 3UMDA 3QP8A 2EX6A 5J3WA 4KUKA 4EBPA 3UDFA 3IQAA 5EECA 3IF6B 2ZC5B 2XK1A 4E3OA 4XT2A 1S66L 4I5SA 5EOEA 2M7UA 4KQQA 4ETXA 4DXBA 2HP6A 3PAGA 1BULA 4OQIA 2DRWA 2HF6A 4S2LA 4F3LB 3UE0A 5M19A 4RYEA 4M3KA 1J3WA 5HW3A 2PU4A 1JTDA 3HUNA 5GLAA 1K56D 1UGUA 3D9YA 3QP6A 4GD6A 1ESUA 3MZEA 4QWOA 3ZQ5A 1N9BA 1MWSA 3EEHA 4MNRA 3WWXA 2V1AA 3BFEA 2J3TD 3T12B 1HLUP 4NG2A 2JKRM 3BLSA 1CEFA 4EQIA 1LSWA 3SS3A 5JYOA 1S0WA 3G30A 3QNBA 5DTKA 4KZAA 3PXPA 4JGOA 2EFXA 1IYOA 1L0FA 1D06A 1MXOA 1IYPA 1K25A 2M7VA 4K91A 3CPTA 1L0EA 2G2UA 5AQBA 5HARA 3ZGAB 3NOTC 5KSHA 3BY8A 4N9KA 5I94A 2J9PA 5U47A 5CEBA 1TEMA 3FKVA 1DP9A 1GSWA 3U4LP 2JKGA 3QP1A 4MLLA 3S4XA 1Z09A 4E3IA 1KE4A 2GZAA 3MKEA 4BMWA 4C3QA 2HV1A 3DTIA 3IHBA 4WM9A 1YAXA 3P09A 4RVAA 4LCMA 2C5WB 2KX6A 3KSFA 4JKTA 5HFOA 3BRMA 3C7UA 5J8XA 3ZG7B 4LCLA 1HZOA 3IXHA 4GNUA 4QHCA 4P6ZM 4BBVA 3PBNA 5EFWA 5I5LA 1PZOA 1VHMA 2QJ7A 2IWDA 3N8RA 4R3BA 5EVLA 5AVFA 1N9OA 2Y4AA 4GKUA 2OAQ1 1PW8A 2GX5A 3GQZA 3KSGA 2ZC6B 3PTEA 1Y4OA 2Q9MA 5F6AA 3UE3A 3BJNA 4X68A 4WEJA 3KYZA 1XKZA 3UPNA 4Y7PA 3ISGA 4X53A 3MBZA 3Q82A 1H5XA 4GDNA 1K4FA 2PT7A 5FAOA 4S2OA 4X1MA 4GW9A 4NXGA 2UV0E 5CHJA 2QYBA 2Y2IA 4GOGA 4BL2A 3UB9A 2PAVP 3IWOA 4UQIS 4QPRA 4WBGA 3JVVA 2A49A 1FSYA 4DE0A 3C4OA 1SKFA 2V1ZA 3G6OA 3RTYA 4NXEA 3FG8A 3CLOA 2A24A 2ZMAA 3HL9A 4R23A 2W1TA 4EBNA 2JKTI 3ITBA 4QJGA 4IHQA 1F5MA 4G3WA 4YOFA 5FA7A 2P04A 3ZCZA 5FASA 5IU1A 3BYDA 4LRXC 3WS1A 5HX9A 3TSGA 2Q0OA 2VGJA 1XJ3A 3CJMA 3H82B 4QY5A 4LV1A 4HJ6A 5HDCA 5FQJA 3EGDC 3G32A 3V39A 1KVMA 3UB5P 4CJNA 3UMEA 2P9VA 5HL1A 4O01A 3W4PA 2EX9A 2XDMA 2JBFA 4U0XA 2D02A 2WZXA 3ZG0A 1CI9A 3E2KA 4K08A 4OPRA 3T4OA 3S7PA 5CECA 1VM1A 3T4LA 4CLCD 1WA9A 2Y2NA 3IXGA 4NEED 2PHYA 1TD5A 4L9FA 1OT9A 4I3JA 1EROA 1SCWA 3MS6A 2HDSA 2K7SA 3HLCA 3LFVA 3SH8A 2XGNA 3NJAA 1RGYA 3LR0A 4KZ7A 2Y2LA 3Q7VA 3ZG9B 4KZ9A 2W3DA 5FAQA 1YSPA 3HLFA 3IX8A 4Z1WA 4NXFA 4E3JA 1KOUA 2G7UA 1OJGA 5TFQA 2P7JA 4OONA 1NWZA 2Y2GA 1GSVA 2Z2LB 4E3NA 3IH9A 1CQAA 2JN7A 1DRMA 4EUZA 1GHMA 1XP4A 4WLAA 2PDRA 2PD7A 1I2WA 1YLJA 4EBLA 2JKRI 3A3IA 1W63Q 4U3TA 3UB8A 3IXBA 1YM1A 3HLDA 4X69A 3UPOA 3A0SA 3MMHA 3LYXA 3E4QA 3VOZA 1TDGA 4LRZE 1JVJA 1S67L 2FFFB 1VB6A 3UB7A 3BLMA 5A90A 4H8RA 3CI6A 3Q07A 3E2LA 3H7WB 3OPHA 4E3MA 5HD5A 5CTNA 4DDYA 1HTZA 3GR2A 2RCXA 3WS2A 4X25A 2EFUA 2Y2OA 5FQ9A 1I5QA 4HQAA 3T1SA 4JXGA 1LL5A 1PI4A 4IUKA 1MY8A 5DKLA 1X0OA 3MQOA 2E8IA 2XR0A 2PR5A 5TBMA 3DTKA 1ZHHB 3HREA 3D72A 3U2AA 3FYZA 4JLFA 2HP5A 2JE5A 4MN5A 5L10A 2DNSA 4R4SA 1W8YA 4WMCD 3LI8A 4RQ9A 1DY6A 4FH4A 3LY3A 5L2FA 2J3WA 1NJ4A 1XXMA 1O7EA 5A93A 4GJ4A 5L07A 3L9KA 2D01A 2B95A 1N4OA 1OPXA 1AWIA 4MEZA 1K55A 5K5BA 3SS5A 4DF6A 1LSXA 4LENA 2HPBA 4OH0A 3QNCA 3A3JA 3FKWA 4NETA 2OSUA 2V20A 4GS9A 4Y13A 3UNWA 1H8MA 1PFLA 2IWCA 3IXDA 4P6BA 4B4XA 2Y8HA 4B4ZA 4Q0HA 1NRJA 4BLMA 2R9WA 5EE8A 1ES5A 3IS2A 4P6ZS 4OQHA 4BBUA 4X6TA 4JXWA 3JVUA 3T1QB 1ERMA 3ZYTA 1FR6A 3BW6A 3ICYA 5F1GA 4EQ1A 4WN5A 4IBRA 1PNEA 2QHKA 4HJ3A 3AGEA 2G2WA 4FUWA 4E04A 2V0WA 3T4TA 2QJ5A 5E2GA
chains in the Genus database with same CATH topology
1DP9A 1GSWA 4I39A 2EA9A 3PBQA 4WL9A 2GZAA 3E4OA 4BMWA 2HV1A 4WUJA 2J80A 4PAUA 1S1YA 1YAXA 3LIAA 4OOLA 4R6LA 3PBTA 4ZRRA 2KX6A 1TS6A 3OCNA 5HWWA 3KX0X 3KSFA 5F68A 4CLCA 4KQOA 4OOMA 2W3GA 2I9VA 2V0UA 4HOIA 2IA2A 4P6ZM 4ARZA 4BBVA 3PBNA 5EFWA 5HWTA 4L9EA 5I5LA 1VHMA 2QJ7A 2ZMVA 2VLGA 4Q0JA 1JNUA 5AVFA 1N9OA 5TJJA 2OAQ1 2GX5A 1MC0A 4CQHA 2O0YA 5HDDA 1P97A 3KSGA 3UE6A 3IBRA 1N9NA 2NUPC 3VE3A 5AVEA 4EERA 2WKPA 4EU0A 2HGVA 5F6AA 3TE8A 3UE3A 1GSXA 3EWKA 3BJNA 5DFYA 1N9LA 4WEJA 4I38A 3KYZA 2PR6A 4NKPA 4UEYA 3EQVA 1T1CA 3NOPC 3CAXA 3FC7A 3MQ0A 2W3FA 3S7NA 1XJ2A 2XSSA 4BJPA 5DFXA 4ME4A 3C8CA 4R38A 2ZMFA 2PT7A 1IFQA 4I3IA 2VGLS 2O9CA 4GW9A 1T18A 4DN0A 4NXGA 3F1OA 5HL6A 2QYBA 2VV7A 5CX7A 5DF9A 3ULFA 1P9RA 3H7WA 4O0PA 3PBRA 4LLOB 3UB9A 2W0NA 1OTIA 2KOIA 