4I39A

Structures of ict and pr1 intermediates from time-resolved laue crystallography collected at 14id-b, aps
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Photoactive yellow protein
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 39
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4i39A00
3IBRA 3D72A 4GS9B 1XJ2A 1OT6A 4E04A 1TS8A 3F1OA 1DP9A 4DJ3A 1ODVA 4L9EA 5AVFA 5A8BA 5TBMA 1S66L 4F3LB 4EEUA 1LSXA 4WF0A 3A0VA 5F69A 2ZBBA 1GSVA 4R70A 4HH2A 2QJ7A 2CMNA 2PYRA 1EW0A 3B33A 2A24A 3A0RA 4DJ2A 4B9OA 1DP6A 1G28A 3IS2B 2D02A 4HIAA 3F1OB 1UWPX 4JGRA 1TS0A 1GSXA 3E4OA 2V0UA 2VV8A 2QJ5A 4HY8A 2PR5A 3UE6A 3F1NA 3EEHA 4LLOB 4KQDA 3E4PA 4L9GA 4LPZA 4JGOA 5HD3A 5AVEA 2PYPA 4EXOA 1N9OA 4YWZA 4EERA 3H9WA 1D7EA 1T1BA 1OTBA 4XT2A 5F6AA 4HJ3A 2H28A 3ULFA 3T50A 3PHYA 2WKPA 3ICYA 4WUJA 2Z6DA 3H82A 5DKLA 5KIZA 1OT9A 2YKHA 4M4XA 3LIAA 3MFXA 1JNUA 3VE3A 2P7JA 2HV1A 1LSWA 1V9ZA 3G6OA 1DP8A 4XT2B 2D01A 2PD8A 4MN5A 4GHIA 2JHEA 1DRMA 1S4RA 5IS1A 1N9LA 3MJQA 3RTYA 1F9IA 4I3IA 4HH3A 5DJUA 3VOLA 4HNBA 3LYXA 4HHDA 3NOTC 3H7WA 3LIDA 4HOIA 2J80A 2ZOHA 2QHKA 1V9YA 2V0WA 3LUQA 3SW1A 4LRYC 1WA9A 3RH8B 3LIFA 3UB7A 1OTIA 3LIEA 4GHIB 4NXEA 3UB6A 4JGQA 5TBMB 3FG8A 3OLOA 4NXFA 4LRXC 2KDKA 2I9VA 4EETB 4H6JA 3PYPA 4RQ9A 1KOUA 5G4ZA 1GSWA 3MQOA 2L4RA 4I3JA 3H7WB 5EFWA 2B02A 3NHQA 1UGUA 2V9AA 3C8CA 1NWZA 4I5SA 5HDDA 1XFNA 2V1BA 1OJ5A 2A24B 3C2WA 3NOUC 1XJ3A 4HI4A 3UMDA 1S4SA 1VB6A 2R78A 1F98A 1XJ4A 1OJGA 4L9FA 5HWVA 1OTAA 4WL9A 3BWLA 1S1ZA 2VLGA 3VE4A 1OTDA 4EW7A 5HSQA 4GS9A 2K7SA 3F1NB 2PHYA 3HJKA 3UB8A 3CLOA 2QWSA 5HZHA 1XFQA 1Y28A 3LI8A 2Z6CA 1T19A 3GECA 4F3LA 3HJIA 2VEAA 1T1CA 1UWNX 2KX6A 2W27A 3CAXA 5F5YA 3GDIA 1P0ZA 1TS6A 3MQQA 1S67L 2WKQA 4HJ4A 4HP9A 1OTEA 3MR0A 2BASA 2ZOIA 3H82B 3IS2A 3LICA 4I3AA 5DKKA 4GCZA 5F68A 2PR6A 4PKYG 2EA9A 2YKFA 1X0OA 4EEPA 5G4YA 4NXBA 4WN5A 2INWA 1LT0A 5J7EA 2WKRA 3NJAA 1BYWA 3F1PA 1TS7A 2V1AA 3UMEA 3E4QA 4HP4A 4R38A 1N9NA 5HWWA 1MZUA 3LI9A 5J4EA 4GW9A 4KUOA 4BBVA 5HDSA 2W0NA 2JN7A 2OWHA 2OWJA 4K08A 3K3CA 5HD5A 1T1AA 3K3DA 4MN6A 3BY8A 5HDCA 4EQ1A 2VV7A 4EESA 2PDRA 3FC7A 2M1CA 2QKPA 4KUKA 4WLAA 5J3WA 4BBUA 4R3AA 3F1PB 1D06A 5IU1A 5DJTA 4H6JB 2OOLA 3NOPC 5HWTA 2VV6A 1T18A 4JGPA 3LIBA 3ZQ5A 1LSVA 4I39A 4NXGA 5I5LA 3CWFA 2L1MA 1LL8A 1P97A 3A0SA 3UB9A 4PKYA 3MXQA 3KX0X 2GJ3A 4I38A 2L0WA 1XJ6A 3EWKA 3BY9A 1S1YA 4LRZE 4HJ6A 4BBTA 4HQAA 4R6LA 3P7NA 2PD7A
chains in the Genus database with same CATH superfamily
3C5AA 4EBPA 4EU0A 1Q2QA 4R4RA 1TS8A 3UB5P 1DP9A 1C3BA 1YLYA 4DJ3A 4FD8A 4L9EA 1W79A 3C30A 3ZDJA 1BT5A 3IH9A 5EUAA 2JKTM 5CHJA 3RXWA 1H3QA 4IHQA 4PM6A 1ZC2A 2XEPA 2ZBBA 3IF6C 2XQZA 3EOIA 2QJ7A 4EQIA 5FEFA 3B33A 1E4DA 2A24A 3DWKA 5JYPA 2MJ6A 1ES5A 4B9OA 1DP6A 1G28A 3FKWA 4C75A 3BFCA 5JYOA 2Y2KA 4KZBA 1ES3A 1RCJA 4DMZA 3CG5A 3DAVA 5E2HA 3E4OA 1NLZA 3N8RA 3P98A 4LENA 5FQQA 3G34A 3GVBA 2QJ5A 2PR5A 1ZKJA 4DE3A 1ACFA 1YSQA 4C3QA 2EX2A 2VGKA 4MBHA 3FZCA 1PWGA 1CK3A 2XK1A 4L9GA 4LPZA 5CRFA 3BLSA 4CPKA 5AVEA 2H0TA 4KG2A 2PYPA 4EERA 3H9WA 1L0FA 4KQQA 5EVIB 5I94A 4XT2A 5F6AA 4HJ3A 2H28A 2WKPA 2HF6A 3TW8A 3ZVTA 5EM0A 1HTZA 2XA7S 4F94A 5DKLA 3VSKA 3S7QA 2E8IA 5KIZA 1GHIA 2DRWA 4LCMA 4RA7A 3MKEA 3B3XA 2QYBA 2YKHA 3BLMA 1FSYA 1DJBA 2V20A 1VEUA 5M18A 3R7WA 1H8YA 1JNUA 3TG9A 3VE3A 3EQVA 1PWDA 5EM1A 4GD6A 1V9ZA 2ZM2A 4S2NA 2WGWB 1XXMA 2JKTI 4MN5A 1O7EA 3U4LP 4ME4A 5FI2A 1DRMA 3UPPA 4IJGA 5K5BA 5DVAA 3T1XA 3PBOA 4ZTKA 4PAUA 3G2ZA 4KG5A 1FCMA 1WE4A 4E3NA 2WZZA 3HLDA 3NOTC 4OPQA 1MWSA 1FILA 1PZOA 1S6RA 2ZQAA 4BMWA 1DJAA 1I5QA 2HJEA 2V0WA 1BLCA 4P87A 3RH8B 5HARA 5HX9A 4WZ4A 1K56D 2P04A 1MXOA 1XP4A 5FQMA 2Y2JA 1E25A 1FIKA 1SZVA 2WKHA 2PBDP 3UB6A 3LEQA 3VP1A 3R4KA 5L10A 2OLUA 4EBLA 3IWIA 1ES2A 2I9VA 2O9AA 3T12B 4RQ9A 5F83A 3GRJA 5G4ZA 5CEDA 2RCXA 5EFWA 2LB5A 3QP5A 3IXGA 1L0DA 1YLJA 2W1TB 3E2KA 4KQRA 2V1BA 3HL9A 1Z09A 3IHAA 2A24B 2JE5A 4QD4A 2NUPC 1XJ3A 5DF9A 4HI4A 3UDFA 3OZHA 3RJUA 3TE8A 4ETXA 1PRQA 4KZ8A 2XF3A 2R78A 5FQKA 1F98A 1OJGA 4L9FA 5HWVA 4WL9A 4DDYA 1MBLA 4LV0A 3BWLA 1YLPA 5EVEA 4GS9A 5F1GA 4CQHA 3HJKA 3CLOA 4Q8IA 5GLBA 5FA7A 4XUZA 2JC7A 2QWSA 1SDEA 3OBFA 1XFQA 2Z6CA 1T19A 4F3LA 1IKIA 2OSUA 2O0YA 4EBNA 1S0WA 1MPLA 1T1CA 4OVDA 2W3FA 2JBFA 4X6TA 1H0MA 2J9OA 4QY5A 1TEMA 3C4PA 4BD1A 3SS5A 3UDIA 2PAVP 2ZMFA 1LLBA 5BOHA 1KGEA 4YNRA 5AQAA 1YSPA 2K2NA 1CF0A 4GN2A 5FQ9A 5FAOA 3BFDA 2HPBA 2VA0A 4PM5A 4Y3IA 2KLIA 4P6ZS 2WKEA 4QPRA 3VFHA 5CTNA 1LT0A 5J7EA 3HBRA 1JWVA 2WKRA 2P08A 3NJAA 4E3MA 3TSGA 2V1AA 3HLFA 1ALQA 4Y0UA 2FFFB 1N9NA 3Q81A 4BL2A 2C6WB 1PFLA 1K38A 4E3IA 4O8GA 1G68A 2JN7A 4UEYA 3K3CA 4X69A 5HD5A 4B4ZA 3HCYA 3BY8A 5FATA 3MSHA 4EQ1A 3I7JA 2Y4AA 2VV7A 2Y2LA 4EESA 2VGLM 2ZQDA 5E2FA 2XRNA 4WBGA 4MCWA 3MZFA 1WYCA 4OP8A 2QKPA 3HLWA 1STZA 3Q07A 4R3AA 3F1PB 1D06A 3A3FA 2QPNA 4CLCA 3ZG5A 5HWTA 2VV6A 4EWFA 3LIBA 3L9KA 2HP6A 2ZM8A 5TJJA 3ZHHA 2J9PA 4CJNA 1SKFA 5I5LA 1W8QA 4MLLA 1JWPA 3CZDA 4PKYA 3PR6A 1G6AA 1QMFA 3PBSA 3BJNA 2ZC3B 3W2ZA 4GNUA 2XH9A 1LL5A 5IT5A 2Y2MA 2J3WA 2B18A 2L0WA 5CEBA 1D1JA 1M6KA 2LB9A 3O5YA 