1NRJA

Signal recognition particle receptor beta-subunit in complex with the srx domain from the alpha-subunit
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
155
structure length
147
Chain Sequence
MFDQLAVFTPQGQVLYQYNCLGKKFSEIQINSFISQLITSPVTRKESVANANTDGFDFNLLTINFNALFYLNKQPELYFVVTFAEQTLELNQETQQTLALVLKLWNSLHLSESILKNRQGQNEKNKHNYVDILQGIEDDLKKFEQYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition particle receptor alpha subunit homolog
publication title Structural Basis for the Function of the beta Subunit of the Eukaryotic Signal Recognition Particle Receptor
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 36
structure length 147
sequence length 155
ec nomenclature
pdb deposition date 2003-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09201 SRX SRX, signal recognition particle receptor alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1nrjA00
1W63M 1NRJA 2XA7S 2HF6A 2JKTI 2XA7M 4P6ZS 4P6ZM 4NEED 4UQIS 4UQIM 2JKRI 2JKTM 5MC7A 3TJZC 2FH5A 1W63Q 2VGLS 2JKRM 2VGLM
chains in the Genus database with same CATH superfamily
3MJQA 2XA7S 4I3IA 3ZG5A 4QD4A 1K4FA 3CPTA 3B47A 1CEFA 5FQ9A 2O99A 3BQAA 3BEBA 2BTFP 4JXSA 3G31A 4EW7A 4KG5A 4OQ0A 3CI6A 2ZM8A 4E3NA 3SS5A 4ETZA 5DFYA 2D02A 3HJKA 1I5QA 2L0WA 2R9XA 1HLUP 4C75A 1FR6A 5AJGA 3NOPC 3T4SA 2XLNA 2ZM0A 3NI9A 2W3HA 3BY9A 5J7EA 4DDSA 2PRFA 3EOIA 1RGZA 4FH4A 4IUHA 5EVIA 2OLVA 4LRXC 4ZJ3A 4N1HA 3ZVTA 1XJ2A 4KZBA 4HJ4A 2W0NA 5M18A 2R9WA 3MQ0A 4L9FA 3QP6A 4MN7A 3NIAA 3R4KA 1BTLA 3LO7A 1K25A 3NJAA 1H5XA 4PM7A 3A0RA 3S7PA 3P09A 3T4TA 3HLFA 1VHMA 1IKGA 2IA2A 1RCJA 1BUEA 2NUTC 3M6BA 3C7UA 3FC7A 4HJ6A 2WUQA 2BG1A 4UAAA 5EOEA 4MCWA 1ONGA 3F1PA 3ISGA 2ZD8A 3IF6B 3HUNA 1DY6A 4Y2FA 3BW6A 5CECA 2PYRA 2YKHA 4P6ZS 4X69A 1EI5A 3IX3A 5F1FA 4EERA 4H6JA 4RVAA 3PHYA 3D72A 4AFIA 5HD5A 4A5RA 2VGKA 3LYXA 3RTYA 2W3FA 3AGDA 1YLPA 1E4DA 1XFNA 3JVUA 4CLCA 3CG5A 5M1AA 1MPLA 3RJUA 4LRZE 1S66L 1PWGA 2O0YA 1MC0A 3IX8A 3LICA 2X02A 4X55A 3VMAA 3GSGA 5E2EA 3SS3A 3NULA 3HLGA 2WZZA 3UMDA 5DF7A 3DTMA 4JXGA 1XGIA 1SDNA 4BD0A 2ZMFA 5FI2A 2VGLM 1FCNA 2HGVA 