3WS2A

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (condition-1c)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
360
structure length
360
Chain Sequence
b'QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAIDVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
molecule tags Hydrolase
total genus 118
structure length 360
sequence length 360
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ws2A00
3P09A 3FWLA 3E2LA 1G68A 4R23A 4E3NA 4X53A 1Q2PA 2Y2GA 4S2NC 3FV7A 4OLDA 5IHVA 3ZG5A 3NBLA 4KZBA 4MBKA 1GCEA 1W5DA 4BQMA 5DF9A 2H10A 2Y2MA 4ZBEA 1KVMA 4KG6A 1FCNA 1MBLA 1Y54A 1XA7A 4C75A 3BEBA 4GDBA 5I94A 5F1FA 2ZLYA 4OPQA 2PU2A 2ZQCA 2FFYA 3GRJA 2IWDA 2P74A 1OMEA 3ZG0A 1M6KA 1KDWA 1NY0A 3N6IA 2VGJA 2XK1A 1YQSA 5FQMA 5A93A 4R0QA 1QMFA 4GNUA 4MNRA 5E2HA 1K56D 3M6BA 3HLGA 3BFFA 5F82A 3LO7A 4X69A 1TDGA 4BL3A 5GLDA 1N4OA 1KE0A 4F94A 1NYYA 4QY6A 4GOGA 1KGFA 4KQRA 2ZM2A 4S2MA 4KZ3A 4GN2A 4DE0A 1W8QA 1HZOA 2EX6A 3QNCA 4OPZA 5HAPA 3BYDA 2ZC4B 3BECA 3TSGA 3VOZA 3G30A 1E3UA 1FCOA 1RGZA 2Y91A 3FYZA 3OCNA 5AQAA 2EFUA 3MFDA 1O7EA 3HREA 5A92A 4C6YA 2BLSA 3Q7ZA 2Y2QA 3NI9A 5EVLA 1YLJA 1PZOA 2G2WA 2V1ZA 4WEJA 3HLEA 1H8YA 2DNSA 4FD8A 4JF6A 4KZ9A 4D2OA 3HLDA 2HP6A 3BM6A 1MWUA 4N9KA 1GHMA 3ITAA 3ZCZA 4DE1A 1PZPA 3N8LA 1SCWA 1JWPA 1MWRA 4RYEA 4GD6A 3IHAA 4KZ5A 4X55A 2Y2OA 5M18A 3NCKA 3GMWA 4Y0OA 5F1GA 4U3TA 1XKZA 5A90A 5JYOA 3NIAA 4JXGA 2EX9A 1PI4A 5FATA 4E6WA 1ES2A 4WM9A 2HP5A 1TDLA 4MBHA 3Q82A 4EBLA 2WKHA 5E2GA 3CG5A 2J9OA 4WEKA 3G2YA 1U60A 4R3JA 5EOEA 1K6RA 2JCHA 2VGKA 4WZ5C 4EUZA 1PYYA 1YLPA 4FSFA 4UHUA 4KZ6A 1ZG6A 3SS5A 1N9BA 3UDFA 2EFXA 5FASA 1ONHA 1K54A 5TGFA 3W4QA 3SH7A 4UA9A 1GHPA 2Y55A 4R4RA 4GDNA 3MZDA 1ZKJA 5FQQA 5HX9A 5CTMA 3VFHA 4OH0A 3DTMA 3VP0A 5FQ9A 1CEGA 3Q7VA 1RCJA 4RX3A 4LCLA 3PBRA 2DRWA 3AGDA 5EE8A 3ZG7B 3BLMA 2ZC3B 3IXBA 3ZNYA 1XX2A 4OOMA 1DY6A 2J9PA 1K4FA 4IVIA 5G18A 2XR0A 3HUMA 3NY4A 3S22A 1BSGA 4HEFA 2Q9MA 4LENA 3ZNTA 4UA6A 3MZEA 4N92A 3VFFA 4LV0A 1YLWA 4B4XA 3EQVA 5CEDA 1KE3A 5FI7A 1HD8A 5HW3A 4BL2A 3HLWA 2BG1A 3ZFZA 4E3MA 2OLVA 2B5RA 1CI9A 3GV9A 4B88A 3CJMA 5CRFA 5AQ9A 3UE0A 3M2KA 4OLGA 1M40A 5CHUA 5EPHA 3IQAA 3V39A 3C7UA 3MXRA 4WYYA 1IKIA 2G2UA 5GHXA 4E3OA 5GLBA 5D3OA 4UAAA 5CTNA 3N8SA 1MY8A 1E3UD 4ZAMA 2WADA 3AGEA 3DW0A 3VSKA 1FSWA 2ZMAA 3BFDA 1LL9A 4RX2A 3OPHA 4XXRA 3ITBA 3HL9A 4ZTKA 4GZBA 4H8RA 5HAIA 3FZCA 1KE4A 3M2JA 4JF4A 1GHIA 4YFMA 1XXMA 2E8IA 4K91A 5EVIA 5HFOA 3ZG9B 1W7FA 1BLPA 2Y2JA 4JKTA 1RGYA 1GA0A 2X71A 2ZC5B 2EX8A 3SS3A 4Q8IA 3IXDA 2JE5A 4PM5A 4N1HA 5FAOA 4OP8A 2C6WB 4BD0A 4MBFA 4S2KA 3N4IA 1DJCA 4OQIA 4U0XA 4B4ZA 4QY5A 5FQIA 4P6BA 4PM9A 2Z2MB 1YM1A 1IYOA 1K55C 4IVKA 4Z9QA 4OONA 1CEFA 1H8ZA 5J8XA 4WZ4A 1Q2QA 4KZ8A 1K4EA 3GTCA 4Y7PA 5GHZA 1BLSA 2XGNA 4N1XA 4R1GA 2A49A 2HDRA 1GA9A 1YLTA 4RA7A 4ZJ3A 1TEMA 4KZ4A 4R3BA 4K0XA 4YINA 3UE1A 1ERMA 4DXCA 4MEZA 2HP9A 1S0WA 3SH8A 2Q9NA 1EI5A 1SHVA 1VQQA 3BFEA 3PAEA 3W8KA 3WS1A 1W8YA 4KG2A 2IWCA 1MPLA 2WK0A 1MWTA 2XH9A 1FR6A 3G2ZA 3HUNA 4KZAA 4DKIA 2Y2PA 1PW8A 3IXGA 5GLAA 4ZJ1A 2XF3A 4E3IA 2HDQA 2EXAA 2QPNA 4S2IA 3NDEA 2Y2LA 3WS5A 1HTZA 1JTDA 3Q7VB 4DXBA 1ES4A 5M19A 3PTEA 5CGWA 3N7WA 1CK3A 3TOIA 1BT5A 4DE2A 3BFGA 3QNBA 5BOHA 5EECA 4LV2A 4IBRA 4QJGA 5FA7A 4EWFA 4DE3A 1EROA 1XGJA 4MLLA 1W79A 1ERQA 4IBXA 1BUEA 3A3FA 1G6AA 2PU4A 1WYCA 3IWQA 4S2NA 4CPKA 2Y2KA 3MKFA 5EUAA 4P87A 3IH8A 3VSLA 3UDXA 4S2JA 3V50A 5HARA 3SS4A 3V3RA 4WELA 3UPPA 1PI5A 4UA7A 3OCLA 1KDSA 3PBQA 1ESUA 3OPLA 1K57C 4L0LA 2XD1A 1PWCA 5DTKA 1LHYA 2WAEA 3ISGA 3OZHA 4JF5A 4OQGA 4FCFA 5E2FA 4DF6A 1L0GA 2ZJ9A 4PPRA 5EVID 3OPPA 3DWZA 5TR7A 2XFTA 3ZG8B 4WMCA 3LY4A 3O3VA 2V2FF 5EVIB 3GQZA 2WYXA 3TG9A 2JBFA 3GSGA 3IH9A 2A3UA 3C4PA 1JWZA 1LI0A 5A91A 1K25A 5GL9A 3PBOA 4PM6A 3PBNA 5CGSA 1NJ4A 3WWXA 4WBGA 1IEMA 4JPMA 5CECA 3VOYA 2IWBA 1IELA 2X01A 5FQKA 2Y59A 2ZQAA 4S2LA 2P9VA 1JVJA 5F83A 4FH2A 1XPBA 3IWOA 3O88A 2H0YA 3VP4A 1ESIA 3JYIA 4OOYA 3E2KA 1FCMA 1CI8A 4U0TA 3SOIA 4BD1A 3G32A 3MKEA 5KZHA 1YMXA 3WRZA 1O07A 4C3QA 4E3LA 1YT4A 1JWVA 2Y2NA 4QD4A 4OPYA 3LEZA 4PMAA 2XDMA 2EXBA 5CERA 2XEPA 3IF6B 2ZM8A 3HLCA 1IYPA 3LY3A 4O7DA 3PAGA 5HAQA 3GVBA 3LCEA 4GD8A 4DRTA 3A3EA 3UE3A 5DTSA 4JXVA 2JC7A 5GHYA 1BULA 2Y4AA 2ZD8A 4BJPA 1H5XA 3IWIA 3PBTA 3QHYA 3W4PA 3MBZA 1DJAA 2V20A 1JTGA 5FSRA 3V3SA 4E6XA 5HL1A 4DDYA 1RP5A 3ZVTA 1BTLA 4PM7A 5DTTA 5JYPA 2OSUA 2Z2LB 3D4FA 4JLFA 5AQBA 3BLSA 1XP4A 3G35A 4IEDA 1HVBA 1BLHA 3P98A 5M1AA 5EOOA 5KSHA 1PWGA 3CMZA 4P85A 3PBSA 3SH9A 1KGGA 1FQGA 1NYMA 4KG5A 4EBPA 2WKEA 2PBYA 1E4DA 3MZFA 1EWZA 1QMEA 4JXWA 1IYQA 5FAQA 5L2FA 4RVAA 2QZ6A 1FR1A 2Y2HA 4A5RA 4GKUA 2WUQA 4Y0UA 5CGXA 4LCMA 1LLBA 4OVDA 4K0WA 5DVAA 3VMAA 3OC2A 5FI6A 3IXHA 3G4PA 4EV4A 2XD5A 2WGWB 4DDSA 5CXWA 5GLCA 1FSYA 1I2SA 1WE4A 2J8YA 2ZQ9A 3IF6A 2R9XA 5KSCA 4X56A 3EQUA 5FI2A 2ZC7A 1C3BA 1K54C 3G34A 4ZJ2A 1MXOA 4WMCD 4OP5A 5DF7A 1MKIA 4NETA 3V5MA 1PWDA 1MWSA 2UWXA 1KVLA 3IF5A 5FDHA 2XLNA 2WZXA 4BLMA 1FOFA 1KGEA 1SDEA 2HDUA 2J7VA 1SDNA 2H5SA 4CJNA 4R4SA 3RXXA 1DJBA 3O87A 2I72A 1PIOA 5FAPA 1Z6FA 2RCXA 3IHBA 3HBRA 4OQ0A 2EX2A 2H0TA 2P9VB 4S2PA 3VP2A 1NZUA 1NRFA 1LI9A 4KZ7A 4QU3A 2ZC6B 3WS2A 4X6TA 1J9MA 1SKFA 3C4OA 1XGIA 4M3KA 2ZQ8A 3ZHHA 2X02A 4KENB 1L0FA 3NC8A 4ID4A 1WYBA 2WAFA 3MXSA 3HVFA 2XFSA 3A3IA 5U47A 3RXWA 3DWKA 1S6RA 1L0DA 1L2SA 1ZG4A 2ZQ7A 1K38A 2WGWA 3C7VA 1PW1A 4JXSA 4PM8A 5E2EA 1ES5A 4OPRA 5KMWA 5CHMA 1K55A 3HUOA 1YLZA 2ZM0A 2HDSA 2GDNA 3BFCA 5E43A 3UN7A 1XA1A 4Y0TA 4QB8A 3W4OA 4OKPA 1BLCA 4OQHA 4XUXA 4HBTA 4N9LA 4XUZA 5EVIC 3Q07A 1K56A 5CHJA 3G31A 5DF8A 3UPNA 3UY6A 4FH4A 3GR2A 2HPBA 3A3JA 2WGVA 4X68A 1NZOA 3C5AA 3ZVWA 3HLFA 5FQJA 1ALQA 4BENA 4NK3A 3UPOA 3CZDA 1I5QA 4HESA 4KQOA 3WS4A 2Y2IA 3B3XA 4JBFA 3S1YA 3ZGAB 1E25A 1I2WA 2WZZA 4OOLA 4P0MA 2WGIA 1L0EA 1YMSA 3M6HA 3IT9A 1YLYA 2DCFA 3O86A 2RL3A 1BZAA 3OPRA 3FKWA 4LV3A 4EBNA 3I7JA 3WS0A 3UDIA 3HLBA 2WKIA 4HBUA 4E3JA 1ES3A 4KQQA 4E3KA 5TFQA 1IYSA 2ZQDA 3IF6C 1TVFA 4GB7A 3S4XA 3UO9A 3VP3A 4EQIA 1ONGA 3UNWA 3AGFA 1LL5A 2OLUA 3Q1FA 2FFFB 2R9WA 1K6SA 2C5WB 2XQZA 3WRTA 3BRMA 1IKGA 1VM1A 2QMIA 4S2OA 1ZC2A 3NDGA 4WZ5A 2OV5A 3RJUA 1NXYA 3VP1A 3Q81A 1K57A 4QHCA 5CEBA 2CC1A 5AQ7A 1AXBA 3N8RA 3ZDJA 4LV1A 4ZDXA 3FKVA 3A3DA
chains in the Genus database with same CATH superfamily