3T1QB 3CPTA 3AGDA 4JKTA 3RXXA 4BQMA 3VP0A 1YMXA 4HQAA 3WS2A 3NCKA 3FYZA 4GS9B 1FSWA 1XJ2A 5HL6A 4E04A 5GLAA 2EFXA 4LGWA 2Y59A 5DTSA 1YAXA 3W4OA 3G4PA 3P01A 4F3LB 3Q7VA 5AQ7A 3B47A 3O87A 3PTEA 3A0VA 1PIOA 2HP9A 5FAPA 1GSVA 4R70A 4HH2A 3OOVA 5GHXA 2JCHA 4DJ2A 3QP1A 4E3JA 1XKZA 1FCOA 2IA2A 3F1OB 4GJ4A 3VMAA 5HPIA 4JGRA 4OKPA 4CLCE 1TS0A 1GSXA 2V0UA 3SH9A 5FQIA 1EROA 3ZG7B 4G3KA 5KSHA 3UE6A 3F1NA 3EEHA 2JKRM 4KQDA 1PI4A 1PWCA 4S2PA 3QP4A 4WM9A 1MKMA 5F82A 3IF5A 1E3UA 1BLPA 4JGOA 5D3OA 3T4KA 4A5RA 1K6RA 3HUMA 1W63M 1IYOA 5HD3A 1J3WA 4EXOA 1N9OA 4YWZA 1D7EA 1T1BA 1OTBA 2KOIA 5FDSA 3OPPA 4Z1WA 5CX7A 3PHYA 3WS0A 3NIAA 3BQ8A 4BWIA 1XA1A 2Z6DA 3H82A 3ITAA 3G2YA 4M4XA 4HBUA 2E8JA 2OLVA 3LIAA 3MFXA 3IF6B 3QNBA 1H8MA 2Y2QA 4UQIS 1Y4OA 3B42A 5DF8A 1Q2PA 3C7VA 4OPRA 4N9KA 2XD5A 2HV1A 3WS4A 2GDNA 2D01A 2M7VA 4EUZA 2DMWA 2Q0OA 3D9YA 3IWOA 3HLCA 1N9LA 3K2NA 3RTYA 1K25A 1K54C 3DWZA 1ZG6A 3EQUA 1PW1A 4ZJ1A 4R0QA 3CPTB 4BL3A 5CGXA 3LIDA 1IKGA 2J80A 5EECA 2ZOHA 3NBLA 4U0XA 3UN7A 2W1TA 3SW1A 3ZG8B 3IWQA 4LRYC 1WA9A 3LIFA 3NULA 3IBJA 3WWXA 3Q1FA 4Q0IA 3BQAA 2GZAA 3WS5A 2P9VA 3LIEA 3V3RA 2ZC5B 1OPXA 4GHIB 2EXBA 3IX8A 1MWUA 4JGQA 4NXEA 4NXFA 1XGIA 2JKRI 3BFEA 3FV7A 4N92A 3Q7VB 4EETB 1LL9A 4R3BA 1I2WA 1SDNA 3LEZA 1GSWA 1N4OA 3IX3A 1NY0A 3S7PA 4K91A 1BLHA 2ZC7A 1UGUA 1PYYA 1NWZA 4I5SA 3CITA 1LI9A 4XXRA 1XFNA 3MQ0A 1CJFA 2HZ5A 3BECA 1OJ5A 4K0WA 3NOUC 5EE8A 4Y2FA 5CHUA 3UMDA 1VB6A 3MS6A 4JXVA 5HPFA 4OPZA 4NETA 1XJ4A 5FASA 1OTAA 1KDSA 4RX2A 3M2JA 3Q82A 3ZG0A 5IHVA 4X68A 2IWDA 4O0PA 4YFMA 3F1NB 4LV2A 2IWBA 2H10A 3UB8A 3V39A 4WMCA 3LI8A 5EOOA 3UE3A 3GECA 3LR3A 5DTTA 2O99A 3HLGA 2VJWA 2VEAA 4BENA 1L0EA 4MEZA 3W4PA 2GNXA 1ZHHB 2W27A 5F5YA 2ACGA 4DN0A 3PBTA 1EWZA 1ES4A 3DTEA 3SH8A 4HP9A 4N1HA 4WEKA 3MR0A 2ZOIA 3H82B 2O9CA 1PW8A 1BLSA 5MC7A 4OP5A 2I72A 4BJPA 2HDUA 3N7WA 4KZ3A 4ID4A 4PKYG 2R9XA 4KZ9A 1N9BA 4S2JA 1U60A 4CLCD 4EEPA 2V2FF 2OV5A 2ZL1A 3F1PA 4BLMA 5HAQA 1TS7A 4HP4A 3DTIA 5HWWA 3GTCA 3IHBA 3IXDA 1MZUA 1DY6A 3M6HA 5HDSA 2EX8A 1NYMA 4Y5FA 1K55C 2ZQ8A 2W0NA 2OWHA 2OWJA 2HDRA 3QHYA 1SKOB 1LHYA 4KG6A 1CEFA 1MKIA 4LV3A 1MY8A 3MKFA 1JTGA 4EV4A 5FDHA 3ZVWA 3JVUA 3FC7A 1MWTA 1K57C 1A0KA 1JVJA 2M1CA 3MMHA 2NUTC 4DE0A 2P9VB 3PBNA 4BBUA 4RX3A 1IFQA 4FCFA 4S2OA 3BFFA 4GLQA 1NRFA 1TDLA 3T4QA 2ZM0A 4JGPA 4P85A 4X56A 1GHPA 1EI5A 2EX6A 4S2KA 2HDSA 2X01A 1LL8A 3A0SA 1I2SA 1YPRA 3SH7A 5L2FA 4DXBA 1KE3A 5A93A 2ZMVA 2X71A 1W7FA 1NRJA 3VOYA 1XJ6A 2UV0E 4LV1A 3PBQA 4GKUA 5EVID 3BW6A 5EVLA 3O88A 1ESIA 4BBTA 4Y13A 4R6LA 2PD7A 5A91A 3CUEC 3D72A 2R9WA 4E3LA 2Y2NA 4GB7A 3LR0A 3F1OA 4UA9A 1ESUA 1ODVA 3UNWA 3P09A 3DBAA 5A8BA 5TBMA 2WGVA 1E3UD 4EEUA 4WF0A 2XFTA 3ZG9B 5GHZA 4PPRA 4KENB 4G3VA 5L09A 1SCWA 3JYIA 3V50A 4OH0A 4GDBA 2BTFP 3IT9A 1EW0A 2W3HA 3A0RA 4Z9QA 1P9WA 4DF6A 4FOFA 4HIAA 3PAEA 1KDWA 2Y91A 3UE0A 4U0TA 2VK3A 4HY8A 1TDGA 3VV4A 1VHMA 1L3LA 1IELA 3DTKA 4WELA 1YLZA 3KYQA 2ZL1B 5KZHA 2PU4A 2DCFA 1ONHA 2W3EA 1RGZA 4ETZA 3IF6A 1JTDA 3TOIA 2Y2PA 4ZRRA 5FQJA 1SHVA 4EUVA 2XSSA 5DF7A 4D60A 3SZTA 5CGSA 4MNRA 1GA0A 3A3EA 1NJ4A 3IX4A 3T4OA 3PXPA 3D4FA 5AJGA 3W8KA 3ULFA 4FUWA 4B88A 1NZUA 3S4XA 5E2EA 4PM8A 1K56A 2WAEA 3S7OA 1H8ZA 4B4XA 4PHTA 3LGOA 3OCNA 1OT9A 1NLYA 4JBFA 3V5MA 1KVMA 4OOLA 4O01A 4KZ6A 1AWIA 4YOFA 2VGLS 4QU3A 2P7JA 5F1FA 4Y0OA 4ESPA 4IVKA 4KQOA 2GX5A 2PD8A 4GHIA 2J8YA 1IYSA 4UHUA 2Y2GA 4ZAMA 1F9IA 4QB8A 4I3IA 4FSFA 5DFYA 3MF0A 4HNBA 3LYXA 5L8MA 2HDQA 2XD1A 3CMZA 4PM7A 3PBRA 2WADA 2QHKA 4IEDA 5C5KA 3W4QA 3UB7A 1KGGA 2UWXA 3MZDA 4H8RA 1VETB 1KE4A 1HZOA 5TBMB 3FG8A 3OLOA 4OONA 1IEMA 1CI8A 3IXBA 5CXWA 4PM9A 2VGJA 4Y17A 3KSIA 4H6JA 3PYPA 1KOUA 2VX8A 3SOIA 4ZJ2A 4I3JA 3BM6A 3H7WB 4NK3A 3NHQA 4FH2A 3C8CA 4UAAA 3N4IA 3C2WA 5DTKA 5DFXA 2AVXA 3FWLA 1HD8A 4LCLA 3OPLA 2RL3A 3DTMA 2BLSA 1XA7A 2XR0A 2FH5A 4ZDXA 1K6SA 3T4TA 3T1SA 3MXSA 1CI9A 1O07A 1BSGA 2C5WB 1S1ZA 1M40A 1AXBA 3VE4A 4NEED 2WGIA 3GV9A 5J8XA 2K7SA 5GL9A 4PMAA 2W3GA 4P0MA 2HP5A 5AQ9A 1NXYA 4R3JA 3Q7ZA 1K55A 5M1AA 1Y28A 4HESA 1VM1A 4X53A 3HJIA 5CHMA 4WZ5C 2Y2OA 3IH8A 1UWNX 2HJ9C 2KX6A 2Q9NA 3A3IA 3CAXA 3OC2A 3GDIA 2J3TD 1TS6A 4U3TA 2WKQA 1K57A 3OPHA 3KYEA 1BULA 3VP3A 2ZJ9A 1OTEA 1YKDA 2BASA 5CERA 2Z2MB 5E2GA 3IS2A 1G5UA 4I3AA 5DKKA 4JXWA 2ZC4B 5F68A 3EGDC 5FEGA 1SKOA 2PR6A 3D3OA 2EXAA 2EA9A 5LBRA 4DE2A 3ZNTA 2ZD8A 4AFIA 4X55A 4X25A 1X0OA 2OAP1 4NXBA 4B93A 4WN5A 4CLCC 1BYWA 3LCEA 3UMEA 3LR4A 4OLGA 3CJMA 3N8SA 4R38A 3V67A 3LI9A 4BBVA 2XA7M 1GA9A 4MBKA 4QWOA 4K08A 2Q9MA 1G6OA 3S1YA 4ARZA 3CUEA 4WEJA 1T1AA 2A2LA 2EWWA 3K3DA 4MN6A 3UDXA 2V8FA 2G7UA 2Y55A 4GZBA 2PDRA 4L0LA 5U47A 5J3WA 2XLNA 1YMSA 4OQHA 3EEAA 2G2WA 4OQ0A 3CHWP 5EPHA 4II7A 4H6JB 2OOLA 3NOPC 1T18A 4Q0HA 2B5RA 4UA7A 1LSVA 4I39A 4NXGA 2JKGA 2QZ6A 1KE0A 3HUOA 2L1MA 1P97A 1FR1A 3UB9A 5GLDA 4KZ7A 1IYPA 2W1RA 2WAFA 3MXQA 2PU2A 2HGVA 4OQIA 1K4FA 3BY9A 1DJCA 1XGJA 1S1YA 4LRZE 1RP5A 3ITBA 4DDSA 1ZG4A 3P7NA 3BEBA 5EVIC 5TFQA 3TRCA 3U2AA 3IBRA 2JKFA 2H5SA 3C38A 1OT6A 1FCNA 5GLCA 3TJZC 5A90A 2FFYA 3GSGA 2VKSA 5AVFA 2VZWA 3WS1A 5HW3A 1S66L 4DE1A 