4I39A

Structures of ict and pr1 intermediates from time-resolved laue crystallography collected at 14id-b, aps
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Luminescent protein
molecule keywords Photoactive yellow protein
total genus 39
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4i39A00
2BASA 1OTIA 1TS8A 5HWWA 3K3CA 3MXQA 5F68A 2V1AA 2B02A 3UMDA 1WA9A 4GHIA 4MN6A 2PYRA 1XJ3A 4NXBA 2QJ5A 4F3LA 2YKFA 2JHEA 3F1NB 3VOLA 3ZQ5A 3EWKA 4PKYG 5F6AA 4L9EA 4NXGA 2D01A 4WN5A 5HD5A 3RTYA 2HV1A 3UB7A 1V9YA 4I5SA 4XT2B 4KUOA 1N9OA 3E4PA 4I3IA 4GS9A 2Z6DA 4L9FA 4JGPA 1D7EA 3BY9A 1G28A 2GJ3A 3H82B 4LRXC 2INWA 4EERA 3BY8A 2J80A 1S66L 3CAXA 2OWHA 1Y28A 3LIDA 4EETB 3LUQA 4M4XA 3UMEA 3C2WA 4E04A 3RH8B 2WKQA 3UE6A 1UWPX 1MZUA 1UWNX 5HDCA 4B9OA 1OJ5A 3MR0A 4WF0A 1XJ6A 3UB8A 2PYPA 1NWZA 4HH3A 3H7WA 5KIZA 5F5YA 2PD7A 2D02A 4KUKA 2QJ7A 3OLOA 4LPZA 4WL9A 5F69A 5TBMB 4HJ4A 4HP4A 1F98A 1LL8A 3HJIA 4HY8A 1X0OA 4JGOA 2ZOIA 4DJ3A 3A0SA 5HDDA 3UB6A 2L4RA 2VV6A 5HD3A 5J3WA 3F1NA 1GSVA 1LSXA 3LIEA 1P0ZA 4I39A 5G4ZA 3UB9A 3VE3A 4F3LB 2W27A 3F1PB 3NOPC 1JNUA 2WKPA 5TBMA 2WKRA 1S1YA 2VLGA 2QHKA 3LYXA 1TS0A 1LT0A 1OTDA 2VEAA 4EEPA 5A8BA 3HJKA 3F1OA 2PDRA 1BYWA 2W0NA 5DKLA 3IBRA 1OJGA 3IS2A 4GW9A 1T1AA 3CWFA 1T1CA 4NXFA 1DP9A 4HH2A 4MN5A 1XJ2A 2PR6A 4NXEA 1EW0A 3F1OB 5HWVA 3ULFA 4HIAA 4BBTA 1T19A 2EA9A 2ZOHA 1T18A 3D72A 4I38A 5HDSA 3NJAA 2L1MA 4R6LA 3A0VA 1LSVA 4HI4A 2VV8A 4EESA 3GDIA 1OTAA 2QWSA 3F1PA 5DJTA 3LI9A 1OT6A 1XFNA 3LICA 4XT2A 2P7JA 4EQ1A 5IS1A 1DP8A 4H6JB 4PKYA 3ICYA 3E4OA 3LIAA 5AVEA 1OT9A 4H6JA 3T50A 3LIBA 4HQAA 1TS6A 2JN7A 3H7WB 1UGUA 2L0WA 4LRZE 3VE4A 1DRMA 1P97A 2V0UA 2CMNA 2ZBBA 4R38A 2PD8A 3SW1A 2H28A 1N9NA 1ODVA 4EXOA 4R70A 4R3AA 3EEHA 2K7SA 2VV7A 5EFWA 3LIFA 4WUJA 4L9GA 4YWZA 4EEUA 1VB6A 2OOLA 2V1BA 1GSXA 1OTBA 3PHYA 2A24B 4RQ9A 4LRYC 3FC7A 4WLAA 1XJ4A 4I3JA 5DJUA 3H82A 3G6OA 5AVFA 2V0WA 2R78A 3IS2B 4BBUA 3GECA 5HSQA 4HJ6A 3CLOA 1GSWA 3LI8A 4HNBA 2I9VA 4LLOB 1N9LA 4GCZA 2PHYA 2OWJA 4GS9B 2QKPA 3MQOA 1LSWA 3MJQA 4HOIA 1V9ZA 1T1BA 4I3AA 3MFXA 4KQDA 5HZHA 1OTEA 4DJ2A 4EW7A 3FG8A 3NHQA 5IU1A 3BWLA 1KOUA 3MQQA 3P7NA 5G4YA 4BBVA 1S4RA 3H9WA 3NOTC 3E4QA 4GHIB 1DP6A 3A0RA 5J4EA 5J7EA 2KX6A 3KX0X 3B33A 4JGQA 5DKKA 1S4SA 2KDKA 3K3DA 4HJ3A 4K08A 3NOUC 3PYPA 2Z6CA 5I5LA 3C8CA 2YKHA 2M1CA 1TS7A 4JGRA 4HP9A 1F9IA 2V9AA 1S1ZA 2PR5A 1S67L 5HWTA 1XFQA 4HHDA 2A24A 1D06A
chains in the Genus database with same CATH superfamily
2Y8HA 3VP3A 2WAEA 3W4QA 2XQZA 2V1AA 4UA7A 2PYRA 3IWIA 1K6SA 3OCLA 4X1LA 1F2KA 1Z6FA 4LRXC 2J80A 1S66L 1G6OA 1PZOA 2WKQA 3PBRA 3NY4A 4WF0A 3UB8A 1KGFA 3DTEA 2PD7A 4OP5A 3HJIA 1H5XA 1W8YA 3HLEA 5EVEA 3UB6A 1K0KA 1H0MA 1GSVA 2E8IA 4S2MA 3VE3A 5DVAA 1FCOA 5EPHA 3CPTB 2WKPA 3VP2A 3Q82A 4KQRA 1H8ZA 1T1CA 2PT7A 3UE1A 4KG2A 3WS0A 1T18A 2C5WB 1FCMA 1FILA 2HGVA 3LR3A 1PFLA 1VEUA 1BUEA 3T50A 4N1HA 3G32A 2K31A 2BTFP 3LIFA 4BQMA 2WGVA 3OZHA 3G2YA 5DJUA 3UPPA 1NLZA 2J3WA 5L8MA 2QKPA 1N4OA 3CMZA 1K55C 4QWOA 1BSGA 5MC7A 3ZNYA 2ZMVA 3GQZA 4R3BA 5EE8A 3S22A 3ZG7B 4ME4A 4WYYA 5GLBA 1H8MA 4E6XA 2V1ZA 2D01A 3BYDA 3T4SA 3QNCA 4PMAA 1MWSA 3HLBA 5L10A 2W3GA 5CGSA 3M6HA 3Q7VB 3LIDA 5FA7A 4QD4A 3C4PA 1IKIA 2ZLYA 5F5YA 4KUKA 5GHXA 5D3OA 4FOFA 3VP0A 2XGNA 3A3DA 3ZG0A 4P0MA 5M18A 3T12B 4WZ5A 1JNUA 2WGWB 1ESIA 1YSPA 4ID4A 4EU0A 1IEMA 3NI9A 2JCHA 1DP9A 4NXEA 3F1OB 1IYOA 3LGOA 4LGWA 5EVIC 4JF5A 1LI0A 2ZQ8A 1C3BA 2Q9MA 1HVBA 3R7WA 4LENA 1ZG4A 3BECA 4CJNA 2ZBBA 3SW1A 3PBNA 3WRZA 3HLGA 1G68A 4Y0OA 3O87A 5AQ9A 5FI2A 4WLAA 4LRYC 3RFBA 2PHYA 3MFXA 1Q2QA 5HZHA 4Q0JA 2PBDP 3ITAA 1NZOA 1DP6A 2QZ6A 4K08A 3TE8A 1TS7A 1F9IA 3A3IA 2BASA 1MPLA 3K3CA 5F68A 5I94A 4GHIA 2QJ5A 3V39A 3V5MA 1TF1A 3T1SA 4L9EA 4WN5A 4P6ZM 1GHPA 1G5UA 4U3TA 2VK3A 1Z09A 5DTKA 1NRJA 3QP2A 2VX8A 4HEFA 1JTDA 1ZKJA 3E98A 4OQGA 1LL8A 4OQIA 5HD3A 5CHUA 3DTMA 2VA0A 5F82A 2VLGA 2VEAA 2VGJA 3IH8A 2OAP1 2HZ5A 2ZD8A 1T1AA 3ZDJA 3E0YA 2K2NA 3R7WB 4ARZA 3A0VA 3R4KA 5DJTA 3LI9A 3PBQA 3UE3A 1CQAA 4YNRA 5CECA 4JBFA 4KG6A 2V8FA 4HQAA 2ZQDA 1XGJA 2WKIA 5BOHA 1GCEA 1XPBA 4MBHA 1OTBA 3WS1A 5HSQA 3LI8A 1K38A 4QHCA 5DF7A 4FSFA 3MJQA 4X55A 3P7NA 5E2GA 5EM0A 2UV0E 5KZHA 3ZVWA 1TVFA 5I5LA 3C7VA 1VM1A 1AXBA 4PM8A 2WGWA 3HUOA 1XXMA 2E8JA 1TS8A 3KSHA 5FASA 3UMDA 2Y2OA 3QP8A 2W1TA 4WBGA 2VGLM 4F3LA 3SS5A 4ZDXA 2M7UA 1RGYA 3RTYA 4JF4A 5KSHA 1QMFA 4FH2A 1N9OA 1W8QA 3E4PA 4S2LA 3VSKA 3B42A 3BY9A 1PYYA 3EGDC 3HREA 3N8SA 4H8RA 3HUMA 5CXWA 4CPKA 5KSCA 1EWZA 3NCKA 1PI5A 3VFHA 4EQIA 2HJEA 3LR5A 2D02A 3ITBA 1PWDA 1SKOB 3BM6A 1X0OA 4KG5A 2ZOIA 3A0SA 3MFDA 3LIEA 5FL3A 3TOIA 4JXGA 5FQIA 4DRTA 1HTZA 1BLSA 2PU2A 3MZDA 1T19A 2ZOHA 1JWPA 4IBXA 5HDSA 1IELA 4PHTA 3NIAA 4OP8A 2HP5A 4G3WA 1CJFA 3TJZC 4EV4A 2QMIA 1OT9A 4BBUA 4LRZE 3RXWA 1VQQA 4OH0A 3T4QA 1YKDA 3MXRA 1NJ4A 3PXPA 1VB6A 3A3EA 2O0YA 5F83A 1ES2A 4HJ6A 3L9KA 3IT9A 4PPRA 1T1BA 2HPBA 2WAFA 1K56A 4GHIB 4Y17A 2M7VA 1TDGA 5DKKA 2JKRM 1S4SA 3HLFA 3TRCA 2V20A 2YKHA 2PBYA 2XH9A 4GZBA 2R9WA 2XFTA 1YMXA 1XGIA 4OLGA 2GZAA 5E2FA 3UB7A 2PAVP 2Q9NA 4I3IA 4GS9A 1FR1A 