3FWLA 1G68A 4R23A 4E3NA 4X53A 3ZG5A 2OAQ1 4O0PA 4KG6A 1TS6A 4OPQA 1UGUA 1XJ2A 3ZYTA 2A24B 3M6BA 2JHEA 2G7UA 3LO7A 4X69A 3S7NA 1TD5A 1NLYA 1N4OA 4KZ3A 1W8QA 3BYDA 3BECA 3VOZA 5HSQA 1E3UA 2Y91A 1VEUA 3HREA 5A92A 4C6YA 1F98A 3NI9A 3LIEA 4P6ZM 4B9OA 3ITAA 3O5YA 3ZCZA 3LR0A 3N8LA 1SCWA 2W3DA 4RYEA 1NLZA 3IHAA 4X55A 2Y2OA 3NCKA 3GMWA 4Y0OA 4U3TA 1LSWA 5A90A 5JYOA 3E4PA 1ES2A 4WM9A 3UB7A 4MBHA 3Q82A 5E2GA 3K3CA 2J9OA 4WEKA 2VGKA 1PYYA 2O0YA 3CI6A 1N9BA 3NHQA 1GHPA 4FOFA 4R4RA 4GDNA 4MDZA 2B95A 3BY9A 3NECA 5G4YA 1DY6A 5G18A 3HUMA 1OT6A 1TS7A 2ZL1B 1OTDA 3EQVA 5HW3A 1NWZA 2Y79A 4R38A 3ZFZA 3T1XA 4E3OA 3N8SA 5F69A 1GSVA 1VEUB 1LL9A 1L3LA 3OPHA 1A0KA 4XXRA 3TRCA 4JF4A 4IUHA 1OTIA 2EX8A 4Q8IA 1Z09A 2JE5A 5FAOA 4OP8A 4WLAA 4S2KA 1DJCA 4B4ZA 4QY5A 4UQIS 2PYPA 3QP1A 4IVKA 3PHYA 5J8XA 1Q2QA 4KZ8A 2L1MA 1BLSA 2XGNA 2UV0E 4XT2B 2A49A 2HDRA 4R3BA 3ICYA 1EW0A 1ERMA 2OWHA 4MEZA 2JKTM 2Q9NA 3BFEA 4HH3A 3TJZC 1ODVA 1MC0A 1PW8A 5HPIA 5L8MA 3U2AA 3CUEC 3CPTA 4E3IA 5L10A 3OLOA 1YKDA 3WS5A 3PTEA 3N7WA 2W3GA 4GHIA 5MC7A 5FA7A 4DE3A 1EROA 2XA7S 4S2NA 3MKFA 1YSQA 4P87A 3EGXC 3VSLA 2O99A 2V8FA 5I5LA 3V3RA 3UPPA 4I3JA 1PI5A 3OCLA 5HD5A 1T1AA 3D72A 2A2LA 4R6LA 2WAEA 3OZHA 4DF6A 2QJ5A 2ZJ9A 4YWZA 3LR3A 3A0SA 5TR7A 3ZG8B 4WMCA 3O3VA 3GSGA 2A3UA 1LI0A 4PM6A 3PBNA 3LYXA 5AVEA 4WBGA 1IEMA 2R78A 4JPMA 5CECA 2ZQAA 1TF1A 3NOTC 4OOYA 1FCMA 1CI8A 3BW6A 3SOIA 1YMXA 3NOPC 1H3QA 2VKSA 4QD4A 4OPYA 2P04A 4JGOA 2EXBA 4Q0JA 5TBMA 3LY3A 5HAQA 3T1SA 3A3EA 3UE3A 4JXVA 2Y4AA 3RH8B 1H5XA 3IWIA 3CPTB 4NKPA 5EFWA 3VE4A 3V3SA 5HL1A 4DDYA 5JYPA 1BTLA 3BLSA 1XP4A 3G35A 1HVBA 5EOOA 4KUOA 4G3KA 1F2KA 1T19A 1QMEA 2JKTI 1XFQA 1D06A 2Y2HA 2VJWA 4GKUA 5CGXA 3CAXA 4OVDA 2EWVA 5KSCA 2J8YA 3BQ8A 2GX5A 4Q0IA 4OP5A 1MKIA 2UWXA 5IU1A 4ETXA 2WZXA 2HDUA 2J7VA 2H5SA 4ME4A 3RXXA 1DJBA 2I72A 3IHBA 4OQ0A 4CLCB 1OTBA 1NRFA 1LI9A 2PAVP 4HH2A 1J9MA 3C4OA 3ZHHA 3MXSA 3HVFA 2XFSA 3A3IA 5U47A 1L0DA 3LIDA 5TBMB 1ZG4A 2Q0OA 4PM8A 2V1AA 1ES5A 3HUOA 5E43A 4OKPA 4BWIA 1GSWA 4Q0HA 1S4RA 4XUZA 3Q07A 1G6OA 5DF8A 3R7WB 3GR2A 4X68A 1NZOA 3C5AA 2ZMVA 4Y15A 1I5QA 2Y2IA 3B3XA 2KX6A 2INWA 4JBFA 1E25A 2LB5A 1L0EA 1OT9A 3LI8A 4NXEA 4EW7A 1GSXA 3BJNA 3OPRA 4LV3A 4M4XA 2OWJA 3UDIA 3T4TA 1F9IA 2YKHA 3UE6A 3UO9A 4HJ6A 1ONGA 2FFFB 3A0RA 1VM1A 3NDGA 4P6ZS 3KYEA 2VGLS 3C8CA 2OV5A 1LSXA 3DTIA 4EESA 3MXQA 5EV0A 4S2NC 3KSIA 2PRFA 3NBLA 4ZBEA 2E8JA 4G3VA 4LGWA 5I94A 4LLOB 2ZQCA 3MJQA 3GRJA 3N6IA 2VGJA 3LEQA 3MR0A 1QMFA 4GNUA 4MNRA 5HWVA 2V0UA 1MKMA 3HLGA 3BFFA 5F82A 1TDGA 3E4QA 4BL3A 3MS6A 2ZM2A 3OBFA 3CHWP 4CLCD 5HAPA 2VV7A 2ZC4B 3TSGA 1YSPA 4DN0A 3FYZA 2EFUA 3MFDA 2GNXA 1YLJA 2G2WA 2V1ZA 3IBJA 2YKFA 3C2WA 5A8BA 4PHTA 4H6JA 3PR6A 4Z1WA 1FILA 5HDCA 4EERA 1JWPA 1MWRA 4GD6A 4KZ5A 1XKZA 4NG2A 2ZOIA 2W3HA 4E6WA 3G6OA 2HP5A 2WKHA 3G2YA 5EOEA 4FSFA 4NXGA 3VOLA 4JGRA 3UDFA 2EFXA 4GS9B 1ONHA 5FASA 3W4QA 3SH7A 3S7QA 3MSHA 2Y55A 1AWIA 3MZDA 5IT5A 5HX9A 3VFHA 4RX3A 2PR5A 3PYPA 2DRWA 3ZG7B 3QP8A 3L9KA 2J9PA 1CJFA 3LFVA 4HEFA 5L09A 4LENA 4N92A 3LI9A 4B4XA 5FI7A 1HD8A 3F1OB 2BG1A 4E3MA 2OLVA 1CI9A 1DP6A 4OLGA 1M40A 5CHUA 4NEED 3IQAA 2M7UA 3C7UA 5GLBA 4UAAA 2WADA 3AGEA 3VSKA 2ZMAA 3BFDA 4Y3IA 2O9BA 3ITBA 4BBTA 1KE4A 1GHIA 2V1BA 5HFOA 1BLPA 2Y2JA 4GCZA 1RGYA 4ETZA 4H6JB 3NJAA 2C6WB 3MFXA 4RQ9A 2O9AA 3N4IA 3NULA 1IYOA 5J7EA 2ZL1A 1CEFA 1FIKA 4WZ4A 1K4EA 1S66L 5GHZA 4N1XA 1VHMA 4R1GA 1GA9A 4RA7A 4KZ4A 4YINA 1ZHHB 3PAEA 1VQQA 3WS1A 3W8KA 4KG2A 2WK0A 5C5KA 4DKIA 1TS8A 5AJGA 4UEYA 4LPZA 5GLAA 4ZJ1A 2EXAA 4S2IA 4II7A 1ES4A 5CGWA 1CK3A 3TOIA 1BT5A 4WF0A 4BMWA 4LV2A 1XGJA 1G6AA 5DKLA 2PU4A 1WYCA 2Y2KA 2EA9A 3IH8A 3V50A 4WELA 1ESUA 4GJ4A 3OPLA 4XT2A 2OOLA 1PWCA 1YPRA 3UB8A 5FEFA 2JKRM 1LHYA 3ISGA 3C30A 4I39A 4OQGA 5E2FA 4PPRA 1T1BA 4D60A 2M7VA 4QWOA 3GQZA 2JBFA 3IH9A 3C4PA 5A91A 1JWZA 1KOUA 2ZMFA 3BWLA 3VOYA 2P9VA 4FH2A 3E2KA 4BD1A 3G32A 5KZHA 2JKFA 1O07A 3H9WA 4E3LA 1D1JA 2MJ6A 1MZUA 3T4KA 3LEZA 4WN5A 2XEPA 3IF6B 3HLCA 3U4LP 3PAGA 3LCEA 2M1CA 2QWSA 2JC7A 3PBTA 3W4PA 3QHYA 5DTTA 2Z2LB 4ZRRA 4IEDA 1BLHA 3P98A 5M1AA 1PWGA 2HJEA 3PBSA 1E4DA 1EWZA 4JXWA 1IYQA 5FAQA 2JN7A 3P7NA 4HJ4A 4RVAA 4LCMA 3OC2A 5FI6A 4DDSA 3KSHA 1CF0A 1FSYA 1WE4A 4GLQA 3EQUA 2ZC7A 3JVUA 4ZJ2A 5DF7A 4NETA 3DAVA 3IF5A 3MF0A 1S67L 1FOFA 2J3TD 1SDEA 4DJ2A 1SDNA 4R4SA 1PIOA 5FAPA 1N9OA 1Z6FA 1NRJA 2P9VB 4S2PA 1NZUA 2FZ0A 4KZ7A 2ZC6B 3WS2A 1ACFA 1SKFA 2JKRI 4M3KA 1XGIA 2I9VA 2X02A 4KENB 4ID4A 3S7PA 3RXWA 2QYBA 2KDKA 3C7VA 4JXSA 2J3WA 4OPRA 1YLZA 3UN7A 2HDSA 3IX3A 4PKYG 4MCWA 3LR5A 4HBTA 1VB6A 3CLOA 3UPNA 2PBDP 2HPBA 2WGVA 3HLFA 2K7SA 3UPOA 3CZDA 1WA9A 4KQOA 4CLCA 1I2WA 4P0MA 2WGIA 3K2NA 3M6HA 1YMSA 1T18A 3O86A 1BZAA 3SZTA 4Y13A 3WS0A 3HLBA 3E98A 1ES3A 4HP4A 5TFQA 1IYSA 2ZQDA 2OAP1 5J4EA 3IF6C 4HY8A 4I3AA 1OJ5A 2B02A 4EUVA 1LL5A 1Y28A 3QP4A 2C5WB 2XRNA 3BRMA 4S2OA 3V67A 3R7WA 3PXPA 4BBUA 3Q81A 4EQ1A 1DRMA 5AQ7A 3N8RA 1K0KA 3FKVA 3A3DA 3P09A 3K3DA 3FV7A 4OLDA 4BQMA 4KZBA 3KSFA 1W5DA 5DF9A 2H10A 2Y2MA 5FDSA 1FCNA 4ARZA 3B33A 4GDBA 2FFYA 2IWDA 3T4JA 3EOIA 1M6KA 1NY0A 3B42A 3ZG0A 1H0MA 3SW1A 5FQMA 4HIAA 1IOUA 5E2HA 1K56D 3IS2B 4HHDA 2V0WA 5GLDA 1BYWA 1NYYA 2XSSA 4KQRA 1OTEA 4GN2A 1ZTUA 1HZOA 2EX6A 5G4ZA 1RGZA 5HZHA 4LRXC 5L07A 1LSVA 2Y2QA 5EVLA 5F6AA 4WEJA 2D01A 4YOFA 1H8YA 4JF6A 4D2OA 3UB6A 3BM6A 1MWUA 4N9KA 5DFXA 4DE1A 1PZPA 2HZ5A 1LL8A 4JXGA 2EX9A 1PI4A 2K31A 1TDLA 4EBLA 3CG5A 4R3JA 2JCHA 2PD8A 2Y8HA 2WKPA 4UHUA 1ZG6A 3SS5A 3FPWA 2LB9A 4UA9A 4HQAA 3FC7A 1VETA 2J80A 4UQIM 4HP9A 5FQQA 3HJIA 5CTMA 4OH0A 3DTMA 3VP0A 5FQ9A 1RCJA 4IHQA 4HOIA 2PYRA 2W0NA 4ARZB 4AFIA 5EE8A 3D3OA 3QP2A 3IXBA 1XX2A 4OOMA 4IVIA 3S22A 3NY4A 2W1TA 3ZNTA 3BY8A 4UA6A 3MZEA 1YLWA 1DP8A 4BL2A 1N9NA 2B5RA 4B88A 5AQ9A 3M2KA 3MMHA 2G2UA 2PDRA 5CTNA 4ZAMA 4GS9A 4RX2A 2VK3A 3HL9A 4GZBA 3FZCA 2XA7M 4YFMA 2E8IA 3TE8A 1GA0A 2X71A 3SS3A 5IS1A 4PM5A 4N1HA 1W63Q 4Y2FA 4BD0A 5TJJA 3RFBA 4OQIA 1UWPX 4PM9A 2Z2MB 4I38A 4Z9QA 1LT0A 4OONA 5AVFA 3F1OA 5F68A 3F1NA 1YLTA 1TEMA 4DXCA 3UE1A 2HP9A 1S0WA 1EI5A 1W8YA 3HUNA 2XH9A 3G2ZA 4CLCC 1J3WA 1VETB 2Y2PA 2XF3A 2QPNA 2Y2LA 1JTDA 4DXBA 2VZWA 3BFGA 3QNBA 4Y17A 5EECA 3UMEA 4QJGA 4JGQA 4EWFA 3KSGA 2PD7A 1W79A 1ERQA 2W1TB 1N9LA 3LIBA 4IBXA 4MLLA 3UMDA 4QPRA 5EUAA 3P01A 2W3EA 2L0WA 3UDXA 3ZQ5A 3EWKA 5HL6A 3QP6A 5EM1A 4JF5A 3HJKA 1L0GA 5EVID 5HWTA 3KX0X 3LY4A 2V2FF 5GL9A 4PAUA 5CGSA 3VV4A 2IWBA 2JKGA 3DTKA 5FQKA 4S2LA 1JVJA 3IWOA 3VP4A 1ESIA 3JYIA 5DKKA 4ESPA 5F5YA 4U0TA 3LIAA 3MKEA 3WRZA 3F1NB 4C3QA 1YT4A 2B18A 4PMAA 3LGOA 1IYPA 3H82B 1S1ZA 2IA2A 4O7DA 3GVBA 4DRTA 5DTSA 5GHYA 1PFLA 1BULA 2ZD8A 4BJPA 2BASA 3A0VA 1DJAA 2V20A 5FSRA 3T1RA 4E6XA 1RP5A 3ZVTA 1V9YA 4EU0A 3D4FA 5AQBA 4KQDA 5KSHA 2W1RA 3CMZA 4P85A 2VV6A 3SH9A 4MMNA 1KGGA 1NYMA 4EBPA 2PBYA 2Z6DA 3T12B 3MZFA 1TS0A 5L2FA 2QZ6A 4X1LA 2QJ7A 3LUQA 2WUQA 3DBAA 1LLBA 4K0WA 3VMAA 3LIFA 3IXHA 3G4PA 1SKOB 4EV4A 2QKPA 2XD5A 2WGWB 3S7OA 2HV1A 5CXWA 5GLCA 4EEPA 3IF6A 2R9XA 4FUWA 3KYZA 4KUKA 1MXOA 4DMZA 1KVLA 5FDHA 3HCYA 4BLMA 1KGEA 4CJNA 1OPXA 1XJ6A 3O87A 3D9YA 2RCXA 3HBRA 2EX2A 2H0TA 2Z6CA 4QU3A 3KYQA 4X6TA 3NC8A 2ZBBA 2WKRA 4F3LB 1V9ZA 1P9WA 3DWKA 1S6RA 1L2SA 1K38A 2VGLM 1PW1A 5E2EA 5KMWA 4X25A 5CHMA 1K55A 2ZM0A 4Y0TA 3BFCA 3LR4A 4EEUA 3T4SA 5LBRA 4QB8A 4OQHA 3QP5A 4LRZE 2P7JA 1K56A 2KLIA 3UY6A 4FH4A 3A3JA 3ZVWA 5FQJA 3IX4A 3WS4A 2PHYA 2WZZA 4OOLA 4DJ3A 4EXOA 2PR6A 2NUTC 5K5BA 1YLYA 2RL3A 3FKWA 4HBUA 4E3JA 5HD3A 3GDIA 