3A0VA

Pas domain of histidine kinase thka (tm1359) (semet, f486m/f489m)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
96
structure length
96
Chain Sequence
METAIITLSKDGRITEWNKKAEQLFGLKKENVLGRRLKDLPDFEEIGSVAESVFENKEPVFLNMYKMGERYFNIRFSPFRNAKTQLLEGVIITIDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Sensor protein
total genus 28
structure length 96
sequence length 96
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3a0vA00
4HP4A 3P7NA 3E4PA 4HH3A 3HJIA 2QJ7A 4PKYA 5DJUA 5HDDA 1LSXA 4KQDA 5IU1A 1V9ZA 2PYPA 2KDKA 4HY8A 1VB6A 4WL9A 5TBMB 2PD8A 4I3AA 5TBMA 4JGRA 5AVFA 5IS1A 1TS6A 3MQQA 2WKRA 2Z6CA 3K3CA 4EQ1A 1N9OA 2L1MA 4E04A 1T1CA 4BBVA 2K7SA 2D01A 4HHDA 4EETB 1OTDA 2QKPA 5DKKA 5A8BA 1XJ2A 1EW0A 2W0NA 4HP9A 3VE3A 4EEUA 4MN6A 2KX6A 1OJ5A 3G6OA 4L9GA 1XFNA 1T1AA 4JGQA 1OTBA 5J4EA 3OLOA 2QWSA 2GJ3A 2V1BA 4EXOA 1DP8A 2B02A 1T18A 4I5SA 2Z6DA 4F3LB 3F1NA 4NXFA 3F1OA 1D06A 3PHYA 4NXEA 2OWHA 3C2WA 1D7EA 1BYWA 2EA9A 1DP6A 1S1YA 2OOLA 3BY9A 3H82A 4GS9A 1S67L 2W27A 4GW9A 3LIFA 2I9VA 1LL8A 1Y28A 3FG8A 2V0WA 2P7JA 3MQOA 3NHQA 4I3JA 4GHIA 2R78A 4BBTA 5HZHA 5G4ZA 3F1PB 4BBUA 3A0VA 3UB8A 4LPZA 1S4SA 1UGUA 3K3DA 4EW7A 1S4RA 3LI8A 4R3AA 1DRMA 2H28A 5F68A 1P0ZA 3GECA 4HNBA 1JNUA 1N9NA 4MN5A 4R38A 5HWWA 2YKFA 4XT2A 3UB6A 3SW1A 5J3WA 1TS8A 4HH2A 1OT6A 3LICA 3NJAA 1UWNX 5KIZA 4LRXC 5HWVA 1OT9A 5HDSA 3LI9A 4I38A 3EWKA 3RTYA 1LSWA 5J7EA 1T1BA 3CAXA 5HDCA 1F98A 3MXQA 3H7WB 3MFXA 3RH8B 2PYRA 2PR5A 1S66L 1XFQA 3IS2A 4JGOA 5G4YA 4WUJA 2JN7A 2VV6A 2PR6A 2VV8A 3LIBA 4H6JB 4RQ9A 3UB7A 1F9IA 2J80A 1KOUA 2VEAA 4KUOA 4HJ6A 1TS7A 5F5YA 4L9EA 5EFWA 1NWZA 2D02A 2QJ5A 2L4RA 3LIAA 4HI4A 3B33A 4R70A 4LRYC 3T50A 3GDIA 3A0SA 1T19A 1XJ6A 3VE4A 3ZQ5A 2QHKA 2OWJA 3NOPC 2WKPA 3LYXA 4HJ4A 3LUQA 4I3IA 4LLOB 3VOLA 4R6LA 3C8CA 3PYPA 4I39A 3FC7A 4WN5A 4WLAA 3UE6A 4DJ2A 5HSQA 2ZOHA 1OTEA 1LSVA 1TS0A 3IS2B 1MZUA 5DJTA 3CWFA 2ZOIA 2PD7A 4NXBA 5F6AA 1N9LA 2V9AA 1GSXA 2L0WA 3H82B 4JGPA 3CLOA 1XJ3A 3H9WA 3HJKA 1V9YA 1LT0A 3IBRA 3F1NB 1S1ZA 1X0OA 3E4QA 4XT2B 5AVEA 4YWZA 5F69A 5HD3A 1DP9A 4EERA 2M1CA 4NXGA 1GSWA 4PKYG 2WKQA 3UMDA 5DKLA 3ULFA 2VV7A 4HQAA 3BY8A 3EEHA 3MR0A 1P97A 4KUKA 2HV1A 4LRZE 3F1PA 2JHEA 2CMNA 3UB9A 2ZBBA 2PDRA 4DJ3A 2V1AA 1WA9A 3D72A 4GS9B 3BWLA 3KX0X 5I5LA 3F1OB 3A0RA 1G28A 3NOUC 5HD5A 2BASA 4M4XA 1XJ4A 3ICYA 1OJGA 1OTIA 1UWPX 2A24B 4L9FA 3MJQA 4K08A 4GCZA 4H6JA 4GHIB 1OTAA 5HWTA 4B9OA 3LIEA 4HIAA 1GSVA 3UMEA 4EEPA 4HOIA 2VLGA 2INWA 4EESA 4HJ3A 2PHYA 3E4OA 4F3LA 3H7WA 1ODVA 2A24A 2V0UA 2YKHA 3LIDA 3NOTC 4WF0A
chains in the Genus database with same CATH superfamily
3HJIA 1CI9A 3IF6C 4DDSA 1XPBA 3HLCA 1TDLA 1IELA 5IS1A 3UO9A 3VP0A 2QZ6A 4OPQA 1K25A 2ACGA 3G6OA 4L9GA 4DRTA 3JVVA 1PI4A 3Q82A 2BLSA 1YPRA 3OPLA 4BBUA 3JVUA 3DTMA 3IXDA 2R78A 5HZHA 4FCFA 2H5SA 4RVAA 1N9NA 1YMSA 1PWGA 3ZCZA 3R7WB 1Z6FA 3LO7A 2WKHA 2VEAA 3OZHA 1BZAA 2XRNA 4L9EA 5A93A 3IH8A 2W3HA 3U4LP 4OPZA 2JKTM 2XDMA 3AGDA 3LR5A 3E2LA 4I39A 3FC7A 1CQAA 4U3TA 3HVFA 1ESUA 3BFGA 5FDSA 5EV0A 2XFSA 4YWZA 1L0GA 1ESIA 3FPWA 3LEZA 1K54C 5BOHA 2WADA 3M6BA 2XR0A 3KYZA 2INWA 3ZG7B 2A24A 2ZL1B 1ALQA 2ZC3B 1XXMA 2EWVA 2W1TA 3BFEA 3ZHHA 2WKRA 3UN7A 3S4XA 1T1CA 1WYBA 4NEED 5FQ9A 5EVIB 4X1LA 3BYDA 1H8ZA 2K2NA 3G32A 3UB5P 3WS2A 2QWSA 1Y4OA 2GX5A 4II7A 4NXEA 1BT5A 1BYWA 5EVIC 3TG9A 2OOLA 2HPBA 3BFFA 3LIFA 1K56D 4KQRA 5GLAA 1MWSA 4LPZA 3OOVA 4JPMA 5F68A 5HWWA 1TS8A 3HLWA 4HH2A 3LICA 4GKUA 1K56A 3CUEC 5CECA 3EQVA 5TJJA 4OP8A 3OBFA 2JKFA 4N1XA 2VV8A 2PR6A 4DJ3A 1TS7A 3PBOA 3UDFA 5HAPA 3T50A 1CJFA 1N4OA 2EWWA 4E3IA 3UDIA 3N8SA 3OPRA 3PR6A 1RGZA 1ONGA 5IT5A 4X55A 2WZZA 3N8RA 4WMCD 5EVIA 3UPPA 2Y91A 1IKGA 2M7UA 5FAQA 4BJPA 1PYYA 3TRCA 5FQQA 4O8GA 1FCOA 1WA9A 4LV0A 4OQGA 2M7VA 4M3KA 4UAAA 3NY4A 1DJBA 3ZDJA 2A24B 4L9FA 4JXWA 5CX7A 1G6AA 3EOIA 5HARA 1H3QA 1L0FA 5DFYA 1PW1A 3SH9A 5TBMA 4CLCD 3BJNA 3K3CA 1FSWA 1N9OA 3IF5A 3MXSA 5DKKA 3B47A 5FI2A 4CJNA 2P74A 4MN6A 5FASA 2HZ5A 4ZRRA 4F3LB 3CITA 3UB6A 2KOIA 3H82A 2Y2OA 4ZJ2A 4LGWA 1H8MA 4S2JA 4EU0A 5G4ZA 1S4SA 1DRMA 1RP5A 2Y2LA 1K4FA 5J3WA 4PM6A 3D4FA 2ZC5B 5HDSA 5CHMA 4B4XA 3CHWP 4MBKA 3EWKA 3T4LA 4IHQA 3MXQA 3ZG5A 3A3JA 3UPNA 2DNSA 4R0QA 2J80A 1K57A 3C5AA 4ARZB 3FYZA 3LYXA 1SDEA 1ES2A 1MKIA 5HAIA 4GB7A 1N9LA 1KE3A 3VMAA 3RXWA 3CLOA 3IBRA 3H9WA 1V9YA 2XEPA 2E8JA 4WEJA 4HQAA 2C6WB 4S2KA 4WMCA 2O9AA 3NDEA 3MJQA 1SKOB 1YAXA 1PZPA 3GSGA 3NOTC 3P7NA 2Y2GA 4PKYA 3N7WA 5FI6A 1VB6A 1CK3A 2IWDA 4X6TA 2VX8A 2VGLM 1LL5A 3UPOA 2W1RA 4BWIA 4IUHA 2GZAA 2QMIA 3GMWA 2NUTC 4GDNA 2KX6A 1MKMA 5CHUA 3C4PA 4EBPA 2WGWA 3QNBA 3FWLA 4GS9A 3DWZA 3MQOA 1W63M 4LCMA 3D3OA 3NECA 3C7UA 3WRTA 1P0ZA 1D1JA 1SCWA 1IYPA 2HP6A 3HLEA 1JWPA 4MBHA 4R4RA 3G31A 4I38A 4KQOA 3W2ZA 5J7EA 1Q2QA 1W79A 2Y2QA 2WKIA 3RH8B 2PYRA 4Z1WA 1K38A 2P9VA 1K6RA 1PRQA 4XXRA 3S7QA 3ZGAB 1I2SA 1L0EA 3V67A 3MQ0A 2X02A 3ZNTA 3VOLA 1NZOA 3MF0A 4O01A 2Y2HA 4C3QA 3CWFA 2IWBA 3WWXA 3HJKA 4DE1A 3UY6A 3IHBA 4CQHA 2JCHA 4XT2B 2IWCA 1NY0A 3OPPA 3PBQA 1P97A 4BL3A 3CPTA 1TD5A 2V1AA 3KX0X 3NCKA 3F1OB 3NOUC 3TOIA 3UE1A 1STZA 3V39A 