3B33A 3P7NA 3MFXA 4UQIS 5IT5A 4QPRA 3JVVA 2JHEA 2H28A 2VA0A 3LR3A 3NHQA 1P0ZA 4DJ2A 3G6OA 3OLOA 3RTYA 4NXEA 4B93A 2Y79A 3FG8A 4XT2B 3CLOA 3NOUC 2A24A 2XRNA 2W1TA 4HH2A 3LI9A 3CUEC 2YKFA 2JKTI 4MDZA 3KO6A 4NXBA 4IHQA 1F5MA 5TBMB 4G3WA 4G3VA 2OWHA 1LT0A 4YOFA 2ZOIA 3T4KA 4O8GA 3BQ8A 3OC2A 2P04A 1UWNX 5HDSA 4F3LA 3OBFA 1XJ6A 2VGLM 5IU1A 4AFIA 4EW7A 2J3TC 4JGQA 1TS8A 5MC7A 1G6OA 4FOFA 4LRXC 2V9AA 5DKKA 2HJEA 3O5YA 1XJ3A 3H82B 5HDCA 4HJ6A 2PYPA 2VZWA 3F1NB 4YWZA 4BBTA 2PYRA 2VEAA 3EGDC 3R7WA 5KIZA 3KYQA 3EEAA 4UQIM 4H6JB 3KSHA 2R78A 3LIEA 1EW0A 3MR0A 1NLYA 3K3DA 3UMEA 3CWFA 2OWJA 4O01A 4GHIB 3PBOA 5C5KA 2EWVA 2L4RA 1OTDA 4KUOA 2B18A 4HNBA 5G4ZA 1OTAA 1H3QA 4EUVA 1T1AA 3TRCA 2D02A 2GNXA 3PYPA 3KSIA 3EGXC 4HJ4A 4GLQA 4HI4A 4K08A 4GS9B 4MN6A 4Y3IA 1V9ZA 3T4OA 3S7PA 3HJKA 3C30A 2L1MA 3T4LA 1UWPX 4JGRA 5DJUA 3F1PB 1MKMA 3LICA 4CLCD 1WA9A 5HPFA 3IS2B 3CUEA 3CITA 4NEED 4Y5FA 3R4KA 3VV4A 4EXOA 2PHYA 1TD5A 2B02A 1YKDA 1DP8A 3MQQA 2OAP1 4L9FA 3FPWA 2W3EA 1OJ5A 1OT9A 4I3JA 1T19A 4HH3A 4PKYG 1Y28A 3UB6A 2K7SA 4M4XA 3C2WA 2CMNA 3S7OA 3LFVA 3EOIA 4CLCE 2WKRA 3NJAA 2P08A 1BYWA 3LR0A 1NLZA 2A2LA 1IOUA 2W3DA 3BQAA 2VV8A 3MJQA 5DJTA 1YSPA 4LRYC 2M1CA 5L8MA 4Z1WA 2PD8A 1OT6A 4NXFA 1KOUA 2GJ3A 2G7UA 1OJGA 2JKTM 2QKPA 2P7JA 4R70A 2EWWA 1NWZA 1GSVA 2K2NA 1XFNA 4PHTA 3C38A 4CLCB 2JN7A 1T1BA 1G28A 2L0WA 3OOVA 3LIDA 1DRMA 4MN7A 4IJGA 2NUTC 2ZOHA 4HIAA 2YKHA 5A8BA 4L9GA 1S1ZA 4ARZB 4WLAA 4ETZA 4MCWA 2PDRA 2PD7A 2W3HA 3GDIA 5J4EA 3IBJA 2O99A 5IS1A 2VJWA 5HSQA 3LIBA 3TW8A 3MXQA 3PHYA 3DBAA 1YSQA 2JKRI 4BWIA 3BWLA 4HHDA 1W63Q 1LSVA 3P01A 3UB8A 4G3KA 5FL3A 3HJIA 1STZA 2Z6DA 5G4YA 4DMZA 4WF0A 2OOLA 1S4SA 1ODVA 5F5YA 3B47A 4I3AA 4IUHA 3E4PA 2QWSA 3A0SA 3MMHA 3LYXA 3PBSA 3V67A 3E4QA 2FH5A 4LRZE 3FPVA 2FZ0A 2XA7S 1OTEA 1S67L 1VB6A 1XFQA 3OCLA 3K3CA 1P9WA 4II7A 3UB7A 3CI6A 3F1OB 1TF1A 2DMWA 4MMNA 4WEKA 3H7WB 4PKYA 5HD5A 5HWVA 5J7EA 5HD3A 2LB9A 3S7QA 3UMDA 2HJ9C 2O9BA 5J3WA 4EEUA 4KUKA 4HP9A 4R3AA 1D7EA 3E98A 3A0RA 3K2NA 2A24B 3GECA 4HQAA 1S66L 4XT2A 2W1TB 1TS7A 2INWA 3PR6A 4I5SA 3SW1A 4WELA 4KQDA 2M7UA 5F69A 4EETB 1W63M 3B42A 4IUKA 5DKLA 4L0LA 1X0OA 3MQOA 4ETXA 1LL8A 2PR5A 3H9WA 5TBMA 3LR5A 2LB5A 2BASA 1ZHHB 2HF6A 4F3LB 3D72A 3T50A 4YNRA 3U2AA 2XA7M 4HP4A 2Z6CA 3LIFA 4Y2FA 5LBRA 4MN5A 1TS0A 2W27A 3W2ZA 1UGUA 4EESA 4EEPA 2K31A 3LI8A 1V9YA 2MJ6A 4RQ9A 3H82A 5HPIA 2J3WA 3R7WB 3F1NA 4B9OA 3BY9A 3ZQ5A 4GJ4A 3RFBA 3EEHA 4H6JA 1ZTUA 2D01A 2V1AA 3RH8B 2W1RA 1OPXA 2J3TD 2VKSA 4DJ3A 3T4JA 3A0VA 2XROA 1DP6A 4GHIA 5K5BA 2JKRM 2WKQA 4CLCC 1LSXA 4JGPA 1LSWA 3D3OA 2KLIA 3TJZC 3E0YA 4GCZA 2VX8A 4GS9A 1F98A 2O9AA 3PXPA 5AJGA 4JGOA 3VOLA 1H8MA 3MF0A 4FSFA 2Y8HA 4Q0HA 3F1PA 1NRJA 1D06A 3T4SA 2ZBBA 3HCYA 3IS2A 4LPZA 3VE4A 4P6ZS 2VV6A 4HY8A 4BBUA 2M7VA 4Q0IA 3LR4A 1XJ4A 3JVUA 3LUQA 3ZYTA 3BW6A 3ICYA 3NOTC 4WN5A 4EQ1A 2QHKA 4HJ3A 1MZUA 5KSHA 1S4RA 3BY8A 3EQUA 5HZHA 4E04A 3T4QA 1OTBA 2V0WA 2KDKA 1F9IA 2V1BA 3T4TA 2QJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DP9 A;  1GSW A;  4I39 A;  2EA9 A;  4WL9 A;  3E4O A;  2HV1 A;  4WUJ A;  2J80 A;  1S1Y A;  3LIA A;  4R6L A;  2KX6 A;  1TS6 A;  5HWW A;  3KX0 X;  5F68 A;  2I9V A;  2V0U A;  4HOI A;  4BBV A;  5EFW A;  5HWT A;  4L9E A;  5I5L A;  2QJ7 A;  2VLG A;  1JNU A;  5AVF A;  1N9O A;  5HDD A;  1P97 A;  3UE6 A;  3IBR A;  1N9N A;  3VE3 A;  5AVE A;  4EER A;  2WKP A;  5F6A A;  1GSX A;  3EWK A;  1N9L A;  4I38 A;  2PR6 A;  1T1C A;  3NOP C;  3CAX A;  3FC7 A;  1XJ2 A;  3C8C A;  4R38 A;  4I3I A;  4GW9 A;  1T18 A;  4NXG A;  3F1O A;  2VV7 A;  3ULF A;  3H7W A;  4LLO B;  3UB9 A;  2W0N A;  1OTI A;  3B33 A;  3P7N A;  3MFX A;  2JHE A;  2H28 A;  3NHQ A;  1P0Z A;  4DJ2 A;  3G6O A;  3OLO A;  3RTY A;  4NXE A;  3FG8 A;  4XT2 B;  3CLO A;  3NOU C;  2A24 A;  4HH2 A;  3LI9 A;  2YKF A;  4NXB A;  5TBM B;  2OWH A;  1LT0 A;  2ZOI A;  