3A0VA

Pas domain of histidine kinase thka (tm1359) (semet, f486m/f489m)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
96
structure length
96
Chain Sequence
METAIITLSKDGRITEWNKKAEQLFGLKKENVLGRRLKDLPDFEEIGSVAESVFENKEPVFLNMYKMGERYFNIRFSPFRNAKTQLLEGVIITIDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein
publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 28
structure length 96
sequence length 96
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3a0vA00
3LIEA 5DJUA 3F1PA 3ZQ5A 2QHKA 3EEHA 2J80A 1S66L 5AVEA 4HH3A 3IS2A 4EERA 2PR6A 1T19A 1S67L 3NOTC 4HJ4A 4PKYA 5IS1A 3A0VA 4KUKA 3E4QA 4XT2A 3UMDA 5DKKA 2QWSA 4R38A 5HWTA 3LIAA 1T1AA 4WUJA 3A0RA 1KOUA 4F3LB 2BASA 3MR0A 3VE4A 4HHDA 3MFXA 2VEAA 4GCZA 1D06A 4HI4A 4L9GA 1XJ3A 2W0NA 3H9WA 3ULFA 5AVFA 1T1BA 1VB6A 4KQDA 1JNUA 5J4EA 2VV8A 4LPZA 3C2WA 3LI8A 2YKFA 1OTBA 2ZOHA 4K08A 3MQOA 3LICA 4HOIA 2VV7A 3T50A 3UE6A 5F5YA 2HV1A 3LYXA 3K3DA 2GJ3A 1DP8A 4EEPA 3RTYA 3H82B 5G4ZA 4L9FA 2PYRA 1NWZA 5DKLA 5HWVA 1D7EA 5HD5A 4B9OA 1TS7A 4JGOA 3VOLA 5F69A 1Y28A 2W27A 4NXEA 1OJGA 4KUOA 5DJTA 5KIZA 1XFQA 1OT9A 1ODVA 5I5LA 2OWHA 3HJKA 3BY8A 4BBVA 3MJQA 4GHIB 4LRYC 2JHEA 4HNBA 5HZHA 4E04A 1MZUA 4M4XA 1F98A 4BBTA 3F1OB 3LIBA 3NHQA 3MXQA 2A24B 1UWPX 1N9NA 1LSVA 4NXBA 3C8CA 3FG8A 1V9YA 3VE3A 3P7NA 3F1NB 3UB8A 4EEUA 2PD7A 4DJ3A 4JGQA 4BBUA 2V1BA 2PYPA 5HWWA 4F3LA 4EETB 2ZBBA 5G4YA 5HD3A 1S1ZA 3GDIA 1OTAA 4HP4A 1XJ2A 4MN6A 2L1MA 5HDSA 1OTIA 3A0SA 3B33A 1GSWA 3GECA 2Z6CA 4I38A 4H6JB 1OJ5A 5HDDA 2VV6A 3UB6A 4HY8A 4GS9B 3OLOA 5J7EA 2Z6DA 3H82A 4HIAA 1T18A 1X0OA 3H7WB 2R78A 4RQ9A 3BY9A 1LT0A 1G28A 3UB9A 2B02A 4R6LA 3CAXA 4I39A 2ZOIA 1WA9A 4HP9A 1UGUA 3SW1A 2H28A 1XJ4A 3LUQA 5TBMB 1OTEA 3ICYA 1S4SA 1LL8A 2PDRA 4GHIA 4MN5A 5HSQA 4L9EA 3NOPC 3FC7A 2V9AA 3F1OA 3LIDA 2L4RA 3KX0X 5HDCA 2PR5A 3MQQA 2OOLA 2INWA 3F1PB 1P0ZA 4NXFA 1TS0A 3CLOA 4EW7A 2KX6A 1N9OA 1P97A 2M1CA 3RH8B 1OT6A 3IS2B 3E4OA 3F1NA 4NXGA 2P7JA 1T1CA 4GW9A 1TS8A 5F68A 2V0UA 1N9LA 4I5SA 4LRZE 1OTDA 4XT2B 4JGRA 4WLAA 3LI9A 1EW0A 3UB7A 2L0WA 1DP6A 2YKHA 4PKYG 3PYPA 1S1YA 4EESA 2KDKA 5A8BA 2D01A 2CMNA 2OWJA 2WKQA 1GSVA 5J3WA 4HJ3A 2I9VA 1S4RA 1XFNA 3BWLA 3CWFA 2K7SA 4I3AA 1TS6A 2VLGA 2WKRA 4I3IA 3NJAA 1XJ6A 4EQ1A 3HJIA 4WF0A 3D72A 4H6JA 4JGPA 4GS9A 4DJ2A 1UWNX 3K3CA 1V9ZA 4HQAA 2D02A 4R70A 3H7WA 4EXOA 1DRMA 2JN7A 3E4PA 1LSXA 3IBRA 4WN5A 1LSWA 4HH2A 2V1AA 2EA9A 3G6OA 4LLOB 4HJ6A 1F9IA 2QJ5A 5IU1A 4YWZA 3LIFA 2PHYA 5TBMA 4I3JA 4LRXC 2WKPA 1DP9A 3UMEA 1BYWA 2V0WA 3PHYA 1GSXA 2QKPA 4R3AA 4WL9A 2A24A 5F6AA 5EFWA 2PD8A 2QJ7A 3NOUC 3EWKA
chains in the Genus database with same CATH superfamily
3EQUA 5KSCA 5DJUA 4GN2A 3FPVA 3HVFA 1S66L 3IX3A 4LCLA 4EERA 5AQAA 2XQZA 4Z1WA 1S67L 4KG2A 4RX3A 2IWCA 5HW3A 1PFLA 2W1RA 4R4SA 1H8YA 3A0VA 3E4QA 1GA0A 4ETXA 4L0LA 5DKKA 4KZ7A 2QWSA 1VQQA 2GDNA 3MF0A 2BTFP 1H8ZA 1T1AA 2H0TA 5FAQA 2JBFA 1FOFA 1FSWA 3MFXA 1L0GA 1D06A 2Y8HA 4ZTKA 3HLDA 1NYMA 1ES4A 1IEMA 5AVFA 1WE4A 1VB6A 2Q9NA 4KENB 1HZOA 3G32A 2XD1A 2ZQ7A 3CUEC 3VP0A 3B42A 1YPRA 4NKPA 4WM9A 3M6BA 1I2SA 3CUEA 3MXRA 5FA7A 4KG6A 4N1XA 3LICA 1IFQA 1BUEA 4WZ5C 5HARA 4WZ5A 2HV1A 2XROA 2GJ3A 2A49A 4ZJ2A 3RTYA 3H82B 2PYRA 1NWZA 3O87A 5DKLA 1D7EA 4KZ5A 3T4LA 3C38A 3A3JA 2ZC5B 3WRZA 2A3UA 1EWZA 4C3QA 5F69A 4BL3A 3QHYA 2WGIA 3C4OA 2ZM2A 5EUAA 4IEDA 3SOIA 2W27A 3T4TA 3WS1A 3MKEA 1MKIA 1XFQA 4GD6A 2Y2IA 3ITBA 3PBQA 3IX4A 2JHEA 5FEGA 3IQAA 4R1GA 4QJGA 4HNBA 5KMWA 5HL1A 3Q7ZA 4E04A 4N9KA 1F98A 2V8FA 1QMFA 1PWDA 3NHQA 5DFXA 2WUQA 3R7WB 1RP5A 4NXBA 2XF3A 4X25A 1G68A 3FG8A 4ETZA 4FCFA 3ZNYA 3P7NA 2H0YA 2GNXA 1FQGA 2JCHA 3CI6A 2FFYA 3PBTA 3ISGA 1IYOA 1W63M 2C6WB 2XFTA 3WS2A 4MMNA 2H5SA 4JGQA 1BLPA 3QNCA 3G35A 2V1BA 3A3DA 1WYBA 2WGWB 3B47A 3FKWA 2HP9A 3M2JA 4NK3A 4NETA 4DXBA 3NDEA 2RL3A 3VP1A 3JPUA 3CZDA 5FAOA 4A5RA 1SDNA 3KYEA 2XEPA 5GL9A 1M40A 2HPBA 4GDBA 3UO9A 1OTAA 4MCWA 2HDSA 4MBFA 5HDSA 2FH5A 4OOYA 4D60A 3IH9A 3EGDC 4S2MA 1M6KA 2IA2A 1RGZA 2O99A 3O86A 3GECA 1XKZA 4I38A 3R4KA 3BFCA 3UB6A 2HP5A 1KE3A 2Z6DA 1T18A 1H5XA 2FFFB 1KE4A 1FCOA 3H7WB 2R78A 3S7PA 3WRTA 4B4ZA 1TF1A 1STZA 4R6LA 4I39A 5FASA 3UDXA 4XXRA 1EROA 4FOFA 3S7OA 5DF8A 5HFOA 3IT9A 3DTEA 1LL8A 4S2JA 1MWUA 4L9EA 5HAIA 1ONHA 2VJWA 3VP4A 1LI0A 5L8MA 3LR5A 2W3GA 4ZRRA 3HLWA 3F1OA 2XFSA 1HVBA 3BFDA 5HDCA 5CX7A 4BD0A 3OBFA 4GDNA 3Q82A 1TS0A 3IF6C 1VEUA 2KX6A 4OP5A 4PMAA 2M1CA 3IF6A 4OPZA 2J9OA 4QPRA 3T1QB 3E4OA 5EVLA 3F1NA 1E4DA 3FV7A 1NRFA 4II7A 1MY8A 5JYPA 4GW9A 1IYSA 3HREA 2WKIA 3LCEA 5HAPA 3VOYA 1PWCA 2WZZA 4HEFA 1ZTUA 2V8CA 1BLHA 1N9BA 3LI9A 5JYOA 2IWBA 4JPMA 1LLBA 3UB7A 1GHPA 4KZ6A 1JWZA 1HLUP 3KSHA 5CGWA 1SKOA 2XH9A 4BWIA 1XFNA 4CLCC 2OAP1 5D3OA 2Y2MA 4CLCA 2K7SA 4YFMA 4EBLA 3L9KA 2WKRA 5I94A 3HLCA 3PAGA 1YSPA 1G6AA 4Y15A 4RVAA 1XJ6A 1W8QA 4H6JA 3OC2A 1JTGA 3DBAA 3HBRA 3GV9A 2B5RA 3G34A 3A3EA 1W79A 3K3CA 3HLBA 4GJ4A 3HL9A 3PBOA 1NJ4A 2PBDP 4Y7PA 3UPOA 3C7UA 4U0TA 4Y17A 3CMZA 2O9AA 2VGJA 2Y2PA 3UPNA 2V20A 2ACGA 1RGYA 1I5QA 3G6OA 3NCKA 5K5BA 1BTLA 4P0MA 3LR0A 2WKPA 3GQZA 3ZCZA 4HBTA 4UA6A 1YMSA 4IBRA 3MSHA 