4I39A

Structures of ict and pr1 intermediates from time-resolved laue crystallography collected at 14id-b, aps
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Luminescent protein
total genus 39
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4i39A00
2V1AA 4WL9A 4WN5A 5J4EA 1D06A 3C8CA 1F98A 4RQ9A 1S1YA 4EXOA 3H82A 1T18A 4DJ3A 5HDDA 4HNBA 2L1MA 3IS2B 3EWKA 3H7WA 4HQAA 1DP6A 2Z6CA 1UWPX 3LUQA 2A24A 5HDCA 4BBVA 3MJQA 3LIFA 1T1CA 4NXFA 3MFXA 5IU1A 3T50A 1MZUA 3MXQA 2W0NA 4L9FA 3F1OB 4LRZE 3F1NB 2M1CA 5HWTA 1TS8A 3H9WA 2ZOHA 2QJ5A 1BYWA 2PYPA 2J80A 2K7SA 5KIZA 1KOUA 1TS0A 2VV7A 3MR0A 2D01A 3EEHA 5HD5A 3PYPA 3K3DA 4L9EA 3LIEA 3F1NA 4HI4A 2V1BA 1XFQA 4GW9A 1N9NA 1G28A 1N9OA 5G4YA 2WKQA 5TBMA 3UE6A 4HOIA 5HWVA 3MQQA 1S4RA 1DP9A 3NHQA 2WKPA 1S67L 5DKLA 3LIBA 1XFNA 2INWA 2QJ7A 3CLOA 4HIAA 4EEPA 3CWFA 4GS9A 4I3AA 4M4XA 2PR6A 2OOLA 5DJUA 3VE3A 4HJ3A 3LYXA 5IS1A 4L9GA 3KX0X 4EQ1A 4I3IA 5F68A 1T1BA 5A8BA 3A0RA 4I5SA 4LPZA 4WF0A 3GECA 3C2WA 3LIDA 3RTYA 1GSXA 3MQOA 2EA9A 3E4OA 1VB6A 1NWZA 1LSVA 1D7EA 5HDSA 1GSVA 4K08A 4EERA 1TS7A 5I5LA 3NJAA 1S1ZA 4B9OA 2W27A 2PR5A 4GHIB 2VEAA 3IS2A 2OWHA 2ZBBA 1P0ZA 1XJ6A 4KQDA 5F5YA 3E4PA 3F1PB 3SW1A 5HWWA 2VV6A 4JGPA 1XJ4A 3E4QA 5HZHA 3K3CA 4JGOA 4DJ2A 5EFWA 1XJ3A 3IBRA 1TS6A 4E04A 4GHIA 4HHDA 4HP9A 3F1OA 3D72A 1LSXA 3ICYA 4KUKA 3NOPC 1S4SA 1OTEA 4HY8A 1V9ZA 2JN7A 3F1PA 2KX6A 2V0UA 2PD7A 4I3JA 3LI9A 2HV1A 3UB9A 3UB8A 4PKYA 4NXGA 2B02A 3H82B 3UB6A 4PKYG 4EW7A 3UMEA 1OT6A 3VOLA 2YKFA 3GDIA 4R3AA 2Z6DA 1T19A 4HJ6A 1OT9A 2YKHA 4LRXC 1LT0A 2ZOIA 1OTIA 2A24B 2WKRA 3LICA 4NXEA 2H28A 3CAXA 3P7NA 5F6AA 1UGUA 2I9VA 1OTDA 1T1AA 5J7EA 2V9AA 4JGRA 5AVFA 4NXBA 4R38A 2PYRA 1EW0A 4I39A 2L0WA 5G4ZA 4EEUA 3B33A 5HSQA 3RH8B 4EETB 3BWLA 2PD8A 1N9LA 1F9IA 4MN5A 4I38A 4BBUA 1LSWA 3VE4A 4EESA 3HJKA 4YWZA 3HJIA 1OTAA 4XT2B 2QKPA 4KUOA 2L4RA 3NOTC 1UWNX 1V9YA 2QHKA 1GSWA 1WA9A 2R78A 1LL8A 3ULFA 1DP8A 2KDKA 3FC7A 3BY9A 5HD3A 4WUJA 4F3LB 1OJ5A 2QWSA 2BASA 4R6LA 1OJGA 3NOUC 4WLAA 5TBMB 1OTBA 2PHYA 4HP4A 1S66L 5F69A 1XJ2A 3G6OA 4H6JB 4XT2A 3A0VA 3A0SA 3PHYA 1X0OA 5AVEA 4LRYC 4HJ4A 4JGQA 3UMDA 4GS9B 4GCZA 2D02A 3LIAA 2GJ3A 3ZQ5A 1Y28A 1JNUA 3BY8A 4BBTA 4F3LA 3UB7A 5J3WA 4R70A 3H7WB 2VV8A 5DKKA 4HH3A 1P97A 2V0WA 2JHEA 2P7JA 4H6JA 1DRMA 2CMNA 4MN6A 3LI8A 1ODVA 2VLGA 2OWJA 4HH2A 5DJTA 3OLOA 2PDRA 3FG8A 4LLOB
chains in the Genus database with same CATH superfamily
4QD4A 4WN5A 2ZC3B 4B93A 5DTKA 2VGLS 1S1YA 3PBOA 4EXOA 3EQVA 1TD5A 3H82A 4S2MA 4LFUA 1ES4A 5BOHA 2J3WA 3IS2B 1MWSA 1W7FA 5FEGA 1ACFA 1BTLA 3G2ZA 3PBQA 1DP6A 1PNEA 3M6BA 4KZAA 2AVXA 2Z6CA 4A5RA 5FAOA 4MN7A 4BL2A 1PI4A 1TEMA 2A24A 3LFVA 3MJQA 2C6WB 4FSFA 5DF7A 1CEGA 1XKZA 4EUZA 5EVID 3NI9A 3LIFA 2Y2LA 3UE3A 4NK3A 3T1RA 5EVIA 1GCEA 4OPYA 3ZYTA 3FZCA 4DRTA 1MZUA 4B4XA 2W3HA 4L9FA 3F1OB 2ZL1B 2ZC4B 3NDEA 2ZQ9A 1HTZA 2ZOHA 2ZQ7A 3SS3A 3KYEA 2GNXA 2GZAA 2QJ5A 1BYWA 3M2KA 2PYPA 5E2FA 2WGWA 1TS0A 1ES3A 5L2FA 1YLWA 5A92A 1ERMA 1PZOA 2HJ9C 1YLJA 2D01A 1DJAA 4NKPA 4JXSA 2HDQA 2VGKA 3PYPA 2J9PA 1L0FA 3T4OA 3F1NA 3CZDA 3NULA 2XFSA 1XFQA 2XD1A 4WEJA 5IT5A 1PW8A 5G4YA 2EXBA 3UE6A 5J8XA 3V5MA 4BENA 2PAVP 1XX2A 3Q81A 2O9AA 1DP9A 3ZCZA 3NHQA 3ZNYA 4WZ5A 1S67L 4Q0JA 2QJ7A 3CLOA 1Y4OA 4S2PA 5GLAA 4OQIA 4I3AA 4X68A 4CLCB 2P08A 3BFEA 4PHTA 2OOLA 3LYXA 2W3GA 1H5XA 1J3WA 4FOFA 3UB5P 4EQ1A 2ZJ9A 3BRMA 1KGGA 2HDUA 1RGYA 4ZJ2A 3GECA 4KG5A 3RTYA 1KDWA 3MQOA 3VFFA 2EA9A 5DF8A 4RX2A 5CHUA 5FQ9A 4NG2A 3RXXA 4LV2A 4MLLA 5CX7A 2Y2NA 3A3DA 3GMWA 3S7OA 4GHIB 1PFLA 3W4QA 2EWWA 3BECA 2W1RA 4C3QA 5EOOA 2M7VA 4ETZA 2X02A 3TJZC 3GQZA 3PBRA 2WUQA 3E4PA 3T4SA 3K2NA 1XJ4A 2FFFB 4IHQA 3BLSA 5EFWA 1QMFA 1L0GA 2ZQAA 2OV5A 3M2JA 1ZG6A 3BFFA 3IF6A 3MF0A 1TS6A 1K57C 1BZAA 1L0DA 2JE5A 3L7HA 2IWBA 1KE3A 1NZUA 3E0YA 2WGVA 1FIKA 2XEPA 5FI7A 3O87A 1K54C 1MWUA 3ICYA 4LV0A 1N4OA 4DMZA 2V8FA 4JBFA 3C7VA 4HY8A 1K38A 3VOYA 3ZGAB 4E3JA 1W63M 4RYEA 2V0UA 1I2WA 4E3KA 3A3JA 4KZ6A 4RVAA 1HLUP 4Y5FA 2HP9A 4EWFA 1ES5A 3GDIA 3P01A 4R3AA 1T19A 4HJ6A 1OT9A 1OTIA 3BQAA 2OAP1 3OPRA 4OPQA 1IYQA 3O5YA 4U0XA 4DE2A 3C7UA 1GHIA 1FCOA 1GA9A 3KSIA 2NUTC 1VETA 4JGRA 5KZHA 5AVFA 4NXBA 4R38A 2PYRA 1FSYA 2W1TA 4G3KA 3MSHA 3CPTA 4N9LA 2K31A 5GHZA 1GHMA 5HSQA 3RH8B 1L0EA 4DF6A 3BWLA 3PBSA 3T1XA 4DN0A 5CEBA 3ZG9B 1F9IA 2PU2A 2EX8A 3U4LP 3LY3A 4I38A 5HW3A 3LEQA 4E3MA 3FV7A 4DE3A 4Y0TA 3LGOA 1JTGA 3HJIA 3PXPA 3LR0A 4RA7A 4EQIA 1YMSA 1IKGA 4E3OA 2ZMVA 1K25A 4R4SA 1MC0A 4OQ0A 4S2NC 1J9MA 2QKPA 4ZDXA 1K55C 2L4RA 3MXSA 3MKFA 1KE4A 2QHKA 2MJ6A 1GSWA 3E2KA 1CI9A 4YFMA 4KQQA 4HEFA 3FKWA 3NDGA 3BFGA 1G68A 3B42A 3LY4A 2HF6A 5HD3A 3A3EA 3QP5A 4X25A 1VEUA 1LI0A 5EM1A 4F3LB 3R7WA 3JVUA 1OJ5A 2EX6A 2QWSA 1OPXA 2JKRI 2EXAA 1OJGA 5TBMB 2W3EA 1XPBA 3HCYA 3D3OA 4UQIM 3DWKA 3N8SA 1MPLA 3G6OA 3IT9A 4XT2A 2CC1A 1XGJA 5AVEA 1NJ4A 2P9VB 3IXGA 4JGQA 3UMDA 4GS9B 4K91A 2EFUA 5DVAA 3C38A 1M6KA 2Y4AA 3ZHHA 2GJ3A 2Y2GA 2Y8HA 4II7A 4BMWA 4JKTA 4R1GA 4BBTA 1G5UA 1K56D 3V67A 4G3WA 3UE1A 4DDSA 2ZMAA 1K56A 3H7WB 4HH3A 5MC7A 4S2OA 2IWDA 3QNCA 1XA1A 