4I39A

Structures of ict and pr1 intermediates from time-resolved laue crystallography collected at 14id-b, aps
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Luminescent protein
molecule keywords Photoactive yellow protein
total genus 39
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4i39A00
2P7JA 4EEUA 3LIDA 5DJUA 3F1OB 3UE6A 3E4OA 3P7NA 1S4RA 5DKLA 2JHEA 1OT6A 1S1ZA 3GDIA 1GSWA 3H9WA 4EXOA 1UWNX 2V0UA 1D06A 2R78A 2ZOIA 5A8BA 3PYPA 4MN6A 1T1AA 3C2WA 4EEPA 2VLGA 1MZUA 4KQDA 2L1MA 3B33A 4I3IA 4F3LA 3PHYA 4NXEA 4GS9A 3RTYA 5F5YA 1TS0A 3MXQA 2Z6DA 4HHDA 4JGPA 4HJ3A 4KUKA 3LIFA 5HDSA 4L9EA 5HD3A 4BBVA 1T18A 4M4XA 3UB9A 2VV6A 4HOIA 3LIBA 2BASA 1F98A 1OJ5A 1TS6A 1G28A 1GSVA 5KIZA 5TBMA 5HSQA 2D01A 4H6JB 5F69A 5F6AA 4I3AA 1UWPX 4L9GA 5HDCA 5IS1A 3LYXA 2QJ5A 5HDDA 3MQOA 3MFXA 4JGOA 2WKPA 5HWTA 1S66L 1V9ZA 3ZQ5A 1LSWA 4EW7A 2KX6A 3IS2B 2W0NA 3G6OA 3IS2A 4HH3A 1N9NA 4R70A 2YKFA 2PD8A 4HY8A 4I3JA 3H7WA 2OWJA 1OJGA 3H7WB 2GJ3A 1LL8A 1N9OA 3A0RA 3LICA 3F1NB 5AVEA 1XJ4A 3F1NA 1DP8A 3UMEA 4HP4A 3F1PB 4HH2A 4F3LB 4HJ4A 5HD5A 2M1CA 3F1OA 5G4ZA 1N9LA 5HWVA 3F1PA 4R6LA 3FG8A 3H82A 3LI8A 4GW9A 4LRYC 1DP6A 2PYPA 4NXGA 5G4YA 2H28A 4BBUA 3ICYA 1V9YA 1X0OA 3MJQA 5HWWA 2V0WA 4H6JA 4HI4A 2D02A 4LRXC 4DJ2A 5HZHA 1S67L 2K7SA 3CWFA 2VV8A 4GCZA 4PKYG 1D7EA 4WF0A 3D72A 1S4SA 4R38A 1KOUA 3HJIA 3NJAA 3NOTC 4RQ9A 3NOPC 4MN5A 1NWZA 4DJ3A 3A0VA 2I9VA 3UB6A 2A24B 4XT2B 4XT2A 3UMDA 1OT9A 2W27A 4GHIA 3T50A 3VE3A 2QHKA 2VEAA 2PR5A 4HQAA 3HJKA 3E4QA 5J4EA 1OTEA 2PD7A 4JGQA 4JGRA 1BYWA 4BBTA 5J3WA 2J80A 1DP9A 1OTAA 1VB6A 2ZBBA 3FC7A 1XJ2A 2PR6A 2Z6CA 2QKPA 4I38A 4LRZE 3LUQA 3UB8A 3EEHA 2HV1A 1OTDA 1ODVA 1XJ3A 4HP9A 4LLOB 1S1YA 4KUOA 3H82B 3GECA 1P0ZA 4I39A 3BY8A 5DKKA 4EETB 3MR0A 2VV7A 4L9FA 3C8CA 4LPZA 3RH8B 2ZOHA 2B02A 2WKRA 5F68A 4E04A 1EW0A 1TS7A 1Y28A 2PYRA 3VOLA 2JN7A 2CMNA 1UGUA 3CLOA 4K08A 1LT0A 4EERA 3K3DA 3IBRA 2V9AA 2QJ7A 3NOUC 3OLOA 2L4RA 3MQQA 2YKHA 2OWHA 3K3CA 4GS9B 3CAXA 4HNBA 1XJ6A 2PHYA 3A0SA 2EA9A 4NXBA 4PKYA 4NXFA 1P97A 4B9OA 3LIAA 1TS8A 2L0WA 2INWA 4GHIB 2WKQA 2V1AA 5TBMB 3SW1A 1OTBA 1OTIA 3LIEA 1JNUA 1WA9A 1T19A 4WLAA 5EFWA 2OOLA 2KDKA 1XFQA 3LI9A 4WN5A 4HJ6A 5DJTA 5AVFA 3KX0X 4WUJA 1T1CA 3UB7A 3VE4A 3EWKA 2PDRA 4EESA 5IU1A 3ULFA 5J7EA 3BY9A 1XFNA 1LSVA 2A24A 1DRMA 4WL9A 1LSXA 4EQ1A 5I5LA 4R3AA 4HIAA 3NHQA 1F9IA 1T1BA 2QWSA 2V1BA 3E4PA 1GSXA 3BWLA 4I5SA 4YWZA
chains in the Genus database with same CATH superfamily
1IYSA 3F1OB 2JE5A 3CPTA 3NCKA 1YLPA 4MLLA 2V0UA 4ZJ2A 1KE3A 2Y91A 1MZUA 2KLIA 2ZQAA 1YKDA 5FQJA 1TS6A 1GSVA 3PAEA 5TBMA 3QNCA 1WYCA 1VHMA 3LYXA 2P9VB 3MQOA 2VZWA 5HDDA 2JKTM 1ONHA 3MKEA 2KX6A 2X02A 2HPBA 4XUZA 3VFHA 3C38A 3HUNA 1BT5A 4F3LB 5G4ZA 4R0QA 1KDWA 2Y2LA 1DP6A 2V0WA 1D7EA 4IUHA 3N8LA 3HJIA 2JC7A 4MN5A 4XT2A 4HQAA 1JVJA 3UB8A 2RL3A 3LUQA 4KZ4A 5DKKA 4S2NC 1PZPA 4NG2A 2PYRA 2IWBA 3Q7ZA 1XA1A 2XLNA 4OPQA 5AQBA 5HPIA 4RX3A 4MDZA 4HNBA 4B88A 4Z9QA 3R7WA 5IT5A 2JBFA 4OOMA 3FPVA 1BZAA 5EFWA 4C75A 3SS5A 3ITBA 4HJ6A 5FAQA 4EESA 2BG1A 2EXAA 2ZC4B 2WUQA 1J9MA 2VGJA 4DE3A 2VA0A 1JWZA 4YNRA 3NHQA 5A92A 1XX2A 3PBTA 1IYOA 4I5SA 3W4QA 1BLPA 1L2SA 1UWNX 5FA7A 4MN6A 3S7QA 2QYBA 4IVIA 4NXEA 4BENA 4HHDA 2ZMAA 4QY5A 3Q81A 2QZ6A 4EUVA 2ZQ7A 2H0TA 1VQQA 3IXHA 5AJGA 3IS2A 4HH3A 3DAVA 5FATA 5HAIA 3G35A 2WYXA 5E2GA 3LI8A 3PR6A 4KZBA 2P08A 1X0OA 3MKFA 3BJNA 5CHMA 4MBFA 2O9CA 1PRQA 3D72A 3CJMA 1H8MA 3NJAA 1CEGA 1SDEA 4CLCB 5EVIB 2VEAA 4BD0A 3N8RA 3A3IA 5J3WA 2PR6A 1NRJA 4CPKA 1OTDA 1LI9A 4P0MA 4Z1WA 1I2WA 4R4SA 1ONGA 2VV7A 3VOLA 3BFCA 3K3DA 3U2AA 1YT4A 3FKWA 1ESUA 4GDBA 2IWDA 1CI9A 4BL2A 4Y7PA 2WKQA 5MC7A 4UHUA 2OLUA 2KDKA 3VE4A 3CUEA 4UAAA 4OQGA 1IEMA 2VGKA 5I5LA 3E4PA 4QY6A 4OPYA 4UA7A 1JWVA 5A8BA 2ZOIA 2VLGA 3PHYA 2Y2PA 1I2SA 5HDSA 4L9EA 3ITAA 4Y0UA 4X25A 4QPRA 4XXRA 4H6JB 4MBHA 5F69A 3CMZA 3LFVA 5FQ9A 1LSWA 1MY8A 3IS2B 2R9XA 4R70A 4HY8A 5A93A 3UY6A 1LL8A 3LICA 1AXBA 3F1PB 1JWPA 1TDGA 1ES4A 1FOFA 5K5BA 3IXBA 4GD6A 1FCOA 3MJQA 3IWIA 1C3BA 4DJ2A 4MCWA 5FI6A 5M19A 3UO9A 4JF6A 5TGFA 3UB6A 1XGJA 5L10A 3C30A 2QHKA 4KG2A 2PR5A 3E4QA 1FCMA 3ZVTA 1OTAA 2Z6CA 2WGWA 2HV1A 4B93A 3C8CA 2WKRA 3LR4A 3EQVA 4UA6A 4IEDA 1K54A 4XUXA 4NXFA 1MBLA 4B9OA 4GHIB 5EUAA 2C5WB 2A2LA 4KZ5A 4S2OA 5EVLA 1QMFA 4WL9A 4F94A 4R3JA 1PI5A 4GOGA 3WWXA 3RXWA 3IXDA 2V2FF 2PAVP 2NUPC 4HESA 4OLDA 3LCEA 5EM1A 2HDUA 1OT6A 4NK3A 4EXOA 2M7UA 2R78A 3C7VA 3FV7A 4KQDA 4KG6A 4GS9A 5HD3A 5GLBA 3UE0A 4M4XA 3RXXA 1G28A 4ZAMA 4Q8IA 1UWPX 2XH9A 2G2UA 4FD8A 1YMSA 4EW7A 2XDMA 1N9NA 4B4ZA 3CI6A 3G30A 1NXYA 5EPHA 1FSYA 5L09A 3F1OA 4LRYC 2V8CA 3ICYA 3HCYA 2IWCA 2ZL1B 2VV8A 3IF5A 4LENA 1I5QA 4RQ9A 1IKIA 4D60A 2XD5A 5FSRA 2W27A 3CUEC 1OTEA 4Y15A 5TFQA 4G3KA 2J80A 1KVLA 1VM1A 2XA7M 3FKVA 4LFUA 3OCLA 4EETB 2XROA 3JYIA 3LY3A 1HLUP 3AGEA 4GDNA 1XJ6A 5L8MA 2DMWA 4X55A 3S4XA 4GKUA 3LIEA 2V20A 2UWXA 4WZ4A 2MJ6A 3Q82A 5G18A 2XEPA 2CC1A 2WZZA 4R3AA 4O01A 4E3KA 3A3EA 2BLSA 1GSXA 2J9PA 4E3NA 3E4OA 5A91A 1L0DA 3VSLA 4ETZA 1BTLA 4LV3A 3TRCA 1T1AA 2WAFA 4S2PA 3W4OA 4EEPA 2L1MA 4EV4A 