3ZG8B 2VLGA 4UQIS 4E3NA 2YKHA 3KSFA 5KMWA 5GHXA 4HY8A 1ZTUA 4WL9A 2Y8HA 1TS6A 3TE8A 4Y0UA 2QKPA 5A8BA 5L8MA 1L0DA 3G30A 4OOYA 5J4EA 1JTGA 2B02A 2JKGA 4I5SA 3F1NA 4E3JA 5FSRA 4WUJA 2W3DA 4G3WA 2I9VA 4X56A 4ETZA 3BQAA 5C5KA 4O0PA 1YQSA 4LFUA 3QP8A 5TFQA 2A2LA 3DTIA 1NZUA 1OT6A 4MN7A 4X25A 2P08A 3LI9A 3RTYA 3S22A 1L2SA 2UWXA 3IF6A 3NULA 4QY6A 1PNEA 2XF3A 1IYOA 3DBAA 3BQ8A 1W63Q 4WM9A 1MY8A 2QJ5A 1MWTA 1W8QA 3QP6A 1VM1A 5F83A 2AVXA 2XGNA 2WAFA 4R6LA 4HEFA 4KZ4A 3NIAA 5CEBA 2Y2JA 4MLLA 2WAEA 2WGIA 3HUMA 1HVBA 5DJTA 2PD7A 1XKZA 1JVJA 3BLMA 5EUAA 1C3BA 3EEHA 4KUKA 5EPHA 1YLYA 5JYOA 2O9BA 4QJGA 2QPNA 3V5MA 5I5LA 4KZBA 4QWOA 5EVLA 2ZM0A 2OLVA 4R3JA 3G34A 4OLGA 4EEPA 5DF9A 4F3LA 1ODVA 2XQZA 2QJ7A 2HP5A 2J8YA 2PYPA 1A0KA 1HLUP 3O87A 1BLHA 4E04A 5FATA 1SDNA 4JF4A 4EETB 2I72A 5J8XA 1E3UA 4CLCA 1OJ5A 1CEGA 1XP4A 1T1AA 2A49A 1T18A 1GA0A 4DF6A 5L07A 4CPKA 3E2KA 4RX2A 2W3GA 3T4KA 4OVDA 3RXXA 4I3JA 4ESPA 3KSIA 1SHVA 4JXVA 1P9RA 5A90A 4BQMA 1KDWA 1S4RA 1ONHA 2HGVA 2WYXA 4MN5A 5HAQA 4GLQA 4IBXA 1PW8A 1G6OA 4PPRA 3M2JA 3S1YA 3N6IA 4KG5A 3G4PA 4GNUA 2JN7A 4K91A 4NKPA 4LV1A 3KYQA 1XX2A 5CGWA 4S2NA 5FAPA 3EGXC 1VETA 5CEDA 1T19A 1NYYA 2WKPA 4OQHA 3LUQA 2VA0A 1NJ4A 1E4DA 4KZ8A 4KZ9A 4WN5A 4JXSA 1TS0A 2XFTA 1XJ3A 1YLWA 3MZFA 1P9WA 3S7PA 1F2KA 3ZQ5A 5DKLA 2VV7A 3UB9A 4ZJ3A 3A0RA 5EVID 2W3FA 3FZCA 2GNXA 3Q07A 4Q0IA 3LIEA 4H8RA 4X68A 4RX3A 3IXHA 4HH3A 4KENB 4S2OA 3P98A 4Y2FA 3GRJA 3GVBA 3UDXA 3KSGA 1K0KA 3VP4A 3T4OA 2PT7A 4HHDA 4CLCC 3RJUA 4DXBA 5DF8A 4GZBA 4RYEA 3SH8A 2ZQ7A 1PWCA 4WBGA 1ERMA 4OOMA 2OV5A 1D06A 3QP1A 2EA9A 4GW9A 1DP6A 4R3BA 4IEDA 4Y0TA 3WS1A 1LL8A 1FSYA 1SKFA 2EXBA 4HESA 4XT2A 5HFOA 4P0MA 3T12B 5AQAA 3GR2A 3B42A 5E2FA 3G2YA 1SZVA 2XROA 3V50A 3CAXA 5AQ9A 5AJGA 4EWFA 2W3EA 3LIBA 3VP3A 3O3VA 4YFMA 5EFWA 1F5MA 3T1RA 2V8FA 3IT9A 1VHMA 1GHIA 4IVIA 4UEYA 2Y2NA 4LENA 4U0TA 5GL9A 3KYEA 4D60A 4YNRA 2Y79A 1O07A 2PU2A 4Q0HA 4PAUA 3T1XA 3GQZA 1IYSA 5MC7A 3BWLA 5GHYA 5CGXA 4YINA 3S7OA 4JBFA 2Q9MA 3JYIA 3MKFA 3PBSA 4EUVA 5HWTA 3CG5A 3HLGA 3ITAA 2B5RA 2J9OA 1TEMA 3E4PA 4P6BA 2G2UA 2PD8A 3VFFA 3MQQA 4MCWA 5EM0A 2K7SA 3W8KA 2QYBA 4GDBA 2W0NA 3IWOA 4BENA 5CTNA 1DP8A 2R9WA 4MDZA 3PHYA 3IH9A 2OWHA 1D7EA 4D2OA 1S1YA 4X69A 2Y59A 1QMFA 1IEMA 3O5YA 1K4EA 4OP5A 1LL9A 3NDGA 3PBRA 3CPTB 1UWNX 3T1SA 4DE3A 4U0XA 3MXRA 4JGOA 1KGFA 3ZG9B 2Y4AA 1NWZA 3EEAA 2ZC4B 3U2AA 1H8YA 3A0SA 3LR0A 3JPUA 1DJAA 3PYPA 3LR4A 1NRFA 2JE5A 4JGPA 5CRFA 1OPXA 2WGVA 1ES4A 2VK3A 1CI8A 5F69A 5I94A 4JXGA 2HDUA 4PKYG 4EXOA 2WZXA 4N1HA 3VFHA 2PDRA 5E43A 2V8CA 2XA7M 1N9BA 4EUZA 1Q2PA 4HIAA 4HOIA 2VGKA 2X71A 3H7WA 4WF0A 3FKVA 5IU1A 3UE3A 2UV0E 4MBFA 4NETA 1GCEA 4B4ZA 4UA6A 4I3AA 1W5DA 3IWQA 4Q0JA 5HL1A 1QMEA 2Z2LB 4IUKA 1IKIA 1XFNA 3OLOA 1TVFA 2GJ3A 2HJEA 4EBLA 2CC1A 2JKRI 3AGFA 1S67L 2J9PA 2EXAA 2ZC7A 4MEZA 1VETB 2B18A 4OH0A 1PI5A 1F98A 3Q7ZA 3A3DA 1ACFA 2J3TD 2P04A 2B95A 4HI4A 4B88A 4R70A 5FEGA 3HREA 3C7VA 2WK0A 4HJ4A 4UQIM 3MSHA 3IHAA 4DJ2A 5HSQA 3BFDA 1OTEA 1GSXA 1YSPA 2J3WA 5GLDA 4S2NC 4FUWA 4OPYA 3UE0A 1W7FA 4N9KA 2WKQA 1G5UA 1TF1A 4LRZE 4BMWA 1WE4A 3ZNYA 1AXBA 3T4JA 3IXGA 2BASA 4WZ5A 4M4XA 3W4PA 3ZYTA 4GHIB 5EECA 1I2WA 2XH9A 4OLDA 3BECA 1J9MA 1K55A 1MWRA 5HDDA 5FQIA 2KDKA 2EX8A 2ZQAA 1MWUA 2EFXA 5DF7A 2Z6CA 4ZJ1A 2W1TB 1LLBA 2JKRM 3HLDA 3NBLA 4FH2A 2ZLYA 4GJ4A 3VSKA 1OTBA 4WEKA 5FQMA 5F1FA 5E2HA 2ZQ9A 2HP9A 3BY9A 4FSFA 2R9XA 2GDNA 2W27A 1Y28A 3NHQA 1PIOA 1ES3A 5G18A 1K55C 1EROA 1BLSA 2X01A 2BG1A 5E2GA 5HL6A 4KG2A 1FQGA 4GD6A 2YKFA 3ZFZA 3OPHA 3NJAA 1ERQA 4OPRA 3Q81A 2XSSA 4UA9A 3MFXA 2VGLS 3E98A 2PBDP 4XUXA 5G4YA 4DKIA 4HJ6A 3G35A 3MZDA 2D02A 2HDRA 3B33A 3GDIA 2ZM8A 1PFLA 2OWJA 4G3KA 2IA2A 4P6ZS 3VP2A 2O99A 1LSVA 1KVLA 3F1NB 3E4QA 3NC8A 3PAGA 3LEQA 5F82A 1BTLA 5GHZA 2JHEA 3ISGA 5K5BA 4K0WA 3MFDA 3WRZA 2Y2KA 3W4QA 5EM1A 4O7DA 3CUEA 4B9OA 3UMEA 1GSVA 4DXCA 2PHYA 3HL9A 4K0XA 2V2FF 5F1GA 3VOZA 3SH7A 3DTKA 3ZVTA 5AVFA 1FCMA 5KZHA 2EX9A 4B93A 3CJMA 1ZC2A 4MMNA 5IHVA 2ZD8A 4HP9A 5KSHA 3FPVA 4KZAA 4GD8A 1EWZA 3L9KA 1NRJA 2ZL1A 2G2WA 4NXFA 5U47A 4I3IA 1GA9A 1BLPA 1K6SA 1XGJA 3FG8A 3IX4A 4BLMA 1BULA 3UB8A 3ZG0A 2H28A 4WZ4A 4HNBA 3KSHA 3BRMA 3P01A 4JKTA 2O9CA 3H7WB 1W8YA 5DFXA 1XFQA 1H0MA 3IBJA 4Y15A 4R1GA 5F5YA 2P9VB 4EQIA 4UHUA 3V3RA 2OAP1 3MKEA 4KZ5A 3VE4A 4P85A 2VZWA 2LB5A 4LLOB 2LB9A 3IWIA 1IYQA 5LBRA 2VGJA 1FIKA 3MBZA 1JWZA 3CI6A 2XD5A 4QHCA 2M1CA 4NXGA 3KO6A 1KE0A 2CMNA 5FL3A 1VEUA 4S2MA 3OCLA 2NUPC 5DTSA 5HD5A 1OJGA 1UWPX 5E2EA 2EX2A 4P87A 1M6KA 1KGGA 1KE4A 5DJUA 5A91A 4E6XA 4ZDXA 3B3XA 1SKOA 4DMZA 2JKTI 1YT4A 3RFBA 3Q7VB 2D01A 1OTDA 4LV2A 1EW0A 4EV4A 1ZHHB 2V1BA 4OQ0A 4E3KA 3C2WA 4R4SA 1PZOA 2Q0OA 2P7JA 4LV3A 3K3DA 4R3AA 1YMXA 3IX8A 4IBRA 3HUOA 3LCEA 4ZBEA 5KIZA 4LRXC 5HWVA 1AWIA 1VQQA 3G2ZA 3D9YA 5DVAA 1WYCA 2PR5A 3UB7A 4RQ9A 1KOUA 4DE0A 3R7WA 4FOFA 4HBUA 1HTZA 2QHKA 4A5RA 1G68A 2K31A 1U60A 4QD4A 2FZ0A 3H82B 2L0WA 3PAEA 1BLCA 1LT0A 3VV4A 3UMDA 1YSQA 3SW1A 4Z9QA 3T4TA 1I5QA 1J3WA 1OMEA 1ZKJA 3O88A 3CMZA 2XD1A 4X1MA 4K08A 1ES5A 5D3OA 1HZOA 5FEFA 5DTTA 1V9ZA 4IVKA 3PXPA 5EE8A 4XUZA 