3HBRA 1ODVA 1IKIA 2VLGA 3EGXC 1XP4A 2IWCA 2Z2LB 3FKVA 1IYSA 3OLOA 2V2FF 4ME4A 1ESUA 1FQGA 4R4RA 2WK0A 1D06A 2Q9MA 1ONGA 5HFOA 2VGLM 1PWCA 2ZQDA 5EVIC 4HNBA 2B18A 5AQBA 5FI2A 4G3VA 3UDFA 4QWOA 4X69A 4R0QA 3EEAA 3D9YA 4X1LA 5EUAA 1Q2PA 3G34A 1CEFA 3GTCA 4OVDA 1BUEA 3DTMA 1T1CA 3GV9A 4NXFA 3OBFA 4HBUA 1M40A 3Q7ZA 3JYIA 2XH9A 1ZC2A 2Y2IA 5HPFA 3IH8A 3H9WA 1TVFA 1HD8A 3NIAA 5HL6A 4JXGA 2K7SA 1KOUA 3IX8A 1G6AA 3MBZA 4FTXA 3V39A 1MWTA 4Y0UA 2VV7A 5EM0A 1BLHA 3BYDA 4NETA 3G2YA 2B5RA 4ZTKA 1H0MA 3ZG7B 5FEFA 3G32A 5GLBA 2XK1A 1ESIA 1Y54A 3IWQA 2VA0A 2ZL1A 4WELA 5EVEA 2XA7S 1L3LA 5TJJA 1G28A 3CHWP 3OOVA 5F82A 4HOIA 5DFXA 5M19A 3T4LA 5HWVA 4WZ4A 4WMCA 4O01A 3ZNTA 4HIAA 3UO9A 3CWFA 5CTNA 3QP4A 4M4XA 4B4ZA 2PR6A 5DJUA 3IWIA 2O9CA 1VHMA 5IS1A 1MBLA 3HREA 4L9GA 5A90A 1NXYA 3KX0X 4KZ7A 3QP6A 4I3IA 5KSCA 4O0PA 3A0RA 4WF0A 5AQ9A 2HJEA 3OPPA 2XFTA 4EBNA 2DRWA 3NY4A 1VM1A 1VB6A 3UPNA 3M6HA 3ZVWA 2HDRA 3PAEA 5DFYA 2W3FA 5FA7A 4PM7A 5HDSA 3UN7A 3WS0A 2O9BA 1FSWA 4EERA 1TS7A 1S1ZA 2WKIA 3UDXA 3JVVA 1C3BA 2PBYA 3BFCA 3IF6C 1XJ6A 4H8RA 4KQDA 4BQMA 5F5YA 1IFQA 3DAVA 4S2IA 3SW1A 3IX3A 2O99A 1PIOA 3KSFA 1K4EA 3IHAA 3HLDA 3E4QA 3MKEA 5FQIA 4JGOA 1SKOA 4KG2A 1XJ3A 4Y7PA 1RGZA 1H8YA 3BFDA 2WGIA 5GHYA 3V3RA 2ZD8A 4BL3A 1BLSA 3IBRA 4KG6A 4E04A 2JKFA 3N4IA 4QY5A 4XUZA 2WKHA 4GHIA 2Y55A 4HP9A 4OPZA 2OSUA 5U47A 3Q82A 3Q7VB 4KUKA 3NOPC 3T4KA 1YKDA 1OTEA 4DE1A 3IH9A 5CGXA 3DWZA 4MMNA 1FILA 4Z1WA 4FCFA 4Z9QA 3WRZA 3UB9A 4PKYA 1YLZA 4ARZB 3H82B 4PKYG 4EW7A 3PBNA 4WBGA 5DF9A 1NYYA 2X01A 1YLTA 2YKFA 1IYOA 1LT0A 3HUOA 2H0YA 3IXBA 5TFQA 5I94A 3C30A 1S6RA 2PT7A 4CLCE 2A24B 4AFIA 3Q07A 3LICA 2B95A 2EWVA 3UPOA 5E2EA 1IELA 3EQUA 5KMWA 2M7UA 5J7EA 2V9AA 4OQHA 1PWGA 1MWRA 3KSGA 3BLMA 1PWDA 4EEUA 4MNRA 3W8KA 2JKTM 3S4XA 3BM6A 3AGFA 3SS5A 2PD8A 1N9LA 2OLUA 2A3UA 1DJBA 1I2SA 4PM8A 1KE0A 4GJ4A 3TE8A 3FPVA 4WEKA 2P04A 1BSGA 4PMAA 5CHMA 1MKMA 4JF5A 1OTAA 1JWVA 2A49A 3W4OA 3LCEA 4KUOA 5E43A 3T4TA 3IQAA 1E3UD 4MEZA 3ZG0A 5G18A 5CGWA 1MY8A 3VP0A 4X55A 1DJCA 2X71A 5CERA 3P09A 1BLCA 4CQHA 2V20A 1BT5A 4WUJA 1ERQA 2WAFA 2Y59A 3QP8A 3AGEA 1ZG4A 3KYQA 3NOUC 3WS5A 5FQQA 5M1AA 4OOYA 2ZC5B 1S66L 4JXVA 3N7WA 3A0VA 1LL5A 5K5BA 5FQMA 4LRYC 5CRFA 4L0LA 2JBFA 2LB9A 4JLFA 1TDLA 3UE0A 4GCZA 1E25A 4PAUA 3ZQ5A 2Y2PA 3MS6A 4N92A 3RJUA 1K6SA 1JNUA 3BY8A 4S2JA 4F3LA 1JTDA 1YLPA 5J3WA 1O7EA 4KZ9A 2VX8A 2VV8A 5DKKA 1K6RA 1AXBA 1SCWA 5FDSA 2XF3A 4UHUA 5GLDA 3U2AA 3LI8A 1KGEA 3WS1A 1FOFA 2P9VA 4HH2A 2EX9A 5DJTA 4GNUA 5L8MA 1RCJA 2PDRA 1FCMA 4LLOB 4P6ZM 3AGDA 4IEDA 2V1AA 1CJFA 4WL9A 5J4EA 1F98A 1T18A 2Y79A 4DJ3A 3ZVTA 4QHCA 1W5DA 1IEMA 1K4FA 3H7WA 1PW1A 4HQAA 2WAEA 2BTFP 3W4PA 4KZ3A 5CECA 5HDCA 2Y2OA 4BBVA 3C4OA 3N8LA 3S7PA 2JC7A 4MBFA 2ZC7A 1Q2QA 4OLDA 3FYZA 4HBTA 3MFXA 2HPBA 3P98A 3IF6B 3T50A 2GX5A 2HDSA 3MXQA 2W0NA 2HP5A 3IXHA 5CTMA 2M1CA 4IVIA 4E6WA 1NZOA 1E4DA 5EECA 2A2LA 2J80A 3FWLA 2H5SA 3HLGA 4QJGA 4DXBA 3HLFA 1LI9A 3HLCA 4EV4A 4IJGA 3PTEA 4XUXA 4P85A 3GVBA 2UV0E 2G7UA 3DBAA 1O07A 4R3JA 4WM9A 2JCHA 1N9BA 4DDYA 3SOIA 3PR6A 3LIEA 5EPHA 3LEZA 2LB5A 1TF1A 5AQ7A 4GW9A 1N9OA 2DNSA 2XA7M 1K0KA 1W8QA 1HVBA 1S4RA 1VETB 4ESPA 2W1TB 4Y3IA 2WKPA 1SZVA 3CPTB 3HLWA 1XFNA 3LIBA 5JYPA 1YMXA 3OCLA 4P87A 3T1SA 3UY6A 2FZ0A 5HPIA 5L10A 2O0YA 4UAAA 1GA0A 5F68A 1T1BA 4EBPA 2KOIA 5FASA 4LPZA 4N1HA 4X6TA 3C2WA 3LIDA 3TG9A 4ZJ3A 4CJNA 4WYYA 4Q0IA 1GSXA 2R9WA 3VV4A 1P9WA 1H8ZA 3VMAA 2HZ5A 3MFDA 1NWZA 1LSVA 2QMIA 1FR1A 4UA6A 1VEUB 5L09A 3V50A 4N1XA 5I5LA 4FUWA 2XD5A 4B9OA 2PR5A 2WADA 1ES2A 5TR7A 2VEAA 1EWZA 3IS2A 5D3OA 2OWHA 4YNRA 4B88A 4GD6A 3SH7A 4C75A 3T4QA 3F1PB 2QZ6A 5GHXA 2VV6A 2Z2MB 1YPRA 4IBRA 1LL9A 3K3CA 2XROA 3S22A 4OONA 2R9XA 2K2NA 3PBTA 1MKIA 2Q0OA 1IOUA 4ETXA 4LCMA 4HHDA 3HVFA 3A3FA 3F1OA 3D72A 4LGWA 1LSXA 2DCFA 5AQAA 4UEYA 5M18A 3JPUA 1S0WA 2JN7A 1KDSA 1VQQA 4K0XA 3CI6A 2PD7A 4I3JA 3LI9A 4QU3A 2B02A 2Y2HA 5C5KA 3DW0A 1FCNA 1XGIA 4ZAMA 1OT6A 4GZBA 5AJGA 1PRQA 3IX4A 1YT4A 3MXRA 3TW8A 4DE0A 2J7VA 2J9OA 3S1YA 2ZMFA 3Q7VA 3ZFZA 1F2KA 4EBLA 1AWIA 2H28A 3CAXA 5HAIA 1UGUA 2WYXA 3B47A 3CMZA 3BQ8A 3NCKA 2I9VA 4X53A 5CHJA 4GD8A 4BJPA 5G4ZA 5F1FA 5EVLA 2XR0A 1NLYA 3GSGA 3B33A 4ARZA 3GRJA 2QYBA 4CLCD 3MZFA 4CLCA 4GOGA 3PAGA 2Y2MA 3OCNA 1LSWA 3VE4A 4U0TA 1D1JA 2XLNA 4OH0A 2PRFA 4LENA 2J3TD 3IF5A 4Y15A 4Y13A 2OLVA 4Y2FA 1PI5A 2XRNA 2OAQ1 3G4PA 3NOTC 4KENB 1TDGA 3KYZA 3ZG8B 4ID4A 1WA9A 2R78A 1LL8A 3ZG5A 3VSLA 1DP8A 1JWZA 2KDKA 3BY9A 1QMEA 2W3DA 4OP8A 2FFYA 3RXWA 2BASA 4R6LA 4ZBEA 2WZZA 3SZTA 2PHYA 4HP4A 4IUHA 1YAXA 2H10A 4PM6A 5F69A 2NUPC 3VSKA 4GB7A 4H6JB 2JKGA 3SH8A 3DTEA 3PHYA 2IA2A 4QPRA 4HJ4A 4Q8IA 2EX2A 2E8IA 4E6XA 3S7NA 2D02A 1U60A 3I7JA 3WRTA 5DTSA 5A91A 3IWOA 3WS4A 3OZHA 2RL3A 5FI6A 1ZHHB 3R4KA 1JVJA 2KLIA 2V1ZA 4OKPA 3ITBA 4P0MA 3N8RA 5HAPA 3WS2A 2JHEA 4Y0OA 2P7JA 5FQKA 3UDIA 3HUNA 3O86A 1DRMA 2CMNA 4QY6A 3G30A 3E2LA 3NBLA 5FAPA 3CUEA 5FL3A 4EUVA 2OWJA 1F5MA 1WYBA 3HLEA 3KO6A 3LR3A 4BWIA 3QHYA 1YM1A 3FG8A 5CEDA 5EVIB 5A93A 5GL9A 1NRFA 3CJMA 1W8YA 3C8CA 2C5WB 4RQ9A 2VK3A 5CXWA 3VOZA 3MZEA 