4EERA 4PM5A 5CGWA 4QPRA 1LLBA 1FQGA 2QYBA 4B9OA 3IWQA 3GSGA 4M3KA 4NETA 1XKZA 2QJ7A 3M2KA 5F69A 1ONGA 1VETA 4JGOA 1FIKA 3NULA 3WS2A 3L7HA 1W79A 2XLNA 5HL1A 4Y7PA 3MXSA 5EVIA 5HPIA 2ZQCA 4FH4A 1RCJA 4LFUA 2EWWA 1S6RA 4OLDA 4R6LA 5FEFA 4GN2A 2QWSA 3CJMA 4WZ5C 3SOIA 4BWIA 2WKHA 3IX8A 4R0QA 4BL2A 3SS3A 3C4OA 3GV9A 3VP1A 4OONA 1KE4A 3T4LA 4EBNA 2H10A 3EOIA 1JWVA 3FC7A 4I3JA 4Z1WA 3Q7VA 4WELA 5EVIB 4GS9B 3ZG5A 1CEFA 2JC7A 5IU1A 4MNRA 1YLJA 2OLVA 2HP9A 1TEMA 2Z2LB 4HJ3A 5HFOA 3FPVA 4X6TA 5EUAA 5GLAA 1S67L 3EGXC 1D06A 1OTIA 4IBRA 3LEQA 4E3MA 1XJ3A 1YLYA 2WGIA 3JYIA 1K55A 3IXHA 3B47A 4CLCA 2HV1A 1Y54A 1KE0A 5LBRA 2W1RA 1K54A 3FYZA 2ZMFA 3CAXA 5GHYA 4M4XA 3HLWA 1SKFA 2GNXA 3I7JA 3OLOA 3IHAA 4FCFA 2JKTM 4K0WA 3IHBA 1U60A 3UB5P 1SZVA 1JTGA 1NZUA 4HBUA 2W3HA 1A0KA 2ACGA 5CX7A 1DJAA 2Y91A 4GD6A 5J8XA 4BBTA 4D2OA 4JKTA 4I38A 3NJAA 4X69A 3PAEA 3LY3A 2OAQ1 3ICYA 2OSUA 4PAUA 5AVEA 5DF9A 1TS6A 3VE4A 2Y2JA 3VOYA 5M19A 4DF6A 5FAPA 4Y13A 3KYQA 2CC1A 2R78A 2I9VA 2EXAA 4HOIA 1N9BA 1EI5A 4DE3A 1PWCA 2G2WA 4YOFA 3SH8A 2J7VA 4OQ0A 2Z6CA 1O7EA 4BD0A 4MBKA 4KZAA 3DTIA 4ZJ2A 5FI7A 5HPFA 3BFEA 3DBAA 4Y3IA 4P87A 5A90A 2DMWA 2Y59A 3EWKA 1FSWA 3K2NA 5EECA 2WK0A 3BFDA 4KZ3A 2JKTI 5DF8A 2INWA 3C2WA 3UE6A 1UWPX 1PNEA 3BQ8A 3H7WA 1OMEA 3IX4A 2HDQA 2HP6A 5TBMB 1PW8A 2FZ0A 4PM9A 4OOLA 4LV0A 1ERMA 4Z9QA 2ZC3B 2V8CA 4ZJ1A 2JE5A 1SDNA 5FAQA 2A2LA 1ES3A 5CERA 1K25A 3GDIA 3D4FA 4JPMA 3V3SA 3LIBA 3VP4A 4PM6A 4NKPA 1BLPA 2ZC7A 2AVXA 1GHIA 1W63Q 4HBTA 3IS2B 4HNBA 3A3FA 5FATA 4X53A 1ES4A 1ESUA 3T1RA 4OQHA 1S4RA 3NOTC 1ES5A 3E4QA 3S7NA 2EXBA 3KX0X 1WE4A 1IFQA 5KMWA 4A5RA 1SCWA 4S2OA 5FDSA 2M1CA 3FKWA 3JVUA 3AGDA 1S0WA 4NG2A 2XROA 4N9LA 3CPTA 4MN6A 4IVKA 2J9PA 4UEYA 3VV4A 2J8YA 4Y15A 1ACFA 3HLDA 4I5SA 4MLLA 1CK3A 1Y4OA 4DE2A 1G28A 3U4LP 2Y2MA 3QP5A 2VGLS 3M6BA 3LUQA 3IXDA 4EBLA 3G2ZA 3V50A 2ZJ9A 1NLYA 2H0TA 3G31A 3ZCZA 3IH9A 1FOFA 4R3JA 1NY0A 4RYEA 2G7UA 2BLSA 1M40A 3UO9A 2VV6A 2BG1A 1YLWA 1L2SA 5A93A 3W4PA 3LYXA 3NBLA 3TSGA 3LR0A 1NXYA 3TG9A 4GB7A 3S7PA 3IS2A 3BLMA 3P09A 4KZ6A 5FEGA 1K57C 4EESA 5K5BA 3G30A 3F1PA 4EQ1A 1SKOA 1ZC2A 2Y2NA 2FH5A 4Y0UA 1YLPA 4OPQA 4P6BA 1KVLA 3G6OA 4JF6A 3VOZA 2X01A 4Y2FA 5E2EA 3FWLA 4KQDA 3DW0A 3SH7A 1K57A 2KX6A 1SHVA 4CLCD 3S1YA 1XFQA 4P85A 1PI4A 3KYEA 4WMCA 1DY6A 2Y2IA 3SZTA 2QPNA 3P01A 5CHJA 4Y0TA 4NXBA 2JHEA 4XXRA 3MSHA 4BENA 1IYQA 1MKIA 4P6ZS 1D7EA 2R9XA 1IKGA 5FDHA 4CLCE 4U0XA 4E04A 4E6WA 3Q7ZA 1NWZA 4DDYA 3CHWP 1OPXA 1CEGA 1L3LA 5L09A 5HDDA 5CEDA 5G4ZA 4GD8A 1AWIA 4RA7A 3NOPC 1TS0A 4CQHA 5AQ7A 4XUXA 5DKLA 2OV5A 5HW3A 5GHZA 4IVIA 2XRNA 2J3TD 1YLZA 5TJJA 4WM9A 4X56A 3HLCA 1OTAA 4R4SA 3LCEA 1NYYA 4KZ5A 2XF3A 2JN7A 5FQKA 2CMNA 1MC0A 1MWTA 4EXOA 4R70A 3EEHA 1PZPA 4YWZA 2ZC4B 3W2ZA 3MKEA 2IWBA 5AVFA 2V0WA 3MF0A 3OCNA 4IJGA 5GLCA 3GECA 3WWXA 3PAGA 1E3UA 1N9LA 2EX6A 1FR6A 5E43A 3G34A 4QB8A 4S2PA 3Q07A 1BULA 1M6KA 3HCYA 4QJGA 1WYBA 5TR7A 1I2SA 5FAOA 2JKGA 4ZTKA 5A92A 3OC2A 3VOLA 5F6AA 5HD5A 3N8RA 4S2NA 1Y28A 1NYMA 4BD1A 4WL9A 1F98A 2ZM8A 3UB9A 3F1PB 2J9OA 5IT5A 4HESA 5TBMA 3FPWA 4OPZA 3PR6A 2A3UA 5GLDA 3UPOA 1KGGA 4HH2A 3IWOA 2EA9A 2KOIA 3V67A 3C7UA 1OT6A 2G2UA 4UAAA 4XT2A 3BFFA 4H6JB 2EWVA 2P9VA 4OPYA 1DRMA 1P97A 1N9NA 1ODVA 3IXBA 2VZWA 1RP5A 4E3LA 1GSXA 5HL6A 1XJ4A 1XA1A 3V3RA 3IF5A 1MXOA 5EV0A 5M1AA 1KOUA 3MQQA 5G4YA 3A0RA 4GKUA 3B33A 2UWXA 3NECA 2I72A 3T4OA 5DFXA 5E2HA 5HWTA 1FSYA 3ZG9B 4C75A 5TGFA 3IF6B 2B02A 4KENB 4AFIA 5L07A 4DMZA 3BQAA 1BLCA 2H5SA 4UQIS 4L9FA 4JGPA 3QP6A 1H8YA 5CTNA 3C5AA 3ZYTA 5DFYA 3GRJA 2XA7M 5F1GA 1ZTUA 3KO6A 4B4ZA 5CGXA 2XR0A 2P08A 3IF6A 2XFSA 3CI6A 2ZC5B 4XUZA 3SS4A 2QHKA 3HJKA 3KSIA 1BYWA 2W0NA 3CUEA 1EROA 3WS4A 2JKFA 1TDLA 4NXFA 4PM7A 5HWVA 4Q0IA 4NK3A 3ULFA 3VSLA 2W3DA 1JVJA 2JBFA 4UQIM 3ZGAB 5F1FA 4K91A 5EOOA 3OPRA 1UGUA 2L0WA 2DNSA 2V0UA 4KZBA 3EEAA 4R23A 3Q1FA 2JKRI 1WYCA 2K7SA 1XX2A 4WUJA 1TD5A 3H82A 3BEBA 3IX3A 4FD8A 2ZL1A 4GLQA 4I3AA 1K54C 3OPLA 3ZFZA 1L0EA 3NHQA 3H9WA 4CLCC 1YLTA 5J7EA 2XD1A 3NOUC 4WEKA 3CUEC 3C8CA 4ESPA 4QU3A 2ZQAA 4ZJ3A 3T4KA 2Q0OA 4KQQA 4HHDA 5HARA 1ZG6A 4BL3A 1GHMA 5AQBA 3JPUA 3ZQ5A 1NRFA 5FQ9A 4UA9A 3T1QB 4XT2B 1YT4A 2Z6DA 3Q81A 3H82B 2PRFA 3O88A 2KLIA 1KE3A 2MJ6A 4EETB 2XD5A 4DXBA 1ERQA 2XK1A 2P74A 3HL9A 3BFGA 3MR0A 5CHMA 1XJ6A 3N8LA 4OOMA 2HF6A 3NDGA 4UHUA 2B18A 2EX2A 1MWUA 2VGKA 2W3FA 2Y55A 3MZEA 4KZ7A 4RVAA 4LCLA 1P9RA 1K4FA 3GR2A 3UE0A 1LT0A 2RCXA 4O8GA 3D3OA 1PRQA 4K0XA 4G3KA 1OJGA 3CWFA 3FV7A 3PTEA 5U47A 4E3KA 4YINA 1VEUB 5EVLA 2VV8A 4KZ4A 3PBSA 3ZNTA 3TW8A 2P7JA 4N92A 4WMCD 3E4OA 3LIAA 3E2KA 3A3JA 2O9CA 2DRWA 3VMAA 4R38A 1BZAA 5EFWA 1I2WA 3LFVA 3UN7A 1STZA 4FUWA 4RQ9A 3PHYA 2A24B 3GMWA 1F5MA 4OPRA 3CLOA 3IF6C 1H3QA 4YFMA 3UNWA 2PU4A 1DJBA 3MQOA 1LSWA 5CEBA 4DJ2A 3FG8A 3OOVA 4MDZA 4ZAMA 3O5YA 5J4EA 1HLUP 1CF0A 5FQJA 1LHYA 3FZCA 1BTLA 2ZQ9A 4IEDA 1G6AA 2XEPA 2A24A 4JXSA 5HWWA 4IHQA 2HDUA 3WRTA 2ZMAA 3KYZA 2P04A 2WUQA 1RGZA 4D60A 4KUOA 1HZOA 2C6WB 2WYXA 3CG5A 2WZXA 3DTKA 2NUPC 2OWHA 5FI6A 3KSGA 1J9MA 4EBPA 1Q2PA 4LV1A 4EUVA 4E3NA 4ETXA 3PBOA 4LPZA 