3WS2A

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (condition-1c)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
360
structure length
360
Chain Sequence
QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAIDVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 118
structure length 360
sequence length 360
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ws2A00
1ES5A 5EUAA 2E8IA 2HP5A 1K4FA 2V1ZA 4OLDA 5HFOA 1NJ4A 4ZJ2A 3VP3A 2WGWB 3HLDA 2JBFA 5FA7A 3OCNA 3CJMA 1TVFA 3OPLA 3G31A 1IKGA 4FSFA 1K56A 3W4QA 5CGSA 3IXBA 4GN2A 5KMWA 4DE1A 2Z2LB 4U0XA 3P98A 2G2UA 4Y0OA 4D2OA 4P6BA 1BZAA 1RGZA 2QMIA 4JPMA 4JXVA 2WUQA 2A49A 4Y0UA 5FAQA 1YM1A 2WKIA 5DVAA 1YLZA 4B4XA 1XKZA 3LCEA 3C7UA 4DXBA 2ZC6B 4BQMA 5G18A 1FCMA 5EVLA 2Y4AA 5FI6A 4K0XA 3MKFA 2WYXA 4IVKA 4KZ8A 3IHBA 1ONHA 5FQIA 3Q81A 2EX9A 1RGYA 4S2NA 1KVMA 5M18A 3GMWA 3JYIA 1IYQA 3Q07A 4MEZA 1N9BA 4OQHA 1KGGA 3ZHHA 3HLFA 3G34A 3UPPA 5KSCA 1VQQA 3FV7A 4OQ0A 4WZ5A 1O07A 1L2SA 4HBTA 2OV5A 1WYBA 1AXBA 5CEDA 4N9KA 4WMCA 5KSHA 5D3OA 1GHPA 1MWRA 2XR0A 5IHVA 2FFFB 1C3BA 5DF9A 2ZQDA 1W8YA 2DNSA 1LI9A 2OLVA 2I72A 5FQ9A 1IEMA 3RJUA 1KGEA 5GLBA 1L0FA 1ZG6A 3ZFZA 2JCHA 3IXGA 4PM6A 1J9MA 4ZDXA 4IBRA 1CK3A 3W4OA 4DDYA 4UA6A 3IF6B 5J8XA 5L2FA 3IH8A 4GNUA 4GKUA 3A3IA 4OONA 1ERQA 1JVJA 4X6TA 1Q2QA 2XLNA 1ZG4A 1K57A 5CHMA 1U60A 3A3JA 3FWLA 5FQQA 4JLFA 4X55A 3UPNA 3VOZA 1RP5A 4CPKA 5FASA 3V50A 4B4ZA 3MZFA 3QHYA 4LV2A 2EXBA 1KVLA 1BULA 1HD8A 3IF6A 4O7DA 4UA7A 1PZOA 2B5RA 3ZCZA 3G32A 4WZ5C 3M6HA 3N4IA 2JE5A 3VFHA 1ONGA 3V3SA 1IYSA 4QHCA 3M2KA 4Y0TA 1XXMA 3O86A 3VSLA 1E4DA 4E3KA 3ZDJA 3UY6A 2WAFA 3O87A 3RXXA 1GHMA 4BL2A 4N1HA 1JTGA 1BT5A 4S2PA 4WEJA 3BM6A 4BJPA 4OPQA 4OPZA 1NZUA 3LO7A 5FI7A 2IWCA 4EBPA 5EVIB 1YLYA 3W8KA 5GLAA 4JBFA 4C6YA 3NC8A 4E3MA 4GDNA 5FQMA 3TG9A 2R9WA 2Q9NA 3DWKA 3G2ZA 3VP1A 5FAPA 2HDUA 3LY3A 3V5MA 3HUMA 1SDEA 1GA0A 1BTLA 4YINA 3RXWA 2XFSA 1O7EA 1FOFA 2WGVA 2XEPA 3WS0A 5A92A 5KZHA 1K25A 3GR2A 2XQZA 3IWQA 4P87A 4EBLA 1YLTA 2J9PA 2A3UA 5F83A 3C5AA 4X68A 1FR1A 3N8RA 2C6WB 4FH4A 4M3KA 3WS1A 3ZG0A 1GHIA 1WE4A 5CRFA 1G68A 3UE3A 1H8YA 1M6KA 4HEFA 1I5QA 3TOIA 1IYPA 1MBLA 3UDFA 1G6AA 3W4PA 1YMXA 4EWFA 2XGNA 1PZPA 1W79A 3AGDA 2H0TA 1TEMA 3BEBA 3VP0A 2WZZA 3C4PA 2VGKA 1H5XA 2Y2PA 1S0WA 1SCWA 4S2OA 3WS5A 2HDQA 3N8SA 1CEFA 5HARA 1Z6FA 1K55A 5AQAA 2PBYA 1VM1A 2WGWA 1HZOA 3WWXA 5HL1A 2ZC4B 4K0WA 1Q2PA 4WBGA 4BLMA 3HLEA 2VGJA 2HDRA 3HVFA 1GCEA 1FQGA 1MPLA 2XF3A 3Q1FA 4KQRA 3MKEA 3HLCA 3FZCA 4EBNA 2QPNA 1NYMA 3PBQA 4FH2A 3Q7VA 3S4XA 3M2JA 3VOYA 2ZLYA 1K6RA 2Y55A 3ZGAB 1PWGA 3IH9A 1K6SA 2V2FF 3DTMA 5DF8A 3Q82A 1W7FA 2X01A 3QNBA 3WRZA 3GTCA 3UDXA 4BL3A 5DF7A 3ZG7B 4QJGA 2EX6A 5CTMA 4NETA 4OH0A 4GD6A 4JF6A 5EOEA 3BECA 1DJCA 2CC1A 1NYYA 3CG5A 3I7JA 3BLSA 4MNRA 1EI5A 1PWCA 3NDEA 4RX2A 5A91A 4KG6A 4S2LA 4GDBA 2Y2HA 3C4OA 2XK1A 2ZQ9A 4KQOA 3EQUA 4MBHA 2ZM0A 3NDGA 1M40A 2EX2A 1KGFA 1CI9A 3UE0A 3A3DA 5FQJA 4E6XA 4QU3A 4R23A 1W8QA 4OPRA 4WM9A 5EPHA 1L0GA 4E3NA 2P9VA 4QD4A 3UN7A 3BFFA 2Y2IA 2WK0A 4ZBEA 4Z9QA 4RA7A 1MWSA 1YLPA 3QNCA 1LLBA 1PI4A 3AGEA 4XUXA 4JF5A 3VP2A 3NBLA 4X69A 3NCKA 3UE1A 1TDLA 4R3BA 5CEBA 4LV3A 4UHUA 1JWVA 2ZQ7A 4K91A 3O88A 3MXSA 3WS4A 5E43A 5TGFA 1ES2A 4QY5A 3MBZA 3SOIA 3C7VA 2JC7A 4X56A 4RYEA 2Y2LA 4KG5A 3TSGA 3HBRA 1BUEA 5A93A 1YT4A 5HW3A 1SHVA 4WZ4A 4S2JA 3HL9A 5F1GA 3G35A 1E3UA 1XA7A 2IWBA 1QMFA 4N9LA 2X71A 3IWOA 4U3TA 1JWPA 4GB7A 2Y91A 2P9VB 2BG1A 5DTSA 5EVID 2ZC7A 4ZAMA 3CZDA 3PTEA 4UAAA 3SS4A 2ZQ8A 5AQ9A 4PM9A 3HUOA 5FI2A 5HAPA 4R1GA 1DY6A 3NIAA 4WMCD 5CHJA 3BLMA 4BD1A 3LY4A 5CGXA 1FSYA 3ZVTA 3VSKA 4ZJ1A 5A90A 1XA1A 5GHXA 1KE3A 3ZVWA 1IKIA 1Y54A 1XPBA 3PBRA 4U0TA 4P85A 2ZC3B 1S6RA 1ALQA 4YFMA 5EVIC 4N1XA 5JYOA 2EXAA 2WGIA 3MFDA 3IWIA 1NZOA 5FDHA 3PBTA 5HX9A 2WKEA 5F1FA 4R3JA 2RL3A 4KZ9A 1MY8A 3MZEA 4KZBA 5CHUA 4ZJ3A 2X02A 1L0EA 4C75A 4H8RA 4LENA 4OOYA 1PYYA 1JTDA 1SDNA 2Z2MB 3GRJA 3SS5A 4IBXA 2Q9MA 3BRMA 3HUNA 3Q7VB 5FQKA 1IELA 3PBNA 4S2KA 2WZXA 2J9OA 3ZNTA 2EFXA 4DF6A 5GL9A 1QMEA 1ERMA 2QZ6A 2OSUA 4OLGA 4OQGA 4S2MA 5TR7A 4F94A 2ZM2A 4QY6A 5EECA 1MKIA 3ZG9B 2DCFA 4L0LA 2HPBA 3ZG5A 1N4OA 3ISGA 4B88A 4KZ6A 3O3VA 4R0QA 3BYDA 1DJBA 1YQSA 1KDWA 3IXHA 4PMAA 3V3RA 1RCJA 4BENA 1PI5A 3SH7A 4WEKA 1BLCA 3OZHA 2GDNA 5M1AA 3OCLA 1ES3A 2PU4A 1IYOA 2Y2GA 4MBKA 4DE0A 2XH9A 4HESA 3UPOA 4S2IA 4R4SA 4E3IA 3BFGA 1K54C 1YLJA 3WRTA 3OPPA 2ZQAA 2XDMA 5E2FA 2WKHA 3CMZA 2H5SA 3G2YA 1FCOA 4LV0A 4RX3A 5CERA 3MXRA 1K4EA 4UA9A 1I2WA 5I94A 2ZC5B 1LI0A 3BFEA 1BLSA 4KZ4A 3N6IA 5GLDA 1XGIA 4IEDA 2G2WA 3IF5A 1FR6A 2H10A 1FCNA 1PWDA 4KZ3A 5TFQA 4XXRA 2OLUA 2PU2A 5FATA 5GLCA 2Y2MA 4EQIA 1LHYA 5M19A 2ZMAA 1ESUA 1K55C 3A3EA 1ES4A 5BOHA 4WELA 5EVIA 3GV9A 3UO9A 5CGWA 4DE3A 1KE4A 3PBSA 1EROA 3N8LA 4DRTA 1NY0A 3NY4A 4GD8A 1E3UD 4E3OA 1L0DA 2Y2JA 4X53A 1CEGA 1SKFA 3FYZA 2WAEA 3G4PA 4QB8A 3DW0A 1BSGA 2RCXA 5CXWA 4OPYA 3NI9A 2EX8A 3IXDA 3S22A 1XP4A 1KDSA 5E2GA 5CECA 4KENB 4GZBA 1NXYA 4HBUA 3OPHA 3E2KA 4KZ5A 1TDGA 2DRWA 2Y59A 3OPRA 4ID4A 4E6WA 3VP4A 4PM7A 2BLSA 3G30A 5CTNA 4DKIA 3M6BA 5AQ7A 4PM5A 2C5WB 4N92A 3PAEA 2HP6A 3GSGA 4A5RA 3D4FA 1HTZA 3P09A 4JF4A 4JXGA 1NRFA 1PIOA 3MZDA 1K38A 4JKTA 1XGJA 2P74A 1K54A 1H8ZA 4GOGA 2XD1A 4EV4A 1LL9A 3IF6C 3AGFA 2HDSA 4XUZA 2Y2NA 3ZNYA 2Y2QA 3PAGA 5U47A 3ITAA 4LCLA 1ZKJA 4E3LA 4E3JA 2WADA 2V20A 3V39A 4WYYA 3HLBA 2Y2OA 1K57C 4FCFA 1JWZA 5EE8A 4C3QA 3HLGA 2ZM8A 4DXCA 4KZ7A 3IQAA 3ITBA 4LCMA 4EUZA 4KZAA 2UWXA 4IVIA 4PM8A 2EFUA 1E25A 5FSRA 2J8YA 1DJAA 2Y2KA 3UNWA 1MWTA 1ZC2A 2XFTA 3LEZA 4FD8A 3A3FA 3SH8A 3E2LA 1PW8A 4PPRA 3GQZA 5DTTA 4MBFA 2XD5A 1BLPA 3FKWA 3SH9A 5GHZA 2H0YA 4OKPA 4JXSA 1OMEA 1EWZA 4Q8IA 5DTKA 4OP8A 3N7WA 5FAOA 3BFDA 5HAIA 2FFYA 2ZJ9A 3WS2A 4KG2A 4OQIA 1I2SA 4BD0A 3OC2A 4JXWA 3VFFA 3Q7ZA 1HVBA 1YLWA 4OVDA 1ESIA 3DWZA 3HLWA 2IWDA 1W5DA 3VMAA 1YMSA 3FKVA 2R9XA 4DE2A 1BLHA 4LV1A 1WYCA 5HAQA 3B3XA 1K56D 3PBOA 5F82A 4OOMA 1KE0A 3GVBA 5JYPA 4OOLA 2ZQCA 4OP5A 4MLLA 4RVAA 4NK3A 4P0MA 5E2HA 2HP9A 5E2EA 4CJNA 1XX2A 1PW1A 3IHAA 2ZD8A 5GHYA 3IT9A 1GA9A 3EQVA 4S2NC 4Y7PA 5EOOA 3UDIA 1FSWA 3BFCA 3SS3A 3S1YA 3HREA 1MWUA 4DDSA 1MXOA 1CI8A 4R4RA 1LL5A 4ZTKA 4KQQA 5AQBA 3ZG8B 2J7VA
chains in the Genus database with same CATH superfamily