3V50A 2A24A 2HP6A 1XA1A 5FAPA 4ARZB 3EWKA 4DE0A 4PM9A 4CLCD 3EEHA 3T1SA 5DFYA 5HX9A 1D1JA 4Y0UA 5EVIC 3NULA 3EOIA 5EVIA 1I2WA 3IF6B 5IS1A 4FUWA 3UE3A 4KUKA 3TG9A 3UMDA 1G6OA 4EUVA 3UY6A 1L3LA 5CECA 1XA7A 4WUJA 4OOLA 3MR0A 5AQBA 4GNUA 3VE4A 2EX8A 4HHDA 5EM0A 3RXXA 4S2PA 4GCZA 3FWLA 4LCMA 4MEZA 2W0NA 1PI4A 1KVMA 4DN0A 4OQIA 2PRFA 1JNUA 3U2AA 3TE8A 4LPZA 3AGFA 4K08A 2QZ6A 4HOIA 1L2SA 1HD8A 5GLCA 3CJMA 3HLGA 4EEPA 1DP8A 2Y2HA 1K56A 4KG5A 1FR6A 2W1TA 5G4ZA 3IXGA 3HUOA 3TRCA 5HWVA 3IWOA 5U47A 5EVID 1IOUA 2EX2A 4GKUA 3S7NA 4B9OA 1TS7A 2Y79A 4X69A 2DMWA 3CITA 5L07A 5GHZA 2ZL1B 2P9VA 4NXEA 1GA9A 3BW6A 1OT9A 4MN7A 3PBRA 3SS3A 4KZ9A 1ODVA 2OWHA 3BFGA 2CC1A 2EWWA 1H0MA 2Y91A 4NEED 2Z2LB 1DY6A 2R9WA 4BBTA 1BULA 3GRJA 1YLWA 2ZC3B 3C7VA 4RX2A 3KYZA 3LIBA 5CHJA 2A24B 1YLJA 1N9NA 1SZVA 5A90A 4P87A 4XUXA 4Q8IA 3LEZA 3NY4A 1V9YA 4KZ3A 4NG2A 5AQ9A 2JKTI 1PRQA 4EEUA 5DVAA 4PM8A 3TJZC 2X02A 3V3SA 4X53A 3WS4A 5GLAA 3CHWP 1K56D 3ZGAB 4LENA 2HGVA 2JKTM 4DJ3A 4Y3IA 3ZVTA 3MXSA 4BBUA 3Q7VB 3A3FA 3IXBA 1Y54A 5HWWA 2WKEA 4F3LA 5IHVA 4EETB 2M7VA 3BM6A 4HBUA 5G4YA 3LY3A 5HD3A 3T1XA 3PTEA 3G2ZA 1KE0A 1S1ZA 4CJNA 4M3KA 3A0SA 3LFVA 4MBKA 4Y5FA 1CI9A 1ESUA 1KGEA 4LV1A 3OCNA 4BD1A 5HDDA 4FH2A 1ES2A 2VV6A 1MWSA 3VP3A 1ZKJA 2XA7S 4GS9B 1FCMA 1H8MA 2EX6A 2X71A 1BZAA 1Z09A 1MPLA 2WZXA 4UA7A 1GCEA 1LT0A 1G28A 3MZDA 3UB9A 2Y2QA 3CAXA 2ZOIA 2VA0A 1O7EA 5CERA 1F5MA 4E3NA 1JVJA 1ALQA 4LV0A 1UGUA 2H28A 3GTCA 1XJ4A 3P98A 3QP6A 4WEKA 4FSFA 3CPTB 1S4SA 3JYIA 2PDRA 4GHIA 4BENA 2X01A 3BFEA 1ZG4A 5FI2A 2W3DA 1XGJA 3EGXC 4Z9QA 3E98A 2OOLA 4EW7A 3T4QA 1CQAA 1YLTA 1OT6A 2HDUA 3RXWA 5CXWA 1CF0A 3KSIA 2P7JA 3NC8A 1T1CA 5E2HA 4S2IA 2PBYA 4WBGA 2XA7M 1N9LA 2V0UA 1JWPA 4IVKA 4I5SA 4OP8A 2Y2LA 4JGRA 3GR2A 1DJCA 1CJFA 3RJUA 3DTIA 2L0WA 1DP6A 2WKHA 3BLSA 3LY4A 2D01A 3ZHHA 4IJGA 3ZG5A 4KZ8A 3MFDA 4DDYA 2I9VA 1S4RA 3ZFZA 4E3MA 2DRWA 1IKIA 4DE1A 5FDSA 4LV2A 4WMCA 4I3AA 3D4FA 4RYEA 1QMEA 5EOEA 3D3OA 1N4OA 2WYXA 1P9WA 5DTKA 2HF6A 3Q81A 3UE1A 4EQ1A 3B3XA 5CGSA 1NLYA 3D72A 4IVIA 1MWRA 5FSRA 4ZBEA 4JKTA 5LBRA 4UA9A 3UDIA 2XLNA 4EBPA 4HQAA 4BJPA 2Y59A 4WZ4A 1LHYA 2DCFA 4MDZA 3SZTA 4WN5A 4JLFA 2JC7A 1LSWA 4YNRA 1A0KA 1G5UA 4Q0HA 1FCNA 4UAAA 4R3BA 3UE0A 4YWZA 3N8SA 3LIFA 4LGWA 2PHYA 5TBMA 4I3JA 4LRXC 1LL9A 1BYWA 5E2EA 2G2WA 4P85A 3PHYA 1BLSA 4ME4A 1C3BA 1GSXA 4R3AA 4KZAA 2RCXA 5CHMA 3BECA 4OKPA 2OV5A 3W4OA 1K57C 4ZDXA 1J3WA 4WMCD 3F1PA 4E3OA 4JF5A 1K57A 2J80A 3BYDA 4PM7A 4HH3A 1K25A 3BRMA 4DDSA 4JXGA 3IS2A 4R3JA 1XX2A 1SDEA 2PR6A 3OCLA 3E0YA 3NOTC 4HJ4A 1HTZA 3W4QA 4PKYA 4WYYA 1JTDA 4OPYA 1W5DA 4XT2A 2EFUA 3VV4A 4OONA 3DTKA 2AVXA 4R38A 2E8JA 2Y2OA 2HZ5A 3A0RA 1KOUA 2BASA 4E3LA 3C4PA 1ONGA 2KLIA 2VEAA 4HI4A 5FI6A 3PBSA 3MMHA 4IUKA 1NZOA 4L9GA 1XJ3A 3H9WA 4QHCA 4X68A 3ULFA 1T1BA 3N8LA 5HAQA 1K0KA 4S2LA 3IF5A 4KQDA 2JKGA 5J4EA 2VV8A 3PAEA 1P9RA 1MWTA 2ZQ8A 3C2WA 2J3WA 2YKFA 3WS5A 2J8YA 3T50A 4F94A 5FQIA 4DKIA 5F5YA 2KOIA 2W3HA 3OPHA 1PWGA 2XK1A 3LYXA 5EV0A 2ZLYA 3HLFA 5EECA 2ZQ9A 4L9FA 1VETA 3N4IA 3O5YA 3OZHA 5DF9A 1W63Q 1YM1A 1ZHHB 3C30A 2QMIA 2J9PA 4JGOA 2O9CA 3VOLA 2B18A 4O8GA 5EOOA 4KUOA 3UNWA 4E6WA 1TEMA 5GLBA 5KIZA 3QP1A 3UB5P 2HJEA 2WK0A 2K31A 2GX5A 3MJQA 1OMEA 3FZCA 4K0WA 5GHXA 1CI8A 5HZHA 2ZC7A 2ZQCA 3F1OB 5M18A 5FQKA 2Y2GA 4UHUA 4ZJ1A 4X6TA 4KQRA 1LL5A 4E3KA 1LSVA 1PW1A 1RCJA 3C8CA 4OQGA 2ZMAA 1VEUB 2ZMFA 3HCYA 1K4EA 5M1AA 3VE3A 3F1NB 4QWOA 2EX9A 3HLEA 5TR7A 3OPRA 5FQJA 3ZYTA 3ZG7B 1YT4A 3ZVWA 3G30A 2PU2A 1L0FA 4OPQA 3DW0A 4GOGA 4EU0A 4S2KA 3E2LA 2MJ6A 2ZBBA 3TOIA 1SKOB 3UN7A 1ERQA 3GVBA 3HUNA 1YLPA 4ID4A 5HPFA 3QP8A 2VKSA 3GDIA 4CLCB 4HP4A 2W3EA 4WELA 2NUTC 1AWIA 3IHAA 3T12B 3WWXA 1OTIA 4BQMA 1PYYA 4ZJ3A 3LR4A 4D2OA 1SHVA 5HPIA 5DTSA 4R23A 1W7FA 2P74A 4H6JB 4QY5A 3KO6A 4PM6A 4HY8A 3OLOA 4OH0A 5GHYA 2ZQAA 3H82A 3SS5A 3P09A 4G3VA 4HIAA 1X0OA 1ERMA 3VFFA 3E2KA 2XD5A 5FQMA 4UEYA 3Q07A 2VGKA 4B88A 4EWFA 3EQVA 2J7VA 4HESA 4B93A 4QU3A 1JWVA 4BLMA 5EM1A 5EPHA 3SW1A 1WYCA 1OTEA 1GHIA 3IHBA 4MN5A 3U4LP 3NOPC 3DWKA 1PZOA 3FC7A 2V9AA 4YOFA 3EEAA 4EV4A 3L7HA 3MBZA 3R7WA 2G2UA 2PR5A 2VZWA 5F1GA 1TDGA 3KSGA 1P0ZA 4NXFA 4PM5A 2HJ9C 2VGLS 1N9OA 3VMAA 3RH8B 5CEBA 4UQIS 4JF4A 4K91A 1Y4OA 5EVIB 5G18A 4LRZE 4DMZA 3RFBA 4KZ4A 3ZG0A 3QP5A 2WGWA 5CTNA 1CEGA 4OVDA 5TGFA 1EW0A 1XPBA 2XRNA 5GLDA 3BJNA 3FYZA 5M19A 1BT5A 4CLCE 2YKHA 3PYPA 1S1YA 4EESA 2KDKA 5A8BA 3TW8A 2O9BA 5TFQA 1IKGA 2BLSA 2OWJA 2XR0A 4DF6A 1MXOA 1XP4A 2WKQA 1GSVA 4JXVA 4Q0JA 1PW8A 1YLYA 1BLCA 1TVFA 3BWLA 1XXMA 4X1LA 4DXCA 3BFFA 3T4SA 1VHMA 5FL3A 2P08A 5L2FA 4KZBA 3DTMA 2PU4A 1TS6A 5AQ7A 4I3IA 1YSQA 4LFUA 3NI9A 3G2YA 3SH8A 4WF0A 4GLQA 3AGDA 1FILA 4JGPA 5FEFA 4LV3A 4OPRA 4JXSA 4DJ2A 1FIKA 1UWNX 4N9LA 2VGLM 1V9ZA 4XUZA 2I72A 3KYQA 2D02A 4R70A 3GMWA 3H7WA 2W1TB 4UQIM 2EXAA 2P04A 2JN7A 4EQIA 1FR1A 1LSXA 2K2NA 1MC0A 3T4OA 4X1MA 1AXBA 2R9XA 4JBFA 4LLOB 1OPXA 4RA7A 2P9VB 3SS4A 1F9IA 5AJGA 1KDSA 4U0XA 1DP9A 3O3VA 2BG1A 1NLZA 1E3UA 2V0WA 4Y2FA 4BMWA 1F2KA 2OLVA 5F6AA 2ZJ9A 4N1HA 3N8RA 5EFWA 1E25A 5F83A 3NOUC 3K2NA 3A3IA 3LIEA 3ZQ5A 2QHKA 3PBNA 