1UWN X;  5HDS A;  4F3L A;  1XJ6 A;  5IU1 A;  4EW7 A;  4JGQ A;  1TS8 A;  4LRX C;  2V9A A;  5DKK A;  1XJ3 A;  3H82 B;  5HDC A;  4HJ6 A;  2PYP A;  3F1N B;  4YWZ A;  4BBT A;  2PYR A;  2VEA A;  5KIZ A;  4H6J B;  2R78 A;  3LIE A;  1EW0 A;  3MR0 A;  3K3D A;  3UME A;  3CWF A;  2OWJ A;  4GHI B;  4KUO A;  2L4R A;  1OTD A;  4HNB A;  5G4Z A;  1OTA A;  1T1A A;  2D02 A;  3PYP A;  4HJ4 A;  4HI4 A;  4K08 A;  4GS9 B;  4MN6 A;  1V9Z A;  3HJK A;  2L1M A;  1UWP X;  4JGR A;  5DJU A;  3F1P B;  3LIC A;  1WA9 A;  3IS2 B;  4EXO A;  2PHY A;  2B02 A;  1DP8 A;  3MQQ A;  4L9F A;  1OJ5 A;  1OT9 A;  4I3J A;  1T19 A;  4HH3 A;  4PKY G;  1Y28 A;  3UB6 A;  2K7S A;  4M4X A;  3C2W A;  2CMN A;  2WKR A;  3NJA A;  1BYW A;  2VV8 A;  3MJQ A;  5DJT A;  4LRY C;  2M1C A;  2PD8 A;  1OT6 A;  4NXF A;  1KOU A;  2GJ3 A;  1OJG A;  2QKP A;  2P7J A;  4R70 A;  1NWZ A;  1GSV A;  1XFN A;  2JN7 A;  1T1B A;  1G28 A;  2L0W A;  3LID A;  1DRM A;  2ZOH A;  4HIA A;  2YKH A;  5A8B A;  4L9G A;  1S1Z A;  4WLA A;  2PDR A;  2PD7 A;  3GDI A;  5J4E A;  5IS1 A;  5HSQ A;  3LIB A;  3MXQ A;  3PHY A;  3BWL A;  4HHD A;  1LSV A;  3UB8 A;  3HJI A;  5G4Y A;  2Z6D A;  4WF0 A;  2OOL A;  1S4S A;  1ODV A;  5F5Y A;  4I3A A;  3E4P A;  2QWS A;  3A0S A;  3LYX A;  3E4Q A;  4LRZ E;  1OTE A;  1S67 L;  1VB6 A;  1XFQ A;  3K3C A;  3UB7 A;  3F1O B;  3H7W B;  4PKY A;  5HD5 A;  5HWV A;  5J7E A;  5HD3 A;  3UMD A;  5J3W A;  4EEU A;  4KUK A;  4HP9 A;  4R3A A;  1D7E A;  3A0R A;  2A24 B;  3GEC A;  4HQA A;  1S66 L;  4XT2 A;  1TS7 A;  2INW A;  4I5S A;  3SW1 A;  4KQD A;  5F69 A;  4EET B;  5DKL A;  1X0O A;  3MQO A;  1LL8 A;  2PR5 A;  3H9W A;  5TBM A;  2BAS A;  4F3L B;  3D72 A;  3T50 A;  4HP4 A;  2Z6C A;  3LIF A;  4MN5 A;  1TS0 A;  2W27 A;  1UGU A;  4EES A;  4EEP A;  3LI8 A;  1V9Y A;  4RQ9 A;  3H82 A;  4B9O A;  3F1N A;  3BY9 A;  3ZQ5 A;  3EEH A;  4H6J A;  2D01 A;  2V1A A;  3RH8 B;  4DJ3 A;  3A0V A;  1DP6 A;  4GHI A;  2WKQ A;  1LSX A;  4JGP A;  1LSW A;  4GCZ A;  4GS9 A;  1F98 A;  4JGO A;  3VOL A;  3F1P A;  1D06 A;  2ZBB A;  3IS2 A;  4LPZ A;  3VE4 A;  2VV6 A;  4HY8 A;  4BBU A;  1XJ4 A;  3LUQ A;  3ICY A;  3NOT C;  4WN5 A;  4EQ1 A;  2QHK A;  4HJ3 A;  1MZU A;  1S4R A;  3BY8 A;  5HZH A;  4E04 A;  1OTB A;  2V0W A;  2KDK A;  1F9I A;  2V1B A;  2QJ5 A; 
#chains in the Genus database with same CATH topology
 1L2S A;  4I39 A;  2EA9 A;  3BFD A;  5FQQ A;  3C4P A;  1PWC A;  4WL9 A;  1ZG4 A;  4B88 A;  1BSG A;  3UN7 A;  3G31 A;  3ZNY A;  3PBT A;  1TS6 A;  3OCN A;  3ZVW A;  4GN2 A;  4DE3 A;  1YLZ A;  2OV5 A;  2V0U A;  4HOI A;  4K0X A;  1FCO A;  2WGV A;  3FZC A;  1NZO A;  5GHZ A;  4JF4 A;  4KZ3 A;  2Y2J A;  4L9E A;  1ONG A;  2ZMV A;  1LI9 A;  4IED A;  1VET B;  1MC0 A;  4CQH A;  4KZ5 A;  3HLE A;  3FV7 A;  3NUL A;  4EER A;  2V8C A;  2HGV A;  4A5R A;  1YMS A;  3MZF A;  1ES3 A;  4WMC A;  1N9L A;  5E2E A;  1JWV A;  4UHU A;  3EQV A;  3ZDJ A;  5TR7 A;  3CAX A;  3FC7 A;  2WGW B;  3LO7 A;  3S7N A;  2BG1 A;  5DFX A;  2ZMF A;  3OPL A;  5A91 A;  2ZL1 B;  3UO9 A;  1E3U A;  2O9C A;  1PWG A;  1T18 A;  1Q2P A;  1E25 A;  1KDW A;  1EWZ A;  3F1O A;  5HL6 A;  3JYI A;  3MSH A;  5KZH A;  2VV7 A;  1P9R A;  1SKO A;  4LLO B;  3P7N A;  5EVI D;  2WK0 A;  2JHE A;  4BEN A;  3LR3 A;  3NHQ A;  4PM7 A;  4DJ2 A;  3OLO A;  4B93 A;  5GHY A;  4XT2 B;  1XA7 A;  5E2F A;  2WYX A;  2BTF P;  4HH2 A;  3MXS A;  3IX4 A;  3C5A A;  2YKF A;  4MDZ A;  3KO6 A;  2WAD A;  2ZQ8 A;  2H0T A;  1LHY A;  5F82 A;  1M6K A;  3BQ8 A;  3OC2 A;  1UWN X;  5HDS A;  3OPP A;  2RL3 A;  4JXV A;  2J9O A;  2VGL M;  4EW7 A;  2J3T C;  1H0M A;  1TS8 A;  4UA9 A;  4FH2 A;  2V9A A;  5GLC A;  3BEB A;  2JKF A;  2VZW A;  4N92 A;  3R7W A;  3V3S A;  5KIZ A;  4GZB A;  1XGI A;  1KGE A;  5DVA A;  4ZJ1 A;  1KGG A;  3MR0 A;  4KUO A;  2X71 A;  5G4Z A;  1OTA A;  3TRC A;  3G34 A;  3VSK A;  1V9Z A;  