2W1TA 1XJ3A 2HP5A 1K4FA 5HFOA 4ZJ2A 3HLDA 2JBFA 4LPZA 2FH5A 3OCNA 3F1OA 5TBMA 3OPLA 3G31A 1W63M 2XROA 1K56A 4DJ2A 4U0XA 4P6BA 1J3WA 1X0OA 5F68A 3LFVA 2V9AA 2WUQA 4Y0UA 2G7UA 5DVAA 1XKZA 2ZC6B 1FCMA 1F5MA 3MKFA 4CLCA 1L3LA 2WYXA 4IVKA 3IHBA 1ONHA 3GMWA 3JYIA 4R3AA 1KGGA 3ZHHA 3FV7A 4OQ0A 1L2SA 1WYBA 5CEDA 4N9KA 4WMCA 1GHPA 1MWRA 5C5KA 5IHVA 1C3BA 1A0KA 1L0FA 2GX5A 3KX0X 1CK3A 5J8XA 4GKUA 4R38A 1Q2QA 3CUEC 3FWLA 1DP6A 2AVXA 3CWFA 5FASA 3H7WA 4LV2A 1BULA 3LR5A 3N4IA 3NOTC 1ONGA 2M1CA 1IYSA 4Y0TA 3BY9A 4ETXA 1E4DA 1F2KA 4EW7A 3ZDJA 3T1XA 3O87A 1BT5A 3T12B 3BM6A 3CITA 5I5LA 1H0MA 1XFNA 3GECA 5FI7A 2LB5A 5EVIB 5GLAA 1T18A 5HPFA 5HWWA 4E3MA 2L0WA 3FPWA 2R9WA 3LY3A 4UQIS 3V39A 1GA0A 1T1AA 2XFSA 5A92A 3IWQA 4P87A 1FR1A 5CRFA 1M6KA 4I39A 4HEFA 1IYPA 1MBLA 3W4PA 1G6AA 5EV0A 5IS1A 4Y17A 3BEBA 3HJKA 1YAXA 2XSSA 2Y2PA 3WS5A 3F1OB 5TBMB 1K55A 1VEUA 4PKYG 5HL1A 2ZC4B 2HDRA 1GCEA 1FQGA 1MPLA 3FZCA 2QPNA 2E8JA 2V0WA 3MR0A 3VOYA 4JGQA 1K6RA 3H9WA 3W2ZA 2K2NA 3IH9A 3DTKA 2X01A 3QNBA 3GTCA 2Q0OA 1VEUB 4HJ3A 3NOUC 1FIKA 3CG5A 3I7JA 4KG6A 4GDBA 3EQUA 5L10A 1KGFA 5FQJA 3CPTB 4GLQA 4QU3A 4R23A 3LGOA 3JVVA 2P9VA 3BFFA 4FOFA 2WK0A 4ZBEA 1MWSA 3VE4A 3QNCA 2Y79A 1PI4A 3AGEA 4XUXA 2WKPA 3VP2A 3FG8A 4UHUA 3EGXC 4K91A 5TGFA 3LUQA 4QY5A 2VLGA 1CF0A 3TSGA 3HBRA 3HL9A 1E3UA 4UQIM 4N9LA 2X71A 5HSQA 1NWZA 2P9VB 3PTEA 2ZQ8A 3LY4A 3VSKA 5A8BA 1T19A 1IKIA 2ZC3B 3MXQA 1S6RA 2HZ5A 1OT9A 2WGIA 3MFDA 4HH3A 5HX9A 5F1FA 4KZ9A 3MZEA 4H8RA 5F69A 1JTDA 3GRJA 4LRZE 1LSWA 3Q7VB 4S2KA 4HNBA 4F3LA 2J9OA 3OBFA 4IJGA 4DF6A 4F94A 2OAP1 4OQGA 2ZM2A 5EECA 4KZ6A 3V3RA 4PMAA 4BENA 3SH7A 4WEKA 1BLCA 3MSHA 4G3KA 2QWSA 2Y2GA 4DE0A 3NOPC 4HESA 4S2IA 3BJNA 4R4SA 2JKTI 3D3OA 3UB7A 3WRTA 5E2FA 3G2YA 4L9EA 4YOFA 1I2WA 2ZC5B 1LI0A 3BFEA 4KZ4A 4HQAA 1ACFA 5TFQA 2G2WA 5K5BA 2D01A 4EQIA 1ESUA 2VV8A 2W1TB 4DE3A 1KE4A 4ETZA 1L0DA 3FYZA 4OPYA 4MN5A 2BTFP 2EX8A 1STZA 1KDSA 2V8CA 5E2GA 4II7A 3PYPA 3F1PB 2DRWA 1TF1A 2Y59A 3C8CA 2XA7M 1PFLA 3G30A 3MQOA 5CTNA 3A0RA 2NUPC 3GSGA 1SKOA 2PYPA 4A5RA 3D4FA 4JF4A 1T1CA 2XRNA 1H8ZA 1OTDA 3RH8B 4X25A 1LL9A 3T4KA 4JGOA 4XUZA 4MMNA 2PHYA 3BQAA 5EM1A 2INWA 2V20A 2Y2OA 5EE8A 5HPIA 4I3JA 4PM8A 3TE8A 2EFUA 3KSHA 5J4EA 1H3QA 1ZC2A 3A3FA 3R4KA 2VA0A 3E2LA 1PW8A 1G6OA 3GQZA 1BLPA 4GJ4A 4MN6A 5GHZA 1S1ZA 4QWOA 4OKPA 1OMEA 3N7WA 1S4RA 4OQIA 1I2SA 4OVDA 2IWDA 4Y15A 1BLHA 4LV1A 5HAQA 2L1MA 1KE0A 4OOLA 2JKRM 2KOIA 4IUKA 3NHQA 5E2EA 1PW1A 1GA9A 1FSWA 3SS3A 3S1YA 1OPXA 2BASA 5AQBA 3LI8A 2E8IA 2V1ZA 4OLDA 3T50A 1TVFA 3IXBA 4GN2A 1HLUP 5KMWA 2Z2LB 4D2OA 2QMIA 1RGZA 4JXVA 4NEED 4BQMA 5G18A 2ZL1B 2J80A 5M18A 5TJJA 3ZQ5A 4OQHA 3HLFA 3G34A 4WLAA 1VQQA 1AXBA 4HH2A 4BWIA 5KSHA 5D3OA 5DF9A 2ZQDA 1UGUA 5HZHA 2OLVA 1IEMA 1K0KA 3IXGA 4PM6A 1MZUA 5L2FA 3F1NB 3CPTA 3BW6A 2J3WA 1ZG4A 5CHMA 1U60A 3UPNA 4JLFA 3K3DA 4X55A 3VOZA 4GW9A 3QHYA 2EXBA 1KVLA 3PHYA 4QPRA 4UA7A 4O7DA 1PZOA 3ZCZA 2JE5A 3VFHA 3H82A 5G4ZA 4NXFA 4QHCA 3M2KA 2XA7S 2KLIA 4E3KA 3UY6A 2WAFA 4BL2A 2O9CA 4N1HA 1JTGA 1OJ5A 2GNXA 4S2PA 4WEJA 2YKHA 4BJPA 1IFQA 4OPZA 4HP9A 4ESPA 2IWCA 4EBPA 1YLYA 3DWKA 3G2ZA 3T4TA 1WA9A 3V5MA 2W1RA 1CJFA 4EEPA 1K25A 2XQZA 4EBLA 2A3UA 3R7WB 4XT2B 4X68A 3S7QA 1OJGA 2CMNA 4FH4A 4M3KA 3WS1A 3ZG0A 1GHIA 1F9IA 1WE4A 1H8YA 1I5QA 3TOIA 2XGNA 1PZPA 1W79A 3AGDA 2H0TA 1DP8A 2VGKA 3LYXA 3C2WA 1H5XA 3JVUA 2QJ5A 3R7WA 2HDQA 3N8SA 3UE6A 1Z6FA 2WGWA 2M7UA 2I9VA 4WBGA 3HVFA 3Q1FA 1G28A 4ME4A 3S4XA 2Y55A 1PWGA 3B47A 3UDXA 4R6LA 4NETA 1IOUA 1DJCA 2CC1A 1EI5A 3NDEA 4RX2A 4S2LA 2KX6A 2Y2HA 3C4OA 2ZQ9A 5HD3A 2L4RA 1YPRA 3IS2B 3UB9A 1YSQA 2EX2A 2OWHA 4NG2A 3UE0A 5FDSA 4E6XA 1S67L 1L0GA 4OPRA 2YKFA 4X1MA 3QP6A 4QD4A 2Y2IA 3E4OA 2OAQ1 4RA7A 1YLPA 2ZMVA 5IU1A 3C38A 2HGVA 4YWZA 3NBLA 4X69A 3UE1A 4R3BA 3WS4A 5E43A 1V9ZA 1ES2A 3C7VA 2JC7A 3ULFA 4KG5A 3MMHA 2D02A 1SHVA 4WZ4A 4NXGA 4S2JA 5HDDA 2IWBA 3G35A 1QMFA 1JWPA 4GB7A 3SS4A 3CZDA 4UAAA 4D60A 3HUOA 3UB8A 4WMCD 3BLMA 4BD1A 1FSYA 4ZJ1A 5A90A 1Y54A 4U0TA 3LIAA 4N1XA 5JYOA 2GZAA 3IWIA 1NZOA 3PBTA 2WKEA 1MY8A 2EWWA 1CQAA 4LENA 4WL9A 2Z6CA 1SDNA 4IBXA 2Q9MA 1IELA 2EFXA 4EXOA 1QMEA 2QZ6A 2OSUA 4OLGA 5TR7A 4QY6A 1MKIA 3ZG9B 4HJ4A 3KYZA 3ZG5A 1YQSA 1DJBA 3IXHA 1D1JA 3P7NA 4GHIA 1GSWA 3OZHA 1ODVA 4LLOB 1KOUA 4KUKA 5L07A 3RFBA 1TS6A 3LIDA 3UMEA 3T1SA 2H5SA 4MN7A 2W3DA 4LV0A 2QKPA 2PAVP 2ZOIA 1VETB 1XGIA 4IEDA 4BBVA 1V9YA 2H10A 1FCNA 5FATA 3NJAA 2Y2MA 2ZMAA 3A3EA 2WKQA 3UO9A 3PBSA 4DRTA 1XJ6A 3NY4A 4GD8A 1E3UD 4X53A 3UB6A 3G4PA 3FPVA 1BSGA 5CXWA 3IXDA 1XP4A 4KENB 1NXYA 2VV7A 5DKKA 3OPHA 4KZ5A 1TDGA 3OPRA 4E6WA 3VP4A 4PM7A 1BYWA 3MJQA 3TJZC 2C5WB 2HP6A 3P09A 2QJ7A 4KUOA 4JXGA 1PIOA 3MZDA 1K38A 3F1NA 5G4YA 4GOGA 2XD1A 4ZRRA 3AGFA 3PAGA 2QHKA 2WADA 4FCFA 5DKLA 4LRYC 1G5UA 2UWXA 2PD7A 1P9RA 2JKFA 4FD8A 2PRFA 1DP9A 3SH9A 4JXSA 1YSPA 1EWZA 2PR5A 5HAIA 4KG2A 2VZWA 1TS0A 5EFWA 1LSVA 1ESIA 3DWZA 2A24B 3FKVA 2R9XA 3PXPA 1WYCA 3B3XA 1K56D 5JYPA 4IUHA 2ZQCA 2UV0E 4NK3A 4GHIB 3EEHA 4CJNA 3IHAA 2ZD8A 3IT9A 3EQVA 3V67A 3S7PA 4S2NC 2PBDP 3VOLA 1SZVA 4JGRA 4DDSA 1MXOA 1CI8A 3FC7A 2VGLM 3IX4A 4ZTKA 4KQQA 4HIAA 3ZG8B 2J7VA 5AJGA 1P0ZA 1VETA 5FA7A 3CJMA 4LFUA 4FSFA 3SZTA 5CGSA 3MQQA 4DE1A 1UWPX 3P98A 4KQDA 2A49A 5FAQA 1YLZA 4B4XA 3LCEA 3B42A 3DAVA 4KZ8A 3QP1A 3Q81A 1KVMA 3UB5P 1IYQA 4DMZA 4MEZA 2V1AA 5KSCA 4BBTA 4HBTA 2OV5A 4CQHA 2EWVA 3CHWP 2XR0A 2FFFB 1W8YA 2DNSA 1ZHHB 1LI9A 1OT6A 2R78A 3RJUA 1KGEA 5GLBA 1ZG6A 3ZFZA 3LR3A 4L9GA 3H82B 3W4OA 4DN0A 3IH8A 4HP4A 4P6ZM 4H6JA 1JVJA 4HHDA 4X6TA 3A3JA 5FQQA 2O9AA 1NRJA 3ICYA 4CPKA 3MZFA 4RQ9A 4I38A 4PKYA 3IF6A 3G32A 3M6HA 3V3SA 1XXMA 3O86A 4EETB 3U4LP 2K31A 4P6ZS 4OPQA 1NZUA 4C6YA 2VGLS 2JKRI 4GDNA 5FQMA 3VP1A 5FAPA 1OTBA 4AFIA 3HUMA 3WS0A 4GS9B 1FOFA 2XEPA 4LGWA 5KZHA 1YLTA 2O9BA 5F83A 3C5AA 3N8RA 3UE3A 5FEGA 3A0SA 3UDFA 3UMDA 3IS2A 4EWFA 1TEMA 3VP0A 3E0YA 4R70A 4XT2A 3D9YA 5HARA 2PBYA 1VM1A 3RTYA 3WWXA 4K0WA 1Q2PA 3U2AA 2XF3A 4KQRA 3MKEA 2O0YA 3HLCA 1GSVA 1H8MA 1NYMA 4WN5A 3Q7VA 2JKGA 3M2JA 2ZLYA 2PD8A 3TW8A 2OOLA 4HOIA 5DF8A 4BL3A 3SW1A 3LIEA 3JPUA 4OH0A 2DMWA 4GD6A 2LB9A 5J7EA 2GJ3A 3BECA 3NECA 4MNRA 3BLSA 4KQOA 4MBHA 3LR0A 3NDGA 1CI9A 1Z09A 4E3NA 5LBRA 5EVEA 3A0VA 2VX8A 4Z9QA 2ZOHA 3MS6A 5L8MA 3NCKA 1TDLA 5CEBA 4LV3A 1JWVA 3IBRA 3O88A 3MXSA 1JNUA 3MBZA 4X56A 4RYEA 2Y2LA 3B33A 5A93A 1LSXA 4Y13A 4EU0A 1XA7A 3DBAA 4U3TA 2Y91A 2BG1A 3CLOA 5EVID 2H28A 4R1GA 1DY6A 5CHJA 5CGXA 4FTXA 1XA1A 4L9FA 1XPBA 3PBRA 4YFMA 2HV1A 1VB6A 1XJ2A 2J3TD 5FDHA 4Q0IA 2X02A 1L0EA 4C75A 4OOYA 1PYYA 3BRMA 5FQKA 3ZNTA 2WZXA 4IHQA 2V0UA 1ERMA 4S2MA 4MCWA 4L0LA 2HPBA 4B88A 1KDWA 3QP4A 3TRCA 5DFYA 1RCJA 1PI5A 3GDIA 5M1AA 1D06A 3OCLA 1ES3A 1LL8A 1IYOA 3BQ8A 4MBKA 3E98A 4E3IA 3BFGA 1PRQA 1TS8A 3LIFA 3OPPA 3P01A 2ZQAA 2XDMA 2P08A 4O0PA 1FCOA 4RX3A 5CERA 3MXRA 3E4PA 2PT7A 2W3HA 4EUVA 3N6IA 4ARZB 1FR6A 3MFXA 4YNRA 4Y5FA 1FILA 2OLUA 1LHYA 3C30A 1K55C 5HL6A 5BOHA 5EVIA 3GV9A 1GSXA 3N8LA 1NY0A 2JHEA 4E3OA 1CEGA 1SKFA 2HJ9C 2WAEA 2RCXA 3NI9A 1F98A 5CECA 2K7SA 4Q0JA 4MDZA 5IT5A 3T1RA 4HY8A 1LT0A 1AWIA 3H7WB 3M6BA 4PM5A 3LIBA 4N92A 3PAEA 1SKOB 5HDCA 1HTZA 1NRFA 2W0NA 4JKTA 2P74A 1P97A 2Y2NA 5AVEA 1PNEA 2W3EA 3ITAA 1ZKJA 1N9OA 3ZYTA 1S4SA 1K57C 1JWZA 4C3QA 3HLGA 2ZM8A 4DJ3A 4DXCA 3IQAA 3ITBA 4EUZA 4KZAA 2Y8HA 4IVIA 1E25A 4FUWA 1DJAA 1MWTA 5CX7A 3LICA 3SH8A 4PPRA 3O5YA 5DTTA 4MBFA 4WUJA 4ARZA 3FKWA 3IX8A 2ZL1A 4NXEA 4Q8IA 5FAOA 1P9WA 4BD0A 3OC2A 1YLWA 3HLWA 4NXBA 3T4SA 1YMSA 4DE2A 2PR6A 2OWJA 