1S6RA 2VX8A 5AVEA 2WAEA 1BSGA 2E8IA 5A92A 3G4PA 4FTXA 3IX8A 1ACFA 2V2FF 1T19A 3MZFA 3MZEA 3NDGA 5DF7A 3V3RA 1U60A 3Q1FA 2V1ZA 1DJBA 3ITAA 1ZG6A 4P6ZS 5FI7A 4IBXA 2QYBA 1PZPA 4OQ0A 5HWTA 3LIAA 4X55A 4F3LB 4P6BA 3IWIA 1ZC2A 3IH8A 3OPLA 4N92A 2WAFA 2HDQA 3QP2A 1ES5A 4DE2A 2NUPC 3NIAA 1E3UD 5CTMA 2C5WB 3S22A 3NECA 4MLLA 5L10A 3LI8A 1OTBA 3LGOA 2ZOHA 3W2ZA 3MQOA 3ZG8B 3W8KA 3IBJA 2VV7A 2PT7A 1NXYA 5KZHA 4Y0TA 3CG5A 3UE6A 3K3DA 3DAVA 2Y2NA 2EXBA 1K55C 4ESPA 1NZUA 1MKMA 5HD5A 4OLDA 3T4KA 1K55A 1VM1A 4IHQA 1Y28A 3UDFA 3OOVA 5HL6A 3FPWA 1OJGA 1H3QA 3ZNTA 5DJTA 4P6ZM 4EBNA 4G3WA 3S1YA 5I5LA 3HJKA 3BY8A 4BBVA 4G3KA 4QD4A 4R0QA 4GHIB 4LRYC 5C5KA 1SCWA 1NRJA 1L0DA 2W3FA 1L0EA 4Q0IA 3MKFA 4BL2A 3BLMA 4B4XA 1MZUA 2ZC4B 1FSYA 4M4XA 4ARZA 3MXQA 3HUMA 1UWPX 1Q2QA 2XDMA 4QB8A 4AFIA 4FD8A 5EVEA 4OQHA 5KSHA 1NYYA 1GHMA 3QNBA 2H10A 2OLUA 3D9YA 2J3TC 3AGEA 1K6SA 1YQSA 4OOMA 3UB8A 4DRTA 1CK3A 2WADA 4MNRA 2PD7A 5E43A 1IELA 2GZAA 5FQQA 4GZBA 3S7QA 5E2GA 2WGVA 4EUZA 4KQQA 1CEFA 2ZC6B 5BOHA 2PYPA 3LR3A 3VSLA 1YKDA 3N6IA 2XGNA 5J8XA 5CHUA 4GD8A 3UPPA 1K6RA 2Q0OA 4U3TA 4PAUA 2Y2KA 1TD5A 1XJ2A 4MN6A 2IWDA 4OLGA 2L1MA 4IUHA 2LB5A 2UWXA 3W4PA 3B33A 5EE8A 2Y55A 1YAXA 3G31A 1LI9A 1GSWA 3IXDA 2JKRI 4FH4A 3PXPA 4S2NC 2Z6CA 1OJ5A 4C6YA 2O0YA 2OSUA 4S2NA 1O07A 1SKFA 3JVVA 2UV0E 4R4RA 4DE3A 5J7EA 2JKRM 3BQAA 5CGXA 4E6XA 3V67A 4YINA 2Q9MA 4E3JA 3N7WA 1IYPA 4RQ9A 3BY9A 2ZQDA 1PNEA 4JF6A 3KSFA 5F82A 2J3TD 1YMXA 1K54C 1YLZA 2B02A 5CEDA 1WA9A 1K54A 2ZL1A 4C75A 1W8YA 1KVLA 1KDWA 4HP9A 4K0XA 3IXHA 3LUQA 3VFHA 2VK3A 5TBMB 3ICYA 3ZDJA 2HDRA 1NY0A 5HSQA 2JE5A 3BEBA 1J9MA 3VSKA 3V5MA 2ZM8A 3LIDA 2L4RA 3KX0X 1MBLA 4E3IA 3FKVA 3MQQA 3F1PB 1S0WA 2INWA 3MQ0A 4PPRA 5F1FA 1Q2PA 2B95A 3CLOA 4Y13A 4JXWA 1P97A 2JKFA 5FDHA 3IS2B 3GSGA 4S2OA 4NXGA 2EFXA 1ES3A 5DTTA 1TS8A 2Y4AA 5F68A 2LB9A 1OTDA 2FZ0A 1KGGA 4XT2B 3Q7VA 4WLAA 5FATA 3M6HA 2G7UA 4GB7A 4ZAMA 1K38A 4X56A 3V39A 3NBLA 3VOZA 5MC7A 4PKYG 1XGIA 4WEJA 4O01A 2CMNA 3T4JA 3LEQA 4KQOA 1Z6FA 5J3WA 4HJ3A 4Y0OA 2ZM0A 3TSGA 3P01A 2Y2JA 1DJAA 3IWQA 3CWFA 3OPPA 2EWVA 2QPNA 3DWZA 3MS6A 3JVUA 4MBHA 3ZG9B 2VLGA 3T1RA 3VP2A 3SH9A 3SH7A 3NJAA 3HJIA 4H8RA 3M2KA 4O7DA 3PR6A 5E2FA 5L09A 4GS9A 1PIOA 5TJJA 4CPKA 5A91A 3S4XA 1ESIA 1KGFA 3BQ8A 5A93A 3WS0A 4EXOA 1IYQA 5FQ9A 1DRMA 1VETB 3O88A 4QY6A 2OAQ1 3E4PA 4CQHA 2M7UA 3IBRA 2PAVP 1K4FA 5CRFA 4PHTA 3QP4A 2DNSA 2ZMVA 2A2LA 4HH2A 2V1AA 2EA9A 3C5AA 4HJ6A 2XSSA 5IT5A 1PI5A 2QJ5A 5IU1A 3CPTA 1EI5A 3UMEA 2ZD8A 2Z2MB 1TDLA 4O0PA 3LO7A 2QKPA 4WL9A 3I7JA 2PD8A 2QJ7A
chains in the Genus database with same CATH topology
3EQUA 3LIEA 5DJUA 3F1PA 3ZQ5A 4CLCD 2QHKA 3PBNA 3EEHA 4ARZB 2VX8A 2J80A 3FPVA 5DFYA 1S66L 5AVEA 4HH3A 3IS2A 4EERA 2PR6A 4Z1WA 3OCLA 1T19A 3E0YA 3EOIA 1S67L 3NOTC 4HJ4A 4PKYA 5IS1A 2W1RA 3UE3A 3A0VA 4KUKA 3E4QA 4XT2A 4ETXA 3UMDA 4L0LA 3VV4A 5DKKA 1G6OA 2QWSA 4P6ZS 4EUVA 3MF0A 2QYBA 4R38A 5HWTA 3LIAA 1T1AA 4WUJA 3A0RA 1KOUA 4F3LB 2BASA 4OOLA 3MR0A 3VE4A 4HHDA 3MFXA 2KLIA 2VEAA 4GCZA 1D06A 2Y8HA 4HI4A 3PBSA 3MMHA 4IUKA 4L9GA 1XJ3A 2W0NA 3H9WA 3ULFA 5AVFA 1T1BA 1VB6A 4DN0A 2NUPC 4KQDA 1JNUA 3U2AA 3TE8A 2VV8A 3CUEC 5J4EA 3B42A 1P9RA 4NKPA 4LPZA 3C2WA 3CUEA 3LI8A 2J3WA 1OTBA 2YKFA 2ZOHA 4K08A 3W2ZA 3MQOA 3LICA 1IFQA 3IBJA 4HOIA 2VV7A 3T50A 2PT7A 3UE6A 5F5YA 2KOIA 2W3HA 2HV1A 3LYXA 2XROA 3K3DA 2GJ3A 1DP8A 4EEPA 3RTYA 2W1TA 3H82B 4L9FA 5G4ZA 2PYRA 1NWZA 3O5YA 5DKLA 3TRCA 5DF9A 5HWVA 1W63Q 1D7EA 1IOUA 1MKMA 5HD5A 1ZHHB 3T4LA 3C30A 3S7NA 3C38A 1TS7A 4B9OA 2Y79A 3T4KA 2DMWA 4JGOA 2O9CA 3CITA 4IHQA 3VOLA 5F69A 1Y28A 3OOVA 5HL6A 2B18A 4O8GA 2W27A 3FPWA 4NXEA 3T4TA 1OJGA 4KUOA 1H3QA 5DJTA 4P6ZM 3BW6A 5KIZA 1XFQA 4G3WA 1OT9A 4MN7A 3PBRA 1ODVA 5I5LA 2OWHA 3HJKA 2HJEA 2K31A 3BY8A 2GX5A 4BBVA 3MJQA 4G3KA 4GHIB 4LRYC 3PBQA 5C5KA 2JHEA 1NRJA 2W3FA 2EWWA 4Q0IA 4HNBA 5HZHA 4NEED 4E04A 1MZUA 4ARZA 4M4XA 1F98A 4BBTA 3F1OB 3KYZA 3LIBA 3NHQA 3MXQA 5DFXA 2A24B 1UWPX 1N9NA 3R7WB 1LSVA 4AFIA 4NXBA 3C8CA 5KSHA 2ZMFA 3FG8A 1V9YA 4ETZA 3HCYA 3VE3A 3P7NA 2J3TC 2JKTI 2GNXA 3F1NB 4OOMA 3UB8A 3CI6A 3PBTA 4EEUA 1W63M 3TJZC 2PD7A 2GZAA 4MMNA 2HGVA 3S7QA 2JKTM 4DJ3A 4Y3IA 4JGQA 3ZYTA 4BBUA 2V1BA 3B47A 2PYPA 5HWWA 3LR3A 4F3LA 1YKDA 4EETB 2M7VA 4EU0A 2MJ6A 2ZBBA 5G4YA 5HD3A 5HPFA 2VKSA 1S1ZA 3GDIA 1OTAA 4PAUA 1TD5A 4CLCB 4HP4A 4MCWA 1XJ2A 2W3EA 2NUTC 4MN6A 4WELA 2L1MA 5HDSA 1OTIA 3A0SA 3LFVA 4IUHA 2LB5A 2FH5A 4Y5FA 3B33A 3EGDC 3LR4A 2IA2A 1YAXA 5HPIA 2O99A 1GSWA 3OCNA 3GECA 2JKRI 3PXPA 2Z6CA 4I38A 4H6JB 1OJ5A 3R4KA 5HDDA 2O0YA 3KO6A 2VV6A 3UB6A 2XA7S 4HY8A 4GS9B 3JVVA 1H8MA 3OLOA 5J7EA 2Z6DA 3H82A 2JKRM 3BQAA 4G3VA 3V67A 4HIAA 1T18A 1X0OA 3H7WB 2R78A 4RQ9A 3S7PA 3BY9A 1LT0A 3KSFA 1G28A 2J3TD 3UB9A 1TF1A 1STZA 2B02A 4UEYA 4R6LA 3CAXA 4I39A 2ZOIA 1WA9A 2VA0A 3EQVA 1F5MA 4B93A 4HP9A 4FOFA 1UGUA 3S7OA 3SW1A 2H28A 1XJ4A 4WEKA 3LUQA 4FSFA 5TBMB 1OTEA 3ICYA 1S4SA 1LL8A 2PDRA 4GHIA 4MN5A 5HSQA 4L9EA 3NOPC 3FC7A 2V9AA 2VJWA 4YOFA 5L8MA 3LR5A 2W3GA 3EEAA 4ZRRA 3F1OA 3LIDA 2L4RA 2W3DA 3KX0X 5CX7A 5HDCA 3EGXC 3OBFA 3R7WA 3E98A 2PR5A 2VZWA 