5FI7A 1DJCA 4WELA 4EQ1A 3VOYA 2OSUA 4BBVA 3I7JA 1KDSA 3GTCA 2C5WB 3SZTA 4EEUA 4Y7PA 4OQIA 3TW8A 3F1OA 2FFFB 4BL2A 5EOOA 4QY5A 3HBRA 2V0WA 4IJGA 2HF6A 4GHIA 2G7UA 3HLFA 2XA7S 5GLBA 1XA1A 3V3SA 2DMWA 1VEUB 4YOFA 5L2FA 3T1QB 3C4OA 4KG6A 5HPFA 2XLNA 2A3UA 4DE2A 1RCJA 2E8IA 2O0YA 3O86A 5GLCA 4QPRA 4ME4A 3QP2A 2VV6A 3AGEA 1Z09A 2JBFA 2L4RA 3LIAA 4E3LA 5HW3A 2H0YA 2PRFA 4FD8A 4FTXA 3OC2A 1NLYA 3QP5A 4Y0OA 1FR1A 1XGIA 5FQJA 1X0OA 3F1PA 3N8LA 5FDHA 3SS4A 1XA7A 3PTEA 1KVMA 4GS9B 3QHYA 1OTIA 1DY6A 5KSCA 4E6WA 4ID4A 4HJ3A 2DRWA 3EGDC 2ZQ8A 3FV7A 4HP4A 3HUNA 3SS3A 2HJ9C 1LSXA 3LR3A 4PMAA 3BEBA 1NLZA 2L1MA 3IX3A 4S2LA 1LHYA 2BTFP 3T4SA 3DTEA 4JGQA 3IXBA 3Q1FA 5JYPA 1CEFA 2Z6DA 5M1AA 4CLCE 1FOFA 3LY4A 4PM5A 1K57C 4JF6A 2Y2PA 5CXWA 4BBTA 2PAVP 3F1PB 3A0VA 1UGUA 4EW7A 3PBTA 1JNUA 3P09A 4R38A 3C30A 3HCYA 1JTDA 5AQ7A 3LFVA 5HDCA 2WKEA 5EVEA 4OONA 4N9LA 3IS2A 4E3OA 3WS4A 4ZAMA 1EI5A 3EQUA 5EOEA 3W4OA 4Y13A 5A92A 3DW0A 3NI9A 2DCFA 3C8CA 4WLAA 4BD1A 5CHJA 3LGOA 3IS2B 1MZUA 1YLTA 2V9AA 4R23A 1S0WA 2WUQA 4ZTKA 3A3FA 2HDQA 4Q8IA 2V20A 1GSWA 3MMHA 1ZG4A 3MR0A 4OKPA 2HV1A 4Y17A 2ZBBA 3QP4A 3D72A 1GHPA 4KQQA 2Q9NA 1G28A 2XK1A 3SS5A 5CERA 2ZM2A 3ICYA 4GCZA 1IFQA 3ITBA 5CTMA 1O7EA 4EESA 5TGFA 3HLBA 4X53A 4EBNA 3DWKA 4N92A 3N4IA 2ZQDA 1YLPA 5TBMB 4JGRA 4NG2A 1LI9A 3E0YA 1XJ2A 3VE3A 5TR7A 4CLCB 1BSGA 5AQBA 1TDGA 5HD3A 2RL3A 2ZQCA 1YKDA 3M6HA 3DAVA 3WS5A 3SOIA 4MNRA 5FAOA 2ZJ9A 4GN2A 3A3EA 4C6YA 2ZMAA 1YM1A 4C75A 4S2PA 1F9IA 5FA7A 3UNWA 2PBYA 4LRYC 1E25A 2J7VA 3MZEA 1FILA 3IQAA 1NYMA 2Y2MA 1FR6A 2ZOHA 2Y55A 4LCLA 2ZOIA 4NXBA 3WS0A 1S1ZA 4JLFA 2ZMVA 1DP9A 4EERA 2FH5A 1GHMA 4FH4A 1YLJA 2EX6A 4KZ3A 1HD8A 3R4KA 3FKWA 2PU4A 2FFYA 2Y2IA 2OAQ1 1Y54A 4PM7A 4QB8A 2V1ZA 3K2NA 3IF6B 3VSLA 1XJ4A 3T4QA 1MXOA 5M19A 1S6RA 4H6JA 1OTAA 5FQKA 4Y5FA 1K54A 4RA7A 2H0TA 3QNCA 1H5XA 3BM6A 3Q7VA 2Z2MB 4PM8A 4KQDA 4KZ6A 1NXYA 4JF5A 4KZ7A 2HDSA 4P6ZM 1IOUA 3MS6A 2RCXA 1MPLA 5HX9A 3TJZC 4WYYA 4BD0A 4E3MA 3BLSA 5CGSA 4G3VA 3LY3A 4OOLA 2WGWB 2MJ6A 5HPIA 1ZG6A 1E3UD 4NK3A 3GV9A 3S7NA 4Y3IA 3LI8A 4ARZA 5M18A 1L3LA 3GECA 4AFIA 3OCNA 1PWDA 2KLIA 4PHTA 5DTKA 2OLUA 1OT9A 1FCNA 1LSWA 1T1BA 1YLZA 3L7HA 4S2IA 2ZMFA 4L0LA 1S66L 1M40A 4H6JB 2H10A 2VKSA 2JC7A 4KUOA 4F94A 3A3IA 1JWVA 1MBLA 4ETXA 1XJ6A 4WZ5C 3NOPC 1CF0A 2VJWA 3UE6A 4HBTA 2J3TC 3VP1A 2EFUA 3CZDA 5F6AA 4GOGA 3M2KA 3PBNA 5AVEA 1LI0A 5L09A 4DDYA 1BUEA 4PM9A 1MC0A 2ZC6B 3ULFA 3BFCA 3BY8A 5L10A 3C38A 1RGYA 3ZVWA 4UA7A 4DN0A 4QU3A 3TSGA 3E4OA 3LIDA 2V0UA 1KGEA 3BW6A
chains in the Genus database with same CATH topology
3HJIA 3KSFA 5IU1A 1V9ZA 3UE3A 4HY8A 1ZTUA 3PXPA 4WL9A 4I3AA 2Y8HA 1TS6A 5IS1A 4WELA 4EQ1A 4Q0JA 4BBVA 3TE8A 2QKPA 5A8BA 4IUKA 4EEUA 5L8MA 3G6OA 4L9GA 1XFNA 3JVVA 5J4EA 3OLOA 2GJ3A 2HJEA 2JKRI 2B02A 4I5SA 3TW8A 3F1NA 3F1OA 4BBUA 3JVUA 4WUJA 1S67L 2W3DA 4G3WA 2I9VA 2V0WA 4IJGA 2HF6A 4GHIA 2R78A 2G7UA 5HZHA 4ETZA 3BQAA 2XA7S 5C5KA 4O0PA 2DMWA 1N9NA 2A2LA 4YOFA 1OT6A 4MN7A 2P08A 2B18A 3LI9A 5HPFA 3RTYA 1F98A 2O0YA 4QPRA 4ME4A 3DBAA 2J3TD 3R7WB 2VV6A 2P04A 2VEAA 2XRNA 1W63Q 3BQ8A 4L9EA 2W3HA 2QJ5A 2L4RA 3LIAA 4HI4A 4R70A 2JKTM 3LR5A 4HJ4A 4UQIM 4R6LA 4I39A 4DJ2A 3FC7A 5HSQA 3OC2A 1NLYA 1OTEA 5DJTA 2PD7A 1GSXA 1YSPA 2J3WA 1X0OA 4YWZA 2WKQA 1TF1A 3EEHA 4KUKA 4LRZE 4BMWA 3F1PA 2O9BA 3FPWA 4GS9B 3T4JA 5I5LA 2BASA 4M4XA 1OTIA 3ZYTA 4GHIB 3KYZA 4EEPA 2INWA 4HJ3A 5DF9A 4F3LA 1ODVA 2A24A 3EGDC 4HP4A 2QJ7A 5HDDA 2EWVA 2HJ9C 1LSXA 3LR3A 2PYPA 2KDKA 2W1TA 1NLZA 2WKRA 2Z6CA 2W1TB 2L1MA 4E04A 1T1CA 4NEED 4EETB 2JKRM 2K2NA 3T4SA 4CLCA 4GJ4A 1OJ5A 1T1AA 4JGQA 1OTBA 4WEKA 2QWSA 1T18A 2Z6DA 2GX5A 4II7A 4NXEA 4CLCE 1BYWA 3BY9A 4FSFA 2OOLA 3T4KA 2W3GA 2W27A 3LIFA 4I3JA 1Y28A 3NHQA 3KSIA 4BBTA 1P9RA 3F1PB 3A0VA 4LPZA 1UGUA 4EW7A 3OOVA 1S4RA 2HGVA 3PBTA 5HL6A 5F68A 4MN5A 1JNUA 4R38A 5HWWA 2YKFA 4GLQA 1TS8A 4HH2A 3C30A 1G6OA 3LICA 3NJAA 3HCYA 3CUEC 3EQVA 3LFVA 5TJJA 2XSSA 5HDCA 3OBFA 3MFXA 2VGLS 3E98A 3IS2A 5G4YA 2JN7A 2VV8A 2PR6A 4DJ3A 4NKPA 3KYQA 4HJ6A 1TS7A 3PBOA 3EGXC 2D02A 3B33A 3T50A 3GDIA 3EQUA 1T19A 2OWJA 2EWWA 2WKPA 4G3KA 3LUQA 2VA0A 2IA2A 3C8CA 4WN5A 4WLAA 3PR6A 4P6ZS 5IT5A 2O99A 1LSVA 1TS0A 3IS2B 1MZUA 2V9AA 1XJ3A 3F1NB 3E4QA 1P9WA 3S7PA 2M7UA 4BJPA 1GSWA 3ZQ5A 3MMHA 3TRCA 5DKLA 2VV7A 3MR0A 4O8GA 2HV1A 2JHEA 3UB9A 2ZBBA 1WA9A 3D72A 2M7VA 5K5BA 3A0RA 2W3FA 1G28A 3ICYA 2A24B 3CUEA 4L9FA 2GNXA 4Q0IA 4GCZA 1IFQA 4B9OA 3LIEA 5CX7A 1GSVA 3UMEA 4EESA 3EOIA 2PHYA 1H3QA 4HH3A 5DFYA 4Y2FA 5TBMB 5TBMA 4CLCD 4JGRA 5AVFA 3BJNA 3K3CA 1N9OA 3KSGA 4B93A 3T4OA 2PT7A 3E0YA 4HHDA 4MMNA 5DKKA 4CLCC 1XJ2A 3B47A 4HP9A 3VE3A 5KSHA 4MN6A 3FPVA 4CLCB 4ZRRA 1NRJA 4OOMA 4F3LB 4NXFA 1D06A 3CITA 4I3IA 2EA9A 2KOIA 1DP6A 3H82A 4GW9A 5HD3A 3UB6A 1LL8A 3FG8A 1H8MA 4EU0A 5G4ZA 3UB8A 1S4SA 1YKDA 1DRMA 2H28A 4HNBA 4XT2A 3KSHA 5J3WA 5HDSA 3B42A 3EWKA 3P01A 2XROA 2O9CA 3CAXA 4IHQA 3T4LA 3MXQA 3H7WB 5AJGA 5DFXA 1XFQA 2W3EA 3LIBA 3IBJA 1F9IA 2J80A 5F5YA 5EFWA 1F5MA 2OAP1 4LRYC 1VHMA 4ARZB 3VE4A 2VZWA 2LB5A 4LLOB 2LB9A 3LYXA 4UEYA 2ZOHA 5LBRA 2ZOIA 4NXBA 1N9LA 3CLOA 