3E2LA 5EM1A 4DJ3A 2P9VB 2W1TB 3F1NA 1LSXA 4I39A 4F3LB 4R1GA 1S1YA 2X02A 1DJCA 3F1OA 4GNUA 4GW9A 2WKEA 3IBJA 4O0PA 4JLFA 4MN5A 1KGEA 3D72A 4KZ9A 2GDNA 2O9AA 3LICA 3QP1A 3GTCA 4MN7A 4UA6A 3MQ0A 1IYSA 2VV7A 2DCFA 2OOLA 2V1BA 5FSRA 1PW1A 2WZZA 1D1JA 3OPPA 3G35A 5FQMA 1V9ZA 3DWKA 1E25A 1OTEA 4S2NC 2Y2HA 4ARZB 2VJWA 5GL9A 1YAXA 5AQAA 3O3VA 4ZRRA 1S1ZA 3IXGA 3DWZA 1K4EA 3S4XA 1WA9A 5HX9A 3RXXA 4DKIA 4GJ4A 3S7QA 1E4DA 4N9KA 4NXGA 2ZM0A 3SH9A 2XSSA 1V9YA 1CI9A 2XA7S 3ISGA 4LV3A 3UMEA 1MBLA 4S2IA 5HDCA 2X71A 3BW6A 2EX9A 2LB5A 1L0FA 2A49A 1QMEA 4MCWA 2L4RA 1P0ZA 1PWGA 2B95A 4JXVA 4EEPA 4KQOA 1E3UD 4RX2A 2Y2GA 4GOGA 1HD8A 3W8KA 3ZHHA 3AGFA 4WZ4A 4HI4A 1MY8A 3BJNA 2V2FF 1L0DA 3N7WA 5IS1A 4BMWA 4PKYA 4IUKA 3WS5A 4B4XA 3T1XA 2PD8A 2H28A 3MKFA 2B5RA 2LB9A 4EEUA 2HDSA 3M2JA 4Y5FA 1GSWA 3HUNA 4LLOB 1IOUA 3KSFA 1GA0A 3ZVTA 4MEZA 2W3EA 1W63M 4EW7A 2XDMA 1KVMA 2ZL1B 1LL5A 3BFCA 3UDFA 4II7A 2KDKA 2H0YA 5CTMA 4S2JA 3PYPA 5IHVA 3EQVA 3UDXA 3HVFA 4E3IA 1BLHA 4O01A 1P9WA 3F1NB 3EQUA 3CZDA 2O9BA 3NDEA 5HAPA 1YSQA 3LEZA 2Z2MB 3AGEA 5EOEA 4IUHA 1W7FA 1L0GA 4N1XA 4DE0A 4WEJA 3HBRA 3RH8B 5JYOA 3N4IA 4C3QA 1MZUA 1UWNX 1KDSA 1OJ5A 5KIZA 3GVBA 4HH3A 4BLMA 4FTXA 4GDNA 4LCMA 1W5DA 4ETZA 4HP4A 4HY8A 4JXWA 1YMSA 3C38A 1YM1A 1YQSA 3JVVA 2VKSA 3T4JA 4F94A 5AJGA 1OTDA 5TFQA 1KDWA 2PDRA 3IBRA 5DTSA 4X1MA 1XJ2A 2PR6A 1EW0A 4HIAA 2Y79A 4E3JA 1YPRA 1LSVA 2HDRA 3N6IA 3UY6A 1MKMA 1VETB 4B88A 2WADA 3O86A 4DN0A 2O99A 3MMHA 2GX5A 3B3XA 3IQAA 2Y2LA 1ZHHB 4R3AA 4EWFA 3DAVA 4LV2A 2Y2PA 5HAIA 1IYPA 2ZM2A 2Y2KA 4QY6A 1LI9A 4DXCA 1PIOA 2EX8A 4GCZA 4E3OA 2OWJA 4R4RA 3FKVA 1BT5A 1JWZA 1O07A 2FFYA 4JGQA 3K3DA 5DTTA 3VFFA 2IWCA 4BJPA 3LO7A 2HJ9C 4RX3A 4HP9A 2J3TC 2V9AA 1ONHA 4S2KA 4GDBA 3MXQA 3ZG8B 4NEED 3LY4A 2YKFA 4PKYG 4B93A 3G4PA 4O7DA 1K56D 2GJ3A 4OKPA 3BY8A 3S7OA 4DE1A 3LR4A 3NC8A 4Q0HA 5G18A 3OPHA 3RJUA 1XP4A 4MMNA 2PYPA 3D9YA 1XA7A 1CI8A 2Y2QA 2FFFB 4HJ4A 4DDSA 4KZ8A 4X68A 3W4OA 5J3WA 3MZFA 2IA2A 2W27A 4ZBEA 2ZC6B 3C30A 2WKRA 5JYPA 5A8BA 3OBFA 4X25A 4MBFA 2RL3A 5C5KA 4OOYA 1I5QA 2Y4AA 3QNBA 5A91A 2L1MA 2EFUA 1SDEA 3MBZA 1XFNA 5FQQA 1DP8A 2IWDA 4CLCB 4G3VA 3U2AA 1LL9A 3MS6A 4H6JA 4U0TA 3H7WB 2NUTC 5L2FA 4C6YA 3QP4A 1FCNA 3BLSA 4L9GA 2EFXA 3CITA 4EUZA 3UDIA 4OVDA 4Q8IA 3P98A 5EVID 4L0LA 1J3WA 3UPNA 5CRFA 2OLUA 4QY5A 3BWLA 4BBVA 3QHYA 1MWRA 1GA9A 1K6RA 3PBTA 3T4TA 2ZQ7A 4JGRA 1VHMA 5HAQA 2PR5A 3BRMA 1ALQA
chains in the Genus database with same CATH topology
5HWWA 2Y8HA 4IHQA 2V1AA 3P01A 2PYRA 4NXBA 2JHEA 3KYZA 2GZAA 2P04A 3OCLA 3UB7A 4KUOA 4I3IA 4P6ZS 4GS9A 1D7EA 4LRXC 4EERA 2J80A 1S66L 2NUPC 1G6OA 2OWHA 4CLCE 4QPRA 4E04A 3KSGA 2QYBA 2WKQA 3PBRA 4B9OA 4WF0A 3UB8A 1NWZA 4EUVA 4ETXA 2PD7A 1OPXA 3PBOA 2QJ7A 4LPZA 5F69A 3HJIA 4DJ3A 4JGOA 3UB6A 5HDDA 2W1TB 3F1NA 1GSVA 1LSXA 4I39A 5G4ZA 4F3LB 3VE3A 3NOPC 2WKPA 1S1YA 1TS0A 4CQHA 3F1OA 5HPIA 5DKLA 4GW9A 1T1CA 3IBJA 4O0PA 2PT7A 2EWWA 4MN5A 2XRNA 2J3TD 5TJJA 3D72A 1T18A 4R6LA 1OTAA 2QWSA 2O9AA 2HGVA 4BWIA 3LICA 3LR3A 4MN7A 3T50A 2JN7A 2CMNA 2K31A 3MQ0A 1MC0A 4EXOA 4R70A 3EEHA 2VV7A 3T4LA 3LIFA 4YWZA 2OOLA 2V1BA 3W2ZA 3EOIA 5DJUA 3FC7A 4I3JA 5AVFA 2V0WA 3MF0A 3OCNA 4IJGA 4Z1WA 3GECA 4WELA 1NLZA 1N9LA 2J3WA 5L8MA 4GS9B 2QKPA 1V9ZA 1OTEA 5IU1A 4ARZB 5MC7A 4HJ3A 2VJWA 3FPVA 2ZMVA 1YAXA 3HCYA 4ZRRA 1S1ZA 4ME4A 1S67L 3EGXC 1D06A 1OTIA 1H8MA 1WA9A 4GJ4A 1XJ3A 3S7QA 3OC2A 3VOLA 5F6AA 3B47A 5HD5A 4NXGA 2D01A 4CLCA 2HV1A 2XSSA 3T4SA 1V9YA 5LBRA 2W1RA 2W3GA 2XA7S 2ZMFA 3CAXA 1Y28A 3LIDA 4M4XA 3UMEA 2GNXA 5HDCA 3BW6A 2LB5A 5F5YA 4KUKA 3OLOA 4MCWA 4WL9A 1F98A 2JKTM 4FOFA 2L4RA 1P0ZA 3UB9A 3F1PB 5IT5A 1JNUA 5TBMA 3FPWA 2W3HA 3PR6A 4EEPA 1YSPA 4KQOA 4EU0A 5CX7A 1DP9A 4HH2A 4NXEA 3F1OB 4BBTA 2EA9A 4I38A 2KOIA 3NJAA 4HI4A 3V67A 3BJNA 1OT6A 2OAQ1 4XT2A 5IS1A 4BMWA 4H6JB 4PKYA 4IUKA 3ICYA 2EWVA 4PAUA 3R7WA 5AVEA 5DF9A 1TS6A 3VE4A 1DRMA 1P97A 2ZBBA 3SW1A 2PD8A 2H28A 3PBNA 1N9NA 1ODVA 2VZWA 2LB9A 4EEUA 1GSXA 5HL6A 4WLAA 4LRYC 3KYQA 1XJ4A 2R78A 4Y5FA 1GSWA 2I9VA 4LLOB 1IOUA 3RFBA 3KSFA 2PHYA 4HOIA 2W3EA 3MFXA 5HZHA 1W63M 4Q0JA 4EW7A 1KOUA 3MQQA 5G4YA 1DP6A 3A0RA 4YOFA 4II7A 3B33A 2KDKA 4K08A 3PYPA 3TE8A 2Z6CA 3EQVA 3T4OA 5DFXA 1TS7A 1F9IA 5HWTA 2BASA 3K3CA 4O01A 5F68A 2B02A 4GHIA 1P9WA 5HPFA 3DBAA 2QJ5A 4Y3IA 2DMWA 3F1NB 1TF1A 3EWKA 3EQUA 4AFIA 2O9BA 3K2NA 4L9EA 4WN5A 4P6ZM 4DMZA 1YSQA 3BQAA 4UQIS 2JKTI 4L9FA 4JGPA 2INWA 4IUHA 3ZYTA 3C2WA 5DFYA 4WEJA 3RH8B 3UE6A 1UWPX 1MZUA 1UWNX 1NRJA 1OJ5A 5KIZA 2VX8A 3BQ8A 4HH3A 3H7WA 2XA7M 1ZTUA 5TBMB 3E98A 4HP4A 4HY8A 1LL8A 4ETZA 3KO6A 5HD3A 3C38A 2FZ0A 2P08A 3JVVA 2VA0A 3CI6A 2VKSA 3T4JA 4OOLA 2VLGA 2QHKA 5AJGA 1OTDA 2VEAA 3HJKA 3KSIA 2PDRA 1BYWA 2OAP1 2W0NA 3CUEA 3IBRA 1T1AA 4NXFA 3E0YA 1XJ2A 2PR6A 5HWVA 1EW0A 2A2LA 4Q0IA 3ULFA 4HIAA 2K2NA 3R7WB 2W3DA 4ARZA 2Y79A 3A0VA 1LSVA 3R4KA 3GDIA 5DJTA 4UQIM 3LI9A 3PBQA 3UE3A 1MKMA 4YNRA 4DN0A 2O99A 3MMHA 3LIBA 2GX5A 4HQAA 1UGUA 2L0WA 2V0UA 3EEAA 2JKRI 1ZHHB 4R3AA 2K7SA 4WUJA 4NKPA 1TD5A 1OTBA 3H82A 1W63Q 3IS2B 5HSQA 3LI8A 4HNBA 4GCZA 2OWJA 4FSFA 