2OOLA 2INWA 3KSGA 3F1PB 3MQQA 1P0ZA 3MQ0A 4NXFA 1TS0A 2HJ9C 2VGLS 3CLOA 4EW7A 2KX6A 1N9OA 1P97A 3T4QA 2M1CA 3RH8B 1OT6A 4QPRA 3IS2B 3E4OA 4UQIS 3F1NA 4NXGA 4II7A 3KSIA 2P7JA 1T1CA 4GW9A 1TS8A 5F68A 2XA7M 2V0UA 1N9LA 4I5SA 4LRZE 2LB9A 4DMZA 1OTDA 2FZ0A 3RFBA 4XT2B 4JGRA 4WLAA 1ZTUA 2G7UA 3LI9A 1EW0A 3UB7A 2XRNA 2L0WA 1DP6A 3BJNA 4CLCE 2YKHA 5MC7A 4PKYG 3PYPA 1S1YA 4EESA 2KDKA 5A8BA 4WEJA 2D01A 3TW8A 2O9BA 4O01A 4IJGA 2CMNA 3T4JA 2OWJA 3KSHA 4KQOA 2WKQA 1GSVA 4Q0JA 4BWIA 5J3WA 4HJ3A 2I9VA 1S4RA 1XFNA 3BWLA 4CLCC 2OAP1 3P01A 3T4SA 3CWFA 1VHMA 5FL3A 4CLCA 2K7SA 2P08A 4I3AA 2EWVA 3JVUA 1TS6A 2VLGA 2WKRA 3D3OA 4I3IA 1YSPA 1P9WA 1YSQA 3NJAA 2HF6A 1XJ6A 4EQ1A 3HJIA 1NLYA 4WF0A 3D72A 4GLQA 4H6JA 3PR6A 3OC2A 3DBAA 4JGPA 5LBRA 4GS9A 4DJ2A 1UWNX 5TJJA 2VGLM 3K3CA 1V9ZA 4GJ4A 3KYQA 2D02A 4HQAA 4R70A 3BQ8A 4BJPA 3PBOA 3H7WA 4EXOA 2W1TB 4UQIM 2P04A 1DRMA 2JN7A 2OAQ1 3E4PA 4CQHA 4MDZA 1LSXA 2O9AA 2M7UA 3IBRA 2K2NA 1MC0A 4WN5A 3T4OA 1LSWA 4PHTA 2ZMVA 4YNRA 2A2LA 4HH2A 2V1AA 2EA9A 3G6OA 4Q0HA 4LLOB 1OPXA 5K5BA 4HJ6A 2XSSA 1F9IA 5IT5A 5AJGA 2QJ5A 5IU1A 4YWZA 3LIFA 2PHYA 5TBMA 4I3JA 3LR0A 2WKPA 4LRXC 1DP9A 3UMEA 1BYWA 4O0PA 1NLZA 2V0WA 4Y2FA 3PHYA 4ME4A 1GSXA 4BMWA 2QKPA 4R3AA 4WL9A 2A24A 5F6AA 5EFWA 2PD8A 2QJ7A 3NOUC 3K2NA 3EWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIE A;  5DJU A;  3F1P A;  3ZQ5 A;  2QHK A;  3EEH A;  2J80 A;  1S66 L;  5AVE A;  4HH3 A;  3IS2 A;  4EER A;  2PR6 A;  1T19 A;  1S67 L;  3NOT C;  4HJ4 A;  4PKY A;  5IS1 A;  3A0V A;  4KUK A;  3E4Q A;  4XT2 A;  3UMD A;  5DKK A;  2QWS A;  4R38 A;  5HWT A;  3LIA A;  1T1A A;  4WUJ A;  3A0R A;  1KOU A;  4F3L B;  2BAS A;  3MR0 A;  3VE4 A;  4HHD A;  3MFX A;  2VEA A;  4GCZ A;  1D06 A;  4HI4 A;  4L9G A;  1XJ3 A;  2W0N A;  3H9W A;  3ULF A;  5AVF A;  1T1B A;  1VB6 A;  4KQD A;  1JNU A;  5J4E A;  2VV8 A;  4LPZ A;  3C2W A;  3LI8 A;  2YKF A;  1OTB A;  2ZOH A;  4K08 A;  3MQO A;  3LIC A;  4HOI A;  2VV7 A;  3T50 A;  3UE6 A;  5F5Y A;  2HV1 A;  3LYX A;  3K3D A;  2GJ3 A;  1DP8 A;  4EEP A;  3RTY A;  3H82 B;  5G4Z A;  4L9F A;  2PYR A;  1NWZ A;  5DKL A;  5HWV A;  1D7E A;  5HD5 A;  4B9O A;  1TS7 A;  4JGO A;  3VOL A;  5F69 A;  1Y28 A;  2W27 A;  4NXE A;  1OJG A;  4KUO A;  5DJT A;  5KIZ A;  1XFQ A;  1OT9 A;  1ODV A;  5I5L A;  2OWH A;  3HJK A;  3BY8 A;  4BBV A;  3MJQ A;  4GHI B;  4LRY C;  2JHE A;  4HNB A;  5HZH A;  4E04 A;  1MZU A;  4M4X A;  1F98 A;  4BBT A;  3F1O B;  3LIB A;  3NHQ A;  3MXQ A;  2A24 B;  1UWP X;  1N9N A;  1LSV A;  4NXB A;  3C8C A;  3FG8 A;  1V9Y A;  3VE3 A;  3P7N A;  3F1N B;  3UB8 A;  4EEU A;  2PD7 A;  4DJ3 A;  4JGQ A;  4BBU A;  2V1B A;  2PYP A;  5HWW A;  4F3L A;  4EET B;  2ZBB A;  5G4Y A;  5HD3 A;  1S1Z A;  3GDI A;  1OTA A;  4HP4 A;  1XJ2 A;  4MN6 A;  2L1M A;  5HDS A;  1OTI A;  3A0S A;  3B33 A;  1GSW A;  3GEC A;  2Z6C A;  4I38 A;  4H6J B;  1OJ5 A;  5HDD A;  2VV6 A;  3UB6 A;  4HY8 A;  4GS9 B;  3OLO A;  5J7E A;  2Z6D A;  3H82 A;  4HIA A;  1T18 A;  1X0O A;  3H7W B;  2R78 A;  4RQ9 A;  3BY9 A;  1LT0 A;  1G28 A;  3UB9 A;  2B02 A;  4R6L A;  3CAX A;  4I39 A;  2ZOI A;  1WA9 A;  4HP9 A;  1UGU A;  3SW1 A;  2H28 A;  1XJ4 A;  3LUQ A;  5TBM B;  1OTE A;  3ICY A;  1S4S A;  1LL8 A;  2PDR A;  4GHI A;  4MN5 A;  5HSQ A;  4L9E A;  3NOP C;  3FC7 A;  2V9A A;  3F1O A;  3LID A;  2L4R A;  3KX0 X;  5HDC A;  2PR5 A;  3MQQ A;  2OOL A;  2INW A;  3F1P B;  1P0Z A;  4NXF A;  1TS0 A;  3CLO A;  4EW7 A;  2KX6 A;  1N9O A;  1P97 A;  2M1C A;  3RH8 B;  1OT6 A;  3IS2 B;  3E4O A;  3F1N A;  4NXG A;  2P7J A;  1T1C A;  4GW9 A;  1TS8 A;  5F68 A;  2V0U A;  1N9L A;  4I5S A;  4LRZ E;  1OTD A;  4XT2 B;  4JGR A;  4WLA A;  3LI9 A;  1EW0 A;  3UB7 A;  2L0W A;  1DP6 A;  2YKH A;  4PKY G;  3PYP A;  1S1Y A;  4EES A;  2KDK A;  5A8B A;  2D01 A;  2CMN A;  2OWJ A;  2WKQ A;  1GSV A;  5J3W A;  4HJ3 A;  2I9V A;  1S4R A;  1XFN A;  3BWL A;  3CWF A;  2K7S A;  4I3A A;  1TS6 A;  2VLG A;  2WKR A;  4I3I A;  3NJA A;  1XJ6 A;  4EQ1 A;  3HJI A;  4WF0 A;  3D72 A;  4H6J A;  4JGP A;  4GS9 A;  4DJ2 A;  1UWN X;  3K3C A;  1V9Z A;  4HQA A;  2D02 A;  4R70 A;  3H7W A;  4EXO A;  1DRM A;  2JN7 A;  3E4P A;  1LSX A;  3IBR A;  4WN5 A;  1LSW A;  4HH2 A;  2V1A A;  2EA9 A;  3G6O A;  4LLO B;  4HJ6 A;  1F9I A;  2QJ5 A;  5IU1 A;  4YWZ A;  3LIF A;  2PHY A;  5TBM A;  4I3J A;  4LRX C;  2WKP A;  1DP9 A;  3UME A;  1BYW A;  2V0W A;  3PHY A;  1GSX A;  2QKP A;  4R3A A;  4WL9 A;  2A24 A;  5F6A A;  5EFW A;  2PD8 A;  2QJ7 A;  3NOU C;  3EWK A; 
#chains in the Genus database with same CATH topology