3PBOA 4OOMA 3GVBA 4OP5A 4RVAA 1D7EA 2Z6DA 4Y7PA 3UDIA 4BBUA 1MWUA 3S7NA 2V8FA 4R4RA 1LL5A 5AVFA 1ES5A 5EUAA 3IBJA 1NJ4A 3VP3A 2WGWB 2A2LA 3BY8A 1IKGA 4I3AA 3W4QA 3D72A 2G2UA 4Y0OA 1BZAA 4JPMA 2W27A 1YM1A 2WKIA 2VEAA 5L09A 2JN7A 3C7UA 4DXBA 5EVLA 2Y4AA 5FI6A 4K0XA 5HD5A 4JGPA 3LI9A 3L9KA 5FQIA 2EX9A 1RGYA 4S2NA 3Q07A 1N9BA 2VV6A 2ACGA 3T4LA 5FL3A 3UPPA 4M4XA 4WZ5A 1O07A 3KO6A 3CAXA 1XJ4A 1OTEA 2I72A 5FQ9A 3EGDC 2JCHA 1J9MA 2FZ0A 4ZDXA 4IBRA 4DDYA 3QP8A 4UA6A 3IF6B 4GNUA 5MC7A 3A3IA 4OONA 1ERQA 2XLNA 1K57A 4Y2FA 1RP5A 3V50A 4B4ZA 3BWLA 1HD8A 2KDKA 2B5RA 5FEFA 4WZ5C 3F1PA 3IX3A 2B95A 1Y28A 2VJWA 2P04A 3VSLA 2HF6A 3RXXA 1GHMA 4CLCC 4G3VA 3LO7A 1Y4OA 4E04A 3W8KA 4JBFA 3OLOA 3NC8A 2W3FA 4I5SA 4EQ1A 3KYEA 3TG9A 3CI6A 2Q9NA 2HDUA 1SDEA 4YINA 1BTLA 3RXWA 1O7EA 2WGVA 1NLYA 3GR2A 2J9PA 2C6WB 1G68A 4CLCE 1YMXA 2M7VA 2WZZA 3C4PA 1S0WA 1SCWA 4S2OA 3T4JA 1CEFA 2NUTC 5AQAA 4GS9A 4I3IA 3VE3A 1HZOA 3DTIA 3KSFA 4BLMA 3HLEA 2VGJA 3HJIA 5J3WA 1VHMA 4EEUA 4EBNA 3PBQA 4FH2A 2JKTM 3ZGAB 1OTAA 1K6SA 2V2FF 3DTMA 3HCYA 3Q82A 1W7FA 3WRZA 4G3WA 5DF7A 3ZG7B 4GCZA 5CTMA 2EX6A 3LEQA 3MF0A 4QJGA 4JF6A 5EOEA 1NYYA 1TD5A 3MQ0A 1PWCA 5A91A 3S7OA 2XK1A 2W3GA 2B18A 2ZM0A 1M40A 3T1QB 4B93A 1XFQA 4BMWA 4H6JB 3A3DA 1W8QA 5EPHA 4WM9A 5F6AA 3UN7A 1TS7A 5HWTA 5F5YA 4NKPA 1LLBA 1N9NA 4JF5A 5DJTA 2ZQ7A 4PHTA 3SOIA 4EESA 1BUEA 1YT4A 3NULA 5HW3A 5F1GA 3IWOA 1ZTUA 5DTSA 2ZC7A 4O01A 4ZAMA 2ZMFA 1DRMA 2V1BA 4PM9A 5AQ9A 5FI2A 5HAPA 3NIAA 1N9LA 3ZVTA 3QP2A 3KSIA 5GHXA 1KE3A 3ZVWA 4Z1WA 4P85A 1ALQA 5EVIC 3VV4A 2EXAA 4R3JA 2RL3A 4KZBA 5CHUA 4ZJ3A 2Z2MB 3SS5A 3KYQA 3HUNA 3PBNA 3KSGA 5GL9A 2O99A 2DCFA 2VKSA 1N4OA 3ISGA 1UWNX 3O3VA 4R0QA 3BYDA 2GDNA 2PU4A 1NLZA 2XH9A 3UPOA 5HWVA 2J3TC 1K54C 1YLJA 1YKDA 2WKHA 3CMZA 1K4EA 4UA9A 5I94A 4Y3IA 1BLSA 5GLDA 3IF5A 4KZ3A 1PWDA 3PR6A 3E4QA 4XXRA 5HDSA 2PU2A 5M19A 5GLCA 1ES4A 2VK3A 4K08A 4WELA 5CGWA 1EROA 3LR4A 2Y2JA 4LRXC 4QB8A 2EA9A 3DW0A 5DFXA 3OOVA 3S22A 4GZBA 2QYBA 1T1BA 4HBUA 3E2KA 4O8GA 1OTIA 4ID4A 3K2NA 1S1YA 3EEAA 2BLSA 3K3CA 4DKIA 2MJ6A 5AQ7A 2A24A 2HJEA 1W63Q 4PAUA 1EW0A 1XGJA 1K54A 2ZBBA 4EV4A 3IF6C 2HDSA 3ZNYA 2Y2QA 5U47A 4LCLA 4E3LA 4E3JA 3EOIA 4WYYA 3HLBA 3CUEA 4KZ7A 4LCMA 2PYRA 4HI4A 5FSRA 2J8YA 2Y2KA 3UNWA 2XFTA 3LEZA 4CLCD 4EERA 4WF0A 2XD5A 1MC0A 3EWKA 4HJ6A 4CLCB 3T4QA 1MKMA 2H0YA 3L7HA 5DTKA 4OP8A 3BFDA 2FFYA 2ZJ9A 3WS2A 4JXWA 3VFFA 3Q7ZA 1HVBA 1W5DA 3VMAA 2PDRA 5DJUA 4Q0HA 5F82A 3T4OA 2P7JA 2B02A 4MLLA 4B9OA 4UEYA 4P0MA 5E2HA 5EM0A 2HP9A 3QP5A 1XX2A 2WKRA 1S66L 5GHYA 4X1LA 5EOOA 5KIZA 3BFCA 3HREA 4F3LB 2IA2A 3DTEA 3G6OA
chains in the Genus database with same CATH topology
1ES5A 5EUAA 2E8IA 2HP5A 1K4FA 2V1ZA 4OLDA 5HFOA 1NJ4A 4ZJ2A 3VP3A 2WGWB 3HLDA 2JBFA 5FA7A 3OCNA 3CJMA 1TVFA 3OPLA 3G31A 1IKGA 4FSFA 1K56A 3W4QA 5CGSA 3IXBA 4GN2A 5KMWA 4DE1A 2Z2LB 4U0XA 3P98A 2G2UA 4Y0OA 4D2OA 4P6BA 1BZAA 1RGZA 2QMIA 4JPMA 4JXVA 2WUQA 2A49A 4Y0UA 5FAQA 1YM1A 2WKIA 5DVAA 1YLZA 4B4XA 1XKZA 3LCEA 3C7UA 4DXBA 2ZC6B 4BQMA 5G18A 1FCMA 5EVLA 2Y4AA 5FI6A 4K0XA 3MKFA 2WYXA 4IVKA 4KZ8A 3IHBA 1ONHA 5FQIA 3Q81A 2EX9A 1RGYA 4S2NA 1KVMA 5M18A 3GMWA 3JYIA 1IYQA 3Q07A 4MEZA 1N9BA 4OQHA 1KGGA 3ZHHA 3HLFA 3G34A 3UPPA 5KSCA 1VQQA 3FV7A 4OQ0A 4WZ5A 1O07A 1L2SA 4HBTA 2OV5A 1WYBA 1AXBA 5CEDA 4N9KA 4WMCA 5KSHA 5D3OA 1GHPA 1MWRA 2XR0A 5IHVA 2FFFB 1C3BA 5DF9A 2ZQDA 1W8YA 2DNSA 1LI9A 2OLVA 2I72A 5FQ9A 1IEMA 3RJUA 1KGEA 5GLBA 1L0FA 1ZG6A 3ZFZA 2JCHA 3IXGA 4PM6A 1J9MA 4ZDXA 4IBRA 1CK3A 3W4OA 4DDYA 4UA6A 3IF6B 5J8XA 5L2FA 3IH8A 4GNUA 4GKUA 3A3IA 4OONA 1ERQA 1JVJA 4X6TA 1Q2QA 2XLNA 1ZG4A 1K57A 5CHMA 1U60A 3A3JA 3FWLA 5FQQA 4JLFA 4X55A 3UPNA 3VOZA 1RP5A 4CPKA 5FASA 3V50A 4B4ZA 3MZFA 3QHYA 4LV2A 2EXBA 1KVLA 1BULA 1HD8A 3IF6A 4O7DA 4UA7A 1PZOA 2B5RA 3ZCZA 3G32A 4WZ5C 3M6HA 3N4IA 2JE5A 3VFHA 1ONGA 3V3SA 1IYSA 4QHCA 3M2KA 4Y0TA 1XXMA 3O86A 3VSLA 1E4DA 4E3KA 3ZDJA 3UY6A 2WAFA 3O87A 3RXXA 1GHMA 4BL2A 4N1HA 1JTGA 1BT5A 4S2PA 4WEJA 3BM6A 4BJPA 4OPQA 4OPZA 1NZUA 3LO7A 5FI7A 2IWCA 4EBPA 5EVIB 1YLYA 3W8KA 5GLAA 4JBFA 4C6YA 3NC8A 4E3MA 4GDNA 5FQMA 3TG9A 2R9WA 2Q9NA 3DWKA 3G2ZA 3VP1A 5FAPA 2HDUA 3LY3A 3V5MA 3HUMA 1SDEA 1GA0A 1BTLA 4YINA 3RXWA 2XFSA 1O7EA 1FOFA 2WGVA 2XEPA 3WS0A 5A92A 5KZHA 1K25A 3GR2A 2XQZA 3IWQA 4P87A 4EBLA 1YLTA 2J9PA 2A3UA 5F83A 3C5AA 4X68A 1FR1A 3N8RA 2C6WB 4FH4A 4M3KA 3WS1A 3ZG0A 1GHIA 1WE4A 5CRFA 1G68A 3UE3A 1H8YA 1M6KA 4HEFA 1I5QA 3TOIA 1IYPA 1MBLA 3UDFA 1G6AA 3W4PA 1YMXA 4EWFA 2XGNA 1PZPA 1W79A 3AGDA 2H0TA 1TEMA 3BEBA 3VP0A 2WZZA 3C4PA 2VGKA 1H5XA 2Y2PA 1S0WA 1SCWA 4S2OA 3WS5A 2HDQA 3N8SA 1CEFA 5HARA 1Z6FA 1K55A 5AQAA 2PBYA 1VM1A 2WGWA 1HZOA 3WWXA 5HL1A 2ZC4B 4K0WA 1Q2PA 4WBGA 4BLMA 3HLEA 2VGJA 2HDRA 3HVFA 1GCEA 1FQGA 1MPLA 2XF3A 3Q1FA 4KQRA 3MKEA 3HLCA 3FZCA 4EBNA 2QPNA 1NYMA 3PBQA 4FH2A 3Q7VA 3S4XA 3M2JA 3VOYA 2ZLYA 1K6RA 2Y55A 3ZGAB 1PWGA 3IH9A 1K6SA 2V2FF 3DTMA 5DF8A 3Q82A 1W7FA 2X01A 3QNBA 3WRZA 3GTCA 3UDXA 4BL3A 5DF7A 3ZG7B 4QJGA 2EX6A 5CTMA 4NETA 4OH0A 4GD6A 4JF6A 5EOEA 3BECA 1DJCA 2CC1A 1NYYA 3CG5A 3I7JA 3BLSA 4MNRA 1EI5A 1PWCA 3NDEA 4RX2A 5A91A 4KG6A 4S2LA 4GDBA 2Y2HA 3C4OA 2XK1A 2ZQ9A 4KQOA 3EQUA 4MBHA 2ZM0A 3NDGA 1M40A 2EX2A 1KGFA 1CI9A 3UE0A 3A3DA 5FQJA 4E6XA 4QU3A 4R23A 1W8QA 4OPRA 4WM9A 5EPHA 1L0GA 4E3NA 2P9VA 4QD4A 3UN7A 3BFFA 2Y2IA 2WK0A 4ZBEA 4Z9QA 4RA7A 1MWSA 1YLPA 3QNCA 1LLBA 1PI4A 3AGEA 4XUXA 4JF5A 3VP2A 3NBLA 4X69A 3NCKA 3UE1A 1TDLA 4R3BA 5CEBA 4LV3A 4UHUA 1JWVA 2ZQ7A 4K91A 3O88A 3MXSA 3WS4A 5E43A 5TGFA 1ES2A 4QY5A 3MBZA 3SOIA 3C7VA 2JC7A 4X56A 4RYEA 2Y2LA 4KG5A 3TSGA 3HBRA 1BUEA 5A93A 1YT4A 5HW3A 1SHVA 4WZ4A 4S2JA 3HL9A 5F1GA 3G35A 1E3UA 1XA7A 2IWBA 1QMFA 4N9LA 2X71A 3IWOA 4U3TA 1JWPA 4GB7A 2Y91A 2P9VB 2BG1A 5DTSA 5EVID 2ZC7A 4ZAMA 3CZDA 3PTEA 4UAAA 3SS4A 2ZQ8A 5AQ9A 4PM9A 3HUOA 5FI2A 5HAPA 4R1GA 1DY6A 3NIAA 4WMCD 5CHJA 3BLMA 4BD1A 3LY4A 5CGXA 1FSYA 3ZVTA 3VSKA 4ZJ1A 5A90A 1XA1A 5GHXA 1KE3A 3ZVWA 1IKIA 1Y54A 1XPBA 3PBRA 4U0TA 4P85A 2ZC3B 1S6RA 1ALQA 4YFMA 5EVIC 4N1XA 5JYOA 2EXAA 2WGIA 3MFDA 3IWIA 1NZOA 5FDHA 3PBTA 5HX9A 2WKEA 5F1FA 4R3JA 2RL3A 4KZ9A 1MY8A 3MZEA 4KZBA 5CHUA 4ZJ3A 2X02A 1L0EA 4C75A 4H8RA 4LENA 4OOYA 1PYYA 1JTDA 1SDNA 2Z2MB 3GRJA 3SS5A 4IBXA 2Q9MA 3BRMA 3HUNA 3Q7VB 5FQKA 1IELA 3PBNA 4S2KA 2WZXA 2J9OA 3ZNTA 2EFXA 4DF6A 5GL9A 1QMEA 1ERMA 2QZ6A 2OSUA 4OLGA 4OQGA 4S2MA 5TR7A 4F94A 2ZM2A 4QY6A 5EECA 1MKIA 3ZG9B 2DCFA 4L0LA 2HPBA 3ZG5A 1N4OA 3ISGA 4B88A 4KZ6A 3O3VA 4R0QA 3BYDA 1DJBA 1YQSA 1KDWA 3IXHA 4PMAA 3V3RA 1RCJA 4BENA 1PI5A 3SH7A 4WEKA 1BLCA 3OZHA 2GDNA 5M1AA 3OCLA 1ES3A 2PU4A 1IYOA 2Y2GA 4MBKA 4DE0A 2XH9A 4HESA 3UPOA 4S2IA 4R4SA 4E3IA 3BFGA 1K54C 1YLJA 3WRTA 3OPPA 2ZQAA 2XDMA 5E2FA 2WKHA 3CMZA 2H5SA 3G2YA 1FCOA 4LV0A 4RX3A 5CERA 3MXRA 1K4EA 4UA9A 1I2WA 5I94A 2ZC5B 1LI0A 3BFEA 1BLSA 4KZ4A 3N6IA 5GLDA 1XGIA 4IEDA 2G2WA 3IF5A 1FR6A 2H10A 1FCNA 