4KQQA 4E3KA 1TVFA 3EGDC 4GB7A 2WKQA 3S4XA 4O8GA 2H28A 3RTYA 3UNWA 2HF6A 3UB9A 1X0OA 3WRTA 2ZOHA 1IKGA 1CQAA 2QMIA 4FTXA 3C38A 1ZC2A 3RJUA 3R4KA 1K57A 3IBRA 2CC1A 5HDDA 4B93A 3T4LA 4LV1A 4ZDXA 3KO6A 3E2LA 2GJ3A 1Q2PA 2Y2GA 5IHVA 2L4RA 4MBKA 1GCEA 4CLCE 1KVMA 4MN7A 2XROA 1MBLA 1Y54A 1XA7A 4IUKA 4C75A 3BEBA 5F1FA 2ZLYA 2PU2A 4EETB 4YNRA 4CQHA 2KOIA 1OMEA 2P74A 1KDWA 2XK1A 1YQSA 5A93A 1DP9A 4R0QA 3LICA 1KE0A 4F94A 4QY6A 4GOGA 1KGFA 2J3TC 4S2MA 4DE0A 3QNCA 4OPZA 4MN6A 3JVVA 3G30A 1FCOA 5DJUA 1S1YA 3OCNA 5AQAA 4JGPA 1O7EA 2BLSA 3Q7ZA 1XJ4A 1PZOA 2QHKA 3HLEA 2DNSA 4FD8A 4KZ9A 3HLDA 2V8CA 2HP6A 1GHMA 1OJGA 5M18A 3F1PA 5F1GA 3NIAA 5FATA 4BBVA 3IS2A 1U60A 1K6RA 4WZ5C 4EUZA 1YLPA 2K2NA 4KZ6A 1K54A 5TGFA 2P08A 1PRQA 3H7WA 1ZKJA 4R70A 1CEGA 3Q7VA 4LCLA 3MQQA 3PBRA 3AGDA 4O01A 3BLMA 2ZC3B 4K08A 3ZNYA 1Y4OA 1K4FA 2XR0A 1BSGA 2Q9MA 5EM0A 3VFFA 4LV0A 4LFUA 5CEDA 1KE3A 2D02A 3HLWA 2V9AA 1IFQA 4WL9A 1H8MA 3GV9A 3CJMA 5CRFA 3UE0A 5EPHA 3V39A 3MXRA 4WYYA 1IKIA 5GHXA 5D3OA 3IX8A 5CX7A 1MY8A 1E3UD 3DW0A 1PNEA 1FSWA 1W63M 2DMWA 3FG8A 4ZTKA 4H8RA 5HAIA 3M2JA 1XXMA 5EVIA 4K91A 3ZG9B 3BQAA 1W7FA 4JKTA 4GHIB 2ZC5B 3IXDA 3E0YA 4MN5A 3VE3A 4MBFA 4U0XA 5FQIA 4P6BA 2W3FA 1YM1A 1K55C 3F1PB 5HDSA 1H8ZA 3GTCA 1P97A 4Y7PA 4ZJ3A 4K0XA 4L9FA 3SH8A 1SHVA 4KZAA 2IWCA 1MPLA 3EEHA 1MWTA 5HWWA 1FR6A 2BTFP 2VX8A 3NOUC 3H7WB 3IXGA 2HDQA 5FEGA 3NDEA 1UWNX 1HTZA 2AVXA 5M19A 3Q7VB 4DE2A 5BOHA 4IBRA 4NXFA 4L9GA 3W2ZA 1BUEA 3A3FA 4L9EA 3L7HA 3IWQA 4CPKA 3JPUA 3T1QB 4S2JA 1XJ3A 5HARA 3SS4A 1S4SA 4UA7A 1KDSA 3PBQA 2VA0A 3ULFA 1K57C 4I3IA 4L0LA 1OTAA 2XD1A 3MQOA 5DTKA 1XFNA 1G5UA 4FCFA 3OPPA 3DWZA 5EVEA 2XFTA 3T4QA 3CWFA 5EVIB 2PT7A 2WYXA 3TG9A 3TW8A 1K25A 3PBOA 1NJ4A 3WWXA 1IELA 2X01A 2HGVA 4LRYC 2Y59A 3EEAA 5F83A 1XPBA 2FH5A 3O88A 2H0YA 5FL3A 2Y2NA 1JWVA 2XDMA 1P9RA 5CERA 1T1CA 2VLGA 2ZM8A 4GD8A 4HJ3A 3MBZA 1JTGA 4WUJA 4PM7A 2OSUA 4JLFA 3GECA 1FQGA 4KG5A 2VV8A 2WKEA 2NUPC 1D7EA 5DFYA 1FR1A 4A5RA 4Y0UA 2HJ9C 4HNBA 5DVAA 4I5SA 3DTEA 1I2SA 2ZQ9A 3H82A 4X56A 5FI2A 1C3BA 1K54C 3G34A 4WMCD 3V5MA 1PWDA 1MWSA 2XLNA 3OOVA 3T50A 1SZVA 4G3WA 5HPFA 5KIZA 2ACGA 2W27A 4GW9A 4Y5FA 3VP2A 4NXBA 1JNUA 2ZQ8A 4R3AA 2GZAA 1L0FA 4E04A 1WYBA 2WAFA 2O9CA 3FPVA 1G28A 1SKOA 2ZQ7A 2WGWA 3E4OA 3CITA 1P0ZA 2GDNA 1XA1A 3W4OA 1BLCA 2A24A 4XUXA 4N9LA 5EVIC 5CHJA 3G31A 3B47A 1ALQA 4BENA 4NK3A 5J3WA 4HESA 5DJTA 3ZGAB 3S1YA 2EWWA 3CUEA 3IT9A 2DCFA 4EBNA 4IJGA 3I7JA 3UB5P 2WKIA 4F3LA 1STZA 2VEAA 1F5MA 3VP3A 4EQIA 2CMNA 3AGFA 2OLUA 3Q1FA 2R9WA 1K6SA 2XQZA 1YAXA 4PKYA 4HI4A 4WZ5A 1NXYA 1HLUP 3MQ0A 3T4OA 3VP1A 4QHCA 5CEBA 1AXBA 3ZDJA 4X1MA
chains in the Genus database with same CATH topology
3P09A 3FWLA 3E2LA 1G68A 4R23A 4E3NA 4X53A 1Q2PA 2Y2GA 4S2NC 3FV7A 4OLDA 5IHVA 3ZG5A 3NBLA 4KZBA 4MBKA 1GCEA 1W5DA 4BQMA 5DF9A 2H10A 2Y2MA 4ZBEA 1KVMA 4KG6A 1FCNA 1MBLA 1Y54A 1XA7A 4C75A 3BEBA 4GDBA 5I94A 5F1FA 2ZLYA 4OPQA 2PU2A 2ZQCA 2FFYA 3GRJA 2IWDA 2P74A 1OMEA 3ZG0A 1M6KA 1KDWA 1NY0A 3N6IA 2VGJA 2XK1A 1YQSA 5FQMA 5A93A 4R0QA 1QMFA 4GNUA 4MNRA 5E2HA 1K56D 3M6BA 3HLGA 3BFFA 5F82A 3LO7A 4X69A 1TDGA 4BL3A 5GLDA 1N4OA 1KE0A 4F94A 1NYYA 4QY6A 4GOGA 1KGFA 4KQRA 2ZM2A 4S2MA 4KZ3A 4GN2A 4DE0A 1W8QA 1HZOA 2EX6A 3QNCA 4OPZA 5HAPA 3BYDA 2ZC4B 3BECA 3TSGA 3VOZA 3G30A 1E3UA 1FCOA 1RGZA 2Y91A 3FYZA 3OCNA 5AQAA 2EFUA 3MFDA 1O7EA 3HREA 5A92A 4C6YA 2BLSA 3Q7ZA 2Y2QA 3NI9A 5EVLA 1YLJA 1PZOA 2G2WA 2V1ZA 4WEJA 3HLEA 1H8YA 2DNSA 4FD8A 4JF6A 4KZ9A 4D2OA 3HLDA 2HP6A 3BM6A 1MWUA 4N9KA 1GHMA 3ITAA 3ZCZA 4DE1A 1PZPA 3N8LA 1SCWA 1JWPA 1MWRA 4RYEA 4GD6A 3IHAA 4KZ5A 4X55A 2Y2OA 5M18A 3NCKA 3GMWA 4Y0OA 5F1GA 4U3TA 1XKZA 5A90A 5JYOA 3NIAA 4JXGA 2EX9A 1PI4A 5FATA 4E6WA 1ES2A 4WM9A 2HP5A 1TDLA 4MBHA 3Q82A 4EBLA 2WKHA 5E2GA 3CG5A 2J9OA 4WEKA 3G2YA 1U60A 4R3JA 5EOEA 1K6RA 2JCHA 2VGKA 4WZ5C 4EUZA 1PYYA 1YLPA 4FSFA 4UHUA 4KZ6A 1ZG6A 3SS5A 1N9BA 3UDFA 2EFXA 5FASA 1ONHA 1K54A 5TGFA 3W4QA 3SH7A 4UA9A 1GHPA 2Y55A 4R4RA 4GDNA 3MZDA 1ZKJA 5FQQA 5HX9A 5CTMA 3VFHA 4OH0A 3DTMA 3VP0A 5FQ9A 1CEGA 3Q7VA 1RCJA 4RX3A 4LCLA 3PBRA 2DRWA 3AGDA 5EE8A 3ZG7B 3BLMA 2ZC3B 3IXBA 3ZNYA 1XX2A 4OOMA 1DY6A 2J9PA 1K4FA 4IVIA 5G18A 2XR0A 3HUMA 3NY4A 3S22A 1BSGA 4HEFA 2Q9MA 4LENA 3ZNTA 4UA6A 3MZEA 4N92A 3VFFA 4LV0A 1YLWA 4B4XA 3EQVA 5CEDA 1KE3A 5FI7A 1HD8A 5HW3A 4BL2A 3HLWA 2BG1A 3ZFZA 4E3MA 2OLVA 2B5RA 1CI9A 3GV9A 4B88A 3CJMA 5CRFA 5AQ9A 3UE0A 3M2KA 4OLGA 1M40A 5CHUA 5EPHA 3IQAA 3V39A 3C7UA 3MXRA 4WYYA 1IKIA 2G2UA 5GHXA 4E3OA 5GLBA 5D3OA 4UAAA 5CTNA 3N8SA 1MY8A 1E3UD 4ZAMA 2WADA 3AGEA 3DW0A 3VSKA 1FSWA 2ZMAA 3BFDA 1LL9A 4RX2A 3OPHA 4XXRA 3ITBA 3HL9A 4ZTKA 4GZBA 4H8RA 5HAIA 3FZCA 1KE4A 3M2JA 4JF4A 1GHIA 4YFMA 1XXMA 2E8IA 4K91A 5EVIA 5HFOA 3ZG9B 1W7FA 1BLPA 2Y2JA 4JKTA 1RGYA 1GA0A 2X71A 2ZC5B 2EX8A 3SS3A 4Q8IA 3IXDA 2JE5A 4PM5A 4N1HA 5FAOA 4OP8A 2C6WB 4BD0A 4MBFA 4S2KA 3N4IA 1DJCA 4OQIA 4U0XA 4B4ZA 4QY5A 5FQIA 4P6BA 4PM9A 2Z2MB 1YM1A 1IYOA 1K55C 4IVKA 4Z9QA 4OONA 1CEFA 1H8ZA 5J8XA 4WZ4A 1Q2QA 4KZ8A 1K4EA 3GTCA 4Y7PA 5GHZA 1BLSA 2XGNA 4N1XA 4R1GA 2A49A 2HDRA 1GA9A 1YLTA 4RA7A 4ZJ3A 1TEMA 4KZ4A 4R3BA 4K0XA 4YINA 3UE1A 1ERMA 4DXCA 4MEZA 2HP9A 1S0WA 3SH8A 2Q9NA 1EI5A 1SHVA 1VQQA 3BFEA 3PAEA 3W8KA 3WS1A 1W8YA 4KG2A 2IWCA 1MPLA 2WK0A 1MWTA 2XH9A 1FR6A 3G2ZA 3HUNA 4KZAA 4DKIA 2Y2PA 1PW8A 3IXGA 5GLAA 4ZJ1A 2XF3A 4E3IA 2HDQA 2EXAA 2QPNA 4S2IA 3NDEA 2Y2LA 3WS5A 1HTZA 1JTDA 3Q7VB 4DXBA 1ES4A 5M19A 3PTEA 5CGWA 3N7WA 1CK3A 3TOIA 1BT5A 4DE2A 3BFGA 3QNBA 5BOHA 5EECA 4LV2A 4IBRA 4QJGA 5FA7A 4EWFA 4DE3A 1EROA 1XGJA 4MLLA 1W79A 1ERQA 4IBXA 1BUEA 3A3FA 1G6AA 2PU4A 1WYCA 3IWQA 4S2NA 4CPKA 2Y2KA 3MKFA 5EUAA 4P87A 3IH8A 3VSLA 3UDXA 4S2JA 3V50A 5HARA 3SS4A 3V3RA 4WELA 3UPPA 1PI5A 4UA7A 3OCLA 1KDSA 3PBQA 1ESUA 3OPLA 1K57C 4L0LA 2XD1A 1PWCA 5DTKA 1LHYA 2WAEA 3ISGA 3OZHA 4JF5A 4OQGA 4FCFA 5E2FA 4DF6A 1L0GA 2ZJ9A 4PPRA 5EVID 3OPPA 3DWZA 5TR7A 2XFTA 3ZG8B 4WMCA 3LY4A 3O3VA 2V2FF 5EVIB 3GQZA 2WYXA 3TG9A 2JBFA 3GSGA 3IH9A 2A3UA 3C4PA 1JWZA 1LI0A 5A91A 1K25A 5GL9A 3PBOA 4PM6A 3PBNA 5CGSA 1NJ4A 3WWXA 4WBGA 1IEMA 4JPMA 5CECA 3VOYA 2IWBA 1IELA 2X01A 5FQKA 2Y59A 2ZQAA 4S2LA 2P9VA 1JVJA 5F83A 4FH2A 1XPBA 3IWOA 3O88A 2H0YA 3VP4A 1ESIA 3JYIA 4OOYA 3E2KA 1FCMA 1CI8A 4U0TA 3SOIA 4BD1A 3G32A 3MKEA 5KZHA 1YMXA 3WRZA 1O07A 4C3QA 4E3LA 1YT4A 1JWVA 2Y2NA 4QD4A 4OPYA 3LEZA 4PMAA 2XDMA 2EXBA 5CERA 2XEPA 3IF6B 2ZM8A 3HLCA 1IYPA 3LY3A 4O7DA 3PAGA 5HAQA 3GVBA 3LCEA 4GD8A 4DRTA 3A3EA 3UE3A 5DTSA 4JXVA 2JC7A 5GHYA 1BULA 2Y4AA 2ZD8A 4BJPA 1H5XA 3IWIA 3PBTA 3QHYA 3W4PA 3MBZA 1DJAA 2V20A 1JTGA 5FSRA 3V3SA 4E6XA 5HL1A 4DDYA 1RP5A 3ZVTA 1BTLA 4PM7A 5DTTA 5JYPA 2OSUA 2Z2LB 3D4FA 4JLFA 5AQBA 3BLSA 1XP4A 3G35A 4IEDA 1HVBA 1BLHA 3P98A 5M1AA 5EOOA 5KSHA 1PWGA 3CMZA 4P85A 3PBSA 3SH9A 1KGGA 1FQGA 1NYMA 4KG5A 4EBPA 2WKEA 2PBYA 1E4DA 3MZFA 1EWZA 1QMEA 4JXWA 1IYQA 5FAQA 5L2FA 4RVAA 