3CG5A 1NRJA 5HDDA 2L1MA 3QNBA 3VP2A 3EWKA 5FDHA 3T4JA 1PZPA 4LV3A 2RCXA 1UWPX 2VJWA 3LUQA 2WGWB 4NEED 4O7DA 1A0KA 2JKRM 2ZM0A 3S7QA 4Y17A 5E2HA 1SKOB 4M3KA 2G2WA 1E3UA 4R3BA 5IU1A 4JXWA 2Y2KA 3OPHA 2ZM8A 1SKFA 4YINA 3DTKA 3F1NB 4LRZE 5HWTA 4GKUA 1TS8A 4YOFA 3C4PA 3VP1A 2ZQ8A 2ACGA 1KGFA 2DMWA 5E2GA 5FSRA 1ALQA 3UNWA 5KIZA 1GHPA 1RP5A 3TOIA 3OC2A 2VGJA 2J8YA 4JF6A 3MR0A 3UPPA 1ZTUA 4KZ5A 1KVMA 1OMEA 1CF0A 3LO7A 5LBRA 2HP6A 3EEHA 5HD5A 3LR4A 1BULA 3K3DA 4L9EA 4X1MA 5FAQA 2I72A 3IHBA 1MXOA 4HI4A 4OPRA 2V1BA 1NLZA 2VZWA 1N9NA 4UA7A 1SHVA 2WKQA 5TBMA 1YSQA 3MQQA 3QP2A 4D60A 2G2UA 4OOMA 3HLBA 4KQOA 5DKLA 3WWXA 2INWA 4EEPA 5L07A 5KSHA 4GS9A 5EE8A 3N6IA 4DKIA 3VP3A 3VE3A 4HJ3A 2VKSA 4ZJ1A 5IHVA 5FATA 4PPRA 5A8BA 1EI5A 3TRCA 4E3NA 4I5SA 3EOIA 4KQRA 3MZDA 2FH5A 4DXCA 2Y91A 3BW6A 4MDZA 1IYPA 3E4OA 3BEBA 2HGVA 4ZRRA 1D7EA 3A3IA 3QP1A 1GSVA 2WZXA 1XA7A 4K08A 4F94A 3NECA 3OPLA 1YLYA 1SDNA 3NJAA 3B3XA 3NC8A 4UA9A 2W27A 1P9RA 5HX9A 4LV1A 1EROA 3VP4A 5JYOA 1Z6FA 2JKTI 2PU4A 2ZBBA 2Y2JA 1P0ZA 4IUKA 3T1QB 3L9KA 3O3VA 3RFBA 2P74A 1H8MA 2BG1A 4JGPA 4KZ8A 1WE4A 5HZHA 4DJ2A 1NYMA 1KVLA 4IBXA 4OP5A 4P6BA 2E8JA 4GDBA 5HL1A 3MQ0A 3EGDC 3DTIA 5EOEA 1H3QA 4KZ4A 4PM5A 4QB8A 5F1GA 3LR5A 2ZC6B 1S4SA 1LHYA 3BJNA 3Q1FA 3HUMA 1V9ZA 3F1PA 1CI8A 5F83A 3IXDA 4E3IA 1W63Q 2PBDP 2WKEA 2KX6A 4S2KA 5HAQA 4MBKA 1K57A 2HV1A 3ITAA 1CK3A 3UB8A 4NXGA 2GDNA 3UB6A 3E98A 1L2SA 3UMEA 4Q0HA 3O88A 4D2OA 1K54A 3VOLA 4K0WA 1ZKJA 5EV0A 1FR6A 2Z6DA 3G31A 2YKHA 4LRXC 3IBJA 4FD8A 4PM9A 2ZOIA 3ZDJA 3HL9A 3G35A 3D4FA 4HESA 2WKRA 4CLCC 4GLQA 5HARA 1STZA 4P6ZS 4NXEA 1G6OA 4BLMA 3P7NA 5F6AA 2ZM2A 4MBHA 4BD1A 1OTDA 1T1AA 1Z09A 2QPNA 4O8GA 1EW0A 4I39A 2L0WA 1BLPA 5TGFA 2J3TC 4EETB 2XDMA 1LLBA 1W79A 5CGSA 4MN5A 3R7WB 2Y2QA 1YQSA 4BBUA 2H0TA 4EESA 3HJKA 4OOLA 4YWZA 3MMHA 3VFHA 4XT2B 4BD0A 3ISGA 4KZBA 2EFXA 1UWNX 1V9YA 2V8CA 3SH9A 5DTTA 3ULFA 4S2LA 3C5AA 3FC7A 2ZQCA 2ZLYA 4X56A 4FH4A 4E3LA 4MCWA 4LCLA 4S2NA 4C6YA 1K55A 4UQIS 1CQAA 4WLAA 1OTBA 1JWPA 2Q9NA 5GLCA 2XQZA 1SDEA 4OQGA 4GN2A 3CITA 5FQJA 4RX3A 1XJ2A 4JF4A 1DY6A 1WYCA 4JPMA 4R23A 3A0SA 3W2ZA 1X0OA 3TSGA 1YSPA 2XSSA 4EU0A 4U3TA 1NY0A 3LIAA 4CPKA 1ONHA 4WZ5C 3CUEC 1Y28A 1XXMA 4OLGA 4FH2A 2XGNA 3UB7A 1I5QA 4R70A 2UWXA 1HZOA 1P97A 3V3SA 4WMCD 3KSHA 2V0WA 3T12B 3FPWA 4N9KA 2BLSA 4H6JA 4MN6A 4GDNA 4IVKA 1PYYA 4XXRA 3GR2A 3SS4A 5HWWA
chains in the Genus database with same CATH topology
2V1AA 4WL9A 4WN5A 5J4EA 1D06A 4B93A 3C8CA 1F98A 2VGLS 4RQ9A 1S1YA 3PBOA 4EXOA 3EQVA 1TD5A 3H82A 1T18A 2VGLM 2Y79A 4DJ3A 1NRJA 4HNBA 2B18A 5HDDA 2L1MA 2J3WA 3IS2B 3EWKA 3T4JA 3H7WA 4G3VA 4HQAA 3PBQA 1DP6A 2Z6CA 3EEAA 1UWPX 4MN7A 2VJWA 3LUQA 4NEED 2A24A 5HDCA 4BBVA 3LFVA 3MJQA 4FSFA 3S7PA 2JKRM 3S7QA 3LIFA 3UE3A 1T1CA 4NXFA 3ZYTA 3MFXA 3OBFA 5IU1A 3T50A 2GX5A 1MZUA 3MXQA 2W3HA 2W0NA 4L9FA 3F1OB 5HPFA 3F1NB 4LRZE 2M1CA 5HWTA 1TS8A 3H9WA 4YOFA 2ZOHA 2GNXA 2A2LA 2GZAA 2QJ5A 1BYWA 5HL6A 2DMWA 2PYPA 2J80A 2K7SA 5KIZA 1KOUA 1TS0A 3OC2A 2VV7A 4IJGA 3MR0A 1ZTUA 2HJ9C 2G7UA 2D01A 3DBAA 4NKPA 5LBRA 3EEHA 5HD5A 3LR4A 3PYPA 3K3DA 3PR6A 4L9EA 3LIEA 2LB5A 1TF1A 3T4OA 2VA0A 4WELA 3F1NA 4HI4A 2XA7S 2V1BA 1NLZA 1XFQA 5TJJA 4GW9A 2VZWA 1N9NA 1G28A 1N9OA 4WEJA 2XA7M 5IT5A 5G4YA 3OOVA 2WKQA 5TBMA 3UE6A 1YSQA 4HOIA 5DFXA 3T4LA 5HWVA 3MQQA 1S4RA 2O9AA 1DP9A 4O01A 4OOMA 3NHQA 2W1TB 4Y3IA 2WKPA 1S67L 4KQOA 5DKLA 4Q0JA 3LIBA 1XFNA 2INWA 2QJ7A 3CLOA 4HIAA 4EEPA 3CWFA 3OCLA 5KSHA 4GS9A 4I3AA 4M4XA 4CLCB 2P08A 2PR6A 2FZ0A 4PHTA 5HPIA 2OOLA 5DJUA 2O9CA 3VE3A 2O0YA 2VKSA 3LYXA 4HJ3A 1VHMA 5IS1A 2W3GA 4L9GA 3KX0X 4FOFA 4EQ1A 4I3IA 5F68A 1T1BA 2KOIA 5A8BA 3TRCA 4O0PA 3A0RA 4I5SA 3EOIA 4LPZA 4WF0A 3GECA 3C2WA 3LIDA 2HJEA 3RTYA 2FH5A 4Q0IA 1GSXA 3MQOA 2EA9A 3VV4A 1P9WA 3BW6A 4MDZA 3E4OA 1VB6A 2HGVA 1NWZA 1LSVA 4ZRRA 1D7EA 5DFYA 2W3FA 5HDSA 1GSVA 2O9BA 4K08A 4EERA 1TS7A 5CX7A 5I5LA 3NJAA 1S1ZA 3S7OA 4B9OA 2W27A 2PR5A 1P9RA 4GHIB 2EWWA 2VEAA 2W1RA 3JVVA 3IS2A 2JKTI 2OWHA 4YNRA 2M7VA 4ETZA 2ZBBA 1P0ZA 4IUKA 1XJ6A 3TJZC 4KQDA 3T4QA 3PBRA 3RFBA 1H8MA 5F5YA 3E4PA 3F1PB 3T4SA 1IFQA 3K2NA 3SW1A 5HWWA 2O99A 2VV6A 4JGPA 3KSFA 1XJ4A 3E4QA 5HZHA 4IHQA 3K3CA 2XROA 4JGOA 4DJ2A 5EFWA 1XJ3A 2K2NA 3PBTA 3MQ0A 3EGDC 3MF0A 3IBRA 1IOUA 1TS6A 4ETXA 1H3QA 4E04A 4GHIA 4HHDA 4HP9A 3E0YA 3F1OA 3D72A 1LSXA 3ICYA 3LR5A 4UEYA 4KUKA 4DMZA 3NOPC 3T4KA 1S4SA 1YKDA 1OTEA 4HY8A 3BJNA 1V9ZA 2JN7A 3F1PA 4MMNA 1W63M 4Z1WA 1W63Q 3CI6A 2KX6A 2V0UA 2PD7A 4I3JA 3LI9A 2HV1A 3UB9A 4PKYA 3UB8A 4NXGA 2B02A 4ARZB 3H82B 5C5KA 3UB6A 4PKYG 3E98A 4EW7A 3PBNA 4Q0HA 3UMEA 5DF9A 1OT6A 3VOLA 4Y5FA 2YKFA 5AJGA 3GDIA 3P01A 4R3AA 2Z6DA 1T19A 4HJ6A 1OT9A 2YKHA 4LRXC 1LT0A 3IBJA 3TW8A 2ZOIA 3C30A 1OTIA 3BQAA 2OAP1 2PT7A 2ZMFA 4CLCE 2A24B 2WKRA 4AFIA 4CLCC 4GLQA 1STZA 3LICA 4P6ZS 3O5YA 1G6OA 2H28A 4NXEA 3CAXA 3P7NA 5F6AA 2EWVA 1UGUA 3B47A 3BQ8A 3EQUA 3KSIA 2NUTC 2I9VA 1OTDA 1T1AA 2M7UA 4O8GA 5J7EA 2V9AA 4JGRA 5AVFA 4NXBA 3KSGA 4R38A 2PYRA 1EW0A 4I39A 4BJPA 2L0WA 2W1TA 5G4ZA 4G3KA 4EEUA 1NLYA 2JKTM 3B33A 4ARZA 2K31A 