2O9CA 5HPIA 5IU1A 5HPFA 4X1MA 2I9VA 4P0MA 1TDGA 4GD6A 4GHIB 3CITA 1E3UD 1YLWA 5HDDA 2XSSA 1QMFA 1XJ3A 3V67A 4DJ2A 4Y0UA 3LY4A 3MR0A 1EW0A 2ZL1B 1CK3A 1VB6A 3GR2A 5FQJA 1BLPA 3CUEA 3IH9A 1JTGA 2Y55A 4PHTA 4LV1A 5AQ9A 3Q7VB 4PM6A 3VFHA 5EE8A 3KYZA 5CHMA 3PBSA 4R3BA 5E2HA 1G6OA 2Z2MB 4M4XA 3P7NA 3SS4A 5FAPA 3GTCA 4IJGA 3UPNA 4Y13A 3C2WA 3H7WB 3CLOA 4OQGA 4MMNA 4ETXA 5FQIA 4UA9A 4KQOA 3HVFA 2PBYA 5TBMB 2FH5A 4R70A 3LUQA 3BFCA 2VX8A 1I2WA 5CHJA 3UB5P 1L0DA 5EM0A 1FCMA 1XJ6A 4HESA 4EBPA 3IWOA 4FH2A 2GDNA 4HBTA 1IYOA 3F1NB 3G35A 2UWXA 4I3JA 4QHCA 5AQ7A 2Q9MA 5AVEA 2VK3A 3OC2A 2WKQA 4X53A 3UE1A 4GDNA 1ZHHB 1NYMA 4KZAA 1XPBA 3LIBA 5AQAA 3LIFA 2HJEA 5EPHA 2QJ5A 5HWWA 2O9AA 3ZNTA 5HDSA 1L0GA 3A0VA 4FD8A 4EUVA 3LI8A 5KSCA 3ITBA 2P9VB 4DE2A 3IWIA 2XA7M 2K2NA 4XT2A 5L07A 3NCKA 4JXWA 1PNEA 4IEDA 5TFQA 5FSRA 4OPQA 2EWWA 3QHYA 2Y2JA 3LY3A 5GLAA 1F2KA 3FYZA 1K57C 2HP5A 1K54C 1HD8A 2XF3A 3E0YA 2V9AA 1FILA 2H5SA 2OOLA 1WYBA 3HLDA 4Q0HA 4LV2A 1H0MA 3MS6A 4N9LA 3HBRA 1ONHA 2RL3A 4BWIA 4WZ5A 3N8SA 3T4KA 5A93A 3UB8A 1FOFA 3DTKA 4NETA 4G3WA 1JWPA 4LCLA 2XQZA 1JWVA 5EM1A 3ZQ5A 2RCXA 1OTIA 2VKSA 4HH2A 1BLSA 1NWZA 4QU3A 4ZDXA 5EOOA 3HREA 4FOFA 2JKRI 2W3EA 3N6IA 3VOYA 2PR5A 4BBTA 4HH3A 4B93A 2DRWA 3BLMA 1FCOA 3OPLA 4EEUA 4UA6A 5EVIC 4JF5A 4E3LA 2PT7A 3ZDJA 5HAPA 2V0UA 3IXHA 3D9YA 4U3TA 4PMAA 3VSLA 1D1JA 3JYIA 3W4QA 5IT5A 2V1BA 5FI7A 1XGJA 4R6LA 3C4OA 3UY6A 4D2OA 1CI8A 4DRTA 2Y2OA 2M7UA 2PYPA 4Q0IA 3GDIA 2C6WB 5HARA 4QY5A 5F69A 1VEUB 1G68A 4DDYA 3HL9A 3CJMA 4P6ZM 2PU2A 3GQZA 3LCEA 2A3UA 2EX8A 4QWOA 1IFQA 2XR0A 1ODVA 3UB7A 3T4JA 5CXWA 4UEYA 1T1CA 5FQQA 3KSGA 5F5YA 3UDFA 3LFVA 3P98A 4LGWA 1ES4A 2WKRA 1L2SA 1NZUA 3PBNA 4E3MA 3QP2A 2V20A 4PM8A 3WS0A 4JXVA 5I94A 1PZPA 2WGVA 3ICYA 5E43A 3NY4A 3O87A 2M1CA 1W63Q 3AGEA 3W4OA 3IBRA 1NRJA 4S2KA 3IF6A 4DE1A 2HV1A 1N4OA 5DF8A 4C6YA 3B3XA 5CERA 2K31A 3FZCA 3M2KA 4CLCC 3FV7A 1PWCA 5FEGA 3Q7ZA 4N1XA 4S2PA 1P0ZA 3T1XA 1K0KA 1GHIA 2H0YA 1RGYA 2EFUA 5DFXA 3A3IA 2OAQ1 1GA9A 5EVEA 2VEAA 4FUWA 4QPRA 3BQ8A 5L09A 2ZQAA 1TVFA 1YM1A 5CEBA 3BRMA 4BBUA 4H8RA 3V39A 3EEAA 1TS0A 4Q8IA 