3A0VA

Pas domain of histidine kinase thka (tm1359) (semet, f486m/f489m)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
96
structure length
96
Chain Sequence
METAIITLSKDGRITEWNKKAEQLFGLKKENVLGRRLKDLPDFEEIGSVAESVFENKEPVFLNMYKMGERYFNIRFSPFRNAKTQLLEGVIITIDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Sensor protein
publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
total genus 28
structure length 96
sequence length 96
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3a0vA00
4JGRA 1LL8A 2P7JA 4EXOA 4MN5A 1JNUA 4WF0A 1TS6A 2KX6A 2PR6A 2OOLA 4HJ3A 4HH2A 3EWKA 2QJ5A 4LRYC 1XFNA 3VOLA 2QWSA 3C2WA 3LYXA 5HWVA 3MQOA 4M4XA 1VB6A 2QJ7A 4EQ1A 3H82A 3H9WA 1XJ2A 3UMDA 1LSXA 4BBUA 4LPZA 5F5YA 3NOPC 2JN7A 5F68A 1D06A 4F3LB 1OT9A 1G28A 2OWJA 1TS0A 1P0ZA 4RQ9A 3LICA 3LIDA 4H6JB 5F6AA 2BASA 4JGPA 3PYPA 3LI9A 3CAXA 4GCZA 2INWA 4MN6A 4JGQA 3RH8B 3G6OA 4HJ4A 4LLOB 4XT2A 3P7NA 4I38A 3A0RA 5TBMB 1V9YA 3B33A 3GDIA 1GSVA 2PDRA 1P97A 3UB8A 2I9VA 1Y28A 2QHKA 1S66L 1OJGA 3HJKA 1BYWA 4WN5A 4WLAA 3F1PB 1S1ZA 3NJAA 5J4EA 1OJ5A 5EFWA 4NXEA 2W0NA 3SW1A 2VEAA 4E04A 3LIAA 1OTIA 4EETB 5DJUA 1WA9A 1T1BA 4KUKA 1XJ4A 2PYRA 3H82B 3RTYA 3KX0X 5HD5A 3F1OA 3NOTC 4NXFA 1LT0A 3F1NA 3MFXA 1D7EA 4R3AA 1S1YA 1DP8A 3BWLA 3C8CA 1S4RA 2K7SA 4HIAA 5HD3A 4DJ3A 3A0SA 4XT2B 4I3JA 1EW0A 5DJTA 4HP4A 4YWZA 2V0UA 2V1AA 2HV1A 4HNBA 2D01A 2Z6CA 3LIEA 4NXGA 5AVFA 2PR5A 2VLGA 3FG8A 5I5LA 1DP9A 5KIZA 2A24A 3LIBA 2JHEA 3ZQ5A 5HDSA 2CMNA 3K3DA 4EERA 1F98A 4EW7A 2L4RA 3K3CA 4PKYA 1GSWA 1NWZA 3OLOA 4EESA 1T18A 3IBRA 3IS2A 1F9IA 3F1OB 3UB7A 2VV8A 4GW9A 1LSVA 3LI8A 3F1NB 5HWWA 2R78A 4HHDA 1OTAA 3UMEA 2ZBBA 2V1BA 3ULFA 1TS8A 2YKFA 4KUOA 3UB6A 2WKRA 1ODVA 5J3WA 3T50A 1UWNX 3LUQA 2M1CA 1S67L 5HDCA 3CWFA 1TS7A 2PYPA 2L1MA 4NXBA 2D02A 4I39A 3BY9A 5F69A 4PKYG 5A8BA 5DKLA 2B02A 2GJ3A 5HWTA 2PD8A 2A24B 3GECA 1UWPX 4GS9A 1GSXA 3H7WA 4I3AA 4I5SA 1OTBA 4K08A 4HH3A 1XFQA 4BBVA 2L0WA 3UB9A 1XJ3A 1T19A 3HJIA 5DKKA 3MXQA 4JGOA 4HY8A 2Z6DA 3E4OA 2YKHA 3IS2B 1OT6A 3LIFA 1KOUA 4R70A 2KDKA 5HDDA 1X0OA 1DRMA 2J80A 4EEUA 1T1CA 4DJ2A 3NOUC 4GHIA 5G4ZA 4HI4A 2OWHA 3VE4A 3A0VA 3MQQA 4L9GA 5HZHA 5HSQA 2WKPA 4HJ6A 4WL9A 1N9LA 1UGUA 2WKQA 2VV6A 2PHYA 5J7EA 3D72A 4HQAA 3MR0A 4F3LA 2V0WA 5IU1A 1N9NA 4EEPA 1T1AA 2EA9A 3CLOA 5IS1A 4R6LA 4GS9B 2ZOIA 2W27A 4H6JA 4LRXC 3BY8A 4BBTA 3H7WB 4L9FA 3UE6A 2ZOHA 5G4YA 3MJQA 4KQDA 2V9AA 1DP6A 3ICYA 5AVEA 4WUJA 5TBMA 3EEHA 4I3IA 4R38A 2QKPA 3E4QA 1MZUA 1S4SA 4L9EA 3NHQA 1OTDA 1V9ZA 3VE3A 1N9OA 4HP9A 3E4PA 4B9OA 3F1PA 1XJ6A 2VV7A 4LRZE 3FC7A 4GHIB 2H28A 1OTEA 4HOIA 3PHYA 1LSWA 2PD7A
chains in the Genus database with same CATH superfamily
4GN2A 4BENA 1N9BA 3CI6A 2J9OA 3G32A 3N7WA 1LL8A 2P7JA 3LR5A 1JNUA 1TS6A 3NDGA 1K4EA 1RGYA 3ZNYA 4N9KA 2ZMAA 2QJ5A 5M1AA 4E3LA 3Q7ZA 2ZC3B 1XXMA 1P9WA 4GJ4A 3IT9A 1YLWA 3KYEA 1MWRA 3VSLA 1XX2A 4ZDXA 1XJ2A 5E43A 2NUTC 1LSXA 2VGLM 2WAEA 4BBUA 4HBTA 2JN7A 5F68A 1D06A 1ZTUA 4F3LB 2XGNA 4S2NC 4U3TA 3T4SA 4C6YA 1K0KA 3PXPA 3UE1A 2VA0A 3Q81A 4IJGA 4H6JB 3U2AA 2ZC4B 4KQQA 3B47A 2BASA 1K56D 3LI9A 4O7DA 3VMAA 3VP2A 4HJ4A 2W1TB 4O01A 4I38A 3LY3A 2WKIA 5TBMB 1V9YA 4KZ4A 1GSVA 3IX4A 5EECA 2Y2OA 1Y28A 4OQIA 5HL1A 1BZAA 2Y2MA 3EEAA 4DDSA 3TJZC 1BYWA 2QMIA 1KGFA 4JF5A 3TG9A 2EX2A 1OJ5A 2P74A 3OC2A 4XUZA 2J3TD 3UPNA 4OPRA 4E6XA 4CJNA 1NXYA 4KG2A 3GR2A 4C3QA 3V3SA 2M7UA 4ZBEA 1VHMA 5DVAA 3LIAA 3O86A 4JXWA 1OTIA 4LV1A 4CPKA 3ZVTA 1T1BA 5DTKA 2X71A 3E2LA 1K25A 3RTYA 1QMFA 3F1OA 5AJGA 4MEZA 3HVFA 1LT0A 3F1NA 4ARZA 5FEFA 1JTGA 1XA1A 5JYPA 3N4IA 4WEKA 1S1YA 4YFMA 1DP8A 2VJWA 3S7QA 3C8CA 1OPXA 2K7SA 1K6SA 4UQIS 1YLYA 5KSCA 3MXSA 2Y2GA 4EU0A 5CEBA 5DFYA 1YSPA 2IWBA 4YWZA 4ZAMA 4S2LA 4O8GA 4B4XA 3MZEA 4UAAA 1FILA 1QMEA 1SCWA 3QP2A 3S4XA 1PYYA 1LLBA 5D3OA 3JVVA 2HJEA 2XA7M 4WBGA 3E98A 1J3WA 5G18A 2A24A 3DAVA 2OLVA 3D9YA 2V2FF 3E0YA 5CTMA 4Q8IA 1Y54A 3BJNA 1SZVA 2CMNA 3ZNTA 4WEJA 1K6RA 4DN0A 2IWDA 1N4OA 1ES5A 3BEBA 4IUKA 2P08A 3OLOA 4Y15A 3HUMA 2EX8A 1ES2A 4S2JA 3FPVA 3UB5P 3T1RA 3PBRA 3O87A 3IS2A 3F1OB 3WRTA 4JKTA 1XKZA 4B93A 3LI8A 3F1NB 4ARZB 5HWWA 1LI9A 2R78A 1HTZA 3HCYA 5HW3A 4UA6A 1GHPA 4LFUA 4WYYA 2O9BA 4P85A 1BTLA 1CEGA 4R1GA 3DWZA 5GLAA 2IWCA 2Y2HA 4KZ6A 3CUEA 4LV0A 1UWNX 3SS5A 5FDHA 4ID4A 1TS7A 5FAPA 2D02A 4I39A 4QU3A 3DTKA 3C4PA 4PKYG 3VP3A 5A8BA 2XR0A 3BQAA 4IVIA 2A24B 1UWPX 1PWDA 2JC7A 3G4PA 4Y7PA 1KDSA 1YMSA 1GSXA 4DF6A 3ZG9B 4JPMA 3FWLA 5E2HA 1F2KA 4K08A 1KE0A 4BBVA 4KZ9A 4Y0TA 5L2FA 3LGOA 3UB9A 4NEED 4JGOA 3PR6A 4HY8A 1IYOA 2Y2LA 1M6KA 3E4OA 3PAEA 3IS2B 1OT6A 1PFLA 3DBAA 3HL9A 4PPRA 1NRJA 3WRZA 1RP5A 5HDDA 2JBFA 2B5RA 1DRMA 4R23A 4DE0A 1J9MA 2J80A 5CGWA 1K55C 3BRMA 2ZC6B 3UPPA 4DJ2A 3LR3A 4GHIA 2XD1A 3BLSA 4X55A 3C30A 4S2OA 2WGVA 1BLSA 1S6RA 3VE4A 2GX5A 3N8LA 2PU4A 2LB5A 1N9LA 1ONGA 2PHYA 4BD1A 1ESIA 1KDWA 1L0DA 5DFXA 3HUOA 1L3LA 4OH0A 3ZG0A 4P6BA 2ZC7A 4WELA 3HLFA 3MR0A 2XFTA 2Z2MB 2VGKA 5HARA 4ZJ2A 3CLOA 1IFQA 5FAQA 1ONHA 3GRJA 4BBTA 4BD0A 3HBRA 2OLUA 3QP8A 1Q2QA 1ZKJA 3IF5A 2HP6A 2ZOHA 4L9FA 4QHCA 3MJQA 4KQDA 4BWIA 2G7UA 2V9AA 1FQGA 