2J3TC 3RH8B 2QYBA 5HSQA 4CLCD 4EETB 3BWLA 3PBSA 4DN0A 2PD8A 1N9LA 4CLCA 1F9IA 4MN5A 3R7WB 4I38A 3OCNA 4BBUA 1LSWA 3VE4A 4GJ4A 3TE8A 4EESA 3HJKA 4OOLA 3FPVA 4WEKA 2P04A 4YWZA 3HJIA 3PXPA 3LR0A 3MMHA 1MKMA 1OTAA 2ZMVA 1MC0A 2J3TD 4XT2B 2QKPA 4KUOA 2L4RA 4Y2FA 3T4TA 2XRNA 2OAQ1 3NOTC 1UWNX 1V9YA 3KYZA 2QHKA 2MJ6A 1GSWA 1WA9A 2R78A 1LL8A 3ULFA 4CQHA 1DP8A 2KDKA 3B42A 3FC7A 3BY9A 2HF6A 5HD3A 4WUJA 2W3DA 4MCWA 4F3LB 3R7WA 3JVUA 1OJ5A 2QWSA 1OPXA 2JKRI 2BASA 4R6LA 4UQIS 1OJGA 3KYQA 3NOUC 4WLAA 5TBMB 1OTBA 2W3EA 2PHYA 3HCYA 4HP4A 3D3OA 1YAXA 4IUHA 4UQIM 1S66L 3CITA 5F69A 2NUPC 1XJ2A 3G6OA 4H6JB 4XT2A 3A0VA 3A0SA 3PHYA 2IA2A 5K5BA 3W2ZA 4QPRA 1X0OA 5AVEA 4LRYC 4HJ4A 1YSPA 4JGQA 3UMDA 2XSSA 4L0LA 4GS9B 2LB9A 4EU0A 4GCZA 3S7NA 2D02A 3LIAA 3C38A 2GJ3A 3CUEC 4PAUA 3ZQ5A 1Y28A 2Y8HA 4II7A 4BMWA 1JNUA 3BY8A 4BBTA 4F3LA 1ZHHB 3UB7A 3V67A 4G3WA 3R4KA 5J3WA 2KLIA 4R70A 2VX8A 3H7WB 2VV8A 5DKKA 4HH3A 1P97A 3KSHA 5MC7A 2V0WA 2JHEA 3FPWA 2P7JA 4H6JA 3U2AA 1DRMA 2CMNA 4MN6A 3LI8A 1ODVA 3CUEA 5FL3A 2VLGA 3EGXC 2OWJA 4EUVA 1F5MA 3KO6A 4HH2A 5DJTA 5L8MA 3OLOA 3LR3A 4BWIA 4ME4A 2PDRA 3FG8A 4LLOB 4P6ZM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1A A;  4WL9 A;  4WN5 A;  5J4E A;  1D06 A;  3C8C A;  1F98 A;  4RQ9 A;  1S1Y A;  4EXO A;  3H82 A;  1T18 A;  4DJ3 A;  5HDD A;  4HNB A;  2L1M A;  3IS2 B;  3EWK A;  3H7W A;  4HQA A;  1DP6 A;  2Z6C A;  1UWP X;  3LUQ A;  2A24 A;  5HDC A;  4BBV A;  3MJQ A;  3LIF A;  1T1C A;  4NXF A;  3MFX A;  5IU1 A;  3T50 A;  1MZU A;  3MXQ A;  2W0N A;  4L9F A;  3F1O B;  4LRZ E;  3F1N B;  2M1C A;  5HWT A;  1TS8 A;  3H9W A;  2ZOH A;  2QJ5 A;  1BYW A;  2PYP A;  2J80 A;  2K7S A;  5KIZ A;  1KOU A;  1TS0 A;  2VV7 A;  3MR0 A;  2D01 A;  3EEH A;  5HD5 A;  3PYP A;  3K3D A;  4L9E A;  3LIE A;  3F1N A;  4HI4 A;  2V1B A;  1XFQ A;  4GW9 A;  1N9N A;  1G28 A;  1N9O A;  5G4Y A;  2WKQ A;  5TBM A;  3UE6 A;  4HOI A;  5HWV A;  3MQQ A;  1S4R A;  1DP9 A;  3NHQ A;  2WKP A;  1S67 L;  5DKL A;  3LIB A;  1XFN A;  2INW A;  2QJ7 A;  3CLO A;  4HIA A;  4EEP A;  3CWF A;  4GS9 A;  4I3A A;  4M4X A;  2PR6 A;  2OOL A;  5DJU A;  3VE3 A;  4HJ3 A;  3LYX A;  5IS1 A;  4L9G A;  3KX0 X;  4EQ1 A;  4I3I A;  5F68 A;  1T1B A;  5A8B A;  3A0R A;  4I5S A;  4LPZ A;  4WF0 A;  3GEC A;  3C2W A;  3LID A;  3RTY A;  1GSX A;  3MQO A;  2EA9 A;  3E4O A;  1VB6 A;  1NWZ A;  1LSV A;  1D7E A;  5HDS A;  1GSV A;  4K08 A;  4EER A;  1TS7 A;  5I5L A;  3NJA A;  1S1Z A;  4B9O A;  2W27 A;  2PR5 A;  4GHI B;  2VEA A;  3IS2 A;  2OWH A;  2ZBB A;  1P0Z A;  1XJ6 A;  4KQD A;  5F5Y A;  3E4P A;  3F1P B;  3SW1 A;  5HWW A;  2VV6 A;  4JGP A;  1XJ4 A;  3E4Q A;  5HZH A;  3K3C A;  4JGO A;  4DJ2 A;  5EFW A;  1XJ3 A;  3IBR A;  1TS6 A;  4E04 A;  4GHI A;  4HHD A;  4HP9 A;  3F1O A;  3D72 A;  1LSX A;  3ICY A;  4KUK A;  3NOP C;  1S4S A;  1OTE A;  4HY8 A;  1V9Z A;  2JN7 A;  3F1P A;  2KX6 A;  2V0U A;  2PD7 A;  4I3J A;  3LI9 A;  2HV1 A;  3UB9 A;  3UB8 A;  4PKY A;  4NXG A;  2B02 A;  3H82 B;  3UB6 A;  4PKY G;  4EW7 A;  3UME A;  1OT6 A;  3VOL A;  2YKF A;  3GDI A;  4R3A A;  2Z6D A;  1T19 A;  4HJ6 A;  1OT9 A;  2YKH A;  4LRX C;  1LT0 A;  2ZOI A;  1OTI A;  2A24 B;  2WKR A;  3LIC A;  4NXE A;  2H28 A;  3CAX A;  3P7N A;  5F6A A;  1UGU A;  2I9V A;  1OTD A;  1T1A A;  5J7E A;  2V9A A;  4JGR A;  5AVF A;  4NXB A;  4R38 A;  2PYR A;  1EW0 A;  4I39 A;  2L0W A;  5G4Z A;  4EEU A;  3B33 A;  5HSQ A;  3RH8 B;  4EET B;  3BWL A;  2PD8 A;  1N9L A;  1F9I A;  4MN5 A;  4I38 A;  4BBU A;  1LSW A;  3VE4 A;  4EES A;  3HJK A;  4YWZ A;  3HJI A;  1OTA A;  4XT2 B;  2QKP A;  4KUO A;  2L4R A;  3NOT C;  1UWN X;  1V9Y A;  2QHK A;  1GSW A;  1WA9 A;  2R78 A;  1LL8 A;  3ULF A;  1DP8 A;  2KDK A;  3FC7 A;  3BY9 A;  5HD3 A;  4WUJ A;  4F3L B;  1OJ5 A;  2QWS A;  2BAS A;  4R6L A;  1OJG A;  3NOU C;  4WLA A;  5TBM B;  1OTB A;  2PHY A;  4HP4 A;  1S66 L;  5F69 A;  1XJ2 A;  3G6O A;  4H6J B;  4XT2 A;  3A0V A;  3A0S A;  3PHY A;  1X0O A;  5AVE A;  4LRY C;  4HJ4 A;  4JGQ A;  3UMD A;  4GS9 B;  4GCZ A;  2D02 A;  3LIA A;  2GJ3 A;  3ZQ5 A;  1Y28 A;  1JNU A;  3BY8 A;  4BBT A;  4F3L A;  3UB7 A;  5J3W A;  4R70 A;  3H7W B;  2VV8 A;  5DKK A;  4HH3 A;  1P97 A;  2V0W A;  2JHE A;  2P7J A;  4H6J A;  1DRM A;  2CMN A;  4MN6 A;  3LI8 A;  1ODV A;  2VLG A;  2OWJ A;  4HH2 A;  5DJT A;  3OLO A;  2PDR A;  3FG8 A;  4LLO B; 
#chains in the Genus database with same CATH topology