4CPK A;  3HJK A;  2H0Y A;  4Z9Q A;  1MKM A;  1L0G A;  3LIC A;  4Y5F A;  1RCJ A;  4LFU A;  3VV4 A;  3CPT B;  1K56 A;  1DP8 A;  2GDN A;  1OJ5 A;  1T19 A;  3IH8 A;  1A0K A;  2H5S A;  5DF8 A;  4OLG A;  1C3B A;  3S7O A;  3P98 A;  1FIK A;  2XH9 A;  3W8K A;  5KSC A;  2WGI A;  4WZ5 C;  2P08 A;  1BYW A;  4R4R A;  1NLZ A;  3SOI A;  3BQA A;  2VV8 A;  4QU3 A;  4LRY C;  4RX2 A;  3UPP A;  1OT6 A;  5EVI A;  2ZQ9 A;  2EWW A;  4GB7 A;  4UA6 A;  2K2N A;  1T1B A;  3PAE A;  1G28 A;  2L0W A;  3OOV A;  1W79 A;  4MN7 A;  4IJG A;  3OZH A;  5FI2 A;  5A8B A;  4O7D A;  4LV2 A;  4R0Q A;  4MCW A;  2ZQC A;  2E8J A;  5IS1 A;  1J9M A;  2VJW A;  5HSQ A;  1IKI A;  1U60 A;  1JWZ A;  4BWI A;  3IF5 A;  3BWL A;  4HHD A;  4LV0 A;  3GRJ A;  3ZG8 B;  3NCK A;  4PM5 A;  1SDN A;  5M1A A;  5FL3 A;  5AQA A;  4BD0 A;  1ODV A;  4NK3 A;  3HVF A;  5F5Y A;  2PRF A;  4DE1 A;  3N8S A;  2Q9N A;  4IUH A;  4Y17 A;  4U0T A;  4WZ5 A;  3FPV A;  1OTE A;  2ZC7 A;  5FAT A;  1XPB A;  1P9W A;  1SZV A;  4P87 A;  2XFT A;  1HVB A;  2WAF A;  4YFM A;  2XD5 A;  2DMW A;  4MMN A;  5FDS A;  1L0D A;  4WEK A;  1RGZ A;  1PWD A;  2B5R A;  5HD3 A;  4GD8 A;  3S7Q A;  3ZVT A;  2HJ9 C;  5FAP A;  2O9B A;  4EEU A;  1LL9 A;  3N8L A;  1GA9 A;  4R3A A;  3E98 A;  1JWP A;  4LGW A;  3O3V A;  3V5M A;  3K2N A;  4P85 A;  2A24 B;  3KYE A;  2W1T B;  1TS7 A;  2INW A;  2PU2 A;  3PR6 A;  3SW1 A;  4K0W A;  4KQD A;  4EET B;  1W63 M;  4JXS A;  3ZG5 A;  1YLW A;  2ZLY A;  4ZJ2 A;  3H9W A;  5L09 A;  2WKE A;  1ES4 A;  3LR5 A;  5FDH A;  5IHV A;  4N1X A;  5CER A;  2LB5 A;  4KG6 A;  3G2Z A;  2BAS A;  2ZM0 A;  4OP8 A;  1NRF A;  4R3J A;  4E3K A;  4YNR A;  3NIA A;  2Z6C A;  1TS0 A;  3W2Z A;  3O88 A;  4EES A;  3WS0 A;  2K31 A;  2MJ6 A;  4OQG A;  3ZNT A;  4B9O A;  3F1N A;  1W8Q A;  3L7H A;  3MZD A;  1K38 A;  3RFB A;  4H6J A;  2OLU A;  1ZTU A;  3RH8 B;  2P9V B;  2W1R A;  5GLB A;  2ZJ9 A;  3VOY A;  2VKS A;  3T4J A;  1VEU A;  2XRO A;  1K6R A;  4GHI A;  2WKQ A;  4CLC C;  4JGP A;  4OPY A;  1G5U A;  2KLI A;  3NC8 A;  4GCZ A;  1FQG A;  3NEC A;  1F98 A;  5D3O A;  3HLG A;  5AJG A;  1MBL A;  3ITA A;  3VOL A;  3MF0 A;  5F83 A;  4FSF A;  4BD1 A;  2PBD P;  3F1P A;  1G6A A;  4Y15 A;  4N1H A;  2VV6 A;  4HY8 A;  3DTE A;  3LR4 A;  3LUQ A;  5M18 A;  3BEC A;  3CG5 A;  3O86 A;  1WYB A;  1EI5 A;  3M6H A;  3Q1F A;  5JYP A;  5DTT A;  3BFC A;  5CGS A;  1FCM A;  1F2K A;  1KGF A;  3Q7V B;  3UE1 A;  1DJA A;  3VSL A;  3PBQ A;  1K55 C;  1RP5 A;  3M2K A;  4PAU A;  3LIA A;  3WRT A;  4R6L A;  5FSR A;  3LY4 A;  4S2I A;  3LCE A;  4S2P A;  3G2Y A;  1NYM A;  1QME A;  4CLC A;  4OOM A;  2W3G A;  1S6R A;  3NBL A;  2IA2 A;  3WRZ A;  4N9L A;  3IF6 C;  2C6W B;  3B3X A;  1Q2Q A;  4ZTK A;  4ARZ A;  5HWT A;  1DJB A;  3AGF A;  4OOY A;  5EUA A;  3NI9 A;  1KE0 A;  4X56 A;  2VLG A;  2AVX A;  4Q0J A;  4MBK A;  4PM8 A;  5TJJ A;  2O0Y A;  1P97 A;  3UE6 A;  1N9N A;  2ACG A;  5AVE A;  1H8Y A;  3VFH A;  2ZC4 B;  2WKP A;  3S1Y A;  4PPR A;  3HBR A;  4X1L A;  1VQQ A;  4NKP A;  3NOP C;  3MQ0 A;  4DDS A;  2W3F A;  2XD1 A;  3TOI A;  5FI6 A;  1XJ2 A;  4BJP A;  3BFF A;  1HD8 A;  3C8C A;  5FQK A;  4R38 A;  2VGL S;  1KE3 A;  2HDR A;  3NY4 A;  5CX7 A;  2FFY A;  5DF9 A;  3RXX A;  1GHP A;  3PBR A;  2W0N A;  1OTI A;  2KOI A;  3B33 A;  1L3L A;  5IT5 A;  2PBY A;  2X02 A;  1MWT A;  1YLT A;  2VA0 A;  1KVL A;  1BLC A;  3IF6 A;  4R1G A;  4IVK A;  3LI9 A;  1ERQ A;  4NXB A;  2JCH A;  4UAA A;  1PIO A;  5TBM B;  2Y91 A;  2OWH A;  2ZOI A;  3CMZ A;  4FTX A;  3UDI A;  3T4K A;  4O8G A;  1ACF A;  4F3L A;  2Z2M B;  3OBF A;  4AFI A;  5HAQ A;  1GA0 A;  4JGQ A;  1BT5 A;  5MC7 A;  1G6O A;  4FOF A;  5CRF A;  3O5Y A;  4JF6 A;  2PYP A;  1BZA A;  2XLN A;  4YWZ A;  1K54 C;  2Y55 A;  2PYR A;  5FQI A;  1FIL A;  3KYQ A;  3RJU A;  2R78 A;  2ZQA A;  2OWJ A;  5FEG A;  1MWU A;  3PBO A;  5C5K A;  4HBT