3WS2A

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (condition-1c)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
360
structure length
360
Chain Sequence
QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAIDVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
total genus 118
structure length 360
sequence length 360
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ws2A00
3W4PA 1JWPA 2ZC6B 3HLEA 5A91A 4EBLA 1GHPA 3MZEA 3W4OA 4KG5A 4OQ0A 5E2FA 2Q9MA 5GHYA 1KGEA 3N8LA 3O3VA 3BFCA 3Q81A 3IHAA 4ZBEA 4U3TA 3MZFA 1H8ZA 1MWSA 5A90A 1GHIA 4K0WA 4C75A 3UN7A 5TGFA 1K56D 1K6SA 1PZOA 1DJAA 4B88A 3OC2A 1YM1A 2H0TA 4R1GA 1ES2A 1YMSA 4ZAMA 4LENA 4A5RA 4HBTA 4KZ8A 3NC8A 2HP5A 3DWZA 1JTDA 1XGIA 4P85A 1K57C 2ZQ8A 3MKFA 4WM9A 1PYYA 2JCHA 1MY8A 3PAEA 1RGZA 3RXWA 2WGWA 3G31A 3LY3A 4OLDA 2OV5A 3JYIA 5KMWA 3O87A 1EROA 2A3UA 2WAEA 2Y2MA 4E6XA 5EVIB 4GDBA 2J9PA 3LCEA 2ZQ7A 4IBXA 1PI4A 3OCLA 4OLGA 2XLNA 3HLGA 1FR1A 2BLSA 2Y2HA 3HUMA 4QY6A 1MXOA 4U0TA 3UPPA 3WWXA 1ZKJA 4QJGA 1W5DA 1TDLA 1L0DA 4OPRA 1QMEA 3PBSA 2VGJA 3SH7A 1GCEA 2EXAA 2H0YA 3MXRA 3E2LA 4FCFA 1W8QA 3QNBA 3N8SA 4OVDA 1BSGA 1O7EA 5FI6A 1ONGA 5A92A 4WEJA 1ES3A 2WGWB 1CI9A 4QD4A 2H10A 5CEDA 3BECA 5CHMA 3AGEA 3NDEA 1PWGA 4Q8IA 1I5QA 3UNWA 2QPNA 4N9LA 3M2JA 4FD8A 2XR0A 3IXHA 3VP3A 5EOOA 5FAOA 5CHUA 5E2GA 4UA7A 4LV3A 4X68A 5I94A 2Y2JA 3NI9A 3UE1A 1C3BA 1KE4A 2XGNA 4PM6A 1SKFA 2WADA 4OPZA 1VM1A 3A3FA 3C4PA 4JKTA 1E3UD 3S1YA 3VSKA 4S2OA 3C7UA 3WS2A 3VP2A 1JWZA 2WYXA 4FSFA 2P9VA 5FQJA 5EVLA 1L0GA 4KZ3A 4KZ4A 3W4QA 1QMFA 2FFYA 1IYQA 3GVBA 4WMCA 5FASA 1YMXA 4OPYA 4NETA 2ZM8A 4JLFA 4OOMA 4JBFA 4QHCA 3E2KA 4E3NA 3Q1FA 3ZG5A 3ZHHA 3Q07A 1RP5A 5A93A 1IELA 3GV9A 4O7DA 3OPLA 3SS3A 3PAGA 2Y2KA 4DDYA 3IH9A 1Q2PA 3S22A 5HAIA 2OSUA 2ZQDA 5EECA 4PM5A 2HPBA 5DTTA 1EWZA 4X55A 5EPHA 3PBNA 2I72A 1PW8A 2P9VB 3EQVA 2WGVA 3A3EA 4EWFA 3UDIA 1BTLA 3QHYA 4KZBA 4EBNA 5CECA 2ZM0A 4KG6A 3LO7A 2WKIA 3ZVTA 4YFMA 4UHUA 3OPRA 4KQQA 2OLVA 3PBQA 1YT4A 1TVFA 2XDMA 2Y2GA 3G2ZA 5CEBA 3VP0A 5CGSA 1YLWA 2QZ6A 1PIOA 3UY6A 3LY4A 4P87A 4RX2A 4KQRA 2UWXA 4IVKA 1ONHA 3NY4A 1VQQA 4M3KA 4OPQA 4XUZA 5FATA 2WZZA 3CJMA 3MZDA 4KQOA 1K38A 1W7FA 3TG9A 3Q82A 5J8XA 5M18A 4GD6A 5U47A 5F1GA 1HZOA 4E3JA 4UAAA 3Q7VB 3OPHA 5FQIA 1NRFA 1M40A 5E2EA 4X6TA 5F82A 2Y2PA 5CHJA 1FCMA 4JF6A 1FOFA 4S2IA 1NXYA 5G18A 1JTGA 2R9WA 5TR7A 1K25A 2XD5A 4LCMA 5HAPA 2XFSA 4PM9A 3V3RA 5HARA 2ZC3B 1BULA 4KZ5A 3VOZA 4QB8A 3ZG0A 4MBHA 4WELA 5DF9A 1PW1A 3VP4A 2IWBA 4P0MA 2Y4AA 4PMAA 3GTCA 1N9BA 1NYYA 1CEFA 3BRMA 3IHBA 5F83A 1XGJA 1IYSA 4KZ9A 2WAFA 2Y2LA 5CERA 4OQIA 1DY6A 3P98A 4DE0A 3OCNA 4MNRA 4IEDA 1ES4A 3ISGA 5D3OA 1GA9A 1LLBA 3ZG8B 4OONA 4Y0UA 2WK0A 2RL3A 4E3MA 1S6RA 2GDNA 5GLDA 5CGWA 4QU3A 2XEPA 1J9MA 4BQMA 2ZM2A 4RX3A 5F1FA 2Q9NA 3VMAA 1E3UA 3RJUA 4WBGA 1XP4A 4NK3A 4JXSA 1FCOA 3I7JA 3PBOA 2ZC7A 1ZG4A 3IF6A 4OOLA 4EUZA 3P09A 3UE0A 4DE3A 2WZXA 4C6YA 1FSYA 4S2NC 5EUAA 4BL2A 4E3LA 1IYOA 2HDUA 4GN2A 5CTNA 4EQIA 3FZCA 3G2YA 1TEMA 3GMWA 5HAQA 4PPRA 5FSRA 2VGKA 5CXWA 5E2HA 3NDGA 2V20A 2ZQCA 1WE4A 5KSCA 1NYMA 4FH4A 3S4XA 4DRTA 2Y59A 5IHVA 4ZJ2A 1MWTA 1KVLA 2EFUA 3HREA 4OP8A 5E43A 5EVID 4B4XA 1IKIA 1U60A 1Y54A 3PBRA 3HLDA 3GQZA 1N4OA 2Y2NA 3IF6B 5DVAA 4XXRA 2EX2A 4BENA 1ESUA 1H5XA 1KDWA 1M6KA 2ZQ9A 1BT5A 5AQAA 5FA7A 3NIAA 4X69A 2ZLYA 3Q7ZA 1Z6FA 4OP5A 4MBFA 3M6BA 3GR2A 3ITBA 3PTEA 3ZFZA 1RCJA 1JWVA 4GZBA 3O86A 2B5RA 4WZ5C 2WUQA 5FQMA 4MLLA 1LHYA 3EQUA 1W8YA 4S2PA 3O88A 2P74A 1YLZA 1KE3A 1WYBA 1HVBA 1G68A 4WYYA 1PI5A 4S2NA 5DTSA 2HDSA 4PM7A 3ITAA 3V50A 5KSHA 3G4PA 1YQSA 1WYCA 4JPMA 3B3XA 3ZNYA 1YLYA 2C5WB 4GDNA 1LI9A 2PBYA 3HLBA 3WRTA 4KZ6A 1ERMA 3UPOA 3AGDA 4HBUA 3TSGA 1ERQA 3TOIA 4N1HA 5FQ9A 2R9XA 2JE5A 2V1ZA 5EOEA 5DF7A 4BL3A 5AQ9A 3HLFA 1CI8A 3IXDA 1K56A 3IT9A 2Y55A 1XA1A 4R3JA 4GNUA 3FKWA 5FI2A 5M1AA 1AXBA 2Y91A 1PWCA 4X56A 1MPLA 3N7WA 4XUXA 1BLPA 4K0XA 2FFFB 2OLUA 5HX9A 4JXWA 5DTKA 3FKVA 3IF6C 1FQGA 4ZDXA 1ALQA 1KDSA 2V2FF 3ZDJA 4WMCD 4S2JA 1HTZA 3SS4A 1SDNA 2PU2A 3V39A 4L0LA 5M19A 4WZ5A 3GSGA 4R23A 4Z9QA 4R4RA 2DNSA 3ZVWA 2X71A 1JVJA 2JBFA 3IXGA 1XA7A 3MXSA 4QY5A 4ID4A 3SH8A 4BLMA 4Y0TA 1DJCA 4R3BA 4HESA 5HW3A 1MWRA 2ZD8A 3MFDA 4GOGA 4OOYA 2J8YA 3BFGA 5FQQA 3V5MA 3W8KA 5JYOA 1YLPA 4OQGA 4S2MA 3A3JA 3WS4A 4JF4A 2EX9A 2C6WB 4MEZA 4P6BA 1E25A 2ZC5B 3QNCA 4KZ7A 3BYDA 1K6RA 3ZGAB 5KZHA 3VFHA 4KENB 5FAPA 1L0EA 2Z2LB 4ZJ3A 4S2KA 3MBZA 3HLCA 4OQHA 2HDRA 3BFFA 3BFEA 4MBKA 1K54C 1XKZA 1K55C 3PBTA 1MKIA 4LV0A 2E8IA 3AGFA 3ZCZA 4Y0OA 3VSLA 5GLCA 3WRZA 3DW0A 3IXBA 1YLTA 3NBLA 4CJNA 1O07A 1SCWA 4DKIA 2QMIA 3CZDA 5EVIA 1KGFA 2G2UA 4BJPA 2G2WA 2ZC4B 2HP6A 5FQKA 5GHXA 4JXGA 3C7VA 2ZMAA 3GRJA 4LCLA 2RCXA 5CGXA 4R4SA 4DDSA 4F94A 4GKUA 5HFOA 1YLJA 2Y2OA 2ZJ9A 3UDFA 4DE2A 4E3IA 4EBPA 3BEBA 5EE8A 1SHVA 1CEGA 3DWKA 1KE0A 1RGYA 2Y2QA 3UO9A 1FR6A 1BLCA 1BZAA 3SOIA 3SS5A 4E3KA 3HLWA 4E3OA 3UDXA 4LV2A 2X01A 1LI0A 1HD8A 1XXMA 3N6IA 4DXBA 3CG5A 4YINA 4LV1A 2J7VA 4JXVA 3WS5A 3WS1A 4ZJ1A 4WZ4A 3IH8A 2DCFA 1XPBA 5AQBA 3OZHA 3G34A 5HL1A 5L2FA 1BLHA 1IEMA 3C5AA 1NZUA 1PZPA 3FYZA 1I2WA 4IBRA 4WEKA 2EX8A 4OKPA 1ZG6A 2XQZA 1XX2A 2XH9A 1NZOA 2BG1A 5GHZA 1H8YA 1ZC2A 3V3SA 2IWDA 3VP1A 2CC1A 3HL9A 3G30A 4K91A 1K4EA 1K54A 4RVAA 1K55A 2DRWA 4N92A 4EV4A 2PU4A 3IWIA 3WS0A 2WKEA 1FSWA 4RYEA 3ZG9B 3N8RA 3G35A 1ESIA 1DJBA 3IQAA 3HUNA 1L0FA 5CTMA 1SDEA 1W79A 1NJ4A 3HVFA 3ZNTA 2XD1A 1BLSA 4N9KA 1FCNA 4PM8A 4UA9A 1EI5A 4U0XA 3BFDA 2ZQAA 5FDHA 1OMEA 2Y2IA 2JC7A 1L2SA 5TFQA 1GHMA 5GL9A 4OH0A 2J9OA 3FWLA 1K57A 2XK1A 4DE1A 1I2SA 1KGGA 4C3QA 1MBLA 4H8RA 4N1XA 1NY0A 1BUEA 2HDQA 4FH2A 3D4FA 3G32A 4GD8A 3SH9A 4RA7A 3RXXA 5JYPA 3BLMA 1K4FA 2XFTA 4D2OA 4BD0A 3UE3A 2A49A 2H5SA 1TDGA 3HUOA 3BM6A 3C4OA 1LL5A 1LL9A 3DTMA 5EVIC 1E4DA 5DF8A 4E6WA 1KVMA 2IWCA 3IWQA 1GA0A 3A3IA 3IWOA 5GLBA 4UA6A 2WGIA 3BLSA 3LEZA 1ES5A 4DF6A 4DXCA 1PWDA 5AQ7A 2XF3A 4HEFA 3Q7VA 4Y7PA 5CRFA 5GLAA 1S0WA 4IVIA 3IF5A 3CMZA 2Z2MB 3VOYA 1MWUA 2EXBA 1Q2QA 3HBRA 4JF5A 3VFFA 4B4ZA 3OPPA 4CPKA 4BD1A 3M2KA 3N4IA 2WKHA 2EFXA 4ZTKA 3FV7A 1G6AA 3M6HA 3A3DA 2HP9A 2X02A 1CK3A 4KZAA 4GB7A 4R0QA 4X53A 3UPNA 4S2LA 1IKGA 3NCKA 3ZG7B 1IYPA 3MKEA 2EX6A 5FI7A 5BOHA 5FAQA 4KG2A
chains in the Genus database with same CATH superfamily