3IBRA 3H9WA 1V9YA 3CI6A 1S1ZA 4YNRA 2Y79A 2ZMVA 1DP9A 4EERA 4WEJA 2M1CA 2FH5A 4NXGA 3KO6A 4HQAA 4Q0HA 4PAUA 2CMNA 3R4KA 5FL3A 5MC7A 3BWLA 3OCLA 2OAQ1 2NUPC 5HD5A 3S7OA 3K2NA 2O9AA 1XJ4A 3T4QA 1OJGA 1UWPX 3MJQA 3PBSA 4H6JA 4EUVA 1OTAA 5HWTA 4Y5FA 1YAXA 3NOTC 3P7NA 3E4PA 4PKYA 5DJUA 4KQDA 1VB6A 4DMZA 2PD8A 2VX8A 2VGLM 3MQQA 2JKTI 3RFBA 4MCWA 4P6ZM 2W1RA 4BWIA 2K7SA 2D01A 4IUHA 1IOUA 1OTDA 2QYBA 3TJZC 1EW0A 2GZAA 2W0NA 2NUTC 2KX6A 1MKMA 4G3VA 1ZHHB 2V1BA 1DP8A 4OOLA 4MDZA 3PHYA 2OWHA 3C2WA 1D7EA 1S1YA 4GS9A 2MJ6A 3O5YA 5HPIA 3MQOA 2P7JA 1W63M 3D3OA 3S7NA 4Y3IA 3K3DA 3LI8A 4R3AA 3PBRA 4ARZA 1P0ZA 3GECA 4AFIA 3OCNA 5KIZA 1UWNX 2KLIA 4LRXC 4PHTA 5HWVA 1OT9A 4I38A 4KQOA 3W2ZA 1LSWA 5J7EA 1T1BA 2ZMFA 4L0LA 3RH8B 2PYRA 2PR5A 1S66L 4JGOA 3UB7A 4Z1WA 4H6JB 4RQ9A 1KOUA 2VKSA 4KUOA 1NWZA 3EEAA 3R7WA 3U2AA 3S7QA 4FOFA 3A0SA 3LR0A 4ETXA 3V67A 1XJ6A 3MQ0A 2QHKA 3NOPC 3VOLA 2K31A 3PYPA 3MF0A 2VJWA 3LR4A 4O01A 3UE6A 2J3TC 2FZ0A 5F6AA 3CWFA 3H82B 2L0WA 4JGPA 3HJKA 1OPXA 1LT0A 3PBNA 3VV4A 4CQHA 4XT2B 5AVEA 5F69A 1MC0A 3ULFA 4PKYG 3UMDA 1YSQA 3PBQA 4EXOA 3SW1A 3BY8A 1P97A 3T4TA 1TD5A 3C38A 2PDRA 2V1AA 3KX0X 3F1OB 3NOUC 2XA7M 1STZA 4K08A 4DN0A 4HIAA 4HOIA 2VLGA 4UQIS 3E4OA 3H7WA 2YKHA 3LIDA 2V0UA 4WF0A 3BW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HP4 A;  3P7N A;  3E4P A;  4HH3 A;  3HJI A;  2QJ7 A;  4PKY A;  5DJU A;  5HDD A;  1LSX A;  4KQD A;  5IU1 A;  1V9Z A;  2PYP A;  2KDK A;  4HY8 A;  1VB6 A;  4WL9 A;  5TBM B;  2PD8 A;  4I3A A;  5TBM A;  4JGR A;  5AVF A;  5IS1 A;  1TS6 A;  3MQQ A;  2WKR A;  2Z6C A;  3K3C A;  4EQ1 A;  1N9O A;  2L1M A;  4E04 A;  1T1C A;  4BBV A;  2K7S A;  2D01 A;  4HHD A;  4EET B;  1OTD A;  2QKP A;  5DKK A;  5A8B A;  1XJ2 A;  1EW0 A;  2W0N A;  4HP9 A;  3VE3 A;  4EEU A;  4MN6 A;  2KX6 A;  1OJ5 A;  3G6O A;  4L9G A;  1XFN A;  1T1A A;  4JGQ A;  1OTB A;  5J4E A;  3OLO A;  2QWS A;  2GJ3 A;  2V1B A;  4EXO A;  1DP8 A;  2B02 A;  1T18 A;  4I5S A;  2Z6D A;  4F3L B;  3F1N A;  4NXF A;  3F1O A;  1D06 A;  3PHY A;  4NXE A;  2OWH A;  3C2W A;  1D7E A;  1BYW A;  2EA9 A;  1DP6 A;  1S1Y A;  2OOL A;  3BY9 A;  3H82 A;  4GS9 A;  1S67 L;  2W27 A;  4GW9 A;  3LIF A;  2I9V A;  1LL8 A;  1Y28 A;  3FG8 A;  2V0W A;  2P7J A;  3MQO A;  3NHQ A;  4I3J A;  4GHI A;  2R78 A;  4BBT A;  5HZH A;  5G4Z A;  3F1P B;  4BBU A;  3A0V A;  3UB8 A;  4LPZ A;  1S4S A;  1UGU A;  3K3D A;  4EW7 A;  1S4R A;  3LI8 A;  4R3A A;  1DRM A;  2H28 A;  5F68 A;  1P0Z A;  3GEC A;  4HNB A;  1JNU A;  1N9N A;  4MN5 A;  4R38 A;  5HWW A;  2YKF A;  4XT2 A;  3UB6 A;  3SW1 A;  5J3W A;  1TS8 A;  4HH2 A;  1OT6 A;  3LIC A;  3NJA A;  1UWN X;  5KIZ A;  4LRX C;  5HWV A;  1OT9 A;  5HDS A;  3LI9 A;  4I38 A;  3EWK A;  3RTY A;  1LSW A;  5J7E A;  1T1B A;  3CAX A;  5HDC A;  1F98 A;  3MXQ A;  3H7W B;  3MFX A;  3RH8 B;  2PYR A;  2PR5 A;  1S66 L;  1XFQ A;  3IS2 A;  4JGO A;  5G4Y A;  4WUJ A;  2JN7 A;  2VV6 A;  2PR6 A;  2VV8 A;  3LIB A;  4H6J B;  4RQ9 A;  3UB7 A;  1F9I A;  2J80 A;  1KOU A;  2VEA A;  4KUO A;  4HJ6 A;  1TS7 A;  5F5Y A;  4L9E A;  5EFW A;  1NWZ A;  2D02 A;  2QJ5 A;  2L4R A;  3LIA A;  4HI4 A;  3B33 A;  4R70 A;  4LRY C;  3T50 A;  3GDI A;  3A0S A;  1T19 A;  1XJ6 A;  3VE4 A;  3ZQ5 A;  2QHK A;  2OWJ A;  3NOP C;  2WKP A;  3LYX A;  4HJ4 A;  3LUQ A;  4I3I A;  4LLO B;  3VOL A;  4R6L A;  3C8C A;  3PYP A;  4I39 A;  3FC7 A;  4WN5 A;  4WLA A;  3UE6 A;  4DJ2 A;  5HSQ A;  2ZOH A;  1OTE A;  1LSV A;  1TS0 A;  3IS2 B;  1MZU A;  5DJT A;  3CWF A;  2ZOI A;  2PD7 A;  4NXB A;  5F6A A;  1N9L A;  2V9A A;  1GSX A;  2L0W A;  3H82 B;  4JGP A;  3CLO A;  1XJ3 A;  3H9W A;  3HJK A;  1V9Y A;  1LT0 A;  3IBR A;  3F1N B;  1S1Z A;  1X0O A;  3E4Q A;  4XT2 B;  5AVE A;  4YWZ A;  5F69 A;  5HD3 A;  1DP9 A;  4EER A;  2M1C A;  4NXG A;  1GSW A;  4PKY G;  2WKQ A;  3UMD A;  5DKL A;  3ULF A;  2VV7 A;  4HQA A;  3BY8 A;  3EEH A;  3MR0 A;  1P97 A;  4KUK A;  2HV1 A;  4LRZ E;  3F1P A;  2JHE A;  2CMN A;  3UB9 A;  2ZBB A;  2PDR A;  4DJ3 A;  2V1A A;  1WA9 A;  3D72 A;  4GS9 B;  3BWL A;  3KX0 X;  5I5L A;  3F1O B;  3A0R A;  1G28 A;  3NOU C;  5HD5 A;  2BAS A;  4M4X A;  1XJ4 A;  3ICY A;  1OJG A;  1OTI A;  1UWP X;  2A24 B;  4L9F A;  3MJQ A;  4K08 A;  4GCZ A;  4H6J A;  4GHI B;  1OTA A;  5HWT A;  4B9O A;  3LIE A;  4HIA A;  1GSV A;  3UME A;  4EEP A;  4HOI A;  2VLG A;  2INW A;  4EES A;  4HJ3 A;  2PHY A;  3E4O A;  4F3L A;  3H7W A;  1ODV A;  2A24 A;  2V0U A;  2YKH A;  3LID A;  3NOT C;  4WF0 A; 
#chains in the Genus database with same CATH topology