 3EQU A;  5KSC A;  5DJU A;  4GN2 A;  3FPV A;  3HVF A;  1S66 L;  3IX3 A;  4LCL A;  4EER A;  5AQA A;  2XQZ A;  4Z1W A;  1S67 L;  4KG2 A;  4RX3 A;  2IWC A;  5HW3 A;  1PFL A;  2W1R A;  4R4S A;  1H8Y A;  3A0V A;  3E4Q A;  1GA0 A;  4ETX A;  4L0L A;  5DKK A;  4KZ7 A;  2QWS A;  1VQQ A;  2GDN A;  3MF0 A;  2BTF P;  1H8Z A;  1T1A A;  2H0T A;  5FAQ A;  2JBF A;  1FOF A;  1FSW A;  3MFX A;  1L0G A;  1D06 A;  2Y8H A;  4ZTK A;  3HLD A;  1NYM A;  1ES4 A;  1IEM A;  5AVF A;  1WE4 A;  1VB6 A;  2Q9N A;  4KEN B;  1HZO A;  3G32 A;  2XD1 A;  2ZQ7 A;  3CUE C;  3VP0 A;  3B42 A;  1YPR A;  4NKP A;  4WM9 A;  3M6B A;  1I2S A;  3CUE A;  3MXR A;  5FA7 A;  4KG6 A;  4N1X A;  3LIC A;  1IFQ A;  1BUE A;  4WZ5 C;  5HAR A;  4WZ5 A;  2HV1 A;  2XRO A;  2GJ3 A;  2A49 A;  4ZJ2 A;  3RTY A;  3H82 B;  2PYR A;  1NWZ A;  3O87 A;  5DKL A;  1D7E A;  4KZ5 A;  3T4L A;  3C38 A;  3A3J A;  2ZC5 B;  3WRZ A;  2A3U A;  1EWZ A;  4C3Q A;  5F69 A;  4BL3 A;  3QHY A;  2WGI A;  3C4O A;  2ZM2 A;  5EUA A;  4IED A;  3SOI A;  2W27 A;  3T4T A;  3WS1 A;  3MKE A;  1MKI A;  1XFQ A;  4GD6 A;  2Y2I A;  3ITB A;  3PBQ A;  3IX4 A;  2JHE A;  5FEG A;  3IQA A;  4R1G A;  4QJG A;  4HNB A;  5KMW A;  5HL1 A;  3Q7Z A;  4E04 A;  4N9K A;  1F98 A;  2V8F A;  1QMF A;  1PWD A;  3NHQ A;  5DFX A;  2WUQ A;  3R7W B;  1RP5 A;  4NXB A;  2XF3 A;  4X25 A;  1G68 A;  3FG8 A;  4ETZ A;  4FCF A;  3ZNY A;  3P7N A;  2H0Y A;  2GNX A;  1FQG A;  2JCH A;  3CI6 A;  2FFY A;  3PBT A;  3ISG A;  1IYO A;  1W63 M;  2C6W B;  2XFT A;  3WS2 A;  4MMN A;  2H5S A;  4JGQ A;  1BLP A;  3QNC A;  3G35 A;  2V1B A;  3A3D A;  1WYB A;  2WGW B;  3B47 A;  3FKW A;  2HP9 A;  3M2J A;  4NK3 A;  4NET A;  4DXB A;  3NDE A;  2RL3 A;  3VP1 A;  3JPU A;  3CZD A;  5FAO A;  4A5R A;  1SDN A;  3KYE A;  2XEP A;  5GL9 A;  1M40 A;  2HPB A;  4GDB A;  3UO9 A;  1OTA A;  4MCW A;  2HDS A;  4MBF A;  5HDS A;  2FH5 A;  4OOY A;  4D60 A;  3IH9 A;  3EGD C;  4S2M A;  1M6K A;  2IA2 A;  1RGZ A;  2O99 A;  3O86 A;  3GEC A;  1XKZ A;  4I38 A;  3R4K A;  3BFC A;  3UB6 A;  2HP5 A;  1KE3 A;  2Z6D A;  1T18 A;  1H5X A;  2FFF B;  1KE4 A;  1FCO A;  3H7W B;  2R78 A;  3S7P A;  3WRT A;  4B4Z A;  1TF1 A;  1STZ A;  4R6L A;  4I39 A;  5FAS A;  3UDX A;  4XXR A;  1ERO A;  4FOF A;  3S7O A;  5DF8 A;  5HFO A;  3IT9 A;  3DTE A;  1LL8 A;  4S2J A;  1MWU A;  4L9E A;  5HAI A;  1ONH A;  2VJW A;  3VP4 A;  1LI0 A;  5L8M A;  3LR5 A;  2W3G A;  4ZRR A;  3HLW A;  3F1O A;  2XFS A;  1HVB A;  3BFD A;  5HDC A;  5CX7 A;  4BD0 A;  3OBF A;  4GDN A;  3Q82 A;  1TS0 A;  3IF6 C;  1VEU A;  2KX6 A;  4OP5 A;  4PMA A;  2M1C A;  3IF6 A;  4OPZ A;  2J9O A;  4QPR A;  3T1Q B;  3E4O A;  5EVL A;  3F1N A;  1E4D A;  3FV7 A;  1NRF A;  4II7 A;  1MY8 A;  5JYP A;  4GW9 A;  1IYS A;  3HRE A;  2WKI A;  3LCE A;  5HAP A;  3VOY A;  1PWC A;  2WZZ A;  4HEF A;  1ZTU A;  2V8C A;  1BLH A;  1N9B A;  3LI9 A;  5JYO A;  2IWB A;  4JPM A;  1LLB A;  3UB7 A;  1GHP A;  4KZ6 A;  1JWZ A;  1HLU P;  3KSH A;  5CGW A;  1SKO A;  2XH9 A;  4BWI A;  1XFN A;  4CLC C;  2OAP 1;  5D3O A;  2Y2M A;  4CLC A;  2K7S A;  4YFM A;  4EBL A;  3L9K A;  2WKR A;  5I94 A;  3HLC A;  3PAG A;  1YSP A;  1G6A A;  4Y15 A;  4RVA A;  1XJ6 A;  1W8Q A;  4H6J A;  3OC2 A;  1JTG A;  3DBA A;  3HBR A;  3GV9 A;  2B5R A;  3G34 A;  3A3E A;  1W79 A;  3K3C A;  3HLB A;  4GJ4 A;  3HL9 A;  3PBO A;  1NJ4 A;  2PBD P;  4Y7P A;  3UPO A;  3C7U A;  4U0T A;  4Y17 A;  3CMZ A;  2O9A A;  2VGJ A;  2Y2P A;  3UPN A;  2V20 A;  2ACG A;  1RGY A;  1I5Q A;  3G6O A;  3NCK A;  5K5B A;  1BTL A;  4P0M A;  3LR0 A;  2WKP A;  3GQZ A;  3ZCZ A;  4HBT A;  4UA6 A;  1YMS A;  4IBR A;  3MSH A;  3V50 A;  2A24 A;  2HP6 A;  1XA1 A;  5FAP A;  4ARZ B;  3EWK A;  4DE0 A;  4PM9 A;  4CLC D;  3EEH A;  3T1S A;  5DFY A;  5HX9 A;  1D1J A;  4Y0U A;  5EVI C;  3NUL A;  3EOI A;  5EVI A;  1I2W A;  3IF6 B;  5IS1 A;  4FUW A;  3UE3 A;  4KUK A;  3TG9 A;  3UMD A;  1G6O A;  4EUV A;  3UY6 A;  1L3L A;  5CEC A;  1XA7 A;  4WUJ A;  4OOL A;  3MR0 A;  5AQB A;  4GNU A;  3VE4 A;  2EX8 A;  4HHD A;  5EM0 A;  3RXX A;  4S2P A;  4GCZ A;  3FWL A;  4LCM A;  4MEZ A;  2W0N A;  1PI4 A;  1KVM A;  4DN0 A;  4OQI A;  2PRF A;  1JNU A;  3U2A A;  3TE8 A;  4LPZ A;  3AGF A;  4K08 A;  2QZ6 A;  4HOI A;  1L2S A;  1HD8 A;  5GLC A;  3CJM A;  3HLG A;  4EEP A;  1DP8 A;  2Y2H A;  1K56 A;  4KG5 A;  1FR6 A;  2W1T A;  5G4Z A;  3IXG A;  3HUO A;  3TRC A;  5HWV A;  3IWO A;  5U47 A;  5EVI D;  1IOU A;  2EX2 A;  4GKU A;  3S7N A;  4B9O A;  1TS7 A;  2Y79 A;  4X69 A;  2DMW A;  3CIT A;  5L07 A;  5GHZ A;  2ZL1 B;  2P9V A;  4NXE A;  1GA9 A;  3BW6 A;  1OT9 A;  4MN7 A;  3PBR A;  3SS3 A;  4KZ9 A;  1ODV A;  2OWH A;  3BFG A;  2CC1 A;  2EWW A;  1H0M A;  2Y91 A;  4NEE D;  2Z2L B;  1DY6 A;  2R9W A;  4BBT A;  1BUL A;  3GRJ A;  1YLW A;  2ZC3 B;  3C7V A;  4RX2 A;  3KYZ A;  3LIB A;  5CHJ A;  2A24 B;  1YLJ A;  1N9N A;  1SZV A;  5A90 A;  4P87 A;  4XUX A;  4Q8I A;  3LEZ A;  3NY4 A;  1V9Y A;  4KZ3 A;  4NG2 A;  5AQ9 A;  2JKT I;  1PRQ A;  4EEU A;  5DVA A;  4PM8 A;  3TJZ C;  2X02 A;  3V3S A;  4X53 A;  3WS4 A;  5GLA A;  3CHW P;  1K56 D;  3ZGA B;  4LEN A;  2HGV A;  2JKT M;  4DJ3 A;  4Y3I A;  3ZVT A;  3MXS A;  4BBU A;  3Q7V B;  3A3F A;  3IXB A;  1Y54 A;  5HWW A;  2WKE A;  4F3L A;  5IHV A;  4EET B;  2M7V A;  3BM6 A;  4HBU A;  5G4Y A;  3LY3 A;  5HD3 A;  3T1X A;  3PTE A;  3G2Z A;  1KE0 A;  1S1Z A;  4CJN A;  4M3K A;  3A0S A;  3LFV A;  4MBK A;  4Y5F A;  1CI9 A;  1ESU A;  1KGE A;  4LV1 A;  3OCN A;  4BD1 A;  5HDD A;  4FH2 A;  1ES2 A;  2VV6 A;  1MWS A;  3VP3 A;  1ZKJ A;  2XA7 S;  4GS9 B;  1FCM A;  1H8M A;  2EX6 A;  2X71 A;  1BZA