1JWPA 1GHPA 2JHEA 4KG5A 4OQ0A 1KGEA 3N8LA 3F1NB 3O3VA 3O5YA 1GHIA 3UN7A 3BQ8A 5TGFA 4AFIA 3LIEA 4B88A 3QP2A 4HBTA 2J3TC 2HP5A 1JTDA 2XSSA 4L9FA 2K2NA 2VK3A 4OLDA 4DMZA 4MN7A 2A3UA 2QKPA 3MS6A 3E4QA 3F1PA 1PI4A 4OLGA 3HLGA 4QY6A 5CX7A 4CQHA 3WWXA 4QJGA 1W5DA 3SH7A 3E2LA 4OVDA 3N8SA 5A92A 3T1RA 2WGWB 1CI9A 4IUHA 5CEDA 5HD3A 3NDEA 4N9LA 4WUJA 5CHUA 2O99A 4UA7A 4X68A 5I94A 1SKFA 4H6JB 4OPZA 1VM1A 2P08A 3R7WA 4UEYA 2LB5A 3C4PA 4I3JA 2PDRA 2PYRA 5KIZA 3VSKA 3T50A 4EESA 1JWZA 2P9VA 3T4JA 4KZ4A 5FASA 4Q0HA 2VA0A 2ZM8A 4JLFA 4QHCA 3IS2B 3MFXA 3ZHHA 2YKHA 3BY9A 3D72A 5A93A 4O7DA 3OPLA 1N9NA 3IH9A 1Q2PA 2OSUA 5EECA 3UB7A 1YSPA 3CUEC 3T4OA 4HI4A 1BTLA 5CECA 2VV8A 4DJ3A 3H9WA 3ZVTA 4KQQA 3F1OB 3PBQA 1TVFA 2QZ6A 2XRNA 1PIOA 1NLZA 3LY4A 4IVKA 1ONHA 1OTBA 1VQQA 3IX4A 1W7FA 4YWZA 4R3AA 1NLYA 3IBRA 3OPHA 1M40A 2QJ5A 2Y2PA 1FOFA 4S2IA 1JTGA 2V0UA 4LCMA 4D60A 3VOZA 4QB8A 4NKPA 1D1JA 3ZG0A 4MBHA 3RTYA 1PW1A 3MSHA 3UB8A 3GTCA 1NYYA 5G4YA 2WAFA 2Y2LA 3P98A 4MNRA 1ES4A 1TS7A 1T19A 3ZG8B 2WK0A 4E3MA 4QU3A 1J9MA 2ZM2A 1E3UA 2J80A 2OAP1 4WBGA 4NK3A 1FCOA 4OOLA 4EUZA 2W27A 4DE3A 1TS8A 2HZ5A 5L07A 1IYOA 5DKKA 1TEMA 3GMWA 5FSRA 3NDGA 3MQOA 1NYMA 2ZMFA 5EVEA 2Y59A 2EFUA 5BOHA 5EVID 3HLDA 2Y2NA 4XXRA 2EX2A 4QPRA 1H0MA 4MBFA 2JKGA 1Y28A 3ZFZA 2B5RA 2WUQA 5FQMA 2PAVP 1LHYA 5HWTA 2HJ9C 2M1CA 4KUKA 3O88A 4S2PA 3T4QA 1OTDA 4I5SA 2PR6A 3P7NA 1PI5A 1V9YA 4S2NA 2L1MA 1LSWA 3B3XA 1YLYA 2C5WB 1LI9A 4KZ6A 1ERMA 3UPOA 3AGDA 1OTEA 1DP6A 4HBUA 4XT2B 1ERQA 3U2AA 2JE5A 2V1ZA 3B33A 3VOLA 3HLFA 2A24B 5HDSA 1PWCA 1MPLA 3N7WA 3LR5A 2J3TD 3KSIA 4G3VA 4K0XA 4B9OA 5DTKA 3FKVA 1FQGA 1ALQA 4WMCD 1HTZA 3UB6A 4X1LA 5EM1A 2H28A 1SDNA 2PU2A 3V39A 3ZVWA 2DNSA 3SH8A 1XA7A 4ARZA 1DJCA 4HESA 1MWRA 4GOGA 2J8YA 3A3JA 4JGPA 4P6BA 3HCYA 3IX3A 4ZJ3A 3MBZA 4OQHA 3BFFA 1XKZA 1K55C 2E8IA 4Y0OA 3H82A 3E4OA 3PR6A 1XFNA 3RFBA 4ESPA 2QMIA 3LIDA 3MR0A 3A0SA 2VGLM 1F2KA 2RCXA 4LFUA 1YLJA 3BEBA 3VV4A 3DWKA 4R38A 1KE0A 1RGYA 3UO9A 1FR6A 1BZAA 3UDXA 4LV2A 1XXMA 1DP8A 2V9AA 3N6IA 1IOUA 3MMHA 4LV1A 3WS5A 4ZJ1A 4WZ4A 2V1AA 3U4LP 1W63M 3P01A 4RQ9A 2HGVA 4H6JA 4OKPA 3JPUA 1NZOA 2BG1A 1CF0A 2CC1A 3HL9A 4K91A 4ZRRA 1K4EA 1K54A 4RVAA 2INWA 2WKEA 1FSWA 4JGRA 2M7VA 2EWWA 4RYEA 2W3EA 3N8RA 3LEQA 1ESIA 4QWOA 3IS2A 3LI9A 1L0FA 2XD1A 4N9KA 4U0XA 2JKRM 2Y2IA 2JC7A 5TFQA 4O8GA 5GL9A 3FWLA 1K57A 1SKOB 3CPTA 3VE4A 1KGGA 1NY0A 4GD8A 4EW7A 1K4FA 4D2OA 3UE3A 4Y13A 2H5SA 3F1OA 5HD5A 3HUOA 4E6WA 1T1CA 2M7UA 3IWQA 1GA0A 3IWOA 5HWVA 5GLBA 2D02A 3BLSA 1ZTUA 2Z2MB 2VLGA 4KUOA 2DMWA 3HBRA 4B4ZA 3OPPA 4WLAA 4CPKA 3M2KA 2WKHA 2YKFA 3FV7A 1G6AA 3KX0X 2JKTI 4R0QA 1G6OA 4F3LA 2EX6A 3LR0A 3W4PA 4GCZA 5A91A 4EBLA 2Q9MA 4BBTA 4X25A 3C2WA 3MZFA 2Z6DA 3D3OA 1YKDA 1K56D 1K6SA 1TS0A 1D7EA 4EEUA 4KZ8A 5FDSA 1YAXA 3T1SA 4GS9A 2I9VA 2ZQ8A 1PYYA 3E4PA 1Y4OA 2Y2MA 4GHIB 5EVIB 4E6XA 2ZQ7A 3ZYTA 1FR1A 1XJ2A 4U0TA 3KYEA 1L0DA 4FCFA 3QNBA 2EA9A 1BSGA 1ONGA 4WEJA 2H10A 3BECA 3AGEA 1I5QA 1S1ZA 5EOOA 5FAOA 5E2GA 2IA2A 2Y2JA 3NI9A 1C3BA 4PM6A 2XGNA 2NUTC 2WADA 2W3HA 4CLCA 3S1YA 1MZUA 1VEUB 3S7PA 1UWPX 3FPVA 4KZ3A 3GVBA 1IYQA 3ZQ5A 4NETA 4JBFA 3Q1FA 3ZG5A 4JGOA 1Z09A 4HHDA 3R4KA 3SS3A 3PAGA 4HY8A 5EM0A 1YSQA 2HF6A 4PM5A 3BY8A 1GSXA 3PBNA 1SZVA 3K2NA 3EQVA 2O0YA 4GLQA 3A3EA 2W3FA 4EBNA 4KG6A 3LO7A 2WKIA 4UHUA 3JVVA 2WKRA 3NOUC 1YT4A 2Y2GA 3UY6A 5DFYA 4KQRA 2UWXA 5FEFA 4OPQA 4XUZA 3TG9A 1TD5A 5U47A 5F1GA 4E3JA 4UAAA 4X6TA 1D06A 3MXQA 4JF6A 2ACGA 5G18A 5TR7A 2XFSA 3V3RA 2ZC3B 4ETXA 2W1TA 3NOPC 2O9AA 3VP4A 2Y4AA 4PMAA 1N9BA 5F83A 2XA7M 1NRJA 4KZ9A 3H7WB 1DY6A 4IEDA 4UQIM 2K31A 5CGWA 1EW0A 4RX3A 2Q9NA 3RJUA 2R78A 3IF6A 4E3LA 4S2NC 4MCWA 1OJGA 1ACFA 5IU1A 3G2YA 5LBRA 2V20A 1N9OA 2O9CA 3S4XA 4HJ3A 2HV1A 5AVFA 3T1QB 2JKFA 4HNBA 5E43A 1U60A 5EFWA 4FOFA 3LIBA 1M6KA 3C8CA 1BT5A 3L7HA 3NIAA 4X69A 3MF0A 3Q7ZA 1Z6FA 3LFVA 3PTEA 4WL9A 4GW9A 1W8YA 2V1BA 1KE3A 3LI8A 1WYBA 5TBMB 1G68A 3HJKA 5KSHA 1YQSA 2BASA 2PBYA 3WRTA 2ZMVA 4X1MA 3TOIA 4G3KA 4BL3A 5AQ9A 3LR4A 4WN5A 1CI8A 5F6AA 3FKWA 5M1AA 4X56A 3UMEA 2FFFB 2OLUA 4M4XA 5F68A 3ZDJA 2QWSA 4BMWA 4Z9QA 4QY5A 5HPIA 2ZD8A 4OOYA 5FQQA 3DTKA 4EQ1A 4EETB 3WS4A 4JF4A 4MEZA 1E25A 1VHMA 4NG2A 2ZC5B 1HLUP 3ZGAB 5KZHA 3VFHA 4KENB 5FAPA 2Z2LB 3HLCA 4R6LA 3BFEA 5K5BA 1K54C 2A2LA 1XJ4A 3VSLA 5GLCA 3G6OA 1YLTA 1S67L 5EVIA 1GSVA 4HP9A 3C7VA 2ZMAA 3GRJA 5CGXA 4R4SA 4GKUA 4EBPA 3SOIA 4E3OA 3HLWA 2VEAA 2X01A 1LI0A 1HD8A 3E0YA 3WS1A 2V8FA 1S66L 3C5AA 1NZUA 3FYZA 4IBRA 1I2WA 4WEKA 4PAUA 3TE8A 2IWDA 1VEUA 3EEAA 4EV4A 5L09A 3ZG9B 2NUPC 1S4RA 3HUNA 4JGQA 2W1RA 4FTXA 4Y15A 1SDEA 1W79A 3HVFA 3LUQA 3KYQA 1FCNA 4PM8A 1EI5A 3BFDA 5G4ZA 2J9OA 2JN7A 3E98A 4DE1A 1I2SA 2QYBA 4N1XA 3SH9A 3D4FA 2VJWA 3G32A 4ME4A 2VKSA 3RXXA 4Y2FA 2XFTA 4BD0A 3NJAA 2A49A 3CITA 2VGLS 3BM6A 1XJ6A 3QP8A 1KVMA 5A8BA 3A3IA 2WGIA 3LEZA 2ZBBA 4P6ZM 1WA9A 5GLAA 3CMZA 3T12B 4GJ4A 3EGDC 3F1NA 4ZTKA 3M6HA 3A3DA 2HP9A 2X02A 1CK3A 4KZAA 3UPNA 3NHQA 2VV7A 3TW8A 3ZG7B 1IYPA 3S7QA 1H3QA 4LRXC 2ZC6B 3MZEA 3W4OA 5GHYA 5E2FA 3LGOA 3Q81A 2Y79A 2ZOIA 1MWSA 4K0WA 4C75A 4PKYG 4L9GA 2P7JA 3CUEA 3OC2A 4R1GA 1ES2A 4CLCC 4LENA 3NC8A 5J3WA 4P85A 3MKFA 2JCHA 1RGZA 2WGWA 3G31A 3LY3A 2OV5A 5KMWA 2B18A 4GDBA 2J9PA 1P0ZA 2XLNA 2BLSA 3HUMA 2Y2HA 2P04A 3UPPA 1ZKJA 4HP4A 4OPRA 1QMEA 2E8JA 2VGJA 2H0YA 3MXRA 3BW6A 1W8QA 1LSVA 5FI6A 4WF0A 1ES3A 2OOLA 4LPZA 4QD4A 3T4SA 1PWGA 4Q8IA 3UNWA 3MQ0A 1LT0A 3VP3A 4BBUA 2W3DA 3EEHA 1KE4A 5HWWA 4I39A 4JKTA 3MJQA 3VP2A 3UB9A 4HIAA 3W4QA 2FFYA 3HJIA 1YMXA 3QP6A 4OPYA 4BWIA 4OOMA 5HZHA 4E3NA 3BJNA 1RP5A 1IELA 3GV9A 4DDYA 3R7WB 5HAIA 5HL6A 4NXEA 5DTTA 1AWIA 4X55A 5EPHA 2I72A 2P9VB 4EWFA 3OBFA 1OTIA 3IBJA 2Z6CA 3OPRA 5MC7A 2OLVA 5J4EA 2XDMA 2V8CA 1PNEA 3VP0A 3LICA 3NY4A 5FATA 2WZZA 5J8XA 1K38A 3Q82A 5M18A 4GD6A 1HZOA 1F5MA 5HDDA 5FQIA 1NRFA 4B93A 1FCMA 3GDIA 3K3DA 1K25A 5HARA 4PKYA 1BULA 4KZ5A 1X0OA 1YPRA 4WELA 2HJEA 2IWBA 3NECA 3W2ZA 3T1XA 1CEFA 3IHBA 1IYSA 4OQIA 4DE0A 3PXPA 2GZAA 1IFQA 3ISGA 2L4RA 1LLBA 4OONA 2EWVA 1S6RA 2GDNA 5GLDA 4EEPA 1XFQA 2OWJA 2CMNA 2Q0OA 5C5KA 4JXSA 3PBOA 2ZC7A 3P09A 3S7NA 2WZXA 4Z1WA 4C6YA 1FSYA 4BL2A 4EQIA 2WKPA 4GN2A 3FZCA 5HAQA 4PPRA 2VGKA 5CXWA 1TS6A 2ZQCA 1WE4A 5KSCA 3OOVA 4FH4A 4DRTA 1MWTA 3FC7A 1KVLA 4O0PA 2L0WA 1IKIA 1Y54A 3PBRA 3GQZA 1TF1A 4CLCE 1N4OA 5DVAA 4EXOA 1KDWA 3ULFA 5AQAA 2ZLYA 4OP5A 3GR2A 3ITBA 3D9YA 1RCJA 2VZWA 4GZBA 3O86A 3SZTA 2JKTM 4XT2A 4MLLA 3OLOA 1YLZA 2B95A 2A24A 3NOTC 1HVBA 2XA7S 3V50A 3G4PA 1WYCA 4JPMA 4LRZE 4HQAA 4UQIS 2OWHA 4N1HA 2R9XA 5DF7A 4L9EA 3IXDA 2PYPA 4NEED 1F98A 1XA1A 2Y55A 4R3JA 4GNUA 4IJGA 4XUXA 1BLPA 3DTIA 5HX9A 2FZ0A 2V2FF 4S2JA 2ZL1B 3SS4A 3CLOA 4WZ5A 3GSGA 4R23A 5AJGA 1JVJA 2JBFA 4BLMA 4R3BA 3CHWP 3V5MA 3MFDA 5JYOA 3BFGA 4OQGA 4EUVA 2EX9A 2C6WB 3BQAA 4LGWA 3QNCA 4KZ7A 4S2KA 1MKMA 4MBKA 4ARZB 3ZCZA 1MKIA 3NBLA 4CJNA 4DKIA 1KGFA 4HOIA 1ZHHB 2ZC4B 2HP6A 5GHXA 1PRQA 5EV0A 4JXGA 3SW1A 4DDSA 4F94A 4DE2A 2Y2OA 2ZJ9A 3UDFA 3T4LA 3CWFA 4E3IA 1SHVA 2Y2QA 4MDZA 3H82B 1BLCA 2G7UA 3CG5A 4YINA 2J7VA 4JXVA 3IH8A 2DCFA 3G34A 5HL1A 5L2FA 1BLHA 3TRCA 1DRMA 1PZPA 2PD7A 2EX8A 2XQZA 4K08A 1H8YA 2PT7A 1ZC2A 3VP1A 3G30A 1SKOA 2DRWA 3KSHA 3NULA 4LRYC 1FIKA 2KLIA 5DFXA 1DJBA 5CTMA 1XJ3A 2PRFA 1L2SA 1GHMA 2B02A 2OAQ1 4C3QA 4H8RA 3C38A 4YNRA 5DJUA 4DJ2A 3C4OA 1LL5A 1E4DA 5DF8A 2IWCA 3C30A 3CPTB 4UA6A 1J3WA 1GSWA 4NXBA 4DXCA 1PWDA 5AQ7A 2XF3A 5CRFA 1P9RA 4HEFA 4HH2A 1S0WA 2WKQA 3S7OA 3VOYA 4MN6A 3VFFA 5FEGA 2AVXA 