3A3JA 4IBRA 3QP2A 1LSXA 4DXCA 5F69A 2PRFA 3G30A 3GR2A 3ZYTA 3HUNA 4GD8A 4JF5A 1YLWA 3AGFA 1W5DA 3O3VA 3KYZA 2CMNA 2PYRA 1VQQA 4QY6A 4JF6A 5CGWA 4S2IA 3PAGA 3UPOA 1YM1A 3IS2B 2D02A 1BZAA 1UWPX 3NY4A 4E6XA 5FI7A 4N1XA 3OCLA 2VV8A 3VP4A 1LI0A 3BRMA 3N8LA 4UA6A 1QMEA 3KO6A 4LLOB 1RGYA 2ZQ9A 3E2LA 4JXGA 3E0YA 5TR7A 5FL3A 3E4PA 4MDZA 1W63Q 2WYXA 4QJGA 3T4SA 3IQAA 1MWRA 2IWCA 1J9MA 5FI6A 3UE1A 4ARZB 3NDEA 4Y0TA 4WYYA 3T50A 3HLBA 3ICYA 1F5MA 1L0GA 1KVLA 5FAQA 4D2OA 4P6ZM 4WUJA 3MXRA 4KZ4A 4JF4A 3QP8A 4OQGA 4M3KA 5HAPA 4BD0A 4R23A 1L2SA 1XPBA 3KSHA 4X1LA 3G31A 3AGEA 3NI9A 1LSWA 3G6OA 2ZMAA 3EGXC 3LFVA 1OMEA 1DP8A 4XT2B 2Y79A 1Z6FA 1VETA 2WUQA 2JHEA 4QHCA 4S2LA 4Y7PA 1S4RA 2DNSA 2ZC6B 4ZBEA 5IS1A 1NYYA 2XFSA 3ZGAB 3MJQA 4HH3A 5DJUA 2G2UA 2PBYA 1W8YA 3VOLA 3FKVA 2EX9A 4HHDA 2OAQ1 2XROA 2W3DA 3H7WA 1FQGA 4IUHA 2M7UA 4HOIA 5HAIA 1ZTUA 3LUQA 1V9YA 1VEUB 2H0YA 4O7DA 3R7WB 1HVBA 2ZLYA 4IBXA 1YT4A 2BG1A 5E43A 3ZCZA 4NKPA 1OTIA 1YQSA 1ERMA 1BUEA 4E6WA 3ISGA 1BTLA 1KGFA 5AQBA 4WZ5A 4X1MA 1PNEA 1CEGA 4RVAA 4LRXC 1H5XA 2KDKA 3UPNA 4HEFA 3VP2A 3MQOA 1YLTA 3T4LA 2L4RA 3ZNYA 1F2KA 3JVVA 1TF1A 1K54A 1XX2A 2B02A 3HVFA 3LY4A 2V9AA 3BYDA 5A92A 1PZPA 5HDDA 2X02A 4IUKA 4S2NC 1Y54A 2P74A 1IYQA 2EWVA 5EV0A 3QNCA 3T1RA 3JPUA 4GOGA 1S4SA 2Z2LB 3FPVA 3MZEA 3MBZA 2ZQ7A 3C4OA 2WZXA 3ZFZA 4OPYA 3HREA 2WKIA 1NZOA 5KSCA 2Y8HA 4OOMA 5HFOA 2VLGA 3G35A 1OTDA 4FTXA 4JLFA 4EW7A 5HSQA 3RFBA 5GHYA 4R4SA 2PHYA 2Y2HA 5CECA 5M19A 3M6BA 4G3WA 4C6YA 5HZHA 4GDNA 3MFDA 4JPMA 5FSRA 1K4EA 4E3OA 1WYBA 4R1GA 4N9LA 2V8CA 3GMWA 4P6BA 3GQZA 3O86A 3M2KA 1P0ZA 3MQQA 5L07A 2K31A 1S67L 4RYEA 1GHMA 4HJ4A 2J3TC 4K0XA 2J7VA 2O9BA 5G18A 4XUXA 2A49A 1IOUA 3SS3A 3LICA 4GCZA 3UO9A 3VFFA 3LY3A 3KSFA 2A3UA 4E3KA 2V1ZA 2YKFA 4MMNA 2CC1A 5G4YA 3NC8A 3OPRA 2INWA 1ONGA 1GCEA 3C7UA 3WRTA 3NDGA 3LO7A 3E4QA 2ZQCA 1TD5A 2EFUA 4DKIA 3V3SA 4WMCD 3L7HA 4FH4A 5J4EA 4GW9A 2FZ0A 4KUOA 3E98A 1JWZA 5EVIA 1TVFA 2Y2IA 2XDMA 4OLDA 3VOZA 4Q0JA 3IXHA 3KSGA 3T4JA 3NECA 5HDCA 4UQIM 4IVIA 4HBTA 5CTMA 3LR5A 4KUKA 4WLAA 1FOFA 3CI6A 1MC0A 5KMWA 1P9RA 2B95A 4S2MA 4KZ5A 5IU1A 2WK0A 1ERQA 4OOYA 5DJTA 3S7NA 4NG2A 3S22A 2QMIA 4MN7A 3ZQ5A 4MBFA 3G32A 3SS4A 5TGFA 4DRTA 2WGWA 3BFGA 3CWFA 3VSLA 1PI5A 1CQAA 4JXSA 3KX0X 1FR6A 2GJ3A 3UY6A 4I38A 4Y15A 2XGNA 5EOEA 1K0KA 4YINA 1HLUP 3EWKA 4LFUA 3A3DA 3FPWA 3DW0A 4KZAA 2PT7A 3WRZA 4HJ6A 4ZJ3A 3QP6A 5HL1A 4CLCB 3N6IA 3HLEA
chains in the Genus database with same CATH topology
3U2AA 3CUEC 3IBRA 3D72A 4GS9B 1XJ2A 5HL6A 3C38A 1OT6A 4EU0A 3TJZC 4E04A 3LR0A 1TS8A 3F1OA 1DP9A 4DJ3A 2VKSA 1ODVA 4L9EA 5AVFA 3DBAA 5A8BA 5TBMA 1YAXA 3C30A 2VZWA 3P01A 1S66L 4F3LB 3B47A 4EEUA 2JKTM 1LSXA 4WF0A 1H3QA 3A0VA 4IHQA 5F69A 4G3VA 2ZBBA 1GSVA 3ZYTA 4R70A 4HH2A 3EOIA 3OOVA 2QJ7A 3KYZA 2CMNA 2PYRA 1EW0A 2W3HA 3B33A 2A24A 3A0RA 4DJ2A 2MJ6A 4B9OA 1DP6A 1G28A 2IA2A 1P9WA 3IS2B 2D02A 4FOFA 4HIAA 3F1OB 4GJ4A 5HPIA 1UWPX 4JGRA 4CLCE 1TS0A 4DMZA 1GSXA 3OCLA 3E4OA 2V0UA 1NLZA 2VV8A 4G3KA 5KSHA 2QJ5A 4HY8A 3VV4A 1VHMA 2PR5A 3UE6A 4WELA 3F1NA 3EEHA 3KO6A 4LLOB 2JKRM 1YSQA 4KQDA 3KYQA 3E0YA 1MKMA 5FL3A 3E4PA 2W3EA 4L9GA 4MDZA 4ETZA 1W63Q 4LPZA 4JGOA 3T4KA 4ZRRA 3T4SA 1W63M 4EUVA 5HD3A 2XSSA 5AVEA 2PYPA 4EXOA 1N9OA 4YWZA 4EERA 3H9WA 1D7EA 3T4OA 1T1BA 3PXPA 1OTBA 4XT2A 5AJGA 5F6AA 4ARZB 2KOIA 4HJ3A 2H28A 4Z1WA 5CX7A 3T50A 3ULFA 2WKPA 3PHYA 2HF6A 3TW8A 3BQ8A 1F5MA 3ICYA 4BWIA 4P6ZM 4WUJA 3S7OA 2XA7S 4PHTA 2Z6DA 3H82A 3OCNA 5DKLA 3S7QA 5KIZA 1OT9A 1NLYA 2QYBA 2YKHA 4M4XA 3LIAA 3MFXA 4OOLA 1H8MA 4O01A 3R7WA 1JNUA 3KSHA 4UQIS 4YOFA 3VE3A 2VGLS 3B42A 2P7JA 3EQVA 2HV1A 1LSWA 1V9ZA 3G6OA 3EGXC 3LFVA 1DP8A 4XT2B 2Y79A 2D01A 2JKTI 2GX5A 4KQOA 2PD8A 2M7VA 4MN5A 4ME4A 4GHIA 2JHEA 2DMWA 1DRMA 1S4RA 5IS1A 4IJGA 1N9LA 5K5BA 3MJQA 3K2NA 3RTYA 1F9IA 4I3IA 3PBOA 4HH3A 4PAUA 4FSFA 5DJUA 3VOLA 5DFYA 3MF0A 3EQUA 4HNBA 3LYXA 4HHDA 3NOTC 2OAQ1 5L8MA 2XROA 2W3DA 3H7WA 4IUHA 4BMWA 2M7UA 3LIDA 3PBRA 2HJEA 4HOIA 1ZTUA 2J80A 2ZOHA 2QHKA 1V9YA 2V0WA 2W1TA 3LUQA 3SW1A 3R7WB 4LRYC 1WA9A 5C5KA 3RH8B 3LIFA 3IBJA 3UB7A 2P04A 4Q0IA 3BQAA 2GZAA 4NKPA 1OTIA 3LIEA 1OPXA 4GHIB 4NXEA 3UB6A 4JGQA 5TBMB 3FG8A 3OLOA 3R4KA 4NXFA 2JKRI 4LRXC 3KSIA 2KDKA 2I9VA 4EETB 2O9AA 4H6JA 3PYPA 4RQ9A 1KOUA 2VX8A 5G4ZA 1GSWA 3MQOA 3T4LA 2L4RA 4I3JA 3H7WB 3JVVA 5EFWA 1TF1A 2LB5A 2B02A 3S7PA 3NHQA 1UGUA 2V9AA 3C8CA 1NWZA 4I5SA 3CITA 2W1TB 5HDDA 1XFNA 4IUKA 3MQ0A 2V1BA 1OJ5A 2A24B 3C2WA 2EWVA 3NOUC 4Y2FA 2NUPC 5DFXA 1XJ3A 5DF9A 4HI4A 3TE8A 4ETXA 3UMDA 1S4SA 1VB6A 3FPVA 2R78A 2FH5A 1F98A 5HPFA 3T4TA 1XJ4A 1OJGA 4L9FA 5HWVA 1OTAA 4WL9A 3BWLA 2Y8HA 4OOMA 1S1ZA 2VLGA 3VE4A 1OTDA 4NEED 4EW7A 5HSQA 3RFBA 4GS9A 4O0PA 2K7SA 3F1NB 2PHYA 4CQHA 3HJKA 2W3GA 3UB8A 3CLOA 4G3WA 2QWSA 5HZHA 3OBFA 1XFQA 3LI8A 1Y28A 2Z6CA 1T19A 3UE3A 3GECA 4F3LA 3LR3A 3HJIA 2O0YA 2O99A 2VJWA 2VEAA 1T1CA 2W3FA 1UWNX 2HJ9C 2GNXA 2KX6A 1ZHHB 2W27A 3CAXA 3OC2A 5F5YA 3GDIA 2J3TD 1P0ZA 1TS6A 3MQQA 4DN0A 2K31A 3PBTA 1S67L 2WKQA 4HJ4A 2J3TC 4HP9A 2O9BA 1OTEA 2ZMFA 4WEKA 1YKDA 3MR0A 2BASA 2ZOIA 3H82B 