A;  2EWV A;  1OTD A;  2B18 A;  2CC1 A;  1YLY A;  3S22 A;  1H3Q A;  5DTS A;  1T1A A;  1LLB A;  2HDU A;  3KSI A;  2EXB A;  4HI4 A;  4GS9 B;  4MN6 A;  3C30 A;  2XFS A;  5E2H A;  4JGR A;  5DJU A;  5FI7 A;  3IS2 B;  3CIT A;  2IWB A;  3GV9 A;  5CHU A;  3FPW A;  1YT4 A;  4HH3 A;  1BLS A;  4M4X A;  4OKP A;  3EOI A;  3LEQ A;  2J7V A;  2EX8 A;  2XF3 A;  2WKR A;  2A2L A;  4JF5 A;  4C75 A;  3IT9 A;  5GHX A;  3MJQ A;  1K54 A;  4MBH A;  5CGW A;  2M1C A;  2QKP A;  1TDL A;  4R70 A;  2Y2P A;  3LGO A;  4PM6 A;  2HDQ A;  4PHT A;  3C38 A;  1NYY A;  1WYC A;  1D1J A;  1LI0 A;  5EM0 A;  1QMF A;  1FOF A;  1BLH A;  2Y2M A;  2ZOH A;  4HIA A;  4DXC A;  4MBF A;  4L9G A;  5BOH A;  1S1Z A;  1DJC A;  3G35 A;  2WUQ A;  4JPM A;  2W3H A;  3IBJ A;  3VP2 A;  1YMX A;  3TW8 A;  4OP5 A;  3PHY A;  3DBA A;  4KG2 A;  2I72 A;  1LSV A;  4EWF A;  3P01 A;  4G3K A;  1STZ A;  5GLD A;  4DMZ A;  4WF0 A;  1S4S A;  4PM9 A;  3B47 A;  1IYS A;  4ESP A;  3HLW A;  4WYY A;  3VP0 A;  4ZAM A;  3PBS A;  5EVI C;  3G4P A;  3V67 A;  3ZHH A;  2FH5 A;  2FZ0 A;  1AXB A;  2V8F A;  1XFQ A;  3K3C A;  4II7 A;  3ZFZ A;  1MPL A;  2BLS A;  3UDX A;  1CEG A;  3F1O B;  1ESI A;  4E3L A;  1CK3 A;  1SKO B;  4PKY A;  5HWV A;  5J7E A;  2LB9 A;  3M2J A;  4D2O A;  3DTM A;  4JBF A;  4HP9 A;  1D7E A;  3A0R A;  3GEC A;  4ZJ3 A;  1GHI A;  2WZZ A;  3TG9 A;  4WEL A;  5F69 A;  3B42 A;  5DF7 A;  3D4F A;  4L0L A;  1LL8 A;  1W5D A;  1ZKJ A;  1XX2 A;  4HEF A;  5TGF A;  3T50 A;  2OLV A;  2XA7 M;  4GDB A;  4HP4 A;  4HES A;  2EXA A;  4OPZ A;  1BTL A;  3LIF A;  3GVB A;  4Y2F A;  5LBR A;  2W27 A;  5FEF A;  3IHA A;  5FQM A;  4EEP A;  5KMW A;  4S2J A;  3BM6 A;  1V9Y A;  3QP2 A;  1ES2 A;  3H82 A;  5HPI A;  3W4Q A;  4UA7 A;  3R7W B;  3BY9 A;  1YLP A;  1YQS A;  1SHV A;  4EV4 A;  2HZ5 A;  4DJ3 A;  3A0V A;  5EPH A;  1DP6 A;  2ZQ7 A;  4KG5 A;  3I7J A;  4QD4 A;  2R9X A;  5HAI A;  1CF0 A;  3D3O A;  2WAE A;  3SZT A;  3TJZ C;  3E0Y A;  2VX8 A;  2J8Y A;  2O9A A;  1GCE A;  5EVE A;  4HBU A;  1NY0 A;  2XQZ A;  5EM1 A;  3T4S A;  2ZBB A;  3HCY A;  4LPZ A;  3VE4 A;  2ZQD A;  2X01 A;  1K0K A;  3OPR A;  4QY6 A;  4Q0I A;  1XJ4 A;  2VK3 A;  1MZU A;  4D60 A;  1S4R A;  3EQU A;  5HZH A;  3GSG A;  1IKG A;  3T4Q A;  4RA7 A;  4Y0O A;  1OTB A;  2KDK A;  1M40 A;  1F9I A;  2V1B A;  1BUE A;  4FD8 A;  3BFG A;  3WS5 A;  3E4O A;  4RX3 A;  1CI8 A;  2ZM2 A;  5EVI B;  4IBX A;  4WUJ A;  2J80 A;  1S1Y A;  3SS4 A;  3N4I A;  4OOL A;  4E6W A;  1PZP A;  3HUO A;  4ZRR A;  5HWW A;  3KX0 X;  3AGD A;  4OQ0 A;  5F68 A;  1PI5 A;  2ZM8 A;  4KQO A;  2I9V A;  4LV3 A;  4Y0U A;  3CZD A;  4OLD A;  3N6I A;  2V2F F;  3GMW A;  4KZB A;  4E6X A;  2Y2H A;  3IWI A;  3C7V A;  3HLB A;  3VP4 A;  3SH9 A;  1JNU A;  1ONH A;  5HDD A;  3IBR A;  2NUP C;  3VE3 A;  4DRT A;  4KZ4 A;  1K57 C;  4EU0 A;  3TE8 A;  4XXR A;  1GSX A;  3EWK A;  5DFY A;  3VMA A;  4I38 A;  2PR6 A;  4UEY A;  1T1C A;  4ID4 A;  3V50 A;  2QPN A;  1MKI A;  5CHM A;  4Y0T A;  2DCF A;  2XSS A;  1E4D A;  4X55 A;  4ME4 A;  2HP9 A;  3LEZ A;  1K4E A;  1IFQ A;  4I3I A;  2QMI A;  5CXW A;  5E43 A;  3IX3 A;  5CED A;  1IEL A;  3SH7 A;  4S2N C;  4DN0 A;  4BQM A;  1TVF A;  4ZBE A;  1SDE A;  1XGJ A;  3ULF A;  3H7W A;  4O0P A;  3Q7Z A;  3MFX A;  5CGX A;  3IWQ A;  4OVD A;  3WS4 A;  3NDE A;  3MXR A;  2H28 A;  1KDS A;  1P0Z A;  4P0M A;  3CHW P;  3DW0 A;  2WKH A;  2Y79 A;  3GTC A;  3NOU C;  2XRN A;  4Q8I A;  5EV0 A;  3CUE C;  3VP1 A;  3NDG A;  2Y59 A;  2ZC3 B;  1W7F A;  1I2S A;  1H8Z A;  1IEM A;  4G3V A;  1LT0 A;  1YPR A;  1OME A;  2ZD8 A;  4KEN B;  1G68 A;  4BL3 A;  1K57 A;  4YIN A;  1XJ6 A;  5HAP A;  3O87 A;  4IVI A;  1JTG A;  3MKF A;  3UY6 A;  2Y2K A;  4KZ8 A;  5DKK A;  1IYQ A;  1PRQ A;  2HJE A;  5EOO A;  3F1N B;  3FWL A;  3QP4 A;  2XEP A;  4OPQ A;  4BBT A;  2VEA A;  1ALQ A;  3EEA A;  4UQI M;  4H6J B;  3KSH A;  