1BLCA 1LI0A 1TS0A 1G6OA 3NC8A 1IFQA 4QHCA 5FASA 1GA9A 1YPRA 2Y8HA 4JGOA 2OSUA 4C3QA 4E3MA 4CLCE 1CEFA 3ISGA 2J9OA 3T4TA 1E25A 3Q7VB 3QP1A 2OWJA 4C6YA 2W3GA 4X1LA 5FQIA 1Y4OA 2VGLM 1L3LA 1TF1A 4OP5A 1W8QA 2Q9NA 1PZOA 3NULA 4HI4A 1DY6A 3BQ8A 3IF6B 3UE3A 5GHXA 1XPBA 3UNWA 4JXWA 3HLEA 3GRJA 5LBRA 5FI2A 4LRZE 3WRZA 3S7NA 3MR0A 2W3HA 3T4LA 3CLOA 3OLOA 5CHJA 3MQQA 3SH9A 5EOOA 2Y2OA 4GJ4A 1TS8A 4E6XA 3EOIA 1LL9A 4IJGA 1JNUA 2P74A 3MS6A 4WLAA 2HJEA 3GVBA 4WN5A 2JCHA 2M7VA 1FIKA 3G34A 2XSSA 3ULFA 2P04A 1XFNA 4IHQA 1ZG6A 1DRMA 5CEBA 3MQ0A 1ERQA 1W8YA 4II7A 2JHEA 1MXOA 3IWOA 1VETA 3P98A 4DRTA 2EXBA 4N9LA 4F3LA 3MXQA 2WAEA 4FSFA 1VEUB 1PFLA 3DBAA 3NDEA 4ZJ1A 1ERMA 3QP8A 4UQIM 1NRFA 4OPRA 3HUOA 1FSWA 4OOYA 5HD5A 3UDFA 3MMHA 4OP8A 3H82A 5TR7A 2PYPA 2H28A 2ZMFA 1O07A 2JKGA 1KE0A 5DF7A 5EVID 3IX8A 5GLAA 1CI8A 3GMWA 3E2LA 4DKIA 1NWZA 3BQAA 2EX6A 3ZNTA 2J3TD 4I38A 1XKZA 1W79A 5F68A 1TS7A 5TJJA 2CMNA 3ZG9B 2EWWA 4ZJ3A 4GS9B 2ZQ8A 2Y4AA 5CX7A 3WS2A 4DN0A 5HPFA 1AWIA 4P6ZS 3V50A 3LIAA 1NZOA 4E3JA 3MZDA 3IHBA 1ACFA 3V67A 4KQRA 3TW8A 2A24A 4OH0A 5FQQA 3R4KA 2E8JA 4P87A 1KVMA 3U4LP 1ZHHB 3B42A 1XP4A 4YFMA 1Y54A 2Y55A 1NZUA 2J3WA 1J3WA 4P6BA 4OQHA 4R23A 2BASA 4K0WA 3NI9A 1ES3A 3OZHA 3MSHA 5IS1A 2HP6A 3HVFA 3OPRA 2WGWB 3MFXA 4PMAA 5KSHA 3BLSA 4UA9A 1FQGA 4X1MA 2XGNA 1SHVA 1K54C 3BLMA 4R3BA 5CECA 2OAP1 4HH2A 1PWDA 3QHYA 2O9BA 3EGDC 5G4YA 4S2NA 3IT9A 1D1JA 4BLMA 4LRXC 1E3UA 4GCZA 4RVAA 1DJBA 5CRFA 4IBXA 2Y79A 3T4KA 3UMDA 2LB5A 5AQAA 1Q2QA 2EX9A 2ZBBA 1KE4A 1YSPA 3UDXA 5EE8A 1XJ3A 3GECA 1H3QA 2B02A 3MZEA 2JN7A 3VP0A 2V9AA 4FH2A 1ALQA 3UDIA 3K3CA 3PAGA 3NDGA 3N6IA 2FH5A 2EX8A 3KSFA 1OTIA 3HREA 3VV4A 1XFQA 5DJTA 1L0GA 5KZHA 2AVXA 2W3FA 3DTEA 2Y2QA 3GSGA 1IKGA 3TSGA 1W7FA 3AGFA 2X01A 5CXWA 2ZC5B 1PWCA 1OPXA 2ZL1A 3MFDA 1Z6FA 3B33A 3PXPA 4K0XA 2Z6DA 2Z2LB 4HJ3A 1T18A 4KG5A 4N9KA 4JF5A 1F98A 5KMWA 2ZD8A 5F6AA 2E8IA 1ES5A 3A3FA 2WKHA 2RCXA 4JBFA 4ZTKA 4ESPA 3G6OA 2WK0A 3S1YA 3RFBA 3QP5A 3F1NB 3F1NA 4LGWA 3A3DA 4WELA 5IHVA 3DWKA 3BFFA 4R6LA 3WS4A 5L2FA 2WGVA 1H0MA 2O0YA 3M2KA 4LCMA 3BW6A 4JKTA 3HBRA 1CK3A 4DJ3A 4GHIA 3HJKA 2PD7A 4BMWA 4P85A 3UE1A 2QKPA 3PBOA 5L07A 4IBRA 3HLFA 3LR0A 4GD8A 5DTTA 4S2JA 1MWRA 2R9WA 2WGIA 3IF6A 2YKHA 2HJ9C 2EX2A 1H8YA 2EA9A 4DDSA 4ETXA 2INWA 2V1AA 1A0KA 1RP5A 1OTBA 4QWOA 1W5DA 5J8XA 4PM6A 4FH4A 1HD8A 5A90A 5J7EA 4D2OA 4X53A 4S2MA 1GHIA 1BULA 3BFEA 1PW1A 2Y59A 2PBYA 3BWLA 4JF4A 5FI7A 4EBLA 1WE4A 4EU0A 4QU3A 3IH8A 3PYPA 4O0PA 1Q2PA 5FEFA 3ZFZA 4GNUA 4OPZA 4HOIA 3LIBA 3ZG0A 1O7EA 2X71A 1BUEA 2ZLYA 5HDCA 4G3VA 2PRFA 1S66L 4PM5A 4CLCC 3Q7VA 1VETB 2PD8A 3OCNA 5KSCA 3H7WB 4IUKA 3C5AA 5HW3A 2HDRA 1LL5A 2QPNA 4S2IA 2B18A 1DJAA 2ZC7A 1G6AA 3R7WB 4NXGA 3MXRA 4FTXA 5FL3A 4RX2A 3ZNYA 3ZVWA 4Y13A 4U3TA 4Y0OA 2P9VA 2JKRI 1EROA 3BECA 4L0LA 1G5UA 1Y28A 2XFTA 2EFXA 4GB7A 1FR1A 3JPUA 4UQIS 5HAQA 2XD1A 4JPMA 5HARA 1K25A 3IXGA 1T19A 4GN2A 5HSQA 5EECA 1T1CA 1XA7A 4YOFA 1YLWA 4KZ6A 3P09A 4JXSA 2DNSA 1S4RA 1ES2A 1SKFA 4X69A 2XF3A 4HEFA 3C2WA 5CTMA 2DRWA 1YSQA 3SH7A 4GZBA 5GL9A 5F1FA 1YLZA 1ZC2A 4WYYA 2H10A 2Q0OA 3K2NA 2XR0A 3ZCZA 5KIZA 1YAXA 3TE8A 2Y2KA 3D4FA 3V3RA 5F83A 1XJ4A 3T1QB 4ARZB 5GHYA 1NYMA 2G2WA 1K4FA 2LB9A 3O3VA 3PBSA 1K57C 4H6JA 2K7SA 2PU2A 5HL1A 1KOUA 2I72A 3T1SA 4A5RA 3A0VA 3QP6A 2A24B 1PIOA 1KGGA 3T50A 4KZ7A 3PBQA 1BYWA 3HLDA 4OQ0A 5HWVA 4CJNA 5HAPA 3H82B 2XA7S 2HP9A 3WS1A 1W63M 4EQIA 3TG9A 3GQZA 1U60A 3KSHA 3A0SA 4PAUA 3SW1A 5E2FA 4EBPA 1PNEA 2OOLA 1GCEA 3EWKA 3HUMA 1RGZA 3QP4A 4WMCD 3KO6A 5EVIA 3UPOA 2QWSA 2V1BA 2EWVA 1M40A 3FPWA 3L7HA 4DE0A 4OKPA 2JKTI 5BOHA 2VJWA 2KOIA 4OOLA 4Y2FA 5CTNA 3GDIA 1GSWA 3VOYA 5CERA 4K91A 1KGFA 1ESIA 5JYPA 4PM9A 1SCWA 4EWFA 3EGXC 4DDYA 1NYYA 3RTYA 5AQ9A 3LR5A 1KGEA 4L9GA 2G7UA 2WKPA 5HWTA 4MEZA 1V9ZA 2PBDP 3DTIA 5DTSA 4JLFA 3HLBA 4Q0IA 2J3TC 3B3XA 3AGDA 4E3LA 1CF0A 4WMCA 5CGXA 2OV5A 4BWIA 1JTDA 1TEMA 5HX9A 5HZHA 3LEZA 3CWFA 4WF0A 1S4SA 1ZKJA 3A3JA 3MXSA 2Y2MA 3LY4A 2WKIA 2WADA 2NUTC 2QMIA 1DP9A 3FC7A 2ZC6B 2V1ZA 1S1YA 1MWUA 1SZVA 1EW0A 4O7DA 1BLSA 5FQKA 1K57A 4ARZA 2DCFA 1N9BA 1NY0A 2VK3A 4FCFA 3UPNA 3UN7A 4P6ZM 1FILA 3LI9A 5DVAA 3KX0X 5DF8A 5EVEA 5E43A 5U47A 1CQAA 1P9RA 4Q0HA 1E3UD 3GTCA 5FEGA 4EQ1A 1T1BA 3OBFA 4NXBA 3UE6A 1F5MA 5DKLA 3WRTA 4ZBEA 2XFSA 4WBGA 3C4OA 3BEBA 4PM8A 4OONA 4I3IA 3P01A 2W1TB 2W1TA 3G31A 1L0FA 4UEYA 4BBVA 5HL6A 2HDSA 5GLDA 4BL3A 3NIAA 1YLTA 3VP1A 4I3AA 1FCNA 3GV9A 1STZA 3SH8A 2Y2JA 3N4IA 2Y2GA 1M6KA 2W0NA 3QNBA 1OJGA 2VGLS 4ZDXA 1N9OA 2J8YA 3W2ZA 4BBTA 2M1CA 2ZQ9A 4DE2A 3Q1FA 4PHTA 1TD5A 3MZFA 1K56D 3FWLA 3VOZA 3ZG7B 3W8KA 4DXBA 4OQIA 5CGWA 3E98A 3VE3A 1HZOA 1Z09A 2HGVA 2ZM8A 1VB6A 3DTKA 2FZ0A 5CHUA 1WYBA 1PI4A 4Y5FA 1RCJA 3V39A 3BRMA 3SZTA 4WEJA 1BSGA 3IBRA 2L4RA 3BYDA 1K6RA 3JVUA 1KDSA 4EUZA 1P97A 1YQSA 3M6HA 2GDNA 3S22A 5IU1A 1LLBA 4OLGA 1LSVA 3IBJA 3TJZC 1MC0A 2GNXA 1F9IA 4HBUA 4NETA 3MF0A 1L0EA 3LIDA 5DJUA 1PW8A 4N1HA 2FFFB 4AFIA 4O8GA 1D06A 4KQOA 5E2EA 2B95A 4U0TA 2Q9MA 1GHMA 1XGIA 5F5YA 4MBKA 1H8ZA 4KUKA 1N4OA 1NLYA 4E6WA 4DXCA 4FOFA 5HFOA 4WZ5A 