A;  1Z09 A;  1MPL A;  2WZX A;  4UA7 A;  1GCE A;  1LT0 A;  1G28 A;  3MZD A;  3UB9 A;  2Y2Q A;  3CAX A;  2ZOI A;  2VA0 A;  1O7E A;  5CER A;  1F5M A;  4E3N A;  1JVJ A;  1ALQ A;  4LV0 A;  1UGU A;  2H28 A;  3GTC A;  1XJ4 A;  3P98 A;  3QP6 A;  4WEK A;  4FSF A;  3CPT B;  1S4S A;  3JYI A;  2PDR A;  4GHI A;  4BEN A;  2X01 A;  3BFE A;  1ZG4 A;  5FI2 A;  2W3D A;  1XGJ A;  3EGX C;  4Z9Q A;  3E98 A;  2OOL A;  4EW7 A;  3T4Q A;  1CQA A;  1YLT A;  1OT6 A;  2HDU A;  3RXW A;  5CXW A;  1CF0 A;  3KSI A;  2P7J A;  3NC8 A;  1T1C A;  5E2H A;  4S2I A;  2PBY A;  4WBG A;  2XA7 M;  1N9L A;  2V0U A;  1JWP A;  4IVK A;  4I5S A;  4OP8 A;  2Y2L A;  4JGR A;  3GR2 A;  1DJC A;  1CJF A;  3RJU A;  3DTI A;  2L0W A;  1DP6 A;  2WKH A;  3BLS A;  3LY4 A;  2D01 A;  3ZHH A;  4IJG A;  3ZG5 A;  4KZ8 A;  3MFD A;  4DDY A;  2I9V A;  1S4R A;  3ZFZ A;  4E3M A;  2DRW A;  1IKI A;  4DE1 A;  5FDS A;  4LV2 A;  4WMC A;  4I3A A;  3D4F A;  4RYE A;  1QME A;  5EOE A;  3D3O A;  1N4O A;  2WYX A;  1P9W A;  5DTK A;  2HF6 A;  3Q81 A;  3UE1 A;  4EQ1 A;  3B3X A;  5CGS A;  1NLY A;  3D72 A;  4IVI A;  1MWR A;  5FSR A;  4ZBE A;  4JKT A;  5LBR A;  4UA9 A;  3UDI A;  2XLN A;  4EBP A;  4HQA A;  4BJP A;  2Y59 A;  4WZ4 A;  1LHY A;  2DCF A;  4MDZ A;  3SZT A;  4WN5 A;  4JLF A;  2JC7 A;  1LSW A;  4YNR A;  1A0K A;  1G5U A;  4Q0H A;  1FCN A;  4UAA A;  4R3B A;  3UE0 A;  4YWZ A;  3N8S A;  3LIF A;  4LGW A;  2PHY A;  5TBM A;  4I3J A;  4LRX C;  1LL9 A;  1BYW A;  5E2E A;  2G2W A;  4P85 A;  3PHY A;  1BLS A;  4ME4 A;  1C3B A;  1GSX A;  4R3A A;  4KZA A;  2RCX A;  5CHM A;  3BEC A;  4OKP A;  2OV5 A;  3W4O A;  1K57 C;  4ZDX A;  1J3W A;  4WMC D;  3F1P A;  4E3O A;  4JF5 A;  1K57 A;  2J80 A;  3BYD A;  4PM7 A;  4HH3 A;  1K25 A;  3BRM A;  4DDS A;  4JXG A;  3IS2 A;  4R3J A;  1XX2 A;  1SDE A;  2PR6 A;  3OCL A;  3E0Y A;  3NOT C;  4HJ4 A;  1HTZ A;  3W4Q A;  4PKY A;  4WYY A;  1JTD A;  4OPY A;  1W5D A;  4XT2 A;  2EFU A;  3VV4 A;  4OON A;  3DTK A;  2AVX A;  4R38 A;  2E8J A;  2Y2O A;  2HZ5 A;  3A0R A;  1KOU A;  2BAS A;  4E3L A;  3C4P A;  1ONG A;  2KLI A;  2VEA A;  4HI4 A;  5FI6 A;  3PBS A;  3MMH A;  4IUK A;  1NZO A;  4L9G A;  1XJ3 A;  3H9W A;  4QHC A;  4X68 A;  3ULF A;  1T1B A;  3N8L A;  5HAQ A;  1K0K A;  4S2L A;  3IF5 A;  4KQD A;  2JKG A;  5J4E A;  2VV8 A;  3PAE A;  1P9R A;  1MWT A;  2ZQ8 A;  3C2W A;  2J3W A;  2YKF A;  3WS5 A;  2J8Y A;  3T50 A;  4F94 A;  5FQI A;  4DKI A;  5F5Y A;  2KOI A;  2W3H A;  3OPH A;  1PWG A;  2XK1 A;  3LYX A;  5EV0 A;  2ZLY A;  3HLF A;  5EEC A;  2ZQ9 A;  4L9F A;  1VET A;  3N4I A;  3O5Y A;  3OZH A;  5DF9 A;  1W63 Q;  1YM1 A;  1ZHH B;  3C30 A;  2QMI A;  2J9P A;  4JGO A;  2O9C A;  3VOL A;  2B18 A;  4O8G A;  5EOO A;  4KUO A;  3UNW A;  4E6W A;  1TEM A;  5GLB A;  5KIZ A;  3QP1 A;  3UB5 P;  2HJE A;  2WK0 A;  2K31 A;  2GX5 A;  3MJQ A;  1OME A;  3FZC A;  4K0W A;  5GHX A;  1CI8 A;  5HZH A;  2ZC7 A;  2ZQC A;  3F1O B;  5M18 A;  5FQK A;  2Y2G A;  4UHU A;  4ZJ1 A;  4X6T A;  4KQR A;  1LL5 A;  4E3K A;  1LSV A;  1PW1 A;  1RCJ A;  3C8C A;  4OQG A;  2ZMA A;  1VEU B;  2ZMF A;  3HCY A;  1K4E A;  5M1A A;  3VE3 A;  3F1N B;  4QWO A;  2EX9 A;  3HLE A;  5TR7 A;  3OPR A;  5FQJ A;  3ZYT A;  3ZG7 B;  1YT4 A;  3ZVW A;  3G30 A;  2PU2 A;  1L0F A;  4OPQ A;  3DW0 A;  4GOG A;  4EU0 A;  4S2K A;  3E2L A;  2MJ6 A;  2ZBB A;  3TOI A;  1SKO B;  3UN7 A;  1ERQ A;  3GVB A;  3HUN A;  1YLP A;  4ID4 A;  5HPF A;  3QP8 A;  2VKS A;  3GDI A;  4CLC B;  4HP4 A;  2W3E A;  4WEL A;  2NUT C;  1AWI A;  3IHA A;  3T12 B;  3WWX A;  1OTI A;  4BQM A;  1PYY A;  4ZJ3 A;  3LR4 A;  4D2O A;  1SHV A;  5HPI A;  5DTS A;  4R23 A;  1W7F A;  2P74 A;  4H6J B;  4QY5 A;  3KO6 A;  4PM6 A;  4HY8 A;  3OLO A;  4OH0 A;  5GHY A;  2ZQA A;  3H82 A;  3SS5 A;  3P09 A;  4G3V A;  4HIA A;  1X0O A;  1ERM A;  3VFF A;  3E2K A;  2XD5 A;  5FQM A;  4UEY A;  3Q07 A;  2VGK A;  4B88 A;  4EWF A;  3EQV A;  2J7V A;  4HES A;  4B93 A;  4QU3 A;  1JWV A;  4BLM A;  5EM1 A;  5EPH A;  3SW1 A;  1WYC A;  1OTE A;  1GHI A;  3IHB A;  4MN5 A;  3U4L P;  3NOP C;  3DWK A;  1PZO A;  3FC7 A;  2V9A A;  4YOF A;  3EEA A;  4EV4 A;  3L7H A;  3MBZ A;  3R7W A;  2G2U A;  2PR5 A;  2VZW A;  5F1G A;  1TDG A;  3KSG A;  1P0Z A;  4NXF A;  4PM5 A;  2HJ9 C;  2VGL S;  1N9O A;  3VMA A;  3RH8 B;  5CEB A;  4UQI S;  4JF4 A;  4K91 A;  1Y4O A;  5EVI B;  5G18 A;  4LRZ E;  4DMZ A;  3RFB A;  4KZ4 A;  3ZG0 A;  3QP5 A;  2WGW A;  5CTN A;  1CEG A;  4OVD A;  5TGF A;  1EW0 A;  1XPB A;  2XRN A;  5GLD A;  3BJN A;  3FYZ A;  5M19 A;  1BT5 A;  4CLC E;  2YKH A;  3PYP A;  1S1Y A;  4EES A;  2KDK A;  5A8B A;  3TW8 A;  2O9B A;  5TFQ A;  1IKG A;  2BLS A;  2OWJ A;  2XR0 A;  4DF6 A;  1MXO A;  1XP4 A;  2WKQ A;  1GSV A;  4JXV A;  4Q0J A;  1PW8 A;  1YLY A;  1BLC A;  1TVF A;  3BWL A;  1XXM A;  4X1L A;  4DXC A;  3BFF A;  3T4S A;  1VHM A;  5FL3 A;  2P08 A;  5L2F A;  4KZB A;  3DTM A;  2PU4 A;  1TS6 A;  5AQ7 A;  4I3I A;  1YSQ A;  4LFU A;  3NI9 A;  3G2Y A;  3SH8 A;  4WF0 A;  4GLQ A;  3AGD A;  1FIL A;  4JGP A;  5FEF A;  4LV3 A;  4OPR A;  4JXS A;  4DJ2 A;  1FIK A;  