2QZ6A 1FR1A 2Y2HA 4A5RA 4GKUA 2WUQA 4Y0UA 5CGXA 4LCMA 1LLBA 4OVDA 4K0WA 5DVAA 3VMAA 3OC2A 5FI6A 3IXHA 3G4PA 4EV4A 2XD5A 2WGWB 4DDSA 5CXWA 5GLCA 1FSYA 1I2SA 1WE4A 2J8YA 2ZQ9A 3IF6A 2R9XA 5KSCA 4X56A 3EQUA 5FI2A 2ZC7A 1C3BA 1K54C 3G34A 4ZJ2A 1MXOA 4WMCD 4OP5A 5DF7A 1MKIA 4NETA 3V5MA 1PWDA 1MWSA 2UWXA 1KVLA 3IF5A 5FDHA 2XLNA 2WZXA 4BLMA 1FOFA 1KGEA 1SDEA 2HDUA 2J7VA 1SDNA 2H5SA 4CJNA 4R4SA 3RXXA 1DJBA 3O87A 2I72A 1PIOA 5FAPA 1Z6FA 2RCXA 3IHBA 3HBRA 4OQ0A 2EX2A 2H0TA 2P9VB 4S2PA 3VP2A 1NZUA 1NRFA 1LI9A 4KZ7A 4QU3A 2ZC6B 3WS2A 4X6TA 1J9MA 1SKFA 3C4OA 1XGIA 4M3KA 2ZQ8A 3ZHHA 2X02A 4KENB 1L0FA 3NC8A 4ID4A 1WYBA 2WAFA 3MXSA 3HVFA 2XFSA 3A3IA 5U47A 3RXWA 3DWKA 1S6RA 1L0DA 1L2SA 1ZG4A 2ZQ7A 1K38A 2WGWA 3C7VA 1PW1A 4JXSA 4PM8A 5E2EA 1ES5A 4OPRA 5KMWA 5CHMA 1K55A 3HUOA 1YLZA 2ZM0A 2HDSA 2GDNA 3BFCA 5E43A 3UN7A 1XA1A 4Y0TA 4QB8A 3W4OA 4OKPA 1BLCA 4OQHA 4XUXA 4HBTA 4N9LA 4XUZA 5EVIC 3Q07A 1K56A 5CHJA 3G31A 5DF8A 3UPNA 3UY6A 4FH4A 3GR2A 2HPBA 3A3JA 2WGVA 4X68A 1NZOA 3C5AA 3ZVWA 3HLFA 5FQJA 1ALQA 4BENA 4NK3A 3UPOA 3CZDA 1I5QA 4HESA 4KQOA 3WS4A 2Y2IA 3B3XA 4JBFA 3S1YA 3ZGAB 1E25A 1I2WA 2WZZA 4OOLA 4P0MA 2WGIA 1L0EA 1YMSA 3M6HA 3IT9A 1YLYA 2DCFA 3O86A 2RL3A 1BZAA 3OPRA 3FKWA 4LV3A 4EBNA 3I7JA 3WS0A 3UDIA 3HLBA 2WKIA 4HBUA 4E3JA 1ES3A 4KQQA 4E3KA 5TFQA 1IYSA 2ZQDA 3IF6C 1TVFA 4GB7A 3S4XA 3UO9A 3VP3A 4EQIA 1ONGA 3UNWA 3AGFA 1LL5A 2OLUA 3Q1FA 2FFFB 2R9WA 1K6SA 2C5WB 2XQZA 3WRTA 3BRMA 1IKGA 1VM1A 2QMIA 4S2OA 1ZC2A 3NDGA 4WZ5A 2OV5A 3RJUA 1NXYA 3VP1A 3Q81A 1K57A 4QHCA 5CEBA 2CC1A 5AQ7A 1AXBA 3N8RA 3ZDJA 4LV1A 4ZDXA 3FKVA 3A3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P09 A;  3FWL A;  3E2L A;  1G68 A;  4R23 A;  4E3N A;  4X53 A;  1Q2P A;  2Y2G A;  4S2N C;  3FV7 A;  4OLD A;  5IHV A;  3ZG5 A;  3NBL A;  4KZB A;  4MBK A;  1GCE A;  1W5D A;  4BQM A;  5DF9 A;  2H10 A;  2Y2M A;  4ZBE A;  1KVM A;  4KG6 A;  1FCN A;  1MBL A;  1Y54 A;  1XA7 A;  4C75 A;  3BEB A;  4GDB A;  5I94 A;  5F1F A;  2ZLY A;  4OPQ A;  2PU2 A;  2ZQC A;  2FFY A;  3GRJ A;  2IWD A;  2P74 A;  1OME A;  3ZG0 A;  1M6K A;  1KDW A;  1NY0 A;  3N6I A;  2VGJ A;  2XK1 A;  1YQS A;  5FQM A;  5A93 A;  4R0Q A;  1QMF A;  4GNU A;  4MNR A;  5E2H A;  1K56 D;  3M6B A;  3HLG A;  3BFF A;  5F82 A;  3LO7 A;  4X69 A;  1TDG A;  4BL3 A;  5GLD A;  1N4O A;  1KE0 A;  4F94 A;  1NYY A;  4QY6 A;  4GOG A;  1KGF A;  4KQR A;  2ZM2 A;  4S2M A;  4KZ3 A;  4GN2 A;  4DE0 A;  1W8Q A;  1HZO A;  2EX6 A;  3QNC A;  4OPZ A;  5HAP A;  3BYD A;  2ZC4 B;  3BEC A;  3TSG A;  3VOZ A;  3G30 A;  1E3U A;  1FCO A;  1RGZ A;  2Y91 A;  3FYZ A;  3OCN A;  5AQA A;  2EFU A;  3MFD A;  1O7E A;  3HRE A;  5A92 A;  4C6Y A;  2BLS A;  3Q7Z A;  2Y2Q A;  3NI9 A;  5EVL A;  1YLJ A;  1PZO A;  2G2W A;  2V1Z A;  4WEJ A;  3HLE A;  1H8Y A;  2DNS A;  4FD8 A;  4JF6 A;  4KZ9 A;  4D2O A;  3HLD A;  2HP6 A;  3BM6 A;  1MWU A;  4N9K A;  1GHM A;  3ITA A;  3ZCZ A;  4DE1 A;  1PZP A;  3N8L A;  1SCW A;  1JWP A;  1MWR A;  4RYE A;  4GD6 A;  3IHA A;  4KZ5 A;  4X55 A;  2Y2O A;  5M18 A;  3NCK A;  3GMW A;  4Y0O A;  5F1G A;  4U3T A;  1XKZ A;  5A90 A;  5JYO A;  3NIA A;  4JXG A;  2EX9 A;  1PI4 A;  5FAT A;  4E6W A;  1ES2 A;  4WM9 A;  2HP5 A;  1TDL A;  4MBH A;  3Q82 A;  4EBL A;  2WKH A;  5E2G A;  3CG5 A;  2J9O A;  4WEK A;  3G2Y A;  1U60 A;  4R3J A;  5EOE A;  1K6R A;  2JCH A;  2VGK A;  4WZ5 C;  4EUZ A;  1PYY A;  1YLP A;  4FSF A;  4UHU A;  4KZ6 A;  1ZG6 A;  3SS5 A;  1N9B A;  3UDF A;  2EFX A;  5FAS A;  1ONH A;  1K54 A;  5TGF A;  3W4Q A;  3SH7 A;  4UA9 A;  1GHP A;  2Y55 A;  4R4R A;  4GDN A;  3MZD A;  1ZKJ A;  5FQQ A;  5HX9 A;  5CTM A;  3VFH A;  4OH0 A;  3DTM A;  3VP0 A;  5FQ9 A;  1CEG A;  3Q7V A;  1RCJ A;  4RX3 A;  4LCL A;  3PBR A;  2DRW A;  3AGD A;  5EE8 A;  3ZG7 B;  3BLM A;  2ZC3 B;  3IXB A;  3ZNY A;  1XX2 A;  4OOM A;  1DY6 A;  2J9P A;  1K4F A;  4IVI A;  5G18 A;  2XR0 A;  3HUM A;  3NY4 A;  3S22 A;  1BSG A;  4HEF A;  2Q9M A;  4LEN A;  3ZNT A;  4UA6 A;  3MZE A;  4N92 A;  3VFF A;  4LV0 A;  1YLW A;  4B4X A;  3EQV A;  5CED A;  1KE3 A;  5FI7 A;  1HD8 A;  5HW3 A;  4BL2 A;  3HLW A;  2BG1 A;  3ZFZ A;  4E3M A;  2OLV A;  2B5R A;  1CI9 A;  3GV9 A;  4B88 A;  3CJM A;  5CRF A;  5AQ9 A;  3UE0 A;  3M2K A;  4OLG A;  1M40 A;  5CHU A;  5EPH A;  3IQA A;  3V39 A;  3C7U A;  3MXR A;  4WYY A;  1IKI A;  2G2U A;  5GHX A;  4E3O A;  5GLB A;  5D3O A;  4UAA A;  5CTN A;  3N8S A;  1MY8 A;  1E3U D;  4ZAM A;  2WAD A;  3AGE A;  3DW0 A;  3VSK A;  1FSW A;  2ZMA A;  3BFD A;  1LL9 A;  4RX2 A;  3OPH A;  4XXR A;  3ITB A;  3HL9 A;  4ZTK A;  4GZB A;  4H8R A;  5HAI A;  3FZC A;  1KE4 A;  3M2J A;  4JF4 A;  1GHI A;  4YFM A;  1XXM A;  2E8I A;  4K91 A;  5EVI A;  5HFO A;  3ZG9 B;  1W7F A;  1BLP A;  2Y2J A;  4JKT A;  1RGY A;  1GA0 A;  2X71 A;  2ZC5 B;  2EX8 A;  3SS3 A;  4Q8I A;  3IXD A;  2JE5 A;  4PM5 A;  4N1H A;  5FAO A;  4OP8 A;  2C6W B;  4BD0 A;  4MBF A;  4S2K A;  3N4I A;  1DJC A;  4OQI A;  4U0X A;  4B4Z A;  4QY5 A;  5FQI A;  4P6B A;  4PM9 A;  2Z2M B;  1YM1 A;  1IYO A;  1K55 C;  4IVK A;  4Z9Q A;  4OON A;  1CEF A;  1H8Z A;  5J8X A;  4WZ4 A;  1Q2Q A;  4KZ8 A;  1K4E A;  3GTC A;  4Y7P A;  5GHZ A;  1BLS A;  2XGN A;  4N1X A;  4R1G A;  2A49 A;  2HDR A;  1GA9 A;  1YLT A;  4RA7 A;  4ZJ3 A;  1TEM A;  4KZ4 A;  4R3B A;  4K0X A;  4YIN A;  3UE1 A;  1ERM A;  4DXC A;  4MEZ A;  2HP9 A;  1S0W A;  3SH8 A;  2Q9N A;  1EI5 A;  1SHV A;  1VQQ A;  3BFE A;  3PAE A;  3W8K A;  3WS1 A;  1W8Y A;  4KG2 A;  2IWC A;  1MPL A;  2WK0 A;  1MWT A;  2XH9 A;  1FR6 A;  3G2Z A;  3HUN A;  4KZA A;  4DKI A;  2Y2P A;  1PW8 A;  3IXG A;  5GLA A;  4ZJ1 A;  2XF3 A;  4E3I A;  2HDQ A;  2EXA A;  2QPN A;  4S2I A;  3NDE A;  2Y2L A;  3WS5 A;  1HTZ A;  1JTD A;  3Q7V B;  4DXB A;  1ES4 A;  5M19 A;  3PTE A;  5CGW A;  3N7W A;  1CK3 A;  3TOI A;  1BT5 A;  4DE2 A;  3BFG A;  3QNB A;  5BOH A;  5EEC A;  4LV2 A;  4IBR A;  4QJG A;  5FA7 A;  4EWF A;  4DE3 A;  1ERO A;  1XGJ A;  4MLL A;  1W79 A;  1ERQ A;  4IBX A;  1BUE A;  3A3F A;  1G6A A;  2PU4 A;  1WYC A;  3IWQ A;  4S2N A;  4CPK A;  2Y2K A;  3MKF A;  5EUA A;  4P87 A;  3IH8 A;  3VSL A;  3UDX A;  4S2J A;  3V50 A;  5HAR A;  3SS4 A;  3V3R A;  4WEL A;  3UPP A;  1PI5 A;  4UA7 A;  3OCL A;  1KDS A;  3PBQ A;  1ESU A;  3OPL A;  1K57 C;  4L0L A;  2XD1 A;  1PWC A;  5DTK A;  1LHY A;  2WAE A;  3ISG A;  3OZH A;  4JF5 A;  4OQG A;  4FCF A;  5E2F A;  4DF6 A;  1L0G A;  2ZJ9 A;  4PPR A;  5EVI D;  3OPP A;  3DWZ A;  5TR7 A;  2XFT A;  3ZG8 B;  4WMC A;  3LY4 A;  3O3V A;  2V2F F;  5EVI B;  3GQZ A;  2WYX A;  3TG9 A;  2JBF A;  3GSG A;  3IH9 A;  2A3U A;  3C4P A;  1JWZ A;  1LI0 A;  5A91 A;  1K25 A;  5GL9 A;  3PBO A;  4PM6 A;  3PBN A;  5CGS A;  1NJ4 A;  3WWX A;  4WBG A;  1IEM A;  4JPM A;  5CEC A;  3VOY A;  2IWB A;  1IEL A;  2X01 A;  5FQK A;  2Y59 A;  2ZQA A;  4S2L A;  2P9V A;  1JVJ A;  5F83 A;  4FH2 A;  1XPB