5FAPA 5DF9A 3VP4A 3D3OA 3FZCA 3PBNA 4I3JA 3IH9A 3DTMA 5AVEA 4EBNA 3IQAA 3VP3A 1DP8A 2O9AA 4OVDA 1W63Q 2VKSA 5CEDA 3N8SA 2JKFA 4GW9A 1EI5A 3WS5A 4BBUA 5HWWA 3IWQA 1XXMA 5GHZA 1S67L 2ZM2A 3EQUA 4G3WA 3NOPC 2HZ5A 4E3IA 3W4PA 1IYQA 3HLCA 4ID4A 3HL9A 4DE1A 4LV2A 1PWGA 1XJ2A 3GR2A 3TOIA 3UPPA 1ODVA 3JVVA 2C6WB 3LO7A 4HP9A 4LLOB 4KUOA 4I39A 1P0ZA 3BY8A 4LPZA 2XK1A 5F1GA 1MKMA 4DF6A 4R4RA 4EERA 3HLGA 5JYOA 3CAXA 2HF6A 1K56A 2J7VA 3KYQA 5TBMB 3T4QA 4X56A 2BTFP 4H8RA 1FR6A 1IOUA 5AVFA 3VSKA 3OPLA 3BY9A 2UV0E 2ZC3B 4KQQA 3KYEA 2H5SA 5GLCA 4YWZA 4EEUA 3LEQA 4CLCD 4HBTA 1HVBA 3B47A 3G4PA 4KZ9A 3PTEA 4JGPA 3O86A 5M18A 4M3KA 4ME4A 2ZQCA 3UB9A 3BFGA 3M2JA 4Y3IA 3ZG8B 1YMXA 3ZQ5A 3G2YA 2PT7A 3H7WA 4WEKA 1HTZA 4X68A 1YLJA 2Z2MB 4KENB 1MPLA 1N9LA 1G68A 3FG8A 3UB5P 1V9YA 1H5XA 4Q0JA 3V5MA 4R38A 5AQ7A 2FFYA 4XT2B 2V8FA 4NKPA 5J4EA 3I7JA 4JGQA 1JTGA 3CG5A 4PPRA 3ZGAB 3CITA 3MBZA 3IHAA 3LGOA 3PBRA 1E4DA 1S6RA 3LR3A 2H0YA 5DFXA 1LT0A 2QJ7A 1TVFA 2ZMVA 1YM1A 4PKYA 2L0WA 2HP5A 3T1RA 4GLQA 4QB8A 1OMEA 2Y2IA 3UB7A 3HLWA 2W3DA 2XRNA 3O87A 1TDLA 4CLCA 2ZJ9A 5FAOA 2HDQA 3D9YA 4HIAA 2P7JA 3P7NA 5EOEA 1S1ZA 2K31A 3OPPA 3CHWP 3C4PA 4B4XA 5FQMA 3EEAA 2Y2NA 1SDNA 4Y17A 1MWTA 1VEUA 3G32A 2D01A 3VFFA 3ZHHA 1K55C 4WM9A 4S2LA 5M1AA 2A3UA 3L9KA 4DMZA 3NECA 4MMNA 4N92A 3T4OA 1SKOA 2XQZA 3A0RA 4KZ3A 3ZYTA 4HP4A 4HJ4A 3S7OA 3ZDJA 5C5KA 4LV0A 5EV0A 2ZM0A 5FDSA 4KZAA 3SOIA 4RYEA 4Y0TA 3CZDA 1PYYA 3NBLA 3QP2A 3OC2A 3NOTC 3EEHA 2Y2HA 3C7UA 4R1GA 3KYZA 1IYPA 2ZOHA 1SKOB 2WZXA 1QMEA 4K08A 1K6SA 3NOUC 2OWHA 1K38A 5FDHA 3ZG5A 1EWZA 1K4EA 1LHYA 3N7WA 2GX5A 4WUJA 2PDRA 4KZ8A 2PU4A 2W3EA 1ZTUA 4N1XA 3DW0A 4S2KA 3RJUA 4LCLA 3O5YA 4BJPA 3F1PA 1ZG4A 1F2KA 3BM6A 3KSGA 3E0YA 3H9WA 3VMAA 3SS3A 2VX8A 4BD1A 3WS0A 4JXGA 4JXVA 4MN7A 1S0WA 3OOVA 3LIFA 1YLYA 5E2HA 2VV6A 3T4SA 3G2ZA 1OJ5A 4PM7A 3NY4A 5I94A 3T1XA 4WZ5C 3E2KA 2QJ5A 1K55A 3KSIA 3IX3A 4NEED 2YKFA 4BQMA 2K2NA 2GJ3A 3IF6C 3UMEA 4X6TA 4YINA 1RGYA 2OLVA 3V3SA 3Q07A 2ZQDA 2B5RA 1K0KA 3T4JA 2IA2A 2OAQ1 5F82A 2D02A 5EM0A 4PKYG 3T12B 3BFDA 1NLZA 3M6BA 3SS4A 2A49A 1CJFA 2I9VA 3DWZA 4LV1A 1OT9A 3OPHA 2EFUA 4JGRA 1IELA 4CQHA 3FYZA 3CPTB 5DFYA 3VP2A 4IVKA 4L9FA 3IX4A 5DTKA 3RH8B 4E04A 2ACGA 1GA0A 1NJ4A 1UGUA 4U0XA 4QD4A 2PHYA 2WKEA 1GHPA 2O99A 1P9WA 3S7PA 1WA9A 4FUWA 4ZRRA 1BLHA 2GZAA 4MNRA 4QJGA 5EVIC 1MWSA 4E3OA 1DJCA 5D3OA 3O88A 1LSXA 1MKIA 2W1RA 2JKRM 5CGSA 4RA7A
chains in the Genus database with same CATH topology
3LIDA 5DJUA 3F1OB 3E4OA 4AFIA 4EU0A 2V0UA 4O8GA 1D06A 4ETZA 3PYPA 4KQOA 4O0PA 3TRCA 1T1AA 4EEPA 1MZUA 2L1MA 2KLIA 5F5YA 1TS0A 1G6OA 1YKDA 4KUKA 1IFQA 4HOIA 3LIBA 1TS6A 1NLYA 1GSVA 5TBMA 4FOFA 5HDCA 1VHMA 3LYXA 4G3VA 5HDDA 2Y8HA 2VZWA 3MQOA 4JGOA 5DF9A 2JKTM 1S66L 4CLCE 3D3OA 3T4TA 2KX6A 4CLCC 3PBNA 2PD8A 3OCNA 4I3JA 2OWJA 3H7WB 4IUKA 3C38A 5AVEA 1DP8A 2W3GA 2O9AA 4F3LB 1W63Q 2B18A 5G4ZA 2VKSA 2VGLM 4GW9A 1DP6A 3R7WB 4NXGA 4BBUA 1TF1A 5HWWA 5FL3A 2V0WA 4HI4A 1S67L 3BQ8A 1D7EA 4IUHA 3EQUA 3HJIA 4G3WA 3NOPC 4MN5A 3UE3A 4XT2A 4HQAA 5LBRA 4LRZE 1XJ2A 3UB8A 3LUQA 2JKRI 3S7NA 1ODVA 3JVVA 4HP9A 4LLOB 4KUOA 4I39A 1P0ZA 5DKKA 3BY8A 4L0LA 3MR0A 4LPZA 2W3HA 2PYRA 1Y28A 1MKMA 3T4LA 3CLOA 4EERA 3OLOA 5HPIA 3MQQA 4MDZA 3CAXA 2HF6A 4HNBA 4UQIS 4GJ4A 3R7WA 5IT5A 1TS8A 3KYQA 3EOIA 4OOMA 5TBMB 3T4QA 3FPVA 4IJGA 1JNUA 1T19A 4WLAA 2HJEA 5EFWA 4WN5A 1IOUA 4HJ6A 5AVFA 5HSQA 4EESA 1T1CA 2M7VA 2XSSA 3ULFA 2P04A 3BY9A 1XFNA 4IHQA 1DRMA 4YOFA 2VA0A 4YNRA 3MQ0A 3NHQA 3PBTA 4I5SA 4YWZA 4EEUA 1S4RA 4II7A 2JHEA 1UWNX 4CLCD 4MN6A 3C2WA 3S7QA 1YSQA 2QYBA 3B47A 4F3LA 4NXEA 3MXQA 4HHDA 4JGPA 4ME4A 3K2NA 3UB9A 4FSFA 3DBAA 5KIZA 4Y3IA 4UQIM 4EUVA 1YAXA 3TE8A 3ZQ5A 5AJGA 2PT7A 3IS2A 4HH3A 3H7WA 4WEKA 1XJ4A 5HD5A 1N9LA 4ARZB 3MMHA 3FG8A 3H82A 3LI8A 3PR6A 2PYPA 2H28A 2P08A 1V9YA 1X0OA 2ZMFA 3BJNA 2LB9A 4H6JA 3PBSA 2K7SA 2O9CA 4Q0JA 3D72A 4R38A 1KOUA 1H8MA 3NJAA 1NWZA 3A0VA 3BQAA 2A24B 4CLCB 4XT2B 4NKPA 5J4EA 3T50A 2VEAA 3PBQA 2J3TD 4JGQA 1BYWA 5J3WA 4I38A 5HWVA 2PR6A 1NRJA 1OTDA 3CITA 3H82B 4Z1WA 2XA7S 2VV7A 3PBRA 5F68A 1TS7A 3LR3A 1W63M 5TJJA 3VOLA 2CMNA 5DFXA 1LT0A 3K3DA 2QJ7A 3U2AA 2EWWA 4GS9B 5CX7A 2ZMVA 4DN0A 3KSHA 3A0SA 4PKYA 5HPFA 4P6ZS 3LIAA 4PAUA 2L0WA 2WKQA 3SW1A 4GLQA 5MC7A 2OOLA 2KDKA 3UB7A 3V67A 3VE4A 3EWKA 2W3DA 3CUEA 3TW8A 2XRNA 4CLCA 2A24A 3KO6A 5I5LA 3R4KA 4HIAA 2QWSA 2V1BA 3FPWA 2EWVA 3E4PA 2JKTI 2P7JA 3P7NA 2VJWA 2KOIA 4OOLA 4Y2FA 1S1ZA 3GDIA 1GSWA 2K31A 5A8BA 1ZHHB 2ZOIA 3B42A 2VLGA 3EGXC 3PHYA 2J3WA 3RTYA 3EEAA 5HDSA 4L9EA 3LR5A 2BASA 4QPRA 2D01A 4H6JB 5F69A 3LFVA 4L9GA 5IS1A 2G7UA 3MFXA 2WKPA 5HWTA 1V9ZA 4DMZA 5KSHA 1LSWA 3IS2B 4MMNA 4R70A 3T4OA 4HY8A 1LL8A 3LICA 3A0RA 4Q0IA 3ZYTA 2J3TC 2OAP1 3F1PB 4HH2A 4HP4A 4HJ4A 3S7OA 5K5BA 2O9BA 3EGDC 5C5KA 5G4YA 4BWIA 3MJQA 4LRXC 4DJ2A 5HZHA 4GCZA 3CWFA 4MCWA 4WF0A 1S4SA 2Y79A 3UB6A 3T4KA 3C30A 3UMDA 2LB5A 2NUTC 2QHKA 3OC2A 2PR5A 3E4QA 3NOTC 1DP9A 1OTAA 2ZBBA 3FC7A 2Z6CA 1YSPA 3EEHA 2HV1A 1XJ3A 1S1YA 3GECA 1H3QA 3KYZA 4B93A 3C8CA 2ZOHA 2B02A 2WKRA 1EW0A 2JN7A 4K08A 3LR4A 