1PWDA 4KZ3A 5TFQA 4XXRA 2OLUA 2PU2A 5FATA 5GLCA 2Y2MA 4EQIA 1LHYA 5M19A 2ZMAA 1ESUA 1K55C 3A3EA 1ES4A 5BOHA 4WELA 5EVIA 3GV9A 3UO9A 5CGWA 4DE3A 1KE4A 3PBSA 1EROA 3N8LA 4DRTA 1NY0A 3NY4A 4GD8A 1E3UD 4E3OA 1L0DA 2Y2JA 4X53A 1CEGA 1SKFA 3FYZA 2WAEA 3G4PA 4QB8A 3DW0A 1BSGA 2RCXA 5CXWA 4OPYA 3NI9A 2EX8A 3IXDA 3S22A 1XP4A 1KDSA 5E2GA 5CECA 4KENB 4GZBA 1NXYA 4HBUA 3OPHA 3E2KA 4KZ5A 1TDGA 2DRWA 2Y59A 3OPRA 4ID4A 4E6WA 3VP4A 4PM7A 2BLSA 3G30A 5CTNA 4DKIA 3M6BA 5AQ7A 4PM5A 2C5WB 4N92A 3PAEA 2HP6A 3GSGA 4A5RA 3D4FA 1HTZA 3P09A 4JF4A 4JXGA 1NRFA 1PIOA 3MZDA 1K38A 4JKTA 1XGJA 2P74A 1K54A 1H8ZA 4GOGA 2XD1A 4EV4A 1LL9A 3IF6C 3AGFA 2HDSA 4XUZA 2Y2NA 3ZNYA 2Y2QA 3PAGA 5U47A 3ITAA 4LCLA 1ZKJA 4E3LA 4E3JA 2WADA 2V20A 3V39A 4WYYA 3HLBA 2Y2OA 1K57C 4FCFA 1JWZA 5EE8A 4C3QA 3HLGA 2ZM8A 4DXCA 4KZ7A 3IQAA 3ITBA 4LCMA 4EUZA 4KZAA 2UWXA 4IVIA 4PM8A 2EFUA 1E25A 5FSRA 2J8YA 1DJAA 2Y2KA 3UNWA 1MWTA 1ZC2A 2XFTA 3LEZA 4FD8A 3A3FA 3SH8A 3E2LA 1PW8A 4PPRA 3GQZA 5DTTA 4MBFA 2XD5A 1BLPA 3FKWA 3SH9A 5GHZA 2H0YA 4OKPA 4JXSA 1OMEA 1EWZA 4Q8IA 5DTKA 4OP8A 3N7WA 5FAOA 3BFDA 5HAIA 2FFYA 2ZJ9A 3WS2A 4KG2A 4OQIA 1I2SA 4BD0A 3OC2A 4JXWA 3VFFA 3Q7ZA 1HVBA 1YLWA 4OVDA 1ESIA 3DWZA 3HLWA 2IWDA 1W5DA 3VMAA 1YMSA 3FKVA 2R9XA 4DE2A 1BLHA 4LV1A 1WYCA 5HAQA 3B3XA 1K56D 3PBOA 5F82A 4OOMA 1KE0A 3GVBA 5JYPA 4OOLA 2ZQCA 4OP5A 4MLLA 4RVAA 4NK3A 4P0MA 5E2HA 2HP9A 5E2EA 4CJNA 1XX2A 1PW1A 3IHAA 2ZD8A 5GHYA 3IT9A 1GA9A 3EQVA 4S2NC 4Y7PA 5EOOA 3UDIA 1FSWA 3BFCA 3SS3A 3S1YA 3HREA 1MWUA 4DDSA 1MXOA 1CI8A 4R4RA 1LL5A 4ZTKA 4KQQA 5AQBA 3ZG8B 2J7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ES5 A;  5EUA A;  2E8I A;  2HP5 A;  1K4F A;  2V1Z A;  4OLD A;  5HFO A;  1NJ4 A;  4ZJ2 A;  3VP3 A;  2WGW B;  3HLD A;  2JBF A;  5FA7 A;  3OCN A;  3CJM A;  1TVF A;  3OPL A;  3G31 A;  1IKG A;  4FSF A;  1K56 A;  3W4Q A;  5CGS A;  3IXB A;  4GN2 A;  5KMW A;  4DE1 A;  2Z2L B;  4U0X A;  3P98 A;  2G2U A;  4Y0O A;  4D2O A;  4P6B A;  1BZA A;  1RGZ A;  2QMI A;  4JPM A;  4JXV A;  2WUQ A;  2A49 A;  4Y0U A;  5FAQ A;  1YM1 A;  2WKI A;  5DVA A;  1YLZ A;  4B4X A;  1XKZ A;  3LCE A;  3C7U A;  4DXB A;  2ZC6 B;  4BQM A;  5G18 A;  1FCM A;  5EVL A;  2Y4A A;  5FI6 A;  4K0X A;  3MKF A;  2WYX A;  4IVK A;  4KZ8 A;  3IHB A;  1ONH A;  5FQI A;  3Q81 A;  2EX9 A;  1RGY A;  4S2N A;  1KVM A;  5M18 A;  3GMW A;  3JYI A;  1IYQ A;  3Q07 A;  4MEZ A;  1N9B A;  4OQH A;  1KGG A;  3ZHH A;  3HLF A;  3G34 A;  3UPP A;  5KSC A;  1VQQ A;  3FV7 A;  4OQ0 A;  4WZ5 A;  1O07 A;  1L2S A;  4HBT A;  2OV5 A;  1WYB A;  1AXB A;  5CED A;  4N9K A;  4WMC A;  5KSH A;  5D3O A;  1GHP A;  1MWR A;  2XR0 A;  5IHV A;  2FFF B;  1C3B A;  5DF9 A;  2ZQD A;  1W8Y A;  2DNS A;  1LI9 A;  2OLV A;  2I72 A;  5FQ9 A;  1IEM A;  3RJU A;  1KGE A;  5GLB A;  1L0F A;  1ZG6 A;  3ZFZ A;  2JCH A;  3IXG A;  4PM6 A;  1J9M A;  4ZDX A;  4IBR A;  1CK3 A;  3W4O A;  4DDY A;  4UA6 A;  3IF6 B;  5J8X A;  5L2F A;  3IH8 A;  4GNU A;  4GKU A;  3A3I A;  4OON A;  1ERQ A;  1JVJ A;  4X6T A;  1Q2Q A;  2XLN A;  1ZG4 A;  1K57 A;  5CHM A;  1U60 A;  3A3J A;  3FWL A;  5FQQ A;  4JLF A;  4X55 A;  3UPN A;  3VOZ A;  1RP5 A;  4CPK A;  5FAS A;  3V50 A;  4B4Z A;  3MZF A;  3QHY A;  4LV2 A;  2EXB A;  1KVL A;  1BUL A;  1HD8 A;  3IF6 A;  4O7D A;  4UA7 A;  1PZO A;  2B5R A;  3ZCZ A;  3G32 A;  4WZ5 C;  3M6H A;  3N4I A;  2JE5 A;  3VFH A;  1ONG A;  3V3S A;  1IYS A;  4QHC A;  3M2K A;  4Y0T A;  1XXM A;  3O86 A;  3VSL A;  1E4D A;  4E3K A;  3ZDJ A;  3UY6 A;  2WAF A;  3O87 A;  3RXX A;  1GHM A;  4BL2 A;  4N1H A;  1JTG A;  1BT5 A;  4S2P A;  4WEJ A;  3BM6 A;  4BJP A;  4OPQ A;  4OPZ A;  1NZU A;  3LO7 A;  5FI7 A;  2IWC A;  4EBP A;  5EVI B;  1YLY A;  3W8K A;  5GLA A;  4JBF A;  4C6Y A;  3NC8 A;  4E3M A;  4GDN A;  5FQM A;  3TG9 A;  2R9W A;  2Q9N A;  3DWK A;  3G2Z A;  3VP1 A;  5FAP A;  2HDU A;  3LY3 A;  3V5M A;  3HUM A;  1SDE A;  1GA0 A;  1BTL A;  4YIN A;  3RXW A;  2XFS A;  1O7E A;  1FOF A;  2WGV A;  2XEP A;  3WS0 A;  5A92 A;  5KZH A;  1K25 A;  3GR2 A;  2XQZ A;  3IWQ A;  4P87 A;  4EBL A;  1YLT A;  2J9P A;  2A3U A;  5F83 A;  3C5A A;  4X68 A;  1FR1 A;  3N8R A;  2C6W B;  4FH4 A;  4M3K A;  3WS1 A;  3ZG0 A;  1GHI A;  1WE4 A;  5CRF A;  1G68 A;  3UE3 A;  1H8Y A;  1M6K A;  4HEF A;  1I5Q A;  3TOI A;  1IYP A;  1MBL A;  3UDF A;  1G6A A;  3W4P A;  1YMX A;  4EWF A;  2XGN A;  1PZP A;  1W79 A;  3AGD A;  2H0T A;  1TEM A;  3BEB A;  3VP0 A;  2WZZ A;  3C4P A;  2VGK A;  1H5X A;  2Y2P A;  1S0W A;  1SCW A;  4S2O A;  3WS5 A;  2HDQ A;  3N8S A;  1CEF A;  5HAR A;  1Z6F A;  1K55 A;  5AQA A;  2PBY A;  1VM1 A;  2WGW A;  1HZO A;  3WWX A;  5HL1 A;  2ZC4 B;  4K0W A;  1Q2P A;  4WBG A;  4BLM A;  3HLE A;  2VGJ A;  2HDR A;  3HVF A;  1GCE A;  1FQG A;  1MPL A;  2XF3 A;  3Q1F A;  4KQR A;  3MKE A;  3HLC A;  3FZC A;  4EBN A;  2QPN A;  1NYM A;  3PBQ A;  4FH2 A;  3Q7V A;  3S4X A;  3M2J A;  3VOY A;  2ZLY A;  1K6R A;  2Y55 A;  3ZGA B;  1PWG A;  3IH9 A;  1K6S A;  2V2F F;  3DTM A;  5DF8 A;  3Q82 A;  1W7F A;  2X01 A;  3QNB A;  3WRZ A;  3GTC A;  3UDX A;  4BL3 A;  5DF7 A;  3ZG7 B;  4QJG A;  2EX6 A;  5CTM A;  4NET A;  4OH0 A;  4GD6 A;  4JF6 A;  5EOE A;  3BEC A;  1DJC A;  2CC1 A;  1NYY A;  3CG5 A;  3I7J A;  3BLS A;  4MNR A;  1EI5 A;  1PWC A;  3NDE A;  4RX2 A;  5A91 A;  4KG6 A;  4S2L A;  4GDB A;  2Y2H A;  3C4O A;  2XK1 A;  2ZQ9 A;  4KQO A;  3EQU A;  4MBH A;  2ZM0 A;  3NDG A;  1M40 A;  2EX2 A;  1KGF A;  1CI9 A;  3UE0 A;  3A3D A;  5FQJ A;  4E6X A;  4QU3 A;  4R23 A;  1W8Q A;  4OPR A;  4WM9 A;  5EPH A;  1L0G A;  4E3N A;  2P9V A;  4QD4 A;  3UN7 A;  3BFF A;  2Y2I A;  2WK0 A;  4ZBE A;  4Z9Q A;  4RA7 A;  1MWS A;  1YLP A;  3QNC A;  1LLB A;  1PI4 A;  3AGE A;  4XUX A;  4JF5 A;  3VP2 A;  3NBL A;  4X69 A;  3NCK A;  3UE1 A;  1TDL A;  4R3B A;  5CEB A;  4LV3 A;  4UHU A;  1JWV A;  2ZQ7 A;  4K91 A;  3O88 A;  3MXS A;  3WS4 A;  5E43 A;  5TGF A;  1ES2 A;  4QY5 A;  3MBZ A;  3SOI A;  3C7V A;  2JC7 A;  4X56 A;  4RYE A;  2Y2L A;  4KG5 A;  3TSG A;  3HBR A;  1BUE A;  5A93 A;  1YT4 A;  5HW3 A;  1SHV A;  4WZ4 A;  4S2J A;  3HL9 A;  5F1G A;  3G35 A;  1E3U A;  1XA7 A;  2IWB A;  1QMF A;  4N9L A;  2X71 A;  3IWO A;  4U3T A;  1JWP A;  4GB7 A;  2Y91 A;  2P9V B;  2BG1 A;  5DTS A;  5EVI D;  2ZC7 A;  4ZAM A;  3CZD A;  3PTE A;  4UAA A;  3SS4 A;  2ZQ8 A;  5AQ9 A;  4PM9 A;  3HUO A;  5FI2 A;  5HAP A;  4R1G A;  1DY6 A;  3NIA A;  4WMC D;  5CHJ A;  3BLM A;  4BD1 A;  3LY4 A;  5CGX A;  1FSY A;  3ZVT A;  3VSK A;  4ZJ1 A;  5A90 A;  1XA1 A;  5GHX A;  1KE3 A;  3ZVW A;  1IKI A;  1Y54 A;  1XPB A;  3PBR A;  4U0T A;  4P85 A;  2ZC3 B;  1S6R A;  1ALQ A;  4YFM A;  5EVI C;  4N1X A;  5JYO A;  2EXA A;  2WGI A;  3MFD A;  3IWI A;  1NZO A;  5FDH A;  3PBT A;  5HX9 A;  2WKE A;  5F1F A;  4R3J A;  2RL3 A;  4KZ9 A;  1MY8 A;  3MZE A;  4KZB A;  5CHU A;  4ZJ3 A;  2X02 A;  1L0E A;  4C75 A;  