2O9CA 1IOUA 3IS2A 5MC7A 3LICA 4I3AA 4YNRA 5DKKA 1YSPA 4GCZA 5F68A 4BJPA 3EGDC 2K2NA 2PR6A 3KSFA 3D3OA 2VA0A 4PKYG 2EA9A 4Y3IA 5LBRA 2KLIA 4P6ZS 4AFIA 4CLCD 2YKFA 1X0OA 4MMNA 4EEPA 5G4YA 4QPRA 2OAP1 4NXBA 4B93A 4WN5A 2INWA 1LT0A 5J7EA 4CLCC 2WKRA 2P08A 3NJAA 1BYWA 3F1PA 1TS7A 2V1AA 3UMEA 3E4QA 3LR4A 4HP4A 4R38A 1TD5A 1N9NA 5HWWA 3V67A 1MZUA 3LI9A 5J4EA 4GW9A 2FZ0A 2XA7M 4KUOA 4O8GA 5HDSA 4BBVA 3E98A 4Y5FA 2W0NA 2JN7A 2OWHA 2OWJA 4K08A 4UEYA 1G6OA 3K3CA 4ARZA 5HD5A 3CUEA 4WEJA 4Q0JA 1T1AA 2A2LA 3HCYA 3KSGA 2EWWA 3T4JA 3K3DA 4MN6A 3BY8A 2G7UA 5HDCA 4EQ1A 4UQIM 2VV7A 4EESA 2VGLM 2PDRA 4L0LA 2XRNA 3JVUA 3FC7A 4MCWA 3LR5A 2M1CA 3MMHA 2QKPA 4KUKA 2NUTC 1STZA 4WLAA 5J3WA 3PBNA 3EEAA 3CI6A 1MC0A 4R3AA 3F1PB 4BBUA 1IFQA 1P9RA 1D06A 5IU1A 3S7NA 5DJTA 4II7A 4CLCA 4GLQA 4H6JB 2OOLA 3NOPC 5HWTA 3T4QA 2VV6A 1T18A 4JGPA 4MN7A 4Q0HA 3LIBA 3ZQ5A 1LSVA 5TJJA 4I39A 4NXGA 5I5LA 3CWFA 2L1MA 1LL8A 1P97A 3A0SA 3UB9A 4PKYA 3PR6A 3PBSA 2W1RA 3BJNA 3W2ZA 5IT5A 3MXQA 2ZMVA 2J3WA 3KX0X 2GJ3A 2HGVA 2B18A 1NRJA 4I38A 2L0WA 2LB9A 3O5YA 1XJ6A 3EWKA 3BY9A 3FPWA 3PBQA 1S1YA 2PT7A 4LRZE 3BW6A 4HJ6A 4BBTA 4HQAA 4R6LA 4CLCB 3P7NA 2PD7A 3TRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IBR A;  3D72 A;  4GS9 B;  1XJ2 A;  1OT6 A;  4E04 A;  1TS8 A;  3F1O A;  1DP9 A;  4DJ3 A;  1ODV A;  4L9E A;  5AVF A;  5A8B A;  5TBM A;  1S66 L;  4F3L B;  4EEU A;  1LSX A;  4WF0 A;  3A0V A;  5F69 A;  2ZBB A;  1GSV A;  4R70 A;  4HH2 A;  2QJ7 A;  2CMN A;  2PYR A;  1EW0 A;  3B33 A;  2A24 A;  3A0R A;  4DJ2 A;  4B9O A;  1DP6 A;  1G28 A;  3IS2 B;  2D02 A;  4HIA A;  3F1O B;  1UWP X;  4JGR A;  1TS0 A;  1GSX A;  3E4O A;  2V0U A;  2VV8 A;  2QJ5 A;  4HY8 A;  2PR5 A;  3UE6 A;  3F1N A;  3EEH A;  4LLO B;  4KQD A;  3E4P A;  4L9G A;  4LPZ A;  4JGO A;  5HD3 A;  5AVE A;  2PYP A;  4EXO A;  1N9O A;  4YWZ A;  4EER A;  3H9W A;  1D7E A;  1T1B A;  1OTB A;  4XT2 A;  5F6A A;  4HJ3 A;  2H28 A;  3ULF A;  3T50 A;  3PHY A;  2WKP A;  3ICY A;  4WUJ A;  2Z6D A;  3H82 A;  5DKL A;  5KIZ A;  1OT9 A;  2YKH A;  4M4X A;  3LIA A;  3MFX A;  1JNU A;  3VE3 A;  2P7J A;  2HV1 A;  1LSW A;  1V9Z A;  3G6O A;  1DP8 A;  4XT2 B;  2D01 A;  2PD8 A;  4MN5 A;  4GHI A;  2JHE A;  1DRM A;  1S4R A;  5IS1 A;  1N9L A;  3MJQ A;  3RTY A;  1F9I A;  4I3I A;  4HH3 A;  5DJU A;  3VOL A;  4HNB A;  3LYX A;  4HHD A;  3NOT C;  3H7W A;  3LID A;  4HOI A;  2J80 A;  2ZOH A;  2QHK A;  1V9Y A;  2V0W A;  3LUQ A;  3SW1 A;  4LRY C;  1WA9 A;  3RH8 B;  3LIF A;  3UB7 A;  1OTI A;  3LIE A;  4GHI B;  4NXE A;  3UB6 A;  4JGQ A;  5TBM B;  3FG8 A;  3OLO A;  4NXF A;  4LRX C;  2KDK A;  2I9V A;  4EET B;  4H6J A;  3PYP A;  4RQ9 A;  1KOU A;  5G4Z A;  1GSW A;  3MQO A;  2L4R A;  4I3J A;  3H7W B;  5EFW A;  2B02 A;  3NHQ A;  1UGU A;  2V9A A;  3C8C A;  1NWZ A;  4I5S A;  5HDD A;  1XFN A;  2V1B A;  1OJ5 A;  2A24 B;  3C2W A;  3NOU C;  1XJ3 A;  4HI4 A;  3UMD A;  1S4S A;  1VB6 A;  2R78 A;  1F98 A;  1XJ4 A;  1OJG A;  4L9F A;  5HWV A;  1OTA A;  4WL9 A;  3BWL A;  1S1Z A;  2VLG A;  3VE4 A;  1OTD A;  4EW7 A;  5HSQ A;  4GS9 A;  2K7S A;  3F1N B;  2PHY A;  3HJK A;  3UB8 A;  3CLO A;  2QWS A;  5HZH A;  1XFQ A;  1Y28 A;  3LI8 A;  2Z6C A;  1T19 A;  3GEC A;  4F3L A;  3HJI A;  2VEA A;  1T1C A;  1UWN X;  2KX6 A;  2W27 A;  3CAX A;  5F5Y A;  3GDI A;  1P0Z A;  1TS6 A;  3MQQ A;  1S67 L;  2WKQ A;  4HJ4 A;  4HP9 A;  1OTE A;  3MR0 A;  2BAS A;  2ZOI A;  3H82 B;  3IS2 A;  3LIC A;  4I3A A;  5DKK A;  4GCZ A;  5F68 A;  2PR6 A;  4PKY G;  2EA9 A;  2YKF A;  1X0O A;  4EEP A;  5G4Y A;  4NXB A;  4WN5 A;  2INW A;  1LT0 A;  5J7E A;  2WKR A;  3NJA A;  1BYW A;  3F1P A;  1TS7 A;  2V1A A;  3UME A;  3E4Q A;  4HP4 A;  4R38 A;  1N9N A;  5HWW A;  1MZU A;  3LI9 A;  5J4E A;  4GW9 A;  4KUO A;  4BBV A;  5HDS A;  2W0N A;  2JN7 A;  2OWH A;  2OWJ A;  4K08 A;  3K3C A;  5HD5 A;  1T1A A;  3K3D A;  4MN6 A;  3BY8 A;  5HDC A;  4EQ1 A;  2VV7 A;  4EES A;  2PDR A;  3FC7 A;  2M1C A;  2QKP A;  4KUK A;  4WLA A;  5J3W A;  4BBU A;  4R3A A;  3F1P B;  1D06 A;  5IU1 A;  5DJT A;  4H6J B;  2OOL A;  3NOP C;  5HWT A;  2VV6 A;  1T18 A;  4JGP A;  3LIB A;  3ZQ5 A;  1LSV A;  4I39 A;  4NXG A;  5I5L A;  3CWF A;  2L1M A;  1LL8 A;  1P97 A;  3A0S A;  3UB9 A;  4PKY A;  3MXQ A;  3KX0 X;  2GJ3 A;  4I38 A;  2L0W A;  1XJ6 A;  3EWK A;  3BY9 A;  1S1Y A;  4LRZ E;  4HJ6 A;  4BBT A;  4HQA A;  4R6L A;  3P7N A;  2PD7 A; 
#chains in the Genus database with same CATH topology