4HH3A 4BD1A 3N4IA 2EFXA 3EOIA 4I38A 4Y17A 4FUWA 4PHTA 4GB7A 3K3CA 4S2LA 2PBDP 3NCKA 4E04A 5IT5A 5FI7A 4KG2A 3A0RA 3T4TA 3HLEA 1V9ZA 3CAXA 4ZBEA 3BFCA 3IHAA 4U3TA 1H8ZA 5A90A 4GHIA 1PZOA 4NXGA 4F3LB 1DJAA 3DTEA 1YM1A 2H0TA 1FILA 4ZAMA 1YMSA 3ICYA 4A5RA 1LSXA 3MQQA 3UMDA 3DWZA 5HPFA 1XGIA 1K57C 4WM9A 3PAEA 1MY8A 1A0KA 3RXWA 3JYIA 3O87A 1EROA 2WAEA 4IBXA 3LCEA 2V0WA 3OCLA 3QP5A 3KSFA 1MXOA 5F5YA 2O9BA 1TDLA 2PHYA 3PBSA 1GCEA 2EXAA 1UGUA 4GS9B 1O7EA 4II7A 3B42A 4P6ZS 3UB5P 4O01A 4HJ6A 5CHMA 2LB9A 2QPNA 3M2JA 4FD8A 2XR0A 3IXHA 3DAVA 4LV3A 1P9WA 3RH8B 3UE1A 2QHKA 4IUKA 3A3FA 4DN0A 3GECA 1E3UD 5HDCA 4S2OA 3C7UA 3WS2A 2WYXA 4FSFA 4I3IA 5FQJA 5EVLA 1L0GA 1QMFA 4WMCA 1P97A 1STZA 1CJFA 2QJ7A 3PHYA 2GX5A 4HJ4A 3E2KA 3Q07A 3EGXC 3QP1A 2Y2KA 3S22A 4CLCB 2ZQDA 2HPBA 1EWZA 2XROA 1PW8A 1LL8A 1DP9A 2WGVA 5HSQA 3UDIA 3QHYA 4KZBA 2ZM0A 1G28A 3FPWA 4LLOB 4YFMA 5AVEA 2ZL1A 3G2ZA 5CEBA 5CGSA 1YLWA 4RX2A 4P87A 4Y3IA 4M3KA 3CJMA 3MZDA 4KQOA 2GJ3A 2JKRI 3Q7VB 5E2EA 5F82A 5CHJA 3H7WA 1NXYA 2R9WA 5J7EA 2XD5A 5HAPA 1NWZA 4PM9A 3LYXA 4YOFA 1VETB 3UE6A 5DF9A 4P0MA 3IX8A 3BRMA 1XGJA 1KOUA 2KX6A 5CERA 5FL3A 3OCNA 3TJZC 5D3OA 1GA9A 4Y0UA 2RL3A 3B47A 2W1TB 3FG8A 4EU0A 2XEPA 3T4KA 4BQMA 5F1FA 3PYPA 4R70A 3VMAA 1XP4A 3BWLA 3I7JA 5I5LA 1JNUA 1ZG4A 4Q0IA 3UE0A 4NXFA 1OT9A 5EUAA 2HDUA 5CTNA 5E2HA 3F1PB 5IHVA 4ZJ2A 4OP8A 3HREA 4B4XA 2VV6A 3IF6B 4BENA 1ESUA 1H5XA 2ZQ9A 5FA7A 5TBMA 3KSGA 3M6BA 1JWVA 4WZ5C 1VB6A 3EQUA 1T1AA 2P74A 2PD8A 4WYYA 3L9KA 5DTSA 2HDSA 4PM7A 4MN5A 4Q0JA 3ITAA 2MJ6A 5L10A 3ZNYA 4GDNA 3HLBA 4KQDA 4BBVA 3TSGA 5FQ9A 5EOEA 1K56A 3IT9A 5FI2A 1AXBA 2Y91A 1ODVA 5L8MA 2Y8HA 4JXWA 3IF6C 4ZDXA 1KDSA 4L0LA 5M19A 4R4RA 2X71A 3IXGA 3MXSA 4Y0TA 4ID4A 5HW3A 3W8KA 1YLPA 4S2MA 1OTAA 2K7SA 5DJTA 3LIAA 1UWNX 1OT6A 1K6RA 3BYDA 1L0EA 2HDRA 4LV0A 3PBTA 3AGFA 3WRZA 3DW0A 3IXBA 4Y5FA 1O07A 1SCWA 1T1BA 5IS1A 1OJ5A 3CZDA 1G5UA 2G2UA 4BJPA 2G2WA 3LIFA 5FQKA 1BYWA 4MMNA 4EERA 1W63Q 4LCLA 5HFOA 1H8MA 5EE8A 1CEGA 3A0VA 3SS5A 4E3KA 4DXBA 2D01A 1N9LA 1XPBA 5AQBA 3OZHA 5TJJA 1IEMA 2W0NA 5F69A 1S4SA 1ZG6A 1XX2A 2XH9A 5GHZA 1S1YA 3JVUA 2PR5A 3V3SA 2BTFP 3DBAA 1F9IA 3CI6A 3VE3A 1K55A 4N92A 2KDKA 2PU4A 3IWIA 3WS0A 3G35A 3IQAA 1NJ4A 3ZNTA 1BLSA 4UA9A 2ZQAA 5FDHA 1OMEA 3KO6A 4OH0A 2XK1A 1PFLA 3V67A 2FH5A 1K0KA 1MBLA 1BUEA 2HDQA 4FH2A 4RA7A 5JYPA 3BLMA 3EWKA 1MC0A 1TDGA 2GNXA 1L3LA 3DTMA 1T18A 1LL9A 5EVIC 2ZOHA 3QP4A 5DKLA 2UV0E 2J3WA 4CLCD 3KYZA 2VX8A 4DF6A 1ES5A 4IHQA 4Y7PA 3Q7VA 4I3AA 4IVIA 3IF5A 2W3GA 2KOIA 1MWUA 2EXBA 1Q2QA 4JF5A 4G3WA 1OPXA 3LR3A 4X53A 1IKGA 4ETZA 1CQAA 1VETA 3MKEA 5FAQA
chains in the Genus database with same CATH topology
3W4PA 1JWPA 2ZC6B 3HLEA 5A91A 4EBLA 1GHPA 3MZEA 3W4OA 4KG5A 4OQ0A 5E2FA 2Q9MA 5GHYA 1KGEA 3N8LA 3O3VA 3BFCA 3Q81A 3IHAA 4ZBEA 4U3TA 3MZFA 1H8ZA 1MWSA 5A90A 1GHIA 4K0WA 4C75A 3UN7A 5TGFA 1K56D 1K6SA 1PZOA 1DJAA 4B88A 3OC2A 1YM1A 2H0TA 4R1GA 1ES2A 1YMSA 4ZAMA 4LENA 4A5RA 4HBTA 4KZ8A 3NC8A 2HP5A 3DWZA 1JTDA 1XGIA 4P85A 1K57C 2ZQ8A 3MKFA 4WM9A 1PYYA 2JCHA 1MY8A 3PAEA 1RGZA 3RXWA 2WGWA 3G31A 3LY3A 4OLDA 2OV5A 3JYIA 5KMWA 3O87A 1EROA 2A3UA 2WAEA 2Y2MA 4E6XA 5EVIB 4GDBA 2J9PA 3LCEA 2ZQ7A 4IBXA 1PI4A 3OCLA 4OLGA 2XLNA 3HLGA 1FR1A 2BLSA 2Y2HA 3HUMA 4QY6A 1MXOA 4U0TA 3UPPA 3WWXA 1ZKJA 4QJGA 1W5DA 1TDLA 1L0DA 4OPRA 1QMEA 3PBSA 2VGJA 3SH7A 1GCEA 2EXAA 2H0YA 3MXRA 3E2LA 4FCFA 1W8QA 3QNBA 3N8SA 4OVDA 1BSGA 1O7EA 5FI6A 1ONGA 5A92A 4WEJA 1ES3A 2WGWB 1CI9A 4QD4A 2H10A 5CEDA 3BECA 5CHMA 3AGEA 3NDEA 1PWGA 4Q8IA 1I5QA 3UNWA 2QPNA 4N9LA 3M2JA 4FD8A 2XR0A 3IXHA 3VP3A 5EOOA 5FAOA 5CHUA 5E2GA 4UA7A 4LV3A 4X68A 5I94A 2Y2JA 3NI9A 3UE1A 1C3BA 1KE4A 2XGNA 4PM6A 1SKFA 2WADA 4OPZA 1VM1A 3A3FA 3C4PA 4JKTA 1E3UD 3S1YA 3VSKA 4S2OA 3C7UA 3WS2A 3VP2A 1JWZA 2WYXA 4FSFA 2P9VA 5FQJA 5EVLA 1L0GA 4KZ3A 4KZ4A 3W4QA 1QMFA 2FFYA 1IYQA 3GVBA 4WMCA 5FASA 1YMXA 4OPYA 4NETA 2ZM8A 4JLFA 4OOMA 4JBFA 4QHCA 3E2KA 4E3NA 3Q1FA 3ZG5A 3ZHHA 3Q07A 1RP5A 5A93A 1IELA 3GV9A 4O7DA 3OPLA 3SS3A 3PAGA 2Y2KA 4DDYA 3IH9A 1Q2PA 3S22A 5HAIA 2OSUA 2ZQDA 5EECA 4PM5A 2HPBA 5DTTA 1EWZA 4X55A 5EPHA 3PBNA 2I72A 1PW8A 2P9VB 3EQVA 2WGVA 3A3EA 4EWFA 3UDIA 1BTLA 3QHYA 4KZBA 4EBNA 5CECA 2ZM0A 4KG6A 3LO7A 2WKIA 3ZVTA 4YFMA 4UHUA 3OPRA 4KQQA 2OLVA 3PBQA 1YT4A 1TVFA 2XDMA 2Y2GA 3G2ZA 5CEBA 3VP0A 5CGSA 1YLWA 2QZ6A 1PIOA 3UY6A 3LY4A 4P87A 4RX2A 4KQRA 2UWXA 4IVKA 1ONHA 3NY4A 1VQQA 4M3KA 4OPQA 4XUZA 5FATA 2WZZA 3CJMA 3MZDA 4KQOA 1K38A 1W7FA 3TG9A 3Q82A 5J8XA 5M18A 4GD6A 5U47A 5F1GA 1HZOA 4E3JA 4UAAA 3Q7VB 3OPHA 5FQIA 1NRFA 1M40A 5E2EA 4X6TA 5F82A 2Y2PA 5CHJA 1FCMA 4JF6A 1FOFA 4S2IA 1NXYA 5G18A 1JTGA 2R9WA 5TR7A 1K25A 2XD5A 4LCMA 5HAPA 2XFSA 4PM9A 3V3RA 5HARA 2ZC3B 1BULA 4KZ5A 3VOZA 4QB8A 3ZG0A 4MBHA 4WELA 5DF9A 1PW1A 3VP4A 2IWBA 4P0MA 2Y4AA 4PMAA 3GTCA 1N9BA 1NYYA 1CEFA 3BRMA 3IHBA 5F83A 1XGJA 1IYSA 4KZ9A 2WAFA 2Y2LA 5CERA 4OQIA 1DY6A 3P98A 4DE0A 3OCNA 4MNRA 4IEDA 1ES4A 3ISGA 5D3OA 1GA9A 1LLBA 3ZG8B 4OONA 4Y0UA 2WK0A 2RL3A 4E3MA 1S6RA 2GDNA 5GLDA 5CGWA 4QU3A 2XEPA 1J9MA 4BQMA 2ZM2A 4RX3A 5F1FA 2Q9NA 3VMAA 1E3UA 3RJUA 4WBGA 1XP4A 4NK3A 4JXSA 1FCOA 3I7JA 3PBOA 2ZC7A 1ZG4A 3IF6A 4OOLA 4EUZA 3P09A 3UE0A 4DE3A 2WZXA 4C6YA 1FSYA 4S2NC 5EUAA 4BL2A 4E3LA 1IYOA 2HDUA 4GN2A 5CTNA 4EQIA 3FZCA 3G2YA 1TEMA 3GMWA 5HAQA 4PPRA 5FSRA 2VGKA 5CXWA 5E2HA 3NDGA 2V20A 2ZQCA 1WE4A 5KSCA 1NYMA 4FH4A 3S4XA 4DRTA 2Y59A 5IHVA 4ZJ2A 1MWTA 1KVLA 2EFUA 3HREA 4OP8A 5E43A 5EVID 4B4XA 1IKIA 1U60A 1Y54A 3PBRA 3HLDA 3GQZA 1N4OA 2Y2NA 3IF6B 5DVAA 4XXRA 2EX2A 4BENA 1ESUA 1H5XA 1KDWA 1M6KA 2ZQ9A 1BT5A 5AQAA 5FA7A 3NIAA 4X69A 2ZLYA 3Q7ZA 1Z6FA 4OP5A 4MBFA 3M6BA 3GR2A 3ITBA 3PTEA 3ZFZA 1RCJA 1JWVA 4GZBA 3O86A 2B5RA 4WZ5C 2WUQA 5FQMA 4MLLA 1LHYA 3EQUA 1W8YA 4S2PA 3O88A 2P74A 1YLZA 1KE3A 1WYBA 1HVBA 1G68A 4WYYA 1PI5A 4S2NA 5DTSA 2HDSA 4PM7A 3ITAA 3V50A 5KSHA 3G4PA 1YQSA 1WYCA 4JPMA 3B3XA 3ZNYA 1YLYA 2C5WB 4GDNA 1LI9A 2PBYA 3HLBA 3WRTA 4KZ6A 1ERMA 3UPOA 3AGDA 4HBUA 3TSGA 1ERQA 3TOIA 4N1HA 5FQ9A 2R9XA 2JE5A 2V1ZA 5EOEA 5DF7A 4BL3A 5AQ9A 3HLFA 1CI8A 3IXDA 1K56A 3IT9A 2Y55A 1XA1A 4R3JA 4GNUA 3FKWA 5FI2A 5M1AA 1AXBA 2Y91A 1PWCA 4X56A 1MPLA 3N7WA 4XUXA 1BLPA 4K0XA 2FFFB 2OLUA 5HX9A 4JXWA 5DTKA 3FKVA 3IF6C 1FQGA 4ZDXA 1ALQA 1KDSA 2V2FF 3ZDJA 4WMCD 4S2JA 1HTZA 3SS4A 1SDNA 2PU2A 3V39A 4L0LA 5M19A 4WZ5A 3GSGA 4R23A 4Z9QA 4R4RA 2DNSA 3ZVWA 2X71A 1JVJA 2JBFA 3IXGA 1XA7A 3MXSA 4QY5A 4ID4A 3SH8A 4BLMA 4Y0TA 1DJCA 4R3BA 4HESA 5HW3A 1MWRA 2ZD8A 3MFDA 4GOGA 4OOYA 2J8YA 3BFGA 5FQQA 3V5MA 3W8KA 5JYOA 1YLPA 4OQGA 4S2MA 3A3JA 3WS4A 4JF4A 2EX9A 2C6WB 4MEZA 4P6BA 1E25A 2ZC5B 3QNCA 4KZ7A 3BYDA 1K6RA 3ZGAB 5KZHA 3VFHA 4KENB 5FAPA 1L0EA 2Z2LB 4ZJ3A 4S2KA 3MBZA 3HLCA 4OQHA 2HDRA 3BFFA 3BFEA 4MBKA 1K54C 1XKZA 1K55C 3PBTA 1MKIA 4LV0A 2E8IA 3AGFA 3ZCZA 4Y0OA 3VSLA 5GLCA 3WRZA 3DW0A 3IXBA 1YLTA 3NBLA 4CJNA 1O07A 1SCWA 4DKIA 