2V9AA 3EQVA 3NOUC 2OWHA 3K3CA 4ARZA 4NXFA 4B9OA 2FH5A 4GHIB 3KSFA 1OTIA 3VV4A 2A2LA 4P6ZM 1XFQA 3LI9A 5DJTA 2GX5A 3KX0X 4WUJA 2PDRA 2W3FA 2W3EA 1ZTUA 1P9RA 4WL9A 4Q0HA 3O5YA 4EQ1A 1T1BA 4BJPA 3OBFA 3F1PA 4NXBA 2NUPC 3UE6A 3KSGA 3E0YA 1F5MA 5DKLA 1OT6A 3H9WA 4EXOA 2M7UA 2R78A 1OPXA 2VX8A 4KQDA 3B33A 4I3IA 3PXPA 3P01A 4MN7A 2W1TB 4GS9A 2W1TA 3OOVA 2Z6DA 5HD3A 4UEYA 4HJ3A 3LIFA 4BBVA 1T18A 5HL6A 4M4XA 2VV6A 3T4SA 1F98A 1OJ5A 1G28A 5F6AA 4I3AA 1UWPX 2QJ5A 1STZA 3KSIA 4EW7A 2W0NA 3G6OA 4NEED 1N9NA 2YKFA 3RFBA 2K2NA 1OJGA 2VGLS 2GJ3A 1N9OA 4BBTA 3W2ZA 3CI6A 3F1NB 3UMEA 3F1NA 4WELA 2M1CA 3F1OA 4R6LA 4LRYC 4PHTA 1TD5A 3T4JA 2IA2A 2OAQ1 3ICYA 3HCYA 2D02A 2O0YA 2VV8A 4PKYG 3BW6A 1NLZA 4RQ9A 4DJ3A 2I9VA 1OT9A 2W27A 3E98A 3CUEC 4GHIA 3VE3A 3HJKA 1OTEA 2PD7A 2HGVA 4JGRA 4G3KA 2J80A 4BMWA 1VB6A 2FZ0A 4CQHA 2QKPA 3PBOA 2XA7M 5DFYA 3LR0A 3OCLA 4Y5FA 4EETB 2XROA 4L9FA 3RH8B 4E04A 4WEJA 1UGUA 3IBRA 2L4RA 2YKHA 2HJ9C 3JVUA 1XJ6A 2PHYA 2EA9A 5L8MA 1P97A 2DMWA 4ETXA 2INWA 2V1AA 1OTBA 2O99A 3LIEA 1P9WA 3S7PA 1WA9A 4ZRRA 2GZAA 5IU1A 2MJ6A 5J7EA 1LSVA 3IBJA 1LSXA 3TJZC 4R3AA 1MC0A 2GNXA 1F9IA 4O01A 2W1RA 2JKRM 3MF0A 1GSXA 3BWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P7J A;  4EEU A;  3LID A;  5DJU A;  3F1O B;  3UE6 A;  3E4O A;  3P7N A;  1S4R A;  5DKL A;  2JHE A;  1OT6 A;  1S1Z A;  3GDI A;  1GSW A;  3H9W A;  4EXO A;  1UWN X;  2V0U A;  1D06 A;  2R78 A;  2ZOI A;  5A8B A;  3PYP A;  4MN6 A;  1T1A A;  3C2W A;  4EEP A;  2VLG A;  1MZU A;  4KQD A;  2L1M A;  3B33 A;  4I3I A;  4F3L A;  3PHY A;  4NXE A;  4GS9 A;  3RTY A;  5F5Y A;  1TS0 A;  3MXQ A;  2Z6D A;  4HHD A;  4JGP A;  4HJ3 A;  4KUK A;  3LIF A;  5HDS A;  4L9E A;  5HD3 A;  4BBV A;  1T18 A;  4M4X A;  3UB9 A;  2VV6 A;  4HOI A;  3LIB A;  2BAS A;  1F98 A;  1OJ5 A;  1TS6 A;  1G28 A;  1GSV A;  5KIZ A;  5TBM A;  5HSQ A;  2D01 A;  4H6J B;  5F69 A;  5F6A A;  4I3A A;  1UWP X;  4L9G A;  5HDC A;  5IS1 A;  3LYX A;  2QJ5 A;  5HDD A;  3MQO A;  3MFX A;  4JGO A;  2WKP A;  5HWT A;  1S66 L;  1V9Z A;  3ZQ5 A;  1LSW A;  4EW7 A;  2KX6 A;  3IS2 B;  2W0N A;  3G6O A;  3IS2 A;  4HH3 A;  1N9N A;  4R70 A;  2YKF A;  2PD8 A;  4HY8 A;  4I3J A;  3H7W A;  2OWJ A;  1OJG A;  3H7W B;  2GJ3 A;  1LL8 A;  1N9O A;  3A0R A;  3LIC A;  3F1N B;  5AVE A;  1XJ4 A;  3F1N A;  1DP8 A;  3UME A;  4HP4 A;  3F1P B;  4HH2 A;  4F3L B;  4HJ4 A;  5HD5 A;  2M1C A;  3F1O A;  5G4Z A;  1N9L A;  5HWV A;  3F1P A;  4R6L A;  3FG8 A;  3H82 A;  3LI8 A;  4GW9 A;  4LRY C;  1DP6 A;  2PYP A;  4NXG A;  5G4Y A;  2H28 A;  4BBU A;  3ICY A;  1V9Y A;  1X0O A;  3MJQ A;  5HWW A;  2V0W A;  4H6J A;  4HI4 A;  2D02 A;  4LRX C;  4DJ2 A;  5HZH A;  1S67 L;  2K7S A;  3CWF A;  2VV8 A;  4GCZ A;  4PKY G;  1D7E A;  4WF0 A;  3D72 A;  1S4S A;  4R38 A;  1KOU A;  3HJI A;  3NJA A;  3NOT C;  4RQ9 A;  3NOP C;  4MN5 A;  1NWZ A;  4DJ3 A;  3A0V A;  2I9V A;  3UB6 A;  2A24 B;  4XT2 B;  4XT2 A;  3UMD A;  1OT9 A;  2W27 A;  4GHI A;  3T50 A;  3VE3 A;  2QHK A;  2VEA A;  2PR5 A;  4HQA A;  3HJK A;  3E4Q A;  5J4E A;  1OTE A;  2PD7 A;  4JGQ A;  4JGR A;  1BYW A;  4BBT A;  5J3W A;  2J80 A;  1DP9 A;  1OTA A;  1VB6 A;  2ZBB A;  3FC7 A;  1XJ2 A;  2PR6 A;  2Z6C A;  2QKP A;  4I38 A;  4LRZ E;  3LUQ A;  3UB8 A;  3EEH A;  2HV1 A;  1OTD A;  1ODV A;  1XJ3 A;  4HP9 A;  4LLO B;  1S1Y A;  4KUO A;  3H82 B;  3GEC A;  1P0Z A;  4I39 A;  3BY8 A;  5DKK A;  4EET B;  3MR0 A;  2VV7 A;  4L9F A;  3C8C A;  4LPZ A;  3RH8 B;  2ZOH A;  2B02 A;  2WKR A;  5F68 A;  4E04 A;  1EW0 A;  1TS7 A;  1Y28 A;  2PYR A;  3VOL A;  2JN7 A;  2CMN A;  1UGU A;  3CLO A;  4K08 A;  1LT0 A;  4EER A;  3K3D A;  3IBR A;  2V9A A;  2QJ7 A;  3NOU C;  3OLO A;  2L4R A;  3MQQ A;  2YKH A;  2OWH A;  3K3C A;  4GS9 B;  3CAX A;  4HNB A;  1XJ6 A;  2PHY A;  3A0S A;  2EA9 A;  4NXB A;  4PKY A;  4NXF A;  1P97 A;  4B9O A;  3LIA A;  1TS8 A;  2L0W A;  2INW A;  4GHI B;  2WKQ A;  2V1A A;  5TBM B;  3SW1 A;  1OTB A;  1OTI A;  3LIE A;  1JNU A;  1WA9 A;  1T19 A;  4WLA A;  5EFW A;  2OOL A;  2KDK A;  1XFQ A;  3LI9 A;  4WN5 A;  4HJ6 A;  5DJT A;  5AVF A;  3KX0 X;  4WUJ A;  1T1C A;  3UB7 A;  3VE4 A;  3EWK A;  2PDR A;  4EES A;  5IU1 A;  3ULF A;  5J7E A;  3BY9 A;  1XFN A;  1LSV A;  2A24 A;  1DRM A;  4WL9 A;  1LSX A;  4EQ1 A;  5I5L A;  4R3A A;  4HIA A;  3NHQ A;  1F9I A;  1T1B A;  2QWS A;  2V1B A;  3E4P A;  1GSX A;  3BWL A;  4I5S A;  4YWZ A; 
#chains in the Genus database with same CATH topology