 3C5A A;  4EBP A;  4EU0 A;  1Q2Q A;  4R4R A;  1TS8 A;  3UB5 P;  1DP9 A;  1C3B A;  1YLY A;  4DJ3 A;  4FD8 A;  4L9E A;  1W79 A;  3C30 A;  3ZDJ A;  1BT5 A;  3IH9 A;  5EUA A;  2JKT M;  5CHJ A;  3RXW A;  1H3Q A;  4IHQ A;  4PM6 A;  1ZC2 A;  2XEP A;  2ZBB A;  3IF6 C;  2XQZ A;  3EOI A;  2QJ7 A;  4EQI A;  5FEF A;  3B33 A;  1E4D A;  2A24 A;  3DWK A;  5JYP A;  2MJ6 A;  1ES5 A;  4B9O A;  1DP6 A;  1G28 A;  3FKW A;  4C75 A;  3BFC A;  5JYO A;  2Y2K A;  4KZB A;  1ES3 A;  1RCJ A;  4DMZ A;  3CG5 A;  3DAV A;  5E2H A;  3E4O A;  1NLZ A;  3N8R A;  3P98 A;  4LEN A;  5FQQ A;  3G34 A;  3GVB A;  2QJ5 A;  2PR5 A;  1ZKJ A;  4DE3 A;  1ACF A;  1YSQ A;  4C3Q A;  2EX2 A;  2VGK A;  4MBH A;  3FZC A;  1PWG A;  1CK3 A;  2XK1 A;  4L9G A;  4LPZ A;  5CRF A;  3BLS A;  4CPK A;  5AVE A;  2H0T A;  4KG2 A;  2PYP A;  4EER A;  3H9W A;  1L0F A;  4KQQ A;  5EVI B;  5I94 A;  4XT2 A;  5F6A A;  4HJ3 A;  2H28 A;  2WKP A;  2HF6 A;  3TW8 A;  3ZVT A;  5EM0 A;  1HTZ A;  2XA7 S;  4F94 A;  5DKL A;  3VSK A;  3S7Q A;  2E8I A;  5KIZ A;  1GHI A;  2DRW A;  4LCM A;  4RA7 A;  3MKE A;  3B3X A;  2QYB A;  2YKH A;  3BLM A;  1FSY A;  1DJB A;  2V20 A;  1VEU A;  5M18 A;  3R7W A;  1H8Y A;  1JNU A;  3TG9 A;  3VE3 A;  3EQV A;  1PWD A;  5EM1 A;  4GD6 A;  1V9Z A;  2ZM2 A;  4S2N A;  2WGW B;  1XXM A;  2JKT I;  4MN5 A;  1O7E A;  3U4L P;  4ME4 A;  5FI2 A;  1DRM A;  3UPP A;  4IJG A;  5K5B A;  5DVA A;  3T1X A;  3PBO A;  4ZTK A;  4PAU A;  3G2Z A;  4KG5 A;  1FCM A;  1WE4 A;  4E3N A;  2WZZ A;  3HLD A;  3NOT C;  4OPQ A;  1MWS A;  1FIL A;  1PZO A;  1S6R A;  2ZQA A;  4BMW A;  1DJA A;  1I5Q A;  2HJE A;  2V0W A;  1BLC A;  4P87 A;  3RH8 B;  5HAR A;  5HX9 A;  4WZ4 A;  1K56 D;  2P04 A;  1MXO A;  1XP4 A;  5FQM A;  2Y2J A;  1E25 A;  1FIK A;  1SZV A;  2WKH A;  2PBD P;  3UB6 A;  3LEQ A;  3VP1 A;  3R4K A;  5L10 A;  2OLU A;  4EBL A;  3IWI A;  1ES2 A;  2I9V A;  2O9A A;  3T12 B;  4RQ9 A;  5F83 A;  3GRJ A;  5G4Z A;  5CED A;  2RCX A;  5EFW A;  2LB5 A;  3QP5 A;  3IXG A;  1L0D A;  1YLJ A;  2W1T B;  3E2K A;  4KQR A;  2V1B A;  3HL9 A;  1Z09 A;  3IHA A;  2A24 B;  2JE5 A;  4QD4 A;  2NUP C;  1XJ3 A;  5DF9 A;  4HI4 A;  3UDF A;  3OZH A;  3RJU A;  3TE8 A;  4ETX A;  1PRQ A;  4KZ8 A;  2XF3 A;  2R78 A;  5FQK A;  1F98 A;  1OJG A;  4L9F A;  5HWV A;  4WL9 A;  4DDY A;  1MBL A;  4LV0 A;  3BWL A;  1YLP A;  5EVE A;  4GS9 A;  5F1G A;  4CQH A;  3HJK A;  3CLO A;  4Q8I A;  5GLB A;  5FA7 A;  4XUZ A;  2JC7 A;  2QWS A;  1SDE A;  3OBF A;  1XFQ A;  2Z6C A;  1T19 A;  4F3L A;  1IKI A;  2OSU A;  2O0Y A;  4EBN A;  1S0W A;  1MPL A;  1T1C A;  4OVD A;  2W3F A;  2JBF A;  4X6T A;  1H0M A;  2J9O A;  4QY5 A;  1TEM A;  3C4P A;  4BD1 A;  3SS5 A;  3UDI A;  2PAV P;  2ZMF A;  1LLB A;  5BOH A;  1KGE A;  4YNR A;  5AQA A;  1YSP A;  2K2N A;  1CF0 A;  4GN2 A;  5FQ9 A;  5FAO A;  3BFD A;  2HPB A;  2VA0 A;  4PM5 A;  4Y3I A;  2KLI A;  4P6Z S;  2WKE A;  4QPR A;  3VFH A;  5CTN A;  1LT0 A;  5J7E A;  3HBR A;  1JWV A;  2WKR A;  2P08 A;  3NJA A;  4E3M A;  3TSG A;  2V1A A;  3HLF A;  1ALQ A;  4Y0U A;  2FFF B;  1N9N A;  3Q81 A;  4BL2 A;  2C6W B;  1PFL A;  1K38 A;  4E3I A;  4O8G A;  1G68 A;  2JN7 A;  4UEY A;  3K3C A;  4X69 A;  5HD5 A;  4B4Z A;  3HCY A;  3BY8 A;  5FAT A;  3MSH A;  4EQ1 A;  3I7J A;  2Y4A A;  2VV7 A;  2Y2L A;  4EES A;  2VGL M;  2ZQD A;  5E2F A;  2XRN A;  4WBG A;  4MCW A;  3MZF A;  1WYC A;  4OP8 A;  2QKP A;  3HLW A;  1STZ A;  3Q07 A;  4R3A A;  3F1P B;  1D06 A;  3A3F A;  2QPN A;  4CLC A;  3ZG5 A;  5HWT A;  2VV6 A;  4EWF A;  3LIB A;  3L9K A;  2HP6 A;  2ZM8 A;  5TJJ A;  3ZHH A;  2J9P A;  4CJN A;  1SKF A;  5I5L A;  1W8Q A;  4MLL A;  1JWP A;  3CZD A;  4PKY A;  3PR6 A;  1G6A A;  1QMF A;  3PBS A;  3BJN A;  2ZC3 B;  3W2Z A;  4GNU A;  2XH9 A;  1LL5 A;  5IT5 A;  2Y2M A;  2J3W A;  2B18 A;  2L0W A;  5CEB A;  1D1J A;  1M6K A;  2LB9 A;  3O5Y A;  3T1Q B;  3CPT A;  3AGD A;  4JKT A;  3RXX A;  4BQM A;  3VP0 A;  1YMX A;  4HQA A;  3WS2 A;  3NCK A;  3FYZ A;  4GS9 B;  1FSW A;  1XJ2 A;  5HL6 A;  4E04 A;  5GLA A;  2EFX A;  4LGW A;  2Y59 A;  5DTS A;  1YAX A;  3W4O A;  3G4P A;  3P01 A;  4F3L B;  3Q7V A;  5AQ7 A;  3B47 A;  3O87 A;  3PTE A;  3A0V A;  1PIO A;  2HP9 A;  5FAP A;  1GSV A;  4R70 A;  4HH2 A;  3OOV A;  5GHX A;  2JCH A;  4DJ2 A;  3QP1 A;  4E3J A;  1XKZ A;  1FCO A;  2IA2 A;  3F1O B;  4GJ4 A;  3VMA A;  5HPI A;  4JGR A;  4OKP A;  4CLC E;  1TS0 A;  1GSX A;  2V0U A;  3SH9 A;  5FQI A;  1ERO A;  3ZG7 B;  4G3K A;  5KSH A;  3UE6 A;  3F1N A;  3EEH A;  2JKR M;  4KQD A;  1PI4 A;  1PWC A;  4S2P A;  3QP4 A;  4WM9 A;  1MKM A;  5F82 A;  3IF5 A;  1E3U A;  1BLP A;  4JGO A;  5D3O A;  3T4K A;  4A5R A;  1K6R A;  3HUM A;  1W63 M;  1IYO A;  5HD3 A;  1J3W A;  4EXO A;  1N9O A;  4YWZ A;  1D7E A;  1T1B A;  1OTB A;  2KOI A;  5FDS A;  3OPP A;  4Z1W A;  5CX7 A;  3PHY A;  3WS0 A;  3NIA A;  3BQ8 A;  4BWI A;  1XA1 A;  2Z6D A;  3H82 A;  3ITA A;  3G2Y A;  4M4X A;  4HBU A;  2E8J A;  2OLV A;  3LIA A;  3MFX A;  3IF6 B;  3QNB A;  1H8M A;  2Y2Q A;  4UQI S;  1Y4O A;  3B42 A;  5DF8 A;  1Q2P A;  3C7V A;  4OPR A;  4N9K A;  2XD5 A;  2HV1 A;  3WS4 A;  2GDN A;  2D01 A;  2M7V A;  4EUZ A;  2DMW A;  2Q0O A;  3D9Y A;  3IWO A;  3HLC A;  1N9L A;  3K2N A;  3RTY A;  1K25 A;  1K54 C;  3DWZ A;  1ZG6 A;  3EQU A;  1PW1 A;  4ZJ1 A;  4R0Q A;  3CPT B;  4BL3 A;  5CGX A;  3LID A;  1IKG A;  2J80 A;  5EEC A;  2ZOH A;  3NBL A;  4U0X A;  3UN7 A;  2W1T A;  3SW1 A;  3ZG8 B;  3IWQ A;  4LRY C;  1WA9 A;  3LIF A;  3NUL A;  3IBJ A;  3WWX A;  3Q1F A;  4Q0I A;  3BQA A;  2GZA A;  3WS5 A;  2P9V A;  3LIE A;  3V3R A;  2ZC5 B;  1OPX A;  4GHI B;  2EXB A;  3IX8 A;  1MWU A;  4JGQ A;  4NXE A;  4NXF A;  1XGI A;  2JKR