4H8R A;  4LEN A;  4OOY A;  1PYY A;  1JTD A;  1SDN A;  2Z2M B;  3GRJ A;  3SS5 A;  4IBX A;  2Q9M A;  3BRM A;  3HUN A;  3Q7V B;  5FQK A;  1IEL A;  3PBN A;  4S2K A;  2WZX A;  2J9O A;  3ZNT A;  2EFX A;  4DF6 A;  5GL9 A;  1QME A;  1ERM A;  2QZ6 A;  2OSU A;  4OLG A;  4OQG A;  4S2M A;  5TR7 A;  4F94 A;  2ZM2 A;  4QY6 A;  5EEC A;  1MKI A;  3ZG9 B;  2DCF A;  4L0L A;  2HPB A;  3ZG5 A;  1N4O A;  3ISG A;  4B88 A;  4KZ6 A;  3O3V A;  4R0Q A;  3BYD A;  1DJB A;  1YQS A;  1KDW A;  3IXH A;  4PMA A;  3V3R A;  1RCJ A;  4BEN A;  1PI5 A;  3SH7 A;  4WEK A;  1BLC A;  3OZH A;  2GDN A;  5M1A A;  3OCL A;  1ES3 A;  2PU4 A;  1IYO A;  2Y2G A;  4MBK A;  4DE0 A;  2XH9 A;  4HES A;  3UPO A;  4S2I A;  4R4S A;  4E3I A;  3BFG A;  1K54 C;  1YLJ A;  3WRT A;  3OPP A;  2ZQA A;  2XDM A;  5E2F A;  2WKH A;  3CMZ A;  2H5S A;  3G2Y A;  1FCO A;  4LV0 A;  4RX3 A;  5CER A;  3MXR A;  1K4E A;  4UA9 A;  1I2W A;  5I94 A;  2ZC5 B;  1LI0 A;  3BFE A;  1BLS A;  4KZ4 A;  3N6I A;  5GLD A;  1XGI A;  4IED A;  2G2W A;  3IF5 A;  1FR6 A;  2H10 A;  1FCN A;  1PWD A;  4KZ3 A;  5TFQ A;  4XXR A;  2OLU A;  2PU2 A;  5FAT A;  5GLC A;  2Y2M A;  4EQI A;  1LHY A;  5M19 A;  2ZMA A;  1ESU A;  1K55 C;  3A3E A;  1ES4 A;  5BOH A;  4WEL A;  5EVI A;  3GV9 A;  3UO9 A;  5CGW A;  4DE3 A;  1KE4 A;  3PBS A;  1ERO A;  3N8L A;  4DRT A;  1NY0 A;  3NY4 A;  4GD8 A;  1E3U D;  4E3O A;  1L0D A;  2Y2J A;  4X53 A;  1CEG A;  1SKF A;  3FYZ A;  2WAE A;  3G4P A;  4QB8 A;  3DW0 A;  1BSG A;  2RCX A;  5CXW A;  4OPY A;  3NI9 A;  2EX8 A;  3IXD A;  3S22 A;  1XP4 A;  1KDS A;  5E2G A;  5CEC A;  4KEN B;  4GZB A;  1NXY A;  4HBU A;  3OPH A;  3E2K A;  4KZ5 A;  1TDG A;  2DRW A;  2Y59 A;  3OPR A;  4ID4 A;  4E6W A;  3VP4 A;  4PM7 A;  2BLS A;  3G30 A;  5CTN A;  4DKI A;  3M6B A;  5AQ7 A;  4PM5 A;  2C5W B;  4N92 A;  3PAE A;  2HP6 A;  3GSG A;  4A5R A;  3D4F A;  1HTZ A;  3P09 A;  4JF4 A;  4JXG A;  1NRF A;  1PIO A;  3MZD A;  1K38 A;  4JKT A;  1XGJ A;  2P74 A;  1K54 A;  1H8Z A;  4GOG A;  2XD1 A;  4EV4 A;  1LL9 A;  3IF6 C;  3AGF A;  2HDS A;  4XUZ A;  2Y2N A;  3ZNY A;  2Y2Q A;  3PAG A;  5U47 A;  3ITA A;  4LCL A;  1ZKJ A;  4E3L A;  4E3J A;  2WAD A;  2V20 A;  3V39 A;  4WYY A;  3HLB A;  2Y2O A;  1K57 C;  4FCF A;  1JWZ A;  5EE8 A;  4C3Q A;  3HLG A;  2ZM8 A;  4DXC A;  4KZ7 A;  3IQA A;  3ITB A;  4LCM A;  4EUZ A;  4KZA A;  2UWX A;  4IVI A;  4PM8 A;  2EFU A;  1E25 A;  5FSR A;  2J8Y A;  1DJA A;  2Y2K A;  3UNW A;  1MWT A;  1ZC2 A;  2XFT A;  3LEZ A;  4FD8 A;  3A3F A;  3SH8 A;  3E2L A;  1PW8 A;  4PPR A;  3GQZ A;  5DTT A;  4MBF A;  2XD5 A;  1BLP A;  3FKW A;  3SH9 A;  5GHZ A;  2H0Y A;  4OKP A;  4JXS A;  1OME A;  1EWZ A;  4Q8I A;  5DTK A;  4OP8 A;  3N7W A;  5FAO A;  3BFD A;  5HAI A;  2FFY A;  2ZJ9 A;  3WS2 A;  4KG2 A;  4OQI A;  1I2S A;  4BD0 A;  3OC2 A;  4JXW A;  3VFF A;  3Q7Z A;  1HVB A;  1YLW A;  4OVD A;  1ESI A;  3DWZ A;  3HLW A;  2IWD A;  1W5D A;  3VMA A;  1YMS A;  3FKV A;  2R9X A;  4DE2 A;  1BLH A;  4LV1 A;  1WYC A;  5HAQ A;  3B3X A;  1K56 D;  3PBO A;  5F82 A;  4OOM A;  1KE0 A;  3GVB A;  5JYP A;  4OOL A;  2ZQC A;  4OP5 A;  4MLL A;  4RVA A;  4NK3 A;  4P0M A;  5E2H A;  2HP9 A;  5E2E A;  4CJN A;  1XX2 A;  1PW1 A;  3IHA A;  2ZD8 A;  5GHY A;  3IT9 A;  1GA9 A;  3EQV A;  4S2N C;  4Y7P A;  5EOO A;  3UDI A;  1FSW A;  3BFC A;  3SS3 A;  3S1Y A;  3HRE A;  1MWU A;  4DDS A;  1MXO A;  1CI8 A;  4R4R A;  1LL5 A;  4ZTK A;  4KQQ A;  5AQB A;  3ZG8 B;  2J7V A; 
#chains in the Genus database with same CATH topology
 2W1T A;  1XJ3 A;  2HP5 A;  1K4F A;  5HFO A;  4ZJ2 A;  3HLD A;  2JBF A;  4LPZ A;  2FH5 A;  3OCN A;  3F1O A;  5TBM A;  3OPL A;  3G31 A;  1W63 M;  2XRO A;  1K56 A;  4DJ2 A;  4U0X A;  4P6B A;  1J3W A;  1X0O A;  5F68 A;  3LFV A;  2V9A A;  2WUQ A;  4Y0U A;  2G7U A;  5DVA A;  1XKZ A;  2ZC6 B;  1FCM A;  1F5M A;  3MKF A;  4CLC A;  1L3L A;  2WYX A;  4IVK A;  3IHB A;  1ONH A;  3GMW A;  3JYI A;  4R3A A;  1KGG A;  3ZHH A;  3FV7 A;  4OQ0 A;  1L2S A;  1WYB A;  5CED A;  4N9K A;  4WMC A;  1GHP A;  1MWR A;  5C5K A;  5IHV A;  1C3B A;  1A0K A;  1L0F A;  2GX5 A;  3KX0 X;  1CK3 A;  5J8X A;  4GKU A;  4R38 A;  1Q2Q A;  3CUE C;  3FWL A;  1DP6 A;  2AVX A;  3CWF A;  5FAS A;  3H7W A;  4LV2 A;  1BUL A;  3LR5 A;  3N4I A;  3NOT C;  1ONG A;  2M1C A;  1IYS A;  4Y0T A;  3BY9 A;  4ETX A;  1E4D A;  1F2K A;  4EW7 A;  3ZDJ A;  3T1X A;  3O87 A;  1BT5 A;  3T12 B;  3BM6 A;  3CIT A;  5I5L A;  1H0M A;  1XFN A;  3GEC A;  5FI7 A;  2LB5 A;  5EVI B;  5GLA A;  1T18 A;  5HPF A;  5HWW A;  4E3M A;  2L0W A;  3FPW A;  2R9W A;  3LY3 A;  4UQI S;  3V39 A;  1GA0 A;  1T1A A;  2XFS A;  5A92 A;  3IWQ A;  4P87 A;  1FR1 A;  5CRF A;  1M6K A;  4I39 A;  4HEF A;  1IYP A;  1MBL A;  3W4P A;  1G6A A;  5EV0 A;  5IS1 A;  4Y17 A;  3BEB A;  3HJK A;  1YAX A;  2XSS A;  2Y2P A;  3WS5 A;  3F1O B;  5TBM B;  1K55 A;  1VEU A;  4PKY G;  5HL1 A;  2ZC4 B;  2HDR A;  1GCE A;  1FQG A;  1MPL A;  3FZC A;  2QPN A;  2E8J A;  2V0W A;  3MR0 A;  3VOY A;  4JGQ A;  1K6R A;  3H9W A;  3W2Z A;  2K2N A;  3IH9 A;  3DTK A;  2X01 A;  3QNB A;  3GTC A;  2Q0O A;  1VEU B;  4HJ3 A;  3NOU C;  1FIK A;  3CG5 A;  3I7J A;  4KG6 A;  4GDB A;  3EQU A;  5L10 A;  1KGF A;  5FQJ A;  3CPT B;  4GLQ A;  4QU3 A;  4R23 A;  3LGO A;  3JVV A;  2P9V A;  3BFF A;  4FOF A;  2WK0 A;  4ZBE A;  1MWS A;  3VE4 A;  3QNC A;  2Y79 A;  1PI4 A;  3AGE A;  4XUX A;  2WKP A;  3VP2 A;  3FG8 A;  4UHU A;  3EGX C;  4K91 A;  5TGF A;  3LUQ A;  4QY5 A;  2VLG A;  1CF0 A;  3TSG A;  3HBR A;  3HL9 A;  1E3U A;  4UQI M;  4N9L A;  2X71 A;  5HSQ A;  1NWZ A;  2P9V B;  3PTE A;  2ZQ8 A;  3LY4 A;  3VSK A;  5A8B A;  1T19 A;  1IKI A;  2ZC3 B;  3MXQ A;  1S6R A;  2HZ5 A;  1OT9 A;  2WGI A;  3MFD A;  4HH3 A;  5HX9 A;  5F1F A;  4KZ9 A;  3MZE A;  4H8R A;  5F69 A;  1JTD A;  3GRJ A;  4LRZ E;  1LSW A;  3Q7V B;  4S2K A;  4HNB A;  4F3L A;  2J9O A;  3OBF A;  4IJG A;  4DF6 A;  4F94 A;  2OAP 1;  4OQG A;  2ZM2 A;  5EEC A;  4KZ6 A;  3V3R A;  4PMA A;  4BEN A;  3SH7 A;  4WEK A;  1BLC A;  3MSH A;  4G3K A;  2QWS A;  2Y2G A;  4DE0 A;  3NOP C;  4HES A;  4S2I A;  3BJN A;  4R4S A;  2JKT I;  3D3O A;  3UB7 A;  3WRT A;  5E2F A;  3G2Y A;  4L9E A;  4YOF A;  1I2W A;  2ZC5 B;  1LI0 A;  3BFE A;  4KZ4 A;  4HQA A;  1ACF A;  5TFQ A;  2G2W A;  5K5B A;  2D01 A;  4EQI A;  1ESU A;  2VV8 A;  2W1T B;  4DE3 A;  1KE4 A;  4ETZ A;  1L0D A;  3FYZ A;  4OPY A;  4MN5 A;  2BTF P;  2EX8 A;  1STZ A;  1KDS A;  2V8C A;  5E2G A;  4II7 A;  3PYP A;  3F1P B;  2DRW A;  1TF1 A;  2Y59 A;  3C8C A;  2XA7 M;  1PFL A;  3G30 A;  3MQO A;  5CTN A;  3A0R A;  2NUP C;  3GSG A;  1SKO A;  2PYP A;  4A5R A;  3D4F A;  4JF4 A;  1T1C A;  2XRN A;  1H8Z A;  1OTD A;  3RH8 B;  4X25 A;  1LL9 A;  3T4K A;  4JGO A;  4XUZ A;  4MMN A;  2PHY A;  3BQA A;  5EM1 A;  2INW A;  2V20 A;  2Y2O A;  5EE8 A;  5HPI A;  4I3J A;  4PM8 A;  3TE8 A;  2EFU