3WS2A

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (condition-1c)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
360
structure length
360
Chain Sequence
QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAIDVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
molecule tags Hydrolase
total genus 118
structure length 360
sequence length 360
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ws2A00
3MKEA 3O3VA 5AQ9A 3M6HA 5FATA 5IHVA 4E3LA 4M3KA 1GHIA 5JYPA 4MBKA 3W4PA 4OH0A 3ZHHA 4E3NA 2RL3A 2JC7A 2QMIA 4PMAA 3WRZA 1TDLA 1IYOA 5EUAA 4MBFA 1ERQA 1KGEA 4RX2A 3PAGA 2Y2NA 4KG2A 3OZHA 1YLJA 1DJBA 3PBSA 2EX6A 3Q81A 2H10A 5FQMA 2ZJ9A 4FH2A 4Z9QA 2BLSA 2WGIA 2ZQAA 3MZFA 3AGEA 3GQZA 1KVLA 1YLTA 3N6IA 5A91A 3WS2A 1PWCA 3E2KA 1K54C 5CRFA 4U0XA 4E3JA 1U60A 1K38A 5FAQA 4WEJA 5GLBA 3HVFA 4L0LA 5A93A 3A3FA 4BD1A 3ISGA 3ZG0A 2HP9A 3VMAA 1E25A 3UDFA 3CG5A 4QD4A 1S0WA 1M40A 3IF6A 1LI9A 4GNUA 2WK0A 2Y4AA 1PZPA 3W4OA 3VP4A 3GVBA 4KZBA 2C6WB 4H8RA 5GHYA 2J9OA 2Y59A 4KQOA 3FV7A 3HLDA 4WELA 5FAPA 2ZC5B 5HARA 4FD8A 5DVAA 4YFMA 3E2LA 1CEFA 3GSGA 5F82A 1EI5A 2Y2OA 3O87A 1Q2QA 3VP0A 1K55A 4PM8A 3UPNA 5EOEA 5EVIA 3IQAA 1JWPA 2EX9A 2HDUA 1VM1A 1FR1A 1PWGA 5FI2A 4LV0A 5EVLA 1QMEA 4QU3A 3G30A 3Q82A 2XFSA 4DF6A 3IH9A 4GB7A 1MKIA 4RVAA 4HEFA 2ZC6B 4WZ4A 3WS1A 3FWLA 5CEBA 4C6YA 4OLDA 3HLBA 4S2KA 4OONA 3WS0A 4GD6A 3AGDA 1I2SA 2H0YA 4A5RA 4NK3A 3ZVTA 3N7WA 3C5AA 3IT9A 2HDRA 4PM9A 1ESIA 4P6BA 3OPLA 4N9LA 2X01A 4RYEA 3FKVA 4GDBA 2HP6A 4LV2A 1SCWA 1K56D 4UA6A 2WGWB 3VP3A 1ES2A 4OP5A 4BLMA 4EQIA 2XGNA 2WZXA 2V1ZA 2XQZA 3G2ZA 4JXVA 2X71A 2V20A 4X55A 2XFTA 1PWDA 1NY0A 1NXYA 1K56A 5CEDA 4O7DA 4FSFA 4JXSA 4OQIA 1SDNA 5FI6A 3FZCA 4KZ7A 4Y7PA 1BLHA 3HLWA 4R4SA 4JF5A 4RX3A 1KDWA 2ZQ8A 1PZOA 3SOIA 3A3EA 5G18A 2ZQ7A 3DW0A 4LV1A 2V2FF 2HDQA 1TEMA 2J9PA 2Z2LB 3IXHA 4K0XA 2RCXA 1DJCA 5JYOA 3RJUA 4S2IA 1EROA 3LEZA 1PI5A 4WYYA 2XDMA 3UE0A 5FSRA 3OPHA 5CHUA 1AXBA 2VGKA 5DTTA 1LHYA 3DWKA 1W5DA 2WKHA 2DRWA 1BLPA 4P85A 4N92A 3HUMA 4UA7A 2EX8A 4LCLA 3UNWA 5AQ7A 3NY4A 2PBYA 1E3UA 3C7VA 4HBTA 3ZGAB 3NIAA 3ZNYA 5EVIC 4JXWA 3G31A 3ZFZA 4R1GA 2R9XA 3GMWA 3LCEA 3ZVWA 1CK3A 4QY6A 1G6AA 5DTKA 3Q07A 1XP4A 5KMWA 3IHAA 4S2LA 3BLSA 2QZ6A 1QMFA 2XLNA 1PW1A 1L0FA 5HAQA 1L0EA 3UDXA 1C3BA 3IXGA 4EV4A 3OPRA 4WM9A 3PAEA 3PTEA 4PPRA 1I2WA 1MWUA 3UE3A 4EBPA 3MXRA 1SKFA 2OSUA 4OQGA 2IWDA 4S2MA 1LL9A 4ZBEA 4OOYA 2DNSA 3IXBA 1XXMA 1MXOA 4EWFA 3PBQA 1JTGA 1ONHA 3BYDA 4KQRA 1N9BA 4X68A 1G68A 4FH4A 5TGFA 4C75A 1IYSA 1W8YA 1MPLA 1MWSA 2ZMAA 2I72A 1IKIA 3OCLA 5E2FA 1BSGA 5AQAA 4CPKA 5GL9A 3HREA 5FQ9A 2EXAA 2QPNA 2WAFA 1BLCA 3UE1A 4OPYA 1K25A 1JVJA 1PYYA 2E8IA 2Y2KA 5DF7A 4ZDXA 4B4XA 4IEDA 4BL3A 3EQUA 4DXBA 4S2JA 2ZD8A 4BL2A 2EFUA 3IF6C 3GRJA 4OKPA 4HBUA 4S2NA 3DTMA 1KE4A 1PI4A 1WYBA 1M6KA 1WE4A 4IVKA 3RXXA 5HW3A 4JF6A 3PBRA 2Y2PA 5FAOA 3IH8A 2FFYA 4KZAA 5FQKA 2G2UA 4JBFA 3BFCA 1BULA 3ZG9B 1ESUA 3IWOA 4E3KA 4EBLA 4R3JA 5CTMA 5FI7A 2UWXA 4GZBA 3S1YA 3UPPA 1XX2A 2EFXA 3OCNA 1JWZA 4WMCA 1K55C 1YLWA 3V3RA 3VOZA 3N8LA 4DDYA 3MZDA 4BJPA 5E43A 1YQSA 4KG6A 2VGJA 3UDIA 2WYXA 4BD0A 3Q1FA 4MLLA 4GD8A 3ZG7B 1TVFA 2HDSA 4OPZA 3HLGA 4GKUA 4IBXA 4KZ5A 3BLMA 4KENB 5GLAA 4E6XA 1N4OA 1NJ4A 1PIOA 4DE3A 5CECA 1W8QA 4XUXA 4U3TA 3ZCZA 1FR6A 3ITAA 5CXWA 1H5XA 1RP5A 1LLBA 2XR0A 3TOIA 1KE0A 3SH7A 4B4ZA 3OPPA 3VP1A 4R4RA 1DY6A 2A3UA 2HP5A 2Y2JA 3QNCA 1K4EA 3GR2A 1XPBA 4QJGA 1HVBA 1KGGA 4OLGA 4KZ6A 3HUNA 3A3DA 2ZM2A 2Y91A 4KG5A 2ZC7A 4X53A 1Y54A 4DE1A 3ZG8B 3WS5A 1RGZA 4MBHA 4ZTKA 5DF8A 3VOYA 2Y2GA 2H5SA 4BENA 4ID4A 1Z6FA 1IYPA 2A49A 2DCFA 3WWXA 4GN2A 1YM1A 1K57A 3W8KA 1FCMA 1S6RA 2C5WB 2Y2HA 3PBTA 2WGWA 3BM6A 2ZQ9A 1KVMA 3UN7A 1RGYA 3IWIA 3SS3A 4DDSA 3BFFA 4B88A 4OP8A 1W7FA 2PU4A 4GOGA 4N1HA 2XH9A 3GTCA 3Q7VB 4KZ8A 1CI8A 4XUZA 5TFQA 3IHBA 4F94A 2Q9NA 1GA9A 4LCMA 5AQBA 3I7JA 3O88A 2ZC4B 1XGIA 2P74A 3C4OA 3NCKA 3HLCA 1E3UD 1BUEA 2CC1A 2ZQDA 1L0GA 1K6RA 5FA7A 5A90A 2EXBA 3P98A 3TSGA 4N9KA 5M19A 3LY3A 3AGFA 3HBRA 2WUQA 2Y2QA 1NZUA 4E3IA 3LY4A 1H8ZA 4LV3A 3VFFA 5DTSA 5EE8A 4X69A 4OOLA 5KZHA 2WKEA 3PBOA 2JE5A 3C7UA 4JPMA 4ZJ2A 1L2SA 3A3IA 1H8YA 2P9VB 5CGXA 1LI0A 3CZDA 4S2PA 5EECA 1GHPA 3HLFA 3FYZA 2Z2MB 1ONGA 3SS5A 3BEBA 4R0QA 1FSWA 2XEPA 1GA0A 5EVIB 5HAPA 4LENA 1BZAA 3G4PA 1YMXA 5FQJA 3BFDA 3FKWA 3SH8A 4WZ5A 3HUOA 2Y2MA 4XXRA 1DJAA 3V3SA 3DWZA 4WEKA 5EPHA 4E6WA 5F1FA 4FCFA 1BT5A 4Y0OA 5CGSA 3QNBA 1IKGA 1KDSA 1CEGA 2X02A 5F83A 4DXCA 3Q7ZA 1NYYA 4UHUA 1ES5A 5GLDA 4MEZA 1LL5A 2IWCA 2XK1A 3G34A 4S2OA 2JCHA 3NC8A 1NYMA 4P87A 1O7EA 3BECA 4PM6A 3UY6A 1IELA 4KZ9A 3M6BA 3S22A 1HTZA 2HPBA 2R9WA 4KZ3A 3UPOA 3HL9A 4YINA 1NRFA 1ALQA 5HL1A 3ZDJA 2WGVA 1XA7A 3SH9A 2BG1A 1ZC2A 4DE2A 5HFOA 5M18A 2WAEA 4NETA 4IBRA 2G2WA 4S2NC 4X56A 4WBGA 3OC2A 2ZM0A 4WMCD 4JKTA 4OPQA 2XD1A 1K54A 4E3OA 3NI9A 3IF6B 4QY5A 5FASA 3M2KA 5CERA 3HLEA 1ERMA 5EOOA 4OQ0A 1RCJA 4R23A 5KSHA 5A92A 4OVDA 4UA9A 4EBNA 1KE3A 1VQQA 1XGJA 3EQVA 3MZEA 5TR7A 2ZM8A 1Q2PA 1W79A 3VP2A 5J8XA 2JBFA 1HD8A 3V5MA 3S4XA 5KSCA 2Q9MA 1KGFA 1YMSA 3N8SA 2J7VA 5E2EA 1MWRA 2Y2IA 3IWQA 1GHMA 3MXSA 1WYCA 5CHMA 1K4FA 3W4QA 5GHXA 5DF9A 5E2HA 1IEMA 4MNRA 5CHJA 4QHCA 1L0DA 3BFGA 4ZAMA 3ITBA 3MBZA 4GDNA 4PM5A 4JF4A 4UAAA 3BRMA 3WS4A 2J8YA 5BOHA 3M2JA 4K91A 2IWBA 5FDHA 1FCOA 4JLFA 5HAIA 1GCEA 4N1XA 3PBNA 2OLUA 4KQQA 4PM7A 3P09A 2PU2A 3JYIA 4BQMA 2XF3A 3A3JA 4R3BA 5FQQA 4JXGA 4CJNA 2B5RA 4DKIA 5E2GA 4ZJ3A 3VSKA 1MWTA 1K57C 3CJMA 3BFEA 3MFDA 2OV5A 3V50A 1PW8A 2XD5A 1MBLA 3RXWA 2Y2LA 1IYQA 1XA1A 3GV9A 1YLZA 5CTNA 5GHZA 4EUZA 3O86A 1NZOA 2WZZA 1TDGA 2Y55A 3IXDA 2ZQCA 5GLCA 3MKFA 3G35A 5U47A 3VFHA 1I5QA 1XKZA 5M1AA 3UO9A 3CMZA 4DE0A 3SS4A 4Q8IA 2H0TA 4P0MA 1J9MA 1FQGA 5I94A 2WADA 2ZC3B 1BLSA 3Q7VA 1FCNA 5CGWA 5FQIA 1YLPA 4OQHA 4QB8A 3NDGA 4KZ4A 3N4IA 3NBLA 4Y0UA 2OLVA 2FFFB 2EX2A 2GDNA 4X6TA 1O07A 1JWVA 5F1GA 3V39A 3ZNTA 1ES3A 3TG9A 1YT4A 3NDEA 1E4DA 4IVIA 4C3QA 3D4FA 1FOFA 3QHYA 4HESA 4DRTA 5L2FA 5HX9A 3IF5A 1HZOA 3LO7A 4U0TA 1EWZA 4ZJ1A 1MY8A 1SHVA 1ZG4A 4K0WA 4D2OA 3N8RA 3C4PA 4OOMA 5EVID 1FSYA 1YLYA 1ES4A 1K6SA 5D3OA 3WRTA 4Y0TA 1ZG6A 4WZ5C 1OMEA 3G2YA 4E3MA 4RA7A 1ZKJA 1BTLA 2P9VA 1JTDA 2ZLYA 3G32A 3ZG5A 3B3XA 3VSLA 4OPRA 2WKIA 1CI9A 1SDEA
chains in the Genus database with same CATH superfamily