3LIE A;  2H10 A;  1EW0 A;  4F94 A;  1NLY A;  3K3D A;  3CWF A;  1VEU B;  4S2N A;  3QHY A;  4GHI B;  1MWR A;  2VGK A;  2L4R A;  4XUZ A;  4HNB A;  1NXY A;  4EUV A;  3N7W A;  2GNX A;  3VFF A;  3PYP A;  4HJ4 A;  3EGX C;  4GLQ A;  1FCN A;  4Y3I A;  1XA1 A;  2L1M A;  2UWX A;  2Y2Q A;  1UWP X;  3F1P B;  2QZ6 A;  5HPF A;  3CUE A;  3V3R A;  3R4K A;  4EXO A;  2B02 A;  3A3F A;  1YKD A;  3MQQ A;  2OAP 1;  4KQR A;  4C6Y A;  1PW1 A;  2W3E A;  1CJF A;  4ZDX A;  1K6S A;  4PKY G;  1Y28 A;  3UB6 A;  1BLP A;  2CMN A;  3C2W A;  4CLC E;  1NZU A;  3DWK A;  3A3D A;  4DKI A;  1IOU A;  2P74 A;  4DE2 A;  1PYY A;  1FSW A;  3DWZ A;  5DJT A;  3RXW A;  5L8M A;  5AQ7 A;  2PD8 A;  4S2M A;  1Z6F A;  3T1X A;  2GJ3 A;  2JKT M;  2A3U A;  3JPU A;  4XUX A;  5CTM A;  5A92 A;  1XFN A;  4S2K A;  4CLC B;  3MFD A;  3LID A;  2JC7 A;  1ZG6 A;  1E3U D;  2NUT C;  4QB8 A;  3VP3 A;  2YKH A;  1O07 A;  4FCF A;  5GL9 A;  5G18 A;  4ARZ B;  2WKI A;  4ETZ A;  4WZ4 A;  3Q81 A;  3GDI A;  5J4E A;  5F1F A;  2O99 A;  3QP5 A;  3LIB A;  3MXQ A;  3T1R A;  1VET A;  1YSQ A;  3HJI A;  5G4Y A;  2Z6D A;  2OOL A;  3DAV A;  4I3A A;  2WGW A;  3E4P A;  2EX2 A;  2QWS A;  2XA7 S;  3A3E A;  3W4O A;  1WE4 A;  2ZL1 A;  3HUM A;  5AQ9 A;  3OCL A;  1FR1 A;  4KZ6 A;  1TF1 A;  1Y54 A;  3M6B A;  4PMA A;  1ZC2 A;  3UMD A;  3QP8 A;  2EX6 A;  5J3W A;  4KUK A;  4EBP A;  3UDF A;  3IQA A;  5EEC A;  3IF6 B;  2ZC5 B;  2XK1 A;  4E3O A;  4XT2 A;  1S66 L;  4I5S A;  5EOE A;  2M7U A;  4KQQ A;  4ETX A;  4DXB A;  2HP6 A;  3PAG A;  1BUL A;  4OQI A;  2DRW A;  2HF6 A;  4S2L A;  4F3L B;  3UE0 A;  5M19 A;  4RYE A;  4M3K A;  1J3W A;  5HW3 A;  2PU4 A;  1JTD A;  3HUN A;  5GLA A;  1K56 D;  1UGU A;  3D9Y A;  3QP6 A;  4GD6 A;  1ESU A;  3MZE A;  4QWO A;  3ZQ5 A;  1N9B A;  1MWS A;  3EEH A;  4MNR A;  3WWX A;  2V1A A;  3BFE A;  2J3T D;  3T12 B;  1HLU P;  4NG2 A;  2JKR M;  3BLS A;  1CEF A;  4EQI A;  1LSW A;  3SS3 A;  5JYO A;  1S0W A;  3G30 A;  3QNB A;  5DTK A;  4KZA A;  3PXP A;  4JGO A;  2EFX A;  1IYO A;  1L0F A;  1D06 A;  1MXO A;  1IYP A;  1K25 A;  2M7V A;  4K91 A;  3CPT A;  1L0E A;  2G2U A;  5AQB A;  5HAR A;  3ZGA B;  3NOT C;  5KSH A;  3BY8 A;  4N9K A;  5I94 A;  2J9P A;  5U47 A;  5CEB A;  1TEM A;  3FKV A;  1DP9 A;  1GSW A;  3U4L P;  2JKG A;  3QP1 A;  4MLL A;  3S4X A;  1Z09 A;  4E3I A;  1KE4 A;  2GZA A;  3MKE A;  4BMW A;  4C3Q A;  2HV1 A;  3DTI A;  3IHB A;  4WM9 A;  1YAX A;  3P09 A;  4RVA A;  4LCM A;  2C5W B;  2KX6 A;  3KSF A;  4JKT A;  5HFO A;  3BRM A;  3C7U A;  5J8X A;  3ZG7 B;  4LCL A;  1HZO A;  3IXH A;  4GNU A;  4QHC A;  4P6Z M;  4BBV A;  3PBN A;  5EFW A;  5I5L A;  1PZO A;  1VHM A;  2QJ7 A;  2IWD A;  3N8R A;  4R3B A;  5EVL A;  5AVF A;  1N9O A;  2Y4A A;  4GKU A;  2OAQ 1;  1PW8 A;  2GX5 A;  3GQZ A;  3KSG A;  2ZC6 B;  3PTE A;  1Y4O A;  2Q9M A;  5F6A A;  3UE3 A;  3BJN A;  4X68 A;  4WEJ A;  3KYZ A;  1XKZ A;  3UPN A;  4Y7P A;  3ISG A;  4X53 A;  3MBZ A;  3Q82 A;  1H5X A;  4GDN A;  1K4F A;  2PT7 A;  5FAO A;  4S2O A;  4X1M A;  4GW9 A;  4NXG A;  2UV0 E;  5CHJ A;  2QYB A;  2Y2I A;  4GOG A;  4BL2 A;  3UB9 A;  2PAV P;  3IWO A;  4UQI S;  4QPR A;  4WBG A;  3JVV A;  2A49 A;  1FSY A;  4DE0 A;  3C4O A;  1SKF A;  2V1Z A;  3G6O A;  3RTY A;  4NXE A;  3FG8 A;  3CLO A;  2A24 A;  2ZMA A;  3HL9 A;  4R23 A;  2W1T A;  4EBN A;  2JKT I;  3ITB A;  4QJG A;  4IHQ A;  1F5M A;  4G3W A;  4YOF A;  5FA7 A;  2P04 A;  3ZCZ A;  5FAS A;  5IU1 A;  3BYD A;  4LRX C;  3WS1 A;  5HX9 A;  3TSG A;  2Q0O A;  2VGJ A;  1XJ3 A;  3CJM A;  3H82 B;  4QY5 A;  4LV1 A;  4HJ6 A;  5HDC A;  5FQJ A;  3EGD C;  3G32 A;  3V39 A;  1KVM A;  3UB5 P;  4CJN A;  3UME A;  2P9V A;  5HL1 A;  4O01 A;  3W4P A;  2EX9 A;  2XDM A;  2JBF A;  4U0X A;  2D02 A;  2WZX A;  3ZG0 A;  1CI9 A;  3E2K A;  4K08 A;  4OPR A;  3T4O A;  3S7P A;  5CEC A;  1VM1 A;  3T4L A;  4CLC D;  1WA9 A;  