1UWN X;  4N9L A;  2VGL M;  1V9Z A;  4XUZ A;  2I72 A;  3KYQ A;  2D02 A;  4R70 A;  3GMW A;  3H7W A;  2W1T B;  4UQI M;  2EXA A;  2P04 A;  2JN7 A;  4EQI A;  1FR1 A;  1LSX A;  2K2N A;  1MC0 A;  3T4O A;  4X1M A;  1AXB A;  2R9X A;  4JBF A;  4LLO B;  1OPX A;  4RA7 A;  2P9V B;  3SS4 A;  1F9I A;  5AJG A;  1KDS A;  4U0X A;  1DP9 A;  3O3V A;  2BG1 A;  1NLZ A;  1E3U A;  2V0W A;  4Y2F A;  4BMW A;  1F2K A;  2OLV A;  5F6A A;  2ZJ9 A;  4N1H A;  3N8R A;  5EFW A;  1E25 A;  5F83 A;  3NOU C;  3K2N A;  3A3I A;  3LIE A;  3ZQ5 A;  2QHK A;  3PBN A;  1S6R A;  2VX8 A;  5AVE A;  2WAE A;  1BSG A;  2E8I A;  5A92 A;  3G4P A;  4FTX A;  3IX8 A;  1ACF A;  2V2F F;  1T19 A;  3MZF A;  3MZE A;  3NDG A;  5DF7 A;  3V3R A;  1U60 A;  3Q1F A;  2V1Z A;  1DJB A;  3ITA A;  1ZG6 A;  4P6Z S;  5FI7 A;  4IBX A;  2QYB A;  1PZP A;  4OQ0 A;  5HWT A;  3LIA A;  4X55 A;  4F3L B;  4P6B A;  3IWI A;  1ZC2 A;  3IH8 A;  3OPL A;  4N92 A;  2WAF A;  2HDQ A;  3QP2 A;  1ES5 A;  4DE2 A;  2NUP C;  3NIA A;  1E3U D;  5CTM A;  2C5W B;  3S22 A;  3NEC A;  4MLL A;  5L10 A;  3LI8 A;  1OTB A;  3LGO A;  2ZOH A;  3W2Z A;  3MQO A;  3ZG8 B;  3W8K A;  3IBJ A;  2VV7 A;  2PT7 A;  1NXY A;  5KZH A;  4Y0T A;  3CG5 A;  3UE6 A;  3K3D A;  3DAV A;  2Y2N A;  2EXB A;  1K55 C;  4ESP A;  1NZU A;  1MKM A;  5HD5 A;  4OLD A;  3T4K A;  1K55 A;  1VM1 A;  4IHQ A;  1Y28 A;  3UDF A;  3OOV A;  5HL6 A;  3FPW A;  1OJG A;  1H3Q A;  3ZNT A;  5DJT A;  4P6Z M;  4EBN A;  4G3W A;  3S1Y A;  5I5L A;  3HJK A;  3BY8 A;  4BBV A;  4G3K A;  4QD4 A;  4R0Q A;  4GHI B;  4LRY C;  5C5K A;  1SCW A;  1NRJ A;  1L0D A;  2W3F A;  1L0E A;  4Q0I A;  3MKF A;  4BL2 A;  3BLM A;  4B4X A;  1MZU A;  2ZC4 B;  1FSY A;  4M4X A;  4ARZ A;  3MXQ A;  3HUM A;  1UWP X;  1Q2Q A;  2XDM A;  4QB8 A;  4AFI A;  4FD8 A;  5EVE A;  4OQH A;  5KSH A;  1NYY A;  1GHM A;  3QNB A;  2H10 A;  2OLU A;  3D9Y A;  2J3T C;  3AGE A;  1K6S A;  1YQS A;  4OOM A;  3UB8 A;  4DRT A;  1CK3 A;  2WAD A;  4MNR A;  2PD7 A;  5E43 A;  1IEL A;  2GZA A;  5FQQ A;  4GZB A;  3S7Q A;  5E2G A;  2WGV A;  4EUZ A;  4KQQ A;  1CEF A;  2ZC6 B;  5BOH A;  2PYP A;  3LR3 A;  3VSL A;  1YKD A;  3N6I A;  2XGN A;  5J8X A;  5CHU A;  4GD8 A;  3UPP A;  1K6R A;  2Q0O A;  4U3T A;  4PAU A;  2Y2K A;  1TD5 A;  1XJ2 A;  4MN6 A;  2IWD A;  4OLG A;  2L1M A;  4IUH A;  2LB5 A;  2UWX A;  3W4P A;  3B33 A;  5EE8 A;  2Y55 A;  1YAX A;  3G31 A;  1LI9 A;  1GSW A;  3IXD A;  2JKR I;  4FH4 A;  3PXP A;  4S2N C;  2Z6C A;  1OJ5 A;  4C6Y A;  2O0Y A;  2OSU A;  4S2N A;  1O07 A;  1SKF A;  3JVV A;  2UV0 E;  4R4R A;  4DE3 A;  5J7E A;  2JKR M;  3BQA A;  5CGX A;  4E6X A;  3V67 A;  4YIN A;  2Q9M A;  4E3J A;  3N7W A;  1IYP A;  4RQ9 A;  3BY9 A;  2ZQD A;  1PNE A;  4JF6 A;  3KSF A;  5F82 A;  2J3T D;  1YMX A;  1K54 C;  1YLZ A;  2B02 A;  5CED A;  1WA9 A;  1K54 A;  2ZL1 A;  4C75 A;  1W8Y A;  1KVL A;  1KDW A;  4HP9 A;  4K0X A;  3IXH A;  3LUQ A;  3VFH A;  2VK3 A;  5TBM B;  3ICY A;  3ZDJ A;  2HDR A;  1NY0 A;  5HSQ A;  2JE5 A;  3BEB A;  1J9M A;  3VSK A;  3V5M A;  2ZM8 A;  3LID A;  2L4R A;  3KX0 X;  1MBL A;  4E3I A;  3FKV A;  3MQQ A;  3F1P B;  1S0W A;  2INW A;  3MQ0 A;  4PPR A;  5F1F A;  1Q2P A;  2B95 A;  3CLO A;  4Y13 A;  4JXW A;  1P97 A;  2JKF A;  5FDH A;  3IS2 B;  3GSG A;  4S2O A;  4NXG A;  2EFX A;  1ES3 A;  5DTT A;  1TS8 A;  2Y4A A;  5F68 A;  2LB9 A;  1OTD A;  2FZ0 A;  1KGG A;  4XT2 B;  3Q7V A;  4WLA A;  5FAT A;  3M6H A;  2G7U A;  4GB7 A;  4ZAM A;  1K38 A;  4X56 A;  3V39 A;  3NBL A;  3VOZ A;  5MC7 A;  4PKY G;  1XGI A;  4WEJ A;  4O01 A;  2CMN A;  3T4J A;  3LEQ A;  4KQO A;  1Z6F A;  5J3W A;  4HJ3 A;  4Y0O A;  2ZM0 A;  3TSG A;  3P01 A;  2Y2J A;  1DJA A;  3IWQ A;  3CWF A;  3OPP A;  2EWV A;  2QPN A;  3DWZ A;  3MS6 A;  3JVU A;  4MBH A;  3ZG9 B;  2VLG A;  3T1R A;  3VP2 A;  3SH9 A;  3SH7 A;  3NJA A;  3HJI A;  4H8R A;  3M2K A;  4O7D A;  3PR6 A;  5E2F A;  5L09 A;  4GS9 A;  1PIO A;  5TJJ A;  4CPK A;  5A91 A;  3S4X A;  1ESI A;  1KGF A;  3BQ8 A;  5A93 A;  3WS0 A;  4EXO A;  1IYQ A;  5FQ9 A;  1DRM A;  1VET B;  3O88 A;  4QY6 A;  2OAQ 1;  3E4P A;  4CQH A;  2M7U A;  3IBR A;  2PAV P;  1K4F A;  5CRF A;  4PHT A;  3QP4 A;  2DNS A;  2ZMV A;  2A2L A;  4HH2 A;  2V1A A;  2EA9 A;  3C5A A;  4HJ6 A;  2XSS A;  5IT5 A;  1PI5 A;  2QJ5 A;  5IU1 A;  3CPT A;  1EI5 A;  3UME A;  2ZD8 A;  2Z2M B;  1TDL A;  4O0P A;  3LO7 A;  2QKP A;  4WL9 A;  3I7J A;  2PD8 A;  2QJ7 A; 
#chains in the Genus database with same CATH homology