4GLQA 4I3AA 3MJQA 3NHQA 3P7NA 1S4RA 3H9WA 3NOTC 3E4QA 4CLCC 3S7NA 5J7EA 3KX0X 4JGQA 1IFQA 3K3DA 3NOUC 4BJPA 4WEKA 3CUEC 5I5LA 3C8CA 2HJ9C 2M1CA 4HP9A 2J3TC 2V9AA 3T4KA 4HHDA 3JVUA 1TS8A 3KSHA 3MXQA 2XROA 3UMDA 4MN6A 4NEED 2W1TA 2VGLM 4UEYA 4F3LA 2YKFA 3ZQ5A 4PKYG 2M7UA 3VV4A 3RTYA 4B93A 4I5SA 4XT2B 5KSHA 1N9OA 3E4PA 2Z6DA 3B42A 3H82B 3BY9A 1G28A 2GJ3A 3EGDC 2KLIA 3BY8A 2MJ6A 2VGLS 3S7OA 4EETB 3LUQA 3LR4A 1NLYA 4Q0HA 3MR0A 4MMNA 1XJ6A 2HJEA 2PYPA 3LR5A 4OOMA 2HF6A 2D02A 2G7UA 2B18A 4HJ4A 1X0OA 2ZOIA 2W3FA 3A0SA 2VV6A 5J3WA 3LIEA 2IA2A 2W27A 5FL3A 1P9RA 3C30A 2WKRA 3LYXA 1LT0A 4O8GA 3D3OA 3LR0A 5A8BA 4G3KA 1OJGA 3S7PA 3OBFA 3IS2A 3CWFA 5C5KA 1T19A 2ZOHA 5HDSA 2L1MA 4PHTA 2VV8A 4EESA 5K5BA 3PBSA 3F1PA 4G3WA 1XFNA 3TW8A 4EQ1A 2P7JA 3TJZC 1DP8A 4CLCB 4G3VA 3E4OA 3U2AA 3LIAA 1OT9A 4H6JA 4BBUA 3H7WB 2NUTC 2O9CA 4LRZE 4R38A 3T4QA 1YKDA 5EFWA 2FH5A 3LFVA 4L9GA 1STZA 3CITA 3PXPA 1VB6A 4RQ9A 2O0YA 3PHYA 2A24B 1F5MA 3G6OA 4HJ6A 4L0LA 3CLOA 4Y2FA 1H3QA 3MQOA 1LSWA 1T1BA 4KQDA 4DJ2A 3FG8A 3OOVA 4MDZA 3BWLA 4BBVA 3O5YA 4GHIB 5J4EA 2M7VA 2KX6A 5DKKA 2JKRM 1S4SA 3PBTA 3TRCA 3T4TA 4CLCD 2YKHA 4JGRA 1VHMA 2PR5A 1XFQA 2A24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BAS A;  1OTI A;  1TS8 A;  5HWW A;  3K3C A;  3MXQ A;  5F68 A;  2V1A A;  2B02 A;  3UMD A;  1WA9 A;  4GHI A;  4MN6 A;  2PYR A;  1XJ3 A;  4NXB A;  2QJ5 A;  4F3L A;  2YKF A;  2JHE A;  3F1N B;  3VOL A;  3ZQ5 A;  3EWK A;  4PKY G;  5F6A A;  4L9E A;  4NXG A;  2D01 A;  4WN5 A;  5HD5 A;  3RTY A;  2HV1 A;  3UB7 A;  1V9Y A;  4I5S A;  4XT2 B;  4KUO A;  1N9O A;  3E4P A;  4I3I A;  4GS9 A;  2Z6D A;  4L9F A;  4JGP A;  1D7E A;  3BY9 A;  1G28 A;  2GJ3 A;  3H82 B;  4LRX C;  2INW A;  4EER A;  3BY8 A;  2J80 A;  1S66 L;  3CAX A;  2OWH A;  1Y28 A;  3LID A;  4EET B;  3LUQ A;  4M4X A;  3UME A;  3C2W A;  4E04 A;  3RH8 B;  2WKQ A;  3UE6 A;  1UWP X;  1MZU A;  1UWN X;  5HDC A;  4B9O A;  1OJ5 A;  3MR0 A;  4WF0 A;  1XJ6 A;  3UB8 A;  2PYP A;  1NWZ A;  4HH3 A;  3H7W A;  5KIZ A;  5F5Y A;  2PD7 A;  2D02 A;  4KUK A;  2QJ7 A;  3OLO A;  4LPZ A;  4WL9 A;  5F69 A;  5TBM B;  4HJ4 A;  4HP4 A;  1F98 A;  1LL8 A;  3HJI A;  4HY8 A;  1X0O A;  4JGO A;  2ZOI A;  4DJ3 A;  3A0S A;  5HDD A;  3UB6 A;  2L4R A;  2VV6 A;  5HD3 A;  5J3W A;  3F1N A;  1GSV A;  1LSX A;  3LIE A;  1P0Z A;  4I39 A;  5G4Z A;  3UB9 A;  3VE3 A;  4F3L B;  2W27 A;  3F1P B;  3NOP C;  1JNU A;  2WKP A;  5TBM A;  2WKR A;  1S1Y A;  2VLG A;  2QHK A;  3LYX A;  1TS0 A;  1LT0 A;  1OTD A;  2VEA A;  4EEP A;  5A8B A;  3HJK A;  3F1O A;  2PDR A;  1BYW A;  2W0N A;  5DKL A;  3IBR A;  1OJG A;  3IS2 A;  4GW9 A;  1T1A A;  3CWF A;  1T1C A;  4NXF A;  1DP9 A;  4HH2 A;  4MN5 A;  1XJ2 A;  2PR6 A;  4NXE A;  1EW0 A;  3F1O B;  5HWV A;  3ULF A;  4HIA A;  4BBT A;  1T19 A;  2EA9 A;  2ZOH A;  1T18 A;  3D72 A;  4I38 A;  5HDS A;  3NJA A;  2L1M A;  4R6L A;  3A0V A;  1LSV A;  4HI4 A;  2VV8 A;  4EES A;  3GDI A;  1OTA A;  2QWS A;  3F1P A;  5DJT A;  3LI9 A;  1OT6 A;  1XFN A;  3LIC A;  4XT2 A;  2P7J A;  4EQ1 A;  5IS1 A;  1DP8 A;  4H6J B;  4PKY A;  3ICY A;  3E4O A;  3LIA A;  5AVE A;  1OT9 A;  4H6J A;  3T50 A;  3LIB A;  4HQA A;  1TS6 A;  2JN7 A;  3H7W B;  1UGU A;  2L0W A;  4LRZ E;  3VE4 A;  1DRM A;  1P97 A;  2V0U A;  2CMN A;  2ZBB A;  4R38 A;  2PD8 A;  3SW1 A;  2H28 A;  1N9N A;  1ODV A;  4EXO A;  4R70 A;  4R3A A;  3EEH A;  2K7S A;  2VV7 A;  5EFW A;  3LIF A;  4WUJ A;  4L9G A;  4YWZ A;  4EEU A;  1VB6 A;  2OOL A;  2V1B A;  1GSX A;  1OTB A;  3PHY A;  2A24 B;  4RQ9 A;  4LRY C;  3FC7 A;  4WLA A;  1XJ4 A;  4I3J A;  5DJU A;  3H82 A;  3G6O A;  5AVF A;  2V0W A;  2R78 A;  3IS2 B;  4BBU A;  3GEC A;  5HSQ A;  4HJ6 A;  3CLO A;  1GSW A;  3LI8 A;  4HNB A;  2I9V A;  4LLO B;  1N9L A;  4GCZ A;  2PHY A;  2OWJ A;  4GS9 B;  2QKP A;  3MQO A;  1LSW A;  3MJQ A;  4HOI A;  1V9Z A;  1T1B A;  4I3A A;  3MFX A;  4KQD A;  5HZH A;  1OTE A;  4DJ2 A;  4EW7 A;  3FG8 A;  3NHQ A;  5IU1 A;  3BWL A;  1KOU A;  3MQQ A;  3P7N A;  5G4Y A;  4BBV A;  1S4R A;  3H9W A;  3NOT C;  3E4Q A;  4GHI B;  1DP6 A;  3A0R A;  5J4E A;  5J7E A;  2KX6 A;  3KX0 X;  3B33 A;  4JGQ A;  5DKK A;  1S4S A;  2KDK A;  3K3D A;  4HJ3 A;  4K08 A;  3NOU C;  3PYP A;  2Z6C A;  5I5L A;  3C8C A;  2YKH A;  2M1C A;  1TS7 A;  4JGR A;  4HP9 A;  1F9I A;  2V9A A;  1S1Z A;  2PR5 A;  1S67 L;  5HWT A;  1XFQ A;  4HHD A;  2A24 A;  1D06 A; 
#chains in the Genus database with same CATH topology