I;  3BFE A;  3FV7 A;  4N92 A;  3Q7V B;  4EET B;  1LL9 A;  4R3B A;  1I2W A;  1SDN A;  3LEZ A;  1GSW A;  1N4O A;  3IX3 A;  1NY0 A;  3S7P A;  4K91 A;  1BLH A;  2ZC7 A;  1UGU A;  1PYY A;  1NWZ A;  4I5S A;  3CIT A;  1LI9 A;  4XXR A;  1XFN A;  3MQ0 A;  1CJF A;  2HZ5 A;  3BEC A;  1OJ5 A;  4K0W A;  3NOU C;  5EE8 A;  4Y2F A;  5CHU A;  3UMD A;  1VB6 A;  3MS6 A;  4JXV A;  5HPF A;  4OPZ A;  4NET A;  1XJ4 A;  5FAS A;  1OTA A;  1KDS A;  4RX2 A;  3M2J A;  3Q82 A;  3ZG0 A;  5IHV A;  4X68 A;  2IWD A;  4O0P A;  4YFM A;  3F1N B;  4LV2 A;  2IWB A;  2H10 A;  3UB8 A;  3V39 A;  4WMC A;  3LI8 A;  5EOO A;  3UE3 A;  3GEC A;  3LR3 A;  5DTT A;  2O99 A;  3HLG A;  2VJW A;  2VEA A;  4BEN A;  1L0E A;  4MEZ A;  3W4P A;  2GNX A;  1ZHH B;  2W27 A;  5F5Y A;  2ACG A;  4DN0 A;  3PBT A;  1EWZ A;  1ES4 A;  3DTE A;  3SH8 A;  4HP9 A;  4N1H A;  4WEK A;  3MR0 A;  2ZOI A;  3H82 B;  2O9C A;  1PW8 A;  1BLS A;  5MC7 A;  4OP5 A;  2I72 A;  4BJP A;  2HDU A;  3N7W A;  4KZ3 A;  4ID4 A;  4PKY G;  2R9X A;  4KZ9 A;  1N9B A;  4S2J A;  1U60 A;  4CLC D;  4EEP A;  2V2F F;  2OV5 A;  2ZL1 A;  3F1P A;  4BLM A;  5HAQ A;  1TS7 A;  4HP4 A;  3DTI A;  5HWW A;  3GTC A;  3IHB A;  3IXD A;  1MZU A;  1DY6 A;  3M6H A;  5HDS A;  2EX8 A;  1NYM A;  4Y5F A;  1K55 C;  2ZQ8 A;  2W0N A;  2OWH A;  2OWJ A;  2HDR A;  3QHY A;  1SKO B;  1LHY A;  4KG6 A;  1CEF A;  1MKI A;  4LV3 A;  1MY8 A;  3MKF A;  1JTG A;  4EV4 A;  5FDH A;  3ZVW A;  3JVU A;  3FC7 A;  1MWT A;  1K57 C;  1A0K A;  1JVJ A;  2M1C A;  3MMH A;  2NUT C;  4DE0 A;  2P9V B;  3PBN A;  4BBU A;  4RX3 A;  1IFQ A;  4FCF A;  4S2O A;  3BFF A;  4GLQ A;  1NRF A;  1TDL A;  3T4Q A;  2ZM0 A;  4JGP A;  4P85 A;  4X56 A;  1GHP A;  1EI5 A;  2EX6 A;  4S2K A;  2HDS A;  2X01 A;  1LL8 A;  3A0S A;  1I2S A;  1YPR A;  3SH7 A;  5L2F A;  4DXB A;  1KE3 A;  5A93 A;  2ZMV A;  2X71 A;  1W7F A;  1NRJ A;  3VOY A;  1XJ6 A;  2UV0 E;  4LV1 A;  3PBQ A;  4GKU A;  5EVI D;  3BW6 A;  5EVL A;  3O88 A;  1ESI A;  4BBT A;  4Y13 A;  4R6L A;  2PD7 A;  5A91 A;  3CUE C;  3D72 A;  2R9W A;  4E3L A;  2Y2N A;  4GB7 A;  3LR0 A;  3F1O A;  4UA9 A;  1ESU A;  1ODV A;  3UNW A;  3P09 A;  3DBA A;  5A8B A;  5TBM A;  2WGV A;  1E3U D;  4EEU A;  4WF0 A;  2XFT A;  3ZG9 B;  5GHZ A;  4PPR A;  4KEN B;  4G3V A;  5L09 A;  1SCW A;  3JYI A;  3V50 A;  4OH0 A;  4GDB A;  2BTF P;  3IT9 A;  1EW0 A;  2W3H A;  3A0R A;  4Z9Q A;  1P9W A;  4DF6 A;  4FOF A;  4HIA A;  3PAE A;  1KDW A;  2Y91 A;  3UE0 A;  4U0T A;  2VK3 A;  4HY8 A;  1TDG A;  3VV4 A;  1VHM A;  1L3L A;  1IEL A;  3DTK A;  4WEL A;  1YLZ A;  3KYQ A;  2ZL1 B;  5KZH A;  2PU4 A;  2DCF A;  1ONH A;  2W3E A;  1RGZ A;  4ETZ A;  3IF6 A;  1JTD A;  3TOI A;  2Y2P A;  4ZRR A;  5FQJ A;  1SHV A;  4EUV A;  2XSS A;  5DF7 A;  4D60 A;  3SZT A;  5CGS A;  4MNR A;  1GA0 A;  3A3E A;  1NJ4 A;  3IX4 A;  3T4O A;  3PXP A;  3D4F A;  5AJG A;  3W8K A;  3ULF A;  4FUW A;  4B88 A;  1NZU A;  3S4X A;  5E2E A;  4PM8 A;  1K56 A;  2WAE A;  3S7O A;  1H8Z A;  4B4X A;  4PHT A;  3LGO A;  3OCN A;  1OT9 A;  1NLY A;  4JBF A;  3V5M A;  1KVM A;  4OOL A;  4O01 A;  4KZ6 A;  1AWI A;  4YOF A;  2VGL S;  4QU3 A;  2P7J A;  5F1F A;  4Y0O A;  4ESP A;  4IVK A;  4KQO A;  2GX5 A;  2PD8 A;  4GHI A;  2J8Y A;  1IYS A;  4UHU A;  2Y2G A;  4ZAM A;  1F9I A;  4QB8 A;  4I3I A;  4FSF A;  5DFY A;  3MF0 A;  4HNB A;  3LYX A;  5L8M A;  2HDQ A;  2XD1 A;  3CMZ A;  4PM7 A;  3PBR A;  2WAD A;  2QHK A;  4IED A;  5C5K A;  3W4Q A;  3UB7 A;  1KGG A;  2UWX A;  3MZD A;  4H8R A;  1VET B;  1KE4 A;  1HZO A;  5TBM B;  3FG8 A;  3OLO A;  4OON A;  1IEM A;  1CI8 A;  3IXB A;  5CXW A;  4PM9 A;  2VGJ A;  4Y17 A;  3KSI A;  4H6J A;  3PYP A;  1KOU A;  2VX8 A;  3SOI A;  4ZJ2 A;  4I3J A;  3BM6 A;  3H7W B;  4NK3 A;  3NHQ A;  4FH2 A;  3C8C A;  4UAA A;  3N4I A;  3C2W A;  5DTK A;  5DFX A;  2AVX A;  3FWL A;  1HD8 A;  4LCL A;  3OPL A;  2RL3 A;  3DTM A;  2BLS A;  1XA7 A;  2XR0 A;  2FH5 A;  4ZDX A;  1K6S A;  3T4T A;  3T1S A;  3MXS A;  1CI9 A;  1O07 A;  1BSG A;  2C5W B;  1S1Z A;  1M40 A;  1AXB A;  3VE4 A;  4NEE D;  2WGI A;  3GV9 A;  5J8X A;  2K7S A;  5GL9 A;  4PMA A;  2W3G A;  4P0M A;  2HP5 A;  5AQ9 A;  1NXY A;  4R3J A;  3Q7Z A;  1K55 A;  5M1A A;  1Y28 A;  4HES A;  1VM1 A;  4X53 A;  3HJI A;  5CHM A;  4WZ5 C;  2Y2O A;  3IH8 A;  1UWN X;  2HJ9 C;  2KX6 A;  2Q9N A;  3A3I A;  3CAX A;  3OC2 A;  3GDI A;  2J3T D;  1TS6 A;  4U3T A;  2WKQ A;  1K57 A;  3OPH A;  3KYE A;  1BUL A;  3VP3 A;  2ZJ9 A;  1OTE A;  1YKD A;  2BAS A;  5CER A;  2Z2M B;  5E2G A;  3IS2 A;  1G5U A;  4I3A A;  5DKK A;  4JXW A;  2ZC4 B;  5F68 A;  3EGD C;  5FEG A;  1SKO A;  2PR6 A;  3D3O A;  2EXA A;  2EA9 A;  5LBR A;  4DE2 A;  3ZNT A;  2ZD8 A;  4AFI A;  4X55 A;  4X25 A;  1X0O A;  2OAP 1;  4NXB A;  4B93 A;  4WN5 A;  4CLC C;  1BYW A;  3LCE A;  3UME A;  3LR4 A;  4OLG A;  3CJM A;  3N8S A;  4R38 A;  3V67 A;  3LI9 A;  4BBV A;  2XA7 M;  1GA9 A;  4MBK A;  4QWO A;  4K08 A;  2Q9M A;  1G6O A;  3S1Y A;  4ARZ A;  3CUE A;  4WEJ A;  1T1A A;  2A2L A;  2EWW A;  3K3D A;  4MN6 A;  3UDX A;  2V8F A;  2G7U A;  2Y55 A;  