 3HJI A;  1CI9 A;  3IF6 C;  4DDS A;  1XPB A;  3HLC A;  1TDL A;  1IEL A;  5IS1 A;  3UO9 A;  3VP0 A;  2QZ6 A;  4OPQ A;  1K25 A;  2ACG A;  3G6O A;  4L9G A;  4DRT A;  3JVV A;  1PI4 A;  3Q82 A;  2BLS A;  1YPR A;  3OPL A;  4BBU A;  3JVU A;  3DTM A;  3IXD A;  2R78 A;  5HZH A;  4FCF A;  2H5S A;  4RVA A;  1N9N A;  1YMS A;  1PWG A;  3ZCZ A;  3R7W B;  1Z6F A;  3LO7 A;  2WKH A;  2VEA A;  3OZH A;  1BZA A;  2XRN A;  4L9E A;  5A93 A;  3IH8 A;  2W3H A;  3U4L P;  4OPZ A;  2JKT M;  2XDM A;  3AGD A;  3LR5 A;  3E2L A;  4I39 A;  3FC7 A;  1CQA A;  4U3T A;  3HVF A;  1ESU A;  3BFG A;  5FDS A;  5EV0 A;  2XFS A;  4YWZ A;  1L0G A;  1ESI A;  3FPW A;  3LEZ A;  1K54 C;  5BOH A;  2WAD A;  3M6B A;  2XR0 A;  3KYZ A;  2INW A;  3ZG7 B;  2A24 A;  2ZL1 B;  1ALQ A;  2ZC3 B;  1XXM A;  2EWV A;  2W1T A;  3BFE A;  3ZHH A;  2WKR A;  3UN7 A;  3S4X A;  1T1C A;  1WYB A;  4NEE D;  5FQ9 A;  5EVI B;  4X1L A;  3BYD A;  1H8Z A;  2K2N A;  3G32 A;  3UB5 P;  3WS2 A;  2QWS A;  1Y4O A;  2GX5 A;  4II7 A;  4NXE A;  1BT5 A;  1BYW A;  5EVI C;  3TG9 A;  2OOL A;  2HPB A;  3BFF A;  3LIF A;  1K56 D;  4KQR A;  5GLA A;  1MWS A;  4LPZ A;  3OOV A;  4JPM A;  5F68 A;  5HWW A;  1TS8 A;  3HLW A;  4HH2 A;  3LIC A;  4GKU A;  1K56 A;  3CUE C;  5CEC A;  3EQV A;  5TJJ A;  4OP8 A;  3OBF A;  2JKF A;  4N1X A;  2VV8 A;  2PR6 A;  4DJ3 A;  1TS7 A;  3PBO A;  3UDF A;  5HAP A;  3T50 A;  1CJF A;  1N4O A;  2EWW A;  4E3I A;  3UDI A;  3N8S A;  3OPR A;  3PR6 A;  1RGZ A;  1ONG A;  5IT5 A;  4X55 A;  2WZZ A;  3N8R A;  4WMC D;  5EVI A;  3UPP A;  2Y91 A;  1IKG A;  2M7U A;  5FAQ A;  4BJP A;  1PYY A;  3TRC A;  5FQQ A;  4O8G A;  1FCO A;  1WA9 A;  4LV0 A;  4OQG A;  2M7V A;  4M3K A;  4UAA A;  3NY4 A;  1DJB A;  3ZDJ A;  2A24 B;  4L9F A;  4JXW A;  5CX7 A;  1G6A A;  3EOI A;  5HAR A;  1H3Q A;  1L0F A;  5DFY A;  1PW1 A;  3SH9 A;  5TBM A;  4CLC D;  3BJN A;  3K3C A;  1FSW A;  1N9O A;  3IF5 A;  3MXS A;  5DKK A;  3B47 A;  5FI2 A;  4CJN A;  2P74 A;  4MN6 A;  5FAS A;  2HZ5 A;  4ZRR A;  4F3L B;  3CIT A;  3UB6 A;  2KOI A;  3H82 A;  2Y2O A;  4ZJ2 A;  4LGW A;  1H8M A;  4S2J A;  4EU0 A;  5G4Z A;  1S4S A;  1DRM A;  1RP5 A;  2Y2L A;  1K4F A;  5J3W A;  4PM6 A;  3D4F A;  2ZC5 B;  5HDS A;  5CHM A;  4B4X A;  3CHW P;  4MBK A;  3EWK A;  3T4L A;  4IHQ A;  3MXQ A;  3ZG5 A;  3A3J A;  3UPN A;  2DNS A;  4R0Q A;  2J80 A;  1K57 A;  3C5A A;  4ARZ B;  3FYZ A;  3LYX A;  1SDE A;  1ES2 A;  1MKI A;  5HAI A;  4GB7 A;  1N9L A;  1KE3 A;  3VMA A;  3RXW A;  3CLO A;  3IBR A;  3H9W A;  1V9Y A;  2XEP A;  2E8J A;  4WEJ A;  4HQA A;  2C6W B;  4S2K A;  4WMC A;  2O9A A;  3NDE A;  3MJQ A;  1SKO B;  1YAX A;  1PZP A;  3GSG A;  3NOT C;  3P7N A;  2Y2G A;  4PKY A;  3N7W A;  5FI6 A;  1VB6 A;  1CK3 A;  2IWD A;  4X6T A;  2VX8 A;  2VGL M;  1LL5 A;  3UPO A;  2W1R A;  4BWI A;  4IUH A;  2GZA A;  2QMI A;  3GMW A;  2NUT C;  4GDN A;  2KX6 A;  1MKM A;  5CHU A;  3C4P A;  4EBP A;  2WGW A;  3QNB A;  3FWL A;  4GS9 A;  3DWZ A;  3MQO A;  1W63 M;  4LCM A;  3D3O A;  3NEC A;  3C7U A;  3WRT A;  1P0Z A;  1D1J A;  1SCW A;  1IYP A;  2HP6 A;  3HLE A;  1JWP A;  4MBH A;  4R4R A;  3G31 A;  4I38 A;  4KQO A;  3W2Z A;  5J7E A;  1Q2Q A;  1W79 A;  2Y2Q A;  2WKI A;  3RH8 B;  2PYR A;  4Z1W A;  1K38 A;  2P9V A;  1K6R A;  1PRQ A;  4XXR A;  3S7Q A;  3ZGA B;  1I2S A;  1L0E A;  3V67 A;  3MQ0 A;  2X02 A;  3ZNT A;  3VOL A;  1NZO A;  3MF0 A;  4O01 A;  2Y2H A;  4C3Q A;  3CWF A;  2IWB A;  3WWX A;  3HJK A;  4DE1 A;  3UY6 A;  3IHB A;  4CQH A;  2JCH A;  4XT2 B;  2IWC A;  1NY0 A;  3OPP A;  3PBQ A;  1P97 A;  4BL3 A;  3CPT A;  1TD5 A;  2V1A A;  3KX0 X;  3NCK A;  3F1O B;  3NOU C;  3TOI A;  3UE1 A;  1STZ A;  3V39 A;  3ZG8 B;  2VLG A;  4UQI S;  4E3N A;  2YKH A;  3KSF A;  5KMW A;  5GHX A;  4HY8 A;  1ZTU A;  4WL9 A;  2Y8H A;  1TS6 A;  3TE8 A;  4Y0U A;  2QKP A;  5A8B A;  5L8M A;  1L0D A;  3G30 A;  4OOY A;  5J4E A;  1JTG A;  2B02 A;  2JKG A;  4I5S A;  3F1N A;  4E3J A;  5FSR A;  4WUJ A;  2W3D A;  4G3W A;  2I9V A;  4X56 A;  4ETZ A;  3BQA A;  5C5K A;  4O0P A;  1YQS A;  4LFU A;  3QP8 A;  5TFQ A;  2A2L A;  3DTI A;  1NZU A;  1OT6 A;  4MN7 A;  4X25 A;  2P08 A;  3LI9 A;  3RTY A;  3S22 A;  1L2S A;  2UWX A;  3IF6 A;  3NUL A;  4QY6 A;  1PNE A;  2XF3 A;  1IYO A;  3DBA A;  3BQ8 A;  1W63 Q;  4WM9 A;  1MY8 A;  2QJ5 A;  1MWT A;  1W8Q A;  3QP6 A;  1VM1 A;  5F83 A;  2AVX A;  2XGN A;  2WAF A;  4R6L A;  4HEF A;  4KZ4 A;  3NIA A;  5CEB A;  2Y2J A;  4MLL A;  2WAE A;  2WGI A;  3HUM A;  1HVB A;  5DJT A;  2PD7 A;  1XKZ A;  1JVJ A;  3BLM A;  5EUA A;  1C3B A;  3EEH A;  4KUK A;  5EPH A;  1YLY A;  5JYO A;  2O9B A;  4QJG A;  2QPN A;  3V5M A;  5I5L A;  4KZB A;  4QWO A;  5EVL A;  2ZM0 A;  2OLV A;  4R3J A;  3G34 A;  4OLG A;  4EEP A;  5DF9 A;  4F3L A;  1ODV A;  2XQZ A;  2QJ7 A;  2HP5 A;  2J8Y A;  2PYP A;  1A0K A;  1HLU P;  3O87 A;  1BLH A;  4E04 A;  5FAT A;  1SDN A;  4JF4 A;  4EET B;  2I72 A;  5J8X A;  1E3U A;  4CLC A;  1OJ5 A;  1CEG A;  1XP4 A;  1T1A A;  2A49 A;  1T18 A;  1GA0 A;  4DF6 A;  5L07 A;  4CPK A;  3E2K A;  4RX2 A;  2W3G A;  3T4K A;  4OVD A;  3RXX A;  4I3J A;  4ESP A;  3KSI A;  1SHV A;  4JXV A;  1P9R A;  5A90 A;  4BQM A;  1KDW A;  1S4R A;  1ONH A;  2HGV A;  2WYX A;  4MN5 A;  5HAQ A;  4GLQ A;  4IBX A;  1PW8 A;  1G6O A;  4PPR A;  3M2J A;  3S1Y A;  3N6I A;  4KG5 A;  3G4P A;  4GNU A;  2JN7 A;  4K91 A;  4NKP A;  4LV1 A;  3KYQ A;  1XX2 A;  5CGW A;  4S2N A;  5FAP A;  3EGX C;  1VET A;  5CED A;  1T19 A;  1NYY A;  2WKP A;  4OQH A;  3LUQ A;  2VA0 A;  1NJ4 A;  1E4D A;  4KZ8 A;  4KZ9 A;  4WN5 A;  4JXS A;  1TS0 A;  2XFT A;  1XJ3 A;  1YLW A;  3MZF A;  1P9W A;  