3V67A 3WS2A 1Z09A 4I3IA 5DTTA 1NZUA 3E4QA 1MZUA 5EUAA 3ZGAB 4ESPA 1PW1A 3FKWA 2EX9A 1N9OA 4HP9A 1BLCA 1ACFA 5EVIA 1XGIA 5AQ7A 2WZXA 3IQAA 4WZ5C 1HVBA 2VV7A 3CITA 1CI9A 3FC7A 4GHIB 2PD7A 1G6AA 4MN5A 4S2KA 1W8YA 4BQMA 2KX6A 4KZ5A 3A3DA 1U60A 4DMZA 1L0FA 3PBTA 5DTSA 5TJJA 2W3FA 4LRYC 1XFNA 2QWSA 3R4KA 3SH8A 1XA7A 3DTEA 4EQ1A 3H82A 3MKFA 4LV3A 3UMDA 5F5YA 1D1JA 1MWSA 4GNUA 3IWQA 1MWTA 5EPHA 4RQ9A 3LICA 3L7HA 3VSKA 3BM6A 3V39A 4JGPA 3PYPA 3CAXA 4GCZA 3CPTA 5HX9A 4WMCD 1KVLA 2W3GA 4LLOB 1EWZA 2EFUA 4LGWA 3S22A 3MBZA 3JYIA 1H8ZA 3B33A 2PDRA 1P97A 1MKMA 1YLPA 4UQIM 3KSFA 4PAUA 4S2PA 4FUWA 2MJ6A 4FH4A 5EVIB 4N92A 2HGVA 1JTDA 3IH9A 2K31A 3A3EA 2O9CA 1MXOA 2VEAA 2XD5A 4ZJ1A 1VEUA 4BL2A 3MSHA 3LEZA 3SOIA 3M2JA 5FL3A 1H5XA 4RVAA 2Y2PA 5A92A 5FI6A 3S7OA 5FI2A 3HLWA 2PYRA 4QY6A 3H82B 5FDSA 3KX0X 3QHYA 5HD5A 1ESUA 2FH5A 3MF0A 3NOTC 4NXFA 3B42A 4OLDA 2EXBA 1GCEA 4R3AA 1OMEA 3QP4A 3A3FA 5KSHA 3I7JA 2XF3A 5GHXA 5J8XA 2JCHA 3CPTB 2XEPA 4HIAA 5HD3A 4DJ3A 1F5MA 2J3WA 5DJTA 2Y4AA 4HP4A 5EM1A 1VETA 3S1YA 2HV1A 4G3VA 4OPYA 4JLFA 2PBDP 2D01A 5M18A 3W4OA 2Y2JA 4ME4A 1IEMA 3UDXA 2VLGA 4S2MA 1ZC2A 5HPFA 2ZLYA 2XQZA 4RX2A 3ZCZA 2WZZA 4IVKA 1O7EA 2HDRA 3ZQ5A 4DKIA 4E3MA 3GSGA 4Q0HA 2Q9MA 3K3DA 4MMNA 2L4RA 4PKYA 1GSWA 1VEUB 3T4QA 1Y4OA 3UNWA 1T18A 3IXBA 3IWIA 3K2NA 1GHMA 4PM9A 4QPRA 4B4ZA 2RCXA 2UWXA 3BYDA 1F9IA 4FSFA 4GB7A 1LSVA 3SZTA 2HPBA 3T4KA 1NYYA 3CUEC 3KO6A 5KZHA 1YLTA 2V1ZA 3GMWA 1JVJA 4HEFA 3TE8A 4KZ3A 4EUZA 4FOFA 4R0QA 2E8JA 5HAIA 3HLDA 2FFFB 5A91A 4KUOA 5FQQA 1W5DA 1CEFA 3HLBA 4ETZA 3G35A 4A5RA 2C5WB 4DE1A 1VETB 4OVDA 4AFIA 2J7VA 4JBFA 2PYPA 1K54A 1PI5A 2ZQ8A 3OPPA 4BLMA 2ACGA 1Q2PA 4OOMA 5DKLA 2GJ3A 5K5BA 2GNXA 3IHBA 4Y0OA 1TF1A 1GHIA 5IT5A 1FSWA 1SKOA 3ISGA 4I5SA 3BW6A 1OTBA 4HH3A 1XFQA 1PWGA 3NI9A 3ZG5A 1YLJA 2ZM2A 2Z6DA 5FASA 3OCLA 3KYZA 2ZD8A 3MXRA 4NETA 1HLUP 2X02A 3ZG7B 3T1XA 2WUQA 4JF4A 3C7UA 3C4OA 4R3JA 2EX6A 5CX7A 2C6WB 5G4ZA 3WS5A 1FIKA 2H0YA 5CHUA 5FQKA 3TSGA 4EBLA 3VOZA 2JKRI 3MQQA 4L9GA 2R9WA 3O3VA 4H8RA 4F94A 2A3UA 4RX3A 3N6IA 1E25A 3VOYA 5F1FA 3OOVA 1W63Q 2JKRM 3R7WA 1UGUA 4S2NA 4OLGA 2WGWA 3C5AA 3D72A 5EOOA 3KSGA 4PM8A 4E3KA 3Q1FA 1JWZA 1NJ4A 3CG5A 1STZA 5IU1A 4D2OA 4EEPA 3IH8A 3CMZA 5IS1A 5CEDA 5IHVA 2Y59A 5GLCA 5E2GA 1VM1A 1SKOB 1IOUA 3IF6C 3OPRA 1H3QA 3N8SA 1GA0A 5FEGA 5EVIC 4LCMA 4C75A 2FZ0A 5AVEA 3W8KA 1K4FA 1JWPA 3CJMA 4HBUA 3EEHA 2EWVA 1HZOA 4OP8A 3D4FA 5DF8A 1FCOA 1G68A 3VE3A 2XSSA 3EGDC 1CK3A 2EXAA 5HAPA 3L9KA 2W3EA 4GDNA 1ERQA 4X56A 2H28A 4WMCA 3PHYA 4OOLA 5E2EA 1ZG6A 4KZAA 2RL3A 4CLCA 3FKVA 4CLCE 3HLGA 3OBFA 3UDFA 3MKEA 3QNBA 2OOLA 4K0WA 4HJ3A 3IWOA 4GKUA 3EWKA 3VP4A 3PBQA 2PAVP 4JXGA 3NCKA 2XLNA 3R7WB 3VOLA 3U4LP 2WGWB 3LYXA 3MQOA 3UPOA 5DF7A 2HZ5A 1DJBA 3H9WA 4ZRRA 3TRCA 2Z2LB 4KZ7A 1NZOA 4UA7A 2JKFA 5U47A 2ZM0A 1OT9A 4P6ZS 1BT5A 4D60A 4YOFA 1FOFA 4G3KA 1ES4A 5A93A 2G2WA 2WYXA 2Y2NA 3LIDA 1BSGA 4K0XA 5I94A 3KSIA 4G3WA 5FSRA 2INWA 4OPZA 1DJCA 4MN6A 4JGQA 4L0LA 3RH8B 3G6OA 1E3UA 3SH7A 3RXWA 4XT2A 3V50A 3A0RA 1KE3A 4X1LA 1FSYA 4IBRA 1PZPA 2W1RA 3DW0A 3P09A 2W3HA 3LFVA 3QP5A 1S66L 4OONA 4QB8A 1OJGA 2K2NA 5M19A 5L07A 3ZFZA 1YQSA 4WN5A 4WLAA 1S1ZA 3MZFA 3ZVWA 5CHJA 3NJAA 1CF0A 3LR4A 2V20A 4CLCB 4P87A 4WM9A 5EFWA 4NXEA 3Q07A 3SW1A 4ETXA 3WS0A 4DDYA 4E04A 1DJAA 2CC1A 4XUXA 2ZQ7A 1YAXA 3BFEA 3UDIA 1WA9A 4IHQA 2QPNA 4KG5A 1L2SA 1XJ4A 4FD8A 4KG6A 1W79A 4OP5A 1K56A 3MMHA 4UEYA 3GV9A 2VZWA 3MQ0A 2WGIA 2XFSA 1D7EA 4KQRA 3PTEA 5F1GA 4EV4A 3BWLA 5FAOA 2JKTI 4EWFA 4UA9A 2FFYA 3RXXA 4NK3A 4Y3IA 3NIAA 3ZYTA 1I2WA 2JKTM 4XT2B 2Y8HA 3W4PA 3T1QB 2V0UA 5F82A 2V1AA 1XGJA 3BLMA 5HPIA 3V5MA 3NDEA 5HL6A 1S0WA 2PBYA 4HESA 2ZQCA 3LIEA 4NXGA 1G5UA 4O0PA 5AVFA 3AGEA 5CXWA 1TVFA 2AVXA 3FG8A 1DP9A 5KIZA 3KSHA 2JHEA 4KQOA 4DE3A 1L0GA 4DXCA 3T1SA 3PAGA 4OQGA 4Y0UA 4PM6A 5FQMA 5EV0A 5GL9A 1PI4A 1NWZA 3SS4A 2HDSA 2P04A 1NRFA 4EESA 3LR0A 3ZG8B 3CZDA 4OPQA 1K55A 3OCNA 5TGFA 3KYQA 1MKIA 3IBRA 5FA7A 3UB7A 2VV8A 4GW9A 1MC0A 3WWXA 1CJFA 2E8IA 3VFHA 4HHDA 3G34A 2WKHA 2W3DA 3BFGA 3UMEA 4CQHA 2HDQA 2V8FA 3IXDA 4X6TA 3A3JA 2ZQAA 4K91A 3NC8A 2VX8A 2WKRA 2O9AA 3T50A 4NG2A 1O07A 3LUQA 4ZTKA 1S67L 1SDEA 3V3RA 1RGZA 3GVBA 2Q9NA 2B95A 3M2KA 4Y13A 2GDNA 3S7PA 3T12B 3EQUA 3BECA 5HWTA 3VV4A 5AQAA 3GECA 1YLZA 4OOYA 4GS9A 1K57A 1IYQA 3C38A 2P9VA 3ITBA 3DTMA 3M6BA 2LB9A 4I3AA 2Y91A 3GTCA 2L0WA 4DRTA 1XJ3A 4S2IA 1T19A 4WZ5A 5FI7A 2O99A 3AGDA 2YKHA 2PU2A 3UO9A 3LIFA 5CERA 1KOUA 4R70A 2HF6A 2OSUA 1X0OA 2HP5A 4EEUA 1T1CA 3G2ZA 3NOUC 1BULA 1LHYA 2OWHA 3HLEA 5EVID 1XPBA 4N1XA 3A0VA 1M40A 3BFDA 4HJ6A 2UV0E 5DF9A 1ES3A 2H10A 2VK3A 2ZC5B 2WKQA 1A0KA 5J7EA 5GHYA 3VFFA 1PWCA 3EGXC 1GA9A 3TW8A 3WS1A 3FPWA 1RCJA 3IHAA 4MBFA 2EA9A 4QD4A 1E4DA 4R6LA 2GZAA 4GS9B 3G30A 3QNCA 2ZOIA 2W27A 3VP1A 4GD6A 2P9VB 3BY8A 1HD8A 3NECA 4P6ZM 3UE6A 2J8YA 3OPHA 1DP6A 3NBLA 2PT7A 4GOGA 5HFOA 3BQ8A 4ZJ3A 4R38A 3RJUA 2QKPA 3M6HA 3PBOA 5CTNA 3UY6A 1S4SA 4CLCC 3SH9A 2Y2IA 4Y5FA 3JPUA 3E4PA 1MBLA 3E2KA 2EFXA 3TOIA 3F1PA 1XJ6A 2IA2A 1YMXA 4HOIA 2QYBA 1LSWA 2XDMA 2Q0OA 4PMAA 4YNRA 4JGRA 4EXOA 5CGXA 4WF0A 4M3KA 