4GZB A;  2PDR A;  4L0L A;  5U47 A;  5J3W A;  2XLN A;  1YMS A;  4OQH A;  3EEA A;  2G2W A;  4OQ0 A;  3CHW P;  5EPH A;  4II7 A;  4H6J B;  2OOL A;  3NOP C;  1T18 A;  4Q0H A;  2B5R A;  4UA7 A;  1LSV A;  4I39 A;  4NXG A;  2JKG A;  2QZ6 A;  1KE0 A;  3HUO A;  2L1M A;  1P97 A;  1FR1 A;  3UB9 A;  5GLD A;  4KZ7 A;  1IYP A;  2W1R A;  2WAF A;  3MXQ A;  2PU2 A;  2HGV A;  4OQI A;  1K4F A;  3BY9 A;  1DJC A;  1XGJ A;  1S1Y A;  4LRZ E;  1RP5 A;  3ITB A;  4DDS A;  1ZG4 A;  3P7N A;  3BEB A;  5EVI C;  5TFQ A;  3TRC A;  3U2A A;  3IBR A;  2JKF A;  2H5S A;  3C38 A;  1OT6 A;  1FCN A;  5GLC A;  3TJZ C;  5A90 A;  2FFY A;  3GSG A;  2VKS A;  5AVF A;  2VZW A;  3WS1 A;  5HW3 A;  1S66 L;  4DE1 A;  3A3J A;  4IBR A;  3QP2 A;  1LSX A;  4DXC A;  5F69 A;  2PRF A;  3G30 A;  3GR2 A;  3ZYT A;  3HUN A;  4GD8 A;  4JF5 A;  1YLW A;  3AGF A;  1W5D A;  3O3V A;  3KYZ A;  2CMN A;  2PYR A;  1VQQ A;  4QY6 A;  4JF6 A;  5CGW A;  4S2I A;  3PAG A;  3UPO A;  1YM1 A;  3IS2 B;  2D02 A;  1BZA A;  1UWP X;  3NY4 A;  4E6X A;  5FI7 A;  4N1X A;  3OCL A;  2VV8 A;  3VP4 A;  1LI0 A;  3BRM A;  3N8L A;  4UA6 A;  1QME A;  3KO6 A;  4LLO B;  1RGY A;  2ZQ9 A;  3E2L A;  4JXG A;  3E0Y A;  5TR7 A;  5FL3 A;  3E4P A;  4MDZ A;  1W63 Q;  2WYX A;  4QJG A;  3T4S A;  3IQA A;  1MWR A;  2IWC A;  1J9M A;  5FI6 A;  3UE1 A;  4ARZ B;  3NDE A;  4Y0T A;  4WYY A;  3T50 A;  3HLB A;  3ICY A;  1F5M A;  1L0G A;  1KVL A;  5FAQ A;  4D2O A;  4P6Z M;  4WUJ A;  3MXR A;  4KZ4 A;  4JF4 A;  3QP8 A;  4OQG A;  4M3K A;  5HAP A;  4BD0 A;  4R23 A;  1L2S A;  1XPB A;  3KSH A;  4X1L A;  3G31 A;  3AGE A;  3NI9 A;  1LSW A;  3G6O A;  2ZMA A;  3EGX C;  3LFV A;  1OME A;  1DP8 A;  4XT2 B;  2Y79 A;  1Z6F A;  1VET A;  2WUQ A;  2JHE A;  4QHC A;  4S2L A;  4Y7P A;  1S4R A;  2DNS A;  2ZC6 B;  4ZBE A;  5IS1 A;  1NYY A;  2XFS A;  3ZGA B;  3MJQ A;  4HH3 A;  5DJU A;  2G2U A;  2PBY A;  1W8Y A;  3VOL A;  3FKV A;  2EX9 A;  4HHD A;  2OAQ 1;  2XRO A;  2W3D A;  3H7W A;  1FQG A;  4IUH A;  2M7U A;  4HOI A;  5HAI A;  1ZTU A;  3LUQ A;  1V9Y A;  1VEU B;  2H0Y A;  4O7D A;  3R7W B;  1HVB A;  2ZLY A;  4IBX A;  1YT4 A;  2BG1 A;  5E43 A;  3ZCZ A;  4NKP A;  1OTI A;  1YQS A;  1ERM A;  1BUE A;  4E6W A;  3ISG A;  1BTL A;  1KGF A;  5AQB A;  4WZ5 A;  4X1M A;  1PNE A;  1CEG A;  4RVA A;  4LRX C;  1H5X A;  2KDK A;  3UPN A;  4HEF A;  3VP2 A;  3MQO A;  1YLT A;  3T4L A;  2L4R A;  3ZNY A;  1F2K A;  3JVV A;  1TF1 A;  1K54 A;  1XX2 A;  2B02 A;  3HVF A;  3LY4 A;  2V9A A;  3BYD A;  5A92 A;  1PZP A;  5HDD A;  2X02 A;  4IUK A;  4S2N C;  1Y54 A;  2P74 A;  1IYQ A;  2EWV A;  5EV0 A;  3QNC A;  3T1R A;  3JPU A;  4GOG A;  1S4S A;  2Z2L B;  3FPV A;  3MZE A;  3MBZ A;  2ZQ7 A;  3C4O A;  2WZX A;  3ZFZ A;  4OPY A;  3HRE A;  2WKI A;  1NZO A;  5KSC A;  2Y8H A;  4OOM A;  5HFO A;  2VLG A;  3G35 A;  1OTD A;  4FTX A;  4JLF A;  4EW7 A;  5HSQ A;  3RFB A;  5GHY A;  4R4S A;  2PHY A;  2Y2H A;  5CEC A;  5M19 A;  3M6B A;  4G3W A;  4C6Y A;  5HZH A;  4GDN A;  3MFD A;  4JPM A;  5FSR A;  1K4E A;  4E3O A;  1WYB A;  4R1G A;  4N9L A;  2V8C A;  3GMW A;  4P6B A;  3GQZ A;  3O86 A;  3M2K A;  1P0Z A;  3MQQ A;  5L07 A;  2K31 A;  1S67 L;  4RYE A;  1GHM A;  4HJ4 A;  2J3T C;  4K0X A;  2J7V A;  2O9B A;  5G18 A;  4XUX A;  2A49 A;  1IOU A;  3SS3 A;  3LIC A;  4GCZ A;  3UO9 A;  3VFF A;  3LY3 A;  3KSF A;  2A3U A;  4E3K A;  2V1Z A;  2YKF A;  4MMN A;  2CC1 A;  5G4Y A;  3NC8 A;  3OPR A;  2INW A;  1ONG A;  1GCE A;  3C7U A;  3WRT A;  3NDG A;  3LO7 A;  3E4Q A;  2ZQC A;  1TD5 A;  2EFU A;  4DKI A;  3V3S A;  4WMC D;  3L7H A;  4FH4 A;  5J4E A;  4GW9 A;  2FZ0 A;  4KUO A;  3E98 A;  1JWZ A;  5EVI A;  1TVF A;  2Y2I A;  2XDM A;  4OLD A;  3VOZ A;  4Q0J A;  3IXH A;  3KSG A;  3T4J A;  3NEC A;  5HDC A;  4UQI M;  4IVI A;  4HBT A;  5CTM A;  3LR5 A;  4KUK A;  4WLA A;  1FOF A;  3CI6 A;  1MC0 A;  5KMW A;  1P9R A;  2B95 A;  4S2M A;  4KZ5 A;  5IU1 A;  2WK0 A;  1ERQ A;  4OOY A;  5DJT A;  3S7N A;  4NG2 A;  3S22 A;  2QMI A;  4MN7 A;  3ZQ5 A;  4MBF A;  3G32 A;  3SS4 A;  5TGF A;  4DRT A;  2WGW A;  3BFG A;  3CWF A;  3VSL A;  1PI5 A;  1CQA A;  4JXS A;  3KX0 X;  1FR6 A;  2GJ3 A;  3UY6 A;  4I38 A;  4Y15 A;  2XGN A;  5EOE A;  1K0K A;  4YIN A;  1HLU P;  3EWK A;  4LFU A;  3A3D A;  3FPW A;  3DW0 A;  4KZA A;  2PT7 A;  3WRZ A;  4HJ6 A;  4ZJ3 A;  3QP6 A;  5HL1 A;  4CLC B;  3N6I A;  3HLE A; 
#chains in the Genus database with same CATH homology