A;  3IWO A;  3O88 A;  2H0Y A;  3VP4 A;  1ESI A;  3JYI A;  4OOY A;  3E2K A;  1FCM A;  1CI8 A;  4U0T A;  3SOI A;  4BD1 A;  3G32 A;  3MKE A;  5KZH A;  1YMX A;  3WRZ A;  1O07 A;  4C3Q A;  4E3L A;  1YT4 A;  1JWV A;  2Y2N A;  4QD4 A;  4OPY A;  3LEZ A;  4PMA A;  2XDM A;  2EXB A;  5CER A;  2XEP A;  3IF6 B;  2ZM8 A;  3HLC A;  1IYP A;  3LY3 A;  4O7D A;  3PAG A;  5HAQ A;  3GVB A;  3LCE A;  4GD8 A;  4DRT A;  3A3E A;  3UE3 A;  5DTS A;  4JXV A;  2JC7 A;  5GHY A;  1BUL A;  2Y4A A;  2ZD8 A;  4BJP A;  1H5X A;  3IWI A;  3PBT A;  3QHY A;  3W4P A;  3MBZ A;  1DJA A;  2V20 A;  1JTG A;  5FSR A;  3V3S A;  4E6X A;  5HL1 A;  4DDY A;  1RP5 A;  3ZVT A;  1BTL A;  4PM7 A;  5DTT A;  5JYP A;  2OSU A;  2Z2L B;  3D4F A;  4JLF A;  5AQB A;  3BLS A;  1XP4 A;  3G35 A;  4IED A;  1HVB A;  1BLH A;  3P98 A;  5M1A A;  5EOO A;  5KSH A;  1PWG A;  3CMZ A;  4P85 A;  3PBS A;  3SH9 A;  1KGG A;  1FQG A;  1NYM A;  4KG5 A;  4EBP A;  2WKE A;  2PBY A;  1E4D A;  3MZF A;  1EWZ A;  1QME A;  4JXW A;  1IYQ A;  5FAQ A;  5L2F A;  4RVA A;  2QZ6 A;  1FR1 A;  2Y2H A;  4A5R A;  4GKU A;  2WUQ A;  4Y0U A;  5CGX A;  4LCM A;  1LLB A;  4OVD A;  4K0W A;  5DVA A;  3VMA A;  3OC2 A;  5FI6 A;  3IXH A;  3G4P A;  4EV4 A;  2XD5 A;  2WGW B;  4DDS A;  5CXW A;  5GLC A;  1FSY A;  1I2S A;  1WE4 A;  2J8Y A;  2ZQ9 A;  3IF6 A;  2R9X A;  5KSC A;  4X56 A;  3EQU A;  5FI2 A;  2ZC7 A;  1C3B A;  1K54 C;  3G34 A;  4ZJ2 A;  1MXO A;  4WMC D;  4OP5 A;  5DF7 A;  1MKI A;  4NET A;  3V5M A;  1PWD A;  1MWS A;  2UWX A;  1KVL A;  3IF5 A;  5FDH A;  2XLN A;  2WZX A;  4BLM A;  1FOF A;  1KGE A;  1SDE A;  2HDU A;  2J7V A;  1SDN A;  2H5S A;  4CJN A;  4R4S A;  3RXX A;  1DJB A;  3O87 A;  2I72 A;  1PIO A;  5FAP A;  1Z6F A;  2RCX A;  3IHB A;  3HBR A;  4OQ0 A;  2EX2 A;  2H0T A;  2P9V B;  4S2P A;  3VP2 A;  1NZU A;  1NRF A;  1LI9 A;  4KZ7 A;  4QU3 A;  2ZC6 B;  3WS2 A;  4X6T A;  1J9M A;  1SKF A;  3C4O A;  1XGI A;  4M3K A;  2ZQ8 A;  3ZHH A;  2X02 A;  4KEN B;  1L0F A;  3NC8 A;  4ID4 A;  1WYB A;  2WAF A;  3MXS A;  3HVF A;  2XFS A;  3A3I A;  5U47 A;  3RXW A;  3DWK A;  1S6R A;  1L0D A;  1L2S A;  1ZG4 A;  2ZQ7 A;  1K38 A;  2WGW A;  3C7V A;  1PW1 A;  4JXS A;  4PM8 A;  5E2E A;  1ES5 A;  4OPR A;  5KMW A;  5CHM A;  1K55 A;  3HUO A;  1YLZ A;  2ZM0 A;  2HDS A;  2GDN A;  3BFC A;  5E43 A;  3UN7 A;  1XA1 A;  4Y0T A;  4QB8 A;  3W4O A;  4OKP A;  1BLC A;  4OQH A;  4XUX A;  4HBT A;  4N9L A;  4XUZ A;  5EVI C;  3Q07 A;  1K56 A;  5CHJ A;  3G31 A;  5DF8 A;  3UPN A;  3UY6 A;  4FH4 A;  3GR2 A;  2HPB A;  3A3J A;  2WGV A;  4X68 A;  1NZO A;  3C5A A;  3ZVW A;  3HLF A;  5FQJ A;  1ALQ A;  4BEN A;  4NK3 A;  3UPO A;  3CZD A;  1I5Q A;  4HES A;  4KQO A;  3WS4 A;  2Y2I A;  3B3X A;  4JBF A;  3S1Y A;  3ZGA B;  1E25 A;  1I2W A;  2WZZ A;  4OOL A;  4P0M A;  2WGI A;  1L0E A;  1YMS A;  3M6H A;  3IT9 A;  1YLY A;  2DCF A;  3O86 A;  2RL3 A;  1BZA A;  3OPR A;  3FKW A;  4LV3 A;  4EBN A;  3I7J A;  3WS0 A;  3UDI A;  3HLB A;  2WKI A;  4HBU A;  4E3J A;  1ES3 A;  4KQQ A;  4E3K A;  5TFQ A;  1IYS A;  2ZQD A;  3IF6 C;  1TVF A;  4GB7 A;  3S4X A;  3UO9 A;  3VP3 A;  4EQI A;  1ONG A;  3UNW A;  3AGF A;  1LL5 A;  2OLU A;  3Q1F A;  2FFF B;  2R9W A;  1K6S A;  2C5W B;  2XQZ A;  3WRT A;  3BRM A;  1IKG A;  1VM1 A;  2QMI A;  4S2O A;  1ZC2 A;  3NDG A;  4WZ5 A;  2OV5 A;  3RJU A;  1NXY A;  3VP1 A;  3Q81 A;  1K57 A;  4QHC A;  5CEB A;  2CC1 A;  5AQ7 A;  1AXB A;  3N8R A;  3ZDJ A;  4LV1 A;  4ZDX A;  3FKV A;  3A3D A; 
#chains in the Genus database with same CATH topology
 3FWL A;  1G68 A;  4R23 A;  4E3N A;  4X53 A;  3ZG5 A;  2OAQ 1;  4O0P A;  4KG6 A;  1TS6 A;  4OPQ A;  1UGU A;  1XJ2 A;  3ZYT A;  2A24 B;  3M6B A;  2JHE A;  2G7U A;  3LO7 A;  4X69 A;  3S7N A;  1TD5 A;  1NLY A;  1N4O A;  4KZ3 A;  1W8Q A;  3BYD A;  3BEC A;  3VOZ A;  5HSQ A;  1E3U A;  2Y91 A;  1VEU A;  3HRE A;  5A92 A;  4C6Y A;  1F98 A;  3NI9 A;  3LIE A;  4P6Z M;  4B9O A;  3ITA A;  3O5Y A;  3ZCZ A;  3LR0 A;  3N8L A;  1SCW A;  2W3D A;  4RYE A;  1NLZ A;  3IHA A;  4X55 A;  2Y2O A;  3NCK A;  3GMW A;  4Y0O A;  4U3T A;  1LSW A;  5A90 A;  5JYO A;  3E4P A;  1ES2 A;  4WM9 A;  3UB7 A;  4MBH A;  3Q82 A;  5E2G A;  3K3C A;  2J9O A;  4WEK A;  2VGK A;  1PYY A;  2O0Y A;  3CI6 A;  1N9B A;  3NHQ A;  1GHP A;  4FOF A;  4R4R A;  4GDN A;  4MDZ A;  2B95 A;  3BY9 A;  3NEC A;  5G4Y A;  1DY6 A;  5G18 A;  3HUM A;  1OT6 A;  1TS7 A;  2ZL1 B;  1OTD A;  3EQV A;  5HW3 A;  1NWZ A;  2Y79 A;  4R38 A;  3ZFZ A;  3T1X A;  4E3O A;  3N8S A;  5F69 A;  1GSV A;  1VEU B;  1LL9 A;  1L3L A;  3OPH A;  1A0K A;  4XXR A;  3TRC A;  4JF4 A;  4IUH A;  1OTI A;  2EX8 A;  4Q8I A;  1Z09 A;  2JE5 A;  5FAO A;  4OP8 A;  4WLA A;  4S2K A;  1DJC A;  4B4Z A;  4QY5 A;  4UQI S;  2PYP A;  3QP1 A;  4IVK A;  3PHY A;  5J8X A;  1Q2Q A;  4KZ8 A;  2L1M A;  1BLS A;  2XGN A;  2UV0 E;  4XT2 B;  2A49 A;  2HDR A;  4R3B A;  3ICY A;  1EW0 A;  1ERM A;  2OWH A;  4MEZ A;  2JKT M;  2Q9N A;  3BFE A;  4HH3 A;  3TJZ C;  1ODV A;  1MC0 A;  1PW8 A;  5HPI A;  5L8M A;  3U2A A;  3CUE C;  3CPT A;  4E3I A;  5L10 A;  3OLO A;  1YKD A;  3WS5 A;  3PTE A;  3N7W A;  2W3G A;  4GHI A;  5MC7 A;  5FA7 A;  4DE3 A;  1ERO A;  2XA7 S;  4S2N A;  3MKF A;  1YSQ A;  4P87 A;  3EGX C;  3VSL A;  2O99 A;  2V8F A;  5I5L A;  3V3R A;  3UPP A;  4I3J A;  1PI5 A;  3OCL A;  5HD5 A;  1T1A A;  3D72 A;  2A2L A;  4R6L A;  2WAE A;  3OZH A;  4DF6 A;  2QJ5 A;  2ZJ9 A;  4YWZ A;  3LR3 A;  3A0S A;  5TR7 A;  3ZG8 B;  4WMC A;  3O3V A;  3GSG A;  2A3U A;  1LI0 A;  4PM6 A;  3PBN A;  3LYX A;  5AVE A;  4WBG A;  1IEM A;  2R78 A;  4JPM A;  5CEC A;  2ZQA A;  1TF1 A;  3NOT C;  4OOY A;  1FCM A;  1CI8 A;  3BW6 A;  3SOI A;  1YMX A;  3NOP C;  1H3Q A;  2VKS A;  4QD4 A;  4OPY A;  2P04 A;  4JGO A;  2EXB A;  4Q0J A;  5TBM A;  3LY3 A;  5HAQ A;  3T1S A;  3A3E A;  3UE3 A;  4JXV A;  2Y4A A;  3RH8 B;  1H5X A;  3IWI A;  3CPT B;  4NKP A;  5EFW A;  3VE4 A;  3V3S A;  5HL1 A;  4DDY A;  5JYP A;  1BTL A;  3BLS A;  1XP4 A;  3G35 A;  1HVB A;  5EOO A;  4KUO A;  4G3K A;  1F2K A;  1T19 A;  1QME A;  2JKT I;  1XFQ A;  1D06 A;  2Y2H A;  2VJW A;  4GKU A;  5CGX A;  3CAX A;  4OVD A;  2EWV A;  5KSC A;  2J8Y A;  3BQ8 A;  2GX5 A;  4Q0I A;  4OP5 A;  1MKI A;  2UWX A;  5IU1 A;  4ETX A;  2WZX A;  2HDU A;  2J7V A;  2H5S A;  4ME4 A;  3RXX A;  1DJB A;  2I72 A;  3IHB A;  4OQ0 A;  4CLC B;  1OTB A;  1NRF A;  1LI9 A;  2PAV P;  4HH2 A;  1J9M A;  3C4O A;  3ZHH A;  3MXS A;  3HVF A;  2XFS A;  3A3I A;  5U47 A;  1L0D A;  3LID A;  5TBM B;  1ZG4 A;  2Q0O A;  4PM8 A;  2V1A A;  1ES5 A;  3HUO A;  5E43 A;  4OKP A;  4BWI A;  1GSW A;  4Q0H A;  1S4R A;  4XUZ A;  3Q07 A;  1G6O A;  5DF8 A;  3R7W B;  3GR2 A;  4X68 A;  1NZO A;  3C5A A;  2ZMV A;  4Y15 A;  1I5Q A;  2Y2I A;  3B3X A;  2KX6 A;  2INW A;  4JBF A;  1E25 A;  2LB5 A;  1L0E A;  1OT9 A;  3LI8 A;  4NXE A;  4EW7 A;  1GSX A;  3BJN A;  