4M3KA 4ETZA 3W4PA 3ZHHA 3CHWP 4OH0A 4I3JA 4PMAA 3WRZA 1DJBA 2P08A 3PBSA 3LIAA 4R70A 3NHQA 5AVEA 2PDRA 1U60A 4L0LA 1P0ZA 3F1NB 4D60A 3NOUC 3VV4A 3D3OA 2HP9A 3GVBA 4KZBA 4H8RA 3ZYTA 5GHYA 2EA9A 2XSSA 3UMDA 3CITA 1CEFA 2ZMFA 5F82A 4IUHA 3LICA 1EI5A 2M7VA 3UPNA 3O5YA 5EOEA 3IQAA 1VM1A 1T1BA 1FR1A 1QMEA 2ZL1A 3G30A 3Q82A 2XFSA 4DF6A 3F1OA 3F1PA 2LB9A 4G3VA 1MKIA 2WKRA 4P6ZM 4RVAA 4HEFA 4OLDA 3HLBA 4S2KA 2W3GA 3BWLA 4A5RA 2H0YA 4RQ9A 4NK3A 3C5AA 4N9LA 1LSVA 2WGWB 4EU0A 3VP3A 4JXSA 4OQIA 4KUOA 4JGRA 4KZ7A 2P7JA 4RX3A 1KDWA 3T1RA 5G18A 2GZAA 2ZQ7A 2BASA 4GS9B 5FL3A 1OTBA 3JPUA 4NKPA 2XDMA 4PHTA 3OPHA 1S4RA 2VGKA 3DWKA 1F2KA 3E0YA 5A8BA 4LCLA 3H82B 1YSPA 5EVIC 4JXWA 5DTKA 1XP4A 3DTIA 2XLNA 1PW1A 1S66L 1L0EA 1C3BA 2JKTM 2JKGA 3UE3A 3KYQA 1SKFA 2IWDA 4GW9A 2MJ6A 4G3KA 1N9BA 1MPLA 1MWSA 3OCLA 5E2FA 1BSGA 2YKHA 3HREA 1G6OA 5G4YA 2WAFA 4HOIA 5DF7A 3BW6A 4B4XA 2KX6A 4S2JA 3IF6C 1KE4A 5EFWA 1WE4A 3F1NA 3PR6A 5FAOA 3IH8A 1OJ5A 3D9YA 2VV7A 3BFCA 1BULA 2AVXA 4E3KA 2I9VA 1D7EA 1K55C 3V3RA 4GJ4A 4BJPA 3UDIA 2WYXA 3DTKA 3Q1FA 1TVFA 3BLMA 1FR6A 1H5XA 1LLBA 1KE0A 2KLIA 1DY6A 2A3UA 3P01A 3QNCA 1K4EA 4QJGA 1XPBA 1HVBA 1KGGA 2ZM2A 3T4OA 4KG5A 4X53A 1Y54A 5DF8A 2H5SA 4M4XA 4GLQA 4GN2A 4BWIA 2K31A 2Y2HA 2WGWA 1KVMA 3IWIA 3SS3A 4DDSA 3BFFA 4B88A 4I3AA 3C2WA 4PAUA 2PU4A 1N9OA 4KZ8A 1CI8A 4XUZA 3IHBA 2Q9NA 3O88A 3TE8A 2P74A 2CC1A 4F3LB 2EXBA 5LBRA 3TSGA 4GS9A 4WF0A 1T19A 4N9KA 5M19A 2WUQA 5HL6A 5EE8A 2JE5A 4JPMA 5DJTA 4DMZA 1XJ6A 2QJ5A 4HH2A 2L0WA 3BEBA 1NRJA 1FSWA 2XEPA 3H82A 5EVIB 3LIEA 3KSFA 1LSXA 2PHYA 5FQJA 3SH8A 3L9KA 4XXRA 5HWVA 5F1FA 5CGSA 3LR4A 2VV6A 5F69A 4HY8A 5F83A 4UHUA 2E8JA 2XK1A 2JCHA 1GSWA 1NYMA 3UY6A 2CMNA 1HTZA 5TBMB 3FPVA 5I5LA 3ZDJA 1XFQA 1XA7A 2BG1A 5HFOA 5HWWA 2HJ9C 4NETA 1VETB 4X56A 3LYXA 1J3WA 4WBGA 3OC2A 2ZM0A 4JKTA 3IF6B 4QY5A 2VA0A 1TS6A 4Y15A 4OVDA 4UA9A 4EBNA 1KE3A 1XGJA 1W79A 1HD8A 2J3TC 3S4XA 4KQDA 1KGFA 5DFYA 2Y2IA 1WYCA 3PYPA 5CHMA 2O9BA 5GHXA 5E2HA 3TJZC 3K2NA 3BFGA 4MCWA 4PM5A 5DFXA 2J8YA 2PYRA 5FDHA 3EGDC 1FCOA 4JLFA 2OOLA 3B47A 2PU2A 4R3BA 4DKIA 4CJNA 3EGXC 2NUPC 1AWIA 3UB5P 1MWTA 1PW8A 2HGVA 5MC7A 4HP9A 1XA1A 4UQIM 1DP8A 1NZOA 1W63Q 2QJ7A 1TDGA 3VOLA 3BQAA 3MKFA 3VFHA 3UO9A 5M1AA 4B93A 4Q8IA 3CMZA 3SS4A 5IT5A 2H0TA 4P0MA 1J9MA 1BLSA 5HWTA 3NDGA 4KZ4A 4IJGA 3NBLA 4Y0UA 1S1ZA 4I39A 2EX2A 1O07A 2O9AA 5F1GA 1XJ4A 2XROA 4YWZA 3TG9A 2FH5A 3NDEA 4F3LA 5L2FA 3BY8A 4GHIB 1EWZA 2ZOIA 1OTDA 4WLAA 3WRTA 1K0KA 1IFQA 2K7SA 4RA7A 1ZKJA 3E4PA 4E3MA 1JTDA 3G32A 2M7UA 1KOUA 3UMEA 5EVIA 3O3VA 1OT6A 5FATA 4Q0IA 2D02A 1A0KA 1KGEA 4RX2A 5HD3A 3KO6A 1YLJA 2J80A 4CLCC 2EX6A 3Q81A 2H10A 2ZJ9A 2ZQAA 3N6IA 3FC7A 1T1CA 5TBMA 1PNEA 4WEJA 1G28A 3IBRA 5A93A 4FOFA 4BD1A 3V67A 3UDFA 3CG5A 1S4SA 1MKMA 1S0WA 1M40A 3IF6A 1LI9A 4GNUA 2WK0A 5HD5A 1CJFA 3RTYA 3MQOA 1S67L 3HLDA 5FAPA 4EEUA 5HARA 4YFMA 3S7PA 4Y17A 3O87A 1Q2QA 3VP0A 1K55A 4PM8A 3T4TA 1JWPA 1PWGA 4LV0A 4LRXC 1STZA 2ZC6B 3WS1A 3EEHA 4OONA 3AGDA 3LI9A 3IT9A 1ESIA 4P6BA 1TD5A 2X01A 3QP5A 4RYEA 2GJ3A 3FKVA 4GDBA 3CPTA 4NXFA 4LV2A 1K56D 1ES2A 3UB9A 3GECA 2XGNA 2V1ZA 1OTAA 2V20A 1V9YA 5C5KA 1ZTUA 5CEDA 4HNBA 4H6JB 2B18A 4WN5A 4Y7PA 1FILA 1BLHA 3NJAA 3HLWA 1D1JA 4O8GA 1UWPX 1X0OA 3MF0A 3SOIA 3A3EA 2J9PA 2PYPA 3IXHA 4K0XA 1DJCA 3LEZA 1PI5A 3UE0A 5CHUA 2V8FA 2DRWA 4P85A 2EX8A 3ZGAB 4GHIA 3ZNYA 4R1GA 4WL9A 1N9LA 3LCEA 1CK3A 1G6AA 4JGOA 5KMWA 2UV0E 3IHAA 4S2LA 5L8MA 2QZ6A 1QMFA 3IXGA 4PPRA 1I2WA 3MXRA 2OSUA 5IU1A 2DNSA 1MXOA 1JTGA 1LL8A 4CLCB 3BYDA 4KQRA 1XFNA 2ZMAA 2I72A 1IKIA 3MQ0A 4CPKA 2EXAA 1LT0A 3UE1A 4OPYA 1K25A 2E8IA 4DXBA 3EQUA 4BMWA 4HBUA 3MFXA 3BQ8A 1OPXA 5J7EA 2JKRM 3PBRA 4KZAA 1VHMA 2G2UA 3ZG9B 1ESUA 4R3JA 5FI7A 2UWXA 2EFXA 3OCNA 2M1CA 2PT7A 3KSGA 3MZDA 5F68A 4MLLA 4GD8A 2W3EA 3NOPC 4OPZA 4EXOA 3HLGA 4E6XA 4KENB 2V0UA 5GLAA 5CECA 1DP9A 1W8QA 3ZCZA 3ITAA 3OBFA 2XR0A 3TOIA 4B4ZA 3C30A 1P9WA 3HUNA 2Y91A 3WS5A 1RGZA 4HJ4A 4BENA 1NWZA 1Z6FA 4EESA 1FCMA 3BM6A 2ZQ9A 4OP8A 3TRCA 5FDSA 1OTIA 4GOGA 4N1HA 3Q7VB 4H6JA 2VGLS 3SZTA 1E3UD 3LY3A 3AGFA 1NZUA 4E3IA 4X69A 4OOLA 4X25A 3CAXA 3PBOA 2V1BA 4ZJ2A 2VLGA 2P9VB 4K08A 4S2PA 3FYZA 3SS5A 2JKTI 3L7HA 5HAPA 5J4EA 1GSXA 3DTEA 4IUKA 3BFDA 3FKWA 3EEAA 3R4KA 4P6ZS 2Y2MA 3E4OA 3V3SA 3DWZA 5EPHA 4FCFA 1BT5A 3A0RA 1KDSA 4DXCA 3Q7ZA 1ES5A 4S2OA 3NC8A 1IELA 2V9AA 2R9WA 4YINA 1NRFA 4CLCA 3SH9A 4R6LA 5M18A 4IBRA 4B9OA 4WMCD 3OLOA 5FEGA 5FASA 3M2KA 3CI6A 2PAVP 3HLEA 1ERMA 4HI4A 4OQ0A 1UWNX 5KSHA 3EQVA 3B33A 1XJ3A 2Q9MA 5E2EA 3N8SA 4HJ6A 2J7VA 3MS6A 4JGPA 4CLCE 4QHCA 1L0DA 4ZAMA 3BRMA 4MN7A 2IWBA 2OLUA 4PM7A 2XF3A 2W3HA 4ZJ3A 2NUTC 2P04A 2B02A 3BFEA 3EWKA 3LFVA 2XD5A 3K3CA 5HSQA 3RXWA 2Y2LA 4AFIA 1YLZA 5CTNA 4EUZA 5F6AA 3QP6A 1YKDA 3O86A 2WZZA 2VEAA 4DE0A 1XKZA 3S7QA 4GCZA 1FIKA 2WADA 3GDIA 3Q7VA 1FCNA 2VV8A 5FQIA 3S7NA 2PRFA 1JWVA 1YT4A 2O99A 4DRTA 3DBAA 3KYZA 3IF5A 2Z6CA 4U0TA 3LO7A 5KIZA 4L9EA 3T1XA 4D2OA 3C4PA 2A24B 1K6SA 3G2YA 1BTLA 2P9VA 1SZVA 3ZG5A 1OTEA 4OPRA 1CI9A 3LIBA 3MKEA 5AQ9A 4O01A 3MXQA 5IHVA 1H3QA 4E3LA 5JYPA 4MBKA 5HZHA 4LGWA 3UB7A 5EUAA 4MBFA 1ERQA 2W1TB 2Y2NA 1TS7A 1MZUA 3T1SA 4ME4A 2WGIA 1TS8A 3AGEA 3GQZA 2JKFA 3JVUA 1PWCA 4ARZB 1K54C 4U0XA 3MMHA 1F9IA 3A3FA 3ISGA 3VMAA 1E25A 2FZ0A 4QD4A 2PR6A 2Y4AA 1PZPA 3W4OA 2C6WB 2Y59A 3FV7A 4WELA 2OAP1 2ZC5B 4FD8A 2OAQ1 3E2LA 3GSGA 5EM1A 5CX7A 5HDCA 4IHQA 4QU3A 1Z09A 3IH9A 4GB7A 2PD7A 2KDKA 5CEBA 4C6YA 3CWFA 4GD6A 1P97A 3ZVTA 4L9FA 3N7WA 5EV0A 2HDRA 4PM9A 3OPLA 5DKKA 5L09A 2HP6A 1SCWA 4UA6A 3IS2B 4OP5A 2WZXA 2INWA 4JXVA 3HJKA 2X71A 4X55A 3CUEC 2XFTA 2PD8A 1PWDA 4FSFA 2O0YA 4WUJA 1SDNA 5FI6A 4HH3A 4R4SA 4JF5A 4R38A 2ZQ8A 4EETB 3BJNA 1PZOA 4LV1A 1TEMA 2ZMVA 2Z2LB 2RCXA 4EQ1A 3A0SA 2EWWA 1EROA 4BBTA 4WYYA 5FSRA 1AXBA 3FPWA 1W5DA 1BLPA 4N92A 2V8CA 3HUMA 3UNWA 3NY4A 1E3UA 1Y28A 3C7VA 2VK3A 2XA7M 3GMWA 4QY6A 1L3LA 2A24A 3QP8A 3Q07A 2G7UA 2L4RA 1ZHHB 1L0FA 4BBUA 5HAQA 3OPRA 4WM9A 1MWUA 4EBPA 3C38A 4OQGA 3BY9A 4S2MA 1LL9A 4HJ3A 4ZBEA 4OOYA 1XXMA 3IBJA 1ONHA 4X68A 5TGFA 2W1TA 1G68A 1V9ZA 1W8YA 1P9RA 5AQAA 5GL9A 5DKLA 5FQ9A 2QPNA 4HIAA 3RH8B 1VETA 4UQIS 1BLCA 4ZDXA 2O9CA 1JVJA 2Y2KA 4BL3A 4IEDA 1F5MA 2ZOHA 3GRJA 3NULA 4EERA 3RXXA 1ODVA 5HW3A 3ULFA 3G6OA 1ACFA 4I3IA 5DJUA 3IWOA 3H7WB 5CTMA 3UPPA 1JWZA 4WMCA 1YLWA 3VOZA 3N8LA 4DDYA 2HF6A 2R78A 4KG6A 5E43A 3HJIA 4BD0A 2K2NA 4PKYG 2HDSA 3K3DA 4EUVA 2OWHA 2QKPA 1G5UA 2QYBA 5F5YA 5CXWA 1RP5A 3F1PB 3LI8A 3SH7A 4NXEA 4R4RA 2Q0OA 4MDZA 2HP5A 3GR2A 4OLGA 1EW0A 3A3DA 3R7WB 1T18A 3PXPA 2D01A 1UGUA 4DE1A 3ZG8B 4ZTKA 1IOUA 2A49A 3WWXA 1S6RA 3IS2A 3UN7A 5L10A 1DP6A 2KOIA 2XH9A 2L1MA 3GTCA 1VEUB 5TFQA 4F94A 1GA9A 5AQBA 4HHDA 3KSHA 4Y13A 4I5SA 3NCKA 3HLCA 1S1YA 1K6RA 2PBDP 3P98A 4Y3IA 4E04A 3VFFA 5DTSA 5KZHA 5L07A 5AVFA 1L2SA 3A3IA 1H8YA 5CGXA 1LI0A 3CZDA 3LIDA 1GHPA 2V0WA 1GA0A 4LENA 3HUOA 1DJAA 4E6WA 1JNUA 3QNBA 2ZBBA 3T12B 2X02A 4Q0JA 3HCYA 5GLDA 4Q0HA 3LIFA 4PM6A 1O7EA 3BECA 4KZ9A 3M6BA 3T50A 2HPBA 3UPOA 1ALQA 4NXBA 5HL1A 2J3WA 2WAEA 2JKRI 2G2WA 4S2NC 2EWVA 3LR0A 1K54A 2XD1A 4ZRRA 3T4JA 4JGQA 4CQHA 1DRMA 2VGLM 1RCJA 1TS0A 1YAXA 2H28A 2Z6DA 4DJ3A 3MZEA 1Q2PA 3VP2A 3H7WA 2JBFA 5KSCA 3UE6A 1YMSA 1VB6A 1MWRA 1GHMA 4II7A 1H8MA 2XRNA 3MXSA 3TW8A 4MNRA 5CHJA 3E98A 3MBZA 4GDNA 4JF4A 4UAAA 3WS4A 3M2JA 4K91A 3DAVA 5HAIA 1GSVA 2WKQA 3PBNA 4KQQA 3JYIA 5FQQA 3A3JA 4JXGA 2DMWA 3VSKA 4NG2A 1K57C 3CJMA 3R7WA 4BBVA 3MFDA 1NLZA 4PKYA 4QWOA 1TF1A 3GV9A 5GHZA 