2QMIA 3CZDA 5EVIA 1KGFA 2G2UA 4BJPA 2G2WA 2ZC4B 2HP6A 5FQKA 5GHXA 4JXGA 3C7VA 2ZMAA 3GRJA 4LCLA 2RCXA 5CGXA 4R4SA 4DDSA 4F94A 4GKUA 5HFOA 1YLJA 2Y2OA 2ZJ9A 3UDFA 4DE2A 4E3IA 4EBPA 3BEBA 5EE8A 1SHVA 1CEGA 3DWKA 1KE0A 1RGYA 2Y2QA 3UO9A 1FR6A 1BLCA 1BZAA 3SOIA 3SS5A 4E3KA 3HLWA 4E3OA 3UDXA 4LV2A 2X01A 1LI0A 1HD8A 1XXMA 3N6IA 4DXBA 3CG5A 4YINA 4LV1A 2J7VA 4JXVA 3WS5A 3WS1A 4ZJ1A 4WZ4A 3IH8A 2DCFA 1XPBA 5AQBA 3OZHA 3G34A 5HL1A 5L2FA 1BLHA 1IEMA 3C5AA 1NZUA 1PZPA 3FYZA 1I2WA 4IBRA 4WEKA 2EX8A 4OKPA 1ZG6A 2XQZA 1XX2A 2XH9A 1NZOA 2BG1A 5GHZA 1H8YA 1ZC2A 3V3SA 2IWDA 3VP1A 2CC1A 3HL9A 3G30A 4K91A 1K4EA 1K54A 4RVAA 1K55A 2DRWA 4N92A 4EV4A 2PU4A 3IWIA 3WS0A 2WKEA 1FSWA 4RYEA 3ZG9B 3N8RA 3G35A 1ESIA 1DJBA 3IQAA 3HUNA 1L0FA 5CTMA 1SDEA 1W79A 1NJ4A 3HVFA 3ZNTA 2XD1A 1BLSA 4N9KA 1FCNA 4PM8A 4UA9A 1EI5A 4U0XA 3BFDA 2ZQAA 5FDHA 1OMEA 2Y2IA 2JC7A 1L2SA 5TFQA 1GHMA 5GL9A 4OH0A 2J9OA 3FWLA 1K57A 2XK1A 4DE1A 1I2SA 1KGGA 4C3QA 1MBLA 4H8RA 4N1XA 1NY0A 1BUEA 2HDQA 4FH2A 3D4FA 3G32A 4GD8A 3SH9A 4RA7A 3RXXA 5JYPA 3BLMA 1K4FA 2XFTA 4D2OA 4BD0A 3UE3A 2A49A 2H5SA 1TDGA 3HUOA 3BM6A 3C4OA 1LL5A 1LL9A 3DTMA 5EVIC 1E4DA 5DF8A 4E6WA 1KVMA 2IWCA 3IWQA 1GA0A 3A3IA 3IWOA 5GLBA 4UA6A 2WGIA 3BLSA 3LEZA 1ES5A 4DF6A 4DXCA 1PWDA 5AQ7A 2XF3A 4HEFA 3Q7VA 4Y7PA 5CRFA 5GLAA 1S0WA 4IVIA 3IF5A 3CMZA 2Z2MB 3VOYA 1MWUA 2EXBA 1Q2QA 3HBRA 4JF5A 3VFFA 4B4ZA 3OPPA 4CPKA 4BD1A 3M2KA 3N4IA 2WKHA 2EFXA 4ZTKA 3FV7A 1G6AA 3M6HA 3A3DA 2HP9A 2X02A 1CK3A 4KZAA 4GB7A 4R0QA 4X53A 3UPNA 4S2LA 1IKGA 3NCKA 3ZG7B 1IYPA 3MKEA 2EX6A 5FI7A 5BOHA 5FAQA 4KG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W4P A;  1JWP A;  2ZC6 B;  3HLE A;  5A91 A;  4EBL A;  1GHP A;  3MZE A;  3W4O A;  4KG5 A;  4OQ0 A;  5E2F A;  2Q9M A;  5GHY A;  1KGE A;  3N8L A;  3O3V A;  3BFC A;  3Q81 A;  3IHA A;  4ZBE A;  4U3T A;  3MZF A;  1H8Z A;  1MWS A;  5A90 A;  1GHI A;  4K0W A;  4C75 A;  3UN7 A;  5TGF A;  1K56 D;  1K6S A;  1PZO A;  1DJA A;  4B88 A;  3OC2 A;  1YM1 A;  2H0T A;  4R1G A;  1ES2 A;  1YMS A;  4ZAM A;  4LEN A;  4A5R A;  4HBT A;  4KZ8 A;  3NC8 A;  2HP5 A;  3DWZ A;  1JTD A;  1XGI A;  4P85 A;  1K57 C;  2ZQ8 A;  3MKF A;  4WM9 A;  1PYY A;  2JCH A;  1MY8 A;  3PAE A;  1RGZ A;  3RXW A;  2WGW A;  3G31 A;  3LY3 A;  4OLD A;  2OV5 A;  3JYI A;  5KMW A;  3O87 A;  1ERO A;  2A3U A;  2WAE A;  2Y2M A;  4E6X A;  5EVI B;  4GDB A;  2J9P A;  3LCE A;  2ZQ7 A;  4IBX A;  1PI4 A;  3OCL A;  4OLG A;  2XLN A;  3HLG A;  1FR1 A;  2BLS A;  2Y2H A;  3HUM A;  4QY6 A;  1MXO A;  4U0T A;  3UPP A;  3WWX A;  1ZKJ A;  4QJG A;  1W5D A;  1TDL A;  1L0D A;  4OPR A;  1QME A;  3PBS A;  2VGJ A;  3SH7 A;  1GCE A;  2EXA A;  2H0Y A;  3MXR A;  3E2L A;  4FCF A;  1W8Q A;  3QNB A;  3N8S A;  4OVD A;  1BSG A;  1O7E A;  5FI6 A;  1ONG A;  5A92 A;  4WEJ A;  1ES3 A;  2WGW B;  1CI9 A;  4QD4 A;  2H10 A;  5CED A;  3BEC A;  5CHM A;  3AGE A;  3NDE A;  1PWG A;  4Q8I A;  1I5Q A;  3UNW A;  2QPN A;  4N9L A;  3M2J A;  4FD8 A;  2XR0 A;  3IXH A;  3VP3 A;  5EOO A;  5FAO A;  5CHU A;  5E2G A;  4UA7 A;  4LV3 A;  4X68 A;  5I94 A;  2Y2J A;  3NI9 A;  3UE1 A;  1C3B A;  1KE4 A;  2XGN A;  4PM6 A;  1SKF A;  2WAD A;  4OPZ A;  1VM1 A;  3A3F A;  3C4P A;  4JKT A;  1E3U D;  3S1Y A;  3VSK A;  4S2O A;  3C7U A;  3WS2 A;  3VP2 A;  1JWZ A;  2WYX A;  4FSF A;  2P9V A;  5FQJ A;  5EVL A;  1L0G A;  4KZ3 A;  4KZ4 A;  3W4Q A;  1QMF A;  2FFY A;  1IYQ A;  3GVB A;  4WMC A;  5FAS A;  1YMX A;  4OPY A;  4NET A;  2ZM8 A;  4JLF A;  4OOM A;  4JBF A;  4QHC A;  3E2K A;  4E3N A;  3Q1F A;  3ZG5 A;  3ZHH A;  3Q07 A;  1RP5 A;  5A93 A;  1IEL A;  3GV9 A;  4O7D A;  3OPL A;  3SS3 A;  3PAG A;  2Y2K A;  4DDY A;  3IH9 A;  1Q2P A;  3S22 A;  5HAI A;  2OSU A;  2ZQD A;  5EEC A;  4PM5 A;  2HPB A;  5DTT A;  1EWZ A;  4X55 A;  5EPH A;  3PBN A;  2I72 A;  1PW8 A;  2P9V B;  3EQV A;  2WGV A;  3A3E A;  4EWF A;  3UDI A;  1BTL A;  3QHY A;  4KZB A;  4EBN A;  5CEC A;  2ZM0 A;  4KG6 A;  3LO7 A;  2WKI A;  3ZVT A;  4YFM A;  4UHU A;  3OPR A;  4KQQ A;  2OLV A;  3PBQ A;  1YT4 A;  1TVF A;  2XDM A;  2Y2G A;  3G2Z A;  5CEB A;  3VP0 A;  5CGS A;  1YLW A;  2QZ6 A;  1PIO A;  3UY6 A;  3LY4 A;  4P87 A;  4RX2 A;  4KQR A;  2UWX A;  4IVK A;  1ONH A;  3NY4 A;  1VQQ A;  4M3K A;  4OPQ A;  4XUZ A;  5FAT A;  2WZZ A;  3CJM A;  3MZD A;  4KQO A;  1K38 A;  1W7F A;  3TG9 A;  3Q82 A;  5J8X A;  5M18 A;  4GD6 A;  5U47 A;  5F1G A;  1HZO A;  4E3J A;  4UAA A;  3Q7V B;  3OPH A;  5FQI A;  1NRF A;  1M40 A;  5E2E A;  4X6T A;  5F82 A;  2Y2P A;  5CHJ A;  1FCM A;  4JF6 A;  1FOF A;  4S2I A;  1NXY A;  5G18 A;  1JTG A;  2R9W A;  5TR7 A;  1K25 A;  2XD5 A;  4LCM A;  5HAP A;  2XFS A;  4PM9 A;  3V3R A;  5HAR A;  2ZC3 B;  1BUL A;  4KZ5 A;  3VOZ A;  4QB8 A;  3ZG0 A;  4MBH A;  4WEL A;  5DF9 A;  1PW1 A;  3VP4 A;  2IWB A;  4P0M A;  2Y4A A;  4PMA A;  3GTC A;  1N9B A;  1NYY A;  1CEF A;  3BRM A;  3IHB A;  5F83 A;  1XGJ A;  1IYS A;  4KZ9 A;  2WAF A;  2Y2L A;  5CER A;  4OQI A;  1DY6 A;  3P98 A;  4DE0 A;  3OCN A;  4MNR A;  4IED A;  1ES4 A;  3ISG A;  5D3O A;  1GA9 A;  1LLB A;  3ZG8 B;  4OON A;  4Y0U A;  2WK0 A;  2RL3 A;  4E3M A;  1S6R A;  2GDN A;  5GLD A;  5CGW A;  4QU3 A;  2XEP A;  1J9M A;  4BQM A;  2ZM2 A;  4RX3 A;  5F1F A;  2Q9N A;  3VMA A;  1E3U A;  3RJU A;  4WBG A;  1XP4 A;  4NK3 A;  4JXS A;  1FCO A;  3I7J A;  3PBO A;  2ZC7 A;  1ZG4 A;  3IF6 A;  4OOL A;  4EUZ A;  3P09 A;  3UE0 A;  4DE3 A;  2WZX A;  4C6Y A;  1FSY A;  4S2N C;  5EUA A;  4BL2 A;  4E3L A;  1IYO A;  2HDU A;  4GN2 A;  5CTN A;  4EQI A;  3FZC A;  3G2Y A;  1TEM A;  3GMW A;  5HAQ A;  4PPR A;  5FSR A;  2VGK A;  5CXW A;  5E2H A;  3NDG A;  2V20 A;  2ZQC A;  1WE4 A;  5KSC A;  1NYM A;  4FH4 A;  3S4X A;  4DRT A;  2Y59 A;  5IHV A;  4ZJ2 A;  1MWT A;  1KVL A;  2EFU A;  3HRE A;  4OP8 A;  5E43 A;  5EVI D;  4B4X A;  1IKI A;  1U60 A;  1Y54 A;  3PBR A;  3HLD A;  3GQZ A;  1N4O A;  2Y2N A;  3IF6 B;  5DVA A;  4XXR A;  2EX2 A;  4BEN A;  1ESU A;  1H5X A;  1KDW A;  1M6K A;  2ZQ9 A;  1BT5 A;  5AQA A;  5FA7 A;  3NIA A;  4X69 A;  2ZLY A;  3Q7Z A;  1Z6F A;  4OP5 A;  4MBF A;  3M6B A;  3GR2 A;  3ITB A;  3PTE A;  3ZFZ A;  1RCJ A;  1JWV A;  4GZB A;  3O86 A;  2B5R A;  4WZ5 C;  2WUQ A;  5FQM A;  4MLL A;  1LHY A;  3EQU A;  1W8Y A;  4S2P A;  3O88 A;  2P74 A;  1YLZ A;  1KE3 A;  1WYB A;  1HVB A;  1G68 A;  4WYY A;  1PI5 A;  4S2N A;  5DTS A;  2HDS A;  4PM7 A;  3ITA A;  3V50 A;  5KSH A;  3G4P A;  1YQS A;  1WYC A;  4JPM A;  3B3X A;  3ZNY A;  1YLY A;  2C5W B;  4GDN A;  1LI9 A;  2PBY A;  3HLB A;  3WRT A;  4KZ6 A;  1ERM A;  3UPO A;  3AGD A;  4HBU A;  3TSG A;  1ERQ A;  3TOI A;  4N1H A;  5FQ9 A;  2R9X A;  2JE5 A;  2V1Z A;  5EOE A;  5DF7 A;  4BL3 A;  5AQ9 A;  3HLF A;  1CI8 A;  3IXD A;  1K56 A;  3IT9 A;  2Y55 A;  1XA1 A;  4R3J A;  4GNU A;  3FKW A;  5FI2 A;  5M1A A;  1AXB A;  2Y91 A;  1PWC A;  4X56 A;  1MPL A;  