2XH9A 3HLCA 4P0MA 4JF6A 2PR6A 5A90A 3UE3A 4KZBA 2G2UA 4HH2A 4E3IA 3MZDA 5FQJA 3MS6A 3HREA 5CGSA 3A3IA 3C2WA 1K38A 5HWVA 1IYSA 2KOIA 4M4XA 1KGEA 1VB6A 3Q7VA 2QJ7A 1AWIA 4LPZA 4LCLA 2A49A 2R9XA 3NOPC 3P01A 4N1HA 3NY4A 3Q82A 1G28A 1XP4A 1NY0A 2OWJA 1TS0A 4R4RA 4Y17A 1P0ZA 3IBJA 4MNRA 1IKIA 5CECA 5FQIA 3HUNA 5F6AA 3O5YA 1YPRA 3EOIA 5EM0A 5GHZA 3P7NA 4Z9QA 5GLDA 2KLIA 4GZBA 3GDIA 1PZOA 4KENB 3UB8A 1WYBA 5BOHA 2I9VA 3ZHHA 2X01A 2QHKA 1SDNA 4U0XA 4R3BA 3HJKA 5MC7A 3QP1A 2JKGA 3F1PB 3T4LA 5J4EA 3D3OA 2BG1A 3MFDA 4FCFA 2DMWA 1TDGA 4IBXA 4IUHA 1TEMA 2W0NA 1WE4A 2HJ9C 1FR6A 4N9LA 5L8MA 2XK1A 3RFBA 2VGLS 2WK0A 2WADA 2XROA 2XRNA 4QJGA 4EETB 5DJUA 2M7VA 4QWOA 3B3XA 3JVUA 3UN7A 2ZL1A 3IXHA 3Q7VB 4X53A 1P9RA 4KUKA 4KZ8A 1C3BA 3LY4A 2OAQ1 1NLYA 2ZMFA 3MFXA 4RYEA 5EE8A 5L10A 5CHMA 1BLHA 1YT4A 4BMWA 4NKPA 3P98A 4PM7A 4MCWA 2OV5A 1I5QA 1S4RA 2Y2QA 3G31A 4PHTA 3W2ZA 3A0SA 2J3TC 4I3JA 1EW0A 2Y55A 1W7FA 3CHWP 3PBNA 3T4TA 2PRFA 4MBHA 1IELA 4X25A 4GLQA 2DCFA 4X1MA 4HNBA 2Z6CA 4EUVA 1MPLA 1PNEA 3IXGA 2PR5A 3LCEA 3N8RA 4JXSA 1MWUA 2H5SA 4JXVA 4Z1WA 4BJPA 1H0MA 5I5LA 2ZM8A 2HDUA 3OZHA 2JE5A 3LIBA 1SHVA 5C5KA 3T4JA 1NYMA 5GLBA 5TR7A 5AQBA 5HDSA 3LEQA 4E3JA 3AGFA 4EERA 1F98A 4EW7A 3K3CA 1BLPA 3FYZA 4OQHA 1JWVA 4B88A 1FCNA 3SS3A 1SKFA 2ZL1B 1AXBA 4E3NA 1ALQA 5EVEA 1H8YA 3G2YA 1W8QA 4EBPA 3S7NA 3T4OA 4BL3A 2WKEA 1FCMA 1G6OA 4E6WA 1OTAA 1CI8A 4X69A 3ZDJA 1H8MA 5HAQA 2ZBBA 2V1BA 3ULFA 1WYCA 4OQ0A 1YM1A 1TS8A 2ZQ9A 2YKFA 5KMWA 4UHUA 3ITAA 3UB6A 5TFQA 1ODVA 5J3WA 1MY8A 2NUPC 2XA7S 2M1CA 5CRFA 3LO7A 4WZ4A 5HDCA 3W4QA 1K57C 3IX8A 3CWFA 2OAP1 2L1MA 4NXBA 1PIOA 3OPLA 1W63M 2EWWA 2J9PA 2BLSA 3BY9A 4MLLA 1BUEA 3IF6A 5F69A 2B02A 4Q0JA 1TD5A 1PRQA 1ZG4A 2PD8A 3BFCA 3NULA 1VQQA 3FV7A 2Y79A 1FR1A 3H7WA 1YKDA 3VP0A 1L0EA 3O88A 3HJIA 5DKKA 3MXQA 2VGJA 1DY6A 1KVMA 1LL9A 4EQIA 1TDLA 5EOEA 4X68A 5L09A 2KDKA 2I72A 4FTXA 4YINA 4II7A 2HP9A 5JYOA 4LV2A 3GQZA 4HI4A 2BTFP 4Q0IA 4GD8A 3UE0A 3FZCA 4Y2FA 5HZHA 4OKPA 5HSQA 2QZ6A 1CQAA 2WKPA 4FH2A 5LBRA 1EROA 4R4SA 3QP6A 4MN7A 4WL9A 4CLCD 4U0TA 2VV6A 2VKSA 4MDZA 3DTIA 4RA7A 5FQ9A 4HQAA 2ZMVA 3DWKA 3EQVA 4QY5A 3IF6B 4F3LA 3BFFA 2V0WA 1N9NA 2ZJ9A 4LENA 1T1AA 5E2FA 4DXBA 2B18A 4MBKA 3C7VA 2Y2KA 2WAFA 1K54C 3IX3A 4IEDA 2V8CA 1KGGA 4H6JA 1LL5A 4LRXC 1EI5A 4GDBA 3H7WB 5F83A 4DE2A 4PM5A 1ERMA 1ZHHB 1Z6FA 2O0YA 5G4YA 2W1TA 1NLZA 2A2LA 3ICYA 4WUJA 5TBMA 3PBSA 4EBNA 2DRWA 3WS4A 1KE4A 1LI0A 2H0TA 4E3OA 1E3UD 4L9EA 1IYPA 4XXRA 5EVLA 3NHQA 1OTDA 1V9ZA 1IKGA 1I2SA 4B9OA 1YSQA 2DNSA 5FATA 4LRZE 1PW8A 1OTEA 2ZQDA 5AQ9A
chains in the Genus database with same CATH topology
3CI6A 4CLCA 4YNRA 4JGRA 1LL8A 2P7JA 4EXOA 4MN5A 3LR5A 1JNUA 4WF0A 4CLCE 1TS6A 3OBFA 2KX6A 2PR6A 2OOLA 4DMZA 3UE3A 4HJ3A 4HH2A 3PBTA 3EWKA 3PBQA 5TJJA 2QJ5A 2W3FA 4LRYC 3R7WB 1XFNA 3VOLA 2QWSA 3C2WA 3LYXA 3R4KA 5HWVA 1P9WA 3MQOA 4GJ4A 2KOIA 4M4XA 1VB6A 2QJ7A 4EQ1A 3H82A 3H9WA 4ZRRA 1XJ2A 3TRCA 2NUTC 3UMDA 1LSXA 2VGLM 4LPZA 4BBUA 5F5YA 3NOPC 3P01A 2JN7A 5F68A 1D06A 1ZTUA 4F3LB 1OT9A 4P6ZS 1G28A 4YOFA 2OWJA 3T4SA 1TS0A 4G3KA 1P0ZA 3IBJA 3PXPA 2VA0A 4RQ9A 4IJGA 3LICA 3LIDA 4H6JB 3U2AA 3B47A 5F6AA 2BASA 4JGPA 3KSIA 3PYPA 4G3WA 3LI9A 3O5YA 3CAXA 4GCZA 2INWA 4MN6A 4JGQA 4L0LA 3RH8B 3G6OA 2W3GA 4HJ4A 4LLOB 2W1TB 3EOIA 4O01A 4XT2A 3P7NA 4I38A 2KLIA 3A0RA 5TBMB 1V9YA 3B33A 3GDIA 2W1RA 1GSVA 2PDRA 1P97A 3UB8A 1MKMA 2W3HA 2I9VA 3LFVA 1Y28A 4UQIM 3KSFA 2QHKA 1S66L 4PAUA 1OJGA 2K2NA 3EEAA 3HJKA 3TJZC 2MJ6A 5MC7A 1BYWA 4WN5A 2HGVA 3F1PB 4WLAA 1S1ZA 3T4LA 3NJAA 5J4EA 3LR4A 2K31A 3D3OA 1OJ5A 3OC2A 2DMWA 4CLCB 2J3TD 5EFWA 4NXEA 4IUHA 2O9CA 2W0NA 2HJ9C 3SW1A 5L8MA 4ETXA 2VEAA 2M7UA 3RFBA 1VHMA 4E04A 2VGLS 3LIAA 1OTIA 2XROA 2XRNA 4EETB 1YAXA 5DJUA 5FL3A 2M7VA 1WA9A 4IHQA 3JVUA 1T1BA 3S7OA 4KUKA 1P9RA 1XJ4A 2PYRA 3H82B 3RTYA 3KX0X 5HD5A 3F1OA 2FH5A 5AJGA 2OAQ1 1NLYA 3MF0A 3MMHA 4UEYA 3NOTC 4NXFA 1LT0A 2ZMFA 3F1NA 2VZWA 3MFXA 3MQ0A 4ARZA 3B42A 1D7EA 4R3AA 4WEKA 1S1YA 4BMWA 5KSHA 4NKPA 1DP8A 2VJWA 3BWLA 2JKTI 3S7QA 3C8CA 4MCWA 1OPXA 1S4RA 2K7SA 4PHTA 4UQIS 4Y3IA 4HIAA 5HD3A 3W2ZA 3ZYTA 4DJ3A 3A0SA 2J3TC 1F5MA 2JKTM 4XT2B 2Y8HA 4I3JA 4EU0A 2J3WA 1EW0A 5DJTA 5DFYA 1YSPA 4HP4A 3PBNA 4YWZA 3T4TA 2V0UA 2V1AA 2HV1A 4O8GA 4G3VA 4GLQA 5HPIA 4HNBA 5HL6A 2D01A 2Z6CA 4EUVA 3LIEA 4NXGA 4O0PA 5AVFA 2PR5A 4ME4A 3JVVA 4Z1WA 2HJEA 2XA7M 2VLGA 5HPFA 3E98A 4BJPA 3FG8A 5I5LA 1DP9A 5KIZA 2A24A 3KSHA 2JHEA 3LIBA 4KQOA 5C5KA 3E0YA 3T4JA 3ZQ5A 3BJNA 5HDSA 4Q0HA 2CMNA 3K3DA 4EERA 1F98A 4WEJA 4EW7A 4MMNA 2L4RA 4DN0A 3K3CA 4PKYA 1GSWA 4IUKA 1NWZA 2P08A 3OLOA 3T4QA 2P04A 4EESA 3LR0A 1T18A 3FPVA 3K2NA 4QPRA 3OCNA 3PBRA 3IBRA 3IS2A 3KYQA 1F9IA 3F1OB 4FSFA 3UB7A 2VV8A 4GW9A 3S7NA 1LSVA 1MC0A 3T4OA 4B93A 3LI8A 3T4KA 3F1NB 4ARZB 5HWWA 2R78A 4HHDA 3CUEC 3HCYA 1G6OA 3KO6A 2W3DA 1OTAA 2O9BA 3UMEA 4CQHA 3TE8A 4FOFA 1H8MA 2ZBBA 2V1BA 3ULFA 1TS8A 2YKFA 4KUOA 2VX8A 3CUEA 3UB6A 2WKRA 1ODVA 5J3WA 2O9AA 3T50A 4ETZA 2NUPC 1UWNX 2XA7S 3LUQA 4AFIA 2M1CA 1S67L 5HDCA 3CWFA 1TS7A 2PYPA 2OAP1 2L1MA 4NXBA 2D02A 4I39A 1W63M 2EWWA 3BY9A 3S7PA 4OOMA 