 2Y8H A;  3VP3 A;  2WAE A;  3W4Q A;  2XQZ A;  2V1A A;  4UA7 A;  2PYR A;  3IWI A;  1K6S A;  3OCL A;  4X1L A;  1F2K A;  1Z6F A;  4LRX C;  2J80 A;  1S66 L;  1G6O A;  1PZO A;  2WKQ A;  3PBR A;  3NY4 A;  4WF0 A;  3UB8 A;  1KGF A;  3DTE A;  2PD7 A;  4OP5 A;  3HJI A;  1H5X A;  1W8Y A;  3HLE A;  5EVE A;  3UB6 A;  1K0K A;  1H0M A;  1GSV A;  2E8I A;  4S2M A;  3VE3 A;  5DVA A;  1FCO A;  5EPH A;  3CPT B;  2WKP A;  3VP2 A;  3Q82 A;  4KQR A;  1H8Z A;  1T1C A;  2PT7 A;  3UE1 A;  4KG2 A;  3WS0 A;  1T18 A;  2C5W B;  1FCM A;  1FIL A;  2HGV A;  3LR3 A;  1PFL A;  1VEU A;  1BUE A;  3T50 A;  4N1H A;  3G32 A;  2K31 A;  2BTF P;  3LIF A;  4BQM A;  2WGV A;  3OZH A;  3G2Y A;  5DJU A;  3UPP A;  1NLZ A;  2J3W A;  5L8M A;  2QKP A;  1N4O A;  3CMZ A;  1K55 C;  4QWO A;  1BSG A;  5MC7 A;  3ZNY A;  2ZMV A;  3GQZ A;  4R3B A;  5EE8 A;  3S22 A;  3ZG7 B;  4ME4 A;  4WYY A;  5GLB A;  1H8M A;  4E6X A;  2V1Z A;  2D01 A;  3BYD A;  3T4S A;  3QNC A;  4PMA A;  1MWS A;  3HLB A;  5L10 A;  2W3G A;  5CGS A;  3M6H A;  3Q7V B;  3LID A;  5FA7 A;  4QD4 A;  3C4P A;  1IKI A;  2ZLY A;  5F5Y A;  4KUK A;  5GHX A;  5D3O A;  4FOF A;  3VP0 A;  2XGN A;  3A3D A;  3ZG0 A;  4P0M A;  5M18 A;  3T12 B;  4WZ5 A;  1JNU A;  2WGW B;  1ESI A;  1YSP A;  4ID4 A;  4EU0 A;  1IEM A;  3NI9 A;  2JCH A;  1DP9 A;  4NXE A;  3F1O B;  1IYO A;  3LGO A;  4LGW A;  5EVI C;  4JF5 A;  1LI0 A;  2ZQ8 A;  1C3B A;  2Q9M A;  1HVB A;  3R7W A;  4LEN A;  1ZG4 A;  3BEC A;  4CJN A;  2ZBB A;  3SW1 A;  3PBN A;  3WRZ A;  3HLG A;  1G68 A;  4Y0O A;  3O87 A;  5AQ9 A;  5FI2 A;  4WLA A;  4LRY C;  3RFB A;  2PHY A;  3MFX A;  1Q2Q A;  5HZH A;  4Q0J A;  2PBD P;  3ITA A;  1NZO A;  1DP6 A;  2QZ6 A;  4K08 A;  3TE8 A;  1TS7 A;  1F9I A;  3A3I A;  2BAS A;  1MPL A;  3K3C A;  5F68 A;  5I94 A;  4GHI A;  2QJ5 A;  3V39 A;  3V5M A;  1TF1 A;  3T1S A;  4L9E A;  4WN5 A;  4P6Z M;  1GHP A;  1G5U A;  4U3T A;  2VK3 A;  1Z09 A;  5DTK A;  1NRJ A;  3QP2 A;  2VX8 A;  4HEF A;  1JTD A;  1ZKJ A;  3E98 A;  4OQG A;  1LL8 A;  4OQI A;  5HD3 A;  5CHU A;  3DTM A;  2VA0 A;  5F82 A;  2VLG A;  2VEA A;  2VGJ A;  3IH8 A;  2OAP 1;  2HZ5 A;  2ZD8 A;  1T1A A;  3ZDJ A;  3E0Y A;  2K2N A;  3R7W B;  4ARZ A;  3A0V A;  3R4K A;  5DJT A;  3LI9 A;  3PBQ A;  3UE3 A;  1CQA A;  4YNR A;  5CEC A;  4JBF A;  4KG6 A;  2V8F A;  4HQA A;  2ZQD A;  1XGJ A;  2WKI A;  5BOH A;  1GCE A;  1XPB A;  4MBH A;  1OTB A;  3WS1 A;  5HSQ A;  3LI8 A;  1K38 A;  4QHC A;  5DF7 A;  4FSF A;  3MJQ A;  4X55 A;  3P7N A;  5E2G A;  5EM0 A;  2UV0 E;  5KZH A;  3ZVW A;  1TVF A;  5I5L A;  3C7V A;  1VM1 A;  1AXB A;  4PM8 A;  2WGW A;  3HUO A;  1XXM A;  2E8J A;  1TS8 A;  3KSH A;  5FAS A;  3UMD A;  2Y2O A;  3QP8 A;  2W1T A;  4WBG A;  2VGL M;  4F3L A;  3SS5 A;  4ZDX A;  2M7U A;  1RGY A;  3RTY A;  4JF4 A;  5KSH A;  1QMF A;  4FH2 A;  1N9O A;  1W8Q A;  3E4P A;  4S2L A;  3VSK A;  3B42 A;  3BY9 A;  1PYY A;  3EGD C;  3HRE A;  3N8S A;  4H8R A;  3HUM A;  5CXW A;  4CPK A;  5KSC A;  1EWZ A;  3NCK A;  1PI5 A;  3VFH A;  4EQI A;  2HJE A;  3LR5 A;  2D02 A;  3ITB A;  1PWD A;  1SKO B;  3BM6 A;  1X0O A;  4KG5 A;  2ZOI A;  3A0S A;  3MFD A;  3LIE A;  5FL3 A;  3TOI A;  4JXG A;  5FQI A;  4DRT A;  1HTZ A;  1BLS A;  2PU2 A;  3MZD A;  1T19 A;  2ZOH A;  1JWP A;  4IBX A;  5HDS A;  1IEL A;  4PHT A;  3NIA A;  4OP8 A;  2HP5 A;  4G3W A;  1CJF A;  3TJZ C;  4EV4 A;  2QMI A;  1OT9 A;  4BBU A;  4LRZ E;  3RXW A;  1VQQ A;  4OH0 A;  3T4Q A;  1YKD A;  3MXR A;  1NJ4 A;  3PXP A;  1VB6 A;  3A3E A;  2O0Y A;  5F83 A;  1ES2 A;  4HJ6 A;  3L9K A;  3IT9 A;  4PPR A;  1T1B A;  2HPB A;  2WAF A;  1K56 A;  4GHI B;  4Y17 A;  2M7V A;  1TDG A;  5DKK A;  2JKR M;  1S4S A;  3HLF A;  3TRC A;  2V20 A;  2YKH A;  2PBY A;  2XH9 A;  4GZB A;  2R9W A;  2XFT A;  1YMX A;  1XGI A;  4OLG A;  2GZA A;  5E2F A;  3UB7 A;  2PAV P;  2Q9N A;  4I3I A;  4GS9 A;  1FR1 A;  4EER A;  4PM5 A;  5CGW A;  4QPR A;  1LLB A;  1FQG A;  2QYB A;  4B9O A;  3IWQ A;  3GSG A;  4M3K A;  4NET A;  1XKZ A;  2QJ7 A;  3M2K A;  5F69 A;  1ONG A;  1VET A;  4JGO A;  1FIK A;  3NUL A;  3WS2 A;  3L7H A;  1W79 A;  2XLN A;  5HL1 A;  4Y7P A;  3MXS A;  5EVI A;  5HPI A;  2ZQC A;  4FH4 A;  1RCJ A;  4LFU A;  2EWW A;  1S6R A;  4OLD A;  4R6L A;  5FEF A;  4GN2 A;  2QWS A;  3CJM A;  4WZ5 C;  3SOI A;  4BWI A;  2WKH A;  3IX8 A;  4R0Q A;  4BL2 A;  3SS3 A;  3C4O A;  3GV9 A;  3VP1 A;  4OON A;  1KE4 A;  3T4L A;  4EBN A;  2H10 A;  3EOI A;  1JWV A;  3FC7 A;  4I3J A;  4Z1W A;  3Q7V A;  4WEL A;  5EVI B;  4GS9 B;  3ZG5 A;  1CEF A;  2JC7 A;  5IU1 A;  4MNR A;  1YLJ A;  2OLV A;  2HP9 A;  1TEM A;  2Z2L B;  4HJ3 A;  5HFO A;  3FPV A;  4X6T A;  5EUA A;  5GLA A;  1S67 L;  3EGX C;  1D06 A;  1OTI A;  4IBR A;  3LEQ A;  4E3M A;  1XJ3 A;  1YLY A;  2WGI A;  3JYI A;  1K55 A;  3IXH A;  3B47 A;  4CLC A;  2HV1 A;  1Y54 A;  1KE0 A;  5LBR A;  2W1R A;  1K54 A;  3FYZ A;  2ZMF A;  3CAX A;  5GHY A;  4M4X A;  3HLW A;  1SKF A;  2GNX A;  3I7J A;  3OLO A;  3IHA A;  4FCF A;  2JKT M;  4K0W A;  3IHB A;  1U60 A;  3UB5 P;  1SZV A;  1JTG A;  1NZU A;  4HBU A;  2W3H A;  1A0K A;  2ACG A;  5CX7 A;  1DJA A;  2Y91 A;  4GD6 A;  5J8X A;  4BBT A;  4D2O A;  4JKT A;  4I38 A;  3NJA A;  4X69 A;  3PAE A;  3LY3 A;  2OAQ 1;  3ICY A;  2OSU A;  4PAU A;  5AVE A;  5DF9 A;  1TS6 A;  3VE4 A;  2Y2J A;  3VOY A;  5M19 A;  4DF6 A;  5FAP A;  4Y13 A;  3KYQ A;  2CC1 A;  2R78 A;  2I9V A;  2EXA A;  4HOI A;  1N9B A;  1EI5 A;  4DE3 A;  1PWC A;  2G2W A;  4YOF A;  3SH8 A;  2J7V A;  4OQ0 A;  2Z6C A;  1O7E A;  4BD0 A;  4MBK A;  4KZA A;  3DTI A;  4ZJ2 A;  5FI7 A;  5HPF A;  3BFE A;  3DBA A;  4Y3I A;  4P87 A;  5A90 A;  2DMW A;  2Y59 A;  3EWK A;  1FSW A;  3K2N A;  5EEC