2Y2N A;  3IXG A;  4NEE D;  2PHY A;  1TD5 A;  4L9F A;  1OT9 A;  4I3J A;  1ERO A;  1SCW A;  3MS6 A;  2HDS A;  2K7S A;  3HLC A;  3LFV A;  3SH8 A;  2XGN A;  3NJA A;  1RGY A;  3LR0 A;  4KZ7 A;  2Y2L A;  3Q7V A;  3ZG9 B;  4KZ9 A;  2W3D A;  5FAQ A;  1YSP A;  3HLF A;  3IX8 A;  4Z1W A;  4NXF A;  4E3J A;  1KOU A;  2G7U A;  1OJG A;  5TFQ A;  2P7J A;  4OON A;  1NWZ A;  2Y2G A;  1GSV A;  2Z2L B;  4E3N A;  3IH9 A;  1CQA A;  2JN7 A;  1DRM A;  4EUZ A;  1GHM A;  1XP4 A;  4WLA A;  2PDR A;  2PD7 A;  1I2W A;  1YLJ A;  4EBL A;  2JKR I;  3A3I A;  1W63 Q;  4U3T A;  3UB8 A;  3IXB A;  1YM1 A;  3HLD A;  4X69 A;  3UPO A;  3A0S A;  3MMH A;  3LYX A;  3E4Q A;  3VOZ A;  1TDG A;  4LRZ E;  1JVJ A;  1S67 L;  2FFF B;  1VB6 A;  3UB7 A;  3BLM A;  5A90 A;  4H8R A;  3CI6 A;  3Q07 A;  3E2L A;  3H7W B;  3OPH A;  4E3M A;  5HD5 A;  5CTN A;  4DDY A;  1HTZ A;  3GR2 A;  2RCX A;  3WS2 A;  4X25 A;  2EFU A;  2Y2O A;  5FQ9 A;  1I5Q A;  4HQA A;  3T1S A;  4JXG A;  1LL5 A;  1PI4 A;  4IUK A;  1MY8 A;  5DKL A;  1X0O A;  3MQO A;  2E8I A;  2XR0 A;  2PR5 A;  5TBM A;  3DTK A;  1ZHH B;  3HRE A;  3D72 A;  3U2A A;  3FYZ A;  4JLF A;  2HP5 A;  2JE5 A;  4MN5 A;  5L10 A;  2DNS A;  4R4S A;  1W8Y A;  4WMC D;  3LI8 A;  4RQ9 A;  1DY6 A;  4FH4 A;  3LY3 A;  5L2F A;  2J3W A;  1NJ4 A;  1XXM A;  1O7E A;  5A93 A;  4GJ4 A;  5L07 A;  3L9K A;  2D01 A;  2B95 A;  1N4O A;  1OPX A;  1AWI A;  4MEZ A;  1K55 A;  5K5B A;  3SS5 A;  4DF6 A;  1LSX A;  4LEN A;  2HPB A;  4OH0 A;  3QNC A;  3A3J A;  3FKW A;  4NET A;  2OSU A;  2V20 A;  4GS9 A;  4Y13 A;  3UNW A;  1H8M A;  1PFL A;  2IWC A;  3IXD A;  4P6B A;  4B4X A;  2Y8H A;  4B4Z A;  4Q0H A;  1NRJ A;  4BLM A;  2R9W A;  5EE8 A;  1ES5 A;  3IS2 A;  4P6Z S;  4OQH A;  4BBU A;  4X6T A;  4JXW A;  3JVU A;  3T1Q B;  1ERM A;  3ZYT A;  1FR6 A;  3BW6 A;  3ICY A;  5F1G A;  4EQ1 A;  4WN5 A;  4IBR A;  1PNE A;  2QHK A;  4HJ3 A;  3AGE A;  2G2W A;  4FUW A;  4E04 A;  2V0W A;  3T4T A;  2QJ5 A;  5E2G A; 
#chains in the Genus database with same CATH homology
 1DP9 A;  1GSW A;  4I39 A;  2EA9 A;  3PBQ A;  4WL9 A;  2GZA A;  3E4O A;  4BMW A;  2HV1 A;  4WUJ A;  2J80 A;  4PAU A;  1S1Y A;  1YAX A;  3LIA A;  4OOL A;  4R6L A;  3PBT A;  4ZRR A;  2KX6 A;  1TS6 A;  3OCN A;  5HWW A;  3KX0 X;  3KSF A;  5F68 A;  4CLC A;  4KQO A;  4OOM A;  2W3G A;  2I9V A;  2V0U A;  4HOI A;  2IA2 A;  4P6Z M;  4ARZ A;  4BBV A;  3PBN A;  5EFW A;  5HWT A;  4L9E A;  5I5L A;  1VHM A;  2QJ7 A;  2ZMV A;  2VLG A;  4Q0J A;  1JNU A;  5AVF A;  1N9O A;  5TJJ A;  2OAQ 1;  2GX5 A;  1MC0 A;  4CQH A;  2O0Y A;  5HDD A;  1P97 A;  3KSG A;  3UE6 A;  3IBR A;  1N9N A;  2NUP C;  3VE3 A;  5AVE A;  4EER A;  2WKP A;  4EU0 A;  2HGV A;  5F6A A;  3TE8 A;  3UE3 A;  1GSX A;  3EWK A;  3BJN A;  5DFY A;  1N9L A;  4WEJ A;  4I38 A;  3KYZ A;  2PR6 A;  4NKP A;  4UEY A;  3EQV A;  1T1C A;  3NOP C;  3CAX A;  3FC7 A;  3MQ0 A;  2W3F A;  3S7N A;  1XJ2 A;  2XSS A;  4BJP A;  5DFX A;  4ME4 A;  3C8C A;  4R38 A;  2ZMF A;  2PT7 A;  1IFQ A;  4I3I A;  2VGL S;  2O9C A;  4GW9 A;  1T18 A;  4DN0 A;  4NXG A;  3F1O A;  5HL6 A;  2QYB A;  2VV7 A;  5CX7 A;  5DF9 A;  3ULF A;  1P9R A;  3H7W A;  4O0P A;  3PBR A;  4LLO B;  3UB9 A;  2W0N A;  1OTI A;  2KOI A;  3B33 A;  3P7N A;  3MFX A;  4UQI S;  5IT5 A;  4QPR A;  3JVV A;  2JHE A;  2H28 A;  2VA0 A;  3LR3 A;  3NHQ A;  1P0Z A;  4DJ2 A;  3G6O A;  3OLO A;  3RTY A;  4NXE A;  4B93 A;  2Y79 A;  3FG8 A;  4XT2 B;  3CLO A;  3NOU C;  2A24 A;  2XRN A;  2W1T A;  4HH2 A;  3LI9 A;  3CUE C;  2YKF A;  2JKT I;  4MDZ A;  3KO6 A;  4NXB A;  4IHQ A;  1F5M A;  5TBM B;  4G3W A;  4G3V A;  2OWH A;  1LT0 A;  4YOF A;  2ZOI A;  3T4K A;  4O8G A;  3BQ8 A;  3OC2 A;  2P04 A;  1UWN X;  5HDS A;  4F3L A;  3OBF A;  1XJ6 A;  2VGL M;  5IU1 A;  4AFI A;  4EW7 A;  2J3T C;  4JGQ A;  1TS8 A;  5MC7 A;  1G6O A;  4FOF A;  4LRX C;  2V9A A;  5DKK A;  