A;  3KSH A;  5J4E A;  1H3Q A;  1ZC2 A;  3A3F A;  3R4K A;  2VA0 A;  3E2L A;  1PW8 A;  1G6O A;  3GQZ A;  1BLP A;  4GJ4 A;  4MN6 A;  5GHZ A;  1S1Z A;  4QWO A;  4OKP A;  1OME A;  3N7W A;  1S4R A;  4OQI A;  1I2S A;  4OVD A;  2IWD A;  4Y15 A;  1BLH A;  4LV1 A;  5HAQ A;  2L1M A;  1KE0 A;  4OOL A;  2JKR M;  2KOI A;  4IUK A;  3NHQ A;  5E2E A;  1PW1 A;  1GA9 A;  1FSW A;  3SS3 A;  3S1Y A;  1OPX A;  2BAS A;  5AQB A;  3LI8 A;  2E8I A;  2V1Z A;  4OLD A;  3T50 A;  1TVF A;  3IXB A;  4GN2 A;  1HLU P;  5KMW A;  2Z2L B;  4D2O A;  2QMI A;  1RGZ A;  4JXV A;  4NEE D;  4BQM A;  5G18 A;  2ZL1 B;  2J80 A;  5M18 A;  5TJJ A;  3ZQ5 A;  4OQH A;  3HLF A;  3G34 A;  4WLA A;  1VQQ A;  1AXB A;  4HH2 A;  4BWI A;  5KSH A;  5D3O A;  5DF9 A;  2ZQD A;  1UGU A;  5HZH A;  2OLV A;  1IEM A;  1K0K A;  3IXG A;  4PM6 A;  1MZU A;  5L2F A;  3F1N B;  3CPT A;  3BW6 A;  2J3W A;  1ZG4 A;  5CHM A;  1U60 A;  3UPN A;  4JLF A;  3K3D A;  4X55 A;  3VOZ A;  4GW9 A;  3QHY A;  2EXB A;  1KVL A;  3PHY A;  4QPR A;  4UA7 A;  4O7D A;  1PZO A;  3ZCZ A;  2JE5 A;  3VFH A;  3H82 A;  5G4Z A;  4NXF A;  4QHC A;  3M2K A;  2XA7 S;  2KLI A;  4E3K A;  3UY6 A;  2WAF A;  4BL2 A;  2O9C A;  4N1H A;  1JTG A;  1OJ5 A;  2GNX A;  4S2P A;  4WEJ A;  2YKH A;  4BJP A;  1IFQ A;  4OPZ A;  4HP9 A;  4ESP A;  2IWC A;  4EBP A;  1YLY A;  3DWK A;  3G2Z A;  3T4T A;  1WA9 A;  3V5M A;  2W1R A;  1CJF A;  4EEP A;  1K25 A;  2XQZ A;  4EBL A;  2A3U A;  3R7W B;  4XT2 B;  4X68 A;  3S7Q A;  1OJG A;  2CMN A;  4FH4 A;  4M3K A;  3WS1 A;  3ZG0 A;  1GHI A;  1F9I A;  1WE4 A;  1H8Y A;  1I5Q A;  3TOI A;  2XGN A;  1PZP A;  1W79 A;  3AGD A;  2H0T A;  1DP8 A;  2VGK A;  3LYX A;  3C2W A;  1H5X A;  3JVU A;  2QJ5 A;  3R7W A;  2HDQ A;  3N8S A;  3UE6 A;  1Z6F A;  2WGW A;  2M7U A;  2I9V A;  4WBG A;  3HVF A;  3Q1F A;  1G28 A;  4ME4 A;  3S4X A;  2Y55 A;  1PWG A;  3B47 A;  3UDX A;  4R6L A;  4NET A;  1IOU A;  1DJC A;  2CC1 A;  1EI5 A;  3NDE A;  4RX2 A;  4S2L A;  2KX6 A;  2Y2H A;  3C4O A;  2ZQ9 A;  5HD3 A;  2L4R A;  1YPR A;  3IS2 B;  3UB9 A;  1YSQ A;  2EX2 A;  2OWH A;  4NG2 A;  3UE0 A;  5FDS A;  4E6X A;  1S67 L;  1L0G A;  4OPR A;  2YKF A;  4X1M A;  3QP6 A;  4QD4 A;  2Y2I A;  3E4O A;  2OAQ 1;  4RA7 A;  1YLP A;  2ZMV A;  5IU1 A;  3C38 A;  2HGV A;  4YWZ A;  3NBL A;  4X69 A;  3UE1 A;  4R3B A;  3WS4 A;  5E43 A;  1V9Z A;  1ES2 A;  3C7V A;  2JC7 A;  3ULF A;  4KG5 A;  3MMH A;  2D02 A;  1SHV A;  4WZ4 A;  4NXG A;  4S2J A;  5HDD A;  2IWB A;  3G35 A;  1QMF A;  1JWP A;  4GB7 A;  3SS4 A;  3CZD A;  4UAA A;  4D60 A;  3HUO A;  3UB8 A;  4WMC D;  3BLM A;  4BD1 A;  1FSY A;  4ZJ1 A;  5A90 A;  1Y54 A;  4U0T A;  3LIA A;  4N1X A;  5JYO A;  2GZA A;  3IWI A;  1NZO A;  3PBT A;  2WKE A;  1MY8 A;  2EWW A;  1CQA A;  4LEN A;  4WL9 A;  2Z6C A;  1SDN A;  4IBX A;  2Q9M A;  1IEL A;  2EFX A;  4EXO A;  1QME A;  2QZ6 A;  2OSU A;  4OLG A;  5TR7 A;  4QY6 A;  1MKI A;  3ZG9 B;  4HJ4 A;  3KYZ A;  3ZG5 A;  1YQS A;  1DJB A;  3IXH A;  1D1J A;  3P7N A;  4GHI A;  1GSW A;  3OZH A;  1ODV A;  4LLO B;  1KOU A;  4KUK A;  5L07 A;  3RFB A;  1TS6 A;  3LID A;  3UME A;  3T1S A;  2H5S A;  4MN7 A;  2W3D A;  4LV0 A;  2QKP A;  2PAV P;  2ZOI A;  1VET B;  1XGI A;  4IED A;  4BBV A;  1V9Y A;  2H10 A;  1FCN A;  5FAT A;  3NJA A;  2Y2M A;  2ZMA A;  3A3E A;  2WKQ A;  3UO9 A;  3PBS A;  4DRT A;  1XJ6 A;  3NY4 A;  4GD8 A;  1E3U D;  4X53 A;  3UB6 A;  3G4P A;  3FPV A;  1BSG A;  5CXW A;  3IXD A;  1XP4 A;  4KEN B;  1NXY A;  2VV7 A;  5DKK A;  3OPH A;  4KZ5 A;  1TDG A;  3OPR A;  4E6W A;  3VP4 A;  4PM7 A;  1BYW A;  3MJQ A;  3TJZ C;  2C5W B;  2HP6 A;  3P09 A;  2QJ7 A;  4KUO A;  4JXG A;  1PIO A;  3MZD A;  1K38 A;  3F1N A;  5G4Y A;  4GOG A;  2XD1 A;  4ZRR A;  3AGF A;  3PAG A;  2QHK A;  2WAD A;  4FCF A;  5DKL A;  4LRY C;  1G5U A;  2UWX A;  2PD7 A;  1P9R A;  2JKF A;  4FD8 A;  2PRF A;  1DP9 A;  3SH9 A;  4JXS A;  1YSP A;  1EWZ A;  2PR5 A;  5HAI A;  4KG2 A;  2VZW A;  1TS0 A;  5EFW A;  1LSV A;  1ESI A;  3DWZ A;  2A24 B;  3FKV A;  2R9X A;  3PXP A;  1WYC A;  3B3X A;  1K56 D;  5JYP A;  4IUH A;  2ZQC A;  2UV0 E;  4NK3 A;  4GHI B;  3EEH A;  4CJN A;  3IHA A;  2ZD8 A;  3IT9 A;  3EQV A;  3V67 A;  3S7P A;  4S2N C;  2PBD P;  3VOL A;  1SZV A;  4JGR A;  4DDS A;  1MXO A;  1CI8 A;  3FC7 A;  2VGL M;  3IX4 A;  4ZTK A;  4KQQ A;  4HIA A;  3ZG8 B;  2J7V A;  5AJG A;  1P0Z A;  1VET A;  5FA7 A;  3CJM A;  4LFU A;  4FSF A;  3SZT A;  5CGS A;  3MQQ A;  4DE1 A;  1UWP X;  3P98 A;  4KQD A;  2A49 A;  5FAQ A;  1YLZ A;  4B4X A;  3LCE A;  3B42 A;  3DAV A;  4KZ8 A;  3QP1 A;  3Q81 A;  1KVM A;  3UB5 P;  1IYQ A;  4DMZ A;  4MEZ A;  2V1A A;  5KSC A;  4BBT A;  4HBT A;  2OV5 A;  4CQH A;  2EWV A;  3CHW P;  2XR0 A;  2FFF B;  1W8Y A;  2DNS A;  1ZHH B;  1LI9 A;  1OT6 A;  2R78 A;  3RJU A;  1KGE A;  5GLB A;  1ZG6 A;  3ZFZ A;  3LR3 A;  4L9G A;  3H82 B;  3W4O A;  4DN0 A;  3IH8 A;  4HP4 A;  4P6Z M;  4H6J A;  1JVJ A;  4HHD A;  4X6T A;  3A3J A;  5FQQ A;  2O9A A;  1NRJ A;  3ICY A;  4CPK A;  3MZF A;  4RQ9 A;  4I38 A;  4PKY A;  3IF6 A;  3G32 A;  3M6H A;  3V3S A;  1XXM A;  3O86 A;  4EET B;  3U4L P;  2K31 A;  4P6Z S;  4OPQ A;  1NZU A;  4C6Y A;  2VGL S;  2JKR I;  4GDN A;  5FQM A;  3VP1 A;  5FAP A;  1OTB A;  4AFI A;  3HUM A;  3WS0 A;  4GS9 B;  1FOF A;  2XEP A;  4LGW A;  5KZH A;  1YLT A;  2O9B A;  5F83 A;  3C5A A;  3N8R A;  3UE3 A;  5FEG A;  3A0S A;  3UDF A;  3UMD A;  3IS2 A;  4EWF A;  1TEM A;  3VP0 A;  3E0Y A;  4R70 A;  4XT2 A;  3D9Y A;  5HAR A;  2PBY A;  1VM1 A;  3RTY A;  3WWX A;  4K0W A;  1Q2P A;  3U2A A;  2XF3 A;  4KQR A;  3MKE A;  2O0Y A;  3HLC A;  1GSV A;  1H8M A;  1NYM A;  4WN5 A;  3Q7V A;  2JKG A;  3M2J A;  2ZLY A;  2PD8 A;  3TW8 A;  2OOL A;  4HOI A;  5DF8 A;  4BL3 A;  3SW1 A;  3LIE A;  3JPU A;  4OH0 A;  2DMW A;  4GD6 A;  2LB9 A;  5J7E A;  2GJ3 A;  3BEC A;  3NEC A;  4MNR A;  3BLS A;  4KQO A;  4MBH A;  3LR0 A;  3NDG A;  1CI9 A;  1Z09 A;  4E3N A;  5LBR A;  5EVE A;  3A0V A;  2VX8 A;  4Z9Q A;  2ZOH A;  3MS6 A;  5L8M A;  3NCK A;  1TDL A;  5CEB A;  4LV3 A;  1JWV A;  3IBR A;  3O88 A;  3MXS A;  1JNU A;  3MBZ A;  4X56 A;  4RYE A;  2Y2L A;  3B33 A;  5A93 A;  1LSX A;  4Y13 A;  4EU0 A;  1XA7 A;  3DBA A;  4U3T A;  2Y91 A;  2BG1 A;  3CLO A;  5EVI D;  2H28 A;  4R1G A;  1DY6 A;  5CHJ A;  5CGX A;  4FTX A;  1XA1 A;  4L9F A;  1XPB A;  3PBR A;  4YFM A;  2HV1 A;  1VB6 A;  1XJ2 A;  2J3T D;  5FDH A;  4Q0I A;  2X02 A;  1L0E A;  4C75 A;  4OOY A;  1PYY A;  3BRM A;  5FQK A;  3ZNT A;  2WZX A;  4IHQ A;  2V0U A;  1ERM A;  4S2M A;  4MCW A;  4L0L A;  2HPB A;  4B88 A;  1KDW A;  3QP4 A;  3TRC A;  5DFY A;  1RCJ A;  1PI5 A;  3GDI A;  5M1A A;  1D06 A;  3OCL A;  1ES3 A;  1LL8 A;  1IYO A;  3BQ8 A;  4MBK A;  3E98 A;  4E3I A;  3BFG A;  1PRQ A;  1TS8 A;  3LIF A;  3OPP A;  3P01 A;  2ZQA A;  2XDM A;  2P08 A;  4O0P A;  1FCO A;  4RX3 A;  5CER A;  3MXR A;  