A;  2WK0 A;  3BFD A;  4KZ3 A;  2JKT I;  5DF8 A;  2INW A;  3C2W A;  3UE6 A;  1UWP X;  1PNE A;  3BQ8 A;  3H7W A;  1OME A;  3IX4 A;  2HDQ A;  2HP6 A;  5TBM B;  1PW8 A;  2FZ0 A;  4PM9 A;  4OOL A;  4LV0 A;  1ERM A;  4Z9Q A;  2ZC3 B;  2V8C A;  4ZJ1 A;  2JE5 A;  1SDN A;  5FAQ A;  2A2L A;  1ES3 A;  5CER A;  1K25 A;  3GDI A;  3D4F A;  4JPM A;  3V3S A;  3LIB A;  3VP4 A;  4PM6 A;  4NKP A;  1BLP A;  2ZC7 A;  2AVX A;  1GHI A;  1W63 Q;  4HBT A;  3IS2 B;  4HNB A;  3A3F A;  5FAT A;  4X53 A;  1ES4 A;  1ESU A;  3T1R A;  4OQH A;  1S4R A;  3NOT C;  1ES5 A;  3E4Q A;  3S7N A;  2EXB A;  3KX0 X;  1WE4 A;  1IFQ A;  5KMW A;  4A5R A;  1SCW A;  4S2O A;  5FDS A;  2M1C A;  3FKW A;  3JVU A;  3AGD A;  1S0W A;  4NG2 A;  2XRO A;  4N9L A;  3CPT A;  4MN6 A;  4IVK A;  2J9P A;  4UEY A;  3VV4 A;  2J8Y A;  4Y15 A;  1ACF A;  3HLD A;  4I5S A;  4MLL A;  1CK3 A;  1Y4O A;  4DE2 A;  1G28 A;  3U4L P;  2Y2M A;  3QP5 A;  2VGL S;  3M6B A;  3LUQ A;  3IXD A;  4EBL A;  3G2Z A;  3V50 A;  2ZJ9 A;  1NLY A;  2H0T A;  3G31 A;  3ZCZ A;  3IH9 A;  1FOF A;  4R3J A;  1NY0 A;  4RYE A;  2G7U A;  2BLS A;  1M40 A;  3UO9 A;  2VV6 A;  2BG1 A;  1YLW A;  1L2S A;  5A93 A;  3W4P A;  3LYX A;  3NBL A;  3TSG A;  3LR0 A;  1NXY A;  3TG9 A;  4GB7 A;  3S7P A;  3IS2 A;  3BLM A;  3P09 A;  4KZ6 A;  5FEG A;  1K57 C;  4EES A;  5K5B A;  3G30 A;  3F1P A;  4EQ1 A;  1SKO A;  1ZC2 A;  2Y2N A;  2FH5 A;  4Y0U A;  1YLP A;  4OPQ A;  4P6B A;  1KVL A;  3G6O A;  4JF6 A;  3VOZ A;  2X01 A;  4Y2F A;  5E2E A;  3FWL A;  4KQD A;  3DW0 A;  3SH7 A;  1K57 A;  2KX6 A;  1SHV A;  4CLC D;  3S1Y A;  1XFQ A;  4P85 A;  1PI4 A;  3KYE A;  4WMC A;  1DY6 A;  2Y2I A;  3SZT A;  2QPN A;  3P01 A;  5CHJ A;  4Y0T A;  4NXB A;  2JHE A;  4XXR A;  3MSH A;  4BEN A;  1IYQ A;  1MKI A;  4P6Z S;  1D7E A;  2R9X A;  1IKG A;  5FDH A;  4CLC E;  4U0X A;  4E04 A;  4E6W A;  3Q7Z A;  1NWZ A;  4DDY A;  3CHW P;  1OPX A;  1CEG A;  1L3L A;  5L09 A;  5HDD A;  5CED A;  5G4Z A;  4GD8 A;  1AWI A;  4RA7 A;  3NOP C;  1TS0 A;  4CQH A;  5AQ7 A;  4XUX A;  5DKL A;  2OV5 A;  5HW3 A;  5GHZ A;  4IVI A;  2XRN A;  2J3T D;  1YLZ A;  5TJJ A;  4WM9 A;  4X56 A;  3HLC A;  1OTA A;  4R4S A;  3LCE A;  1NYY A;  4KZ5 A;  2XF3 A;  2JN7 A;  5FQK A;  2CMN A;  1MC0 A;  1MWT A;  4EXO A;  4R70 A;  3EEH A;  1PZP A;  4YWZ A;  2ZC4 B;  3W2Z A;  3MKE A;  2IWB A;  5AVF A;  2V0W A;  3MF0 A;  3OCN A;  4IJG A;  5GLC A;  3GEC A;  3WWX A;  3PAG A;  1E3U A;  1N9L A;  2EX6 A;  1FR6 A;  5E43 A;  3G34 A;  4QB8 A;  4S2P A;  3Q07 A;  1BUL A;  1M6K A;  3HCY A;  4QJG A;  1WYB A;  5TR7 A;  1I2S A;  5FAO A;  2JKG A;  4ZTK A;  5A92 A;  3OC2 A;  3VOL A;  5F6A A;  5HD5 A;  3N8R A;  4S2N A;  1Y28 A;  1NYM A;  4BD1 A;  4WL9 A;  1F98 A;  2ZM8 A;  3UB9 A;  3F1P B;  2J9O A;  5IT5 A;  4HES A;  5TBM A;  3FPW A;  4OPZ A;  3PR6 A;  2A3U A;  5GLD A;  3UPO A;  1KGG A;  4HH2 A;  3IWO A;  2EA9 A;  2KOI A;  3V67 A;  3C7U A;  1OT6 A;  2G2U A;  4UAA A;  4XT2 A;  3BFF A;  4H6J B;  2EWV A;  2P9V A;  4OPY A;  1DRM A;  1P97 A;  1N9N A;  1ODV A;  3IXB A;  2VZW A;  1RP5 A;  4E3L A;  1GSX A;  5HL6 A;  1XJ4 A;  1XA1 A;  3V3R A;  3IF5 A;  1MXO A;  5EV0 A;  5M1A A;  1KOU A;  3MQQ A;  5G4Y A;  3A0R A;  4GKU A;  3B33 A;  2UWX A;  3NEC A;  2I72 A;  3T4O A;  5DFX A;  5E2H A;  5HWT A;  1FSY A;  3ZG9 B;  4C75 A;  5TGF A;  3IF6 B;  2B02 A;  4KEN B;  4AFI A;  5L07 A;  4DMZ A;  3BQA A;  1BLC A;  2H5S A;  4UQI S;  4L9F A;  4JGP A;  3QP6 A;  1H8Y A;  5CTN A;  3C5A A;  3ZYT A;  5DFY A;  3GRJ A;  2XA7 M;  5F1G A;  1ZTU A;  3KO6 A;  4B4Z A;  5CGX A;  2XR0 A;  2P08 A;  3IF6 A;  2XFS A;  3CI6 A;  2ZC5 B;  4XUZ A;  3SS4 A;  2QHK A;  3HJK A;  3KSI A;  1BYW A;  2W0N A;  3CUE A;  1ERO A;  3WS4 A;  2JKF A;  1TDL A;  4NXF A;  4PM7 A;  5HWV A;  4Q0I A;  4NK3 A;  3ULF A;  3VSL A;  2W3D A;  1JVJ A;  2JBF A;  4UQI M;  3ZGA B;  5F1F A;  4K91 A;  5EOO A;  3OPR A;  1UGU A;  2L0W A;  2DNS A;  2V0U A;  4KZB A;  3EEA A;  4R23 A;  3Q1F A;  2JKR I;  1WYC A;  2K7S A;  1XX2 A;  4WUJ A;  1TD5 A;  3H82 A;  3BEB A;  3IX3 A;  4FD8 A;  2ZL1 A;  4GLQ A;  4I3A A;  1K54 C;  3OPL A;  3ZFZ A;  1L0E A;  3NHQ A;  3H9W A;  4CLC C;  1YLT A;  5J7E A;  2XD1 A;  3NOU C;  4WEK A;  3CUE C;  3C8C A;  4ESP A;  4QU3 A;  2ZQA A;  4ZJ3 A;  3T4K A;  2Q0O A;  4KQQ A;  4HHD A;  5HAR A;  1ZG6 A;  4BL3 A;  1GHM A;  5AQB A;  3JPU A;  3ZQ5 A;  1NRF A;  5FQ9 A;  4UA9 A;  3T1Q B;  4XT2 B;  1YT4 A;  2Z6D A;  3Q81 A;  3H82 B;  2PRF A;  3O88 A;  2KLI A;  1KE3 A;  2MJ6 A;  4EET B;  2XD5 A;  4DXB A;  1ERQ A;  2XK1 A;  2P74 A;  3HL9 A;  3BFG A;  3MR0 A;  5CHM A;  1XJ6 A;  3N8L A;  4OOM A;  2HF6 A;  3NDG A;  4UHU A;  2B18 A;  2EX2 A;  1MWU A;  2VGK A;  2W3F A;  2Y55 A;  3MZE A;  4KZ7 A;  4RVA A;  4LCL A;  1P9R A;  1K4F A;  3GR2 A;  3UE0 A;  1LT0 A;  2RCX A;  4O8G A;  3D3O A;  1PRQ A;  4K0X A;  4G3K A;  1OJG A;  3CWF A;  3FV7 A;  3PTE A;  5U47 A;  4E3K A;  4YIN A;  1VEU B;  5EVL A;  2VV8 A;  4KZ4 A;  3PBS A;  3ZNT A;  3TW8 A;  2P7J A;  4N92 A;  4WMC D;  3E4O A;  3LIA A;  3E2K A;  3A3J A;  