 4QD4 A;  4WN5 A;  2ZC3 B;  4B93 A;  5DTK A;  2VGL S;  1S1Y A;  3PBO A;  4EXO A;  3EQV A;  1TD5 A;  3H82 A;  4S2M A;  4LFU A;  1ES4 A;  5BOH A;  2J3W A;  3IS2 B;  1MWS A;  1W7F A;  5FEG A;  1ACF A;  1BTL A;  3G2Z A;  3PBQ A;  1DP6 A;  1PNE A;  3M6B A;  4KZA A;  2AVX A;  2Z6C A;  4A5R A;  5FAO A;  4MN7 A;  4BL2 A;  1PI4 A;  1TEM A;  2A24 A;  3LFV A;  3MJQ A;  2C6W B;  4FSF A;  5DF7 A;  1CEG A;  1XKZ A;  4EUZ A;  5EVI D;  3NI9 A;  3LIF A;  2Y2L A;  3UE3 A;  4NK3 A;  3T1R A;  5EVI A;  1GCE A;  4OPY A;  3ZYT A;  3FZC A;  4DRT A;  1MZU A;  4B4X A;  2W3H A;  4L9F A;  3F1O B;  2ZL1 B;  2ZC4 B;  3NDE A;  2ZQ9 A;  1HTZ A;  2ZOH A;  2ZQ7 A;  3SS3 A;  3KYE A;  2GNX A;  2GZA A;  2QJ5 A;  1BYW A;  3M2K A;  2PYP A;  5E2F A;  2WGW A;  1TS0 A;  1ES3 A;  5L2F A;  1YLW A;  5A92 A;  1ERM A;  1PZO A;  2HJ9 C;  1YLJ A;  2D01 A;  1DJA A;  4NKP A;  4JXS A;  2HDQ A;  2VGK A;  3PYP A;  2J9P A;  1L0F A;  3T4O A;  3F1N A;  3CZD A;  3NUL A;  2XFS A;  1XFQ A;  2XD1 A;  4WEJ A;  5IT5 A;  1PW8 A;  5G4Y A;  2EXB A;  3UE6 A;  5J8X A;  3V5M A;  4BEN A;  2PAV P;  1XX2 A;  3Q81 A;  2O9A A;  1DP9 A;  3ZCZ A;  3NHQ A;  3ZNY A;  4WZ5 A;  1S67 L;  4Q0J A;  2QJ7 A;  3CLO A;  1Y4O A;  4S2P A;  5GLA A;  4OQI A;  4I3A A;  4X68 A;  4CLC B;  2P08 A;  3BFE A;  4PHT A;  2OOL A;  3LYX A;  2W3G A;  1H5X A;  1J3W A;  4FOF A;  3UB5 P;  4EQ1 A;  2ZJ9 A;  3BRM A;  1KGG A;  2HDU A;  1RGY A;  4ZJ2 A;  3GEC A;  4KG5 A;  3RTY A;  1KDW A;  3MQO A;  3VFF A;  2EA9 A;  5DF8 A;  4RX2 A;  5CHU A;  5FQ9 A;  4NG2 A;  3RXX A;  4LV2 A;  4MLL A;  5CX7 A;  2Y2N A;  3A3D A;  3GMW A;  3S7O A;  4GHI B;  1PFL A;  3W4Q A;  2EWW A;  3BEC A;  2W1R A;  4C3Q A;  5EOO A;  2M7V A;  4ETZ A;  2X02 A;  3TJZ C;  3GQZ A;  3PBR A;  2WUQ A;  3E4P A;  3T4S A;  3K2N A;  1XJ4 A;  2FFF B;  4IHQ A;  3BLS A;  5EFW A;  1QMF A;  1L0G A;  2ZQA A;  2OV5 A;  3M2J A;  1ZG6 A;  3BFF A;  3IF6 A;  3MF0 A;  1TS6 A;  1K57 C;  1BZA A;  1L0D A;  2JE5 A;  3L7H A;  2IWB A;  1KE3 A;  1NZU A;  3E0Y A;  2WGV A;  1FIK A;  2XEP A;  5FI7 A;  3O87 A;  1K54 C;  1MWU A;  3ICY A;  4LV0 A;  1N4O A;  4DMZ A;  2V8F A;  4JBF A;  3C7V A;  4HY8 A;  1K38 A;  3VOY A;  3ZGA B;  4E3J A;  1W63 M;  4RYE A;  2V0U A;  1I2W A;  4E3K A;  3A3J A;  4KZ6 A;  4RVA A;  1HLU P;  4Y5F A;  2HP9 A;  4EWF A;  1ES5 A;  3GDI A;  3P01 A;  4R3A A;  1T19 A;  4HJ6 A;  1OT9 A;  1OTI A;  3BQA A;  2OAP 1;  3OPR A;  4OPQ A;  1IYQ A;  3O5Y A;  4U0X A;  4DE2 A;  3C7U A;  1GHI A;  1FCO A;  1GA9 A;  3KSI A;  2NUT C;  1VET A;  4JGR A;  5KZH A;  5AVF A;  4NXB A;  4R38 A;  2PYR A;  1FSY A;  2W1T A;  4G3K A;  3MSH A;  3CPT A;  4N9L A;  2K31 A;  5GHZ A;  1GHM A;  5HSQ A;  3RH8 B;  1L0E A;  4DF6 A;  3BWL A;  3PBS A;  3T1X A;  4DN0 A;  5CEB A;  3ZG9 B;  1F9I A;  2PU2 A;  2EX8 A;  3U4L P;  3LY3 A;  4I38 A;  5HW3 A;  3LEQ A;  4E3M A;  3FV7 A;  4DE3 A;  4Y0T A;  3LGO A;  1JTG A;  3HJI A;  3PXP A;  3LR0 A;  4RA7 A;  4EQI A;  1YMS A;  1IKG A;  4E3O A;  2ZMV A;  1K25 A;  4R4S A;  1MC0 A;  4OQ0 A;  4S2N C;  1J9M A;  2QKP A;  4ZDX A;  1K55 C;  2L4R A;  3MXS A;  3MKF A;  1KE4 A;  2QHK A;  2MJ6 A;  1GSW A;  3E2K A;  1CI9 A;  4YFM A;  4KQQ A;  4HEF A;  3FKW A;  3NDG A;  3BFG A;  1G68 A;  3B42 A;  3LY4 A;  2HF6 A;  5HD3 A;  3A3E A;  3QP5 A;  4X25 A;  1VEU A;  1LI0 A;  5EM1 A;  4F3L B;  3R7W A;  3JVU A;  1OJ5 A;  2EX6 A;  2QWS A;  1OPX A;  2JKR I;  2EXA A;  1OJG A;  5TBM B;  2W3E A;  1XPB A;  3HCY A;  3D3O A;  4UQI M;  3DWK A;  3N8S A;  1MPL A;  3G6O A;  3IT9 A;  4XT2 A;  2CC1 A;  1XGJ A;  5AVE A;  1NJ4 A;  2P9V B;  3IXG A;  4JGQ A;  3UMD A;  4GS9 B;  4K91 A;  2EFU A;  5DVA A;  3C38 A;  1M6K A;  2Y4A A;  3ZHH A;  2GJ3 A;  2Y2G A;  2Y8H A;  4II7 A;  4BMW A;  4JKT A;  4R1G A;  4BBT A;  1G5U A;  1K56 D;  3V67 A;  4G3W A;  3UE1 A;  4DDS A;  2ZMA A;  1K56 A;  3H7W B;  4HH3 A;  5MC7 A;  4S2O A;  2IWD A;  3QNC A;  1XA1 A;  3HBR A;  1ODV A;  1IKI A;  2VLG A;  3EGX C;  1XP4 A;  2IWC A;  2Z2L B;  3FKV A;  1IYS A;  3OLO A;  2V2F F;  4ME4 A;  1ESU A;  1FQG A;  4R4R A;  2WK0 A;  1D06 A;  2Q9M A;  1ONG A;  5HFO A;  2VGL M;  1PWC A;  2ZQD A;  5EVI C;  4HNB A;  2B18 A;  5AQB A;  5FI2 A;  4G3V A;  3UDF A;  4QWO A;  4X69 A;  4R0Q A;  3EEA A;  3D9Y A;  4X1L A;  5EUA A;  1Q2P A;  3G34 A;  1CEF A;  3GTC A;  4OVD A;  1BUE A;  3DTM A;  1T1C A;  3GV9 A;  4NXF A;  3OBF A;  4HBU A;  1M40 A;  3Q7Z A;  3JYI A;  2XH9 A;  1ZC2 A;  2Y2I A;  5HPF A;  3IH8 A;  3H9W A;  1TVF A;  1HD8 A;  3NIA A;  5HL6 A;  4JXG A;  2K7S A;  1KOU A;  3IX8 A;  1G6A A;  3MBZ A;  4FTX A;  3V39 A;  1MWT A;  4Y0U A;  2VV7 A;  5EM0 A;  1BLH A;  3BYD A;  4NET A;  3G2Y A;  2B5R A;  4ZTK A;  1H0M A;  3ZG7 B;  5FEF A;  3G32 A;  5GLB A;  2XK1 A;  1ESI A;  1Y54 A;  3IWQ A;  2VA0 A;  2ZL1 A;  4WEL A;  5EVE A;  2XA7 S;  1L3L A;  5TJJ A;  1G28 A;  3CHW P;  3OOV A;  5F82 A;  4HOI A;  5DFX A;  5M19 A;  3T4L A;  5HWV A;  4WZ4 A;  4WMC A;  4O01 A;  3ZNT A;  4HIA A;  3UO9 A;  3CWF A;  5CTN A;  3QP4 A;  4M4X A;  4B4Z A;  2PR6 A;  5DJU A;  3IWI A;  2O9C A;  1VHM A;  5IS1 A;  1MBL A;  3HRE A;  4L9G A;  5A90 A;  1NXY A;  3KX0 X;  4KZ7 A;  3QP6 A;  4I3I A;  5KSC A;  4O0P A;  3A0R A;  4WF0 A;  5AQ9 A;  2HJE A;  3OPP A;  2XFT A;  4EBN A;  2DRW A;  3NY4 A;  1VM1 A;  1VB6 A;  3UPN A;  3M6H A;  3ZVW A;  2HDR A;  3PAE A;  5DFY A;  2W3F A;  5FA7 A;  4PM7 A;  5HDS A;  3UN7 A;  3WS0 A;  2O9B A;  1FSW A;  4EER A;  1TS7 A;  1S1Z A;  2WKI A;  3UDX A;  3JVV A;  1C3B A;  2PBY A;  3BFC A;  3IF6 C;  1XJ6 A;  4H8R A;  4KQD A;  4BQM A;  5F5Y A;  1IFQ A;  3DAV A;  4S2I A;  3SW1 A;  3IX3 A;  2O99 A;  1PIO A;  3KSF A;  1K4E A;  3IHA A;  3HLD A;  3E4Q