1OJGA 3CUEA 3IXDA 1F98A 4X1LA 3G35A 1VEUA 3QP4A 4QB8A 1CF0A 2OLVA 2FFFB 3V39A 4Y5FA 3ZNTA 1XJ2A 4IVIA 4I38A 3QHYA 4XT2B 1MY8A 1ZG4A 4K0WA 2W0NA 4OOMA 5EVID 5FEFA 1YLYA 5D3OA 4Y0TA 1ZG6A 2YKFA 4WZ5C 3KX0X 2ZLYA 1SKOB 2W27A 3KYEA 1H0MA 1SDEA 3LUQA 4LRZE 3M6HA 1Y4OA 1GHIA 2GX5A 4E3NA 2RL3A 2JC7A 2QMIA 1TDLA 1IYOA 4YOFA 4EEPA 3PAGA 4KG2A 3OZHA 2HV1A 2JN7A 4FH2A 5FQMA 4Z9QA 2BLSA 3MZFA 1KVLA 1YLTA 5A91A 3P7NA 3WS2A 4KUKA 3E2KA 2VZWA 5CRFA 2W1RA 4E3JA 1K38A 5FAQA 5GLBA 3HVFA 4FTXA 3ZG0A 4ETXA 5EVEA 3VP4A 2J9OA 3UB6A 4KQOA 5DVAA 3PHYA 2Y2OA 1N9NA 2EX9A 2HDUA 3CLOA 5FI2A 5EVLA 5HDDA 2OWJA 4WZ4A 3FWLA 4ESPA 3WS0A 1I2SA 1WA9A 4BLMA 4EQIA 2XQZA 3G2ZA 4X1MA 1NY0A 4L9GA 1NXYA 1K56A 4O7DA 4O0PA 3FZCA 1OT9A 1PFLA 4UEYA 3ICYA 1NLYA 2PR5A 3DW0A 4HP4A 2V2FF 2HDQA 1LSWA 5JYOA 3RJUA 4S2IA 5DTTA 1LHYA 4LLOB 5TJJA 2WKHA 3RFBA 3T4KA 4UA7A 5HDSA 5AQ7A 2PBYA 3OOVA 4HBTA 4XT2A 3NIAA 3G31A 3ZFZA 2R9XA 3ZVWA 3LR5A 3BLSA 5G4ZA 2VJWA 1SKOA 3MJQA 3UDXA 4EV4A 3PAEA 3PTEA 3IX4A 4EW7A 3MSHA 3IXBA 4NXGA 4EWFA 2V1AA 3D72A 3PBQA 3NOTC 4FH4A 4C75A 1IYSA 3VE3A 1PYYA 3T4LA 2ZD8A 4BL2A 2EFUA 2W3FA 4OKPA 4S2NA 3DTMA 2A2LA 1PI4A 1WYBA 1M6KA 4IVKA 4JF6A 2Y2PA 3LR3A 2HJEA 2FFYA 5FQKA 4JBFA 4EBLA 4GZBA 3S1YA 1XX2A 2J3TD 5K5BA 1YQSA 2VGJA 5J3WA 2IA2A 3ZG7B 3NECA 4GKUA 4IBXA 4KZ5A 4DJ2A 1N4OA 1NJ4A 1PIOA 4DE3A 4LPZA 4XUXA 2Y79A 4U3TA 4MMNA 3OPPA 3VP1A 2Y2JA 4LFUA 4KZ6A 2W3DA 1HLUP 2ZC7A 3T4SA 4MBHA 3VOYA 2Y2GA 2HZ5A 4R3AA 3CPTB 4ID4A 1IYPA 2DCFA 3VE4A 3A0VA 1YM1A 1K57A 3W8KA 2C5WB 3PBTA 1RGYA 3H9WA 4Z1WA 2QWSA 3MR0A 1W7FA 3E4QA 2ACGA 1W63M 4YNRA 4LCMA 3I7JA 4HQAA 2ZC4B 3S7OA 1XGIA 1YPRA 3C4OA 3IX3A 1BUEA 2ZQDA 1L0GA 5FA7A 5A90A 3SW1A 3HBRA 2Y2QA 4LRYC 3LY4A 3QP1A 1H8ZA 4LV3A 3MQQA 1CQAA 2WKEA 3C7UA 5EECA 3HLFA 2Z2MB 1ONGA 4R0QA 4DN0A 1BZAA 3G4PA 1D06A 1YMXA 4WZ5A 3QP2A 2VKSA 4WEKA 2JHEA 1T1AA 1PRQA 4Y0OA 1IKGA 5AJGA 1YSQA 1CEGA 1NYYA 4MEZA 1LL5A 2IWCA 3G34A 4P87A 4CLCD 3S22A 4KZ3A 3HL9A 3IX8A 2WGVA 4ARZA 2GNXA 1ZC2A 4DE2A 3T1QB 2Y8HA 3LGOA 3KSIA 4OPQA 4E3OA 3NI9A 5CERA 3EOIA 5EOOA 4NEED 4R23A 5A92A 4MN6A 1VQQA 2QHKA 5TR7A 2ZM8A 3C8CA 5J8XA 3LEQA 3U2AA 3V5MA 3IWQA 4QPRA 2B95A 2ZL1B 1K4FA 3W4QA 3F1OB 5DF9A 1IEMA 2XA7S 2VX8A 2LB5A 3ITBA 5BOHA 2WKPA 1GCEA 4MN5A 4N1XA 2BTFP 3P09A 4BQMA 2B5RA 3U4LP 5E2GA 1MC0A 3UB8A 2OV5A 3V50A 1MBLA 1IYQA 3B42A 4G3WA 2Y55A 2ZQCA 3T4QA 5GLCA 5U47A 3ZQ5A 1I5QA 1BYWA 1FQGA 5I94A 2ZC3B 5CGWA 1YLPA 4OQHA 3N4IA 3FG8A 4X6TA 2GDNA 3JVVA 4Y2FA 5HPIA 1ES3A 5HPFA 1E4DA 4C3QA 3D4FA 1FOFA 4HESA 5HX9A 1HZOA 4ZJ1A 5IS1A 1SHVA 3N8RA 1FSYA 1ES4A 3W2ZA 1OMEA 4FUWA 3B3XA 5EM0A 3VSLA 2WKIA
chains in the Genus database with same CATH topology
3MKEA 3O3VA 5AQ9A 3M6HA 5FATA 5IHVA 4E3LA 4M3KA 1GHIA 5JYPA 4MBKA 3W4PA 4OH0A 3ZHHA 4E3NA 2RL3A 2JC7A 2QMIA 4PMAA 3WRZA 1TDLA 1IYOA 5EUAA 4MBFA 1ERQA 1KGEA 4RX2A 3PAGA 2Y2NA 4KG2A 3OZHA 1YLJA 1DJBA 3PBSA 2EX6A 3Q81A 2H10A 5FQMA 2ZJ9A 4FH2A 4Z9QA 2BLSA 2WGIA 2ZQAA 3MZFA 3AGEA 3GQZA 1KVLA 1YLTA 3N6IA 5A91A 3WS2A 1PWCA 3E2KA 1K54C 5CRFA 4U0XA 4E3JA 1U60A 1K38A 5FAQA 4WEJA 5GLBA 3HVFA 4L0LA 5A93A 3A3FA 4BD1A 3ISGA 3ZG0A 2HP9A 3VMAA 1E25A 3UDFA 3CG5A 4QD4A 1S0WA 1M40A 3IF6A 1LI9A 4GNUA 2WK0A 2Y4AA 1PZPA 3W4OA 3VP4A 3GVBA 4KZBA 2C6WB 4H8RA 5GHYA 2J9OA 2Y59A 4KQOA 3FV7A 3HLDA 4WELA 5FAPA 2ZC5B 5HARA 4FD8A 5DVAA 4YFMA 3E2LA 1CEFA 3GSGA 5F82A 1EI5A 2Y2OA 3O87A 1Q2QA 3VP0A 1K55A 4PM8A 3UPNA 5EOEA 5EVIA 3IQAA 1JWPA 2EX9A 2HDUA 1VM1A 1FR1A 1PWGA 5FI2A 4LV0A 5EVLA 1QMEA 4QU3A 3G30A 3Q82A 2XFSA 4DF6A 3IH9A 4GB7A 1MKIA 4RVAA 4HEFA 2ZC6B 4WZ4A 3WS1A 3FWLA 5CEBA 4C6YA 4OLDA 3HLBA 4S2KA 4OONA 3WS0A 4GD6A 3AGDA 1I2SA 2H0YA 4A5RA 4NK3A 3ZVTA 3N7WA 3C5AA 3IT9A 2HDRA 4PM9A 1ESIA 4P6BA 3OPLA 4N9LA 2X01A 4RYEA 3FKVA 4GDBA 2HP6A 4LV2A 1SCWA 1K56D 4UA6A 2WGWB 3VP3A 1ES2A 4OP5A 4BLMA 4EQIA 2XGNA 2WZXA 2V1ZA 2XQZA 3G2ZA 4JXVA 2X71A 2V20A 4X55A 2XFTA 1PWDA 1NY0A 1NXYA 1K56A 5CEDA 4O7DA 4FSFA 4JXSA 4OQIA 1SDNA 5FI6A 3FZCA 4KZ7A 4Y7PA 1BLHA 3HLWA 4R4SA 4JF5A 4RX3A 1KDWA 2ZQ8A 1PZOA 3SOIA 3A3EA 5G18A 2ZQ7A 3DW0A 4LV1A 2V2FF 2HDQA 1TEMA 2J9PA 2Z2LB 3IXHA 4K0XA 2RCXA 1DJCA 5JYOA 3RJUA 4S2IA 1EROA 3LEZA 1PI5A 4WYYA 2XDMA 3UE0A 5FSRA 3OPHA 5CHUA 1AXBA 2VGKA 5DTTA 1LHYA 3DWKA 1W5DA 2WKHA 2DRWA 1BLPA 4P85A 4N92A 3HUMA 4UA7A 2EX8A 4LCLA 3UNWA 5AQ7A 3NY4A 2PBYA 1E3UA 3C7VA 4HBTA 3ZGAB 3NIAA 3ZNYA 5EVIC 4JXWA 3G31A 3ZFZA 4R1GA 2R9XA 3GMWA 3LCEA 3ZVWA 1CK3A 4QY6A 1G6AA 5DTKA 3Q07A 1XP4A 5KMWA 3IHAA 4S2LA 3BLSA 2QZ6A 1QMFA 2XLNA 1PW1A 1L0FA 5HAQA 1L0EA 3UDXA 1C3BA 3IXGA 4EV4A 3OPRA 4WM9A 3PAEA 3PTEA 4PPRA 1I2WA 1MWUA 3UE3A 4EBPA 3MXRA 1SKFA 2OSUA 4OQGA 2IWDA 4S2MA 1LL9A 4ZBEA 4OOYA 2DNSA 3IXBA 1XXMA 1MXOA 4EWFA 3PBQA 1JTGA 1ONHA 3BYDA 4KQRA 1N9BA 4X68A 1G68A 4FH4A 5TGFA 4C75A 1IYSA 1W8YA 1MPLA 1MWSA 2ZMAA 2I72A 1IKIA 3OCLA 5E2FA 1BSGA 5AQAA 4CPKA 5GL9A 3HREA 5FQ9A 2EXAA 2QPNA 2WAFA 1BLCA 3UE1A 4OPYA 1K25A 1JVJA 1PYYA 2E8IA 2Y2KA 5DF7A 4ZDXA 4B4XA 4IEDA 4BL3A 3EQUA 4DXBA 4S2JA 2ZD8A 4BL2A 2EFUA 3IF6C 3GRJA 4OKPA 4HBUA 4S2NA 3DTMA 1KE4A 1PI4A 1WYBA 1M6KA 1WE4A 4IVKA 3RXXA 5HW3A 4JF6A 3PBRA 2Y2PA 5FAOA 3IH8A 2FFYA 4KZAA 5FQKA 2G2UA 4JBFA 3BFCA 1BULA 3ZG9B 1ESUA 3IWOA 4E3KA 4EBLA 4R3JA 5CTMA 5FI7A 2UWXA 4GZBA 3S1YA 3UPPA 1XX2A 2EFXA 3OCNA 1JWZA 4WMCA 1K55C 1YLWA 3V3RA 3VOZA 3N8LA 4DDYA 3MZDA 4BJPA 5E43A 1YQSA 4KG6A 2VGJA 3UDIA 2WYXA 4BD0A 3Q1FA 4MLLA 4GD8A 3ZG7B 1TVFA 2HDSA 4OPZA 3HLGA 4GKUA 4IBXA 4KZ5A 3BLMA 4KENB 5GLAA 4E6XA 1N4OA 1NJ4A 1PIOA 4DE3A 5CECA 1W8QA 4XUXA 4U3TA 3ZCZA 1FR6A 3ITAA 5CXWA 1H5XA 1RP5A 1LLBA 2XR0A 3TOIA 1KE0A 3SH7A 4B4ZA 3OPPA 3VP1A 4R4RA 1DY6A 2A3UA 2HP5A 2Y2JA 3QNCA 1K4EA 3GR2A 1XPBA 4QJGA 1HVBA 1KGGA 4OLGA 4KZ6A 3HUNA 3A3DA 2ZM2A 2Y91A 4KG5A 2ZC7A 4X53A 1Y54A 4DE1A 3ZG8B 3WS5A 1RGZA 4MBHA 4ZTKA 5DF8A 3VOYA 2Y2GA 2H5SA 4BENA 4ID4A 1Z6FA 1IYPA 2A49A 2DCFA 3WWXA 4GN2A 1YM1A 1K57A 3W8KA 1FCMA 1S6RA 2C5WB 2Y2HA 3PBTA 2WGWA 3BM6A 2ZQ9A 1KVMA 3UN7A 1RGYA 3IWIA 3SS3A 4DDSA 3BFFA 4B88A 4OP8A 1W7FA 2PU4A 4GOGA 4N1HA 2XH9A 3GTCA 3Q7VB 4KZ8A 1CI8A 4XUZA 5TFQA 3IHBA 4F94A 2Q9NA 1GA9A 4LCMA 5AQBA 3I7JA 3O88A 2ZC4B 1XGIA 2P74A 3C4OA 3NCKA 3HLCA 1E3UD 1BUEA 2CC1A 2ZQDA 1L0GA 1K6RA 5FA7A 5A90A 2EXBA 3P98A 3TSGA 4N9KA 5M19A 3LY3A 3AGFA 3HBRA 2WUQA 2Y2QA 1NZUA 4E3IA 3LY4A 1H8ZA 4LV3A 3VFFA 5DTSA 5EE8A 4X69A 4OOLA 5KZHA 2WKEA 3PBOA 2JE5A 3C7UA 4JPMA 4ZJ2A 1L2SA 3A3IA 1H8YA 2P9VB 5CGXA 1LI0A 3CZDA 4S2PA 5EECA 1GHPA 3HLFA 3FYZA 2Z2MB 1ONGA 3SS5A 3BEBA 4R0QA 1FSWA 2XEPA 1GA0A 5EVIB 5HAPA 4LENA 1BZAA 3G4PA 1YMXA 5FQJA 3BFDA 3FKWA 3SH8A 4WZ5A 3HUOA 2Y2MA 4XXRA 1DJAA 3V3SA 3DWZA 4WEKA 5EPHA 4E6WA 5F1FA 4FCFA 1BT5A 4Y0OA 5CGSA 3QNBA 1IKGA 1KDSA 1CEGA 2X02A 5F83A 4DXCA 3Q7ZA 1NYYA 4UHUA 1ES5A 5GLDA 4MEZA 1LL5A 2IWCA 2XK1A 3G34A 4S2OA 2JCHA 3NC8A 1NYMA 4P87A 1O7EA 3BECA 4PM6A 3UY6A 1IELA 4KZ9A 3M6BA 