 1IYS A;  3F1O B;  2JE5 A;  3CPT A;  3NCK A;  1YLP A;  4MLL A;  2V0U A;  4ZJ2 A;  1KE3 A;  2Y91 A;  1MZU A;  2KLI A;  2ZQA A;  1YKD A;  5FQJ A;  1TS6 A;  1GSV A;  3PAE A;  5TBM A;  3QNC A;  1WYC A;  1VHM A;  3LYX A;  2P9V B;  3MQO A;  2VZW A;  5HDD A;  2JKT M;  1ONH A;  3MKE A;  2KX6 A;  2X02 A;  2HPB A;  4XUZ A;  3VFH A;  3C38 A;  3HUN A;  1BT5 A;  4F3L B;  5G4Z A;  4R0Q A;  1KDW A;  2Y2L A;  1DP6 A;  2V0W A;  1D7E A;  4IUH A;  3N8L A;  3HJI A;  2JC7 A;  4MN5 A;  4XT2 A;  4HQA A;  1JVJ A;  3UB8 A;  2RL3 A;  3LUQ A;  4KZ4 A;  5DKK A;  4S2N C;  1PZP A;  4NG2 A;  2PYR A;  2IWB A;  3Q7Z A;  1XA1 A;  2XLN A;  4OPQ A;  5AQB A;  5HPI A;  4RX3 A;  4MDZ A;  4HNB A;  4B88 A;  4Z9Q A;  3R7W A;  5IT5 A;  2JBF A;  4OOM A;  3FPV A;  1BZA A;  5EFW A;  4C75 A;  3SS5 A;  3ITB A;  4HJ6 A;  5FAQ A;  4EES A;  2BG1 A;  2EXA A;  2ZC4 B;  2WUQ A;  1J9M A;  2VGJ A;  4DE3 A;  2VA0 A;  1JWZ A;  4YNR A;  3NHQ A;  5A92 A;  1XX2 A;  3PBT A;  1IYO A;  4I5S A;  3W4Q A;  1BLP A;  1L2S A;  1UWN X;  5FA7 A;  4MN6 A;  3S7Q A;  2QYB A;  4IVI A;  4NXE A;  4BEN A;  4HHD A;  2ZMA A;  4QY5 A;  3Q81 A;  2QZ6 A;  4EUV A;  2ZQ7 A;  2H0T A;  1VQQ A;  3IXH A;  5AJG A;  3IS2 A;  4HH3 A;  3DAV A;  5FAT A;  5HAI A;  3G35 A;  2WYX A;  5E2G A;  3LI8 A;  3PR6 A;  4KZB A;  2P08 A;  1X0O A;  3MKF A;  3BJN A;  5CHM A;  4MBF A;  2O9C A;  1PRQ A;  3D72 A;  3CJM A;  1H8M A;  3NJA A;  1CEG A;  1SDE A;  4CLC B;  5EVI B;  2VEA A;  4BD0 A;  3N8R A;  3A3I A;  5J3W A;  2PR6 A;  1NRJ A;  4CPK A;  1OTD A;  1LI9 A;  4P0M A;  4Z1W A;  1I2W A;  4R4S A;  1ONG A;  2VV7 A;  3VOL A;  3BFC A;  3K3D A;  3U2A A;  1YT4 A;  3FKW A;  1ESU A;  4GDB A;  2IWD A;  1CI9 A;  4BL2 A;  4Y7P A;  2WKQ A;  5MC7 A;  4UHU A;  2OLU A;  2KDK A;  3VE4 A;  3CUE A;  4UAA A;  4OQG A;  1IEM A;  2VGK A;  5I5L A;  3E4P A;  4QY6 A;  4OPY A;  4UA7 A;  1JWV A;  5A8B A;  2ZOI A;  2VLG A;  3PHY A;  2Y2P A;  1I2S A;  5HDS A;  4L9E A;  3ITA A;  4Y0U A;  4X25 A;  4QPR A;  4XXR A;  4H6J B;  4MBH A;  5F69 A;  3CMZ A;  3LFV A;  5FQ9 A;  1LSW A;  1MY8 A;  3IS2 B;  2R9X A;  4R70 A;  4HY8 A;  5A93 A;  3UY6 A;  1LL8 A;  3LIC A;  1AXB A;  3F1P B;  1JWP A;  1TDG A;  1ES4 A;  1FOF A;  5K5B A;  3IXB A;  4GD6 A;  1FCO A;  3MJQ A;  3IWI A;  1C3B A;  4DJ2 A;  4MCW A;  5FI6 A;  5M19 A;  3UO9 A;  4JF6 A;  5TGF A;  3UB6 A;  1XGJ A;  5L10 A;  3C30 A;  2QHK A;  4KG2 A;  2PR5 A;  3E4Q A;  1FCM A;  3ZVT A;  1OTA A;  2Z6C A;  2WGW A;  2HV1 A;  4B93 A;  3C8C A;  2WKR A;  3LR4 A;  3EQV A;  4UA6 A;  4IED A;  1K54 A;  4XUX A;  4NXF A;  1MBL A;  4B9O A;  4GHI B;  5EUA A;  2C5W B;  2A2L A;  4KZ5 A;  4S2O A;  5EVL A;  1QMF A;  4WL9 A;  4F94 A;  4R3J A;  1PI5 A;  4GOG A;  3WWX A;  3RXW A;  3IXD A;  2V2F F;  2PAV P;  2NUP C;  4HES A;  4OLD A;  3LCE A;  5EM1 A;  2HDU A;  1OT6 A;  4NK3 A;  4EXO A;  2M7U A;  2R78 A;  3C7V A;  3FV7 A;  4KQD A;  4KG6 A;  4GS9 A;  5HD3 A;  5GLB A;  3UE0 A;  4M4X A;  3RXX A;  1G28 A;  4ZAM A;  4Q8I A;  1UWP X;  2XH9 A;  2G2U A;  4FD8 A;  1YMS A;  4EW7 A;  2XDM A;  1N9N A;  4B4Z A;  3CI6 A;  3G30 A;  1NXY A;  5EPH A;  1FSY A;  5L09 A;  3F1O A;  4LRY C;  2V8C A;  3ICY A;  3HCY A;  2IWC A;  2ZL1 B;  2VV8 A;  3IF5 A;  4LEN A;  1I5Q A;  4RQ9 A;  1IKI A;  4D60 A;  2XD5 A;  5FSR A;  2W27 A;  3CUE C;  1OTE A;  4Y15 A;  5TFQ A;  4G3K A;  2J80 A;  1KVL A;  1VM1 A;  2XA7 M;  3FKV A;  4LFU A;  3OCL A;  4EET B;  2XRO A;  3JYI A;  3LY3 A;  1HLU P;  3AGE A;  4GDN A;  1XJ6 A;  5L8M A;  2DMW A;  4X55 A;  3S4X A;  4GKU A;  3LIE A;  2V20 A;  2UWX A;  4WZ4 A;  2MJ6 A;  3Q82 A;  5G18 A;  2XEP A;  2CC1 A;  2WZZ A;  4R3A A;  4O01 A;  4E3K A;  3A3E A;  2BLS A;  1GSX A;  2J9P A;  4E3N A;  3E4O A;  5A91 A;  1L0D A;  3VSL A;  4ETZ A;  1BTL A;  4LV3 A;  3TRC A;  1T1A A;  2WAF A;  4S2P A;  3W4O A;  4EEP A;  2L1M A;  4EV4 A;  1BLC A;  1LI0 A;  1TS0 A;  1G6O A;  3NC8 A;  1IFQ A;  4QHC A;  5FAS A;  1GA9 A;  1YPR A;  2Y8H A;  4JGO A;  2OSU A;  4C3Q A;  4E3M A;  4CLC E;  1CEF A;  3ISG A;  2J9O A;  3T4T A;  1E25 A;  3Q7V B;  3QP1 A;  2OWJ A;  4C6Y A;  2W3G A;  4X1L A;  5FQI A;  1Y4O A;  2VGL M;  1L3L A;  1TF1 A;  4OP5 A;  1W8Q A;  2Q9N A;  1PZO A;  3NUL A;  4HI4 A;  1DY6 A;  3BQ8 A;  3IF6 B;  3UE3 A;  5GHX A;  1XPB A;  3UNW A;  4JXW A;  3HLE A;  3GRJ A;  5LBR A;  5FI2 A;  4LRZ E;  3WRZ A;  3S7N A;  3MR0 A;  2W3H A;  3T4L A;  3CLO A;  3OLO A;  5CHJ A;  3MQQ A;  3SH9 A;  5EOO A;  2Y2O A;  4GJ4 A;  1TS8 A;  4E6X A;  3EOI A;  1LL9 A;  4IJG A;  1JNU A;  2P74 A;  3MS6 A;  4WLA A;  2HJE A;  3GVB A;  4WN5 A;  2JCH A;  2M7V A;  1FIK A;  3G34 A;  2XSS A;  3ULF A;  2P04 A;  1XFN A;  4IHQ A;  1ZG6 A;  1DRM A;  5CEB A;  3MQ0 A;  1ERQ A;  1W8Y A;  4II7 A;  2JHE A;  1MXO A;  3IWO A;  1VET A;  3P98 A;  4DRT A;  2EXB A;  4N9L A;  4F3L A;  3MXQ A;  2WAE A;  4FSF A;  1VEU B;  1PFL A;  3DBA A;  3NDE A;  4ZJ1 A;  1ERM A;  3QP8 A;  4UQI M;  1NRF A;  4OPR A;  3HUO A;  1FSW A;  4OOY A;  5HD5 A;  3UDF A;  3MMH A;  4OP8 A;  3H82 A;  5TR7 A;  2PYP A;  2H28 A;  2ZMF A;  1O07 A;  2JKG A;  1KE0 A;  5DF7 A;  5EVI D;  3IX8 A;  5GLA A;  1CI8 A;  3GMW A;  3E2L A;  4DKI A;  1NWZ A;  3BQA A;  2EX6 A;  3ZNT A;  2J3T D;  4I38 A;  1XKZ A;  1W79 A;  5F68 A;  1TS7 A;  5TJJ A;  2CMN A;  3ZG9 B;  2EWW A;  4ZJ3 A;  4GS9 B;  2ZQ8 A;  2Y4A A;  5CX7 A;  3WS2 A;  4DN0 A;  5HPF A;  1AWI A;  4P6Z S;  3V50 A;  3LIA A;  1NZO A;  4E3J A;  3MZD A;  3IHB A;  1ACF A;  3V67 A;  4KQR A;  3TW8 A;  2A24 A;  4OH0 A;  5FQQ A;  3R4K A;  2E8J A;  4P87 A;  1KVM A;  3U4L P;  1ZHH B;  3B42 A;  1XP4 A;  4YFM A;  1Y54 A;  2Y55 A;  1NZU A;  2J3W A;  1J3W A;  4P6B A;  4OQH