3S7P A;  1F2K A;  3ZQ5 A;  5DKL A;  2VV7 A;  3UB9 A;  4ZJ3 A;  3A0R A;  5EVI D;  2W3F A;  3FZC A;  2GNX A;  3Q07 A;  4Q0I A;  3LIE A;  4H8R A;  4X68 A;  4RX3 A;  3IXH A;  4HH3 A;  4KEN B;  4S2O A;  3P98 A;  4Y2F A;  3GRJ A;  3GVB A;  3UDX A;  3KSG A;  1K0K A;  3VP4 A;  3T4O A;  2PT7 A;  4HHD A;  4CLC C;  3RJU A;  4DXB A;  5DF8 A;  4GZB A;  4RYE A;  3SH8 A;  2ZQ7 A;  1PWC A;  4WBG A;  1ERM A;  4OOM A;  2OV5 A;  1D06 A;  3QP1 A;  2EA9 A;  4GW9 A;  1DP6 A;  4R3B A;  4IED A;  4Y0T A;  3WS1 A;  1LL8 A;  1FSY A;  1SKF A;  2EXB A;  4HES A;  4XT2 A;  5HFO A;  4P0M A;  3T12 B;  5AQA A;  3GR2 A;  3B42 A;  5E2F A;  3G2Y A;  1SZV A;  2XRO A;  3V50 A;  3CAX A;  5AQ9 A;  5AJG A;  4EWF A;  2W3E A;  3LIB A;  3VP3 A;  3O3V A;  4YFM A;  5EFW A;  1F5M A;  3T1R A;  2V8F A;  3IT9 A;  1VHM A;  1GHI A;  4IVI A;  4UEY A;  2Y2N A;  4LEN A;  4U0T A;  5GL9 A;  3KYE A;  4D60 A;  4YNR A;  2Y79 A;  1O07 A;  2PU2 A;  4Q0H A;  4PAU A;  3T1X A;  3GQZ A;  1IYS A;  5MC7 A;  3BWL A;  5GHY A;  5CGX A;  4YIN A;  3S7O A;  4JBF A;  2Q9M A;  3JYI A;  3MKF A;  3PBS A;  4EUV A;  5HWT A;  3CG5 A;  3HLG A;  3ITA A;  2B5R A;  2J9O A;  1TEM A;  3E4P A;  4P6B A;  2G2U A;  2PD8 A;  3VFF A;  3MQQ A;  4MCW A;  5EM0 A;  2K7S A;  3W8K A;  2QYB A;  4GDB A;  2W0N A;  3IWO A;  4BEN A;  5CTN A;  1DP8 A;  2R9W A;  4MDZ A;  3PHY A;  3IH9 A;  2OWH A;  1D7E A;  4D2O A;  1S1Y A;  4X69 A;  2Y59 A;  1QMF A;  1IEM A;  3O5Y A;  1K4E A;  4OP5 A;  1LL9 A;  3NDG A;  3PBR A;  3CPT B;  1UWN X;  3T1S A;  4DE3 A;  4U0X A;  3MXR A;  4JGO A;  1KGF A;  3ZG9 B;  2Y4A A;  1NWZ A;  3EEA A;  2ZC4 B;  3U2A A;  1H8Y A;  3A0S A;  3LR0 A;  3JPU A;  1DJA A;  3PYP A;  3LR4 A;  1NRF A;  2JE5 A;  4JGP A;  5CRF A;  1OPX A;  2WGV A;  1ES4 A;  2VK3 A;  1CI8 A;  5F69 A;  5I94 A;  4JXG A;  2HDU A;  4PKY G;  4EXO A;  2WZX A;  4N1H A;  3VFH A;  2PDR A;  5E43 A;  2V8C A;  2XA7 M;  1N9B A;  4EUZ A;  1Q2P A;  4HIA A;  4HOI A;  2VGK A;  2X71 A;  3H7W A;  4WF0 A;  3FKV A;  5IU1 A;  3UE3 A;  2UV0 E;  4MBF A;  4NET A;  1GCE A;  4B4Z A;  4UA6 A;  4I3A A;  1W5D A;  3IWQ A;  4Q0J A;  5HL1 A;  1QME A;  2Z2L B;  4IUK A;  1IKI A;  1XFN A;  3OLO A;  1TVF A;  2GJ3 A;  2HJE A;  4EBL A;  2CC1 A;  2JKR I;  3AGF A;  1S67 L;  2J9P A;  2EXA A;  2ZC7 A;  4MEZ A;  1VET B;  2B18 A;  4OH0 A;  1PI5 A;  1F98 A;  3Q7Z A;  3A3D A;  1ACF A;  2J3T D;  2P04 A;  2B95 A;  4HI4 A;  4B88 A;  4R70 A;  5FEG A;  3HRE A;  3C7V A;  2WK0 A;  4HJ4 A;  4UQI M;  3MSH A;  3IHA A;  4DJ2 A;  5HSQ A;  3BFD A;  1OTE A;  1GSX A;  1YSP A;  2J3W A;  5GLD A;  4S2N C;  4FUW A;  4OPY A;  3UE0 A;  1W7F A;  4N9K A;  2WKQ A;  1G5U A;  1TF1 A;  4LRZ E;  4BMW A;  1WE4 A;  3ZNY A;  1AXB A;  3T4J A;  3IXG A;  2BAS A;  4WZ5 A;  4M4X A;  3W4P A;  3ZYT A;  4GHI B;  5EEC A;  1I2W A;  2XH9 A;  4OLD A;  3BEC A;  1J9M A;  1K55 A;  1MWR A;  5HDD A;  5FQI A;  2KDK A;  2EX8 A;  2ZQA A;  1MWU A;  2EFX A;  5DF7 A;  2Z6C A;  4ZJ1 A;  2W1T B;  1LLB A;  2JKR M;  3HLD A;  3NBL A;  4FH2 A;  2ZLY A;  4GJ4 A;  3VSK A;  1OTB A;  4WEK A;  5FQM A;  5F1F A;  5E2H A;  2ZQ9 A;  2HP9 A;  3BY9 A;  4FSF A;  2R9X A;  2GDN A;  2W27 A;  1Y28 A;  3NHQ A;  1PIO A;  1ES3 A;  5G18 A;  1K55 C;  1ERO A;  1BLS A;  2X01 A;  2BG1 A;  5E2G A;  5HL6 A;  4KG2 A;  1FQG A;  4GD6 A;  2YKF A;  3ZFZ A;  3OPH A;  3NJA A;  1ERQ A;  4OPR A;  3Q81 A;  2XSS A;  4UA9 A;  3MFX A;  2VGL S;  3E98 A;  2PBD P;  4XUX A;  5G4Y A;  4DKI A;  4HJ6 A;  3G35 A;  3MZD A;  2D02 A;  2HDR A;  3B33 A;  3GDI A;  2ZM8 A;  1PFL A;  2OWJ A;  4G3K A;  2IA2 A;  4P6Z S;  3VP2 A;  2O99 A;  1LSV A;  1KVL A;  3F1N B;  3E4Q A;  3NC8 A;  3PAG A;  3LEQ A;  5F82 A;  1BTL A;  5GHZ A;  2JHE A;  3ISG A;  5K5B A;  4K0W A;  3MFD A;  3WRZ A;  2Y2K A;  3W4Q A;  5EM1 A;  4O7D A;  3CUE A;  4B9O A;  3UME A;  1GSV A;  4DXC A;  2PHY A;  3HL9 A;  4K0X A;  2V2F F;  5F1G A;  3VOZ A;  3SH7 A;  3DTK A;  3ZVT A;  5AVF A;  1FCM A;  5KZH A;  2EX9 A;  4B93 A;  3CJM A;  1ZC2 A;  4MMN A;  5IHV A;  2ZD8 A;  4HP9 A;  5KSH A;  3FPV A;  4KZA A;  4GD8 A;  1EWZ A;  3L9K A;  1NRJ A;  2ZL1 A;  2G2W A;  4NXF A;  5U47 A;  4I3I A;  1GA9 A;  1BLP A;  1K6S A;  1XGJ A;  3FG8 A;  3IX4 A;  4BLM A;  1BUL A;  3UB8 A;  3ZG0 A;  2H28 A;  4WZ4 A;  4HNB A;  3KSH A;  3BRM A;  3P01 A;  4JKT A;  2O9C A;  3H7W B;  1W8Y A;  5DFX A;  1XFQ A;  1H0M A;  3IBJ A;  4Y15 A;  4R1G A;  5F5Y A;  2P9V B;  4EQI A;  4UHU A;  3V3R A;  2OAP 1;  3MKE A;  4KZ5 A;  3VE4 A;  4P85 A;  2VZW A;  2LB5 A;  4LLO B;  2LB9 A;  3IWI A;  1IYQ A;  5LBR A;  2VGJ A;  1FIK A;  3MBZ A;  1JWZ A;  3CI6 A;  2XD5 A;  4QHC A;  2M1C A;  4NXG A;  3KO6 A;  1KE0 A;  2CMN A;  5FL3 A;  1VEU A;  4S2M A;  3OCL A;  2NUP C;  5DTS A;  5HD5 A;  1OJG A;  1UWP X;  5E2E A;  2EX2 A;  4P87 A;  1M6K A;  1KGG A;  1KE4 A;  5DJU A;  5A91 A;  4E6X A;  4ZDX A;  3B3X A;  1SKO A;  4DMZ A;  2JKT I;  1YT4 A;  3RFB A;  3Q7V B;  2D01 A;  1OTD A;  4LV2 A;  1EW0 A;  4EV4 A;  1ZHH B;  2V1B A;  4OQ0 A;  4E3K A;  3C2W A;  4R4S A;  1PZO A;  2Q0O A;  2P7J A;  4LV3 A;  