4PKYG 5F69A 5DKLA 2B02A 5A8BA 4Q0JA 1TD5A 2GJ3A 5K5BA 2GNXA 3EQUA 5HWTA 3VV4A 3BQAA 2PD8A 2A24B 3GECA 1UWPX 4GS9A 2Y79A 1TF1A 1GSXA 3C38A 5IT5A 3H7WA 2LB9A 1YKDA 4I3AA 4I5SA 3BW6A 1OTBA 4K08A 4HH3A 1XFQA 4BBVA 2L0WA 3UB9A 4NEED 1XJ3A 1T19A 3HJIA 5DKKA 3MXQA 4JGOA 3PR6A 4HY8A 2Z6DA 3E4OA 2O99A 3OCLA 2YKHA 3IS2B 1OT6A 3DBAA 3KYZA 3LIFA 1KOUA 1NRJA 4R70A 2KDKA 2HF6A 5HDDA 4II7A 1X0OA 1DRMA 2J80A 4EEUA 1T1CA 4DJ2A 3NOUC 3LR3A 4GHIA 5CX7A 5G4ZA 3C30A 4HI4A 2OWHA 4Q0IA 3VE4A 4Y2FA 2JKRI 3A0VA 3MQQA 4L9GA 5HZHA 2GX5A 5HSQA 2WKPA 5LBRA 4HJ6A 5DF9A 3OOVA 2LB5A 1W63Q 4MN7A 2JKRM 1N9LA 4WL9A 3R7WA 4CLCD 1UGUA 2WKQA 2VV6A 2PHYA 5J7EA 2VKSA 3D72A 3EGXC 3KSGA 4MDZA 3TW8A 5DFXA 4HQAA 2ZMVA 3EQVA 3FPWA 4WELA 3MR0A 4F3LA 1STZA 2V0WA 5IU1A 1N9NA 4EEPA 1T1AA 2EA9A 2B18A 3CLOA 5IS1A 4R6LA 2GZAA 4GS9B 1IFQA 2ZOIA 2W27A 4H6JA 4LRXC 3BY8A 4BBTA 3H7WB 1IOUA 1ZHHB 4P6ZM 4L9FA 3UE6A 2ZOHA 1H3QA 2O0YA 5G4YA 3MJQA 4KQDA 4BWIA 2G7UA 2W1TA 2V9AA 1DP6A 1NLZA 3V67A 2A2LA 3ICYA 2FZ0A 5AVEA 2PT7A 4WUJA 5TBMA 3EEHA 3PBSA 4I3IA 2EWVA 3BQ8A 4R38A 2QKPA 3E4QA 1MZUA 3PBOA 1S4SA 4CLCC 4L9EA 4Y5FA 3NHQA 1OTDA 1V9ZA 3VE3A 1N9OA 2XSSA 4HP9A 3EGDC 3E4PA 4B9OA 1YSQA 2W3EA 3F1PA 1XJ6A 2IA2A 2VV7A 3CITA 4LRZE 3FC7A 4GHIB 2H28A 1OTEA 4HOIA 2QYBA 3PHYA 1LSWA 4OOLA 2PD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JGR A;  1LL8 A;  2P7J A;  4EXO A;  4MN5 A;  1JNU A;  4WF0 A;  1TS6 A;  2KX6 A;  2PR6 A;  2OOL A;  4HJ3 A;  4HH2 A;  3EWK A;  2QJ5 A;  4LRY C;  1XFN A;  3VOL A;  2QWS A;  3C2W A;  3LYX A;  5HWV A;  3MQO A;  4M4X A;  1VB6 A;  2QJ7 A;  4EQ1 A;  3H82 A;  3H9W A;  1XJ2 A;  3UMD A;  1LSX A;  4BBU A;  4LPZ A;  5F5Y A;  3NOP C;  2JN7 A;  5F68 A;  1D06 A;  4F3L B;  1OT9 A;  1G28 A;  2OWJ A;  1TS0 A;  1P0Z A;  4RQ9 A;  3LIC A;  3LID A;  4H6J B;  5F6A A;  2BAS A;  4JGP A;  3PYP A;  3LI9 A;  3CAX A;  4GCZ A;  2INW A;  4MN6 A;  4JGQ A;  3RH8 B;  3G6O A;  4HJ4 A;  4LLO B;  4XT2 A;  3P7N A;  4I38 A;  3A0R A;  5TBM B;  1V9Y A;  3B33 A;  3GDI A;  1GSV A;  2PDR A;  1P97 A;  3UB8 A;  2I9V A;  1Y28 A;  2QHK A;  1S66 L;  1OJG A;  3HJK A;  1BYW A;  4WN5 A;  4WLA A;  3F1P B;  1S1Z A;  3NJA A;  5J4E A;  1OJ5 A;  5EFW A;  4NXE A;  2W0N A;  3SW1 A;  2VEA A;  4E04 A;  3LIA A;  1OTI A;  4EET B;  5DJU A;  1WA9 A;  1T1B A;  4KUK A;  1XJ4 A;  2PYR A;  3H82 B;  3RTY A;  3KX0 X;  5HD5 A;  3F1O A;  3NOT C;  4NXF A;  1LT0 A;  3F1N A;  3MFX A;  1D7E A;  4R3A A;  1S1Y A;  1DP8 A;  3BWL A;  3C8C A;  1S4R A;  2K7S A;  4HIA A;  5HD3 A;  4DJ3 A;  3A0S A;  4XT2 B;  4I3J A;  1EW0 A;  5DJT A;  4HP4 A;  4YWZ A;  2V0U A;  2V1A A;  2HV1 A;  4HNB A;  2D01 A;  2Z6C A;  3LIE A;  4NXG A;  5AVF A;  2PR5 A;  2VLG A;  3FG8 A;  5I5L A;  1DP9 A;  5KIZ A;  2A24 A;  3LIB A;  2JHE A;  3ZQ5 A;  5HDS A;  2CMN A;  3K3D A;  4EER A;  1F98 A;  4EW7 A;  2L4R A;  3K3C A;  4PKY A;  1GSW A;  1NWZ A;  3OLO A;  4EES A;  1T18 A;  3IBR A;  3IS2 A;  1F9I A;  3F1O B;  3UB7 A;  2VV8 A;  4GW9 A;  1LSV A;  3LI8 A;  3F1N B;  5HWW A;  2R78 A;  4HHD A;  1OTA A;  3UME A;  2ZBB A;  2V1B A;  3ULF A;  1TS8 A;  2YKF A;  4KUO A;  3UB6 A;  2WKR A;  1ODV A;  5J3W A;  3T50 A;  1UWN X;  3LUQ A;  2M1C A;  1S67 L;  5HDC A;  3CWF A;  1TS7 A;  2PYP A;  2L1M A;  4NXB A;  2D02 A;  4I39 A;  3BY9 A;  5F69 A;  4PKY G;  5A8B A;  5DKL A;  2B02 A;  2GJ3 A;  5HWT A;  2PD8 A;  2A24 B;  3GEC A;  1UWP X;  4GS9 A;  1GSX A;  3H7W A;  4I3A A;  4I5S A;  1OTB A;  4K08 A;  4HH3 A;  1XFQ A;  4BBV A;  2L0W A;  3UB9 A;  1XJ3 A;  1T19 A;  3HJI A;  5DKK A;  3MXQ A;  4JGO A;  4HY8 A;  2Z6D A;  3E4O A;  2YKH A;  3IS2 B;  1OT6 A;  3LIF A;  1KOU A;  4R70 A;  2KDK A;  5HDD A;  1X0O A;  1DRM A;  2J80 A;  4EEU A;  1T1C A;  4DJ2 A;  3NOU C;  4GHI A;  5G4Z A;  4HI4 A;  2OWH A;  3VE4 A;  3A0V A;  3MQQ A;  4L9G A;  5HZH A;  5HSQ A;  2WKP A;  4HJ6 A;  4WL9 A;  1N9L A;  1UGU A;  2WKQ A;  2VV6 A;  2PHY A;  5J7E A;  3D72 A;  4HQA A;  3MR0 A;  4F3L A;  2V0W A;  5IU1 A;  1N9N A;  4EEP A;  1T1A A;  2EA9 A;  3CLO A;  5IS1 A;  4R6L A;  4GS9 B;  2ZOI A;  2W27 A;  4H6J A;  4LRX C;  3BY8 A;  4BBT A;  3H7W B;  4L9F A;  3UE6 A;  2ZOH A;  5G4Y A;  3MJQ A;  4KQD A;  2V9A A;  1DP6 A;  3ICY A;  5AVE A;  4WUJ A;  5TBM A;  3EEH A;  4I3I A;  4R38 A;  2QKP A;  3E4Q A;  1MZU A;  1S4S A;  4L9E A;  3NHQ A;  1OTD A;  1V9Z A;  3VE3 A;  1N9O A;  4HP9 A;  3E4P A;  4B9O A;  3F1P A;  1XJ6 A;  2VV7 A;  4LRZ E;  3FC7 A;  4GHI B;  2H28 A;  1OTE A;  4HOI A;  3PHY A;  1LSW A;  2PD7 A; 
#chains in the Genus database with same CATH topology