A;  4R23 A;  2BAS A;  4K0W A;  3NI9 A;  1ES3 A;  3OZH A;  3MSH A;  5IS1 A;  2HP6 A;  3HVF A;  3OPR A;  2WGW B;  3MFX A;  4PMA A;  5KSH A;  3BLS A;  4UA9 A;  1FQG A;  4X1M A;  2XGN A;  1SHV A;  1K54 C;  3BLM A;  4R3B A;  5CEC A;  2OAP 1;  4HH2 A;  1PWD A;  3QHY A;  2O9B A;  3EGD C;  5G4Y A;  4S2N A;  3IT9 A;  1D1J A;  4BLM A;  4LRX C;  1E3U A;  4GCZ A;  4RVA A;  1DJB A;  5CRF A;  4IBX A;  2Y79 A;  3T4K A;  3UMD A;  2LB5 A;  5AQA A;  1Q2Q A;  2EX9 A;  2ZBB A;  1KE4 A;  1YSP A;  3UDX A;  5EE8 A;  1XJ3 A;  3GEC A;  1H3Q A;  2B02 A;  3MZE A;  2JN7 A;  3VP0 A;  2V9A A;  4FH2 A;  1ALQ A;  3UDI A;  3K3C A;  3PAG A;  3NDG A;  3N6I A;  2FH5 A;  2EX8 A;  3KSF A;  1OTI A;  3HRE A;  3VV4 A;  1XFQ A;  5DJT A;  1L0G A;  5KZH A;  2AVX A;  2W3F A;  3DTE A;  2Y2Q A;  3GSG A;  1IKG A;  3TSG A;  1W7F A;  3AGF A;  2X01 A;  5CXW A;  2ZC5 B;  1PWC A;  1OPX A;  2ZL1 A;  3MFD A;  1Z6F A;  3B33 A;  3PXP A;  4K0X A;  2Z6D A;  2Z2L B;  4HJ3 A;  1T18 A;  4KG5 A;  4N9K A;  4JF5 A;  1F98 A;  5KMW A;  2ZD8 A;  5F6A A;  2E8I A;  1ES5 A;  3A3F A;  2WKH A;  2RCX A;  4JBF A;  4ZTK A;  4ESP A;  3G6O A;  2WK0 A;  3S1Y A;  3RFB A;  3QP5 A;  3F1N B;  3F1N A;  4LGW A;  3A3D A;  4WEL A;  5IHV A;  3DWK A;  3BFF A;  4R6L A;  3WS4 A;  5L2F A;  2WGV A;  1H0M A;  2O0Y A;  3M2K A;  4LCM A;  3BW6 A;  4JKT A;  3HBR A;  1CK3 A;  4DJ3 A;  4GHI A;  3HJK A;  2PD7 A;  4BMW A;  4P85 A;  3UE1 A;  2QKP A;  3PBO A;  5L07 A;  4IBR A;  3HLF A;  3LR0 A;  4GD8 A;  5DTT A;  4S2J A;  1MWR A;  2R9W A;  2WGI A;  3IF6 A;  2YKH A;  2HJ9 C;  2EX2 A;  1H8Y A;  2EA9 A;  4DDS A;  4ETX A;  2INW A;  2V1A A;  1A0K A;  1RP5 A;  1OTB A;  4QWO A;  1W5D A;  5J8X A;  4PM6 A;  4FH4 A;  1HD8 A;  5A90 A;  5J7E A;  4D2O A;  4X53 A;  4S2M A;  1GHI A;  1BUL A;  3BFE A;  1PW1 A;  2Y59 A;  2PBY A;  3BWL A;  4JF4 A;  5FI7 A;  4EBL A;  1WE4 A;  4EU0 A;  4QU3 A;  3IH8 A;  3PYP A;  4O0P A;  1Q2P A;  5FEF A;  3ZFZ A;  4GNU A;  4OPZ A;  4HOI A;  3LIB A;  3ZG0 A;  1O7E A;  2X71 A;  1BUE A;  2ZLY A;  5HDC A;  4G3V A;  2PRF A;  1S66 L;  4PM5 A;  4CLC C;  3Q7V A;  1VET B;  2PD8 A;  3OCN A;  5KSC A;  3H7W B;  4IUK A;  3C5A A;  5HW3 A;  2HDR A;  1LL5 A;  2QPN A;  4S2I A;  2B18 A;  1DJA A;  2ZC7 A;  1G6A A;  3R7W B;  4NXG A;  3MXR A;  4FTX A;  5FL3 A;  4RX2 A;  3ZNY A;  3ZVW A;  4Y13 A;  4U3T A;  4Y0O A;  2P9V A;  2JKR I;  1ERO A;  3BEC A;  4L0L A;  1G5U A;  1Y28 A;  2XFT A;  2EFX A;  4GB7 A;  1FR1 A;  3JPU A;  4UQI S;  5HAQ A;  2XD1 A;  4JPM A;  5HAR A;  1K25 A;  3IXG A;  1T19 A;  4GN2 A;  5HSQ A;  5EEC A;  1T1C A;  1XA7 A;  4YOF A;  1YLW A;  4KZ6 A;  3P09 A;  4JXS A;  2DNS A;  1S4R A;  1ES2 A;  1SKF A;  4X69 A;  2XF3 A;  4HEF A;  3C2W A;  5CTM A;  2DRW A;  1YSQ A;  3SH7 A;  4GZB A;  5GL9 A;  5F1F A;  1YLZ A;  1ZC2 A;  4WYY A;  2H10 A;  2Q0O A;  3K2N A;  2XR0 A;  3ZCZ A;  5KIZ A;  1YAX A;  3TE8 A;  2Y2K A;  3D4F A;  3V3R A;  5F83 A;  1XJ4 A;  3T1Q B;  4ARZ B;  5GHY A;  1NYM A;  2G2W A;  1K4F A;  2LB9 A;  3O3V A;  3PBS A;  1K57 C;  4H6J A;  2K7S A;  2PU2 A;  5HL1 A;  1KOU A;  2I72 A;  3T1S A;  4A5R A;  3A0V A;  3QP6 A;  2A24 B;  1PIO A;  1KGG A;  3T50 A;  4KZ7 A;  3PBQ A;  1BYW A;  3HLD A;  4OQ0 A;  5HWV A;  4CJN A;  5HAP A;  3H82 B;  2XA7 S;  2HP9 A;  3WS1 A;  1W63 M;  4EQI A;  3TG9 A;  3GQZ A;  1U60 A;  3KSH A;  3A0S A;  4PAU A;  3SW1 A;  5E2F A;  4EBP A;  1PNE A;  2OOL A;  1GCE A;  3EWK A;  3HUM A;  1RGZ A;  3QP4 A;  4WMC D;  3KO6 A;  5EVI A;  3UPO A;  2QWS A;  2V1B A;  2EWV A;  1M40 A;  3FPW A;  3L7H A;  4DE0 A;  4OKP A;  2JKT I;  5BOH A;  2VJW A;  2KOI A;  4OOL A;  4Y2F A;  5CTN A;  3GDI A;  1GSW A;  3VOY A;  5CER A;  4K91 A;  1KGF A;  1ESI A;  5JYP A;  4PM9 A;  1SCW A;  4EWF A;  3EGX C;  4DDY A;  1NYY A;  3RTY A;  5AQ9 A;  3LR5 A;  1KGE A;  4L9G A;  2G7U A;  2WKP A;  5HWT A;  4MEZ A;  1V9Z A;  2PBD P;  3DTI A;  5DTS A;  4JLF A;  3HLB A;  4Q0I A;  2J3T C;  3B3X A;  3AGD A;  4E3L A;  1CF0 A;  4WMC A;  5CGX A;  2OV5 A;  4BWI A;  1JTD A;  1TEM A;  5HX9 A;  5HZH A;  3LEZ A;  3CWF A;  4WF0 A;  1S4S A;  1ZKJ A;  3A3J A;  3MXS A;  2Y2M A;  3LY4 A;  2WKI A;  2WAD A;  2NUT C;  2QMI A;  1DP9 A;  3FC7 A;  2ZC6 B;  2V1Z A;  1S1Y A;  1MWU A;  1SZV A;  1EW0 A;  4O7D A;  1BLS A;  5FQK A;  1K57 A;  4ARZ A;  2DCF A;  1N9B A;  1NY0 A;  2VK3 A;  4FCF A;  3UPN A;  3UN7 A;  4P6Z M;  1FIL A;  3LI9 A;  5DVA A;  3KX0 X;  5DF8 A;  5EVE A;  5E43 A;  5U47 A;  1CQA A;  1P9R A;  4Q0H A;  1E3U D;  3GTC A;  5FEG A;  4EQ1 A;  1T1B A;  3OBF A;  4NXB A;  3UE6 A;  1F5M A;  5DKL A;  3WRT A;  4ZBE A;  2XFS A;  4WBG A;  3C4O A;  3BEB A;  4PM8 A;  4OON A;  4I3I A;  3P01 A;  2W1T B;  2W1T A;  3G31 A;  1L0F A;  4UEY A;  4BBV A;  5HL6 A;  2HDS A;  5GLD A;  4BL3 A;  3NIA A;  1YLT A;  3VP1 A;  4I3A A;  1FCN A;  3GV9 A;  1STZ A;  3SH8 A;  2Y2J A;  3N4I A;  2Y2G A;  1M6K A;  2W0N A;  3QNB A;  1OJG A;  2VGL S;  4ZDX A;  1N9O A;  2J8Y A;  3W2Z A;  4BBT A;  2M1C A;  2ZQ9 A;  4DE2 A;  3Q1F A;  4PHT A;  1TD5 A;  3MZF A;  1K56 D;  3FWL A;  