3S22A 1HTZA 2HPBA 2R9WA 4KZ3A 3UPOA 3HL9A 4YINA 1NRFA 1ALQA 5HL1A 3ZDJA 2WGVA 1XA7A 3SH9A 2BG1A 1ZC2A 4DE2A 5HFOA 5M18A 2WAEA 4NETA 4IBRA 2G2WA 4S2NC 4X56A 4WBGA 3OC2A 2ZM0A 4WMCD 4JKTA 4OPQA 2XD1A 1K54A 4E3OA 3NI9A 3IF6B 4QY5A 5FASA 3M2KA 5CERA 3HLEA 1ERMA 5EOOA 4OQ0A 1RCJA 4R23A 5KSHA 5A92A 4OVDA 4UA9A 4EBNA 1KE3A 1VQQA 1XGJA 3EQVA 3MZEA 5TR7A 2ZM8A 1Q2PA 1W79A 3VP2A 5J8XA 2JBFA 1HD8A 3V5MA 3S4XA 5KSCA 2Q9MA 1KGFA 1YMSA 3N8SA 2J7VA 5E2EA 1MWRA 2Y2IA 3IWQA 1GHMA 3MXSA 1WYCA 5CHMA 1K4FA 3W4QA 5GHXA 5DF9A 5E2HA 1IEMA 4MNRA 5CHJA 4QHCA 1L0DA 3BFGA 4ZAMA 3ITBA 3MBZA 4GDNA 4PM5A 4JF4A 4UAAA 3BRMA 3WS4A 2J8YA 5BOHA 3M2JA 4K91A 2IWBA 5FDHA 1FCOA 4JLFA 5HAIA 1GCEA 4N1XA 3PBNA 2OLUA 4KQQA 4PM7A 3P09A 2PU2A 3JYIA 4BQMA 2XF3A 3A3JA 4R3BA 5FQQA 4JXGA 4CJNA 2B5RA 4DKIA 5E2GA 4ZJ3A 3VSKA 1MWTA 1K57C 3CJMA 3BFEA 3MFDA 2OV5A 3V50A 1PW8A 2XD5A 1MBLA 3RXWA 2Y2LA 1IYQA 1XA1A 3GV9A 1YLZA 5CTNA 5GHZA 4EUZA 3O86A 1NZOA 2WZZA 1TDGA 2Y55A 3IXDA 2ZQCA 5GLCA 3MKFA 3G35A 5U47A 3VFHA 1I5QA 1XKZA 5M1AA 3UO9A 3CMZA 4DE0A 3SS4A 4Q8IA 2H0TA 4P0MA 1J9MA 1FQGA 5I94A 2WADA 2ZC3B 1BLSA 3Q7VA 1FCNA 5CGWA 5FQIA 1YLPA 4OQHA 4QB8A 3NDGA 4KZ4A 3N4IA 3NBLA 4Y0UA 2OLVA 2FFFB 2EX2A 2GDNA 4X6TA 1O07A 1JWVA 5F1GA 3V39A 3ZNTA 1ES3A 3TG9A 1YT4A 3NDEA 1E4DA 4IVIA 4C3QA 3D4FA 1FOFA 3QHYA 4HESA 4DRTA 5L2FA 5HX9A 3IF5A 1HZOA 3LO7A 4U0TA 1EWZA 4ZJ1A 1MY8A 1SHVA 1ZG4A 4K0WA 4D2OA 3N8RA 3C4PA 4OOMA 5EVID 1FSYA 1YLYA 1ES4A 1K6SA 5D3OA 3WRTA 4Y0TA 1ZG6A 4WZ5C 1OMEA 3G2YA 4E3MA 4RA7A 1ZKJA 1BTLA 2P9VA 1JTDA 2ZLYA 3G32A 3ZG5A 3B3XA 3VSLA 4OPRA 2WKIA 1CI9A 1SDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MKE A;  3O3V A;  5AQ9 A;  3M6H A;  5FAT A;  5IHV A;  4E3L A;  4M3K A;  1GHI A;  5JYP A;  4MBK A;  3W4P A;  4OH0 A;  3ZHH A;  4E3N A;  2RL3 A;  2JC7 A;  2QMI A;  4PMA A;  3WRZ A;  1TDL A;  1IYO A;  5EUA A;  4MBF A;  1ERQ A;  1KGE A;  4RX2 A;  3PAG A;  2Y2N A;  4KG2 A;  3OZH A;  1YLJ A;  1DJB A;  3PBS A;  2EX6 A;  3Q81 A;  2H10 A;  5FQM A;  2ZJ9 A;  4FH2 A;  4Z9Q A;  2BLS A;  2WGI A;  2ZQA A;  3MZF A;  3AGE A;  3GQZ A;  1KVL A;  1YLT A;  3N6I A;  5A91 A;  3WS2 A;  1PWC A;  3E2K A;  1K54 C;  5CRF A;  4U0X A;  4E3J A;  1U60 A;  1K38 A;  5FAQ A;  4WEJ A;  5GLB A;  3HVF A;  4L0L A;  5A93 A;  3A3F A;  4BD1 A;  3ISG A;  3ZG0 A;  2HP9 A;  3VMA A;  1E25 A;  3UDF A;  3CG5 A;  4QD4 A;  1S0W A;  1M40 A;  3IF6 A;  1LI9 A;  4GNU A;  2WK0 A;  2Y4A A;  1PZP A;  3W4O A;  3VP4 A;  3GVB A;  4KZB A;  2C6W B;  4H8R A;  5GHY A;  2J9O A;  2Y59 A;  4KQO A;  3FV7 A;  3HLD A;  4WEL A;  5FAP A;  2ZC5 B;  5HAR A;  4FD8 A;  5DVA A;  4YFM A;  3E2L A;  1CEF A;  3GSG A;  5F82 A;  1EI5 A;  2Y2O A;  3O87 A;  1Q2Q A;  3VP0 A;  1K55 A;  4PM8 A;  3UPN A;  5EOE A;  5EVI A;  3IQA A;  1JWP A;  2EX9 A;  2HDU A;  1VM1 A;  1FR1 A;  1PWG A;  5FI2 A;  4LV0 A;  5EVL A;  1QME A;  4QU3 A;  3G30 A;  3Q82 A;  2XFS A;  4DF6 A;  3IH9 A;  4GB7 A;  1MKI A;  4RVA A;  4HEF A;  2ZC6 B;  4WZ4 A;  3WS1 A;  3FWL A;  5CEB A;  4C6Y A;  4OLD A;  3HLB A;  4S2K A;  4OON A;  3WS0 A;  4GD6 A;  3AGD A;  1I2S A;  2H0Y A;  4A5R A;  4NK3 A;  3ZVT A;  3N7W A;  3C5A A;  3IT9 A;  2HDR A;  4PM9 A;  1ESI A;  4P6B A;  3OPL A;  4N9L A;  2X01 A;  4RYE A;  3FKV A;  4GDB A;  2HP6 A;  4LV2 A;  1SCW A;  1K56 D;  4UA6 A;  2WGW B;  3VP3 A;  1ES2 A;  4OP5 A;  4BLM A;  4EQI A;  2XGN A;  2WZX A;  2V1Z A;  2XQZ A;  3G2Z A;  4JXV A;  2X71 A;  2V20 A;  4X55 A;  2XFT A;  1PWD A;  1NY0 A;  1NXY A;  1K56 A;  5CED A;  4O7D A;  4FSF A;  4JXS A;  4OQI A;  1SDN A;  5FI6 A;  3FZC A;  4KZ7 A;  4Y7P A;  1BLH A;  3HLW A;  4R4S A;  4JF5 A;  4RX3 A;  1KDW A;  2ZQ8 A;  1PZO A;  3SOI A;  3A3E A;  5G18 A;  2ZQ7 A;  3DW0 A;  4LV1 A;  2V2F F;  2HDQ A;  1TEM A;  2J9P A;  2Z2L B;  3IXH A;  4K0X A;  2RCX A;  1DJC A;  5JYO A;  3RJU A;  4S2I A;  1ERO A;  3LEZ A;  1PI5 A;  4WYY A;  2XDM A;  3UE0 A;  5FSR A;  3OPH A;  5CHU A;  1AXB A;  2VGK A;  5DTT A;  1LHY A;  3DWK A;  1W5D A;  2WKH A;  2DRW A;  1BLP A;  4P85 A;  4N92 A;  3HUM A;  4UA7 A;  2EX8 A;  4LCL A;  3UNW A;  5AQ7 A;  3NY4 A;  2PBY A;  1E3U A;  3C7V A;  4HBT A;  3ZGA B;  3NIA A;  3ZNY A;  5EVI C;  4JXW A;  3G31 A;  3ZFZ A;  4R1G A;  2R9X A;  3GMW A;  3LCE A;  3ZVW A;  1CK3 A;  4QY6 A;  1G6A A;  5DTK A;  3Q07 A;  1XP4 A;  5KMW A;  3IHA A;  4S2L A;  3BLS A;  2QZ6 A;  1QMF A;  2XLN A;  1PW1 A;  1L0F A;  5HAQ A;  1L0E A;  3UDX A;  1C3B A;  3IXG A;  4EV4 A;  3OPR A;  4WM9 A;  3PAE A;  3PTE A;  4PPR A;  1I2W A;  1MWU A;  3UE3 A;  4EBP A;  3MXR A;  1SKF A;  2OSU A;  4OQG A;  2IWD A;  4S2M A;  1LL9 A;  4ZBE A;  4OOY A;  2DNS A;  3IXB A;  1XXM A;  1MXO A;  4EWF A;  3PBQ A;  1JTG A;  1ONH A;  3BYD A;  4KQR A;  1N9B A;  4X68 A;  1G68 A;  4FH4 A;  5TGF A;  4C75 A;  1IYS A;  1W8Y A;  1MPL A;  1MWS A;  2ZMA A;  2I72 A;  1IKI A;  3OCL A;  5E2F A;  1BSG A;  5AQA A;  4CPK A;  5GL9 A;  3HRE A;  5FQ9 A;  2EXA A;  2QPN A;  2WAF A;  1BLC A;  3UE1 A;  4OPY A;  1K25 A;  1JVJ A;  1PYY A;  2E8I A;  2Y2K A;  5DF7 A;  4ZDX A;  4B4X A;  4IED A;  4BL3 A;  3EQU A;  4DXB A;  4S2J A;  2ZD8 A;  4BL2 A;  2EFU A;  3IF6 C;  3GRJ A;  4OKP A;  4HBU A;  4S2N A;  3DTM A;  1KE4 A;  1PI4 A;  1WYB A;  1M6K A;  1WE4 A;  4IVK A;  3RXX A;  5HW3 A;  4JF6 A;  3PBR A;  2Y2P A;  5FAO A;  3IH8 A;  2FFY A;  4KZA A;  5FQK A;  2G2U A;  4JBF A;  3BFC A;  1BUL A;  3ZG9 B;  1ESU A;  3IWO A;  4E3K A;  4EBL A;  4R3J A;  5CTM A;  5FI7 A;  2UWX A;  4GZB A;  3S1Y A;  3UPP A;  1XX2 A;  2EFX A;  3OCN A;  1JWZ A;  4WMC A;  1K55 C;  1YLW A;  3V3R A;  3VOZ A;  3N8L A;  4DDY A;  3MZD A;  4BJP A;  5E43 A;  1YQS A;  4KG6 A;  2VGJ A;  3UDI A;  2WYX A;  4BD0 A;  3Q1F A;  4MLL A;  4GD8 A;  3ZG7 B;  1TVF A;  2HDS A;  4OPZ A;  3HLG A;  4GKU A;  4IBX A;  4KZ5 A;  3BLM A;  4KEN B;  5GLA A;  4E6X A;  1N4O A;  1NJ4 A;  1PIO A;  4DE3 A;  5CEC A;  1W8Q A;  4XUX A;  4U3T A;  3ZCZ A;  1FR6 A;  3ITA A;  5CXW A;  1H5X A;  1RP5 A;  1LLB A;  2XR0 A;  3TOI A;  1KE0 A;  3SH7 A;  4B4Z A;  3OPP A;  3VP1 A;  4R4R A;  1DY6 A;  2A3U A;  2HP5 A;  2Y2J A;  3QNC A;  1K4E A;  3GR2 A;  1XPB A;  4QJG A;  1HVB A;  1KGG A;  4OLG A;  4KZ6 A;  3HUN A;  3A3D A;  2ZM2 A;  2Y91 A;  4KG5 A;  2ZC7 A;  4X53 A;  1Y54 A;  4DE1 A;  3ZG8 B;  3WS5 A;  1RGZ A;  4MBH A;  4ZTK A;  5DF8 A;  3VOY A;  2Y2G A;  2H5S A;  4BEN A;  4ID4 A;  1Z6F A;  1IYP A;  2A49 A;  2DCF A;  3WWX A;  4GN2 A;  1YM1 A;  1K57 A;  3W8K A;  1FCM A;  1S6R A;  2C5W B;  2Y2H A;  3PBT A;  2WGW A;  3BM6 A;  2ZQ9 A;  1KVM A;  3UN7 A;  1RGY A;  3IWI A;  3SS3 A;  4DDS A;  3BFF A;  4B88 A;  4OP8 A;  1W7F A;  2PU4 A;  4GOG A;  4N1H A;  2XH9 A;  3GTC A;  3Q7V B;  4KZ8 A;  1CI8 A;  4XUZ A;  5TFQ A;  3IHB A;  4F94 A;  2Q9N A;  1GA9 A;  4LCM A;  5AQB A;  3I7J A;  3O88 A;  2ZC4 B;  1XGI A;  2P74 A;  3C4O A;  3NCK A;  