 3U2A A;  3CUE C;  3IBR A;  3D72 A;  4GS9 B;  1XJ2 A;  5HL6 A;  3C38 A;  1OT6 A;  4EU0 A;  3TJZ C;  4E04 A;  3LR0 A;  1TS8 A;  3F1O A;  1DP9 A;  4DJ3 A;  2VKS A;  1ODV A;  4L9E A;  5AVF A;  3DBA A;  5A8B A;  5TBM A;  1YAX A;  3C30 A;  2VZW A;  3P01 A;  1S66 L;  4F3L B;  3B47 A;  4EEU A;  2JKT M;  1LSX A;  4WF0 A;  1H3Q A;  3A0V A;  4IHQ A;  5F69 A;  4G3V A;  2ZBB A;  1GSV A;  3ZYT A;  4R70 A;  4HH2 A;  3EOI A;  3OOV A;  2QJ7 A;  3KYZ A;  2CMN A;  2PYR A;  1EW0 A;  2W3H A;  3B33 A;  2A24 A;  3A0R A;  4DJ2 A;  2MJ6 A;  4B9O A;  1DP6 A;  1G28 A;  2IA2 A;  1P9W A;  3IS2 B;  2D02 A;  4FOF A;  4HIA A;  3F1O B;  4GJ4 A;  5HPI A;  1UWP X;  4JGR A;  4CLC E;  1TS0 A;  4DMZ A;  1GSX A;  3OCL A;  3E4O A;  2V0U A;  1NLZ A;  2VV8 A;  4G3K A;  5KSH A;  2QJ5 A;  4HY8 A;  3VV4 A;  1VHM A;  2PR5 A;  3UE6 A;  4WEL A;  3F1N A;  3EEH A;  3KO6 A;  4LLO B;  2JKR M;  1YSQ A;  4KQD A;  3KYQ A;  3E0Y A;  1MKM A;  5FL3 A;  3E4P A;  2W3E A;  4L9G A;  4MDZ A;  4ETZ A;  1W63 Q;  4LPZ A;  4JGO A;  3T4K A;  4ZRR A;  3T4S A;  1W63 M;  4EUV A;  5HD3 A;  2XSS A;  5AVE A;  2PYP A;  4EXO A;  1N9O A;  4YWZ A;  4EER A;  3H9W A;  1D7E A;  3T4O A;  1T1B A;  3PXP A;  1OTB A;  4XT2 A;  5AJG A;  5F6A A;  4ARZ B;  2KOI A;  4HJ3 A;  2H28 A;  4Z1W A;  5CX7 A;  3T50 A;  3ULF A;  2WKP A;  3PHY A;  2HF6 A;  3TW8 A;  3BQ8 A;  1F5M A;  3ICY A;  4BWI A;  4P6Z M;  4WUJ A;  3S7O A;  2XA7 S;  4PHT A;  2Z6D A;  3H82 A;  3OCN A;  5DKL A;  3S7Q A;  5KIZ A;  1OT9 A;  1NLY A;  2QYB A;  2YKH A;  4M4X A;  3LIA A;  3MFX A;  4OOL A;  1H8M A;  4O01 A;  3R7W A;  1JNU A;  3KSH A;  4UQI S;  4YOF A;  3VE3 A;  2VGL S;  3B42 A;  2P7J A;  3EQV A;  2HV1 A;  1LSW A;  1V9Z A;  3G6O A;  3EGX C;  3LFV A;  1DP8 A;  4XT2 B;  2Y79 A;  2D01 A;  2JKT I;  2GX5 A;  4KQO A;  2PD8 A;  2M7V A;  4MN5 A;  4ME4 A;  4GHI A;  2JHE A;  2DMW A;  1DRM A;  1S4R A;  5IS1 A;  4IJG A;  1N9L A;  5K5B A;  3MJQ A;  3K2N A;  3RTY A;  1F9I A;  4I3I A;  3PBO A;  4HH3 A;  4PAU A;  4FSF A;  5DJU A;  3VOL A;  5DFY A;  3MF0 A;  3EQU A;  4HNB A;  3LYX A;  4HHD A;  3NOT C;  2OAQ 1;  5L8M A;  2XRO A;  2W3D A;  3H7W A;  4IUH A;  4BMW A;  2M7U A;  3LID A;  3PBR A;  2HJE A;  4HOI A;  1ZTU A;  2J80 A;  2ZOH A;  2QHK A;  1V9Y A;  2V0W A;  2W1T A;  3LUQ A;  3SW1 A;  3R7W B;  4LRY C;  1WA9 A;  5C5K A;  3RH8 B;  3LIF A;  3IBJ A;  3UB7 A;  2P04 A;  4Q0I A;  3BQA A;  2GZA A;  4NKP A;  1OTI A;  3LIE A;  1OPX A;  4GHI B;  4NXE A;  3UB6 A;  4JGQ A;  5TBM B;  3FG8 A;  3OLO A;  3R4K A;  4NXF A;  2JKR I;  4LRX C;  3KSI A;  2KDK A;  2I9V A;  4EET B;  2O9A A;  4H6J A;  3PYP A;  4RQ9 A;  1KOU A;  2VX8 A;  5G4Z A;  1GSW A;  3MQO A;  3T4L A;  2L4R A;  4I3J A;  3H7W B;  3JVV A;  5EFW A;  1TF1 A;  2LB5 A;  2B02 A;  3S7P A;  3NHQ A;  1UGU A;  2V9A A;  3C8C A;  1NWZ A;  4I5S A;  3CIT A;  2W1T B;  5HDD A;  1XFN A;  4IUK A;  3MQ0 A;  2V1B A;  1OJ5 A;  2A24 B;  3C2W A;  2EWV A;  3NOU C;  4Y2F A;  2NUP C;  5DFX A;  1XJ3 A;  5DF9 A;  4HI4 A;  3TE8 A;  4ETX A;  3UMD A;  1S4S A;  1VB6 A;  3FPV A;  2R78 A;  2FH5 A;  1F98 A;  5HPF A;  3T4T A;  1XJ4 A;  1OJG A;  4L9F A;  5HWV A;  1OTA A;  4WL9 A;  3BWL A;  2Y8H A;  4OOM A;  1S1Z A;  2VLG A;  3VE4 A;  1OTD A;  4NEE D;  4EW7 A;  5HSQ A;  3RFB A;  4GS9 A;  4O0P A;  2K7S A;  3F1N B;  2PHY A;  4CQH A;  3HJK A;  2W3G A;  3UB8 A;  3CLO A;  4G3W A;  2QWS A;  5HZH A;  3OBF A;  1XFQ A;  3LI8 A;  1Y28 A;  2Z6C A;  1T19 A;  3UE3 A;  3GEC A;  4F3L A;  3LR3 A;  3HJI A;  2O0Y A;  2O99 A;  2VJW A;  2VEA A;  1T1C A;  2W3F A;  1UWN X;  2HJ9 C;  2GNX A;  2KX6 A;  1ZHH B;  2W27 A;  3CAX A;  3OC2 A;  5F5Y A;  3GDI A;  2J3T D;  1P0Z A;  1TS6 A;  3MQQ A;  4DN0 A;  2K31 A;  3PBT A;  1S67 L;  2WKQ A;  4HJ4 A;  2J3T C;  4HP9 A;  2O9B A;  1OTE A;  2ZMF A;  4WEK A;  1YKD A;  3MR0 A;  2BAS A;  2ZOI A;  3H82 B;  2O9C A;  1IOU A;  3IS2 A;  5MC7 A;  3LIC A;  4I3A A;  4YNR A;  5DKK A;  1YSP A;  4GCZ A;  5F68 A;  4BJP A;  3EGD C;  2K2N A;  2PR6 A;  3KSF A;  3D3O A;  2VA0 A;  4PKY G;  2EA9 A;  4Y3I A;  5LBR A;  2KLI A;  4P6Z S;  4AFI A;  4CLC D;  2YKF A;  1X0O A;  4MMN A;  4EEP A;  5G4Y A;  4QPR A;  2OAP 1;  4NXB A;  4B93 A;  4WN5 A;  2INW A;  1LT0 A;  5J7E A;  4CLC C;  2WKR A;  2P08 A;  3NJA A;  1BYW A;  3F1P A;  1TS7 A;  2V1A A;  3UME A;  3E4Q A;  3LR4 A;  4HP4 A;  4R38 A;  1TD5 A;  1N9N A;  5HWW A;  3V67 A;  1MZU A;  3LI9 A;  5J4E A;  4GW9 A;  2FZ0 A;  2XA7 M;  4KUO A;  4O8G A;  5HDS A;  4BBV A;  3E98 A;  4Y5F A;  2W0N A;  2JN7 A;  2OWH A;  2OWJ A;  4K08 A;  4UEY A;  1G6O A;  3K3C A;  4ARZ A;  5HD5 A;  3CUE A;  4WEJ A;  4Q0J A;  1T1A A;  2A2L A;  3HCY A;  3KSG A;  2EWW A;  3T4J A;  3K3D A;  4MN6 A;  3BY8 A;  2G7U A;  5HDC A;  4EQ1 A;  4UQI M;  2VV7 A;  4EES A;  2VGL M;  2PDR A;  4L0L A;  2XRN A;  3JVU A;  3FC7 A;  4MCW A;  3LR5 A;  2M1C A;  3MMH A;  2QKP A;  4KUK A;  2NUT C;  1STZ A;  4WLA A;  5J3W A;  3PBN A;  3EEA A;  3CI6 A;  1MC0 A;  4R3A A;  3F1P B;  4BBU A;  1IFQ A;  1P9R A;  1D06 A;  5IU1 A;  3S7N A;  5DJT A;  4II7 A;  4CLC A;  4GLQ A;  4H6J B;  2OOL A;  3NOP C;  5HWT A;  3T4Q A;  2VV6 A;  1T18 A;  4JGP A;  4MN7 A;  4Q0H A;  3LIB A;  3ZQ5 A;  1LSV A;  5TJJ A;  4I39 A;  4NXG A;  5I5L A;  3CWF A;  2L1M A;  1LL8 A;  1P97 A;  3A0S A;  3UB9 A;  4PKY A;  3PR6 A;  3PBS A;  2W1R A;  3BJN A;  3W2Z A;  5IT5 A;  3MXQ A;  2ZMV A;  2J3W A;  3KX0 X;  2GJ3 A;  2HGV A;  2B18 A;  1NRJ A;  4I38 A;  2L0W A;  2LB9 A;  3O5Y A;  1XJ6 A;  3EWK A;  3BY9 A;  3FPW A;  3PBQ A;  1S1Y A;  2PT7 A;  4LRZ E;  3BW6 A;  4HJ6 A;  4BBT A;  4HQA A;  4R6L A;  4CLC B;  3P7N A;  2PD7 A;  3TRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...