3VOZ A;  3ZG7 B;  3W8K A;  4DXB A;  4OQI A;  5CGW A;  3E98 A;  3VE3 A;  1HZO A;  1Z09 A;  2HGV A;  2ZM8 A;  1VB6 A;  3DTK A;  2FZ0 A;  5CHU A;  1WYB A;  1PI4 A;  4Y5F A;  1RCJ A;  3V39 A;  3BRM A;  3SZT A;  4WEJ A;  1BSG A;  3IBR A;  2L4R A;  3BYD A;  1K6R A;  3JVU A;  1KDS A;  4EUZ A;  1P97 A;  1YQS A;  3M6H A;  2GDN A;  3S22 A;  5IU1 A;  1LLB A;  4OLG A;  1LSV A;  3IBJ A;  3TJZ C;  1MC0 A;  2GNX A;  1F9I A;  4HBU A;  4NET A;  3MF0 A;  1L0E A;  3LID A;  5DJU A;  1PW8 A;  4N1H A;  2FFF B;  4AFI A;  4O8G A;  1D06 A;  4KQO A;  5E2E A;  2B95 A;  4U0T A;  2Q9M A;  1GHM A;  1XGI A;  5F5Y A;  4MBK A;  1H8Z A;  4KUK A;  1N4O A;  1NLY A;  4E6W A;  4DXC A;  4FOF A;  5HFO A;  4WZ5 A;  5FAP A;  5DF9 A;  3VP4 A;  3D3O A;  3FZC A;  3PBN A;  4I3J A;  3IH9 A;  3DTM A;  5AVE A;  4EBN A;  3IQA A;  3VP3 A;  1DP8 A;  2O9A A;  4OVD A;  1W63 Q;  2VKS A;  5CED A;  3N8S A;  2JKF A;  4GW9 A;  1EI5 A;  3WS5 A;  4BBU A;  5HWW A;  3IWQ A;  1XXM A;  5GHZ A;  1S67 L;  2ZM2 A;  3EQU A;  4G3W A;  3NOP C;  2HZ5 A;  4E3I A;  3W4P A;  1IYQ A;  3HLC A;  4ID4 A;  3HL9 A;  4DE1 A;  4LV2 A;  1PWG A;  1XJ2 A;  3GR2 A;  3TOI A;  3UPP A;  1ODV A;  3JVV A;  2C6W B;  3LO7 A;  4HP9 A;  4LLO B;  4KUO A;  4I39 A;  1P0Z A;  3BY8 A;  4LPZ A;  2XK1 A;  5F1G A;  1MKM A;  4DF6 A;  4R4R A;  4EER A;  3HLG A;  5JYO A;  3CAX A;  2HF6 A;  1K56 A;  2J7V A;  3KYQ A;  5TBM B;  3T4Q A;  4X56 A;  2BTF P;  4H8R A;  1FR6 A;  1IOU A;  5AVF A;  3VSK A;  3OPL A;  3BY9 A;  2UV0 E;  2ZC3 B;  4KQQ A;  3KYE A;  2H5S A;  5GLC A;  4YWZ A;  4EEU A;  3LEQ A;  4CLC D;  4HBT A;  1HVB A;  3B47 A;  3G4P A;  4KZ9 A;  3PTE A;  4JGP A;  3O86 A;  5M18 A;  4M3K A;  4ME4 A;  2ZQC A;  3UB9 A;  3BFG A;  3M2J A;  4Y3I A;  3ZG8 B;  1YMX A;  3ZQ5 A;  3G2Y A;  2PT7 A;  3H7W A;  4WEK A;  1HTZ A;  4X68 A;  1YLJ A;  2Z2M B;  4KEN B;  1MPL A;  1N9L A;  1G68 A;  3FG8 A;  3UB5 P;  1V9Y A;  1H5X A;  4Q0J A;  3V5M A;  4R38 A;  5AQ7 A;  2FFY A;  4XT2 B;  2V8F A;  4NKP A;  5J4E A;  3I7J A;  4JGQ A;  1JTG A;  3CG5 A;  4PPR A;  3ZGA B;  3CIT A;  3MBZ A;  3IHA A;  3LGO A;  3PBR A;  1E4D A;  1S6R A;  3LR3 A;  2H0Y A;  5DFX A;  1LT0 A;  2QJ7 A;  1TVF A;  2ZMV A;  1YM1 A;  4PKY A;  2L0W A;  2HP5 A;  3T1R A;  4GLQ A;  4QB8 A;  1OME A;  2Y2I A;  3UB7 A;  3HLW A;  2W3D A;  2XRN A;  3O87 A;  1TDL A;  4CLC A;  2ZJ9 A;  5FAO A;  2HDQ A;  3D9Y A;  4HIA A;  2P7J A;  3P7N A;  5EOE A;  1S1Z A;  2K31 A;  3OPP A;  3CHW P;  3C4P A;  4B4X A;  5FQM A;  3EEA A;  2Y2N A;  1SDN A;  4Y17 A;  1MWT A;  1VEU A;  3G32 A;  2D01 A;  3VFF A;  3ZHH A;  1K55 C;  4WM9 A;  4S2L A;  5M1A A;  2A3U A;  3L9K A;  4DMZ A;  3NEC A;  4MMN A;  4N92 A;  3T4O A;  1SKO A;  2XQZ A;  3A0R A;  4KZ3 A;  3ZYT A;  4HP4 A;  4HJ4 A;  3S7O A;  3ZDJ A;  5C5K A;  4LV0 A;  5EV0 A;  2ZM0 A;  5FDS A;  4KZA A;  3SOI A;  4RYE A;  4Y0T A;  3CZD A;  1PYY A;  3NBL A;  3QP2 A;  3OC2 A;  3NOT C;  3EEH A;  2Y2H A;  3C7U A;  4R1G A;  3KYZ A;  1IYP A;  2ZOH A;  1SKO B;  2WZX A;  1QME A;  4K08 A;  1K6S A;  3NOU C;  2OWH A;  1K38 A;  5FDH A;  3ZG5 A;  1EWZ A;  1K4E A;  1LHY A;  3N7W A;  2GX5 A;  4WUJ A;  2PDR A;  4KZ8 A;  2PU4 A;  2W3E A;  1ZTU A;  4N1X A;  3DW0 A;  4S2K A;  3RJU A;  4LCL A;  3O5Y A;  4BJP A;  3F1P A;  1ZG4 A;  1F2K A;  3BM6 A;  3KSG A;  3E0Y A;  3H9W A;  3VMA A;  3SS3 A;  2VX8 A;  4BD1 A;  3WS0 A;  4JXG A;  4JXV A;  4MN7 A;  1S0W A;  3OOV A;  3LIF A;  1YLY A;  5E2H A;  2VV6 A;  3T4S A;  3G2Z A;  1OJ5 A;  4PM7 A;  3NY4 A;  5I94 A;  3T1X A;  4WZ5 C;  3E2K A;  2QJ5 A;  1K55 A;  3KSI A;  3IX3 A;  4NEE D;  2YKF A;  4BQM A;  2K2N A;  2GJ3 A;  3IF6 C;  3UME A;  4X6T A;  4YIN A;  1RGY A;  2OLV A;  3V3S A;  3Q07 A;  2ZQD A;  2B5R A;  1K0K A;  3T4J A;  2IA2 A;  2OAQ 1;  5F82 A;  2D02 A;  5EM0 A;  4PKY G;  3T12 B;  3BFD A;  1NLZ A;  3M6B A;  3SS4 A;  2A49 A;  1CJF A;  2I9V A;  3DWZ A;  4LV1 A;  1OT9 A;  3OPH A;  2EFU A;  4JGR A;  1IEL A;  4CQH A;  3FYZ A;  3CPT B;  5DFY A;  3VP2 A;  4IVK A;  4L9F A;  3IX4 A;  5DTK A;  3RH8 B;  4E04 A;  2ACG A;  1GA0 A;  1NJ4 A;  1UGU A;  4U0X A;  4QD4 A;  2PHY A;  2WKE A;  1GHP A;  2O99 A;  1P9W A;  3S7P A;  1WA9 A;  4FUW A;  4ZRR A;  1BLH A;  2GZA A;  4MNR A;  4QJG A;  5EVI C;  1MWS A;  4E3O A;  1DJC A;  5D3O A;  3O88 A;  1LSX A;  1MKI A;  2W1R A;  2JKR M;  5CGS A;  4RA7 A; 
#chains in the Genus database with same CATH homology