3HLC A;  1E3U D;  1BUE A;  2CC1 A;  2ZQD A;  1L0G A;  1K6R A;  5FA7 A;  5A90 A;  2EXB A;  3P98 A;  3TSG A;  4N9K A;  5M19 A;  3LY3 A;  3AGF A;  3HBR A;  2WUQ A;  2Y2Q A;  1NZU A;  4E3I A;  3LY4 A;  1H8Z A;  4LV3 A;  3VFF A;  5DTS A;  5EE8 A;  4X69 A;  4OOL A;  5KZH A;  2WKE A;  3PBO A;  2JE5 A;  3C7U A;  4JPM A;  4ZJ2 A;  1L2S A;  3A3I A;  1H8Y A;  2P9V B;  5CGX A;  1LI0 A;  3CZD A;  4S2P A;  5EEC A;  1GHP A;  3HLF A;  3FYZ A;  2Z2M B;  1ONG A;  3SS5 A;  3BEB A;  4R0Q A;  1FSW A;  2XEP A;  1GA0 A;  5EVI B;  5HAP A;  4LEN A;  1BZA A;  3G4P A;  1YMX A;  5FQJ A;  3BFD A;  3FKW A;  3SH8 A;  4WZ5 A;  3HUO A;  2Y2M A;  4XXR A;  1DJA A;  3V3S A;  3DWZ A;  4WEK A;  5EPH A;  4E6W A;  5F1F A;  4FCF A;  1BT5 A;  4Y0O A;  5CGS A;  3QNB A;  1IKG A;  1KDS A;  1CEG A;  2X02 A;  5F83 A;  4DXC A;  3Q7Z A;  1NYY A;  4UHU A;  1ES5 A;  5GLD A;  4MEZ A;  1LL5 A;  2IWC A;  2XK1 A;  3G34 A;  4S2O A;  2JCH A;  3NC8 A;  1NYM A;  4P87 A;  1O7E A;  3BEC A;  4PM6 A;  3UY6 A;  1IEL A;  4KZ9 A;  3M6B A;  3S22 A;  1HTZ A;  2HPB A;  2R9W A;  4KZ3 A;  3UPO A;  3HL9 A;  4YIN A;  1NRF A;  1ALQ A;  5HL1 A;  3ZDJ A;  2WGV A;  1XA7 A;  3SH9 A;  2BG1 A;  1ZC2 A;  4DE2 A;  5HFO A;  5M18 A;  2WAE A;  4NET A;  4IBR A;  2G2W A;  4S2N C;  4X56 A;  4WBG A;  3OC2 A;  2ZM0 A;  4WMC D;  4JKT A;  4OPQ A;  2XD1 A;  1K54 A;  4E3O A;  3NI9 A;  3IF6 B;  4QY5 A;  5FAS A;  3M2K A;  5CER A;  3HLE A;  1ERM A;  5EOO A;  4OQ0 A;  1RCJ A;  4R23 A;  5KSH A;  5A92 A;  4OVD A;  4UA9 A;  4EBN A;  1KE3 A;  1VQQ A;  1XGJ A;  3EQV A;  3MZE A;  5TR7 A;  2ZM8 A;  1Q2P A;  1W79 A;  3VP2 A;  5J8X A;  2JBF A;  1HD8 A;  3V5M A;  3S4X A;  5KSC A;  2Q9M A;  1KGF A;  1YMS A;  3N8S A;  2J7V A;  5E2E A;  1MWR A;  2Y2I A;  3IWQ A;  1GHM A;  3MXS A;  1WYC A;  5CHM A;  1K4F A;  3W4Q A;  5GHX A;  5DF9 A;  5E2H A;  1IEM A;  4MNR A;  5CHJ A;  4QHC A;  1L0D A;  3BFG A;  4ZAM A;  3ITB A;  3MBZ A;  4GDN A;  4PM5 A;  4JF4 A;  4UAA A;  3BRM A;  3WS4 A;  2J8Y A;  5BOH A;  3M2J A;  4K91 A;  2IWB A;  5FDH A;  1FCO A;  4JLF A;  5HAI A;  1GCE A;  4N1X A;  3PBN A;  2OLU A;  4KQQ A;  4PM7 A;  3P09 A;  2PU2 A;  3JYI A;  4BQM A;  2XF3 A;  3A3J A;  4R3B A;  5FQQ A;  4JXG A;  4CJN A;  2B5R A;  4DKI A;  5E2G A;  4ZJ3 A;  3VSK A;  1MWT A;  1K57 C;  3CJM A;  3BFE A;  3MFD A;  2OV5 A;  3V50 A;  1PW8 A;  2XD5 A;  1MBL A;  3RXW A;  2Y2L A;  1IYQ A;  1XA1 A;  3GV9 A;  1YLZ A;  5CTN A;  5GHZ A;  4EUZ A;  3O86 A;  1NZO A;  2WZZ A;  1TDG A;  2Y55 A;  3IXD A;  2ZQC A;  5GLC A;  3MKF A;  3G35 A;  5U47 A;  3VFH A;  1I5Q A;  1XKZ A;  5M1A A;  3UO9 A;  3CMZ A;  4DE0 A;  3SS4 A;  4Q8I A;  2H0T A;  4P0M A;  1J9M A;  1FQG A;  5I94 A;  2WAD A;  2ZC3 B;  1BLS A;  3Q7V A;  1FCN A;  5CGW A;  5FQI A;  1YLP A;  4OQH A;  4QB8 A;  3NDG A;  4KZ4 A;  3N4I A;  3NBL A;  4Y0U A;  2OLV A;  2FFF B;  2EX2 A;  2GDN A;  4X6T A;  1O07 A;  1JWV A;  5F1G A;  3V39 A;  3ZNT A;  1ES3 A;  3TG9 A;  1YT4 A;  3NDE A;  1E4D A;  4IVI A;  4C3Q A;  3D4F A;  1FOF A;  3QHY A;  4HES A;  4DRT A;  5L2F A;  5HX9 A;  3IF5 A;  1HZO A;  3LO7 A;  4U0T A;  1EWZ A;  4ZJ1 A;  1MY8 A;  1SHV A;  1ZG4 A;  4K0W A;  4D2O A;  3N8R A;  3C4P A;  4OOM A;  5EVI D;  1FSY A;  1YLY A;  1ES4 A;  1K6S A;  5D3O A;  3WRT A;  4Y0T A;  1ZG6 A;  4WZ5 C;  1OME A;  3G2Y A;  4E3M A;  4RA7 A;  1ZKJ A;  1BTL A;  2P9V A;  1JTD A;  2ZLY A;  3G32 A;  3ZG5 A;  3B3X A;  3VSL A;  4OPR A;  2WKI A;  1CI9 A;  1SDE A; 
#chains in the Genus database with same CATH topology
 4M3K A;  4ETZ A;  3W4P A;  3ZHH A;  3CHW P;  4OH0 A;  4I3J A;  4PMA A;  3WRZ A;  1DJB A;  2P08 A;  3PBS A;  3LIA A;  4R70 A;  3NHQ A;  5AVE A;  2PDR A;  1U60 A;  4L0L A;  1P0Z A;  3F1N B;  4D60 A;  3NOU C;  3VV4 A;  3D3O A;  2HP9 A;  3GVB A;  4KZB A;  4H8R A;  3ZYT A;  5GHY A;  2EA9 A;  2XSS A;  3UMD A;  3CIT A;  1CEF A;  2ZMF A;  5F82 A;  4IUH A;  3LIC A;  1EI5 A;  2M7V A;  3UPN A;  3O5Y A;  5EOE A;  3IQA A;  1VM1 A;  1T1B A;  1FR1 A;  1QME A;  2ZL1 A;  3G30 A;  3Q82 A;  2XFS A;  4DF6 A;  3F1O A;  3F1P A;  2LB9 A;  4G3V A;  1MKI A;  2WKR A;  4P6Z M;  4RVA A;  4HEF A;  4OLD A;  3HLB A;  4S2K A;  2W3G A;  3BWL A;  4A5R A;  2H0Y A;  4RQ9 A;  4NK3 A;  3C5A A;  4N9L A;  1LSV A;  2WGW B;  4EU0 A;  3VP3 A;  4JXS A;  4OQI A;  4KUO A;  4JGR A;  4KZ7 A;  2P7J A;  4RX3 A;  1KDW A;  3T1R A;  5G18 A;  2GZA A;  2ZQ7 A;  2BAS A;  4GS9 B;  5FL3 A;  1OTB A;  3JPU A;  4NKP A;  2XDM A;  4PHT A;  3OPH A;  1S4R A;  2VGK A;  3DWK A;  1F2K A;  3E0Y A;  5A8B A;  4LCL A;  3H82 B;  1YSP A;  5EVI C;  4JXW A;  5DTK A;  1XP4 A;  3DTI A;  2XLN A;  1PW1 A;  1S66 L;  1L0E A;  1C3B A;  2JKT M;  2JKG A;  3UE3 A;  3KYQ A;  1SKF A;  2IWD A;  4GW9 A;  2MJ6 A;  4G3K A;  1N9B A;  1MPL A;  1MWS A;  3OCL A;  5E2F A;  1BSG A;  2YKH A;  3HRE A;  1G6O A;  5G4Y A;  2WAF A;  4HOI A;  5DF7 A;  3BW6 A;  4B4X A;  2KX6 A;  4S2J A;  3IF6 C;  1KE4 A;  5EFW A;  1WE4 A;  3F1N A;  3PR6 A;  5FAO A;  3IH8 A;  1OJ5 A;  3D9Y A;  2VV7 A;  3BFC A;  1BUL A;  2AVX A;  4E3K A;  2I9V A;  1D7E A;  1K55 C;  3V3R A;  4GJ4 A;  4BJP A;  3UDI A;  2WYX A;  3DTK A;  3Q1F A;  1TVF A;  3BLM A;  1FR6 A;  1H5X A;  1LLB A;  1KE0 A;  2KLI A;  1DY6 A;  2A3U A;  3P01 A;  3QNC A;  1K4E A;  4QJG A;  1XPB A;  1HVB A;  1KGG A;  2ZM2 A;  3T4O A;  4KG5 A;  4X53 A;  1Y54 A;  5DF8 A;  2H5S A;  4M4X A;  4GLQ A;  4GN2 A;  4BWI A;  2K31 A;  2Y2H A;  2WGW A;  1KVM A;  3IWI A;  3SS3 A;  4DDS A;  3BFF A;  4B88 A;  4I3A A;  3C2W A;  4PAU A;  2PU4 A;  1N9O A;  4KZ8 A;  1CI8 A;  4XUZ A;  3IHB A;  2Q9N A;  3O88 A;  3TE8 A;  2P74 A;  2CC1 A;  4F3L B;  2EXB A;  5LBR A;  3TSG A;  4GS9 A;  4WF0 A;  1T19 A;  4N9K A;  5M19 A;  2WUQ A;  5HL6 A;  5EE8 A;  2JE5 A;  4JPM A;  5DJT A;  4DMZ A;  1XJ6 A;  2QJ5 A;  4HH2 A;  2L0W A;  3BEB A;  1NRJ A;  1FSW A;  2XEP A;  3H82 A;  5EVI B;  3LIE A;  3KSF A;  1LSX A;  2PHY A;  5FQJ A;  3SH8 A;  3L9K A;  4XXR A;  5HWV A;  5F1F A;  5CGS A;  3LR4 A;  2VV6 A;  5F69 A;  4HY8 A;  5F83 A;  4UHU A;  2E8J A;  2XK1 A;  2JCH A;  1GSW A;  1NYM A;  3UY6 A;  2CMN A;  1HTZ A;  5TBM B;  3FPV A;  5I5L A;  3ZDJ A;  1XFQ A;  1XA7 A;  2BG1 A;  5HFO A;  5HWW A;  2HJ9 C;  4NET A;  1VET B;  4X56 A;  3LYX A;  1J3W A;  4WBG A;  3OC2 A;  2ZM0 A;  4JKT A;  3IF6 B;  4QY5 A;  2VA0 A;  1TS6 A;  4Y15 A;  4OVD A;  4UA9 A;  4EBN A;  1KE3 A;  1XGJ A;  1W79 A;  1HD8 A;  2J3T C;  3S4X A;  4KQD A;  1KGF A;  5DFY A;  2Y2I A;  1WYC A;  3PYP A;  5CHM A;  2O9B A;  5GHX A;  5E2H A;  3TJZ C;  3K2N A;  3BFG A;  4MCW A;  4PM5 A;  5DFX A;  2J8Y A;  2PYR A;  5FDH A;  3EGD C;  1FCO A;  4JLF A;  2OOL A;  3B47 A;  2PU2 A;  4R3B A;  4DKI A;  4CJN A;  3EGX C;  2NUP C;  1AWI A;  3UB5 P;  1MWT A;  1PW8 A;  2HGV A;  5MC7 A;  4HP9 A;  1XA1 A;  4UQI M;  1DP8 A;  1NZO A;  1W63 Q;  2QJ7 A;  1TDG A;  