 3EQU A;  3LIE A;  5DJU A;  3F1P A;  3ZQ5 A;  4CLC D;  2QHK A;  3PBN A;  3EEH A;  4ARZ B;  2VX8 A;  2J80 A;  3FPV A;  5DFY A;  1S66 L;  5AVE A;  4HH3 A;  3IS2 A;  4EER A;  2PR6 A;  4Z1W A;  3OCL A;  1T19 A;  3E0Y A;  3EOI A;  1S67 L;  3NOT C;  4HJ4 A;  4PKY A;  5IS1 A;  2W1R A;  3UE3 A;  3A0V A;  4KUK A;  3E4Q A;  4XT2 A;  4ETX A;  3UMD A;  4L0L A;  3VV4 A;  5DKK A;  1G6O A;  2QWS A;  4P6Z S;  4EUV A;  3MF0 A;  2QYB A;  4R38 A;  5HWT A;  3LIA A;  1T1A A;  4WUJ A;  3A0R A;  1KOU A;  4F3L B;  2BAS A;  4OOL A;  3MR0 A;  3VE4 A;  4HHD A;  3MFX A;  2KLI A;  2VEA A;  4GCZ A;  1D06 A;  2Y8H A;  4HI4 A;  3PBS A;  3MMH A;  4IUK A;  4L9G A;  1XJ3 A;  2W0N A;  3H9W A;  3ULF A;  5AVF A;  1T1B A;  1VB6 A;  4DN0 A;  2NUP C;  4KQD A;  1JNU A;  3U2A A;  3TE8 A;  2VV8 A;  3CUE C;  5J4E A;  3B42 A;  1P9R A;  4NKP A;  4LPZ A;  3C2W A;  3CUE A;  3LI8 A;  2J3W A;  1OTB A;  2YKF A;  2ZOH A;  4K08 A;  3W2Z A;  3MQO A;  3LIC A;  1IFQ A;  3IBJ A;  4HOI A;  2VV7 A;  3T50 A;  2PT7 A;  3UE6 A;  5F5Y A;  2KOI A;  2W3H A;  2HV1 A;  3LYX A;  2XRO A;  3K3D A;  2GJ3 A;  1DP8 A;  4EEP A;  3RTY A;  2W1T A;  3H82 B;  4L9F A;  5G4Z A;  2PYR A;  1NWZ A;  3O5Y A;  5DKL A;  3TRC A;  5DF9 A;  5HWV A;  1W63 Q;  1D7E A;  1IOU A;  1MKM A;  5HD5 A;  1ZHH B;  3T4L A;  3C30 A;  3S7N A;  3C38 A;  1TS7 A;  4B9O A;  2Y79 A;  3T4K A;  2DMW A;  4JGO A;  2O9C A;  3CIT A;  4IHQ A;  3VOL A;  5F69 A;  1Y28 A;  3OOV A;  5HL6 A;  2B18 A;  4O8G A;  2W27 A;  3FPW A;  4NXE A;  3T4T A;  1OJG A;  4KUO A;  1H3Q A;  5DJT A;  4P6Z M;  3BW6 A;  5KIZ A;  1XFQ A;  4G3W A;  1OT9 A;  4MN7 A;  3PBR A;  1ODV A;  5I5L A;  2OWH A;  3HJK A;  2HJE A;  2K31 A;  3BY8 A;  2GX5 A;  4BBV A;  3MJQ A;  4G3K A;  4GHI B;  4LRY C;  3PBQ A;  5C5K A;  2JHE A;  1NRJ A;  2W3F A;  2EWW A;  4Q0I A;  4HNB A;  5HZH A;  4NEE D;  4E04 A;  1MZU A;  4ARZ A;  4M4X A;  1F98 A;  4BBT A;  3F1O B;  3KYZ A;  3LIB A;  3NHQ A;  3MXQ A;  5DFX A;  2A24 B;  1UWP X;  1N9N A;  3R7W B;  1LSV A;  4AFI A;  4NXB A;  3C8C A;  5KSH A;  2ZMF A;  3FG8 A;  1V9Y A;  4ETZ A;  3HCY A;  3VE3 A;  3P7N A;  2J3T C;  2JKT I;  2GNX A;  3F1N B;  4OOM A;  3UB8 A;  3CI6 A;  3PBT A;  4EEU A;  1W63 M;  3TJZ C;  2PD7 A;  2GZA A;  4MMN A;  2HGV A;  3S7Q A;  2JKT M;  4DJ3 A;  4Y3I A;  4JGQ A;  3ZYT A;  4BBU A;  2V1B A;  3B47 A;  2PYP A;  5HWW A;  3LR3 A;  4F3L A;  1YKD A;  4EET B;  2M7V A;  4EU0 A;  2MJ6 A;  2ZBB A;  5G4Y A;  5HD3 A;  5HPF A;  2VKS A;  1S1Z A;  3GDI A;  1OTA A;  4PAU A;  1TD5 A;  4CLC B;  4HP4 A;  4MCW A;  1XJ2 A;  2W3E A;  2NUT C;  4MN6 A;  4WEL A;  2L1M A;  5HDS A;  1OTI A;  3A0S A;  3LFV A;  4IUH A;  2LB5 A;  2FH5 A;  4Y5F A;  3B33 A;  3EGD C;  3LR4 A;  2IA2 A;  1YAX A;  5HPI A;  2O99 A;  1GSW A;  3OCN A;  3GEC A;  2JKR I;  3PXP A;  2Z6C A;  4I38 A;  4H6J B;  1OJ5 A;  3R4K A;  5HDD A;  2O0Y A;  3KO6 A;  2VV6 A;  3UB6 A;  2XA7 S;  4HY8 A;  4GS9 B;  3JVV A;  1H8M A;  3OLO A;  5J7E A;  2Z6D A;  3H82 A;  2JKR M;  3BQA A;  4G3V A;  3V67 A;  4HIA A;  1T18 A;  1X0O A;  3H7W B;  2R78 A;  4RQ9 A;  3S7P A;  3BY9 A;  1LT0 A;  3KSF A;  1G28 A;  2J3T D;  3UB9 A;  1TF1 A;  1STZ A;  2B02 A;  4UEY A;  4R6L A;  3CAX A;  4I39 A;  2ZOI A;  1WA9 A;  2VA0 A;  3EQV A;  1F5M A;  4B93 A;  4HP9 A;  4FOF A;  1UGU A;  3S7O A;  3SW1 A;  2H28 A;  1XJ4 A;  4WEK A;  3LUQ A;  4FSF A;  5TBM B;  1OTE A;  3ICY A;  1S4S A;  1LL8 A;  2PDR A;  4GHI A;  4MN5 A;  5HSQ A;  4L9E A;  3NOP C;  3FC7 A;  2V9A A;  2VJW A;  4YOF A;  5L8M A;  3LR5 A;  2W3G A;  3EEA A;  4ZRR A;  3F1O A;  3LID A;  2L4R A;  2W3D A;  3KX0 X;  5CX7 A;  5HDC A;  3EGX C;  3OBF A;  3R7W A;  3E98 A;  2PR5 A;  2VZW A;  2OOL A;  2INW A;  3KSG A;  3F1P B;  3MQQ A;  1P0Z A;  3MQ0 A;  4NXF A;  1TS0 A;  2HJ9 C;  2VGL S;  3CLO A;  4EW7 A;  2KX6 A;  1N9O A;  1P97 A;  3T4Q A;  2M1C A;  3RH8 B;  1OT6 A;  4QPR A;  3IS2 B;  3E4O A;  4UQI S;  3F1N A;  4NXG A;  4II7 A;  3KSI A;  2P7J A;  1T1C A;  4GW9 A;  1TS8 A;  5F68 A;  2XA7 M;  2V0U A;  1N9L A;  4I5S A;  4LRZ E;  2LB9 A;  4DMZ A;  1OTD A;  2FZ0 A;  3RFB A;  4XT2 B;  4JGR A;  4WLA A;  1ZTU A;  2G7U A;  3LI9 A;  1EW0 A;  3UB7 A;  2XRN A;  2L0W A;  1DP6 A;  3BJN A;  4CLC E;  2YKH A;  5MC7 A;  4PKY G;  3PYP A;  1S1Y A;  4EES A;  2KDK A;  5A8B A;  4WEJ A;  2D01 A;  3TW8 A;  2O9B A;  4O01 A;  4IJG A;  2CMN A;  3T4J A;  2OWJ A;  3KSH A;  4KQO A;  2WKQ A;  1GSV A;  4Q0J A;  4BWI A;  5J3W A;  4HJ3 A;  2I9V A;  1S4R A;  1XFN A;  3BWL A;  4CLC C;  2OAP 1;  3P01 A;  3T4S A;  3CWF A;  1VHM A;  5FL3 A;  4CLC A;  2K7S A;  2P08 A;  4I3A A;  2EWV A;  3JVU A;  1TS6 A;  2VLG A;  2WKR A;  3D3O A;  4I3I A;  1YSP A;  1P9W A;  1YSQ A;  3NJA A;  2HF6 A;  1XJ6 A;  4EQ1 A;  3HJI A;  1NLY A;  4WF0 A;  3D72 A;  4GLQ A;  4H6J A;  3PR6 A;  3OC2 A;  3DBA A;  4JGP A;  5LBR A;  4GS9 A;  4DJ2 A;  1UWN X;  5TJJ A;  2VGL M;  3K3C A;  1V9Z A;  4GJ4 A;  3KYQ A;  2D02 A;  4HQA A;  4R70 A;  3BQ8 A;  4BJP A;  3PBO A;  3H7W A;  4EXO A;  2W1T B;  4UQI M;  2P04 A;  1DRM A;  2JN7 A;  2OAQ 1;  3E4P A;  4CQH A;  4MDZ A;  1LSX A;  2O9A A;  2M7U A;  3IBR A;  2K2N A;  1MC0 A;  4WN5 A;  3T4O A;  1LSW A;  4PHT A;  2ZMV A;  4YNR A;  2A2L A;  4HH2 A;  2V1A A;  2EA9 A;  3G6O A;  4Q0H A;  4LLO B;  1OPX A;  5K5B A;  4HJ6 A;  2XSS A;  1F9I A;  5IT5 A;  5AJG A;  2QJ5 A;  5IU1 A;  4YWZ A;  3LIF A;  2PHY A;  5TBM A;  4I3J A;  3LR0 A;  2WKP A;  4LRX C;  1DP9 A;  3UME A;  1BYW A;  4O0P A;  1NLZ A;  2V0W A;  4Y2F A;  3PHY A;  4ME4 A;  1GSX A;  4BMW A;  2QKP A;  4R3A A;  4WL9 A;  2A24 A;  5F6A A;  5EFW A;  2PD8 A;  2QJ7 A;  3NOU C;  3K2N A;  3EWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...