A;  3MKE A;  5FQI A;  4JGO A;  1SKO A;  4KG2 A;  1XJ3 A;  4Y7P A;  1RGZ A;  1H8Y A;  3BFD A;  2WGI A;  5GHY A;  3V3R A;  2ZD8 A;  4BL3 A;  1BLS A;  3IBR A;  4KG6 A;  4E04 A;  2JKF A;  3N4I A;  4QY5 A;  4XUZ A;  2WKH A;  4GHI A;  2Y55 A;  4HP9 A;  4OPZ A;  2OSU A;  5U47 A;  3Q82 A;  3Q7V B;  4KUK A;  3NOP C;  3T4K A;  1YKD A;  1OTE A;  4DE1 A;  3IH9 A;  5CGX A;  3DWZ A;  4MMN A;  1FIL A;  4Z1W A;  4FCF A;  4Z9Q A;  3WRZ A;  3UB9 A;  4PKY A;  1YLZ A;  4ARZ B;  3H82 B;  4PKY G;  4EW7 A;  3PBN A;  4WBG A;  5DF9 A;  1NYY A;  2X01 A;  1YLT A;  2YKF A;  1IYO A;  1LT0 A;  3HUO A;  2H0Y A;  3IXB A;  5TFQ A;  5I94 A;  3C30 A;  1S6R A;  2PT7 A;  4CLC E;  2A24 B;  4AFI A;  3Q07 A;  3LIC A;  2B95 A;  2EWV A;  3UPO A;  5E2E A;  1IEL A;  3EQU A;  5KMW A;  2M7U A;  5J7E A;  2V9A A;  4OQH A;  1PWG A;  1MWR A;  3KSG A;  3BLM A;  1PWD A;  4EEU A;  4MNR A;  3W8K A;  2JKT M;  3S4X A;  3BM6 A;  3AGF A;  3SS5 A;  2PD8 A;  1N9L A;  2OLU A;  2A3U A;  1DJB A;  1I2S A;  4PM8 A;  1KE0 A;  4GJ4 A;  3TE8 A;  3FPV A;  4WEK A;  2P04 A;  1BSG A;  4PMA A;  5CHM A;  1MKM A;  4JF5 A;  1OTA A;  1JWV A;  2A49 A;  3W4O A;  3LCE A;  4KUO A;  5E43 A;  3T4T A;  3IQA A;  1E3U D;  4MEZ A;  3ZG0 A;  5G18 A;  5CGW A;  1MY8 A;  3VP0 A;  4X55 A;  1DJC A;  2X71 A;  5CER A;  3P09 A;  1BLC A;  4CQH A;  2V20 A;  1BT5 A;  4WUJ A;  1ERQ A;  2WAF A;  2Y59 A;  3QP8 A;  3AGE A;  1ZG4 A;  3KYQ A;  3NOU C;  3WS5 A;  5FQQ A;  5M1A A;  4OOY A;  2ZC5 B;  1S66 L;  4JXV A;  3N7W A;  3A0V A;  1LL5 A;  5K5B A;  5FQM A;  4LRY C;  5CRF A;  4L0L A;  2JBF A;  2LB9 A;  4JLF A;  1TDL A;  3UE0 A;  4GCZ A;  1E25 A;  4PAU A;  3ZQ5 A;  2Y2P A;  3MS6 A;  4N92 A;  3RJU A;  1K6S A;  1JNU A;  3BY8 A;  4S2J A;  4F3L A;  1JTD A;  1YLP A;  5J3W A;  1O7E A;  4KZ9 A;  2VX8 A;  2VV8 A;  5DKK A;  1K6R A;  1AXB A;  1SCW A;  5FDS A;  2XF3 A;  4UHU A;  5GLD A;  3U2A A;  3LI8 A;  1KGE A;  3WS1 A;  1FOF A;  2P9V A;  4HH2 A;  2EX9 A;  5DJT A;  4GNU A;  5L8M A;  1RCJ A;  2PDR A;  1FCM A;  4LLO B;  4P6Z M;  3AGD A;  4IED A;  2V1A A;  1CJF A;  4WL9 A;  5J4E A;  1F98 A;  1T18 A;  2Y79 A;  4DJ3 A;  3ZVT A;  4QHC A;  1W5D A;  1IEM A;  1K4F A;  3H7W A;  1PW1 A;  4HQA A;  2WAE A;  2BTF P;  3W4P A;  4KZ3 A;  5CEC A;  5HDC A;  2Y2O A;  4BBV A;  3C4O A;  3N8L A;  3S7P A;  2JC7 A;  4MBF A;  2ZC7 A;  1Q2Q A;  4OLD A;  3FYZ A;  4HBT A;  3MFX A;  2HPB A;  3P98 A;  3IF6 B;  3T50 A;  2GX5 A;  2HDS A;  3MXQ A;  2W0N A;  2HP5 A;  3IXH A;  5CTM A;  2M1C A;  4IVI A;  4E6W A;  1NZO A;  1E4D A;  5EEC A;  2A2L A;  2J80 A;  3FWL A;  2H5S A;  3HLG A;  4QJG A;  4DXB A;  3HLF A;  1LI9 A;  3HLC A;  4EV4 A;  4IJG A;  3PTE A;  4XUX A;  4P85 A;  3GVB A;  2UV0 E;  2G7U A;  3DBA A;  1O07 A;  4R3J A;  4WM9 A;  2JCH A;  1N9B A;  4DDY A;  3SOI A;  3PR6 A;  3LIE A;  5EPH A;  3LEZ A;  2LB5 A;  1TF1 A;  5AQ7 A;  4GW9 A;  1N9O A;  2DNS A;  2XA7 M;  1K0K A;  1W8Q A;  1HVB A;  1S4R A;  1VET B;  4ESP A;  2W1T B;  4Y3I A;  2WKP A;  1SZV A;  3CPT B;  3HLW A;  1XFN A;  3LIB A;  5JYP A;  1YMX A;  3OCL A;  4P87 A;  3T1S A;  3UY6 A;  2FZ0 A;  5HPI A;  5L10 A;  2O0Y A;  4UAA A;  1GA0 A;  5F68 A;  1T1B A;  4EBP A;  2KOI A;  5FAS A;  4LPZ A;  4N1H A;  4X6T A;  3C2W A;  3LID A;  3TG9 A;  4ZJ3 A;  4CJN A;  4WYY A;  4Q0I A;  1GSX A;  2R9W A;  3VV4 A;  1P9W A;  1H8Z A;  3VMA A;  2HZ5 A;  3MFD A;  1NWZ A;  1LSV A;  2QMI A;  1FR1 A;  4UA6 A;  1VEU B;  5L09 A;  3V50 A;  4N1X A;  5I5L A;  4FUW A;  2XD5 A;  4B9O A;  2PR5 A;  2WAD A;  1ES2 A;  5TR7 A;  2VEA A;  1EWZ A;  3IS2 A;  5D3O A;  2OWH A;  4YNR A;  4B88 A;  4GD6 A;  3SH7 A;  4C75 A;  3T4Q A;  3F1P B;  2QZ6 A;  5GHX A;  2VV6 A;  2Z2M B;  1YPR A;  4IBR A;  1LL9 A;  3K3C A;  2XRO A;  3S22 A;  4OON A;  2R9X A;  2K2N A;  3PBT A;  1MKI A;  2Q0O A;  1IOU A;  4ETX A;  4LCM A;  4HHD A;  3HVF A;  3A3F A;  3F1O A;  3D72 A;  4LGW A;  1LSX A;  2DCF A;  5AQA A;  4UEY A;  5M18 A;  3JPU A;  1S0W A;  2JN7 A;  1KDS A;  1VQQ A;  4K0X A;  3CI6 A;  2PD7 A;  4I3J A;  3LI9 A;  4QU3 A;  2B02 A;  2Y2H A;  5C5K A;  3DW0 A;  1FCN A;  1XGI A;  4ZAM A;  1OT6 A;  4GZB A;  5AJG A;  1PRQ A;  3IX4 A;  1YT4 A;  3MXR A;  3TW8 A;  4DE0 A;  2J7V A;  2J9O A;  3S1Y A;  2ZMF A;  3Q7V A;  3ZFZ A;  1F2K A;  4EBL A;  1AWI A;  2H28 A;  3CAX A;  5HAI A;  1UGU A;  2WYX A;  3B47 A;  3CMZ A;  3BQ8 A;  3NCK A;  2I9V A;  4X53 A;  5CHJ A;  4GD8 A;  4BJP A;  5G4Z A;  5F1F A;  5EVL A;  2XR0 A;  1NLY A;  3GSG A;  3B33 A;  4ARZ A;  3GRJ A;  2QYB A;  4CLC D;  3MZF A;  4CLC A;  4GOG A;  3PAG A;  2Y2M A;  3OCN A;  1LSW A;  3VE4 A;  4U0T A;  1D1J A;  2XLN A;  4OH0 A;  2PRF A;  4LEN A;  2J3T D;  3IF5 A;  4Y15 A;  4Y13 A;  2OLV A;  4Y2F A;  1PI5 A;  2XRN A;  2OAQ 1;  3G4P A;  3NOT C;  4KEN B;  1TDG A;  3KYZ A;  3ZG8 B;  4ID4 A;  1WA9 A;  2R78 A;  1LL8 A;  3ZG5 A;  3VSL A;  1DP8 A;  1JWZ A;  2KDK A;  3BY9 A;  1QME A;  2W3D A;  4OP8 A;  2FFY A;  3RXW A;  2BAS A;  4R6L A;  4ZBE A;  2WZZ A;  3SZT A;  2PHY A;  4HP4 A;  4IUH A;  1YAX A;  2H10 A;  4PM6 