3VOL A;  3BQA A;  3MKF A;  3VFH A;  3UO9 A;  5M1A A;  4B93 A;  4Q8I A;  3CMZ A;  3SS4 A;  5IT5 A;  2H0T A;  4P0M A;  1J9M A;  1BLS A;  5HWT A;  3NDG A;  4KZ4 A;  4IJG A;  3NBL A;  4Y0U A;  1S1Z A;  4I39 A;  2EX2 A;  1O07 A;  2O9A A;  5F1G A;  1XJ4 A;  2XRO A;  4YWZ A;  3TG9 A;  2FH5 A;  3NDE A;  4F3L A;  5L2F A;  3BY8 A;  4GHI B;  1EWZ A;  2ZOI A;  1OTD A;  4WLA A;  3WRT A;  1K0K A;  1IFQ A;  2K7S A;  4RA7 A;  1ZKJ A;  3E4P A;  4E3M A;  1JTD A;  3G32 A;  2M7U A;  1KOU A;  3UME A;  5EVI A;  3O3V A;  1OT6 A;  5FAT A;  4Q0I A;  2D02 A;  1A0K A;  1KGE A;  4RX2 A;  5HD3 A;  3KO6 A;  1YLJ A;  2J80 A;  4CLC C;  2EX6 A;  3Q81 A;  2H10 A;  2ZJ9 A;  2ZQA A;  3N6I A;  3FC7 A;  1T1C A;  5TBM A;  1PNE A;  4WEJ A;  1G28 A;  3IBR A;  5A93 A;  4FOF A;  4BD1 A;  3V67 A;  3UDF A;  3CG5 A;  1S4S A;  1MKM A;  1S0W A;  1M40 A;  3IF6 A;  1LI9 A;  4GNU A;  2WK0 A;  5HD5 A;  1CJF A;  3RTY A;  3MQO A;  1S67 L;  3HLD A;  5FAP A;  4EEU A;  5HAR A;  4YFM A;  3S7P A;  4Y17 A;  3O87 A;  1Q2Q A;  3VP0 A;  1K55 A;  4PM8 A;  3T4T A;  1JWP A;  1PWG A;  4LV0 A;  4LRX C;  1STZ A;  2ZC6 B;  3WS1 A;  3EEH A;  4OON A;  3AGD A;  3LI9 A;  3IT9 A;  1ESI A;  4P6B A;  1TD5 A;  2X01 A;  3QP5 A;  4RYE A;  2GJ3 A;  3FKV A;  4GDB A;  3CPT A;  4NXF A;  4LV2 A;  1K56 D;  1ES2 A;  3UB9 A;  3GEC A;  2XGN A;  2V1Z A;  1OTA A;  2V20 A;  1V9Y A;  5C5K A;  1ZTU A;  5CED A;  4HNB A;  4H6J B;  2B18 A;  4WN5 A;  4Y7P A;  1FIL A;  1BLH A;  3NJA A;  3HLW A;  1D1J A;  4O8G A;  1UWP X;  1X0O A;  3MF0 A;  3SOI A;  3A3E A;  2J9P A;  2PYP A;  3IXH A;  4K0X A;  1DJC A;  3LEZ A;  1PI5 A;  3UE0 A;  5CHU A;  2V8F A;  2DRW A;  4P85 A;  2EX8 A;  3ZGA B;  4GHI A;  3ZNY A;  4R1G A;  4WL9 A;  1N9L A;  3LCE A;  1CK3 A;  1G6A A;  4JGO A;  5KMW A;  2UV0 E;  3IHA A;  4S2L A;  5L8M A;  2QZ6 A;  1QMF A;  3IXG A;  4PPR A;  1I2W A;  3MXR A;  2OSU A;  5IU1 A;  2DNS A;  1MXO A;  1JTG A;  1LL8 A;  4CLC B;  3BYD A;  4KQR A;  1XFN A;  2ZMA A;  2I72 A;  1IKI A;  3MQ0 A;  4CPK A;  2EXA A;  1LT0 A;  3UE1 A;  4OPY A;  1K25 A;  2E8I A;  4DXB A;  3EQU A;  4BMW A;  4HBU A;  3MFX A;  3BQ8 A;  1OPX A;  5J7E A;  2JKR M;  3PBR A;  4KZA A;  1VHM A;  2G2U A;  3ZG9 B;  1ESU A;  4R3J A;  5FI7 A;  2UWX A;  2EFX A;  3OCN A;  2M1C A;  2PT7 A;  3KSG A;  3MZD A;  5F68 A;  4MLL A;  4GD8 A;  2W3E A;  3NOP C;  4OPZ A;  4EXO A;  3HLG A;  4E6X A;  4KEN B;  2V0U A;  5GLA A;  5CEC A;  1DP9 A;  1W8Q A;  3ZCZ A;  3ITA A;  3OBF A;  2XR0 A;  3TOI A;  4B4Z A;  3C30 A;  1P9W A;  3HUN A;  2Y91 A;  3WS5 A;  1RGZ A;  4HJ4 A;  4BEN A;  1NWZ A;  1Z6F A;  4EES A;  1FCM A;  3BM6 A;  2ZQ9 A;  4OP8 A;  3TRC A;  5FDS A;  1OTI A;  4GOG A;  4N1H A;  3Q7V B;  4H6J A;  2VGL S;  3SZT A;  1E3U D;  3LY3 A;  3AGF A;  1NZU A;  4E3I A;  4X69 A;  4OOL A;  4X25 A;  3CAX A;  3PBO A;  2V1B A;  4ZJ2 A;  2VLG A;  2P9V B;  4K08 A;  4S2P A;  3FYZ A;  3SS5 A;  2JKT I;  3L7H A;  5HAP A;  5J4E A;  1GSX A;  3DTE A;  4IUK A;  3BFD A;  3FKW A;  3EEA A;  3R4K A;  4P6Z S;  2Y2M A;  3E4O A;  3V3S A;  3DWZ A;  5EPH A;  4FCF A;  1BT5 A;  3A0R A;  1KDS A;  4DXC A;  3Q7Z A;  1ES5 A;  4S2O A;  3NC8 A;  1IEL A;  2V9A A;  2R9W A;  4YIN A;  1NRF A;  4CLC A;  3SH9 A;  4R6L A;  5M18 A;  4IBR A;  4B9O A;  4WMC D;  3OLO A;  5FEG A;  5FAS A;  3M2K A;  3CI6 A;  2PAV P;  3HLE A;  1ERM A;  4HI4 A;  4OQ0 A;  1UWN X;  5KSH A;  3EQV A;  3B33 A;  1XJ3 A;  2Q9M A;  5E2E A;  3N8S A;  4HJ6 A;  2J7V A;  3MS6 A;  4JGP A;  4CLC E;  4QHC A;  1L0D A;  4ZAM A;  3BRM A;  4MN7 A;  2IWB A;  2OLU A;  4PM7 A;  2XF3 A;  2W3H A;  4ZJ3 A;  2NUT C;  2P04 A;  2B02 A;  3BFE A;  3EWK A;  3LFV A;  2XD5 A;  3K3C A;  5HSQ A;  3RXW A;  2Y2L A;  4AFI A;  1YLZ A;  5CTN A;  4EUZ A;  5F6A A;  3QP6 A;  1YKD A;  3O86 A;  2WZZ A;  2VEA A;  4DE0 A;  1XKZ A;  3S7Q A;  4GCZ A;  1FIK A;  2WAD A;  3GDI A;  3Q7V A;  1FCN A;  2VV8 A;  5FQI A;  3S7N A;  2PRF A;  1JWV A;  1YT4 A;  2O99 A;  4DRT A;  3DBA A;  3KYZ A;  3IF5 A;  2Z6C A;  4U0T A;  3LO7 A;  5KIZ A;  4L9E A;  3T1X A;  4D2O A;  3C4P A;  2A24 B;  1K6S A;  3G2Y A;  1BTL A;  2P9V A;  1SZV A;  3ZG5 A;  1OTE A;  4OPR A;  1CI9 A;  3LIB A;  3MKE A;  5AQ9 A;  4O01 A;  3MXQ A;  5IHV A;  1H3Q A;  4E3L A;  5JYP A;  4MBK A;  5HZH A;  4LGW A;  3UB7 A;  5EUA A;  4MBF A;  1ERQ A;  2W1T B;  2Y2N A;  1TS7 A;  1MZU A;  3T1S A;  4ME4 A;  2WGI A;  1TS8 A;  3AGE A;  3GQZ A;  2JKF A;  3JVU A;  1PWC A;  4ARZ B;  1K54 C;  4U0X A;  3MMH A;  1F9I A;  3A3F A;  3ISG A;  3VMA A;  1E25 A;  2FZ0 A;  4QD4 A;  2PR6 A;  2Y4A A;  1PZP A;  3W4O A;  2C6W B;  2Y59 A;  3FV7 A;  4WEL A;  2OAP 1;  2ZC5 B;  4FD8 A;  2OAQ 1;  3E2L A;  3GSG A;  5EM1 A;  5CX7 A;  5HDC A;  4IHQ A;  4QU3 A;  1Z09 A;  3IH9 A;  4GB7 A;  2PD7 A;  2KDK A;  5CEB A;  4C6Y A;  3CWF A;  4GD6 A;  1P97 A;  3ZVT A;  4L9F A;  3N7W A;  5EV0 A;  2HDR A;  4PM9 A;  3OPL A;  5DKK A;  5L09 A;  2HP6 A;  1SCW A;  4UA6 A;  3IS2 B;  4OP5 A;  2WZX A;  2INW A;  4JXV A;  3HJK A;  2X71 A;  4X55 A;  3CUE C;  2XFT A;  2PD8 A;  1PWD A;  4FSF A;  2O0Y A;  4WUJ A;  1SDN A;  5FI6 A;  4HH3 A;  4R4S A;  4JF5 A;  4R38 A;  2ZQ8 A;  4EET B;  3BJN A;  1PZO A;  4LV1 A;  1TEM A;  2ZMV A;  2Z2L B;  2RCX A;  4EQ1 A;  3A0S A;  2EWW A;  1ERO A;  4BBT A;  4WYY A;  5FSR A;  1AXB A;  3FPW A;  1W5D A;  1BLP A;  4N92 A;  2V8C A;  3HUM A;  3UNW A;  3NY4 A;  1E3U A;  1Y28 A;  3C7V A;  2VK3 A;  2XA7 M;  3GMW A;  4QY6 A;  1L3L A;  2A24 A;  3QP8 A;  3Q07 A;  2G7U A;  2L4R A;  1ZHH B;  1L0F A;  4BBU A;  5HAQ A;  3OPR A;  4WM9 A;  1MWU A;  4EBP A;  3C38 A;  4OQG A;  3BY9 A;  4S2M A;  1LL9 A;  4HJ3 A;  4ZBE A;  4OOY A;  1XXM A;  3IBJ A;  1ONH A;  4X68 A;  5TGF A;  2W1T A;  1G68 A;  1V9Z A;  1W8Y A;  1P9R A;  5AQA A;  5GL9 A;  5DKL A;  5FQ9 A;  2QPN A;  4HIA A;  3RH8 B;  1VET A;  4UQI S;  1BLC A;  4ZDX A;  2O9C A;  1JVJ A;  2Y2K A;  4BL3 A;  4IED A;  1F5M A;  2ZOH A;  3GRJ A;  3NUL A;  4EER A;  3RXX A;  1ODV A;  5HW3 A;  3ULF A;  3G6O A;  1ACF A;  4I3I A;  5DJU A;  3IWO A;  3H7W B;  5CTM A;  3UPP A;  1JWZ A;  4WMC A;  1YLW A;  3VOZ A;  3N8L A;  4DDY A;  2HF6 A;  2R78 A;  4KG6 A;  5E43 A;  3HJI A;  4BD0 A;  2K2N A;  4PKY G;  2HDS A;  3K3D A;  4EUV A;  2OWH A;  2QKP A;  1G5U A;  2QYB A;  5F5Y A;  5CXW A;  1RP5 A;  3F1P B;  3LI8 A;  3SH7 A;  4NXE A;  4R4R A;  2Q0O A;  4MDZ A;  2HP5 A;  3GR2 A;  4OLG A;  1EW0 A;  3A3D A;  3R7W B;  1T18 A;  3PXP A;  2D01 A;  1UGU A;  4DE1 A;  3ZG8 B;  4ZTK A;  1IOU A;  2A49 A;  3WWX A;  1S6R A;  3IS2 A;  3UN7 A;  5L10 A;  1DP6 A;  2KOI A;  2XH9 A;  2L1M A;  3GTC A;  1VEU B;  5TFQ A;  4F94 A;  1GA9 A;  5AQB A;  4HHD A;  3KSH A;  4Y13 A;  4I5S A;  3NCK A;  3HLC A;  1S1Y A;  1K6R A;  2PBD P;  3P98 A;  4Y3I A;  4E04 A;  3VFF A;  5DTS A;  5KZH A;  5L07 A;  5AVF A;  1L2S A;  3A3I A;  1H8Y A;  5CGX A;  