 4GN2 A;  4BEN A;  1N9B A;  3CI6 A;  2J9O A;  3G32 A;  3N7W A;  1LL8 A;  2P7J A;  3LR5 A;  1JNU A;  1TS6 A;  3NDG A;  1K4E A;  1RGY A;  3ZNY A;  4N9K A;  2ZMA A;  2QJ5 A;  5M1A A;  4E3L A;  3Q7Z A;  2ZC3 B;  1XXM A;  1P9W A;  4GJ4 A;  3IT9 A;  1YLW A;  3KYE A;  1MWR A;  3VSL A;  1XX2 A;  4ZDX A;  1XJ2 A;  5E43 A;  2NUT C;  1LSX A;  2VGL M;  2WAE A;  4BBU A;  4HBT A;  2JN7 A;  5F68 A;  1D06 A;  1ZTU A;  4F3L B;  2XGN A;  4S2N C;  4U3T A;  3T4S A;  4C6Y A;  1K0K A;  3PXP A;  3UE1 A;  2VA0 A;  3Q81 A;  4IJG A;  4H6J B;  3U2A A;  2ZC4 B;  4KQQ A;  3B47 A;  2BAS A;  1K56 D;  3LI9 A;  4O7D A;  3VMA A;  3VP2 A;  4HJ4 A;  2W1T B;  4O01 A;  4I38 A;  3LY3 A;  2WKI A;  5TBM B;  1V9Y A;  4KZ4 A;  1GSV A;  3IX4 A;  5EEC A;  2Y2O A;  1Y28 A;  4OQI A;  5HL1 A;  1BZA A;  2Y2M A;  3EEA A;  4DDS A;  3TJZ C;  1BYW A;  2QMI A;  1KGF A;  4JF5 A;  3TG9 A;  2EX2 A;  1OJ5 A;  2P74 A;  3OC2 A;  4XUZ A;  2J3T D;  3UPN A;  4OPR A;  4E6X A;  4CJN A;  1NXY A;  4KG2 A;  3GR2 A;  4C3Q A;  3V3S A;  2M7U A;  4ZBE A;  1VHM A;  5DVA A;  3LIA A;  3O86 A;  4JXW A;  1OTI A;  4LV1 A;  4CPK A;  3ZVT A;  1T1B A;  5DTK A;  2X71 A;  3E2L A;  1K25 A;  3RTY A;  1QMF A;  3F1O A;  5AJG A;  4MEZ A;  3HVF A;  1LT0 A;  3F1N A;  4ARZ A;  5FEF A;  1JTG A;  1XA1 A;  5JYP A;  3N4I A;  4WEK A;  1S1Y A;  4YFM A;  1DP8 A;  2VJW A;  3S7Q A;  3C8C A;  1OPX A;  2K7S A;  1K6S A;  4UQI S;  1YLY A;  5KSC A;  3MXS A;  2Y2G A;  4EU0 A;  5CEB A;  5DFY A;  1YSP A;  2IWB A;  4YWZ A;  4ZAM A;  4S2L A;  4O8G A;  4B4X A;  3MZE A;  4UAA A;  1FIL A;  1QME A;  1SCW A;  3QP2 A;  3S4X A;  1PYY A;  1LLB A;  5D3O A;  3JVV A;  2HJE A;  2XA7 M;  4WBG A;  3E98 A;  1J3W A;  5G18 A;  2A24 A;  3DAV A;  2OLV A;  3D9Y A;  2V2F F;  3E0Y A;  5CTM A;  4Q8I A;  1Y54 A;  3BJN A;  1SZV A;  2CMN A;  3ZNT A;  4WEJ A;  1K6R A;  4DN0 A;  2IWD A;  1N4O A;  1ES5 A;  3BEB A;  4IUK A;  2P08 A;  3OLO A;  4Y15 A;  3HUM A;  2EX8 A;  1ES2 A;  4S2J A;  3FPV A;  3UB5 P;  3T1R A;  3PBR A;  3O87 A;  3IS2 A;  3F1O B;  3WRT A;  4JKT A;  1XKZ A;  4B93 A;  3LI8 A;  3F1N B;  4ARZ B;  5HWW A;  1LI9 A;  2R78 A;  1HTZ A;  3HCY A;  5HW3 A;  4UA6 A;  1GHP A;  4LFU A;  4WYY A;  2O9B A;  4P85 A;  1BTL A;  1CEG A;  4R1G A;  3DWZ A;  5GLA A;  2IWC A;  2Y2H A;  4KZ6 A;  3CUE A;  4LV0 A;  1UWN X;  3SS5 A;  5FDH A;  4ID4 A;  1TS7 A;  5FAP A;  2D02 A;  4I39 A;  4QU3 A;  3DTK A;  3C4P A;  4PKY G;  3VP3 A;  5A8B A;  2XR0 A;  3BQA A;  4IVI A;  2A24 B;  1UWP X;  1PWD A;  2JC7 A;  3G4P A;  4Y7P A;  1KDS A;  1YMS A;  1GSX A;  4DF6 A;  3ZG9 B;  4JPM A;  3FWL A;  5E2H A;  1F2K A;  4K08 A;  1KE0 A;  4BBV A;  4KZ9 A;  4Y0T A;  5L2F A;  3LGO A;  3UB9 A;  4NEE D;  4JGO A;  3PR6 A;  4HY8 A;  1IYO A;  2Y2L A;  1M6K A;  3E4O A;  3PAE A;  3IS2 B;  1OT6 A;  1PFL A;  3DBA A;  3HL9 A;  4PPR A;  1NRJ A;  3WRZ A;  1RP5 A;  5HDD A;  2JBF A;  2B5R A;  1DRM A;  4R23 A;  4DE0 A;  1J9M A;  2J80 A;  5CGW A;  1K55 C;  3BRM A;  2ZC6 B;  3UPP A;  4DJ2 A;  3LR3 A;  4GHI A;  2XD1 A;  3BLS A;  4X55 A;  3C30 A;  4S2O A;  2WGV A;  1BLS A;  1S6R A;  3VE4 A;  2GX5 A;  3N8L A;  2PU4 A;  2LB5 A;  1N9L A;  1ONG A;  2PHY A;  4BD1 A;  1ESI A;  1KDW A;  1L0D A;  5DFX A;  3HUO A;  1L3L A;  4OH0 A;  3ZG0 A;  4P6B A;  2ZC7 A;  4WEL A;  3HLF A;  3MR0 A;  2XFT A;  2Z2M B;  2VGK A;  5HAR A;  4ZJ2 A;  3CLO A;  1IFQ A;  5FAQ A;  1ONH A;  3GRJ A;  4BBT A;  4BD0 A;  3HBR A;  2OLU A;  3QP8 A;  1Q2Q A;  1ZKJ A;  3IF5 A;  2HP6 A;  2ZOH A;  4L9F A;  4QHC A;  3MJQ A;  4KQD A;  4BWI A;  2G7U A;  2V9A A;  1FQG A;  3V67 A;  3WS2 A;  1Z09 A;  4I3I A;  5DTT A;  1NZU A;  3E4Q A;  1MZU A;  5EUA A;  3ZGA B;  4ESP A;  1PW1 A;  3FKW A;  2EX9 A;  1N9O A;  4HP9 A;  1BLC A;  1ACF A;  5EVI A;  1XGI A;  5AQ7 A;  2WZX A;  3IQA A;  4WZ5 C;  1HVB A;  2VV7 A;  3CIT A;  1CI9 A;  3FC7 A;  4GHI B;  2PD7 A;  1G6A A;  4MN5 A;  4S2K A;  1W8Y A;  4BQM A;  2KX6 A;  4KZ5 A;  3A3D A;  1U60 A;  4DMZ A;  1L0F A;  3PBT A;  5DTS A;  5TJJ A;  2W3F A;  4LRY C;  1XFN A;  2QWS A;  3R4K A;  3SH8 A;  1XA7 A;  3DTE A;  4EQ1 A;  3H82 A;  3MKF A;  4LV3 A;  3UMD A;  5F5Y A;  1D1J A;  1MWS A;  4GNU A;  3IWQ A;  1MWT A;  5EPH A;  4RQ9 A;  3LIC A;  3L7H A;  3VSK A;  3BM6 A;  3V39 A;  4JGP A;  3PYP A;  3CAX A;  4GCZ A;  3CPT A;  5HX9 A;  4WMC D;  1KVL A;  2W3G A;  4LLO B;  1EWZ A;  2EFU A;  4LGW A;  3S22 A;  3MBZ A;  3JYI A;  1H8Z A;  3B33 A;  2PDR A;  1P97 A;  1MKM A;  1YLP A;  4UQI M;  3KSF A;  4PAU A;  4S2P A;  4FUW A;  2MJ6 A;  4FH4 A;  5EVI B;  4N92 A;  2HGV A;  1JTD A;  3IH9 A;  2K31 A;  3A3E A;  2O9C A;  1MXO A;  2VEA A;  2XD5 A;  4ZJ1 A;  1VEU A;  4BL2 A;  3MSH A;  3LEZ A;  3SOI A;  3M2J A;  5FL3 A;  1H5X A;  4RVA A;  2Y2P A;  5A92 A;  5FI6 A;  3S7O A;  5FI2 A;  3HLW A;  2PYR A;  4QY6 A;  3H82 B;  5FDS A;  3KX0 X;  3QHY A;  5HD5 A;  1ESU A;  2FH5 A;  3MF0 A;  3NOT C;  4NXF A;  3B42 A;  4OLD A;  2EXB A;  1GCE A;  4R3A A;  1OME A;  3QP4 A;  3A3F A;  5KSH A;  3I7J A;  2XF3 A;  5GHX A;  5J8X A;  2JCH A;  3CPT B;  2XEP A;  4HIA A;  5HD3 A;  4DJ3 A;  1F5M A;  2J3W A;  5DJT A;  2Y4A A;  4HP4 A;  5EM1 A;  1VET A;  3S1Y A;  2HV1 A;  4G3V A;  4OPY A;  4JLF A;  2PBD P;  2D01 A;  5M18 A;  3W4O A;  2Y2J A;  4ME4 A;  1IEM A;  3UDX A;  2VLG A;  4S2M A;  1ZC2 A;  5HPF A;  2ZLY A;  2XQZ A;  4RX2 A;  3ZCZ A;  2WZZ A;  4IVK A;  1O7E A;  2HDR A;  3ZQ5 A;  4DKI A;  4E3M A;  3GSG A;  4Q0H A;  2Q9M A;  3K3D A;  4MMN A;  2L4R A;  4PKY A;  1GSW A;  1VEU B;  3T4Q A;  1Y4O A;  3UNW A;  1T18 A;  3IXB A;  3IWI A;  3K2N A;  1GHM A;  4PM9 