A;  5F69 A;  2NUP C;  3VSK A;  4GB7 A;  4H6J B;  2JKG A;  3SH8 A;  3DTE A;  3PHY A;  2IA2 A;  4QPR A;  4HJ4 A;  4Q8I A;  2EX2 A;  2E8I A;  4E6X A;  3S7N A;  2D02 A;  1U60 A;  3I7J A;  3WRT A;  5DTS A;  5A91 A;  3IWO A;  3WS4 A;  3OZH A;  2RL3 A;  5FI6 A;  1ZHH B;  3R4K A;  1JVJ A;  2KLI A;  2V1Z A;  4OKP A;  3ITB A;  4P0M A;  3N8R A;  5HAP A;  3WS2 A;  2JHE A;  4Y0O A;  2P7J A;  5FQK A;  3UDI A;  3HUN A;  3O86 A;  1DRM A;  2CMN A;  4QY6 A;  3G30 A;  3E2L A;  3NBL A;  5FAP A;  3CUE A;  5FL3 A;  4EUV A;  2OWJ A;  1F5M A;  1WYB A;  3HLE A;  3KO6 A;  3LR3 A;  4BWI A;  3QHY A;  1YM1 A;  3FG8 A;  5CED A;  5EVI B;  5A93 A;  5GL9 A;  1NRF A;  3CJM A;  1W8Y A;  3C8C A;  2C5W B;  4RQ9 A;  2VK3 A;  5CXW A;  3VOZ A;  3MZE A;  3CG5 A;  1NRJ A;  5HDD A;  2L1M A;  3QNB A;  3VP2 A;  3EWK A;  5FDH A;  3T4J A;  1PZP A;  4LV3 A;  2RCX A;  1UWP X;  2VJW A;  3LUQ A;  2WGW B;  4NEE D;  4O7D A;  1A0K A;  2JKR M;  2ZM0 A;  3S7Q A;  4Y17 A;  5E2H A;  1SKO B;  4M3K A;  2G2W A;  1E3U A;  4R3B A;  5IU1 A;  4JXW A;  2Y2K A;  3OPH A;  2ZM8 A;  1SKF A;  4YIN A;  3DTK A;  3F1N B;  4LRZ E;  5HWT A;  4GKU A;  1TS8 A;  4YOF A;  3C4P A;  3VP1 A;  2ZQ8 A;  2ACG A;  1KGF A;  2DMW A;  5E2G A;  5FSR A;  1ALQ A;  3UNW A;  5KIZ A;  1GHP A;  1RP5 A;  3TOI A;  3OC2 A;  2VGJ A;  2J8Y A;  4JF6 A;  3MR0 A;  3UPP A;  1ZTU A;  4KZ5 A;  1KVM A;  1OME A;  1CF0 A;  3LO7 A;  5LBR A;  2HP6 A;  3EEH A;  5HD5 A;  3LR4 A;  1BUL A;  3K3D A;  4L9E A;  4X1M A;  5FAQ A;  2I72 A;  3IHB A;  1MXO A;  4HI4 A;  4OPR A;  2V1B A;  1NLZ A;  2VZW A;  1N9N A;  4UA7 A;  1SHV A;  2WKQ A;  5TBM A;  1YSQ A;  3MQQ A;  3QP2 A;  4D60 A;  2G2U A;  4OOM A;  3HLB A;  4KQO A;  5DKL A;  3WWX A;  2INW A;  4EEP A;  5L07 A;  5KSH A;  4GS9 A;  5EE8 A;  3N6I A;  4DKI A;  3VP3 A;  3VE3 A;  4HJ3 A;  2VKS A;  4ZJ1 A;  5IHV A;  5FAT A;  4PPR A;  5A8B A;  1EI5 A;  3TRC A;  4E3N A;  4I5S A;  3EOI A;  4KQR A;  3MZD A;  2FH5 A;  4DXC A;  2Y91 A;  3BW6 A;  4MDZ A;  1IYP A;  3E4O A;  3BEB A;  2HGV A;  4ZRR A;  1D7E A;  3A3I A;  3QP1 A;  1GSV A;  2WZX A;  1XA7 A;  4K08 A;  4F94 A;  3NEC A;  3OPL A;  1YLY A;  1SDN A;  3NJA A;  3B3X A;  3NC8 A;  4UA9 A;  2W27 A;  1P9R A;  5HX9 A;  4LV1 A;  1ERO A;  3VP4 A;  5JYO A;  1Z6F A;  2JKT I;  2PU4 A;  2ZBB A;  2Y2J A;  1P0Z A;  4IUK A;  3T1Q B;  3L9K A;  3O3V A;  3RFB A;  2P74 A;  1H8M A;  2BG1 A;  4JGP A;  4KZ8 A;  1WE4 A;  5HZH A;  4DJ2 A;  1NYM A;  1KVL A;  4IBX A;  4OP5 A;  4P6B A;  2E8J A;  4GDB A;  5HL1 A;  3MQ0 A;  3EGD C;  3DTI A;  5EOE A;  1H3Q A;  4KZ4 A;  4PM5 A;  4QB8 A;  5F1G A;  3LR5 A;  2ZC6 B;  1S4S A;  1LHY A;  3BJN A;  3Q1F A;  3HUM A;  1V9Z A;  3F1P A;  1CI8 A;  5F83 A;  3IXD A;  4E3I A;  1W63 Q;  2PBD P;  2WKE A;  2KX6 A;  4S2K A;  5HAQ A;  4MBK A;  1K57 A;  2HV1 A;  3ITA A;  1CK3 A;  3UB8 A;  4NXG A;  2GDN A;  3UB6 A;  3E98 A;  1L2S A;  3UME A;  4Q0H A;  3O88 A;  4D2O A;  1K54 A;  3VOL A;  4K0W A;  1ZKJ A;  5EV0 A;  1FR6 A;  2Z6D A;  3G31 A;  2YKH A;  4LRX C;  3IBJ A;  4FD8 A;  4PM9 A;  2ZOI A;  3ZDJ A;  3HL9 A;  3G35 A;  3D4F A;  4HES A;  2WKR A;  4CLC C;  4GLQ A;  5HAR A;  1STZ A;  4P6Z S;  4NXE A;  1G6O A;  4BLM A;  3P7N A;  5F6A A;  2ZM2 A;  4MBH A;  4BD1 A;  1OTD A;  1T1A A;  1Z09 A;  2QPN A;  4O8G A;  1EW0 A;  4I39 A;  2L0W A;  1BLP A;  5TGF A;  2J3T C;  4EET B;  2XDM A;  1LLB A;  1W79 A;  5CGS A;  4MN5 A;  3R7W B;  2Y2Q A;  1YQS A;  4BBU A;  2H0T A;  4EES A;  3HJK A;  4OOL A;  4YWZ A;  3MMH A;  3VFH A;  4XT2 B;  4BD0 A;  3ISG A;  4KZB A;  2EFX A;  1UWN X;  1V9Y A;  2V8C A;  3SH9 A;  5DTT A;  3ULF A;  4S2L A;  3C5A A;  3FC7 A;  2ZQC A;  2ZLY A;  4X56 A;  4FH4 A;  4E3L A;  4MCW A;  4LCL A;  4S2N A;  4C6Y A;  1K55 A;  4UQI S;  1CQA A;  4WLA A;  1OTB A;  1JWP A;  2Q9N A;  5GLC A;  2XQZ A;  1SDE A;  4OQG A;  4GN2 A;  3CIT A;  5FQJ A;  4RX3 A;  1XJ2 A;  4JF4 A;  1DY6 A;  1WYC A;  4JPM A;  4R23 A;  3A0S A;  3W2Z A;  1X0O A;  3TSG A;  1YSP A;  2XSS A;  4EU0 A;  4U3T A;  1NY0 A;  3LIA A;  4CPK A;  1ONH A;  4WZ5 C;  3CUE C;  1Y28 A;  1XXM A;  4OLG A;  4FH2 A;  2XGN A;  3UB7 A;  1I5Q A;  4R70 A;  2UWX A;  1HZO A;  1P97 A;  3V3S A;  4WMC D;  3KSH A;  2V0W A;  3T12 B;  3FPW A;  4N9K A;  2BLS A;  4H6J A;  4MN6 A;  4GDN A;  4IVK A;  1PYY A;  4XXR A;  3GR2 A;  3SS4 A;  5HWW A; 
#chains in the Genus database with same CATH homology