3N7W A;  4XUX A;  1BLP A;  4K0X A;  2FFF B;  2OLU A;  5HX9 A;  4JXW A;  5DTK A;  3FKV A;  3IF6 C;  1FQG A;  4ZDX A;  1ALQ A;  1KDS A;  2V2F F;  3ZDJ A;  4WMC D;  4S2J A;  1HTZ A;  3SS4 A;  1SDN A;  2PU2 A;  3V39 A;  4L0L A;  5M19 A;  4WZ5 A;  3GSG A;  4R23 A;  4Z9Q A;  4R4R A;  2DNS A;  3ZVW A;  2X71 A;  1JVJ A;  2JBF A;  3IXG A;  1XA7 A;  3MXS A;  4QY5 A;  4ID4 A;  3SH8 A;  4BLM A;  4Y0T A;  1DJC A;  4R3B A;  4HES A;  5HW3 A;  1MWR A;  2ZD8 A;  3MFD A;  4GOG A;  4OOY A;  2J8Y A;  3BFG A;  5FQQ A;  3V5M A;  3W8K A;  5JYO A;  1YLP A;  4OQG A;  4S2M A;  3A3J A;  3WS4 A;  4JF4 A;  2EX9 A;  2C6W B;  4MEZ A;  4P6B A;  1E25 A;  2ZC5 B;  3QNC A;  4KZ7 A;  3BYD A;  1K6R A;  3ZGA B;  5KZH A;  3VFH A;  4KEN B;  5FAP A;  1L0E A;  2Z2L B;  4ZJ3 A;  4S2K A;  3MBZ A;  3HLC A;  4OQH A;  2HDR A;  3BFF A;  3BFE A;  4MBK A;  1K54 C;  1XKZ A;  1K55 C;  3PBT A;  1MKI A;  4LV0 A;  2E8I A;  3AGF A;  3ZCZ A;  4Y0O A;  3VSL A;  5GLC A;  3WRZ A;  3DW0 A;  3IXB A;  1YLT A;  3NBL A;  4CJN A;  1O07 A;  1SCW A;  4DKI A;  2QMI A;  3CZD A;  5EVI A;  1KGF A;  2G2U A;  4BJP A;  2G2W A;  2ZC4 B;  2HP6 A;  5FQK A;  5GHX A;  4JXG A;  3C7V A;  2ZMA A;  3GRJ A;  4LCL A;  2RCX A;  5CGX A;  4R4S A;  4DDS A;  4F94 A;  4GKU A;  5HFO A;  1YLJ A;  2Y2O A;  2ZJ9 A;  3UDF A;  4DE2 A;  4E3I A;  4EBP A;  3BEB A;  5EE8 A;  1SHV A;  1CEG A;  3DWK A;  1KE0 A;  1RGY A;  2Y2Q A;  3UO9 A;  1FR6 A;  1BLC A;  1BZA A;  3SOI A;  3SS5 A;  4E3K A;  3HLW A;  4E3O A;  3UDX A;  4LV2 A;  2X01 A;  1LI0 A;  1HD8 A;  1XXM A;  3N6I A;  4DXB A;  3CG5 A;  4YIN A;  4LV1 A;  2J7V A;  4JXV A;  3WS5 A;  3WS1 A;  4ZJ1 A;  4WZ4 A;  3IH8 A;  2DCF A;  1XPB A;  5AQB A;  3OZH A;  3G34 A;  5HL1 A;  5L2F A;  1BLH A;  1IEM A;  3C5A A;  1NZU A;  1PZP A;  3FYZ A;  1I2W A;  4IBR A;  4WEK A;  2EX8 A;  4OKP A;  1ZG6 A;  2XQZ A;  1XX2 A;  2XH9 A;  1NZO A;  2BG1 A;  5GHZ A;  1H8Y A;  1ZC2 A;  3V3S A;  2IWD A;  3VP1 A;  2CC1 A;  3HL9 A;  3G30 A;  4K91 A;  1K4E A;  1K54 A;  4RVA A;  1K55 A;  2DRW A;  4N92 A;  4EV4 A;  2PU4 A;  3IWI A;  3WS0 A;  2WKE A;  1FSW A;  4RYE A;  3ZG9 B;  3N8R A;  3G35 A;  1ESI A;  1DJB A;  3IQA A;  3HUN A;  1L0F A;  5CTM A;  1SDE A;  1W79 A;  1NJ4 A;  3HVF A;  3ZNT A;  2XD1 A;  1BLS A;  4N9K A;  1FCN A;  4PM8 A;  4UA9 A;  1EI5 A;  4U0X A;  3BFD A;  2ZQA A;  5FDH A;  1OME A;  2Y2I A;  2JC7 A;  1L2S A;  5TFQ A;  1GHM A;  5GL9 A;  4OH0 A;  2J9O A;  3FWL A;  1K57 A;  2XK1 A;  4DE1 A;  1I2S A;  1KGG A;  4C3Q A;  1MBL A;  4H8R A;  4N1X A;  1NY0 A;  1BUE A;  2HDQ A;  4FH2 A;  3D4F A;  3G32 A;  4GD8 A;  3SH9 A;  4RA7 A;  3RXX A;  5JYP A;  3BLM A;  1K4F A;  2XFT A;  4D2O A;  4BD0 A;  3UE3 A;  2A49 A;  2H5S A;  1TDG A;  3HUO A;  3BM6 A;  3C4O A;  1LL5 A;  1LL9 A;  3DTM A;  5EVI C;  1E4D A;  5DF8 A;  4E6W A;  1KVM A;  2IWC A;  3IWQ A;  1GA0 A;  3A3I A;  3IWO A;  5GLB A;  4UA6 A;  2WGI A;  3BLS A;  3LEZ A;  1ES5 A;  4DF6 A;  4DXC A;  1PWD A;  5AQ7 A;  2XF3 A;  4HEF A;  3Q7V A;  4Y7P A;  5CRF A;  5GLA A;  1S0W A;  4IVI A;  3IF5 A;  3CMZ A;  2Z2M B;  3VOY A;  1MWU A;  2EXB A;  1Q2Q A;  3HBR A;  4JF5 A;  3VFF A;  4B4Z A;  3OPP A;  4CPK A;  4BD1 A;  3M2K A;  3N4I A;  2WKH A;  2EFX A;  4ZTK A;  3FV7 A;  1G6A A;  3M6H A;  3A3D A;  2HP9 A;  2X02 A;  1CK3 A;  4KZA A;  4GB7 A;  4R0Q A;  4X53 A;  3UPN A;  4S2L A;  1IKG A;  3NCK A;  3ZG7 B;  1IYP A;  3MKE A;  2EX6 A;  5FI7 A;  5BOH A;  5FAQ A;  4KG2 A; 
#chains in the Genus database with same CATH topology
 1JWP A;  1GHP A;  2JHE A;  4KG5 A;  4OQ0 A;  1KGE A;  3N8L A;  3F1N B;  3O3V A;  3O5Y A;  1GHI A;  3UN7 A;  3BQ8 A;  5TGF A;  4AFI A;  3LIE A;  4B88 A;  3QP2 A;  4HBT A;  2J3T C;  2HP5 A;  1JTD A;  2XSS A;  4L9F A;  2K2N A;  2VK3 A;  4OLD A;  4DMZ A;  4MN7 A;  2A3U A;  2QKP A;  3MS6 A;  3E4Q A;  3F1P A;  1PI4 A;  4OLG A;  3HLG A;  4QY6 A;  5CX7 A;  4CQH A;  3WWX A;  4QJG A;  1W5D A;  3SH7 A;  3E2L A;  4OVD A;  3N8S A;  5A92 A;  3T1R A;  2WGW B;  1CI9 A;  4IUH A;  5CED A;  5HD3 A;  3NDE A;  4N9L A;  4WUJ A;  5CHU A;  2O99 A;  4UA7 A;  4X68 A;  5I94 A;  1SKF A;  4H6J B;  4OPZ A;  1VM1 A;  2P08 A;  3R7W A;  4UEY A;  2LB5 A;  3C4P A;  4I3J A;  2PDR A;  2PYR A;  5KIZ A;  3VSK A;  3T50 A;  4EES A;  1JWZ A;  2P9V A;  3T4J A;  4KZ4 A;  5FAS A;  4Q0H A;  2VA0 A;  2ZM8 A;  4JLF A;  4QHC A;  3IS2 B;  3MFX A;  3ZHH A;  2YKH A;  3BY9 A;  3D72 A;  5A93 A;  4O7D A;  3OPL A;  1N9N A;  3IH9 A;  1Q2P A;  2OSU A;  5EEC A;  3UB7 A;  1YSP A;  3CUE C;  3T4O A;  4HI4 A;  1BTL A;  5CEC A;  2VV8 A;  4DJ3 A;  3H9W A;  3ZVT A;  4KQQ A;  3F1O B;  3PBQ A;  1TVF A;  2QZ6 A;  2XRN A;  1PIO A;  1NLZ A;  3LY4 A;  4IVK A;  1ONH A;  1OTB A;  1VQQ A;  3IX4 A;  1W7F A;  4YWZ A;  4R3A A;  1NLY A;  3IBR A;  3OPH A;  1M40 A;  2QJ5 A;  2Y2P A;  1FOF A;  4S2I A;  1JTG A;  2V0U A;  4LCM A;  4D60 A;  3VOZ A;  4QB8 A;  4NKP A;  1D1J A;  3ZG0 A;  4MBH A;  3RTY A;  1PW1 A;  3MSH A;  3UB8 A;  3GTC A;  1NYY A;  5G4Y A;  2WAF A;  2Y2L A;  3P98 A;  4MNR A;  1ES4 A;  1TS7 A;  1T19 A;  3ZG8 B;  2WK0 A;  4E3M A;  4QU3 A;  1J9M A;  2ZM2 A;  1E3U A;  2J80 A;  2OAP 1;  4WBG A;  4NK3 A;  1FCO A;  4OOL A;  4EUZ A;  2W27 A;  4DE3 A;  1TS8 A;  2HZ5 A;  5L07 A;  1IYO A;  5DKK A;  1TEM A;  3GMW A;  5FSR A;  3NDG A;  3MQO A;  1NYM A;  2ZMF A;  5EVE A;  2Y59 A;  2EFU A;  5BOH A;  5EVI D;  3HLD A;  2Y2N A;  4XXR A;  2EX2 A;  4QPR A;  1H0M A;  4MBF A;  2JKG A;  1Y28 A;  3ZFZ A;  2B5R A;  2WUQ A;  5FQM A;  2PAV P;  1LHY A;  5HWT A;  2HJ9 C;  2M1C A;  4KUK A;  3O88 A;  4S2P A;  3T4Q A;  1OTD A;  4I5S A;  2PR6 A;  3P7N A;  1PI5 A;  1V9Y A;  4S2N A;  2L1M A;  1LSW A;  3B3X A;  1YLY A;  2C5W B;  1LI9 A;  4KZ6 A;  1ERM A;  3UPO A;  3AGD A;  1OTE A;  1DP6 A;  4HBU A;  4XT2 B;  1ERQ A;  3U2A A;  2JE5 A;  2V1Z A;  3B33 A;  3VOL A;  3HLF A;  2A24 B;  5HDS A;  1PWC A;  1MPL A;  3N7W A;  3LR5 A;  2J3T D;  3KSI A;  4G3V A;  4K0X A;  4B9O A;  5DTK A;  3FKV A;  1FQG A;  1ALQ A;  4WMC D;  1HTZ A;  3UB6 A;  4X1L A;  5EM1 A;  2H28 A;  1SDN A;  2PU2 A;  3V39 A;  3ZVW A;  2DNS A;  3SH8 A;  1XA7 A;  4ARZ A;  1DJC A;  4HES A;  1MWR A;  4GOG A;  2J8Y A;  3A3J A;  4JGP A;  4P6B A;  3HCY A;  3IX3 A;  4ZJ3 A;  3MBZ A;  4OQH A;  3BFF A;  1XKZ A;  1K55 C;  2E8I A;  4Y0O A;  3H82 A;  3E4O A;  3PR6 A;  1XFN A;  3RFB A;  4ESP A;  2QMI A;  3LID A;  3MR0 A;  3A0S A;  2VGL M;  1F2K A;  2RCX A;  4LFU A;  1YLJ A;  3BEB A;  3VV4 A;  3DWK A;  4R38 A;  1KE0 A;  1RGY A;  3UO9 A;  1FR6 A;  1BZA A;  3UDX A;  4LV2 A;  1XXM A;  1DP8 A;  2V9A A;  3N6I A;  1IOU A;  3MMH A;  4LV1 A;  3WS5 A;  4ZJ1 A;  4WZ4 A;  2V1A A;  3U4L P;  1W63 M;  3P01 A;  4RQ9 A;  2HGV A;  4H6J A;  4OKP A;  3JPU A;  1NZO A;  2BG1 A;  1CF0 A;  2CC1 A;  3HL9 A;  4K91 A;  4ZRR A;  1K4E A;  1K54 A;  4RVA A;  2INW A;  2WKE A;  