1LI0 A;  3CZD A;  3LID A;  1GHP A;  2V0W A;  1GA0 A;  4LEN A;  3HUO A;  1DJA A;  4E6W A;  1JNU A;  3QNB A;  2ZBB A;  3T12 B;  2X02 A;  4Q0J A;  3HCY A;  5GLD A;  4Q0H A;  3LIF A;  4PM6 A;  1O7E A;  3BEC A;  4KZ9 A;  3M6B A;  3T50 A;  2HPB A;  3UPO A;  1ALQ A;  4NXB A;  5HL1 A;  2J3W A;  2WAE A;  2JKR I;  2G2W A;  4S2N C;  2EWV A;  3LR0 A;  1K54 A;  2XD1 A;  4ZRR A;  3T4J A;  4JGQ A;  4CQH A;  1DRM A;  2VGL M;  1RCJ A;  1TS0 A;  1YAX A;  2H28 A;  2Z6D A;  4DJ3 A;  3MZE A;  1Q2P A;  3VP2 A;  3H7W A;  2JBF A;  5KSC A;  3UE6 A;  1YMS A;  1VB6 A;  1MWR A;  1GHM A;  4II7 A;  1H8M A;  2XRN A;  3MXS A;  3TW8 A;  4MNR A;  5CHJ A;  3E98 A;  3MBZ A;  4GDN A;  4JF4 A;  4UAA A;  3WS4 A;  3M2J A;  4K91 A;  3DAV A;  5HAI A;  1GSV A;  2WKQ A;  3PBN A;  4KQQ A;  3JYI A;  5FQQ A;  3A3J A;  4JXG A;  2DMW A;  3VSK A;  4NG2 A;  1K57 C;  3CJM A;  3R7W A;  4BBV A;  3MFD A;  1NLZ A;  4PKY A;  4QWO A;  1TF1 A;  3GV9 A;  5GHZ A;  1OJG A;  3CUE A;  3IXD A;  1F98 A;  4X1L A;  3G35 A;  1VEU A;  3QP4 A;  4QB8 A;  1CF0 A;  2OLV A;  2FFF B;  3V39 A;  4Y5F A;  3ZNT A;  1XJ2 A;  4IVI A;  4I38 A;  3QHY A;  4XT2 B;  1MY8 A;  1ZG4 A;  4K0W A;  2W0N A;  4OOM A;  5EVI D;  5FEF A;  1YLY A;  5D3O A;  4Y0T A;  1ZG6 A;  2YKF A;  4WZ5 C;  3KX0 X;  2ZLY A;  1SKO B;  2W27 A;  3KYE A;  1H0M A;  1SDE A;  3LUQ A;  4LRZ E;  3M6H A;  1Y4O A;  1GHI A;  2GX5 A;  4E3N A;  2RL3 A;  2JC7 A;  2QMI A;  1TDL A;  1IYO A;  4YOF A;  4EEP A;  3PAG A;  4KG2 A;  3OZH A;  2HV1 A;  2JN7 A;  4FH2 A;  5FQM A;  4Z9Q A;  2BLS A;  3MZF A;  1KVL A;  1YLT A;  5A91 A;  3P7N A;  3WS2 A;  4KUK A;  3E2K A;  2VZW A;  5CRF A;  2W1R A;  4E3J A;  1K38 A;  5FAQ A;  5GLB A;  3HVF A;  4FTX A;  3ZG0 A;  4ETX A;  5EVE A;  3VP4 A;  2J9O A;  3UB6 A;  4KQO A;  5DVA A;  3PHY A;  2Y2O A;  1N9N A;  2EX9 A;  2HDU A;  3CLO A;  5FI2 A;  5EVL A;  5HDD A;  2OWJ A;  4WZ4 A;  3FWL A;  4ESP A;  3WS0 A;  1I2S A;  1WA9 A;  4BLM A;  4EQI A;  2XQZ A;  3G2Z A;  4X1M A;  1NY0 A;  4L9G A;  1NXY A;  1K56 A;  4O7D A;  4O0P A;  3FZC A;  1OT9 A;  1PFL A;  4UEY A;  3ICY A;  1NLY A;  2PR5 A;  3DW0 A;  4HP4 A;  2V2F F;  2HDQ A;  1LSW A;  5JYO A;  3RJU A;  4S2I A;  5DTT A;  1LHY A;  4LLO B;  5TJJ A;  2WKH A;  3RFB A;  3T4K A;  4UA7 A;  5HDS A;  5AQ7 A;  2PBY A;  3OOV A;  4HBT A;  4XT2 A;  3NIA A;  3G31 A;  3ZFZ A;  2R9X A;  3ZVW A;  3LR5 A;  3BLS A;  5G4Z A;  2VJW A;  1SKO A;  3MJQ A;  3UDX A;  4EV4 A;  3PAE A;  3PTE A;  3IX4 A;  4EW7 A;  3MSH A;  3IXB A;  4NXG A;  4EWF A;  2V1A A;  3D72 A;  3PBQ A;  3NOT C;  4FH4 A;  4C75 A;  1IYS A;  3VE3 A;  1PYY A;  3T4L A;  2ZD8 A;  4BL2 A;  2EFU A;  2W3F A;  4OKP A;  4S2N A;  3DTM A;  2A2L A;  1PI4 A;  1WYB A;  1M6K A;  4IVK A;  4JF6 A;  2Y2P A;  3LR3 A;  2HJE A;  2FFY A;  5FQK A;  4JBF A;  4EBL A;  4GZB A;  3S1Y A;  1XX2 A;  2J3T D;  5K5B A;  1YQS A;  2VGJ A;  5J3W A;  2IA2 A;  3ZG7 B;  3NEC A;  4GKU A;  4IBX A;  4KZ5 A;  4DJ2 A;  1N4O A;  1NJ4 A;  1PIO A;  4DE3 A;  4LPZ A;  4XUX A;  2Y79 A;  4U3T A;  4MMN A;  3OPP A;  3VP1 A;  2Y2J A;  4LFU A;  4KZ6 A;  2W3D A;  1HLU P;  2ZC7 A;  3T4S A;  4MBH A;  3VOY A;  2Y2G A;  2HZ5 A;  4R3A A;  3CPT B;  4ID4 A;  1IYP A;  2DCF A;  3VE4 A;  3A0V A;  1YM1 A;  1K57 A;  3W8K A;  2C5W B;  3PBT A;  1RGY A;  3H9W A;  4Z1W A;  2QWS A;  3MR0 A;  1W7F A;  3E4Q A;  2ACG A;  1W63 M;  4YNR A;  4LCM A;  3I7J A;  4HQA A;  2ZC4 B;  3S7O A;  1XGI A;  1YPR A;  3C4O A;  3IX3 A;  1BUE A;  2ZQD A;  1L0G A;  5FA7 A;  5A90 A;  3SW1 A;  3HBR A;  2Y2Q A;  4LRY C;  3LY4 A;  3QP1 A;  1H8Z A;  4LV3 A;  3MQQ A;  1CQA A;  2WKE A;  3C7U A;  5EEC A;  3HLF A;  2Z2M B;  1ONG A;  4R0Q A;  4DN0 A;  1BZA A;  3G4P A;  1D06 A;  1YMX A;  4WZ5 A;  3QP2 A;  2VKS A;  4WEK A;  2JHE A;  1T1A A;  1PRQ A;  4Y0O A;  1IKG A;  5AJG A;  1YSQ A;  1CEG A;  1NYY A;  4MEZ A;  1LL5 A;  2IWC A;  3G34 A;  4P87 A;  4CLC D;  3S22 A;  4KZ3 A;  3HL9 A;  3IX8 A;  2WGV A;  4ARZ A;  2GNX A;  1ZC2 A;  4DE2 A;  3T1Q B;  2Y8H A;  3LGO A;  3KSI A;  4OPQ A;  4E3O A;  3NI9 A;  5CER A;  3EOI A;  5EOO A;  4NEE D;  4R23 A;  5A92 A;  4MN6 A;  1VQQ A;  2QHK A;  5TR7 A;  2ZM8 A;  3C8C A;  5J8X A;  3LEQ A;  3U2A A;  3V5M A;  3IWQ A;  4QPR A;  2B95 A;  2ZL1 B;  1K4F A;  3W4Q A;  3F1O B;  5DF9 A;  1IEM A;  2XA7 S;  2VX8 A;  2LB5 A;  3ITB A;  5BOH A;  2WKP A;  1GCE A;  4MN5 A;  4N1X A;  2BTF P;  3P09 A;  4BQM A;  2B5R A;  3U4L P;  5E2G A;  1MC0 A;  3UB8 A;  2OV5 A;  3V50 A;  1MBL A;  1IYQ A;  3B42 A;  4G3W A;  2Y55 A;  2ZQC A;  3T4Q A;  5GLC A;  5U47 A;  3ZQ5 A;  1I5Q A;  1BYW A;  1FQG A;  5I94 A;  2ZC3 B;  5CGW A;  1YLP A;  4OQH A;  3N4I A;  3FG8 A;  4X6T A;  2GDN A;  3JVV A;  4Y2F A;  5HPI A;  1ES3 A;  5HPF A;  1E4D A;  4C3Q A;  3D4F A;  1FOF A;  4HES A;  5HX9 A;  1HZO A;  4ZJ1 A;  5IS1 A;  1SHV A;  3N8R A;  1FSY A;  1ES4 A;  3W2Z A;  1OME A;  4FUW A;  3B3X A;  5EM0 A;  3VSL A;  2WKI A; 
#chains in the Genus database with same CATH homology
 3MKE A;  3O3V A;  5AQ9 A;  3M6H A;  5FAT A;  5IHV A;  4E3L A;  4M3K A;  1GHI A;  5JYP A;  4MBK A;  3W4P A;  4OH0 A;  3ZHH A;  4E3N A;  2RL3 A;  2JC7 A;  2QMI A;  4PMA A;  3WRZ A;  1TDL A;  1IYO A;  5EUA A;  4MBF A;  1ERQ A;  1KGE A;  4RX2 A;  3PAG A;  2Y2N A;  4KG2 A;  3OZH A;  1YLJ A;  1DJB A;  3PBS A;  2EX6 A;  3Q81 A;  2H10 A;  5FQM A;  2ZJ9 A;  4FH2 A;  4Z9Q A;  2BLS A;  2WGI A;  2ZQA A;  3MZF A;  3AGE A;  3GQZ A;  1KVL A;  1YLT A;  3N6I A;  5A91 A;  3WS2 A;  1PWC A;  3E2K A;  1K54 C;  5CRF A;  4U0X A;  4E3J A;  1U60 A;  1K38 A;  5FAQ A;  4WEJ A;  5GLB A;  3HVF A;  4L0L A;  5A93 A;  3A3F A;  4BD1 A;  3ISG A;  3ZG0 A;  2HP9 A;  3VMA A;  1E25 A;  3UDF A;  3CG5 A;  4QD4 A;  1S0W A;  1M40 A;  3IF6 A;  1LI9 A;  4GNU A;  2WK0 A;  2Y4A A;  1PZP A;  3W4O A;  3VP4 A;  3GVB A;  4KZB A;  2C6W B;  4H8R A;  5GHY A;  2J9O A;  2Y59 A;  4KQO A;  3FV7 A;  3HLD A;  4WEL A;  5FAP A;  2ZC5 B;  5HAR A;  4FD8 A;  5DVA A;  4YFM A;  3E2L A;  1CEF A;  3GSG A;  5F82 A;  1EI5 A;  2Y2O A;  3O87 A;  1Q2Q A;  3VP0 A;  1K55 A;  4PM8 A;  3UPN A;  5EOE A;  5EVI A;  3IQA A;  1JWP A;  2EX9 A;  2HDU A;  1VM1 A;  1FR1 A;  1PWG A;  5FI2 A;  4LV0 A;  5EVL A;  1QME A;  4QU3 A;  3G30 A;  3Q82 A;  2XFS A;  4DF6 A;  3IH9 A;  4GB7 A;  1MKI A;  4RVA A;  4HEF A;  2ZC6 B;  4WZ4 A;  3WS1 A;  3FWL A;  5CEB A;  4C6Y A;  4OLD A;  3HLB A;  4S2K A;  4OON A;  3WS0 A;  4GD6 A;  3AGD A;  1I2S A;  2H0Y A;  4A5R A;  4NK3 A;  3ZVT A;  3N7W A;  3C5A A;  3IT9 A;  2HDR A;  4PM9 A;  1ESI A;  4P6B A;  3OPL A;  4N9L A;  2X01 A;  4RYE A;  3FKV A;  4GDB A;  2HP6 A;  4LV2 A;  1SCW A;  1K56 D;  4UA6 A;  2WGW B;  3VP3 A;  1ES2 A;  4OP5 A;  4BLM A;  4EQI A;  2XGN A;  2WZX A;  2V1Z A;  2XQZ A;  3G2Z A;  4JXV A;  2X71 A;  2V20 A;  4X55 A;  2XFT A;  1PWD A;  1NY0 A;  1NXY A;  1K56 A;  5CED A;  4O7D