3E4P A;  2PT7 A;  2W3H A;  4EUV A;  3N6I A;  4ARZ B;  1FR6 A;  3MFX A;  4YNR A;  4Y5F A;  1FIL A;  2OLU A;  1LHY A;  3C30 A;  1K55 C;  5HL6 A;  5BOH A;  5EVI A;  3GV9 A;  1GSX A;  3N8L A;  1NY0 A;  2JHE A;  4E3O A;  1CEG A;  1SKF A;  2HJ9 C;  2WAE A;  2RCX A;  3NI9 A;  1F98 A;  5CEC A;  2K7S A;  4Q0J A;  4MDZ A;  5IT5 A;  3T1R A;  4HY8 A;  1LT0 A;  1AWI A;  3H7W B;  3M6B A;  4PM5 A;  3LIB A;  4N92 A;  3PAE A;  1SKO B;  5HDC A;  1HTZ A;  1NRF A;  2W0N A;  4JKT A;  2P74 A;  1P97 A;  2Y2N A;  5AVE A;  1PNE A;  2W3E A;  3ITA A;  1ZKJ A;  1N9O A;  3ZYT A;  1S4S A;  1K57 C;  1JWZ A;  4C3Q A;  3HLG A;  2ZM8 A;  4DJ3 A;  4DXC A;  3IQA A;  3ITB A;  4EUZ A;  4KZA A;  2Y8H A;  4IVI A;  1E25 A;  4FUW A;  1DJA A;  1MWT A;  5CX7 A;  3LIC A;  3SH8 A;  4PPR A;  3O5Y A;  5DTT A;  4MBF A;  4WUJ A;  4ARZ A;  3FKW A;  3IX8 A;  2ZL1 A;  4NXE A;  4Q8I A;  5FAO A;  1P9W A;  4BD0 A;  3OC2 A;  1YLW A;  3HLW A;  4NXB A;  3T4S A;  1YMS A;  4DE2 A;  2PR6 A;  2OWJ A;  3PBO A;  4OOM A;  3GVB A;  4OP5 A;  4RVA A;  1D7E A;  2Z6D A;  4Y7P A;  3UDI A;  4BBU A;  1MWU A;  3S7N A;  2V8F A;  4R4R A;  1LL5 A;  5AVF A;  1ES5 A;  5EUA A;  3IBJ A;  1NJ4 A;  3VP3 A;  2WGW B;  2A2L A;  3BY8 A;  1IKG A;  4I3A A;  3W4Q A;  3D72 A;  2G2U A;  4Y0O A;  1BZA A;  4JPM A;  2W27 A;  1YM1 A;  2WKI A;  2VEA A;  5L09 A;  2JN7 A;  3C7U A;  4DXB A;  5EVL A;  2Y4A A;  5FI6 A;  4K0X A;  5HD5 A;  4JGP A;  3LI9 A;  3L9K A;  5FQI A;  2EX9 A;  1RGY A;  4S2N A;  3Q07 A;  1N9B A;  2VV6 A;  2ACG A;  3T4L A;  5FL3 A;  3UPP A;  4M4X A;  4WZ5 A;  1O07 A;  3KO6 A;  3CAX A;  1XJ4 A;  1OTE A;  2I72 A;  5FQ9 A;  3EGD C;  2JCH A;  1J9M A;  2FZ0 A;  4ZDX A;  4IBR A;  4DDY A;  3QP8 A;  4UA6 A;  3IF6 B;  4GNU A;  5MC7 A;  3A3I A;  4OON A;  1ERQ A;  2XLN A;  1K57 A;  4Y2F A;  1RP5 A;  3V50 A;  4B4Z A;  3BWL A;  1HD8 A;  2KDK A;  2B5R A;  5FEF A;  4WZ5 C;  3F1P A;  3IX3 A;  2B95 A;  1Y28 A;  2VJW A;  2P04 A;  3VSL A;  2HF6 A;  3RXX A;  1GHM A;  4CLC C;  4G3V A;  3LO7 A;  1Y4O A;  4E04 A;  3W8K A;  4JBF A;  3OLO A;  3NC8 A;  2W3F A;  4I5S A;  4EQ1 A;  3KYE A;  3TG9 A;  3CI6 A;  2Q9N A;  2HDU A;  1SDE A;  4YIN A;  1BTL A;  3RXW A;  1O7E A;  2WGV A;  1NLY A;  3GR2 A;  2J9P A;  2C6W B;  1G68 A;  4CLC E;  1YMX A;  2M7V A;  2WZZ A;  3C4P A;  1S0W A;  1SCW A;  4S2O A;  3T4J A;  1CEF A;  2NUT C;  5AQA A;  4GS9 A;  4I3I A;  3VE3 A;  1HZO A;  3DTI A;  3KSF A;  4BLM A;  3HLE A;  2VGJ A;  3HJI A;  5J3W A;  1VHM A;  4EEU A;  4EBN A;  3PBQ A;  4FH2 A;  2JKT M;  3ZGA B;  1OTA A;  1K6S A;  2V2F F;  3DTM A;  3HCY A;  3Q82 A;  1W7F A;  3WRZ A;  4G3W A;  5DF7 A;  3ZG7 B;  4GCZ A;  5CTM A;  2EX6 A;  3LEQ A;  3MF0 A;  4QJG A;  4JF6 A;  5EOE A;  1NYY A;  1TD5 A;  3MQ0 A;  1PWC A;  5A91 A;  3S7O A;  2XK1 A;  2W3G A;  2B18 A;  2ZM0 A;  1M40 A;  3T1Q B;  4B93 A;  1XFQ A;  4BMW A;  4H6J B;  3A3D A;  1W8Q A;  5EPH A;  4WM9 A;  5F6A A;  3UN7 A;  1TS7 A;  5HWT A;  5F5Y A;  4NKP A;  1LLB A;  1N9N A;  4JF5 A;  5DJT A;  2ZQ7 A;  4PHT A;  3SOI A;  4EES A;  1BUE A;  1YT4 A;  3NUL A;  5HW3 A;  5F1G A;  3IWO A;  1ZTU A;  5DTS A;  2ZC7 A;  4O01 A;  4ZAM A;  2ZMF A;  1DRM A;  2V1B A;  4PM9 A;  5AQ9 A;  5FI2 A;  5HAP A;  3NIA A;  1N9L A;  3ZVT A;  3QP2 A;  3KSI A;  5GHX A;  1KE3 A;  3ZVW A;  4Z1W A;  4P85 A;  1ALQ A;  5EVI C;  3VV4 A;  2EXA A;  4R3J A;  2RL3 A;  4KZB A;  5CHU A;  4ZJ3 A;  2Z2M B;  3SS5 A;  3KYQ A;  3HUN A;  3PBN A;  3KSG A;  5GL9 A;  2O99 A;  2DCF A;  2VKS A;  1N4O A;  3ISG A;  1UWN X;  3O3V A;  4R0Q A;  3BYD A;  2GDN A;  2PU4 A;  1NLZ A;  2XH9 A;  3UPO A;  5HWV A;  2J3T C;  1K54 C;  1YLJ A;  1YKD A;  2WKH A;  3CMZ A;  1K4E A;  4UA9 A;  5I94 A;  4Y3I A;  1BLS A;  5GLD A;  3IF5 A;  4KZ3 A;  1PWD A;  3PR6 A;  3E4Q A;  4XXR A;  5HDS A;  2PU2 A;  5M19 A;  5GLC A;  1ES4 A;  2VK3 A;  4K08 A;  4WEL A;  5CGW A;  1ERO A;  3LR4 A;  2Y2J A;  4LRX C;  4QB8 A;  2EA9 A;  3DW0 A;  5DFX A;  3OOV A;  3S22 A;  4GZB A;  2QYB A;  1T1B A;  4HBU A;  3E2K A;  4O8G A;  1OTI A;  4ID4 A;  3K2N A;  1S1Y A;  3EEA A;  2BLS A;  3K3C A;  4DKI A;  2MJ6 A;  5AQ7 A;  2A24 A;  2HJE A;  1W63 Q;  4PAU A;  1EW0 A;  1XGJ A;  1K54 A;  2ZBB A;  4EV4 A;  3IF6 C;  2HDS A;  3ZNY A;  2Y2Q A;  5U47 A;  4LCL A;  4E3L A;  4E3J A;  3EOI A;  4WYY A;  3HLB A;  3CUE A;  4KZ7 A;  4LCM A;  2PYR A;  4HI4 A;  5FSR A;  2J8Y A;  2Y2K A;  3UNW A;  2XFT A;  3LEZ A;  4CLC D;  4EER A;  4WF0 A;  2XD5 A;  1MC0 A;  3EWK A;  4HJ6 A;  4CLC B;  3T4Q A;  1MKM A;  2H0Y A;  3L7H A;  5DTK A;  4OP8 A;  3BFD A;  2FFY A;  2ZJ9 A;  3WS2 A;  4JXW A;  3VFF A;  3Q7Z A;  1HVB A;  1W5D A;  3VMA A;  2PDR A;  5DJU A;  4Q0H A;  5F82 A;  3T4O A;  2P7J A;  2B02 A;  4MLL A;  4B9O A;  4UEY A;  4P0M A;  5E2H A;  5EM0 A;  2HP9 A;  3QP5 A;  1XX2 A;  2WKR A;  1S66 L;  5GHY A;  4X1L A;  5EOO A;  5KIZ A;  3BFC A;  3HRE A;  4F3L B;  2IA2 A;  3DTE A;  3G6O A; 
#chains in the Genus database with same CATH homology
 1ES5 A;  5EUA A;  2E8I A;  2HP5 A;  1K4F A;  2V1Z A;  4OLD A;  5HFO A;  1NJ4 A;  4ZJ2 A;  3VP3 A;  2WGW B;  3HLD A;  2JBF A;  5FA7 A;  3OCN A;  3CJM A;  1TVF A;  3OPL A;  3G31 A;  1IKG A;  4FSF A;  1K56 A;  3W4Q A;  5CGS A;  3IXB A;  4GN2 A;  5KMW A;  4DE1 A;  2Z2L B;  4U0X A;  3P98 A;  2G2U A;  4Y0O A;  4D2O A;  4P6B A;  1BZA A;  1RGZ A;  2QMI A;  4JPM A;  4JXV A;  2WUQ A;  2A49 A;  4Y0U A;  5FAQ A;  1YM1 A;  2WKI A;  5DVA A;  1YLZ A;  4B4X A;  1XKZ A;  3LCE A;  3C7U A;  4DXB A;  2ZC6 B;  4BQM A;  5G18 A;  1FCM A;  5EVL A;  2Y4A A;  5FI6 A;  4K0X A;  3MKF A;  2WYX A;  4IVK A;  4KZ8 A;  3IHB A;  1ONH A;  5FQI A;  3Q81 A;  2EX9 A;  1RGY A;  4S2N A;  1KVM A;  5M18 A;  3GMW A;  3JYI A;  1IYQ A;  3Q07 A;  4MEZ A;  1N9B A;  4OQH A;  1KGG A;  3ZHH A;  3HLF A;  3G34 A;  3UPP A;  5KSC A;  1VQQ A;  3FV7 A;  4OQ0 A;  4WZ5 A;  1O07 A;  1L2S A;  4HBT A;  2OV5 A;  1WYB A;  1AXB A;  5CED A;  4N9K A;  4WMC A;  5KSH A;  5D3O A;  1GHP A;  1MWR A;  2XR0 A;  5IHV A;  2FFF B;  1C3B A;  5DF9 A;  2ZQD A;  1W8Y A;  2DNS A;  1LI9 A;  2OLV A;  2I72 A;  5FQ9 A;  1IEM A;  3RJU A;  1KGE A;  5GLB A;  1L0F A;  1ZG6 A;  3ZFZ A;  2JCH A;  3IXG A;  4PM6 A;  1J9M A;  4ZDX A;  4IBR A;  1CK3 A;  3W4O A;  4DDY A;  4UA6 A;  3IF6 B;  5J8X A;  5L2F A;  3IH8 A;  4GNU A;  4GKU A;  3A3I A;  4OON A;  1ERQ A;  1JVJ A;  4X6T A;  1Q2Q A;  2XLN A;  1ZG4 A;  1K57 A;  5CHM A;  1U60 A;  3A3J A;  3FWL A;  5FQQ A;  4JLF A;  4X55 A;  3UPN A;  3VOZ A;  1RP5 A;  4CPK A;  5FAS A;  3V50 A;  4B4Z A;  3MZF A;  3QHY A;  4LV2 A;  2EXB A;  1KVL A;  1BUL A;  1HD8 A;  3IF6 A;  4O7D A;  4UA7 A;  1PZO A;  2B5R A;  3ZCZ A;  3G32 A;  4WZ5 C;  3M6H A;  3N4I A;  2JE5 A;  3VFH A;  1ONG A;  3V3S A;  1IYS A;  4QHC A;  3M2K A;  4Y0T A;  1XXM A;  3O86 A;  3VSL A;  1E4D A;  4E3K A;  3ZDJ A;  3UY6 A;  2WAF A;  