1FSW A;  4JGR A;  2M7V A;  2EWW A;  4RYE A;  2W3E A;  3N8R A;  3LEQ A;  1ESI A;  4QWO A;  3IS2 A;  3LI9 A;  1L0F A;  2XD1 A;  4N9K A;  4U0X A;  2JKR M;  2Y2I A;  2JC7 A;  5TFQ A;  4O8G A;  5GL9 A;  3FWL A;  1K57 A;  1SKO B;  3CPT A;  3VE4 A;  1KGG A;  1NY0 A;  4GD8 A;  4EW7 A;  1K4F A;  4D2O A;  3UE3 A;  4Y13 A;  2H5S A;  3F1O A;  5HD5 A;  3HUO A;  4E6W A;  1T1C A;  2M7U A;  3IWQ A;  1GA0 A;  3IWO A;  5HWV A;  5GLB A;  2D02 A;  3BLS A;  1ZTU A;  2Z2M B;  2VLG A;  4KUO A;  2DMW A;  3HBR A;  4B4Z A;  3OPP A;  4WLA A;  4CPK A;  3M2K A;  2WKH A;  2YKF A;  3FV7 A;  1G6A A;  3KX0 X;  2JKT I;  4R0Q A;  1G6O A;  4F3L A;  2EX6 A;  3LR0 A;  3W4P A;  4GCZ A;  5A91 A;  4EBL A;  2Q9M A;  4BBT A;  4X25 A;  3C2W A;  3MZF A;  2Z6D A;  3D3O A;  1YKD A;  1K56 D;  1K6S A;  1TS0 A;  1D7E A;  4EEU A;  4KZ8 A;  5FDS A;  1YAX A;  3T1S A;  4GS9 A;  2I9V A;  2ZQ8 A;  1PYY A;  3E4P A;  1Y4O A;  2Y2M A;  4GHI B;  5EVI B;  4E6X A;  2ZQ7 A;  3ZYT A;  1FR1 A;  1XJ2 A;  4U0T A;  3KYE A;  1L0D A;  4FCF A;  3QNB A;  2EA9 A;  1BSG A;  1ONG A;  4WEJ A;  2H10 A;  3BEC A;  3AGE A;  1I5Q A;  1S1Z A;  5EOO A;  5FAO A;  5E2G A;  2IA2 A;  2Y2J A;  3NI9 A;  1C3B A;  4PM6 A;  2XGN A;  2NUT C;  2WAD A;  2W3H A;  4CLC A;  3S1Y A;  1MZU A;  1VEU B;  3S7P A;  1UWP X;  3FPV A;  4KZ3 A;  3GVB A;  1IYQ A;  3ZQ5 A;  4NET A;  4JBF A;  3Q1F A;  3ZG5 A;  4JGO A;  1Z09 A;  4HHD A;  3R4K A;  3SS3 A;  3PAG A;  4HY8 A;  5EM0 A;  1YSQ A;  2HF6 A;  4PM5 A;  3BY8 A;  1GSX A;  3PBN A;  1SZV A;  3K2N A;  3EQV A;  2O0Y A;  4GLQ A;  3A3E A;  2W3F A;  4EBN A;  4KG6 A;  3LO7 A;  2WKI A;  4UHU A;  3JVV A;  2WKR A;  3NOU C;  1YT4 A;  2Y2G A;  3UY6 A;  5DFY A;  4KQR A;  2UWX A;  5FEF A;  4OPQ A;  4XUZ A;  3TG9 A;  1TD5 A;  5U47 A;  5F1G A;  4E3J A;  4UAA A;  4X6T A;  1D06 A;  3MXQ A;  4JF6 A;  2ACG A;  5G18 A;  5TR7 A;  2XFS A;  3V3R A;  2ZC3 B;  4ETX A;  2W1T A;  3NOP C;  2O9A A;  3VP4 A;  2Y4A A;  4PMA A;  1N9B A;  5F83 A;  2XA7 M;  1NRJ A;  4KZ9 A;  3H7W B;  1DY6 A;  4IED A;  4UQI M;  2K31 A;  5CGW A;  1EW0 A;  4RX3 A;  2Q9N A;  3RJU A;  2R78 A;  3IF6 A;  4E3L A;  4S2N C;  4MCW A;  1OJG A;  1ACF A;  5IU1 A;  3G2Y A;  5LBR A;  2V20 A;  1N9O A;  2O9C A;  3S4X A;  4HJ3 A;  2HV1 A;  5AVF A;  3T1Q B;  2JKF A;  4HNB A;  5E43 A;  1U60 A;  5EFW A;  4FOF A;  3LIB A;  1M6K A;  3C8C A;  1BT5 A;  3L7H A;  3NIA A;  4X69 A;  3MF0 A;  3Q7Z A;  1Z6F A;  3LFV A;  3PTE A;  4WL9 A;  4GW9 A;  1W8Y A;  2V1B A;  1KE3 A;  3LI8 A;  1WYB A;  5TBM B;  1G68 A;  3HJK A;  5KSH A;  1YQS A;  2BAS A;  2PBY A;  3WRT A;  2ZMV A;  4X1M A;  3TOI A;  4G3K A;  4BL3 A;  5AQ9 A;  3LR4 A;  4WN5 A;  1CI8 A;  5F6A A;  3FKW A;  5M1A A;  4X56 A;  3UME A;  2FFF B;  2OLU A;  4M4X A;  5F68 A;  3ZDJ A;  2QWS A;  4BMW A;  4Z9Q A;  4QY5 A;  5HPI A;  2ZD8 A;  4OOY A;  5FQQ A;  3DTK A;  4EQ1 A;  4EET B;  3WS4 A;  4JF4 A;  4MEZ A;  1E25 A;  1VHM A;  4NG2 A;  2ZC5 B;  1HLU P;  3ZGA B;  5KZH A;  3VFH A;  4KEN B;  5FAP A;  2Z2L B;  3HLC A;  4R6L A;  3BFE A;  5K5B A;  1K54 C;  2A2L A;  1XJ4 A;  3VSL A;  5GLC A;  3G6O A;  1YLT A;  1S67 L;  5EVI A;  1GSV A;  4HP9 A;  3C7V A;  2ZMA A;  3GRJ A;  5CGX A;  4R4S A;  4GKU A;  4EBP A;  3SOI A;  4E3O A;  3HLW A;  2VEA A;  2X01 A;  1LI0 A;  1HD8 A;  3E0Y A;  3WS1 A;  2V8F A;  1S66 L;  3C5A A;  1NZU A;  3FYZ A;  4IBR A;  1I2W A;  4WEK A;  4PAU A;  3TE8 A;  2IWD A;  1VEU A;  3EEA A;  4EV4 A;  5L09 A;  3ZG9 B;  2NUP C;  1S4R A;  3HUN A;  4JGQ A;  2W1R A;  4FTX A;  4Y15 A;  1SDE A;  1W79 A;  3HVF A;  3LUQ A;  3KYQ A;  1FCN A;  4PM8 A;  1EI5 A;  3BFD A;  5G4Z A;  2J9O A;  2JN7 A;  3E98 A;  4DE1 A;  1I2S A;  2QYB A;  4N1X A;  3SH9 A;  3D4F A;  2VJW A;  3G32 A;  4ME4 A;  2VKS A;  3RXX A;  4Y2F A;  2XFT A;  4BD0 A;  3NJA A;  2A49 A;  3CIT A;  2VGL S;  3BM6 A;  1XJ6 A;  3QP8 A;  1KVM A;  5A8B A;  3A3I A;  2WGI A;  3LEZ A;  2ZBB A;  4P6Z M;  1WA9 A;  5GLA A;  3CMZ A;  3T12 B;  4GJ4 A;  3EGD C;  3F1N A;  4ZTK A;  3M6H A;  3A3D A;  2HP9 A;  2X02 A;  1CK3 A;  4KZA A;  3UPN A;  3NHQ A;  2VV7 A;  3TW8 A;  3ZG7 B;  1IYP A;  3S7Q A;  1H3Q A;  4LRX C;  2ZC6 B;  3MZE A;  3W4O A;  5GHY A;  5E2F A;  3LGO A;  3Q81 A;  2Y79 A;  2ZOI A;  1MWS A;  4K0W A;  4C75 A;  4PKY G;  4L9G A;  2P7J A;  3CUE A;  3OC2 A;  4R1G A;  1ES2 A;  4CLC C;  4LEN A;  3NC8 A;  5J3W A;  4P85 A;  3MKF A;  2JCH A;  1RGZ A;  2WGW A;  3G31 A;  3LY3 A;  2OV5 A;  5KMW A;  2B18 A;  4GDB A;  2J9P A;  1P0Z A;  2XLN A;  2BLS A;  3HUM A;  2Y2H A;  2P04 A;  3UPP A;  1ZKJ A;  4HP4 A;  4OPR A;  1QME A;  2E8J A;  2VGJ A;  2H0Y A;  3MXR A;  3BW6 A;  1W8Q A;  1LSV A;  5FI6 A;  4WF0 A;  1ES3 A;  2OOL A;  4LPZ A;  4QD4 A;  3T4S A;  1PWG A;  4Q8I A;  3UNW A;  3MQ0 A;  1LT0 A;  3VP3 A;  4BBU A;  2W3D A;  3EEH A;  1KE4 A;  5HWW A;  4I39 A;  4JKT A;  3MJQ A;  3VP2 A;  3UB9 A;  4HIA A;  3W4Q A;  2FFY A;  3HJI A;  1YMX A;  3QP6 A;  4OPY A;  4BWI A;  4OOM A;  5HZH A;  4E3N A;  3BJN A;  1RP5 A;  1IEL A;  3GV9 A;  4DDY A;  3R7W B;  5HAI A;  5HL6 A;  4NXE A;  5DTT A;  1AWI A;  4X55 A;  5EPH A;  2I72 A;  2P9V B;  4EWF A;  3OBF A;  1OTI A;  3IBJ A;  2Z6C A;  3OPR A;  5MC7 A;  2OLV A;  5J4E A;  2XDM A;  2V8C A;  1PNE A;  3VP0 A;  3LIC A;  3NY4 A;  5FAT A;  2WZZ A;  5J8X A;  1K38 A;  3Q82 A;  5M18 A;  4GD6 A;  1HZO A;  1F5M A;  5HDD A;  5FQI A;  1NRF A;  4B93 A;  1FCM A;  3GDI A;  3K3D A;  1K25 A;  5HAR A;  4PKY A;  1BUL A;  4KZ5 A;  1X0O A;  1YPR A;  4WEL A;  2HJE A;  2IWB A;  3NEC A;  3W2Z A;  3T1X A;  1CEF A;  3IHB A;  1IYS A;  4OQI A;  4DE0 A;  3PXP A;  2GZA A;  1IFQ A;  3ISG A;  2L4R A;  1LLB A;  4OON A;  2EWV A;  1S6R A;  2GDN A;  5GLD A;  4EEP A;  1XFQ A;  2OWJ A;  2CMN A;  2Q0O A;  5C5K A;  4JXS A;  3PBO A;  2ZC7 A;  3P09 A;  3S7N A;  2WZX A;  4Z1W A;  4C6Y A;  1FSY A;  4BL2 A;  4EQI A;  2WKP A;  4GN2 A;  3FZC A;  5HAQ A;  4PPR A;  2VGK A;  5CXW A;  1TS6 A;  2ZQC A;  1WE4 A;  5KSC A;  3OOV A;  4FH4 A;  4DRT A;  1MWT A;  3FC7 A;  1KVL A;  4O0P A;  2L0W A;  1IKI A;  1Y54 A;  3PBR A;  3GQZ A;  1TF1 A;  4CLC E;  1N4O A;  5DVA A;  4EXO A;  1KDW A;  3ULF A;  5AQA A;  2ZLY A;  4OP5 A;  3GR2 A;  3ITB A;  3D9Y A;  1RCJ A;  2VZW A;  4GZB A;  3O86 A;  3SZT A;  2JKT M;  4XT2 A;  4MLL A;  3OLO A;  1YLZ A;  2B95 A;  2A24 A;  3NOT C;  1HVB A;  2XA7 S;  3V50 A;  3G4P A;  1WYC A;  4JPM A;  4LRZ E;  4HQA A;  4UQI S;  2OWH A;  4N1H A;  2R9X A;  5DF7 A;  4L9E A;  3IXD A;  2PYP A;  4NEE D;  1F98 A;  1XA1 A;  2Y55 A;  4R3J A;  4GNU A;  4IJG A;  4XUX A;  1BLP A;  3DTI A;  5HX9 A;  2FZ0 A;  2V2F F;  4S2J A;  2ZL1 B;  3SS4 A;  3CLO A;  4WZ5 A;  3GSG A;  4R23 A;  5AJG A;  1JVJ A;  2JBF A;  4BLM A;  4R3B A;  3CHW P;  3V5M A;  3MFD A;  5JYO A;  3BFG A;  4OQG A;  4EUV A;  2EX9 A;  2C6W B;  3BQA A;  4LGW A;  3QNC A;  4KZ7 A;  4S2K A;  