2HJE A;  3O5Y A;  1XJ3 A;  3H82 B;  5HDC A;  4HJ6 A;  2PYP A;  2VZW A;  3F1N B;  4YWZ A;  4BBT A;  2PYR A;  2VEA A;  3EGD C;  3R7W A;  5KIZ A;  3KYQ A;  3EEA A;  4UQI M;  4H6J B;  3KSH A;  2R78 A;  3LIE A;  1EW0 A;  3MR0 A;  1NLY A;  3K3D A;  3UME A;  3CWF A;  2OWJ A;  4O01 A;  4GHI B;  3PBO A;  5C5K A;  2EWV A;  2L4R A;  1OTD A;  4KUO A;  2B18 A;  4HNB A;  5G4Z A;  1OTA A;  1H3Q A;  4EUV A;  1T1A A;  3TRC A;  2D02 A;  2GNX A;  3PYP A;  3KSI A;  3EGX C;  4HJ4 A;  4GLQ A;  4HI4 A;  4K08 A;  4GS9 B;  4MN6 A;  4Y3I A;  1V9Z A;  3T4O A;  3S7P A;  3HJK A;  3C30 A;  2L1M A;  3T4L A;  1UWP X;  4JGR A;  5DJU A;  3F1P B;  1MKM A;  3LIC A;  4CLC D;  1WA9 A;  5HPF A;  3IS2 B;  3CUE A;  3CIT A;  4NEE D;  4Y5F A;  3R4K A;  3VV4 A;  4EXO A;  2PHY A;  1TD5 A;  2B02 A;  1YKD A;  1DP8 A;  3MQQ A;  2OAP 1;  4L9F A;  3FPW A;  2W3E A;  1OJ5 A;  1OT9 A;  4I3J A;  1T19 A;  4HH3 A;  4PKY G;  1Y28 A;  3UB6 A;  2K7S A;  4M4X A;  3C2W A;  2CMN A;  3S7O A;  3LFV A;  3EOI A;  4CLC E;  2WKR A;  3NJA A;  2P08 A;  1BYW A;  3LR0 A;  1NLZ A;  2A2L A;  1IOU A;  2W3D A;  3BQA A;  2VV8 A;  3MJQ A;  5DJT A;  1YSP A;  4LRY C;  2M1C A;  5L8M A;  4Z1W A;  2PD8 A;  1OT6 A;  4NXF A;  1KOU A;  2GJ3 A;  2G7U A;  1OJG A;  2JKT M;  2QKP A;  2P7J A;  4R70 A;  2EWW A;  1NWZ A;  1GSV A;  2K2N A;  1XFN A;  4PHT A;  3C38 A;  4CLC B;  2JN7 A;  1T1B A;  1G28 A;  2L0W A;  3OOV A;  3LID A;  1DRM A;  4MN7 A;  4IJG A;  2NUT C;  2ZOH A;  4HIA A;  2YKH A;  5A8B A;  4L9G A;  1S1Z A;  4ARZ B;  4WLA A;  4ETZ A;  4MCW A;  2PDR A;  2PD7 A;  2W3H A;  3GDI A;  5J4E A;  3IBJ A;  2O99 A;  5IS1 A;  2VJW A;  5HSQ A;  3LIB A;  3TW8 A;  3MXQ A;  3PHY A;  3DBA A;  1YSQ A;  2JKR I;  4BWI A;  3BWL A;  4HHD A;  1W63 Q;  1LSV A;  3P01 A;  3UB8 A;  4G3K A;  5FL3 A;  3HJI A;  1STZ A;  2Z6D A;  5G4Y A;  4DMZ A;  4WF0 A;  2OOL A;  1S4S A;  1ODV A;  5F5Y A;  3B47 A;  4I3A A;  4IUH A;  3E4P A;  2QWS A;  3A0S A;  3MMH A;  3LYX A;  3PBS A;  3V67 A;  3E4Q A;  2FH5 A;  4LRZ E;  3FPV A;  2FZ0 A;  2XA7 S;  1OTE A;  1S67 L;  1VB6 A;  1XFQ A;  3OCL A;  3K3C A;  1P9W A;  4II7 A;  3UB7 A;  3CI6 A;  3F1O B;  1TF1 A;  2DMW A;  4MMN A;  4WEK A;  3H7W B;  4PKY A;  5HD5 A;  5HWV A;  5J7E A;  5HD3 A;  2LB9 A;  3S7Q A;  3UMD A;  2HJ9 C;  2O9B A;  5J3W A;  4EEU A;  4KUK A;  4HP9 A;  4R3A A;  1D7E A;  3E98 A;  3A0R A;  3K2N A;  2A24 B;  3GEC A;  4HQA A;  1S66 L;  4XT2 A;  2W1T B;  1TS7 A;  2INW A;  3PR6 A;  4I5S A;  3SW1 A;  4WEL A;  4KQD A;  2M7U A;  5F69 A;  4EET B;  1W63 M;  3B42 A;  4IUK A;  5DKL A;  4L0L A;  1X0O A;  3MQO A;  4ETX A;  1LL8 A;  2PR5 A;  3H9W A;  5TBM A;  3LR5 A;  2LB5 A;  2BAS A;  1ZHH B;  2HF6 A;  4F3L B;  3D72 A;  3T50 A;  4YNR A;  3U2A A;  2XA7 M;  4HP4 A;  2Z6C A;  3LIF A;  4Y2F A;  5LBR A;  4MN5 A;  1TS0 A;  2W27 A;  3W2Z A;  1UGU A;  4EES A;  4EEP A;  2K31 A;  3LI8 A;  1V9Y A;  2MJ6 A;  4RQ9 A;  3H82 A;  5HPI A;  2J3W A;  3R7W B;  3F1N A;  4B9O A;  3BY9 A;  3ZQ5 A;  4GJ4 A;  3RFB A;  3EEH A;  4H6J A;  1ZTU A;  2D01 A;  2V1A A;  3RH8 B;  2W1R A;  1OPX A;  2J3T D;  2VKS A;  4DJ3 A;  3T4J A;  3A0V A;  2XRO A;  1DP6 A;  4GHI A;  5K5B A;  2JKR M;  2WKQ A;  4CLC C;  1LSX A;  4JGP A;  1LSW A;  3D3O A;  2KLI A;  3TJZ C;  3E0Y A;  4GCZ A;  2VX8 A;  4GS9 A;  1F98 A;  2O9A A;  3PXP A;  5AJG A;  4JGO A;  3VOL A;  1H8M A;  3MF0 A;  4FSF A;  2Y8H A;  4Q0H A;  3F1P A;  1NRJ A;  1D06 A;  3T4S A;  2ZBB A;  3HCY A;  3IS2 A;  4LPZ A;  3VE4 A;  4P6Z S;  2VV6 A;  4HY8 A;  4BBU A;  2M7V A;  4Q0I A;  3LR4 A;  1XJ4 A;  3JVU A;  3LUQ A;  3ZYT A;  3BW6 A;  3ICY A;  3NOT C;  4WN5 A;  4EQ1 A;  2QHK A;  4HJ3 A;  1MZU A;  5KSH A;  1S4R A;  3BY8 A;  3EQU A;  5HZH A;  4E04 A;  3T4Q A;  1OTB A;  2V0W A;  2KDK A;  1F9I A;  2V1B A;  3T4T A;  2QJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...