2O9C A;  2DRW A;  3VMA A;  4R38 A;  1BZA A;  5EFW A;  1I2W A;  3LFV A;  3UN7 A;  1STZ A;  4FUW A;  4RQ9 A;  3PHY A;  2A24 B;  3GMW A;  1F5M A;  4OPR A;  3CLO A;  3IF6 C;  1H3Q A;  4YFM A;  3UNW A;  2PU4 A;  1DJB A;  3MQO A;  1LSW A;  5CEB A;  4DJ2 A;  3FG8 A;  3OOV A;  4MDZ A;  4ZAM A;  3O5Y A;  5J4E A;  1HLU P;  1CF0 A;  5FQJ A;  1LHY A;  3FZC A;  1BTL A;  2ZQ9 A;  4IED A;  1G6A A;  2XEP A;  2A24 A;  4JXS A;  5HWW A;  4IHQ A;  2HDU A;  3WRT A;  2ZMA A;  3KYZ A;  2P04 A;  2WUQ A;  1RGZ A;  4D60 A;  4KUO A;  1HZO A;  2C6W B;  2WYX A;  3CG5 A;  2WZX A;  3DTK A;  2NUP C;  2OWH A;  5FI6 A;  3KSG A;  1J9M A;  4EBP A;  1Q2P A;  4LV1 A;  4EUV A;  4E3N A;  4ETX A;  3PBO A;  4LPZ A;  3E2L A;  5EM1 A;  4DJ3 A;  2P9V B;  2W1T B;  3F1N A;  1LSX A;  4I39 A;  4F3L B;  4R1G A;  1S1Y A;  2X02 A;  1DJC A;  3F1O A;  4GNU A;  4GW9 A;  2WKE A;  3IBJ A;  4O0P A;  4JLF A;  4MN5 A;  1KGE A;  3D72 A;  4KZ9 A;  2GDN A;  2O9A A;  3LIC A;  3QP1 A;  3GTC A;  4MN7 A;  4UA6 A;  3MQ0 A;  1IYS A;  2VV7 A;  2DCF A;  2OOL A;  2V1B A;  5FSR A;  1PW1 A;  2WZZ A;  1D1J A;  3OPP A;  3G35 A;  5FQM A;  1V9Z A;  3DWK A;  1E25 A;  1OTE A;  4S2N C;  2Y2H A;  4ARZ B;  2VJW A;  5GL9 A;  1YAX A;  5AQA A;  3O3V A;  4ZRR A;  1S1Z A;  3IXG A;  3DWZ A;  1K4E A;  3S4X A;  1WA9 A;  5HX9 A;  3RXX A;  4DKI A;  4GJ4 A;  3S7Q A;  1E4D A;  4N9K A;  4NXG A;  2ZM0 A;  3SH9 A;  2XSS A;  1V9Y A;  1CI9 A;  2XA7 S;  3ISG A;  4LV3 A;  3UME A;  1MBL A;  4S2I A;  5HDC A;  2X71 A;  3BW6 A;  2EX9 A;  2LB5 A;  1L0F A;  2A49 A;  1QME A;  4MCW A;  2L4R A;  1P0Z A;  1PWG A;  2B95 A;  4JXV A;  4EEP A;  4KQO A;  1E3U D;  4RX2 A;  2Y2G A;  4GOG A;  1HD8 A;  3W8K A;  3ZHH A;  3AGF A;  4WZ4 A;  4HI4 A;  1MY8 A;  3BJN A;  2V2F F;  1L0D A;  3N7W A;  5IS1 A;  4BMW A;  4PKY A;  4IUK A;  3WS5 A;  4B4X A;  3T1X A;  2PD8 A;  2H28 A;  3MKF A;  2B5R A;  2LB9 A;  4EEU A;  2HDS A;  3M2J A;  4Y5F A;  1GSW A;  3HUN A;  4LLO B;  1IOU A;  3KSF A;  1GA0 A;  3ZVT A;  4MEZ A;  2W3E A;  1W63 M;  4EW7 A;  2XDM A;  1KVM A;  2ZL1 B;  1LL5 A;  3BFC A;  3UDF A;  4II7 A;  2KDK A;  2H0Y A;  5CTM A;  4S2J A;  3PYP A;  5IHV A;  3EQV A;  3UDX A;  3HVF A;  4E3I A;  1BLH A;  4O01 A;  1P9W A;  3F1N B;  3EQU A;  3CZD A;  2O9B A;  3NDE A;  5HAP A;  1YSQ A;  3LEZ A;  2Z2M B;  3AGE A;  5EOE A;  4IUH A;  1W7F A;  1L0G A;  4N1X A;  4DE0 A;  4WEJ A;  3HBR A;  3RH8 B;  5JYO A;  3N4I A;  4C3Q A;  1MZU A;  1UWN X;  1KDS A;  1OJ5 A;  5KIZ A;  3GVB A;  4HH3 A;  4BLM A;  4FTX A;  4GDN A;  4LCM A;  1W5D A;  4ETZ A;  4HP4 A;  4HY8 A;  4JXW A;  1YMS A;  3C38 A;  1YM1 A;  1YQS A;  3JVV A;  2VKS A;  3T4J A;  4F94 A;  5AJG A;  1OTD A;  5TFQ A;  1KDW A;  2PDR A;  3IBR A;  5DTS A;  4X1M A;  1XJ2 A;  2PR6 A;  1EW0 A;  4HIA A;  2Y79 A;  4E3J A;  1YPR A;  1LSV A;  2HDR A;  3N6I A;  3UY6 A;  1MKM A;  1VET B;  4B88 A;  2WAD A;  3O86 A;  4DN0 A;  2O99 A;  3MMH A;  2GX5 A;  3B3X A;  3IQA A;  2Y2L A;  1ZHH B;  4R3A A;  4EWF A;  3DAV A;  4LV2 A;  2Y2P A;  5HAI A;  1IYP A;  2ZM2 A;  2Y2K A;  4QY6 A;  1LI9 A;  4DXC A;  1PIO A;  2EX8 A;  4GCZ A;  4E3O A;  2OWJ A;  4R4R A;  3FKV A;  1BT5 A;  1JWZ A;  1O07 A;  2FFY A;  4JGQ A;  3K3D A;  5DTT A;  3VFF A;  2IWC A;  4BJP A;  3LO7 A;  2HJ9 C;  4RX3 A;  4HP9 A;  2J3T C;  2V9A A;  1ONH A;  4S2K A;  4GDB A;  3MXQ A;  3ZG8 B;  4NEE D;  3LY4 A;  2YKF A;  4PKY G;  4B93 A;  3G4P A;  4O7D A;  1K56 D;  2GJ3 A;  4OKP A;  3BY8 A;  3S7O A;  4DE1 A;  3LR4 A;  3NC8 A;  4Q0H A;  5G18 A;  3OPH A;  3RJU A;  1XP4 A;  4MMN A;  2PYP A;  3D9Y A;  1XA7 A;  1CI8 A;  2Y2Q A;  2FFF B;  4HJ4 A;  4DDS A;  4KZ8 A;  4X68 A;  3W4O A;  5J3W A;  3MZF A;  2IA2 A;  2W27 A;  4ZBE A;  2ZC6 B;  3C30 A;  2WKR A;  5JYP A;  5A8B A;  3OBF A;  4X25 A;  4MBF A;  2RL3 A;  5C5K A;  4OOY A;  1I5Q A;  2Y4A A;  3QNB A;  5A91 A;  2L1M A;  2EFU A;  1SDE A;  3MBZ A;  1XFN A;  5FQQ A;  1DP8 A;  2IWD A;  4CLC B;  4G3V A;  3U2A A;  1LL9 A;  3MS6 A;  4H6J A;  4U0T A;  3H7W B;  2NUT C;  5L2F A;  4C6Y A;  3QP4 A;  1FCN A;  3BLS A;  4L9G A;  2EFX A;  3CIT A;  4EUZ A;  3UDI A;  4OVD A;  4Q8I A;  3P98 A;  5EVI D;  4L0L A;  1J3W A;  3UPN A;  5CRF A;  2OLU A;  4QY5 A;  3BWL A;  4BBV A;  3QHY A;  1MWR A;  1GA9 A;  1K6R A;  3PBT A;  3T4T A;  2ZQ7 A;  4JGR A;  1VHM A;  5HAQ A;  2PR5 A;  3BRM A;  1ALQ A; 
#chains in the Genus database with same CATH homology