1MKM A;  4MBK A;  4ARZ B;  3ZCZ A;  1MKI A;  3NBL A;  4CJN A;  4DKI A;  1KGF A;  4HOI A;  1ZHH B;  2ZC4 B;  2HP6 A;  5GHX A;  1PRQ A;  5EV0 A;  4JXG A;  3SW1 A;  4DDS A;  4F94 A;  4DE2 A;  2Y2O A;  2ZJ9 A;  3UDF A;  3T4L A;  3CWF A;  4E3I A;  1SHV A;  2Y2Q A;  4MDZ A;  3H82 B;  1BLC A;  2G7U A;  3CG5 A;  4YIN A;  2J7V A;  4JXV A;  3IH8 A;  2DCF A;  3G34 A;  5HL1 A;  5L2F A;  1BLH A;  3TRC A;  1DRM A;  1PZP A;  2PD7 A;  2EX8 A;  2XQZ A;  4K08 A;  1H8Y A;  2PT7 A;  1ZC2 A;  3VP1 A;  3G30 A;  1SKO A;  2DRW A;  3KSH A;  3NUL A;  4LRY C;  1FIK A;  2KLI A;  5DFX A;  1DJB A;  5CTM A;  1XJ3 A;  2PRF A;  1L2S A;  1GHM A;  2B02 A;  2OAQ 1;  4C3Q A;  4H8R A;  3C38 A;  4YNR A;  5DJU A;  4DJ2 A;  3C4O A;  1LL5 A;  1E4D A;  5DF8 A;  2IWC A;  3C30 A;  3CPT B;  4UA6 A;  1J3W A;  1GSW A;  4NXB A;  4DXC A;  1PWD A;  5AQ7 A;  2XF3 A;  5CRF A;  1P9R A;  4HEF A;  4HH2 A;  1S0W A;  2WKQ A;  3S7O A;  3VOY A;  4MN6 A;  3VFF A;  5FEG A;  2AVX A;  4HH3 A;  4BD1 A;  3N4I A;  2EFX A;  3EOI A;  4I38 A;  4Y17 A;  4FUW A;  4PHT A;  4GB7 A;  3K3C A;  4S2L A;  2PBD P;  3NCK A;  4E04 A;  5IT5 A;  5FI7 A;  4KG2 A;  3A0R A;  3T4T A;  3HLE A;  1V9Z A;  3CAX A;  4ZBE A;  3BFC A;  3IHA A;  4U3T A;  1H8Z A;  5A90 A;  4GHI A;  1PZO A;  4NXG A;  4F3L B;  1DJA A;  3DTE A;  1YM1 A;  2H0T A;  1FIL A;  4ZAM A;  1YMS A;  3ICY A;  4A5R A;  1LSX A;  3MQQ A;  3UMD A;  3DWZ A;  5HPF A;  1XGI A;  1K57 C;  4WM9 A;  3PAE A;  1MY8 A;  1A0K A;  3RXW A;  3JYI A;  3O87 A;  1ERO A;  2WAE A;  4IBX A;  3LCE A;  2V0W A;  3OCL A;  3QP5 A;  3KSF A;  1MXO A;  5F5Y A;  2O9B A;  1TDL A;  2PHY A;  3PBS A;  1GCE A;  2EXA A;  1UGU A;  4GS9 B;  1O7E A;  4II7 A;  3B42 A;  4P6Z S;  3UB5 P;  4O01 A;  4HJ6 A;  5CHM A;  2LB9 A;  2QPN A;  3M2J A;  4FD8 A;  2XR0 A;  3IXH A;  3DAV A;  4LV3 A;  1P9W A;  3RH8 B;  3UE1 A;  2QHK A;  4IUK A;  3A3F A;  4DN0 A;  3GEC A;  1E3U D;  5HDC A;  4S2O A;  3C7U A;  3WS2 A;  2WYX A;  4FSF A;  4I3I A;  5FQJ A;  5EVL A;  1L0G A;  1QMF A;  4WMC A;  1P97 A;  1STZ A;  1CJF A;  2QJ7 A;  3PHY A;  2GX5 A;  4HJ4 A;  3E2K A;  3Q07 A;  3EGX C;  3QP1 A;  2Y2K A;  3S22 A;  4CLC B;  2ZQD A;  2HPB A;  1EWZ A;  2XRO A;  1PW8 A;  1LL8 A;  1DP9 A;  2WGV A;  5HSQ A;  3UDI A;  3QHY A;  4KZB A;  2ZM0 A;  1G28 A;  3FPW A;  4LLO B;  4YFM A;  5AVE A;  2ZL1 A;  3G2Z A;  5CEB A;  5CGS A;  1YLW A;  4RX2 A;  4P87 A;  4Y3I A;  4M3K A;  3CJM A;  3MZD A;  4KQO A;  2GJ3 A;  2JKR I;  3Q7V B;  5E2E A;  5F82 A;  5CHJ A;  3H7W A;  1NXY A;  2R9W A;  5J7E A;  2XD5 A;  5HAP A;  1NWZ A;  4PM9 A;  3LYX A;  4YOF A;  1VET B;  3UE6 A;  5DF9 A;  4P0M A;  3IX8 A;  3BRM A;  1XGJ A;  1KOU A;  2KX6 A;  5CER A;  5FL3 A;  3OCN A;  3TJZ C;  5D3O A;  1GA9 A;  4Y0U A;  2RL3 A;  3B47 A;  2W1T B;  3FG8 A;  4EU0 A;  2XEP A;  3T4K A;  4BQM A;  5F1F A;  3PYP A;  4R70 A;  3VMA A;  1XP4 A;  3BWL A;  3I7J A;  5I5L A;  1JNU A;  1ZG4 A;  4Q0I A;  3UE0 A;  4NXF A;  1OT9 A;  5EUA A;  2HDU A;  5CTN A;  5E2H A;  3F1P B;  5IHV A;  4ZJ2 A;  4OP8 A;  3HRE A;  4B4X A;  2VV6 A;  3IF6 B;  4BEN A;  1ESU A;  1H5X A;  2ZQ9 A;  5FA7 A;  5TBM A;  3KSG A;  3M6B A;  1JWV A;  4WZ5 C;  1VB6 A;  3EQU A;  1T1A A;  2P74 A;  2PD8 A;  4WYY A;  3L9K A;  5DTS A;  2HDS A;  4PM7 A;  4MN5 A;  4Q0J A;  3ITA A;  2MJ6 A;  5L10 A;  3ZNY A;  4GDN A;  3HLB A;  4KQD A;  4BBV A;  3TSG A;  5FQ9 A;  5EOE A;  1K56 A;  3IT9 A;  5FI2 A;  1AXB A;  2Y91 A;  1ODV A;  5L8M A;  2Y8H A;  4JXW A;  3IF6 C;  4ZDX A;  1KDS A;  4L0L A;  5M19 A;  4R4R A;  2X71 A;  3IXG A;  3MXS A;  4Y0T A;  4ID4 A;  5HW3 A;  3W8K A;  1YLP A;  4S2M A;  1OTA A;  2K7S A;  5DJT A;  3LIA A;  1UWN X;  1OT6 A;  1K6R A;  3BYD A;  1L0E A;  2HDR A;  4LV0 A;  3PBT A;  3AGF A;  3WRZ A;  3DW0 A;  3IXB A;  4Y5F A;  1O07 A;  1SCW A;  1T1B A;  5IS1 A;  1OJ5 A;  3CZD A;  1G5U A;  2G2U A;  4BJP A;  2G2W A;  3LIF A;  5FQK A;  1BYW A;  4MMN A;  4EER A;  1W63 Q;  4LCL A;  5HFO A;  1H8M A;  5EE8 A;  1CEG A;  3A0V A;  3SS5 A;  4E3K A;  4DXB A;  2D01 A;  1N9L A;  1XPB A;  5AQB A;  3OZH A;  5TJJ A;  1IEM A;  2W0N A;  5F69 A;  1S4S A;  1ZG6 A;  1XX2 A;  2XH9 A;  5GHZ A;  1S1Y A;  3JVU A;  2PR5 A;  3V3S A;  2BTF P;  3DBA A;  1F9I A;  3CI6 A;  3VE3 A;  1K55 A;  4N92 A;  2KDK A;  2PU4 A;  3IWI A;  3WS0 A;  3G35 A;  3IQA A;  1NJ4 A;  3ZNT A;  1BLS A;  4UA9 A;  2ZQA A;  5FDH A;  1OME A;  3KO6 A;  4OH0 A;  2XK1 A;  1PFL A;  3V67 A;  2FH5 A;  1K0K A;  1MBL A;  1BUE A;  2HDQ A;  4FH2 A;  4RA7 A;  5JYP A;  3BLM A;  3EWK A;  1MC0 A;  1TDG A;  2GNX A;  1L3L A;  3DTM A;  1T18 A;  1LL9 A;  5EVI C;  2ZOH A;  3QP4 A;  5DKL A;  2UV0 E;  2J3W A;  4CLC D;  3KYZ A;  2VX8 A;  4DF6 A;  1ES5 A;  4IHQ A;  4Y7P A;  3Q7V A;  4I3A A;  4IVI A;  3IF5 A;  2W3G A;  2KOI A;  1MWU A;  2EXB A;  1Q2Q A;  4JF5 A;  4G3W A;  1OPX A;  3LR3 A;  4X53 A;  1IKG A;  4ETZ A;  1CQA A;  1VET A;  3MKE A;  5FAQ A; 
#chains in the Genus database with same CATH homology
 3W4P A;  1JWP A;  2ZC6 B;  3HLE A;  5A91 A;  4EBL A;  1GHP A;  3MZE A;  3W4O A;  4KG5 A;  4OQ0 A;  5E2F A;  2Q9M A;  5GHY A;  1KGE A;  3N8L A;  3O3V A;  3BFC A;  3Q81 A;  3IHA A;  4ZBE A;  4U3T A;  3MZF A;  1H8Z A;  1MWS A;  5A90 A;  1GHI A;  4K0W A;  4C75 A;  3UN7 A;  5TGF A;  1K56 D;  1K6S A;  1PZO A;  1DJA A;  4B88 A;  3OC2 A;  1YM1 A;  2H0T A;  4R1G A;  1ES2 A;  1YMS A;  4ZAM A;  4LEN A;  4A5R A;  4HBT A;  4KZ8 A;  3NC8 A;  2HP5 A;  3DWZ A;  1JTD A;  1XGI A;  4P85 A;  1K57 C;  2ZQ8 A;  3MKF A;  4WM9 A;  1PYY A;  2JCH A;  1MY8 A;  3PAE A;  1RGZ A;  3RXW A;  2WGW A;  3G31 A;  3LY3 A;  4OLD A;  2OV5 A;  3JYI A;  5KMW A;  3O87 A;  1ERO A;  2A3U A;  2WAE A;  2Y2M A;  4E6X A;  5EVI B;  4GDB A;  2J9P A;  3LCE A;  2ZQ7 A;  4IBX A;  1PI4 A;  3OCL A;  4OLG A;  2XLN A;  3HLG A;  1FR1 A;  2BLS A;  2Y2H A;  3HUM A;  4QY6 A;  1MXO A;  4U0T A;  3UPP A;  3WWX A;  1ZKJ A;  4QJG A;  1W5D A;  1TDL A;  1L0D A;  4OPR A;  1QME A;  3PBS A;  2VGJ A;  3SH7 A;  1GCE A;  2EXA A;  2H0Y A;  3MXR A;  3E2L A;  4FCF A;  1W8Q A;  3QNB A;  3N8S A;  4OVD A;  1BSG A;  1O7E A;  5FI6 A;  1ONG A;  5A92 A;  4WEJ A;  1ES3 A;  2WGW B;  1CI9 A;  4QD4 A;  2H10 A;  5CED A;  3BEC A;  5CHM A;  3AGE A;  3NDE A;  1PWG A;  4Q8I A;  1I5Q A;  3UNW A;  2QPN A;  4N9L A;  3M2J A;  4FD8 A;  2XR0 A;  3IXH A;  3VP3 A;  5EOO A;  5FAO A;  5CHU A;  5E2G A;  4UA7 A;  4LV3 A;  4X68 A;  5I94 A;  2Y2J A;  3NI9 A;  3UE1 A;  1C3B A;  1KE4 A;  2XGN A;  4PM6 A;  1SKF A;  2WAD A;  4OPZ A;  1VM1 A;  3A3F A;  3C4P A;  4JKT A;  1E3U D;  3S1Y A;  3VSK A;  4S2O A;  3C7U A;  3WS2 A;  3VP2 A;  1JWZ A;  2WYX A;  4FSF A;  2P9V A;  5FQJ A;  5EVL A;  1L0G A;  4KZ3 A;  4KZ4 A;  3W4Q A;  1QMF A;  2FFY A;  1IYQ A;  3GVB A;  4WMC A;  5FAS A;  1YMX A;  4OPY A;  4NET A;  2ZM8 A;  4JLF A;  4OOM A;  4JBF A;  4QHC