 2V1A A;  4WL9 A;  4WN5 A;  5J4E A;  1D06 A;  4B93 A;  3C8C A;  1F98 A;  2VGL S;  4RQ9 A;  1S1Y A;  3PBO A;  4EXO A;  3EQV A;  1TD5 A;  3H82 A;  1T18 A;  2VGL M;  2Y79 A;  4DJ3 A;  1NRJ A;  4HNB A;  2B18 A;  5HDD A;  2L1M A;  2J3W A;  3IS2 B;  3EWK A;  3T4J A;  3H7W A;  4G3V A;  4HQA A;  3PBQ A;  1DP6 A;  2Z6C A;  3EEA A;  1UWP X;  4MN7 A;  2VJW A;  3LUQ A;  4NEE D;  2A24 A;  5HDC A;  4BBV A;  3LFV A;  3MJQ A;  4FSF A;  3S7P A;  2JKR M;  3S7Q A;  3LIF A;  3UE3 A;  1T1C A;  4NXF A;  3ZYT A;  3MFX A;  3OBF A;  5IU1 A;  3T50 A;  2GX5 A;  1MZU A;  3MXQ A;  2W3H A;  2W0N A;  4L9F A;  3F1O B;  5HPF A;  3F1N B;  4LRZ E;  2M1C A;  5HWT A;  1TS8 A;  3H9W A;  4YOF A;  2ZOH A;  2GNX A;  2A2L A;  2GZA A;  2QJ5 A;  1BYW A;  5HL6 A;  2DMW A;  2PYP A;  2J80 A;  2K7S A;  5KIZ A;  1KOU A;  1TS0 A;  3OC2 A;  2VV7 A;  4IJG A;  3MR0 A;  1ZTU A;  2HJ9 C;  2G7U A;  2D01 A;  3DBA A;  4NKP A;  5LBR A;  3EEH A;  5HD5 A;  3LR4 A;  3PYP A;  3K3D A;  3PR6 A;  4L9E A;  3LIE A;  2LB5 A;  1TF1 A;  3T4O A;  2VA0 A;  4WEL A;  3F1N A;  4HI4 A;  2XA7 S;  2V1B A;  1NLZ A;  1XFQ A;  5TJJ A;  4GW9 A;  2VZW A;  1N9N A;  1G28 A;  1N9O A;  4WEJ A;  2XA7 M;  5IT5 A;  5G4Y A;  3OOV A;  2WKQ A;  5TBM A;  3UE6 A;  1YSQ A;  4HOI A;  5DFX A;  3T4L A;  5HWV A;  3MQQ A;  1S4R A;  2O9A A;  1DP9 A;  4O01 A;  4OOM A;  3NHQ A;  2W1T B;  4Y3I A;  2WKP A;  1S67 L;  4KQO A;  5DKL A;  4Q0J A;  3LIB A;  1XFN A;  2INW A;  2QJ7 A;  3CLO A;  4HIA A;  4EEP A;  3CWF A;  3OCL A;  5KSH A;  4GS9 A;  4I3A A;  4M4X A;  4CLC B;  2P08 A;  2PR6 A;  2FZ0 A;  4PHT A;  5HPI A;  2OOL A;  5DJU A;  2O9C A;  3VE3 A;  2O0Y A;  2VKS A;  3LYX A;  4HJ3 A;  1VHM A;  5IS1 A;  2W3G A;  4L9G A;  3KX0 X;  4FOF A;  4EQ1 A;  4I3I A;  5F68 A;  1T1B A;  2KOI A;  5A8B A;  3TRC A;  4O0P A;  3A0R A;  4I5S A;  3EOI A;  4LPZ A;  4WF0 A;  3GEC A;  3C2W A;  3LID A;  2HJE A;  3RTY A;  2FH5 A;  4Q0I A;  1GSX A;  3MQO A;  2EA9 A;  3VV4 A;  1P9W A;  3BW6 A;  4MDZ A;  3E4O A;  1VB6 A;  2HGV A;  1NWZ A;  1LSV A;  4ZRR A;  1D7E A;  5DFY A;  2W3F A;  5HDS A;  1GSV A;  2O9B A;  4K08 A;  4EER A;  1TS7 A;  5CX7 A;  5I5L A;  3NJA A;  1S1Z A;  3S7O A;  4B9O A;  2W27 A;  2PR5 A;  1P9R A;  4GHI B;  2EWW A;  2VEA A;  2W1R A;  3JVV A;  3IS2 A;  2JKT I;  2OWH A;  4YNR A;  2M7V A;  4ETZ A;  2ZBB A;  1P0Z A;  4IUK A;  1XJ6 A;  3TJZ C;  4KQD A;  3T4Q A;  3PBR A;  3RFB A;  1H8M A;  5F5Y A;  3E4P A;  3F1P B;  3T4S A;  1IFQ A;  3K2N A;  3SW1 A;  5HWW A;  2O99 A;  2VV6 A;  4JGP A;  3KSF A;  1XJ4 A;  3E4Q A;  5HZH A;  4IHQ A;  3K3C A;  2XRO A;  4JGO A;  4DJ2 A;  5EFW A;  1XJ3 A;  2K2N A;  3PBT A;  3MQ0 A;  3EGD C;  3MF0 A;  3IBR A;  1IOU A;  1TS6 A;  4ETX A;  1H3Q A;  4E04 A;  4GHI A;  4HHD A;  4HP9 A;  3E0Y A;  3F1O A;  3D72 A;  1LSX A;  3ICY A;  3LR5 A;  4UEY A;  4KUK A;  4DMZ A;  3NOP C;  3T4K A;  1S4S A;  1YKD A;  1OTE A;  4HY8 A;  3BJN A;  1V9Z A;  2JN7 A;  3F1P A;  4MMN A;  1W63 M;  4Z1W A;  1W63 Q;  3CI6 A;  2KX6 A;  2V0U A;  2PD7 A;  4I3J A;  3LI9 A;  2HV1 A;  3UB9 A;  4PKY A;  3UB8 A;  4NXG A;  2B02 A;  4ARZ B;  3H82 B;  5C5K A;  3UB6 A;  4PKY G;  3E98 A;  4EW7 A;  3PBN A;  4Q0H A;  3UME A;  5DF9 A;  1OT6 A;  3VOL A;  4Y5F A;  2YKF A;  5AJG A;  3GDI A;  3P01 A;  4R3A A;  2Z6D A;  1T19 A;  4HJ6 A;  1OT9 A;  2YKH A;  4LRX C;  1LT0 A;  3IBJ A;  3TW8 A;  2ZOI A;  3C30 A;  1OTI A;  3BQA A;  2OAP 1;  2PT7 A;  2ZMF A;  4CLC E;  2A24 B;  2WKR A;  4AFI A;  4CLC C;  4GLQ A;  1STZ A;  3LIC A;  4P6Z S;  3O5Y A;  1G6O A;  2H28 A;  4NXE A;  3CAX A;  3P7N A;  5F6A A;  2EWV A;  1UGU A;  3B47 A;  3BQ8 A;  3EQU A;  3KSI A;  2NUT C;  2I9V A;  1OTD A;  1T1A A;  2M7U A;  4O8G A;  5J7E A;  2V9A A;  4JGR A;  5AVF A;  4NXB A;  3KSG A;  4R38 A;  2PYR A;  1EW0 A;  4I39 A;  4BJP A;  2L0W A;  2W1T A;  5G4Z A;  4G3K A;  4EEU A;  1NLY A;  2JKT M;  3B33 A;  4ARZ A;  2K31 A;  2J3T C;  3RH8 B;  2QYB A;  5HSQ A;  4CLC D;  4EET B;  3BWL A;  3PBS A;  4DN0 A;  2PD8 A;  1N9L A;  4CLC A;  1F9I A;  4MN5 A;  3R7W B;  4I38 A;  3OCN A;  4BBU A;  1LSW A;  3VE4 A;  4GJ4 A;  3TE8 A;  4EES A;  3HJK A;  4OOL A;  3FPV A;  4WEK A;  2P04 A;  4YWZ A;  3HJI A;  3PXP A;  3LR0 A;  3MMH A;  1MKM A;  1OTA A;  2ZMV A;  1MC0 A;  2J3T D;  4XT2 B;  2QKP A;  4KUO A;  2L4R A;  4Y2F A;  3T4T A;  2XRN A;  2OAQ 1;  3NOT C;  1UWN X;  1V9Y A;  3KYZ A;  2QHK A;  2MJ6 A;  1GSW A;  1WA9 A;  2R78 A;  1LL8 A;  3ULF A;  4CQH A;  1DP8 A;  2KDK A;  3B42 A;  3FC7 A;  3BY9 A;  2HF6 A;  5HD3 A;  4WUJ A;  2W3D A;  4MCW A;  4F3L B;  3R7W A;  3JVU A;  1OJ5 A;  2QWS A;  1OPX A;  2JKR I;  2BAS A;  4R6L A;  4UQI S;  1OJG A;  3KYQ A;  3NOU C;  4WLA A;  5TBM B;  1OTB A;  2W3E A;  2PHY A;  3HCY A;  4HP4 A;  3D3O A;  1YAX A;  4IUH A;  4UQI M;  1S66 L;  3CIT A;  5F69 A;  2NUP C;  1XJ2 A;  3G6O A;  4H6J B;  4XT2 A;  3A0V A;  3A0S A;  3PHY A;  2IA2 A;  5K5B A;  3W2Z A;  4QPR A;  1X0O A;  5AVE A;  4LRY C;  4HJ4 A;  1YSP A;  4JGQ A;  3UMD A;  2XSS A;  4L0L A;  4GS9 B;  2LB9 A;  4EU0 A;  4GCZ A;  3S7N A;  2D02 A;  3LIA A;  3C38 A;  2GJ3 A;  3CUE C;  4PAU A;  3ZQ5 A;  1Y28 A;  2Y8H A;  4II7 A;  4BMW A;  1JNU A;  3BY8 A;  4BBT A;  4F3L A;  1ZHH B;  3UB7 A;  3V67 A;  4G3W A;  3R4K A;  5J3W A;  2KLI A;  4R70 A;  2VX8 A;  3H7W B;  2VV8 A;  5DKK A;  4HH3 A;  1P97 A;  3KSH A;  5MC7 A;  2V0W A;  2JHE A;  3FPW A;  2P7J A;  4H6J A;  3U2A A;  1DRM A;  2CMN A;  4MN6 A;  3LI8 A;  1ODV A;  3CUE A;  5FL3 A;  2VLG A;  3EGX C;  2OWJ A;  4EUV A;  1F5M A;  3KO6 A;  4HH2 A;  5DJT A;  5L8M A;  3OLO A;  3LR3 A;  4BWI A;  4ME4 A;  2PDR A;  3FG8 A;  4LLO B;  4P6Z M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...