 3LID A;  5DJU A;  3F1O B;  3E4O A;  4AFI A;  4EU0 A;  2V0U A;  4O8G A;  1D06 A;  4ETZ A;  3PYP A;  4KQO A;  4O0P A;  3TRC A;  1T1A A;  4EEP A;  1MZU A;  2L1M A;  2KLI A;  5F5Y A;  1TS0 A;  1G6O A;  1YKD A;  4KUK A;  1IFQ A;  4HOI A;  3LIB A;  1TS6 A;  1NLY A;  1GSV A;  5TBM A;  4FOF A;  5HDC A;  1VHM A;  3LYX A;  4G3V A;  5HDD A;  2Y8H A;  2VZW A;  3MQO A;  4JGO A;  5DF9 A;  2JKT M;  1S66 L;  4CLC E;  3D3O A;  3T4T A;  2KX6 A;  4CLC C;  3PBN A;  2PD8 A;  3OCN A;  4I3J A;  2OWJ A;  3H7W B;  4IUK A;  3C38 A;  5AVE A;  1DP8 A;  2W3G A;  2O9A A;  4F3L B;  1W63 Q;  2B18 A;  5G4Z A;  2VKS A;  2VGL M;  4GW9 A;  1DP6 A;  3R7W B;  4NXG A;  4BBU A;  1TF1 A;  5HWW A;  5FL3 A;  2V0W A;  4HI4 A;  1S67 L;  3BQ8 A;  1D7E A;  4IUH A;  3EQU A;  3HJI A;  4G3W A;  3NOP C;  4MN5 A;  3UE3 A;  4XT2 A;  4HQA A;  5LBR A;  4LRZ E;  1XJ2 A;  3UB8 A;  3LUQ A;  2JKR I;  3S7N A;  1ODV A;  3JVV A;  4HP9 A;  4LLO B;  4KUO A;  4I39 A;  1P0Z A;  5DKK A;  3BY8 A;  4L0L A;  3MR0 A;  4LPZ A;  2W3H A;  2PYR A;  1Y28 A;  1MKM A;  3T4L A;  3CLO A;  4EER A;  3OLO A;  5HPI A;  3MQQ A;  4MDZ A;  3CAX A;  2HF6 A;  4HNB A;  4UQI S;  4GJ4 A;  3R7W A;  5IT5 A;  1TS8 A;  3KYQ A;  3EOI A;  4OOM A;  5TBM B;  3T4Q A;  3FPV A;  4IJG A;  1JNU A;  1T19 A;  4WLA A;  2HJE A;  5EFW A;  4WN5 A;  1IOU A;  4HJ6 A;  5AVF A;  5HSQ A;  4EES A;  1T1C A;  2M7V A;  2XSS A;  3ULF A;  2P04 A;  3BY9 A;  1XFN A;  4IHQ A;  1DRM A;  4YOF A;  2VA0 A;  4YNR A;  3MQ0 A;  3NHQ A;  3PBT A;  4I5S A;  4YWZ A;  4EEU A;  1S4R A;  4II7 A;  2JHE A;  1UWN X;  4CLC D;  4MN6 A;  3C2W A;  3S7Q A;  1YSQ A;  2QYB A;  3B47 A;  4F3L A;  4NXE A;  3MXQ A;  4HHD A;  4JGP A;  4ME4 A;  3K2N A;  3UB9 A;  4FSF A;  3DBA A;  5KIZ A;  4Y3I A;  4UQI M;  4EUV A;  1YAX A;  3TE8 A;  3ZQ5 A;  5AJG A;  2PT7 A;  3IS2 A;  4HH3 A;  3H7W A;  4WEK A;  1XJ4 A;  5HD5 A;  1N9L A;  4ARZ B;  3MMH A;  3FG8 A;  3H82 A;  3LI8 A;  3PR6 A;  2PYP A;  2H28 A;  2P08 A;  1V9Y A;  1X0O A;  2ZMF A;  3BJN A;  2LB9 A;  4H6J A;  3PBS A;  2K7S A;  2O9C A;  4Q0J A;  3D72 A;  4R38 A;  1KOU A;  1H8M A;  3NJA A;  1NWZ A;  3A0V A;  3BQA A;  2A24 B;  4CLC B;  4XT2 B;  4NKP A;  5J4E A;  3T50 A;  2VEA A;  3PBQ A;  2J3T D;  4JGQ A;  1BYW A;  5J3W A;  4I38 A;  5HWV A;  2PR6 A;  1NRJ A;  1OTD A;  3CIT A;  3H82 B;  4Z1W A;  2XA7 S;  2VV7 A;  3PBR A;  5F68 A;  1TS7 A;  3LR3 A;  1W63 M;  5TJJ A;  3VOL A;  2CMN A;  5DFX A;  1LT0 A;  3K3D A;  2QJ7 A;  3U2A A;  2EWW A;  4GS9 B;  5CX7 A;  2ZMV A;  4DN0 A;  3KSH A;  3A0S A;  4PKY A;  5HPF A;  4P6Z S;  3LIA A;  4PAU A;  2L0W A;  2WKQ A;  3SW1 A;  4GLQ A;  5MC7 A;  2OOL A;  2KDK A;  3UB7 A;  3V67 A;  3VE4 A;  3EWK A;  2W3D A;  3CUE A;  3TW8 A;  2XRN A;  4CLC A;  2A24 A;  3KO6 A;  5I5L A;  3R4K A;  4HIA A;  2QWS A;  2V1B A;  3FPW A;  2EWV A;  3E4P A;  2JKT I;  2P7J A;  3P7N A;  2VJW A;  2KOI A;  4OOL A;  4Y2F A;  1S1Z A;  3GDI A;  1GSW A;  2K31 A;  5A8B A;  1ZHH B;  2ZOI A;  3B42 A;  2VLG A;  3EGX C;  3PHY A;  2J3W A;  3RTY A;  3EEA A;  5HDS A;  4L9E A;  3LR5 A;  2BAS A;  4QPR A;  2D01 A;  4H6J B;  5F69 A;  3LFV A;  4L9G A;  5IS1 A;  2G7U A;  3MFX A;  2WKP A;  5HWT A;  1V9Z A;  4DMZ A;  5KSH A;  1LSW A;  3IS2 B;  4MMN A;  4R70 A;  3T4O A;  4HY8 A;  1LL8 A;  3LIC A;  3A0R A;  4Q0I A;  3ZYT A;  2J3T C;  2OAP 1;  3F1P B;  4HH2 A;  4HP4 A;  4HJ4 A;  3S7O A;  5K5B A;  2O9B A;  3EGD C;  5C5K A;  5G4Y A;  4BWI A;  3MJQ A;  4LRX C;  4DJ2 A;  5HZH A;  4GCZ A;  3CWF A;  4MCW A;  4WF0 A;  1S4S A;  2Y79 A;  3UB6 A;  3T4K A;  3C30 A;  3UMD A;  2LB5 A;  2NUT C;  2QHK A;  3OC2 A;  2PR5 A;  3E4Q A;  3NOT C;  1DP9 A;  1OTA A;  2ZBB A;  3FC7 A;  2Z6C A;  1YSP A;  3EEH A;  2HV1 A;  1XJ3 A;  1S1Y A;  3GEC A;  1H3Q A;  3KYZ A;  4B93 A;  3C8C A;  2ZOH A;  2B02 A;  2WKR A;  1EW0 A;  2JN7 A;  4K08 A;  3LR4 A;  2V9A A;  3EQV A;  3NOU C;  2OWH A;  3K3C A;  4ARZ A;  4NXF A;  4B9O A;  2FH5 A;  4GHI B;  3KSF A;  1OTI A;  3VV4 A;  2A2L A;  4P6Z M;  1XFQ A;  3LI9 A;  5DJT A;  2GX5 A;  3KX0 X;  4WUJ A;  2PDR A;  2W3F A;  2W3E A;  1ZTU A;  1P9R A;  4WL9 A;  4Q0H A;  3O5Y A;  4EQ1 A;  1T1B A;  4BJP A;  3OBF A;  3F1P A;  4NXB A;  2NUP C;  3UE6 A;  3KSG A;  3E0Y A;  1F5M A;  5DKL A;  1OT6 A;  3H9W A;  4EXO A;  2M7U A;  2R78 A;  1OPX A;  2VX8 A;  4KQD A;  3B33 A;  4I3I A;  3PXP A;  3P01 A;  4MN7 A;  2W1T B;  4GS9 A;  2W1T A;  3OOV A;  2Z6D A;  5HD3 A;  4UEY A;  4HJ3 A;  3LIF A;  4BBV A;  1T18 A;  5HL6 A;  4M4X A;  2VV6 A;  3T4S A;  1F98 A;  1OJ5 A;  1G28 A;  5F6A A;  4I3A A;  1UWP X;  2QJ5 A;  1STZ A;  3KSI A;  4EW7 A;  2W0N A;  3G6O A;  4NEE D;  1N9N A;  2YKF A;  3RFB A;  2K2N A;  1OJG A;  2VGL S;  2GJ3 A;  1N9O A;  4BBT A;  3W2Z A;  3CI6 A;  3F1N B;  3UME A;  3F1N A;  4WEL A;  2M1C A;  3F1O A;  4R6L A;  4LRY C;  4PHT A;  1TD5 A;  3T4J A;  2IA2 A;  2OAQ 1;  3ICY A;  3HCY A;  2D02 A;  2O0Y A;  2VV8 A;  4PKY G;  3BW6 A;  1NLZ A;  4RQ9 A;  4DJ3 A;  2I9V A;  1OT9 A;  2W27 A;  3E98 A;  3CUE C;  4GHI A;  3VE3 A;  3HJK A;  1OTE A;  2PD7 A;  2HGV A;  4JGR A;  4G3K A;  2J80 A;  4BMW A;  1VB6 A;  2FZ0 A;  4CQH A;  2QKP A;  3PBO A;  2XA7 M;  5DFY A;  3LR0 A;  3OCL A;  4Y5F A;  4EET B;  2XRO A;  4L9F A;  3RH8 B;  4E04 A;  4WEJ A;  1UGU A;  3IBR A;  2L4R A;  2YKH A;  2HJ9 C;  3JVU A;  1XJ6 A;  2PHY A;  2EA9 A;  5L8M A;  1P97 A;  2DMW A;  4ETX A;  2INW A;  2V1A A;  1OTB A;  2O99 A;  3LIE A;  1P9W A;  3S7P A;  1WA9 A;  4ZRR A;  2GZA A;  5IU1 A;  2MJ6 A;  5J7E A;  1LSV A;  3IBJ A;  1LSX A;  3TJZ C;  4R3A A;  1MC0 A;  2GNX A;  1F9I A;  4O01 A;  2W1R A;  2JKR M;  3MF0 A;  1GSX A;  3BWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...