3K3D A;  4R3A A;  1YMX A;  3IX8 A;  4IBR A;  3HUO A;  3LCE A;  4ZBE A;  5KIZ A;  4LRX C;  5HWV A;  1AWI A;  1VQQ A;  3G2Z A;  3D9Y A;  5DVA A;  1WYC A;  2PR5 A;  3UB7 A;  4RQ9 A;  1KOU A;  4DE0 A;  3R7W A;  4FOF A;  4HBU A;  1HTZ A;  2QHK A;  4A5R A;  1G68 A;  2K31 A;  1U60 A;  4QD4 A;  2FZ0 A;  3H82 B;  2L0W A;  3PAE A;  1BLC A;  1LT0 A;  3VV4 A;  3UMD A;  1YSQ A;  3SW1 A;  4Z9Q A;  3T4T A;  1I5Q A;  1J3W A;  1OME A;  1ZKJ A;  3O88 A;  3CMZ A;  2XD1 A;  4X1M A;  4K08 A;  1ES5 A;  5D3O A;  1HZO A;  5FEF A;  5DTT A;  1V9Z A;  4IVK A;  3PXP A;  5EE8 A;  4XUZ A;  5FI7 A;  1DJC A;  4WEL A;  4EQ1 A;  3VOY A;  2OSU A;  4BBV A;  3I7J A;  1KDS A;  3GTC A;  2C5W B;  3SZT A;  4EEU A;  4Y7P A;  4OQI A;  3TW8 A;  3F1O A;  2FFF B;  4BL2 A;  5EOO A;  4QY5 A;  3HBR A;  2V0W A;  4IJG A;  2HF6 A;  4GHI A;  2G7U A;  3HLF A;  2XA7 S;  5GLB A;  1XA1 A;  3V3S A;  2DMW A;  1VEU B;  4YOF A;  5L2F A;  3T1Q B;  3C4O A;  4KG6 A;  5HPF A;  2XLN A;  2A3U A;  4DE2 A;  1RCJ A;  2E8I A;  2O0Y A;  3O86 A;  5GLC A;  4QPR A;  4ME4 A;  3QP2 A;  2VV6 A;  3AGE A;  1Z09 A;  2JBF A;  2L4R A;  3LIA A;  4E3L A;  5HW3 A;  2H0Y A;  2PRF A;  4FD8 A;  4FTX A;  3OC2 A;  1NLY A;  3QP5 A;  4Y0O A;  1FR1 A;  1XGI A;  5FQJ A;  1X0O A;  3F1P A;  3N8L A;  5FDH A;  3SS4 A;  1XA7 A;  3PTE A;  1KVM A;  4GS9 B;  3QHY A;  1OTI A;  1DY6 A;  5KSC A;  4E6W A;  4ID4 A;  4HJ3 A;  2DRW A;  3EGD C;  2ZQ8 A;  3FV7 A;  4HP4 A;  3HUN A;  3SS3 A;  2HJ9 C;  1LSX A;  3LR3 A;  4PMA A;  3BEB A;  1NLZ A;  2L1M A;  3IX3 A;  4S2L A;  1LHY A;  2BTF P;  3T4S A;  3DTE A;  4JGQ A;  3IXB A;  3Q1F A;  5JYP A;  1CEF A;  2Z6D A;  5M1A A;  4CLC E;  1FOF A;  3LY4 A;  4PM5 A;  1K57 C;  4JF6 A;  2Y2P A;  5CXW A;  4BBT A;  2PAV P;  3F1P B;  3A0V A;  1UGU A;  4EW7 A;  3PBT A;  1JNU A;  3P09 A;  4R38 A;  3C30 A;  3HCY A;  1JTD A;  5AQ7 A;  3LFV A;  5HDC A;  2WKE A;  5EVE A;  4OON A;  4N9L A;  3IS2 A;  4E3O A;  3WS4 A;  4ZAM A;  1EI5 A;  3EQU A;  5EOE A;  3W4O A;  4Y13 A;  5A92 A;  3DW0 A;  3NI9 A;  2DCF A;  3C8C A;  4WLA A;  4BD1 A;  5CHJ A;  3LGO A;  3IS2 B;  1MZU A;  1YLT A;  2V9A A;  4R23 A;  1S0W A;  2WUQ A;  4ZTK A;  3A3F A;  2HDQ A;  4Q8I A;  2V20 A;  1GSW A;  3MMH A;  1ZG4 A;  3MR0 A;  4OKP A;  2HV1 A;  4Y17 A;  2ZBB A;  3QP4 A;  3D72 A;  1GHP A;  4KQQ A;  2Q9N A;  1G28 A;  2XK1 A;  3SS5 A;  5CER A;  2ZM2 A;  3ICY A;  4GCZ A;  1IFQ A;  3ITB A;  5CTM A;  1O7E A;  4EES A;  5TGF A;  3HLB A;  4X53 A;  4EBN A;  3DWK A;  4N92 A;  3N4I A;  2ZQD A;  1YLP A;  5TBM B;  4JGR A;  4NG2 A;  1LI9 A;  3E0Y A;  1XJ2 A;  3VE3 A;  5TR7 A;  4CLC B;  1BSG A;  5AQB A;  1TDG A;  5HD3 A;  2RL3 A;  2ZQC A;  1YKD A;  3M6H A;  3DAV A;  3WS5 A;  3SOI A;  4MNR A;  5FAO A;  2ZJ9 A;  4GN2 A;  3A3E A;  4C6Y A;  2ZMA A;  1YM1 A;  4C75 A;  4S2P A;  1F9I A;  5FA7 A;  3UNW A;  2PBY A;  4LRY C;  1E25 A;  2J7V A;  3MZE A;  1FIL A;  3IQA A;  1NYM A;  2Y2M A;  1FR6 A;  2ZOH A;  2Y55 A;  4LCL A;  2ZOI A;  4NXB A;  3WS0 A;  1S1Z A;  4JLF A;  2ZMV A;  1DP9 A;  4EER A;  2FH5 A;  1GHM A;  4FH4 A;  1YLJ A;  2EX6 A;  4KZ3 A;  1HD8 A;  3R4K A;  3FKW A;  2PU4 A;  2FFY A;  2Y2I A;  2OAQ 1;  1Y54 A;  4PM7 A;  4QB8 A;  2V1Z A;  3K2N A;  3IF6 B;  3VSL A;  1XJ4 A;  3T4Q A;  1MXO A;  5M19 A;  1S6R A;  4H6J A;  1OTA A;  5FQK A;  4Y5F A;  1K54 A;  4RA7 A;  2H0T A;  3QNC A;  1H5X A;  3BM6 A;  3Q7V A;  2Z2M B;  4PM8 A;  4KQD A;  4KZ6 A;  1NXY A;  4JF5 A;  4KZ7 A;  2HDS A;  4P6Z M;  1IOU A;  3MS6 A;  2RCX A;  1MPL A;  5HX9 A;  3TJZ C;  4WYY A;  4BD0 A;  4E3M A;  3BLS A;  5CGS A;  4G3V A;  3LY3 A;  4OOL A;  2WGW B;  2MJ6 A;  5HPI A;  1ZG6 A;  1E3U D;  4NK3 A;  3GV9 A;  3S7N A;  4Y3I A;  3LI8 A;  4ARZ A;  5M18 A;  1L3L A;  3GEC A;  4AFI A;  3OCN A;  1PWD A;  2KLI A;  4PHT A;  5DTK A;  2OLU A;  1OT9 A;  1FCN A;  1LSW A;  1T1B A;  1YLZ A;  3L7H A;  4S2I A;  2ZMF A;  4L0L A;  1S66 L;  1M40 A;  4H6J B;  2H10 A;  2VKS A;  2JC7 A;  4KUO A;  4F94 A;  3A3I A;  1JWV A;  1MBL A;  4ETX A;  1XJ6 A;  4WZ5 C;  3NOP C;  1CF0 A;  2VJW A;  3UE6 A;  4HBT A;  2J3T C;  3VP1 A;  2EFU A;  3CZD A;  5F6A A;  4GOG A;  3M2K A;  3PBN A;  5AVE A;  1LI0 A;  5L09 A;  4DDY A;  1BUE A;  4PM9 A;  1MC0 A;  2ZC6 B;  3ULF A;  3BFC A;  3BY8 A;  5L10 A;  3C38 A;  1RGY A;  3ZVW A;  4UA7 A;  4DN0 A;  4QU3 A;  3TSG A;  3E4O A;  3LID A;  2V0U A;  1KGE A;  3BW6 A; 
#chains in the Genus database with same CATH homology