 5HWW A;  2Y8H A;  4IHQ A;  2V1A A;  3P01 A;  2PYR A;  4NXB A;  2JHE A;  3KYZ A;  2GZA A;  2P04 A;  3OCL A;  3UB7 A;  4KUO A;  4I3I A;  4P6Z S;  4GS9 A;  1D7E A;  4LRX C;  4EER A;  2J80 A;  1S66 L;  2NUP C;  1G6O A;  2OWH A;  4CLC E;  4QPR A;  4E04 A;  3KSG A;  2QYB A;  2WKQ A;  3PBR A;  4B9O A;  4WF0 A;  3UB8 A;  1NWZ A;  4EUV A;  4ETX A;  2PD7 A;  1OPX A;  3PBO A;  2QJ7 A;  4LPZ A;  5F69 A;  3HJI A;  4DJ3 A;  4JGO A;  3UB6 A;  5HDD A;  2W1T B;  3F1N A;  1GSV A;  1LSX A;  4I39 A;  5G4Z A;  4F3L B;  3VE3 A;  3NOP C;  2WKP A;  1S1Y A;  1TS0 A;  4CQH A;  3F1O A;  5HPI A;  5DKL A;  4GW9 A;  1T1C A;  3IBJ A;  4O0P A;  2PT7 A;  2EWW A;  4MN5 A;  2XRN A;  2J3T D;  5TJJ A;  3D72 A;  1T18 A;  4R6L A;  1OTA A;  2QWS A;  2O9A A;  2HGV A;  4BWI A;  3LIC A;  3LR3 A;  4MN7 A;  3T50 A;  2JN7 A;  2CMN A;  2K31 A;  3MQ0 A;  1MC0 A;  4EXO A;  4R70 A;  3EEH A;  2VV7 A;  3T4L A;  3LIF A;  4YWZ A;  2OOL A;  2V1B A;  3W2Z A;  3EOI A;  5DJU A;  3FC7 A;  4I3J A;  5AVF A;  2V0W A;  3MF0 A;  3OCN A;  4IJG A;  4Z1W A;  3GEC A;  4WEL A;  1NLZ A;  1N9L A;  2J3W A;  5L8M A;  4GS9 B;  2QKP A;  1V9Z A;  1OTE A;  5IU1 A;  4ARZ B;  5MC7 A;  4HJ3 A;  2VJW A;  3FPV A;  2ZMV A;  1YAX A;  3HCY A;  4ZRR A;  1S1Z A;  4ME4 A;  1S67 L;  3EGX C;  1D06 A;  1OTI A;  1H8M A;  1WA9 A;  4GJ4 A;  1XJ3 A;  3S7Q A;  3OC2 A;  3VOL A;  5F6A A;  3B47 A;  5HD5 A;  4NXG A;  2D01 A;  4CLC A;  2HV1 A;  2XSS A;  3T4S A;  1V9Y A;  5LBR A;  2W1R A;  2W3G A;  2XA7 S;  2ZMF A;  3CAX A;  1Y28 A;  3LID A;  4M4X A;  3UME A;  2GNX A;  5HDC A;  3BW6 A;  2LB5 A;  5F5Y A;  4KUK A;  3OLO A;  4MCW A;  4WL9 A;  1F98 A;  2JKT M;  4FOF A;  2L4R A;  1P0Z A;  3UB9 A;  3F1P B;  5IT5 A;  1JNU A;  5TBM A;  3FPW A;  2W3H A;  3PR6 A;  4EEP A;  1YSP A;  4KQO A;  4EU0 A;  5CX7 A;  1DP9 A;  4HH2 A;  4NXE A;  3F1O B;  4BBT A;  2EA9 A;  4I38 A;  2KOI A;  3NJA A;  4HI4 A;  3V67 A;  3BJN A;  1OT6 A;  2OAQ 1;  4XT2 A;  5IS1 A;  4BMW A;  4H6J B;  4PKY A;  4IUK A;  3ICY A;  2EWV A;  4PAU A;  3R7W A;  5AVE A;  5DF9 A;  1TS6 A;  3VE4 A;  1DRM A;  1P97 A;  2ZBB A;  3SW1 A;  2PD8 A;  2H28 A;  3PBN A;  1N9N A;  1ODV A;  2VZW A;  2LB9 A;  4EEU A;  1GSX A;  5HL6 A;  4WLA A;  4LRY C;  3KYQ A;  1XJ4 A;  2R78 A;  4Y5F A;  1GSW A;  2I9V A;  4LLO B;  1IOU A;  3RFB A;  3KSF A;  2PHY A;  4HOI A;  2W3E A;  3MFX A;  5HZH A;  1W63 M;  4Q0J A;  4EW7 A;  1KOU A;  3MQQ A;  5G4Y A;  1DP6 A;  3A0R A;  4YOF A;  4II7 A;  3B33 A;  2KDK A;  4K08 A;  3PYP A;  3TE8 A;  2Z6C A;  3EQV A;  3T4O A;  5DFX A;  1TS7 A;  1F9I A;  5HWT A;  2BAS A;  3K3C A;  4O01 A;  5F68 A;  2B02 A;  4GHI A;  1P9W A;  5HPF A;  3DBA A;  2QJ5 A;  4Y3I A;  2DMW A;  3F1N B;  1TF1 A;  3EWK A;  3EQU A;  4AFI A;  2O9B A;  3K2N A;  4L9E A;  4WN5 A;  4P6Z M;  4DMZ A;  1YSQ A;  3BQA A;  4UQI S;  2JKT I;  4L9F A;  4JGP A;  2INW A;  4IUH A;  3ZYT A;  3C2W A;  5DFY A;  4WEJ A;  3RH8 B;  3UE6 A;  1UWP X;  1MZU A;  1UWN X;  1NRJ A;  1OJ5 A;  5KIZ A;  2VX8 A;  3BQ8 A;  4HH3 A;  3H7W A;  2XA7 M;  1ZTU A;  5TBM B;  3E98 A;  4HP4 A;  4HY8 A;  1LL8 A;  4ETZ A;  3KO6 A;  5HD3 A;  3C38 A;  2FZ0 A;  2P08 A;  3JVV A;  2VA0 A;  3CI6 A;  2VKS A;  3T4J A;  4OOL A;  2VLG A;  2QHK A;  5AJG A;  1OTD A;  2VEA A;  3HJK A;  3KSI A;  2PDR A;  1BYW A;  2OAP 1;  2W0N A;  3CUE A;  3IBR A;  1T1A A;  4NXF A;  3E0Y A;  1XJ2 A;  2PR6 A;  5HWV A;  1EW0 A;  2A2L A;  4Q0I A;  3ULF A;  4HIA A;  2K2N A;  3R7W B;  2W3D A;  4ARZ A;  2Y79 A;  3A0V A;  1LSV A;  3R4K A;  3GDI A;  5DJT A;  4UQI M;  3LI9 A;  3PBQ A;  3UE3 A;  1MKM A;  4YNR A;  4DN0 A;  2O99 A;  3MMH A;  3LIB A;  2GX5 A;  4HQA A;  1UGU A;  2L0W A;  2V0U A;  3EEA A;  2JKR I;  1ZHH B;  4R3A A;  2K7S A;  4WUJ A;  4NKP A;  1TD5 A;  1OTB A;  3H82 A;  1W63 Q;  3IS2 B;  5HSQ A;  3LI8 A;  4HNB A;  4GCZ A;  2OWJ A;  4FSF A;  4GLQ A;  4I3A A;  3MJQ A;  3NHQ A;  3P7N A;  1S4R A;  3H9W A;  3NOT C;  3E4Q A;  4CLC C;  3S7N A;  5J7E A;  3KX0 X;  4JGQ A;  1IFQ A;  3K3D A;  3NOU C;  4BJP A;  4WEK A;  3CUE C;  5I5L A;  3C8C A;  2HJ9 C;  2M1C A;  4HP9 A;  2J3T C;  2V9A A;  3T4K A;  4HHD A;  3JVU A;  1TS8 A;  3KSH A;  3MXQ A;  2XRO A;  3UMD A;  4MN6 A;  4NEE D;  2W1T A;  2VGL M;  4UEY A;  4F3L A;  2YKF A;  3ZQ5 A;  4PKY G;  2M7U A;  3VV4 A;  3RTY A;  4B93 A;  4I5S A;  4XT2 B;  5KSH A;  1N9O A;  3E4P A;  2Z6D A;  3B42 A;  3H82 B;  3BY9 A;  1G28 A;  2GJ3 A;  3EGD C;  2KLI A;  3BY8 A;  2MJ6 A;  2VGL S;  3S7O A;  4EET B;  3LUQ A;  3LR4 A;  1NLY A;  4Q0H A;  3MR0 A;  4MMN A;  1XJ6 A;  2HJE A;  2PYP A;  3LR5 A;  4OOM A;  2HF6 A;  2D02 A;  2G7U A;  2B18 A;  4HJ4 A;  1X0O A;  2ZOI A;  2W3F A;  3A0S A;  2VV6 A;  5J3W A;  3LIE A;  2IA2 A;  2W27 A;  5FL3 A;  1P9R A;  3C30 A;  2WKR A;  3LYX A;  1LT0 A;  4O8G A;  3D3O A;  3LR0 A;  5A8B A;  4G3K A;  1OJG A;  3S7P A;  3OBF A;  3IS2 A;  3CWF A;  5C5K A;  1T19 A;  2ZOH A;  5HDS A;  2L1M A;  4PHT A;  2VV8 A;  4EES A;  5K5B A;  3PBS A;  3F1P A;  4G3W A;  1XFN A;  3TW8 A;  4EQ1 A;  2P7J A;  3TJZ C;  1DP8 A;  4CLC B;  4G3V A;  3E4O A;  3U2A A;  3LIA A;  1OT9 A;  4H6J A;  4BBU A;  3H7W B;  2NUT C;  2O9C A;  4LRZ E;  4R38 A;  3T4Q A;  1YKD A;  5EFW A;  2FH5 A;  3LFV A;  4L9G A;  1STZ A;  3CIT A;  3PXP A;  1VB6 A;  4RQ9 A;  2O0Y A;  3PHY A;  2A24 B;  1F5M A;  3G6O A;  4HJ6 A;  4L0L A;  3CLO A;  4Y2F A;  1H3Q A;  3MQO A;  1LSW A;  1T1B A;  4KQD A;  4DJ2 A;  3FG8 A;  3OOV A;  4MDZ A;  3BWL A;  4BBV A;  3O5Y A;  4GHI B;  5J4E A;  2M7V A;  2KX6 A;  5DKK A;  2JKR M;  1S4S A;  3PBT A;  3TRC A;  3T4T A;  4CLC D;  2YKH A;  4JGR A;  1VHM A;  2PR5 A;  1XFQ A;  2A24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...