A;  3E2K A;  4E3N A;  3Q1F A;  3ZG5 A;  3ZHH A;  3Q07 A;  1RP5 A;  5A93 A;  1IEL A;  3GV9 A;  4O7D A;  3OPL A;  3SS3 A;  3PAG A;  2Y2K A;  4DDY A;  3IH9 A;  1Q2P A;  3S22 A;  5HAI A;  2OSU A;  2ZQD A;  5EEC A;  4PM5 A;  2HPB A;  5DTT A;  1EWZ A;  4X55 A;  5EPH A;  3PBN A;  2I72 A;  1PW8 A;  2P9V B;  3EQV A;  2WGV A;  3A3E A;  4EWF A;  3UDI A;  1BTL A;  3QHY A;  4KZB A;  4EBN A;  5CEC A;  2ZM0 A;  4KG6 A;  3LO7 A;  2WKI A;  3ZVT A;  4YFM A;  4UHU A;  3OPR A;  4KQQ A;  2OLV A;  3PBQ A;  1YT4 A;  1TVF A;  2XDM A;  2Y2G A;  3G2Z A;  5CEB A;  3VP0 A;  5CGS A;  1YLW A;  2QZ6 A;  1PIO A;  3UY6 A;  3LY4 A;  4P87 A;  4RX2 A;  4KQR A;  2UWX A;  4IVK A;  1ONH A;  3NY4 A;  1VQQ A;  4M3K A;  4OPQ A;  4XUZ A;  5FAT A;  2WZZ A;  3CJM A;  3MZD A;  4KQO A;  1K38 A;  1W7F A;  3TG9 A;  3Q82 A;  5J8X A;  5M18 A;  4GD6 A;  5U47 A;  5F1G A;  1HZO A;  4E3J A;  4UAA A;  3Q7V B;  3OPH A;  5FQI A;  1NRF A;  1M40 A;  5E2E A;  4X6T A;  5F82 A;  2Y2P A;  5CHJ A;  1FCM A;  4JF6 A;  1FOF A;  4S2I A;  1NXY A;  5G18 A;  1JTG A;  2R9W A;  5TR7 A;  1K25 A;  2XD5 A;  4LCM A;  5HAP A;  2XFS A;  4PM9 A;  3V3R A;  5HAR A;  2ZC3 B;  1BUL A;  4KZ5 A;  3VOZ A;  4QB8 A;  3ZG0 A;  4MBH A;  4WEL A;  5DF9 A;  1PW1 A;  3VP4 A;  2IWB A;  4P0M A;  2Y4A A;  4PMA A;  3GTC A;  1N9B A;  1NYY A;  1CEF A;  3BRM A;  3IHB A;  5F83 A;  1XGJ A;  1IYS A;  4KZ9 A;  2WAF A;  2Y2L A;  5CER A;  4OQI A;  1DY6 A;  3P98 A;  4DE0 A;  3OCN A;  4MNR A;  4IED A;  1ES4 A;  3ISG A;  5D3O A;  1GA9 A;  1LLB A;  3ZG8 B;  4OON A;  4Y0U A;  2WK0 A;  2RL3 A;  4E3M A;  1S6R A;  2GDN A;  5GLD A;  5CGW A;  4QU3 A;  2XEP A;  1J9M A;  4BQM A;  2ZM2 A;  4RX3 A;  5F1F A;  2Q9N A;  3VMA A;  1E3U A;  3RJU A;  4WBG A;  1XP4 A;  4NK3 A;  4JXS A;  1FCO A;  3I7J A;  3PBO A;  2ZC7 A;  1ZG4 A;  3IF6 A;  4OOL A;  4EUZ A;  3P09 A;  3UE0 A;  4DE3 A;  2WZX A;  4C6Y A;  1FSY A;  4S2N C;  5EUA A;  4BL2 A;  4E3L A;  1IYO A;  2HDU A;  4GN2 A;  5CTN A;  4EQI A;  3FZC A;  3G2Y A;  1TEM A;  3GMW A;  5HAQ A;  4PPR A;  5FSR A;  2VGK A;  5CXW A;  5E2H A;  3NDG A;  2V20 A;  2ZQC A;  1WE4 A;  5KSC A;  1NYM A;  4FH4 A;  3S4X A;  4DRT A;  2Y59 A;  5IHV A;  4ZJ2 A;  1MWT A;  1KVL A;  2EFU A;  3HRE A;  4OP8 A;  5E43 A;  5EVI D;  4B4X A;  1IKI A;  1U60 A;  1Y54 A;  3PBR A;  3HLD A;  3GQZ A;  1N4O A;  2Y2N A;  3IF6 B;  5DVA A;  4XXR A;  2EX2 A;  4BEN A;  1ESU A;  1H5X A;  1KDW A;  1M6K A;  2ZQ9 A;  1BT5 A;  5AQA A;  5FA7 A;  3NIA A;  4X69 A;  2ZLY A;  3Q7Z A;  1Z6F A;  4OP5 A;  4MBF A;  3M6B A;  3GR2 A;  3ITB A;  3PTE A;  3ZFZ A;  1RCJ A;  1JWV A;  4GZB A;  3O86 A;  2B5R A;  4WZ5 C;  2WUQ A;  5FQM A;  4MLL A;  1LHY A;  3EQU A;  1W8Y A;  4S2P A;  3O88 A;  2P74 A;  1YLZ A;  1KE3 A;  1WYB A;  1HVB A;  1G68 A;  4WYY A;  1PI5 A;  4S2N A;  5DTS A;  2HDS A;  4PM7 A;  3ITA A;  3V50 A;  5KSH A;  3G4P A;  1YQS A;  1WYC A;  4JPM A;  3B3X A;  3ZNY A;  1YLY A;  2C5W B;  4GDN A;  1LI9 A;  2PBY A;  3HLB A;  3WRT A;  4KZ6 A;  1ERM A;  3UPO A;  3AGD A;  4HBU A;  3TSG A;  1ERQ A;  3TOI A;  4N1H A;  5FQ9 A;  2R9X A;  2JE5 A;  2V1Z A;  5EOE A;  5DF7 A;  4BL3 A;  5AQ9 A;  3HLF A;  1CI8 A;  3IXD A;  1K56 A;  3IT9 A;  2Y55 A;  1XA1 A;  4R3J A;  4GNU A;  3FKW A;  5FI2 A;  5M1A A;  1AXB A;  2Y91 A;  1PWC A;  4X56 A;  1MPL A;  3N7W A;  4XUX A;  1BLP A;  4K0X A;  2FFF B;  2OLU A;  5HX9 A;  4JXW A;  5DTK A;  3FKV A;  3IF6 C;  1FQG A;  4ZDX A;  1ALQ A;  1KDS A;  2V2F F;  3ZDJ A;  4WMC D;  4S2J A;  1HTZ A;  3SS4 A;  1SDN A;  2PU2 A;  3V39 A;  4L0L A;  5M19 A;  4WZ5 A;  3GSG A;  4R23 A;  4Z9Q A;  4R4R A;  2DNS A;  3ZVW A;  2X71 A;  1JVJ A;  2JBF A;  3IXG A;  1XA7 A;  3MXS A;  4QY5 A;  4ID4 A;  3SH8 A;  4BLM A;  4Y0T A;  1DJC A;  4R3B A;  4HES A;  5HW3 A;  1MWR A;  2ZD8 A;  3MFD A;  4GOG A;  4OOY A;  2J8Y A;  3BFG A;  5FQQ A;  3V5M A;  3W8K A;  5JYO A;  1YLP A;  4OQG A;  4S2M A;  3A3J A;  3WS4 A;  4JF4 A;  2EX9 A;  2C6W B;  4MEZ A;  4P6B A;  1E25 A;  2ZC5 B;  3QNC A;  4KZ7 A;  3BYD A;  1K6R A;  3ZGA B;  5KZH A;  3VFH A;  4KEN B;  5FAP A;  1L0E A;  2Z2L B;  4ZJ3 A;  4S2K A;  3MBZ A;  3HLC A;  4OQH A;  2HDR A;  3BFF A;  3BFE A;  4MBK A;  1K54 C;  1XKZ A;  1K55 C;  3PBT A;  1MKI A;  4LV0 A;  2E8I A;  3AGF A;  3ZCZ A;  4Y0O A;  3VSL A;  5GLC A;  3WRZ A;  3DW0 A;  3IXB A;  1YLT A;  3NBL A;  4CJN A;  1O07 A;  1SCW A;  4DKI A;  2QMI A;  3CZD A;  5EVI A;  1KGF A;  2G2U A;  4BJP A;  2G2W A;  2ZC4 B;  2HP6 A;  5FQK A;  5GHX A;  4JXG A;  3C7V A;  2ZMA A;  3GRJ A;  4LCL A;  2RCX A;  5CGX A;  4R4S A;  4DDS A;  4F94 A;  4GKU A;  5HFO A;  1YLJ A;  2Y2O A;  2ZJ9 A;  3UDF A;  4DE2 A;  4E3I A;  4EBP A;  3BEB A;  5EE8 A;  1SHV A;  1CEG A;  3DWK A;  1KE0 A;  1RGY A;  2Y2Q A;  3UO9 A;  1FR6 A;  1BLC A;  1BZA A;  3SOI A;  3SS5 A;  4E3K A;  3HLW A;  4E3O A;  3UDX A;  4LV2 A;  2X01 A;  1LI0 A;  1HD8 A;  1XXM A;  3N6I A;  4DXB A;  3CG5 A;  4YIN A;  4LV1 A;  2J7V A;  4JXV A;  3WS5 A;  3WS1 A;  4ZJ1 A;  4WZ4 A;  3IH8 A;  2DCF A;  1XPB A;  5AQB A;  3OZH A;  3G34 A;  5HL1 A;  5L2F A;  1BLH A;  1IEM A;  3C5A A;  1NZU A;  1PZP A;  3FYZ A;  1I2W A;  4IBR A;  4WEK A;  2EX8 A;  4OKP A;  1ZG6 A;  2XQZ A;  1XX2 A;  2XH9 A;  1NZO A;  2BG1 A;  5GHZ A;  1H8Y A;  1ZC2 A;  3V3S A;  2IWD A;  3VP1 A;  2CC1 A;  3HL9 A;  3G30 A;  4K91 A;  1K4E A;  1K54 A;  4RVA A;  1K55 A;  2DRW A;  4N92 A;  4EV4 A;  2PU4 A;  3IWI A;  3WS0 A;  2WKE A;  1FSW A;  4RYE A;  3ZG9 B;  3N8R A;  3G35 A;  1ESI A;  1DJB A;  3IQA A;  3HUN A;  1L0F A;  5CTM A;  1SDE A;  1W79 A;  1NJ4 A;  3HVF A;  3ZNT A;  2XD1 A;  1BLS A;  4N9K A;  1FCN A;  4PM8 A;  4UA9 A;  1EI5 A;  4U0X A;  3BFD A;  2ZQA A;  5FDH A;  1OME A;  2Y2I A;  2JC7 A;  1L2S A;  5TFQ A;  1GHM A;  5GL9 A;  4OH0 A;  2J9O A;  3FWL A;  1K57 A;  2XK1 A;  4DE1 A;  1I2S A;  1KGG A;  4C3Q A;  1MBL A;  4H8R A;  4N1X A;  1NY0 A;  1BUE A;  2HDQ A;  4FH2 A;  3D4F A;  3G32 A;  4GD8 A;  3SH9 A;  4RA7 A;  3RXX A;  5JYP A;  3BLM A;  1K4F A;  2XFT A;  4D2O A;  4BD0 A;  3UE3 A;  2A49 A;  2H5S A;  1TDG A;  3HUO A;  3BM6 A;  3C4O A;  1LL5 A;  1LL9 A;  3DTM A;  5EVI C;  1E4D A;  5DF8 A;  4E6W A;  1KVM A;  2IWC A;  3IWQ A;  1GA0 A;  3A3I A;  3IWO A;  5GLB A;  4UA6 A;  2WGI A;  3BLS A;  3LEZ A;  1ES5 A;  4DF6 A;  4DXC A;  1PWD A;  5AQ7 A;  2XF3 A;  4HEF A;  3Q7V A;  4Y7P A;  5CRF A;  5GLA A;  1S0W A;  4IVI A;  3IF5 A;  3CMZ A;  2Z2M B;  3VOY A;  1MWU A;  2EXB A;  1Q2Q A;  3HBR A;  4JF5 A;  3VFF A;  4B4Z A;  3OPP A;  4CPK A;  4BD1 A;  3M2K A;  3N4I A;  2WKH A;  2EFX A;  4ZTK A;  3FV7 A;  1G6A A;  3M6H A;  3A3D A;  2HP9 A;  2X02 A;  1CK3 A;  4KZA A;  4GB7 A;  4R0Q A;  4X53 A;  3UPN A;  4S2L A;  1IKG A;  3NCK A;  3ZG7 B;  1IYP A;  3MKE A;  2EX6 A;  5FI7 A;  5BOH A;  5FAQ A;  4KG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...