3O87 A;  3RXX A;  1GHM A;  4BL2 A;  4N1H A;  1JTG A;  1BT5 A;  4S2P A;  4WEJ A;  3BM6 A;  4BJP A;  4OPQ A;  4OPZ A;  1NZU A;  3LO7 A;  5FI7 A;  2IWC A;  4EBP A;  5EVI B;  1YLY A;  3W8K A;  5GLA A;  4JBF A;  4C6Y A;  3NC8 A;  4E3M A;  4GDN A;  5FQM A;  3TG9 A;  2R9W A;  2Q9N A;  3DWK A;  3G2Z A;  3VP1 A;  5FAP A;  2HDU A;  3LY3 A;  3V5M A;  3HUM A;  1SDE A;  1GA0 A;  1BTL A;  4YIN A;  3RXW A;  2XFS A;  1O7E A;  1FOF A;  2WGV A;  2XEP A;  3WS0 A;  5A92 A;  5KZH A;  1K25 A;  3GR2 A;  2XQZ A;  3IWQ A;  4P87 A;  4EBL A;  1YLT A;  2J9P A;  2A3U A;  5F83 A;  3C5A A;  4X68 A;  1FR1 A;  3N8R A;  2C6W B;  4FH4 A;  4M3K A;  3WS1 A;  3ZG0 A;  1GHI A;  1WE4 A;  5CRF A;  1G68 A;  3UE3 A;  1H8Y A;  1M6K A;  4HEF A;  1I5Q A;  3TOI A;  1IYP A;  1MBL A;  3UDF A;  1G6A A;  3W4P A;  1YMX A;  4EWF A;  2XGN A;  1PZP A;  1W79 A;  3AGD A;  2H0T A;  1TEM A;  3BEB A;  3VP0 A;  2WZZ A;  3C4P A;  2VGK A;  1H5X A;  2Y2P A;  1S0W A;  1SCW A;  4S2O A;  3WS5 A;  2HDQ A;  3N8S A;  1CEF A;  5HAR A;  1Z6F A;  1K55 A;  5AQA A;  2PBY A;  1VM1 A;  2WGW A;  1HZO A;  3WWX A;  5HL1 A;  2ZC4 B;  4K0W A;  1Q2P A;  4WBG A;  4BLM A;  3HLE A;  2VGJ A;  2HDR A;  3HVF A;  1GCE A;  1FQG A;  1MPL A;  2XF3 A;  3Q1F A;  4KQR A;  3MKE A;  3HLC A;  3FZC A;  4EBN A;  2QPN A;  1NYM A;  3PBQ A;  4FH2 A;  3Q7V A;  3S4X A;  3M2J A;  3VOY A;  2ZLY A;  1K6R A;  2Y55 A;  3ZGA B;  1PWG A;  3IH9 A;  1K6S A;  2V2F F;  3DTM A;  5DF8 A;  3Q82 A;  1W7F A;  2X01 A;  3QNB A;  3WRZ A;  3GTC A;  3UDX A;  4BL3 A;  5DF7 A;  3ZG7 B;  4QJG A;  2EX6 A;  5CTM A;  4NET A;  4OH0 A;  4GD6 A;  4JF6 A;  5EOE A;  3BEC A;  1DJC A;  2CC1 A;  1NYY A;  3CG5 A;  3I7J A;  3BLS A;  4MNR A;  1EI5 A;  1PWC A;  3NDE A;  4RX2 A;  5A91 A;  4KG6 A;  4S2L A;  4GDB A;  2Y2H A;  3C4O A;  2XK1 A;  2ZQ9 A;  4KQO A;  3EQU A;  4MBH A;  2ZM0 A;  3NDG A;  1M40 A;  2EX2 A;  1KGF A;  1CI9 A;  3UE0 A;  3A3D A;  5FQJ A;  4E6X A;  4QU3 A;  4R23 A;  1W8Q A;  4OPR A;  4WM9 A;  5EPH A;  1L0G A;  4E3N A;  2P9V A;  4QD4 A;  3UN7 A;  3BFF A;  2Y2I A;  2WK0 A;  4ZBE A;  4Z9Q A;  4RA7 A;  1MWS A;  1YLP A;  3QNC A;  1LLB A;  1PI4 A;  3AGE A;  4XUX A;  4JF5 A;  3VP2 A;  3NBL A;  4X69 A;  3NCK A;  3UE1 A;  1TDL A;  4R3B A;  5CEB A;  4LV3 A;  4UHU A;  1JWV A;  2ZQ7 A;  4K91 A;  3O88 A;  3MXS A;  3WS4 A;  5E43 A;  5TGF A;  1ES2 A;  4QY5 A;  3MBZ A;  3SOI A;  3C7V A;  2JC7 A;  4X56 A;  4RYE A;  2Y2L A;  4KG5 A;  3TSG A;  3HBR A;  1BUE A;  5A93 A;  1YT4 A;  5HW3 A;  1SHV A;  4WZ4 A;  4S2J A;  3HL9 A;  5F1G A;  3G35 A;  1E3U A;  1XA7 A;  2IWB A;  1QMF A;  4N9L A;  2X71 A;  3IWO A;  4U3T A;  1JWP A;  4GB7 A;  2Y91 A;  2P9V B;  2BG1 A;  5DTS A;  5EVI D;  2ZC7 A;  4ZAM A;  3CZD A;  3PTE A;  4UAA A;  3SS4 A;  2ZQ8 A;  5AQ9 A;  4PM9 A;  3HUO A;  5FI2 A;  5HAP A;  4R1G A;  1DY6 A;  3NIA A;  4WMC D;  5CHJ A;  3BLM A;  4BD1 A;  3LY4 A;  5CGX A;  1FSY A;  3ZVT A;  3VSK A;  4ZJ1 A;  5A90 A;  1XA1 A;  5GHX A;  1KE3 A;  3ZVW A;  1IKI A;  1Y54 A;  1XPB A;  3PBR A;  4U0T A;  4P85 A;  2ZC3 B;  1S6R A;  1ALQ A;  4YFM A;  5EVI C;  4N1X A;  5JYO A;  2EXA A;  2WGI A;  3MFD A;  3IWI A;  1NZO A;  5FDH A;  3PBT A;  5HX9 A;  2WKE A;  5F1F A;  4R3J A;  2RL3 A;  4KZ9 A;  1MY8 A;  3MZE A;  4KZB A;  5CHU A;  4ZJ3 A;  2X02 A;  1L0E A;  4C75 A;  4H8R A;  4LEN A;  4OOY A;  1PYY A;  1JTD A;  1SDN A;  2Z2M B;  3GRJ A;  3SS5 A;  4IBX A;  2Q9M A;  3BRM A;  3HUN A;  3Q7V B;  5FQK A;  1IEL A;  3PBN A;  4S2K A;  2WZX A;  2J9O A;  3ZNT A;  2EFX A;  4DF6 A;  5GL9 A;  1QME A;  1ERM A;  2QZ6 A;  2OSU A;  4OLG A;  4OQG A;  4S2M A;  5TR7 A;  4F94 A;  2ZM2 A;  4QY6 A;  5EEC A;  1MKI A;  3ZG9 B;  2DCF A;  4L0L A;  2HPB A;  3ZG5 A;  1N4O A;  3ISG A;  4B88 A;  4KZ6 A;  3O3V A;  4R0Q A;  3BYD A;  1DJB A;  1YQS A;  1KDW A;  3IXH A;  4PMA A;  3V3R A;  1RCJ A;  4BEN A;  1PI5 A;  3SH7 A;  4WEK A;  1BLC A;  3OZH A;  2GDN A;  5M1A A;  3OCL A;  1ES3 A;  2PU4 A;  1IYO A;  2Y2G A;  4MBK A;  4DE0 A;  2XH9 A;  4HES A;  3UPO A;  4S2I A;  4R4S A;  4E3I A;  3BFG A;  1K54 C;  1YLJ A;  3WRT A;  3OPP A;  2ZQA A;  2XDM A;  5E2F A;  2WKH A;  3CMZ A;  2H5S A;  3G2Y A;  1FCO A;  4LV0 A;  4RX3 A;  5CER A;  3MXR A;  1K4E A;  4UA9 A;  1I2W A;  5I94 A;  2ZC5 B;  1LI0 A;  3BFE A;  1BLS A;  4KZ4 A;  3N6I A;  5GLD A;  1XGI A;  4IED A;  2G2W A;  3IF5 A;  1FR6 A;  2H10 A;  1FCN A;  1PWD A;  4KZ3 A;  5TFQ A;  4XXR A;  2OLU A;  2PU2 A;  5FAT A;  5GLC A;  2Y2M A;  4EQI A;  1LHY A;  5M19 A;  2ZMA A;  1ESU A;  1K55 C;  3A3E A;  1ES4 A;  5BOH A;  4WEL A;  5EVI A;  3GV9 A;  3UO9 A;  5CGW A;  4DE3 A;  1KE4 A;  3PBS A;  1ERO A;  3N8L A;  4DRT A;  1NY0 A;  3NY4 A;  4GD8 A;  1E3U D;  4E3O A;  1L0D A;  2Y2J A;  4X53 A;  1CEG A;  1SKF A;  3FYZ A;  2WAE A;  3G4P A;  4QB8 A;  3DW0 A;  1BSG A;  2RCX A;  5CXW A;  4OPY A;  3NI9 A;  2EX8 A;  3IXD A;  3S22 A;  1XP4 A;  1KDS A;  5E2G A;  5CEC A;  4KEN B;  4GZB A;  1NXY A;  4HBU A;  3OPH A;  3E2K A;  4KZ5 A;  1TDG A;  2DRW A;  2Y59 A;  3OPR A;  4ID4 A;  4E6W A;  3VP4 A;  4PM7 A;  2BLS A;  3G30 A;  5CTN A;  4DKI A;  3M6B A;  5AQ7 A;  4PM5 A;  2C5W B;  4N92 A;  3PAE A;  2HP6 A;  3GSG A;  4A5R A;  3D4F A;  1HTZ A;  3P09 A;  4JF4 A;  4JXG A;  1NRF A;  1PIO A;  3MZD A;  1K38 A;  4JKT A;  1XGJ A;  2P74 A;  1K54 A;  1H8Z A;  4GOG A;  2XD1 A;  4EV4 A;  1LL9 A;  3IF6 C;  3AGF A;  2HDS A;  4XUZ A;  2Y2N A;  3ZNY A;  2Y2Q A;  3PAG A;  5U47 A;  3ITA A;  4LCL A;  1ZKJ A;  4E3L A;  4E3J A;  2WAD A;  2V20 A;  3V39 A;  4WYY A;  3HLB A;  2Y2O A;  1K57 C;  4FCF A;  1JWZ A;  5EE8 A;  4C3Q A;  3HLG A;  2ZM8 A;  4DXC A;  4KZ7 A;  3IQA A;  3ITB A;  4LCM A;  4EUZ A;  4KZA A;  2UWX A;  4IVI A;  4PM8 A;  2EFU A;  1E25 A;  5FSR A;  2J8Y A;  1DJA A;  2Y2K A;  3UNW A;  1MWT A;  1ZC2 A;  2XFT A;  3LEZ A;  4FD8 A;  3A3F A;  3SH8 A;  3E2L A;  1PW8 A;  4PPR A;  3GQZ A;  5DTT A;  4MBF A;  2XD5 A;  1BLP A;  3FKW A;  3SH9 A;  5GHZ A;  2H0Y A;  4OKP A;  4JXS A;  1OME A;  1EWZ A;  4Q8I A;  5DTK A;  4OP8 A;  3N7W A;  5FAO A;  3BFD A;  5HAI A;  2FFY A;  2ZJ9 A;  3WS2 A;  4KG2 A;  4OQI A;  1I2S A;  4BD0 A;  3OC2 A;  4JXW A;  3VFF A;  3Q7Z A;  1HVB A;  1YLW A;  4OVD A;  1ESI A;  3DWZ A;  3HLW A;  2IWD A;  1W5D A;  3VMA A;  1YMS A;  3FKV A;  2R9X A;  4DE2 A;  1BLH A;  4LV1 A;  1WYC A;  5HAQ A;  3B3X A;  1K56 D;  3PBO A;  5F82 A;  4OOM A;  1KE0 A;  3GVB A;  5JYP A;  4OOL A;  2ZQC A;  4OP5 A;  4MLL A;  4RVA A;  4NK3 A;  4P0M A;  5E2H A;  2HP9 A;  5E2E A;  4CJN A;  1XX2 A;  1PW1 A;  3IHA A;  2ZD8 A;  5GHY A;  3IT9 A;  1GA9 A;  3EQV A;  4S2N C;  4Y7P A;  5EOO A;  3UDI A;  1FSW A;  3BFC A;  3SS3 A;  3S1Y A;  3HRE A;  1MWU A;  4DDS A;  1MXO A;  1CI8 A;  4R4R A;  1LL5 A;  4ZTK A;  4KQQ A;  5AQB A;  3ZG8 B;  2J7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...