A;  4QPR A;  4B4Z A;  2RCX A;  2UWX A;  3BYD A;  1F9I A;  4FSF A;  4GB7 A;  1LSV A;  3SZT A;  2HPB A;  3T4K A;  1NYY A;  3CUE C;  3KO6 A;  5KZH A;  1YLT A;  2V1Z A;  3GMW A;  1JVJ A;  4HEF A;  3TE8 A;  4KZ3 A;  4EUZ A;  4FOF A;  4R0Q A;  2E8J A;  5HAI A;  3HLD A;  2FFF B;  5A91 A;  4KUO A;  5FQQ A;  1W5D A;  1CEF A;  3HLB A;  4ETZ A;  3G35 A;  4A5R A;  2C5W B;  4DE1 A;  1VET B;  4OVD A;  4AFI A;  2J7V A;  4JBF A;  2PYP A;  1K54 A;  1PI5 A;  2ZQ8 A;  3OPP A;  4BLM A;  2ACG A;  1Q2P A;  4OOM A;  5DKL A;  2GJ3 A;  5K5B A;  2GNX A;  3IHB A;  4Y0O A;  1TF1 A;  1GHI A;  5IT5 A;  1FSW A;  1SKO A;  3ISG A;  4I5S A;  3BW6 A;  1OTB A;  4HH3 A;  1XFQ A;  1PWG A;  3NI9 A;  3ZG5 A;  1YLJ A;  2ZM2 A;  2Z6D A;  5FAS A;  3OCL A;  3KYZ A;  2ZD8 A;  3MXR A;  4NET A;  1HLU P;  2X02 A;  3ZG7 B;  3T1X A;  2WUQ A;  4JF4 A;  3C7U A;  3C4O A;  4R3J A;  2EX6 A;  5CX7 A;  2C6W B;  5G4Z A;  3WS5 A;  1FIK A;  2H0Y A;  5CHU A;  5FQK A;  3TSG A;  4EBL A;  3VOZ A;  2JKR I;  3MQQ A;  4L9G A;  2R9W A;  3O3V A;  4H8R A;  4F94 A;  2A3U A;  4RX3 A;  3N6I A;  1E25 A;  3VOY A;  5F1F A;  3OOV A;  1W63 Q;  2JKR M;  3R7W A;  1UGU A;  4S2N A;  4OLG A;  2WGW A;  3C5A A;  3D72 A;  5EOO A;  3KSG A;  4PM8 A;  4E3K A;  3Q1F A;  1JWZ A;  1NJ4 A;  3CG5 A;  1STZ A;  5IU1 A;  4D2O A;  4EEP A;  3IH8 A;  3CMZ A;  5IS1 A;  5CED A;  5IHV A;  2Y59 A;  5GLC A;  5E2G A;  1VM1 A;  1SKO B;  1IOU A;  3IF6 C;  3OPR A;  1H3Q A;  3N8S A;  1GA0 A;  5FEG A;  5EVI C;  4LCM A;  4C75 A;  2FZ0 A;  5AVE A;  3W8K A;  1K4F A;  1JWP A;  3CJM A;  4HBU A;  3EEH A;  2EWV A;  1HZO A;  4OP8 A;  3D4F A;  5DF8 A;  1FCO A;  1G68 A;  3VE3 A;  2XSS A;  3EGD C;  1CK3 A;  2EXA A;  5HAP A;  3L9K A;  2W3E A;  4GDN A;  1ERQ A;  4X56 A;  2H28 A;  4WMC A;  3PHY A;  4OOL A;  5E2E A;  1ZG6 A;  4KZA A;  2RL3 A;  4CLC A;  3FKV A;  4CLC E;  3HLG A;  3OBF A;  3UDF A;  3MKE A;  3QNB A;  2OOL A;  4K0W A;  4HJ3 A;  3IWO A;  4GKU A;  3EWK A;  3VP4 A;  3PBQ A;  2PAV P;  4JXG A;  3NCK A;  2XLN A;  3R7W B;  3VOL A;  3U4L P;  2WGW B;  3LYX A;  3MQO A;  3UPO A;  5DF7 A;  2HZ5 A;  1DJB A;  3H9W A;  4ZRR A;  3TRC A;  2Z2L B;  4KZ7 A;  1NZO A;  4UA7 A;  2JKF A;  5U47 A;  2ZM0 A;  1OT9 A;  4P6Z S;  1BT5 A;  4D60 A;  4YOF A;  1FOF A;  4G3K A;  1ES4 A;  5A93 A;  2G2W A;  2WYX A;  2Y2N A;  3LID A;  1BSG A;  4K0X A;  5I94 A;  3KSI A;  4G3W A;  5FSR A;  2INW A;  4OPZ A;  1DJC A;  4MN6 A;  4JGQ A;  4L0L A;  3RH8 B;  3G6O A;  1E3U A;  3SH7 A;  3RXW A;  4XT2 A;  3V50 A;  3A0R A;  1KE3 A;  4X1L A;  1FSY A;  4IBR A;  1PZP A;  2W1R A;  3DW0 A;  3P09 A;  2W3H A;  3LFV A;  3QP5 A;  1S66 L;  4OON A;  4QB8 A;  1OJG A;  2K2N A;  5M19 A;  5L07 A;  3ZFZ A;  1YQS A;  4WN5 A;  4WLA A;  1S1Z A;  3MZF A;  3ZVW A;  5CHJ A;  3NJA A;  1CF0 A;  3LR4 A;  2V20 A;  4CLC B;  4P87 A;  4WM9 A;  5EFW A;  4NXE A;  3Q07 A;  3SW1 A;  4ETX A;  3WS0 A;  4DDY A;  4E04 A;  1DJA A;  2CC1 A;  4XUX A;  2ZQ7 A;  1YAX A;  3BFE A;  3UDI A;  1WA9 A;  4IHQ A;  2QPN A;  4KG5 A;  1L2S A;  1XJ4 A;  4FD8 A;  4KG6 A;  1W79 A;  4OP5 A;  1K56 A;  3MMH A;  4UEY A;  3GV9 A;  2VZW A;  3MQ0 A;  2WGI A;  2XFS A;  1D7E A;  4KQR A;  3PTE A;  5F1G A;  4EV4 A;  3BWL A;  5FAO A;  2JKT I;  4EWF A;  4UA9 A;  2FFY A;  3RXX A;  4NK3 A;  4Y3I A;  3NIA A;  3ZYT A;  1I2W A;  2JKT M;  4XT2 B;  2Y8H A;  3W4P A;  3T1Q B;  2V0U A;  5F82 A;  2V1A A;  1XGJ A;  3BLM A;  5HPI A;  3V5M A;  3NDE A;  5HL6 A;  1S0W A;  2PBY A;  4HES A;  2ZQC A;  3LIE A;  4NXG A;  1G5U A;  4O0P A;  5AVF A;  3AGE A;  5CXW A;  1TVF A;  2AVX A;  3FG8 A;  1DP9 A;  5KIZ A;  3KSH A;  2JHE A;  4KQO A;  4DE3 A;  1L0G A;  4DXC A;  3T1S A;  3PAG A;  4OQG A;  4Y0U A;  4PM6 A;  5FQM A;  5EV0 A;  5GL9 A;  1PI4 A;  1NWZ A;  3SS4 A;  2HDS A;  2P04 A;  1NRF A;  4EES A;  3LR0 A;  3ZG8 B;  3CZD A;  4OPQ A;  1K55 A;  3OCN A;  5TGF A;  3KYQ A;  1MKI A;  3IBR A;  5FA7 A;  3UB7 A;  2VV8 A;  4GW9 A;  1MC0 A;  3WWX A;  1CJF A;  2E8I A;  3VFH A;  4HHD A;  3G34 A;  2WKH A;  2W3D A;  3BFG A;  3UME A;  4CQH A;  2HDQ A;  2V8F A;  3IXD A;  4X6T A;  3A3J A;  2ZQA A;  4K91 A;  3NC8 A;  2VX8 A;  2WKR A;  2O9A A;  3T50 A;  4NG2 A;  1O07 A;  3LUQ A;  4ZTK A;  1S67 L;  1SDE A;  3V3R A;  1RGZ A;  3GVB A;  2Q9N A;  2B95 A;  3M2K A;  4Y13 A;  2GDN A;  3S7P A;  3T12 B;  3EQU A;  3BEC A;  5HWT A;  3VV4 A;  5AQA A;  3GEC A;  1YLZ A;  4OOY A;  4GS9 A;  1K57 A;  1IYQ A;  3C38 A;  2P9V A;  3ITB A;  3DTM A;  3M6B A;  2LB9 A;  4I3A A;  2Y91 A;  3GTC A;  2L0W A;  4DRT A;  1XJ3 A;  4S2I A;  1T19 A;  4WZ5 A;  5FI7 A;  2O99 A;  3AGD A;  2YKH A;  2PU2 A;  3UO9 A;  3LIF A;  5CER A;  1KOU A;  4R70 A;  2HF6 A;  2OSU A;  1X0O A;  2HP5 A;  4EEU A;  1T1C A;  3G2Z A;  3NOU C;  1BUL A;  1LHY A;  2OWH A;  3HLE A;  5EVI D;  1XPB A;  4N1X A;  3A0V A;  1M40 A;  3BFD A;  4HJ6 A;  2UV0 E;  5DF9 A;  1ES3 A;  2H10 A;  2VK3 A;  2ZC5 B;  2WKQ A;  1A0K A;  5J7E A;  5GHY A;  3VFF A;  1PWC A;  3EGX C;  1GA9 A;  3TW8 A;  3WS1 A;  3FPW A;  1RCJ A;  3IHA A;  4MBF A;  2EA9 A;  4QD4 A;  1E4D A;  4R6L