3OPR A;  4LV3 A;  4M4X A;  2OWJ A;  3UDI A;  3T4T A;  1F9I A;  2YKH A;  3UE6 A;  3UO9 A;  4HJ6 A;  1ONG A;  2FFF B;  3A0R A;  1VM1 A;  3NDG A;  4P6Z S;  3KYE A;  2VGL S;  3C8C A;  2OV5 A;  1LSX A;  3DTI A;  4EES A;  3MXQ A;  5EV0 A;  4S2N C;  3KSI A;  2PRF A;  3NBL A;  4ZBE A;  2E8J A;  4G3V A;  4LGW A;  5I94 A;  4LLO B;  2ZQC A;  3MJQ A;  3GRJ A;  3N6I A;  2VGJ A;  3LEQ A;  3MR0 A;  1QMF A;  4GNU A;  4MNR A;  5HWV A;  2V0U A;  1MKM A;  3HLG A;  3BFF A;  5F82 A;  1TDG A;  3E4Q A;  4BL3 A;  3MS6 A;  2ZM2 A;  3OBF A;  3CHW P;  4CLC D;  5HAP A;  2VV7 A;  2ZC4 B;  3TSG A;  1YSP A;  4DN0 A;  3FYZ A;  2EFU A;  3MFD A;  2GNX A;  1YLJ A;  2G2W A;  2V1Z A;  3IBJ A;  2YKF A;  3C2W A;  5A8B A;  4PHT A;  4H6J A;  3PR6 A;  4Z1W A;  1FIL A;  5HDC A;  4EER A;  1JWP A;  1MWR A;  4GD6 A;  4KZ5 A;  1XKZ A;  4NG2 A;  2ZOI A;  2W3H A;  4E6W A;  3G6O A;  2HP5 A;  2WKH A;  3G2Y A;  5EOE A;  4FSF A;  4NXG A;  3VOL A;  4JGR A;  3UDF A;  2EFX A;  4GS9 B;  1ONH A;  5FAS A;  3W4Q A;  3SH7 A;  3S7Q A;  3MSH A;  2Y55 A;  1AWI A;  3MZD A;  5IT5 A;  5HX9 A;  3VFH A;  4RX3 A;  2PR5 A;  3PYP A;  2DRW A;  3ZG7 B;  3QP8 A;  3L9K A;  2J9P A;  1CJF A;  3LFV A;  4HEF A;  5L09 A;  4LEN A;  4N92 A;  3LI9 A;  4B4X A;  5FI7 A;  1HD8 A;  3F1O B;  2BG1 A;  4E3M A;  2OLV A;  1CI9 A;  1DP6 A;  4OLG A;  1M40 A;  5CHU A;  4NEE D;  3IQA A;  2M7U A;  3C7U A;  5GLB A;  4UAA A;  2WAD A;  3AGE A;  3VSK A;  2ZMA A;  3BFD A;  4Y3I A;  2O9B A;  3ITB A;  4BBT A;  1KE4 A;  1GHI A;  2V1B A;  5HFO A;  1BLP A;  2Y2J A;  4GCZ A;  1RGY A;  4ETZ A;  4H6J B;  3NJA A;  2C6W B;  3MFX A;  4RQ9 A;  2O9A A;  3N4I A;  3NUL A;  1IYO A;  5J7E A;  2ZL1 A;  1CEF A;  1FIK A;  4WZ4 A;  1K4E A;  1S66 L;  5GHZ A;  4N1X A;  1VHM A;  4R1G A;  1GA9 A;  4RA7 A;  4KZ4 A;  4YIN A;  1ZHH B;  3PAE A;  1VQQ A;  3WS1 A;  3W8K A;  4KG2 A;  2WK0 A;  5C5K A;  4DKI A;  1TS8 A;  5AJG A;  4UEY A;  4LPZ A;  5GLA A;  4ZJ1 A;  2EXA A;  4S2I A;  4II7 A;  1ES4 A;  5CGW A;  1CK3 A;  3TOI A;  1BT5 A;  4WF0 A;  4BMW A;  4LV2 A;  1XGJ A;  1G6A A;  5DKL A;  2PU4 A;  1WYC A;  2Y2K A;  2EA9 A;  3IH8 A;  3V50 A;  4WEL A;  1ESU A;  4GJ4 A;  3OPL A;  4XT2 A;  2OOL A;  1PWC A;  1YPR A;  3UB8 A;  5FEF A;  2JKR M;  1LHY A;  3ISG A;  3C30 A;  4I39 A;  4OQG A;  5E2F A;  4PPR A;  1T1B A;  4D60 A;  2M7V A;  4QWO A;  3GQZ A;  2JBF A;  3IH9 A;  3C4P A;  5A91 A;  1JWZ A;  1KOU A;  2ZMF A;  3BWL A;  3VOY A;  2P9V A;  4FH2 A;  3E2K A;  4BD1 A;  3G32 A;  5KZH A;  2JKF A;  1O07 A;  3H9W A;  4E3L A;  1D1J A;  2MJ6 A;  1MZU A;  3T4K A;  3LEZ A;  4WN5 A;  2XEP A;  3IF6 B;  3HLC A;  3U4L P;  3PAG A;  3LCE A;  2M1C A;  2QWS A;  2JC7 A;  3PBT A;  3W4P A;  3QHY A;  5DTT A;  2Z2L B;  4ZRR A;  4IED A;  1BLH A;  3P98 A;  5M1A A;  1PWG A;  2HJE A;  3PBS A;  1E4D A;  1EWZ A;  4JXW A;  1IYQ A;  5FAQ A;  2JN7 A;  3P7N A;  4HJ4 A;  4RVA A;  4LCM A;  3OC2 A;  5FI6 A;  4DDS A;  3KSH A;  1CF0 A;  1FSY A;  1WE4 A;  4GLQ A;  3EQU A;  2ZC7 A;  3JVU A;  4ZJ2 A;  5DF7 A;  4NET A;  3DAV A;  3IF5 A;  3MF0 A;  1S67 L;  1FOF A;  2J3T D;  1SDE A;  4DJ2 A;  1SDN A;  4R4S A;  1PIO A;  5FAP A;  1N9O A;  1Z6F A;  1NRJ A;  2P9V B;  4S2P A;  1NZU A;  2FZ0 A;  4KZ7 A;  2ZC6 B;  3WS2 A;  1ACF A;  1SKF A;  2JKR I;  4M3K A;  1XGI A;  2I9V A;  2X02 A;  4KEN B;  4ID4 A;  3S7P A;  3RXW A;  2QYB A;  2KDK A;  3C7V A;  4JXS A;  2J3W A;  4OPR A;  1YLZ A;  3UN7 A;  2HDS A;  3IX3 A;  4PKY G;  4MCW A;  3LR5 A;  4HBT A;  1VB6 A;  3CLO A;  3UPN A;  2PBD P;  2HPB A;  2WGV A;  3HLF A;  2K7S A;  3UPO A;  3CZD A;  1WA9 A;  4KQO A;  4CLC A;  1I2W A;  4P0M A;  2WGI A;  3K2N A;  3M6H A;  1YMS A;  1T18 A;  3O86 A;  1BZA A;  3SZT A;  4Y13 A;  3WS0 A;  3HLB A;  3E98 A;  1ES3 A;  4HP4 A;  5TFQ A;  1IYS A;  2ZQD A;  2OAP 1;  5J4E A;  3IF6 C;  4HY8 A;  4I3A A;  1OJ5 A;  2B02 A;  4EUV A;  1LL5 A;  1Y28 A;  3QP4 A;  2C5W B;  2XRN A;  3BRM A;  4S2O A;  3V67 A;  3R7W A;  3PXP A;  4BBU A;  3Q81 A;  4EQ1 A;  1DRM A;  5AQ7 A;  3N8R A;  1K0K A;  3FKV A;  3A3D A;  3P09 A;  3K3D A;  3FV7 A;  4OLD A;  4BQM A;  4KZB A;  3KSF A;  1W5D A;  5DF9 A;  2H10 A;  2Y2M A;  5FDS A;  1FCN A;  4ARZ A;  3B33 A;  4GDB A;  2FFY A;  2IWD A;  3T4J A;  3EOI A;  1M6K A;  1NY0 A;  3B42 A;  3ZG0 A;  1H0M A;  3SW1 A;  5FQM A;  4HIA A;  1IOU A;  5E2H A;  1K56 D;  3IS2 B;  4HHD A;  2V0W A;  5GLD A;  1BYW A;  1NYY A;  2XSS A;  4KQR A;  1OTE A;  4GN2 A;  1ZTU A;  1HZO A;  2EX6 A;  5G4Z A;  1RGZ A;  5HZH A;  4LRX C;  5L07 A;  1LSV A;  2Y2Q A;  5EVL A;  5F6A A;  4WEJ A;  2D01 A;  4YOF A;  1H8Y A;  4JF6 A;  4D2O A;  3UB6 A;  3BM6 A;  1MWU A;  4N9K A;  5DFX A;  4DE1 A;  1PZP A;  2HZ5 A;  1LL8 A;  4JXG A;  2EX9 A;  1PI4 A;  2K31 A;  1TDL A;  4EBL A;  3CG5 A;  4R3J A;  2JCH A;  2PD8 A;  2Y8H A;  2WKP A;  4UHU A;  1ZG6 A;  3SS5 A;  3FPW A;  2LB9 A;  4UA9 A;  4HQA A;  3FC7 A;  1VET A;  2J80 A;  4UQI M;  4HP9 A;  5FQQ A;  3HJI A;  5CTM A;  4OH0 A;  3DTM A;  3VP0 A;  5FQ9 A;  1RCJ A;  4IHQ A;  4HOI A;  2PYR A;  2W0N A;  4ARZ B;  4AFI A;  5EE8 A;  3D3O A;  3QP2 A;  3IXB A;  1XX2 A;  4OOM A;  4IVI A;  3S22 A;  3NY4 A;  2W1T A;  3ZNT A;  3BY8 A;  4UA6 A;  3MZE A;  1YLW A;  1DP8 A;  4BL2 A;  1N9N A;  2B5R A;  4B88 A;  5AQ9 A;  3M2K A;  3MMH A;  2G2U A;  2PDR A;  5CTN A;  4ZAM A;  4GS9 A;  4RX2 A;  2VK3 A;  3HL9 A;  4GZB A;  3FZC A;  2XA7 M;  4YFM A;  2E8I A;  3TE8 A;  1GA0 A;  2X71 A;  3SS3 A;  5IS1 A;  4PM5 A;  4N1H A;  1W63 Q;  4Y2F A;  4BD0 A;  5TJJ A;  3RFB A;  4OQI A;  1UWP X;  4PM9 A;  2Z2M B;  4I38 A;  4Z9Q A;  1LT0 A;  4OON A;  5AVF A;  3F1O A;  5F68 A;  3F1N A;  1YLT A;  1TEM A;  4DXC A;  3UE1 A;  2HP9 A;  1S0W A;  1EI5 A;  1W8Y A;  3HUN A;  2XH9 A;  3G2Z A;  4CLC C;  1J3W A;  1VET B;  2Y2P A;  2XF3 A;  2QPN A;  2Y2L A;  1JTD A;  4DXB A;  2VZW A;  3BFG A;  3QNB A;  4Y17 A;  5EEC A;  3UME A;  4QJG A;  4JGQ A;  4EWF A;  3KSG A;  2PD7 A;  1W79 A;  1ERQ A;  2W1T B;  1N9L A;  3LIB A;  4IBX A;  4MLL A;  3UMD A;  4QPR A;  5EUA A;  3P01 A;  2W3E A;  2L0W A;  3UDX A;  3ZQ5 A;  3EWK A;  5HL6 A;  3QP6 A;  5EM1 A;  4JF5 A;  3HJK A;  1L0G A;  5EVI D;  5HWT A;  3KX0 X;  3LY4 A;  2V2F F;  5GL9 A;  4PAU A;  5CGS A;  3VV4 A;  2IWB A;  2JKG A;  3DTK A;  5FQK A;  4S2L A;  1JVJ A;  3IWO A;  3VP4 A;  1ESI A;  3JYI A;  5DKK A;  4ESP A;  5F5Y A;  4U0T A;  3LIA A;  3MKE A;  3WRZ A;  3F1N B;  4C3Q A;  1YT4 A;  2B18 A;  4PMA A;  3LGO A;  1IYP A;  3H82 B;  1S1Z A;  2IA2 A;  4O7D A;  3GVB A;  4DRT A;  5DTS A;  5GHY A;  1PFL A;  1BUL A;  2ZD8 A;  4BJP A;  2BAS A;  3A0V A;  1DJA A;  2V20 A;  5FSR A;  3T1R A;  4E6X A;  1RP5 A;  3ZVT A;  1V9Y A;  4EU0 A;  3D4F A;  5AQB A;  4KQD A;  5KSH A;  2W1R A;  3CMZ A;  4P85 A;  2VV6 A;  3SH9 A;  4MMN A;  1KGG A;  1NYM A;  4EBP A;  2PBY A;  2Z6D A;  3T12 B;  3MZF A;  