 3HJI A;  3KSF A;  5IU1 A;  1V9Z A;  3UE3 A;  4HY8 A;  1ZTU A;  3PXP A;  4WL9 A;  4I3A A;  2Y8H A;  1TS6 A;  5IS1 A;  4WEL A;  4EQ1 A;  4Q0J A;  4BBV A;  3TE8 A;  2QKP A;  5A8B A;  4IUK A;  4EEU A;  5L8M A;  3G6O A;  4L9G A;  1XFN A;  3JVV A;  5J4E A;  3OLO A;  2GJ3 A;  2HJE A;  2JKR I;  2B02 A;  4I5S A;  3TW8 A;  3F1N A;  3F1O A;  4BBU A;  3JVU A;  4WUJ A;  1S67 L;  2W3D A;  4G3W A;  2I9V A;  2V0W A;  4IJG A;  2HF6 A;  4GHI A;  2R78 A;  2G7U A;  5HZH A;  4ETZ A;  3BQA A;  2XA7 S;  5C5K A;  4O0P A;  2DMW A;  1N9N A;  2A2L A;  4YOF A;  1OT6 A;  4MN7 A;  2P08 A;  2B18 A;  3LI9 A;  5HPF A;  3RTY A;  1F98 A;  2O0Y A;  4QPR A;  4ME4 A;  3DBA A;  2J3T D;  3R7W B;  2VV6 A;  2P04 A;  2VEA A;  2XRN A;  1W63 Q;  3BQ8 A;  4L9E A;  2W3H A;  2QJ5 A;  2L4R A;  3LIA A;  4HI4 A;  4R70 A;  2JKT M;  3LR5 A;  4HJ4 A;  4UQI M;  4R6L A;  4I39 A;  4DJ2 A;  3FC7 A;  5HSQ A;  3OC2 A;  1NLY A;  1OTE A;  5DJT A;  2PD7 A;  1GSX A;  1YSP A;  2J3W A;  1X0O A;  4YWZ A;  2WKQ A;  1TF1 A;  3EEH A;  4KUK A;  4LRZ E;  4BMW A;  3F1P A;  2O9B A;  3FPW A;  4GS9 B;  3T4J A;  5I5L A;  2BAS A;  4M4X A;  1OTI A;  3ZYT A;  4GHI B;  3KYZ A;  4EEP A;  2INW A;  4HJ3 A;  5DF9 A;  4F3L A;  1ODV A;  2A24 A;  3EGD C;  4HP4 A;  2QJ7 A;  5HDD A;  2EWV A;  2HJ9 C;  1LSX A;  3LR3 A;  2PYP A;  2KDK A;  2W1T A;  1NLZ A;  2WKR A;  2Z6C A;  2W1T B;  2L1M A;  4E04 A;  1T1C A;  4NEE D;  4EET B;  2JKR M;  2K2N A;  3T4S A;  4CLC A;  4GJ4 A;  1OJ5 A;  1T1A A;  4JGQ A;  1OTB A;  4WEK A;  2QWS A;  1T18 A;  2Z6D A;  2GX5 A;  4II7 A;  4NXE A;  4CLC E;  1BYW A;  3BY9 A;  4FSF A;  2OOL A;  3T4K A;  2W3G A;  2W27 A;  3LIF A;  4I3J A;  1Y28 A;  3NHQ A;  3KSI A;  4BBT A;  1P9R A;  3F1P B;  3A0V A;  4LPZ A;  1UGU A;  4EW7 A;  3OOV A;  1S4R A;  2HGV A;  3PBT A;  5HL6 A;  5F68 A;  4MN5 A;  1JNU A;  4R38 A;  5HWW A;  2YKF A;  4GLQ A;  1TS8 A;  4HH2 A;  3C30 A;  1G6O A;  3LIC A;  3NJA A;  3HCY A;  3CUE C;  3EQV A;  3LFV A;  5TJJ A;  2XSS A;  5HDC A;  3OBF A;  3MFX A;  2VGL S;  3E98 A;  3IS2 A;  5G4Y A;  2JN7 A;  2VV8 A;  2PR6 A;  4DJ3 A;  4NKP A;  3KYQ A;  4HJ6 A;  1TS7 A;  3PBO A;  3EGX C;  2D02 A;  3B33 A;  3T50 A;  3GDI A;  3EQU A;  1T19 A;  2OWJ A;  2EWW A;  2WKP A;  4G3K A;  3LUQ A;  2VA0 A;  2IA2 A;  3C8C A;  4WN5 A;  4WLA A;  3PR6 A;  4P6Z S;  5IT5 A;  2O99 A;  1LSV A;  1TS0 A;  3IS2 B;  1MZU A;  2V9A A;  1XJ3 A;  3F1N B;  3E4Q A;  1P9W A;  3S7P A;  2M7U A;  4BJP A;  1GSW A;  3ZQ5 A;  3MMH A;  3TRC A;  5DKL A;  2VV7 A;  3MR0 A;  4O8G A;  2HV1 A;  2JHE A;  3UB9 A;  2ZBB A;  1WA9 A;  3D72 A;  2M7V A;  5K5B A;  3A0R A;  2W3F A;  1G28 A;  3ICY A;  2A24 B;  3CUE A;  4L9F A;  2GNX A;  4Q0I A;  4GCZ A;  1IFQ A;  4B9O A;  3LIE A;  5CX7 A;  1GSV A;  3UME A;  4EES A;  3EOI A;  2PHY A;  1H3Q A;  4HH3 A;  5DFY A;  4Y2F A;  5TBM B;  5TBM A;  4CLC D;  4JGR A;  5AVF A;  3BJN A;  3K3C A;  1N9O A;  3KSG A;  4B93 A;  3T4O A;  2PT7 A;  3E0Y A;  4HHD A;  4MMN A;  5DKK A;  4CLC C;  1XJ2 A;  3B47 A;  4HP9 A;  3VE3 A;  5KSH A;  4MN6 A;  3FPV A;  4CLC B;  4ZRR A;  1NRJ A;  4OOM A;  4F3L B;  4NXF A;  1D06 A;  3CIT A;  4I3I A;  2EA9 A;  2KOI A;  1DP6 A;  3H82 A;  4GW9 A;  5HD3 A;  3UB6 A;  1LL8 A;  3FG8 A;  1H8M A;  4EU0 A;  5G4Z A;  3UB8 A;  1S4S A;  1YKD A;  1DRM A;  2H28 A;  4HNB A;  4XT2 A;  3KSH A;  5J3W A;  5HDS A;  3B42 A;  3EWK A;  3P01 A;  2XRO A;  2O9C A;  3CAX A;  4IHQ A;  3T4L A;  3MXQ A;  3H7W B;  5AJG A;  5DFX A;  1XFQ A;  2W3E A;  3LIB A;  3IBJ A;  1F9I A;  2J80 A;  5F5Y A;  5EFW A;  1F5M A;  2OAP 1;  4LRY C;  1VHM A;  4ARZ B;  3VE4 A;  2VZW A;  2LB5 A;  4LLO B;  2LB9 A;  3LYX A;  4UEY A;  2ZOH A;  5LBR A;  2ZOI A;  4NXB A;  1N9L A;  3CLO A;  3IBR A;  3H9W A;  1V9Y A;  3CI6 A;  1S1Z A;  4YNR A;  2Y79 A;  2ZMV A;  1DP9 A;  4EER A;  4WEJ A;  2M1C A;  2FH5 A;  4NXG A;  3KO6 A;  4HQA A;  4Q0H A;  4PAU A;  2CMN A;  3R4K A;  5FL3 A;  5MC7 A;  3BWL A;  3OCL A;  2OAQ 1;  2NUP C;  5HD5 A;  3S7O A;  3K2N A;  2O9A A;  1XJ4 A;  3T4Q A;  1OJG A;  1UWP X;  3MJQ A;  3PBS A;  4H6J A;  4EUV A;  1OTA A;  5HWT A;  4Y5F A;  1YAX A;  3NOT C;  3P7N A;  3E4P A;  4PKY A;  5DJU A;  4KQD A;  1VB6 A;  4DMZ A;  2PD8 A;  2VX8 A;  2VGL M;  3MQQ A;  2JKT I;  3RFB A;  4MCW A;  4P6Z M;  2W1R A;  4BWI A;  2K7S A;  2D01 A;  4IUH A;  1IOU A;  1OTD A;  2QYB A;  3TJZ C;  1EW0 A;  2GZA A;  2W0N A;  2NUT C;  2KX6 A;  1MKM A;  4G3V A;  1ZHH B;  2V1B A;  1DP8 A;  4OOL A;  4MDZ A;  3PHY A;  2OWH A;  3C2W A;  1D7E A;  1S1Y A;  4GS9 A;  2MJ6 A;  3O5Y A;  5HPI A;  3MQO A;  2P7J A;  1W63 M;  3D3O A;  3S7N A;  4Y3I A;  3K3D A;  3LI8 A;  4R3A A;  3PBR A;  4ARZ A;  1P0Z A;  3GEC A;  4AFI A;  3OCN A;  5KIZ A;  1UWN X;  2KLI A;  4LRX C;  4PHT A;  5HWV A;  1OT9 A;  4I38 A;  4KQO A;  3W2Z A;  1LSW A;  5J7E A;  1T1B A;  2ZMF A;  4L0L A;  3RH8 B;  2PYR A;  2PR5 A;  1S66 L;  4JGO A;  3UB7 A;  4Z1W A;  4H6J B;  4RQ9 A;  1KOU A;  2VKS A;  4KUO A;  1NWZ A;  3EEA A;  3R7W A;  3U2A A;  3S7Q A;  4FOF A;  3A0S A;  3LR0 A;  4ETX A;  3V67 A;  1XJ6 A;  3MQ0 A;  2QHK A;  3NOP C;  3VOL A;  2K31 A;  3PYP A;  3MF0 A;  2VJW A;  3LR4 A;  4O01 A;  3UE6 A;  2J3T C;  2FZ0 A;  5F6A A;  3CWF A;  3H82 B;  2L0W A;  4JGP A;  3HJK A;  1OPX A;  1LT0 A;  3PBN A;  3VV4 A;  4CQH A;  4XT2 B;  5AVE A;  5F69 A;  1MC0 A;  3ULF A;  4PKY G;  3UMD A;  1YSQ A;  3PBQ A;  4EXO A;  3SW1 A;  3BY8 A;  1P97 A;  3T4T A;  1TD5 A;  3C38 A;  2PDR A;  2V1A A;  3KX0 X;  3F1O B;  3NOU C;  2XA7 M;  1STZ A;  4K08 A;  4DN0 A;  4HIA A;  4HOI A;  2VLG A;  4UQI S;  3E4O A;  3H7W A;  2YKH A;  3LID A;  2V0U A;  4WF0 A;  3BW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...