A;  2GZA A;  4GS9 B;  3G30 A;  3QNC A;  2ZOI A;  2W27 A;  3VP1 A;  4GD6 A;  2P9V B;  3BY8 A;  1HD8 A;  3NEC A;  4P6Z M;  3UE6 A;  2J8Y A;  3OPH A;  1DP6 A;  3NBL A;  2PT7 A;  4GOG A;  5HFO A;  3BQ8 A;  4ZJ3 A;  4R38 A;  3RJU A;  2QKP A;  3M6H A;  3PBO A;  5CTN A;  3UY6 A;  1S4S A;  4CLC C;  3SH9 A;  2Y2I A;  4Y5F A;  3JPU A;  3E4P A;  1MBL A;  3E2K A;  2EFX A;  3TOI A;  3F1P A;  1XJ6 A;  2IA2 A;  1YMX A;  4HOI A;  2QYB A;  1LSW A;  2XDM A;  2Q0O A;  4PMA A;  4YNR A;  4JGR A;  4EXO A;  5CGX A;  4WF0 A;  4M3K A;  2XH9 A;  3HLC A;  4P0M A;  4JF6 A;  2PR6 A;  5A90 A;  3UE3 A;  4KZB A;  2G2U A;  4HH2 A;  4E3I A;  3MZD A;  5FQJ A;  3MS6 A;  3HRE A;  5CGS A;  3A3I A;  3C2W A;  1K38 A;  5HWV A;  1IYS A;  2KOI A;  4M4X A;  1KGE A;  1VB6 A;  3Q7V A;  2QJ7 A;  1AWI A;  4LPZ A;  4LCL A;  2A49 A;  2R9X A;  3NOP C;  3P01 A;  4N1H A;  3NY4 A;  3Q82 A;  1G28 A;  1XP4 A;  1NY0 A;  2OWJ A;  1TS0 A;  4R4R A;  4Y17 A;  1P0Z A;  3IBJ A;  4MNR A;  1IKI A;  5CEC A;  5FQI A;  3HUN A;  5F6A A;  3O5Y A;  1YPR A;  3EOI A;  5EM0 A;  5GHZ A;  3P7N A;  4Z9Q A;  5GLD A;  2KLI A;  4GZB A;  3GDI A;  1PZO A;  4KEN B;  3UB8 A;  1WYB A;  5BOH A;  2I9V A;  3ZHH A;  2X01 A;  2QHK A;  1SDN A;  4U0X A;  4R3B A;  3HJK A;  5MC7 A;  3QP1 A;  2JKG A;  3F1P B;  3T4L A;  5J4E A;  3D3O A;  2BG1 A;  3MFD A;  4FCF A;  2DMW A;  1TDG A;  4IBX A;  4IUH A;  1TEM A;  2W0N A;  1WE4 A;  2HJ9 C;  1FR6 A;  4N9L A;  5L8M A;  2XK1 A;  3RFB A;  2VGL S;  2WK0 A;  2WAD A;  2XRO A;  2XRN A;  4QJG A;  4EET B;  5DJU A;  2M7V A;  4QWO A;  3B3X A;  3JVU A;  3UN7 A;  2ZL1 A;  3IXH A;  3Q7V B;  4X53 A;  1P9R A;  4KUK A;  4KZ8 A;  1C3B A;  3LY4 A;  2OAQ 1;  1NLY A;  2ZMF A;  3MFX A;  4RYE A;  5EE8 A;  5L10 A;  5CHM A;  1BLH A;  1YT4 A;  4BMW A;  4NKP A;  3P98 A;  4PM7 A;  4MCW A;  2OV5 A;  1I5Q A;  1S4R A;  2Y2Q A;  3G31 A;  4PHT A;  3W2Z A;  3A0S A;  2J3T C;  4I3J A;  1EW0 A;  2Y55 A;  1W7F A;  3CHW P;  3PBN A;  3T4T A;  2PRF A;  4MBH A;  1IEL A;  4X25 A;  4GLQ A;  2DCF A;  4X1M A;  4HNB A;  2Z6C A;  4EUV A;  1MPL A;  1PNE A;  3IXG A;  2PR5 A;  3LCE A;  3N8R A;  4JXS A;  1MWU A;  2H5S A;  4JXV A;  4Z1W A;  4BJP A;  1H0M A;  5I5L A;  2ZM8 A;  2HDU A;  3OZH A;  2JE5 A;  3LIB A;  1SHV A;  5C5K A;  3T4J A;  1NYM A;  5GLB A;  5TR7 A;  5AQB A;  5HDS A;  3LEQ A;  4E3J A;  3AGF A;  4EER A;  1F98 A;  4EW7 A;  3K3C A;  1BLP A;  3FYZ A;  4OQH A;  1JWV A;  4B88 A;  1FCN A;  3SS3 A;  1SKF A;  2ZL1 B;  1AXB A;  4E3N A;  1ALQ A;  5EVE A;  1H8Y A;  3G2Y A;  1W8Q A;  4EBP A;  3S7N A;  3T4O A;  4BL3 A;  2WKE A;  1FCM A;  1G6O A;  4E6W A;  1OTA A;  1CI8 A;  4X69 A;  3ZDJ A;  1H8M A;  5HAQ A;  2ZBB A;  2V1B A;  3ULF A;  1WYC A;  4OQ0 A;  1YM1 A;  1TS8 A;  2ZQ9 A;  2YKF A;  5KMW A;  4UHU A;  3ITA A;  3UB6 A;  5TFQ A;  1ODV A;  5J3W A;  1MY8 A;  2NUP C;  2XA7 S;  2M1C A;  5CRF A;  3LO7 A;  4WZ4 A;  5HDC A;  3W4Q A;  1K57 C;  3IX8 A;  3CWF A;  2OAP 1;  2L1M A;  4NXB A;  1PIO A;  3OPL A;  1W63 M;  2EWW A;  2J9P A;  2BLS A;  3BY9 A;  4MLL A;  1BUE A;  3IF6 A;  5F69 A;  2B02 A;  4Q0J A;  1TD5 A;  1PRQ A;  1ZG4 A;  2PD8 A;  3BFC A;  3NUL A;  1VQQ A;  3FV7 A;  2Y79 A;  1FR1 A;  3H7W A;  1YKD A;  3VP0 A;  1L0E A;  3O88 A;  3HJI A;  5DKK A;  3MXQ A;  2VGJ A;  1DY6 A;  1KVM A;  1LL9 A;  4EQI A;  1TDL A;  5EOE A;  4X68 A;  5L09 A;  2KDK A;  2I72 A;  4FTX A;  4YIN A;  4II7 A;  2HP9 A;  5JYO A;  4LV2 A;  3GQZ A;  4HI4 A;  2BTF P;  4Q0I A;  4GD8 A;  3UE0 A;  3FZC A;  4Y2F A;  5HZH A;  4OKP A;  5HSQ A;  2QZ6 A;  1CQA A;  2WKP A;  4FH2 A;  5LBR A;  1ERO A;  4R4S A;  3QP6 A;  4MN7 A;  4WL9 A;  4CLC D;  4U0T A;  2VV6 A;  2VKS A;  4MDZ A;  3DTI A;  4RA7 A;  5FQ9 A;  4HQA A;  2ZMV A;  3DWK A;  3EQV A;  4QY5 A;  3IF6 B;  4F3L A;  3BFF A;  2V0W A;  1N9N A;  2ZJ9 A;  4LEN A;  1T1A A;  5E2F A;  4DXB A;  2B18 A;  4MBK A;  3C7V A;  2Y2K A;  2WAF A;  1K54 C;  3IX3 A;  4IED A;  2V8C A;  1KGG A;  4H6J A;  1LL5 A;  4LRX C;  1EI5 A;  4GDB A;  3H7W B;  5F83 A;  4DE2 A;  4PM5 A;  1ERM A;  1ZHH B;  1Z6F A;  2O0Y A;  5G4Y A;  2W1T A;  1NLZ A;  2A2L A;  3ICY A;  4WUJ A;  5TBM A;  3PBS A;  4EBN A;  2DRW A;  3WS4 A;  1KE4 A;  1LI0 A;  2H0T A;  4E3O A;  1E3U D;  4L9E A;  1IYP A;  4XXR A;  5EVL A;  3NHQ A;  1OTD A;  1V9Z A;  1IKG A;  1I2S A;  4B9O A;  1YSQ A;  2DNS A;  5FAT A;  4LRZ E;  1PW8 A;  1OTE A;  2ZQD A;  5AQ9 A; 
#chains in the Genus database with same CATH homology