1TS0 A;  5L2F A;  2QZ6 A;  4X1L A;  2QJ7 A;  3LUQ A;  2WUQ A;  3DBA A;  1LLB A;  4K0W A;  3VMA A;  3LIF A;  3IXH A;  3G4P A;  1SKO B;  4EV4 A;  2QKP A;  2XD5 A;  2WGW B;  3S7O A;  2HV1 A;  5CXW A;  5GLC A;  4EEP A;  3IF6 A;  2R9X A;  4FUW A;  3KYZ A;  4KUK A;  1MXO A;  4DMZ A;  1KVL A;  5FDH A;  3HCY A;  4BLM A;  1KGE A;  4CJN A;  1OPX A;  1XJ6 A;  3O87 A;  3D9Y A;  2RCX A;  3HBR A;  2EX2 A;  2H0T A;  2Z6C A;  4QU3 A;  3KYQ A;  4X6T A;  3NC8 A;  2ZBB A;  2WKR A;  4F3L B;  1V9Z A;  1P9W A;  3DWK A;  1S6R A;  1L2S A;  1K38 A;  2VGL M;  1PW1 A;  5E2E A;  5KMW A;  4X25 A;  5CHM A;  1K55 A;  2ZM0 A;  4Y0T A;  3BFC A;  3LR4 A;  4EEU A;  3T4S A;  5LBR A;  4QB8 A;  4OQH A;  3QP5 A;  4LRZ E;  2P7J A;  1K56 A;  2KLI A;  3UY6 A;  4FH4 A;  3A3J A;  3ZVW A;  5FQJ A;  3IX4 A;  3WS4 A;  2PHY A;  2WZZ A;  4OOL A;  4DJ3 A;  4EXO A;  2PR6 A;  2NUT C;  5K5B A;  1YLY A;  2RL3 A;  3FKW A;  4HBU A;  4E3J A;  5HD3 A;  3GDI A;  4KQQ A;  4E3K A;  1TVF A;  3EGD C;  4GB7 A;  2WKQ A;  3S4X A;  4O8G A;  2H28 A;  3RTY A;  3UNW A;  2HF6 A;  3UB9 A;  1X0O A;  3WRT A;  2ZOH A;  1IKG A;  1CQA A;  2QMI A;  4FTX A;  3C38 A;  1ZC2 A;  3RJU A;  3R4K A;  1K57 A;  3IBR A;  2CC1 A;  5HDD A;  4B93 A;  3T4L A;  4LV1 A;  4ZDX A;  3KO6 A;  3E2L A;  2GJ3 A;  1Q2P A;  2Y2G A;  5IHV A;  2L4R A;  4MBK A;  1GCE A;  4CLC E;  1KVM A;  4MN7 A;  2XRO A;  1MBL A;  1Y54 A;  1XA7 A;  4IUK A;  4C75 A;  3BEB A;  5F1F A;  2ZLY A;  2PU2 A;  4EET B;  4YNR A;  4CQH A;  2KOI A;  1OME A;  2P74 A;  1KDW A;  2XK1 A;  1YQS A;  5A93 A;  1DP9 A;  4R0Q A;  3LIC A;  1KE0 A;  4F94 A;  4QY6 A;  4GOG A;  1KGF A;  2J3T C;  4S2M A;  4DE0 A;  3QNC A;  4OPZ A;  4MN6 A;  3JVV A;  3G30 A;  1FCO A;  5DJU A;  1S1Y A;  3OCN A;  5AQA A;  4JGP A;  1O7E A;  2BLS A;  3Q7Z A;  1XJ4 A;  1PZO A;  2QHK A;  3HLE A;  2DNS A;  4FD8 A;  4KZ9 A;  3HLD A;  2V8C A;  2HP6 A;  1GHM A;  1OJG A;  5M18 A;  3F1P A;  5F1G A;  3NIA A;  5FAT A;  4BBV A;  3IS2 A;  1U60 A;  1K6R A;  4WZ5 C;  4EUZ A;  1YLP A;  2K2N A;  4KZ6 A;  1K54 A;  5TGF A;  2P08 A;  1PRQ A;  3H7W A;  1ZKJ A;  4R70 A;  1CEG A;  3Q7V A;  4LCL A;  3MQQ A;  3PBR A;  3AGD A;  4O01 A;  3BLM A;  2ZC3 B;  4K08 A;  3ZNY A;  1Y4O A;  1K4F A;  2XR0 A;  1BSG A;  2Q9M A;  5EM0 A;  3VFF A;  4LV0 A;  4LFU A;  5CED A;  1KE3 A;  2D02 A;  3HLW A;  2V9A A;  1IFQ A;  4WL9 A;  1H8M A;  3GV9 A;  3CJM A;  5CRF A;  3UE0 A;  5EPH A;  3V39 A;  3MXR A;  4WYY A;  1IKI A;  5GHX A;  5D3O A;  3IX8 A;  5CX7 A;  1MY8 A;  1E3U D;  3DW0 A;  1PNE A;  1FSW A;  1W63 M;  2DMW A;  3FG8 A;  4ZTK A;  4H8R A;  5HAI A;  3M2J A;  1XXM A;  5EVI A;  4K91 A;  3ZG9 B;  3BQA A;  1W7F A;  4JKT A;  4GHI B;  2ZC5 B;  3IXD A;  3E0Y A;  4MN5 A;  3VE3 A;  4MBF A;  4U0X A;  5FQI A;  4P6B A;  2W3F A;  1YM1 A;  1K55 C;  3F1P B;  5HDS A;  1H8Z A;  3GTC A;  1P97 A;  4Y7P A;  4ZJ3 A;  4K0X A;  4L9F A;  3SH8 A;  1SHV A;  4KZA A;  2IWC A;  1MPL A;  3EEH A;  1MWT A;  5HWW A;  1FR6 A;  2BTF P;  2VX8 A;  3NOU C;  3H7W B;  3IXG A;  2HDQ A;  5FEG A;  3NDE A;  1UWN X;  1HTZ A;  2AVX A;  5M19 A;  3Q7V B;  4DE2 A;  5BOH A;  4IBR A;  4NXF A;  4L9G A;  3W2Z A;  1BUE A;  3A3F A;  4L9E A;  3L7H A;  3IWQ A;  4CPK A;  3JPU A;  3T1Q B;  4S2J A;  1XJ3 A;  5HAR A;  3SS4 A;  1S4S A;  4UA7 A;  1KDS A;  3PBQ A;  2VA0 A;  3ULF A;  1K57 C;  4I3I A;  4L0L A;  1OTA A;  2XD1 A;  3MQO A;  5DTK A;  1XFN A;  1G5U A;  4FCF A;  3OPP A;  3DWZ A;  5EVE A;  2XFT A;  3T4Q A;  3CWF A;  5EVI B;  2PT7 A;  2WYX A;  3TG9 A;  3TW8 A;  1K25 A;  3PBO A;  1NJ4 A;  3WWX A;  1IEL A;  2X01 A;  2HGV A;  4LRY C;  2Y59 A;  3EEA A;  5F83 A;  1XPB A;  2FH5 A;  3O88 A;  2H0Y A;  5FL3 A;  2Y2N A;  1JWV A;  2XDM A;  1P9R A;  5CER A;  1T1C A;  2VLG A;  2ZM8 A;  4GD8 A;  4HJ3 A;  3MBZ A;  1JTG A;  4WUJ A;  4PM7 A;  2OSU A;  4JLF A;  3GEC A;  1FQG A;  4KG5 A;  2VV8 A;  2WKE A;  2NUP C;  1D7E A;  5DFY A;  1FR1 A;  4A5R A;  4Y0U A;  2HJ9 C;  4HNB A;  5DVA A;  4I5S A;  3DTE A;  1I2S A;  2ZQ9 A;  3H82 A;  4X56 A;  5FI2 A;  1C3B A;  1K54 C;  3G34 A;  4WMC D;  3V5M A;  1PWD A;  1MWS A;  2XLN A;  3OOV A;  3T50 A;  1SZV A;  4G3W A;  5HPF A;  5KIZ A;  2ACG A;  2W27 A;  4GW9 A;  4Y5F A;  3VP2 A;  4NXB A;  1JNU A;  2ZQ8 A;  4R3A A;  2GZA A;  1L0F A;  4E04 A;  1WYB A;  2WAF A;  2O9C A;  3FPV A;  1G28 A;  1SKO A;  2ZQ7 A;  2WGW A;  3E4O A;  3CIT A;  1P0Z A;  2GDN A;  1XA1 A;  3W4O A;  1BLC A;  2A24 A;  4XUX A;  4N9L A;  5EVI C;  5CHJ A;  3G31 A;  3B47 A;  1ALQ A;  4BEN A;  4NK3 A;  5J3W A;  4HES A;  5DJT A;  3ZGA B;  3S1Y A;  2EWW A;  3CUE A;  3IT9 A;  2DCF A;  4EBN A;  4IJG A;  3I7J A;  3UB5 P;  2WKI A;  4F3L A;  1STZ A;  2VEA A;  1F5M A;  3VP3 A;  4EQI A;  2CMN A;  3AGF A;  2OLU A;  3Q1F A;  2R9W A;  1K6S A;  2XQZ A;  1YAX A;  4PKY A;  4HI4 A;  4WZ5 A;  1NXY A;  1HLU P;  3MQ0 A;  3T4O A;  3VP1 A;  4QHC A;  5CEB A;  1AXB A;  3ZDJ A;  4X1M A; 
#chains in the Genus database with same CATH homology
 3P09 A;  3FWL A;  3E2L A;  1G68 A;  4R23 A;  4E3N A;  4X53 A;  1Q2P A;  2Y2G A;  4S2N C;  3FV7 A;  4OLD A;  5IHV A;  3ZG5 A;  3NBL A;  4KZB A;  4MBK A;  1GCE A;  1W5D A;  4BQM A;  5DF9 A;  2H10 A;  2Y2M A;  4ZBE A;  1KVM A;  4KG6 A;  1FCN A;  1MBL A;  1Y54 A;  1XA7 A;  4C75 A;  3BEB A;  4GDB A;  5I94 A;  5F1F A;  2ZLY A;  4OPQ A;  2PU2 A;  2ZQC A;  2FFY A;  3GRJ A;  2IWD A;  2P74 A;  1OME A;  3ZG0 A;  1M6K A;  1KDW A;  1NY0 A;  3N6I A;  2VGJ A;  2XK1 A;  1YQS A;  5FQM A;  5A93 A;  4R0Q A;  1QMF A;  4GNU A;  4MNR A;  5E2H A;  1K56 D;  3M6B A;  3HLG A;  3BFF A;  5F82 A;  3LO7 A;  4X69 A;  1TDG A;  4BL3 A;  5GLD A;  1N4O A;  1KE0 A;  4F94 A;  1NYY A;  4QY6 A;  4GOG A;  1KGF A;  4KQR A;  2ZM2 A;  4S2M A;  4KZ3 A;  4GN2 A;  4DE0 A;  1W8Q A;  1HZO A;  2EX6 A;  3QNC A;  4OPZ A;  5HAP A;  3BYD A;  2ZC4 B;  3BEC A;  3TSG A;  3VOZ A;  3G30 A;  1E3U A;  1FCO A;  1RGZ A;  2Y91 A;  3FYZ A;  3OCN A;  5AQA A;  2EFU A;  3MFD A;  1O7E A;  3HRE A;  5A92 A;  4C6Y A;  2BLS A;  3Q7Z A;  2Y2Q A;  3NI9 A;  5EVL A;  1YLJ A;  1PZO A;  2G2W A;  2V1Z A;  4WEJ A;  3HLE A;  1H8Y A;  2DNS A;  4FD8 A;  4JF6 A;  4KZ9 A;  4D2O A;  3HLD A;  2HP6 A;  3BM6 A;  1MWU A;  4N9K A;  1GHM A;  3ITA A;  3ZCZ A;  4DE1 A;  1PZP A;  3N8L A;  1SCW A;  1JWP A;  1MWR A;  4RYE A;  4GD6 A;  3IHA A;  4KZ5 A;  4X55 A;  2Y2O A;  5M18 A;  3NCK A;  3GMW A;  4Y0O A;  5F1G A;  4U3T A;  1XKZ A;  5A90 A;  5JYO A;  3NIA A;  4JXG A;  2EX9 A;  1PI4 A;  5FAT A;  4E6W A;  1ES2 A;  4WM9 A;  2HP5 A;  1TDL A;  4MBH A;  3Q82 A;  4EBL A;  2WKH A;  5E2G A;  3CG5 A;  2J9O A;  4WEK A;  3G2Y A;  1U60 A;  4R3J A;  5EOE A;  1K6R A;  2JCH A;  2VGK A;  4WZ5 C;  4EUZ A;  1PYY A;  1YLP A;  4FSF A;  4UHU A;  4KZ6 A;  1ZG6 A;  3SS5 A;  1N9B A;  3UDF A;  2EFX A;  5FAS A;  1ONH A;  1K54 A;  5TGF A;  3W4Q A;  3SH7 