A;  4FSF A;  4JXS A;  4OQI A;  1SDN A;  5FI6 A;  3FZC A;  4KZ7 A;  4Y7P A;  1BLH A;  3HLW A;  4R4S A;  4JF5 A;  4RX3 A;  1KDW A;  2ZQ8 A;  1PZO A;  3SOI A;  3A3E A;  5G18 A;  2ZQ7 A;  3DW0 A;  4LV1 A;  2V2F F;  2HDQ A;  1TEM A;  2J9P A;  2Z2L B;  3IXH A;  4K0X A;  2RCX A;  1DJC A;  5JYO A;  3RJU A;  4S2I A;  1ERO A;  3LEZ A;  1PI5 A;  4WYY A;  2XDM A;  3UE0 A;  5FSR A;  3OPH A;  5CHU A;  1AXB A;  2VGK A;  5DTT A;  1LHY A;  3DWK A;  1W5D A;  2WKH A;  2DRW A;  1BLP A;  4P85 A;  4N92 A;  3HUM A;  4UA7 A;  2EX8 A;  4LCL A;  3UNW A;  5AQ7 A;  3NY4 A;  2PBY A;  1E3U A;  3C7V A;  4HBT A;  3ZGA B;  3NIA A;  3ZNY A;  5EVI C;  4JXW A;  3G31 A;  3ZFZ A;  4R1G A;  2R9X A;  3GMW A;  3LCE A;  3ZVW A;  1CK3 A;  4QY6 A;  1G6A A;  5DTK A;  3Q07 A;  1XP4 A;  5KMW A;  3IHA A;  4S2L A;  3BLS A;  2QZ6 A;  1QMF A;  2XLN A;  1PW1 A;  1L0F A;  5HAQ A;  1L0E A;  3UDX A;  1C3B A;  3IXG A;  4EV4 A;  3OPR A;  4WM9 A;  3PAE A;  3PTE A;  4PPR A;  1I2W A;  1MWU A;  3UE3 A;  4EBP A;  3MXR A;  1SKF A;  2OSU A;  4OQG A;  2IWD A;  4S2M A;  1LL9 A;  4ZBE A;  4OOY A;  2DNS A;  3IXB A;  1XXM A;  1MXO A;  4EWF A;  3PBQ A;  1JTG A;  1ONH A;  3BYD A;  4KQR A;  1N9B A;  4X68 A;  1G68 A;  4FH4 A;  5TGF A;  4C75 A;  1IYS A;  1W8Y A;  1MPL A;  1MWS A;  2ZMA A;  2I72 A;  1IKI A;  3OCL A;  5E2F A;  1BSG A;  5AQA A;  4CPK A;  5GL9 A;  3HRE A;  5FQ9 A;  2EXA A;  2QPN A;  2WAF A;  1BLC A;  3UE1 A;  4OPY A;  1K25 A;  1JVJ A;  1PYY A;  2E8I A;  2Y2K A;  5DF7 A;  4ZDX A;  4B4X A;  4IED A;  4BL3 A;  3EQU A;  4DXB A;  4S2J A;  2ZD8 A;  4BL2 A;  2EFU A;  3IF6 C;  3GRJ A;  4OKP A;  4HBU A;  4S2N A;  3DTM A;  1KE4 A;  1PI4 A;  1WYB A;  1M6K A;  1WE4 A;  4IVK A;  3RXX A;  5HW3 A;  4JF6 A;  3PBR A;  2Y2P A;  5FAO A;  3IH8 A;  2FFY A;  4KZA A;  5FQK A;  2G2U A;  4JBF A;  3BFC A;  1BUL A;  3ZG9 B;  1ESU A;  3IWO A;  4E3K A;  4EBL A;  4R3J A;  5CTM A;  5FI7 A;  2UWX A;  4GZB A;  3S1Y A;  3UPP A;  1XX2 A;  2EFX A;  3OCN A;  1JWZ A;  4WMC A;  1K55 C;  1YLW A;  3V3R A;  3VOZ A;  3N8L A;  4DDY A;  3MZD A;  4BJP A;  5E43 A;  1YQS A;  4KG6 A;  2VGJ A;  3UDI A;  2WYX A;  4BD0 A;  3Q1F A;  4MLL A;  4GD8 A;  3ZG7 B;  1TVF A;  2HDS A;  4OPZ A;  3HLG A;  4GKU A;  4IBX A;  4KZ5 A;  3BLM A;  4KEN B;  5GLA A;  4E6X A;  1N4O A;  1NJ4 A;  1PIO A;  4DE3 A;  5CEC A;  1W8Q A;  4XUX A;  4U3T A;  3ZCZ A;  1FR6 A;  3ITA A;  5CXW A;  1H5X A;  1RP5 A;  1LLB A;  2XR0 A;  3TOI A;  1KE0 A;  3SH7 A;  4B4Z A;  3OPP A;  3VP1 A;  4R4R A;  1DY6 A;  2A3U A;  2HP5 A;  2Y2J A;  3QNC A;  1K4E A;  3GR2 A;  1XPB A;  4QJG A;  1HVB A;  1KGG A;  4OLG A;  4KZ6 A;  3HUN A;  3A3D A;  2ZM2 A;  2Y91 A;  4KG5 A;  2ZC7 A;  4X53 A;  1Y54 A;  4DE1 A;  3ZG8 B;  3WS5 A;  1RGZ A;  4MBH A;  4ZTK A;  5DF8 A;  3VOY A;  2Y2G A;  2H5S A;  4BEN A;  4ID4 A;  1Z6F A;  1IYP A;  2A49 A;  2DCF A;  3WWX A;  4GN2 A;  1YM1 A;  1K57 A;  3W8K A;  1FCM A;  1S6R A;  2C5W B;  2Y2H A;  3PBT A;  2WGW A;  3BM6 A;  2ZQ9 A;  1KVM A;  3UN7 A;  1RGY A;  3IWI A;  3SS3 A;  4DDS A;  3BFF A;  4B88 A;  4OP8 A;  1W7F A;  2PU4 A;  4GOG A;  4N1H A;  2XH9 A;  3GTC A;  3Q7V B;  4KZ8 A;  1CI8 A;  4XUZ A;  5TFQ A;  3IHB A;  4F94 A;  2Q9N A;  1GA9 A;  4LCM A;  5AQB A;  3I7J A;  3O88 A;  2ZC4 B;  1XGI A;  2P74 A;  3C4O A;  3NCK A;  3HLC A;  1E3U D;  1BUE A;  2CC1 A;  2ZQD A;  1L0G A;  1K6R A;  5FA7 A;  5A90 A;  2EXB A;  3P98 A;  3TSG A;  4N9K A;  5M19 A;  3LY3 A;  3AGF A;  3HBR A;  2WUQ A;  2Y2Q A;  1NZU A;  4E3I A;  3LY4 A;  1H8Z A;  4LV3 A;  3VFF A;  5DTS A;  5EE8 A;  4X69 A;  4OOL A;  5KZH A;  2WKE A;  3PBO A;  2JE5 A;  3C7U A;  4JPM A;  4ZJ2 A;  1L2S A;  3A3I A;  1H8Y A;  2P9V B;  5CGX A;  1LI0 A;  3CZD A;  4S2P A;  5EEC A;  1GHP A;  3HLF A;  3FYZ A;  2Z2M B;  1ONG A;  3SS5 A;  3BEB A;  4R0Q A;  1FSW A;  2XEP A;  1GA0 A;  5EVI B;  5HAP A;  4LEN A;  1BZA A;  3G4P A;  1YMX A;  5FQJ A;  3BFD A;  3FKW A;  3SH8 A;  4WZ5 A;  3HUO A;  2Y2M A;  4XXR A;  1DJA A;  3V3S A;  3DWZ A;  4WEK A;  5EPH A;  4E6W A;  5F1F A;  4FCF A;  1BT5 A;  4Y0O A;  5CGS A;  3QNB A;  1IKG A;  1KDS A;  1CEG A;  2X02 A;  5F83 A;  4DXC A;  3Q7Z A;  1NYY A;  4UHU A;  1ES5 A;  5GLD A;  4MEZ A;  1LL5 A;  2IWC A;  2XK1 A;  3G34 A;  4S2O A;  2JCH A;  3NC8 A;  1NYM A;  4P87 A;  1O7E A;  3BEC A;  4PM6 A;  3UY6 A;  1IEL A;  4KZ9 A;  3M6B A;  3S22 A;  1HTZ A;  2HPB A;  2R9W A;  4KZ3 A;  3UPO A;  3HL9 A;  4YIN A;  1NRF A;  1ALQ A;  5HL1 A;  3ZDJ A;  2WGV A;  1XA7 A;  3SH9 A;  2BG1 A;  1ZC2 A;  4DE2 A;  5HFO A;  5M18 A;  2WAE A;  4NET A;  4IBR A;  2G2W A;  4S2N C;  4X56 A;  4WBG A;  3OC2 A;  2ZM0 A;  4WMC D;  4JKT A;  4OPQ A;  2XD1 A;  1K54 A;  4E3O A;  3NI9 A;  3IF6 B;  4QY5 A;  5FAS A;  3M2K A;  5CER A;  3HLE A;  1ERM A;  5EOO A;  4OQ0 A;  1RCJ A;  4R23 A;  5KSH A;  5A92 A;  4OVD A;  4UA9 A;  4EBN A;  1KE3 A;  1VQQ A;  1XGJ A;  3EQV A;  3MZE A;  5TR7 A;  2ZM8 A;  1Q2P A;  1W79 A;  3VP2 A;  5J8X A;  2JBF A;  1HD8 A;  3V5M A;  3S4X A;  5KSC A;  2Q9M A;  1KGF A;  1YMS A;  3N8S A;  2J7V A;  5E2E A;  1MWR A;  2Y2I A;  3IWQ A;  1GHM A;  3MXS A;  1WYC A;  5CHM A;  1K4F A;  3W4Q A;  5GHX A;  5DF9 A;  5E2H A;  1IEM A;  4MNR A;  5CHJ A;  4QHC A;  1L0D A;  3BFG A;  4ZAM A;  3ITB A;  3MBZ A;  4GDN A;  4PM5 A;  4JF4 A;  4UAA A;  3BRM A;  3WS4 A;  2J8Y A;  5BOH A;  3M2J A;  4K91 A;  2IWB A;  5FDH A;  1FCO A;  4JLF A;  5HAI A;  1GCE A;  4N1X A;  3PBN A;  2OLU A;  4KQQ A;  4PM7 A;  3P09 A;  2PU2 A;  3JYI A;  4BQM A;  2XF3 A;  3A3J A;  4R3B A;  5FQQ A;  4JXG A;  4CJN A;  2B5R A;  4DKI A;  5E2G A;  4ZJ3 A;  3VSK A;  1MWT A;  1K57 C;  3CJM A;  3BFE A;  3MFD A;  2OV5 A;  3V50 A;  1PW8 A;  2XD5 A;  1MBL A;  3RXW A;  2Y2L A;  1IYQ A;  1XA1 A;  3GV9 A;  1YLZ A;  5CTN A;  5GHZ A;  4EUZ A;  3O86 A;  1NZO A;  2WZZ A;  1TDG A;  2Y55 A;  3IXD A;  2ZQC A;  5GLC A;  3MKF A;  3G35 A;  5U47 A;  3VFH A;  1I5Q A;  1XKZ A;  5M1A A;  3UO9 A;  3CMZ A;  4DE0 A;  3SS4 A;  4Q8I A;  2H0T A;  4P0M A;  1J9M A;  1FQG A;  5I94 A;  2WAD A;  2ZC3 B;  1BLS A;  3Q7V A;  1FCN A;  5CGW A;  5FQI A;  1YLP A;  4OQH A;  4QB8 A;  3NDG A;  4KZ4 A;  3N4I A;  3NBL A;  4Y0U A;  2OLV A;  2FFF B;  2EX2 A;  2GDN A;  4X6T A;  1O07 A;  1JWV A;  5F1G A;  3V39 A;  3ZNT A;  1ES3 A;  3TG9 A;  1YT4 A;  3NDE A;  1E4D A;  4IVI A;  4C3Q A;  3D4F A;  1FOF A;  3QHY A;  4HES A;  4DRT A;  5L2F A;  5HX9 A;  3IF5 A;  1HZO A;  3LO7 A;  4U0T A;  1EWZ A;  4ZJ1 A;  1MY8 A;  1SHV A;  1ZG4 A;  4K0W A;  4D2O A;  3N8R A;  3C4P A;  4OOM A;  5EVI D;  1FSY A;  1YLY A;  1ES4 A;  1K6S A;  5D3O A;  3WRT A;  4Y0T A;  1ZG6 A;  4WZ5 C;  1OME A;  3G2Y A;  4E3M A;  4RA7 A;  1ZKJ A;  1BTL A;  2P9V A;  1JTD A;  2ZLY A;  3G32 A;  3ZG5 A;  3B3X A;  3VSL A;  4OPR A;  2WKI A;  1CI9 A;  1SDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...