 3CI6 A;  4CLC A;  4YNR A;  4JGR A;  1LL8 A;  2P7J A;  4EXO A;  4MN5 A;  3LR5 A;  1JNU A;  4WF0 A;  4CLC E;  1TS6 A;  3OBF A;  2KX6 A;  2PR6 A;  2OOL A;  4DMZ A;  3UE3 A;  4HJ3 A;  4HH2 A;  3PBT A;  3EWK A;  3PBQ A;  5TJJ A;  2QJ5 A;  2W3F A;  4LRY C;  3R7W B;  1XFN A;  3VOL A;  2QWS A;  3C2W A;  3LYX A;  3R4K A;  5HWV A;  1P9W A;  3MQO A;  4GJ4 A;  2KOI A;  4M4X A;  1VB6 A;  2QJ7 A;  4EQ1 A;  3H82 A;  3H9W A;  4ZRR A;  1XJ2 A;  3TRC A;  2NUT C;  3UMD A;  1LSX A;  2VGL M;  4LPZ A;  4BBU A;  5F5Y A;  3NOP C;  3P01 A;  2JN7 A;  5F68 A;  1D06 A;  1ZTU A;  4F3L B;  1OT9 A;  4P6Z S;  1G28 A;  4YOF A;  2OWJ A;  3T4S A;  1TS0 A;  4G3K A;  1P0Z A;  3IBJ A;  3PXP A;  2VA0 A;  4RQ9 A;  4IJG A;  3LIC A;  3LID A;  4H6J B;  3U2A A;  3B47 A;  5F6A A;  2BAS A;  4JGP A;  3KSI A;  3PYP A;  4G3W A;  3LI9 A;  3O5Y A;  3CAX A;  4GCZ A;  2INW A;  4MN6 A;  4JGQ A;  4L0L A;  3RH8 B;  3G6O A;  2W3G A;  4HJ4 A;  4LLO B;  2W1T B;  3EOI A;  4O01 A;  4XT2 A;  3P7N A;  4I38 A;  2KLI A;  3A0R A;  5TBM B;  1V9Y A;  3B33 A;  3GDI A;  2W1R A;  1GSV A;  2PDR A;  1P97 A;  3UB8 A;  1MKM A;  2W3H A;  2I9V A;  3LFV A;  1Y28 A;  4UQI M;  3KSF A;  2QHK A;  1S66 L;  4PAU A;  1OJG A;  2K2N A;  3EEA A;  3HJK A;  3TJZ C;  2MJ6 A;  5MC7 A;  1BYW A;  4WN5 A;  2HGV A;  3F1P B;  4WLA A;  1S1Z A;  3T4L A;  3NJA A;  5J4E A;  3LR4 A;  2K31 A;  3D3O A;  1OJ5 A;  3OC2 A;  2DMW A;  4CLC B;  2J3T D;  5EFW A;  4NXE A;  4IUH A;  2O9C A;  2W0N A;  2HJ9 C;  3SW1 A;  5L8M A;  4ETX A;  2VEA A;  2M7U A;  3RFB A;  1VHM A;  4E04 A;  2VGL S;  3LIA A;  1OTI A;  2XRO A;  2XRN A;  4EET B;  1YAX A;  5DJU A;  5FL3 A;  2M7V A;  1WA9 A;  4IHQ A;  3JVU A;  1T1B A;  3S7O A;  4KUK A;  1P9R A;  1XJ4 A;  2PYR A;  3H82 B;  3RTY A;  3KX0 X;  5HD5 A;  3F1O A;  2FH5 A;  5AJG A;  2OAQ 1;  1NLY A;  3MF0 A;  3MMH A;  4UEY A;  3NOT C;  4NXF A;  1LT0 A;  2ZMF A;  3F1N A;  2VZW A;  3MFX A;  3MQ0 A;  4ARZ A;  3B42 A;  1D7E A;  4R3A A;  4WEK A;  1S1Y A;  4BMW A;  5KSH A;  4NKP A;  1DP8 A;  2VJW A;  3BWL A;  2JKT I;  3S7Q A;  3C8C A;  4MCW A;  1OPX A;  1S4R A;  2K7S A;  4PHT A;  4UQI S;  4Y3I A;  4HIA A;  5HD3 A;  3W2Z A;  3ZYT A;  4DJ3 A;  3A0S A;  2J3T C;  1F5M A;  2JKT M;  4XT2 B;  2Y8H A;  4I3J A;  4EU0 A;  2J3W A;  1EW0 A;  5DJT A;  5DFY A;  1YSP A;  4HP4 A;  3PBN A;  4YWZ A;  3T4T A;  2V0U A;  2V1A A;  2HV1 A;  4O8G A;  4G3V A;  4GLQ A;  5HPI A;  4HNB A;  5HL6 A;  2D01 A;  2Z6C A;  4EUV A;  3LIE A;  4NXG A;  4O0P A;  5AVF A;  2PR5 A;  4ME4 A;  3JVV A;  4Z1W A;  2HJE A;  2XA7 M;  2VLG A;  5HPF A;  3E98 A;  4BJP A;  3FG8 A;  5I5L A;  1DP9 A;  5KIZ A;  2A24 A;  3KSH A;  2JHE A;  3LIB A;  4KQO A;  5C5K A;  3E0Y A;  3T4J A;  3ZQ5 A;  3BJN A;  5HDS A;  4Q0H A;  2CMN A;  3K3D A;  4EER A;  1F98 A;  4WEJ A;  4EW7 A;  4MMN A;  2L4R A;  4DN0 A;  3K3C A;  4PKY A;  1GSW A;  4IUK A;  1NWZ A;  2P08 A;  3OLO A;  3T4Q A;  2P04 A;  4EES A;  3LR0 A;  1T18 A;  3FPV A;  3K2N A;  4QPR A;  3OCN A;  3PBR A;  3IBR A;  3IS2 A;  3KYQ A;  1F9I A;  3F1O B;  4FSF A;  3UB7 A;  2VV8 A;  4GW9 A;  3S7N A;  1LSV A;  1MC0 A;  3T4O A;  4B93 A;  3LI8 A;  3T4K A;  3F1N B;  4ARZ B;  5HWW A;  2R78 A;  4HHD A;  3CUE C;  3HCY A;  1G6O A;  3KO6 A;  2W3D A;  1OTA A;  2O9B A;  3UME A;  4CQH A;  3TE8 A;  4FOF A;  1H8M A;  2ZBB A;  2V1B A;  3ULF A;  1TS8 A;  2YKF A;  4KUO A;  2VX8 A;  3CUE A;  3UB6 A;  2WKR A;  1ODV A;  5J3W A;  2O9A A;  3T50 A;  4ETZ A;  2NUP C;  1UWN X;  2XA7 S;  3LUQ A;  4AFI A;  2M1C A;  1S67 L;  5HDC A;  3CWF A;  1TS7 A;  2PYP A;  2OAP 1;  2L1M A;  4NXB A;  2D02 A;  4I39 A;  1W63 M;  2EWW A;  3BY9 A;  3S7P A;  4OOM A;  4PKY G;  5F69 A;  5DKL A;  2B02 A;  5A8B A;  4Q0J A;  1TD5 A;  2GJ3 A;  5K5B A;  2GNX A;  3EQU A;  5HWT A;  3VV4 A;  3BQA A;  2PD8 A;  2A24 B;  3GEC A;  1UWP X;  4GS9 A;  2Y79 A;  1TF1 A;  1GSX A;  3C38 A;  5IT5 A;  3H7W A;  2LB9 A;  1YKD A;  4I3A A;  4I5S A;  3BW6 A;  1OTB A;  4K08 A;  4HH3 A;  1XFQ A;  4BBV A;  2L0W A;  3UB9 A;  4NEE D;  1XJ3 A;  1T19 A;  3HJI A;  5DKK A;  3MXQ A;  4JGO A;  3PR6 A;  4HY8 A;  2Z6D A;  3E4O A;  2O99 A;  3OCL A;  2YKH A;  3IS2 B;  1OT6 A;  3DBA A;  3KYZ A;  3LIF A;  1KOU A;  1NRJ A;  4R70 A;  2KDK A;  2HF6 A;  5HDD A;  4II7 A;  1X0O A;  1DRM A;  2J80 A;  4EEU A;  1T1C A;  4DJ2 A;  3NOU C;  3LR3 A;  4GHI A;  5CX7 A;  5G4Z A;  3C30 A;  4HI4 A;  2OWH A;  4Q0I A;  3VE4 A;  4Y2F A;  2JKR I;  3A0V A;  3MQQ A;  4L9G A;  5HZH A;  2GX5 A;  5HSQ A;  2WKP A;  5LBR A;  4HJ6 A;  5DF9 A;  3OOV A;  2LB5 A;  1W63 Q;  4MN7 A;  2JKR M;  1N9L A;  4WL9 A;  3R7W A;  4CLC D;  1UGU A;  2WKQ A;  2VV6 A;  2PHY A;  5J7E A;  2VKS A;  3D72 A;  3EGX C;  3KSG A;  4MDZ A;  3TW8 A;  5DFX A;  4HQA A;  2ZMV A;  3EQV A;  3FPW A;  4WEL A;  3MR0 A;  4F3L A;  1STZ A;  2V0W A;  5IU1 A;  1N9N A;  4EEP A;  1T1A A;  2EA9 A;  2B18 A;  3CLO A;  5IS1 A;  4R6L A;  2GZA A;  4GS9 B;  1IFQ A;  2ZOI A;  2W27 A;  4H6J A;  4LRX C;  3BY8 A;  4BBT A;  3H7W B;  1IOU A;  1ZHH B;  4P6Z M;  4L9F A;  3UE6 A;  2ZOH A;  1H3Q A;  2O0Y A;  5G4Y A;  3MJQ A;  4KQD A;  4BWI A;  2G7U A;  2W1T A;  2V9A A;  1DP6 A;  1NLZ A;  3V67 A;  2A2L A;  3ICY A;  2FZ0 A;  5AVE A;  2PT7 A;  4WUJ A;  5TBM A;  3EEH A;  3PBS A;  4I3I A;  2EWV A;  3BQ8 A;  4R38 A;  2QKP A;  3E4Q A;  1MZU A;  3PBO A;  1S4S A;  4CLC C;  4L9E A;  4Y5F A;  3NHQ A;  1OTD A;  1V9Z A;  3VE3 A;  1N9O A;  2XSS A;  4HP9 A;  3EGD C;  3E4P A;  4B9O A;  1YSQ A;  2W3E A;  3F1P A;  1XJ6 A;  2IA2 A;  2VV7 A;  3CIT A;  4LRZ E;  3FC7 A;  4GHI B;  2H28 A;  1OTE A;  4HOI A;  2QYB A;  3PHY A;  1LSW A;  4OOL A;  2PD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...