A;  4UA9 A;  1GHP A;  2Y55 A;  4R4R A;  4GDN A;  3MZD A;  1ZKJ A;  5FQQ A;  5HX9 A;  5CTM A;  3VFH A;  4OH0 A;  3DTM A;  3VP0 A;  5FQ9 A;  1CEG A;  3Q7V A;  1RCJ A;  4RX3 A;  4LCL A;  3PBR A;  2DRW A;  3AGD A;  5EE8 A;  3ZG7 B;  3BLM A;  2ZC3 B;  3IXB A;  3ZNY A;  1XX2 A;  4OOM A;  1DY6 A;  2J9P A;  1K4F A;  4IVI A;  5G18 A;  2XR0 A;  3HUM A;  3NY4 A;  3S22 A;  1BSG A;  4HEF A;  2Q9M A;  4LEN A;  3ZNT A;  4UA6 A;  3MZE A;  4N92 A;  3VFF A;  4LV0 A;  1YLW A;  4B4X A;  3EQV A;  5CED A;  1KE3 A;  5FI7 A;  1HD8 A;  5HW3 A;  4BL2 A;  3HLW A;  2BG1 A;  3ZFZ A;  4E3M A;  2OLV A;  2B5R A;  1CI9 A;  3GV9 A;  4B88 A;  3CJM A;  5CRF A;  5AQ9 A;  3UE0 A;  3M2K A;  4OLG A;  1M40 A;  5CHU A;  5EPH A;  3IQA A;  3V39 A;  3C7U A;  3MXR A;  4WYY A;  1IKI A;  2G2U A;  5GHX A;  4E3O A;  5GLB A;  5D3O A;  4UAA A;  5CTN A;  3N8S A;  1MY8 A;  1E3U D;  4ZAM A;  2WAD A;  3AGE A;  3DW0 A;  3VSK A;  1FSW A;  2ZMA A;  3BFD A;  1LL9 A;  4RX2 A;  3OPH A;  4XXR A;  3ITB A;  3HL9 A;  4ZTK A;  4GZB A;  4H8R A;  5HAI A;  3FZC A;  1KE4 A;  3M2J A;  4JF4 A;  1GHI A;  4YFM A;  1XXM A;  2E8I A;  4K91 A;  5EVI A;  5HFO A;  3ZG9 B;  1W7F A;  1BLP A;  2Y2J A;  4JKT A;  1RGY A;  1GA0 A;  2X71 A;  2ZC5 B;  2EX8 A;  3SS3 A;  4Q8I A;  3IXD A;  2JE5 A;  4PM5 A;  4N1H A;  5FAO A;  4OP8 A;  2C6W B;  4BD0 A;  4MBF A;  4S2K A;  3N4I A;  1DJC A;  4OQI A;  4U0X A;  4B4Z A;  4QY5 A;  5FQI A;  4P6B A;  4PM9 A;  2Z2M B;  1YM1 A;  1IYO A;  1K55 C;  4IVK A;  4Z9Q A;  4OON A;  1CEF A;  1H8Z A;  5J8X A;  4WZ4 A;  1Q2Q A;  4KZ8 A;  1K4E A;  3GTC A;  4Y7P A;  5GHZ A;  1BLS A;  2XGN A;  4N1X A;  4R1G A;  2A49 A;  2HDR A;  1GA9 A;  1YLT A;  4RA7 A;  4ZJ3 A;  1TEM A;  4KZ4 A;  4R3B A;  4K0X A;  4YIN A;  3UE1 A;  1ERM A;  4DXC A;  4MEZ A;  2HP9 A;  1S0W A;  3SH8 A;  2Q9N A;  1EI5 A;  1SHV A;  1VQQ A;  3BFE A;  3PAE A;  3W8K A;  3WS1 A;  1W8Y A;  4KG2 A;  2IWC A;  1MPL A;  2WK0 A;  1MWT A;  2XH9 A;  1FR6 A;  3G2Z A;  3HUN A;  4KZA A;  4DKI A;  2Y2P A;  1PW8 A;  3IXG A;  5GLA A;  4ZJ1 A;  2XF3 A;  4E3I A;  2HDQ A;  2EXA A;  2QPN A;  4S2I A;  3NDE A;  2Y2L A;  3WS5 A;  1HTZ A;  1JTD A;  3Q7V B;  4DXB A;  1ES4 A;  5M19 A;  3PTE A;  5CGW A;  3N7W A;  1CK3 A;  3TOI A;  1BT5 A;  4DE2 A;  3BFG A;  3QNB A;  5BOH A;  5EEC A;  4LV2 A;  4IBR A;  4QJG A;  5FA7 A;  4EWF A;  4DE3 A;  1ERO A;  1XGJ A;  4MLL A;  1W79 A;  1ERQ A;  4IBX A;  1BUE A;  3A3F A;  1G6A A;  2PU4 A;  1WYC A;  3IWQ A;  4S2N A;  4CPK A;  2Y2K A;  3MKF A;  5EUA A;  4P87 A;  3IH8 A;  3VSL A;  3UDX A;  4S2J A;  3V50 A;  5HAR A;  3SS4 A;  3V3R A;  4WEL A;  3UPP A;  1PI5 A;  4UA7 A;  3OCL A;  1KDS A;  3PBQ A;  1ESU A;  3OPL A;  1K57 C;  4L0L A;  2XD1 A;  1PWC A;  5DTK A;  1LHY A;  2WAE A;  3ISG A;  3OZH A;  4JF5 A;  4OQG A;  4FCF A;  5E2F A;  4DF6 A;  1L0G A;  2ZJ9 A;  4PPR A;  5EVI D;  3OPP A;  3DWZ A;  5TR7 A;  2XFT A;  3ZG8 B;  4WMC A;  3LY4 A;  3O3V A;  2V2F F;  5EVI B;  3GQZ A;  2WYX A;  3TG9 A;  2JBF A;  3GSG A;  3IH9 A;  2A3U A;  3C4P A;  1JWZ A;  1LI0 A;  5A91 A;  1K25 A;  5GL9 A;  3PBO A;  4PM6 A;  3PBN A;  5CGS A;  1NJ4 A;  3WWX A;  4WBG A;  1IEM A;  4JPM A;  5CEC A;  3VOY A;  2IWB A;  1IEL A;  2X01 A;  5FQK A;  2Y59 A;  2ZQA A;  4S2L A;  2P9V A;  1JVJ A;  5F83 A;  4FH2 A;  1XPB A;  3IWO A;  3O88 A;  2H0Y A;  3VP4 A;  1ESI A;  3JYI A;  4OOY A;  3E2K A;  1FCM A;  1CI8 A;  4U0T A;  3SOI A;  4BD1 A;  3G32 A;  3MKE A;  5KZH A;  1YMX A;  3WRZ A;  1O07 A;  4C3Q A;  4E3L A;  1YT4 A;  1JWV A;  2Y2N A;  4QD4 A;  4OPY A;  3LEZ A;  4PMA A;  2XDM A;  2EXB A;  5CER A;  2XEP A;  3IF6 B;  2ZM8 A;  3HLC A;  1IYP A;  3LY3 A;  4O7D A;  3PAG A;  5HAQ A;  3GVB A;  3LCE A;  4GD8 A;  4DRT A;  3A3E A;  3UE3 A;  5DTS A;  4JXV A;  2JC7 A;  5GHY A;  1BUL A;  2Y4A A;  2ZD8 A;  4BJP A;  1H5X A;  3IWI A;  3PBT A;  3QHY A;  3W4P A;  3MBZ A;  1DJA A;  2V20 A;  1JTG A;  5FSR A;  3V3S A;  4E6X A;  5HL1 A;  4DDY A;  1RP5 A;  3ZVT A;  1BTL A;  4PM7 A;  5DTT A;  5JYP A;  2OSU A;  2Z2L B;  3D4F A;  4JLF A;  5AQB A;  3BLS A;  1XP4 A;  3G35 A;  4IED A;  1HVB A;  1BLH A;  3P98 A;  5M1A A;  5EOO A;  5KSH A;  1PWG A;  3CMZ A;  4P85 A;  3PBS A;  3SH9 A;  1KGG A;  1FQG A;  1NYM A;  4KG5 A;  4EBP A;  2WKE A;  2PBY A;  1E4D A;  3MZF A;  1EWZ A;  1QME A;  4JXW A;  1IYQ A;  5FAQ A;  5L2F A;  4RVA A;  2QZ6 A;  1FR1 A;  2Y2H A;  4A5R A;  4GKU A;  2WUQ A;  4Y0U A;  5CGX A;  4LCM A;  1LLB A;  4OVD A;  4K0W A;  5DVA A;  3VMA A;  3OC2 A;  5FI6 A;  3IXH A;  3G4P A;  4EV4 A;  2XD5 A;  2WGW B;  4DDS A;  5CXW A;  5GLC A;  1FSY A;  1I2S A;  1WE4 A;  2J8Y A;  2ZQ9 A;  3IF6 A;  2R9X A;  5KSC A;  4X56 A;  3EQU A;  5FI2 A;  2ZC7 A;  1C3B A;  1K54 C;  3G34 A;  4ZJ2 A;  1MXO A;  4WMC D;  4OP5 A;  5DF7 A;  1MKI A;  4NET A;  3V5M A;  1PWD A;  1MWS A;  2UWX A;  1KVL A;  3IF5 A;  5FDH A;  2XLN A;  2WZX A;  4BLM A;  1FOF A;  1KGE A;  1SDE A;  2HDU A;  2J7V A;  1SDN A;  2H5S A;  4CJN A;  4R4S A;  3RXX A;  1DJB A;  3O87 A;  2I72 A;  1PIO A;  5FAP A;  1Z6F A;  2RCX A;  3IHB A;  3HBR A;  4OQ0 A;  2EX2 A;  2H0T A;  2P9V B;  4S2P A;  3VP2 A;  1NZU A;  1NRF A;  1LI9 A;  4KZ7 A;  4QU3 A;  2ZC6 B;  3WS2 A;  4X6T A;  1J9M A;  1SKF A;  3C4O A;  1XGI A;  4M3K A;  2ZQ8 A;  3ZHH A;  2X02 A;  4KEN B;  1L0F A;  3NC8 A;  4ID4 A;  1WYB A;  2WAF A;  3MXS A;  3HVF A;  2XFS A;  3A3I A;  5U47 A;  3RXW A;  3DWK A;  1S6R A;  1L0D A;  1L2S A;  1ZG4 A;  2ZQ7 A;  1K38 A;  2WGW A;  3C7V A;  1PW1 A;  4JXS A;  4PM8 A;  5E2E A;  1ES5 A;  4OPR A;  5KMW A;  5CHM A;  1K55 A;  3HUO A;  1YLZ A;  2ZM0 A;  2HDS A;  2GDN A;  3BFC A;  5E43 A;  3UN7 A;  1XA1 A;  4Y0T A;  4QB8 A;  3W4O A;  4OKP A;  1BLC A;  4OQH A;  4XUX A;  4HBT A;  4N9L A;  4XUZ A;  5EVI C;  3Q07 A;  1K56 A;  5CHJ A;  3G31 A;  5DF8 A;  3UPN A;  3UY6 A;  4FH4 A;  3GR2 A;  2HPB A;  3A3J A;  2WGV A;  4X68 A;  1NZO A;  3C5A A;  3ZVW A;  3HLF A;  5FQJ A;  1ALQ A;  4BEN A;  4NK3 A;  3UPO A;  3CZD A;  1I5Q A;  4HES A;  4KQO A;  3WS4 A;  2Y2I A;  3B3X A;  4JBF A;  3S1Y A;  3ZGA B;  1E25 A;  1I2W A;  2WZZ A;  4OOL A;  4P0M A;  2WGI A;  1L0E A;  1YMS A;  3M6H A;  3IT9 A;  1YLY A;  2DCF A;  3O86 A;  2RL3 A;  1BZA A;  3OPR A;  3FKW A;  4LV3 A;  4EBN A;  3I7J A;  3WS0 A;  3UDI A;  3HLB A;  2WKI A;  4HBU A;  4E3J A;  1ES3 A;  4KQQ A;  4E3K A;  5TFQ A;  1IYS A;  2ZQD A;  3IF6 C;  1TVF A;  4GB7 A;  3S4X A;  3UO9 A;  3VP3 A;  4EQI A;  1ONG A;  3UNW A;  3AGF A;  1LL5 A;  2OLU A;  3Q1F A;  2FFF B;  2R9W A;  1K6S A;  2C5W B;  2XQZ A;  3WRT A;  3BRM A;  1IKG A;  1VM1 A;  2QMI A;  4S2O A;  1ZC2 A;  3NDG A;  4WZ5 A;  2OV5 A;  3RJU A;  1NXY A;  3VP1 A;  3Q81 A;  1K57 A;  4QHC A;  5CEB A;  2CC1 A;  5AQ7 A;  1AXB A;  3N8R A;  3ZDJ A;  4LV1 A;  4ZDX A;  3FKV A;  3A3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...