2FFFB 2JKTI 5L2FA 4C3QA 3NC8A 3NDGA 2ZQDA 4WELA 3O88A 2BLSA 3G6OA 2EXAA 1LI0A 1K54A 1KDWA 5M19A 1XFQA 3DTEA 4GNUA 3WRTA 3N8LA 4JF4A 5GLCA 3FWLA 1S67L 4OPZA 3SH7A 5EVID 1O07A 1ERMA 2VGJA 2JN7A 2ZQ9A 4WUJA 4YNRA 2MJ6A 4WM9A 3CUEC 2ACGA 1ESUA 4GHIA 1KE4A 2Y2MA 5IS1A 1U60A 2ZMVA 2ZL1A 2XGNA 4ZBEA 2VV8A 2W1RA 5A91A 5K5BA 4B4XA 4HJ3A 4E3KA 4MN5A 4E3IA 4BD1A 3G30A 3Q7VA 4PM9A 4FCFA 3UB6A 3UB9A 1YT4A 5HAIA 4GB7A 2W1TB 4RX3A 3TE8A 3S7NA 1H8YA 2WGWB 4GN2A 4MDZA 2P04A 2EWVA 5HL1A 1K6SA 4KUOA 3H7WA 3CZDA 3HLBA 3S4XA 4NG2A 2WKIA 3VP4A 1M40A 1L0EA 1BZAA 4UA7A 4U0XA 5TBMA 1CF0A 4P85A 3FKWA 3WS2A 3OZHA 2W27A 4Q0JA 4BQMA 4OOMA 2Y2PA 2AVXA 3UE6A 1OT9A 4X25A 5GL9A 4D60A 2JE5A 4CLCD 3F1NA 3H82A 3LIAA 1NJ4A 2IWBA 2PU4A 3W4PA 3I7JA 4HEFA 5JYOA 3ULFA 3M2JA 4KZ6A 2Y8HA 2Y2KA 1IYQA 4X56A 1MWRA 2Y91A 5HDCA 3U4LP 3UMEA 4EU0A 1W79A 2QYBA 4N9KA 2EXBA 5BOHA 4EQIA 2LB5A 1Y54A 4OPRA 3C4PA 1MY8A 2IWDA 4EQ1A 1K4EA 2E8JA 3JPUA 4F3LA 1DJBA 2Y2GA 1YPRA 2ZQ7A 1MXOA 1W5DA 2P9VA 4LV3A 2ZOHA 5DKKA 2R78A 2HDQA 3KYEA 2Z6DA 4ZJ1A 4R3AA 5A90A 2Y2IA 4WZ5C 2PDRA 3TOIA 5CX7A 2OLUA 3S1YA 4OOLA 5F68A 3R7WB 2UV0E 2XRNA 3QP4A 1YLYA 2QZ6A 1D7EA 1OMEA 3T4QA 5MC7A 2WAFA 1G28A 3IHAA 1FQGA 2H0TA 1HVBA 2ZC5B 3IXGA 3DBAA 2JHEA 1S0WA 4MLLA 4O0PA 2ZQCA 5HD3A 1YSPA 4JKTA 4IVKA 1BSGA 3IBJA 2E8IA 4WMCA 3SOIA 3ZG0A 4HP4A 1GA0A 1TF1A 3V3SA 1KOUA 2O9BA 1YQSA 2XROA 4GS9B 4KUKA 5HWTA 2G7UA 2Y2QA 3UDXA 4HI4A 3K3DA 2ZBBA 2WGIA 2WYXA 4K08A 2VV6A 1VM1A 3NOTC 2WKEA 4K0WA 4RQ9A 1AXBA 1SDEA 3VOZA 1KGFA 1UWNX 3LEQA 4LCMA 1KE3A 3WS4A 2B95A 4DMZA 4EETB 5FDSA 2VZWA 2W3GA 2ZJ9A 3UPPA 1G6AA 4U0TA 2EFXA 5CEDA 4ARZB 1MKMA 4PAUA 3PBTA 5L8MA 1LHYA 1E3UA 1I2SA 4EEPA 4HIAA 4OH0A 4P87A 1K56A 2QPNA 3IF6C 5CGXA 5C5KA 3WWXA 3VP1A 1IEMA 2PBDP 3ZGAB 5F83A 3QNCA 2KX6A 4BL3A 1NRFA 4WZ4A 4GZBA 3GMWA 1YMSA 2ZC3B 1XX2A 4DE0A 1J3WA 3Q81A 4GJ4A 1MBLA 1Q2QA 2CC1A 3Q07A 3LI9A 3Q1FA 1P97A 3MSHA 1LLBA 1ERQA 3E2KA 4XUXA 3QP8A 2JKGA 3VFFA 4K91A 4S2NA 5HZHA 5GHZA 4RYEA 4DKIA 1F5MA 4BL2A 1T1BA 3SH8A 4B4ZA 2ZQ8A 3G2YA 1GSVA 1VETB 4UQIS 2V1AA 3S7OA 3BFDA 4CJNA 4BENA 1S4SA 2J80A 4OP8A 1IOUA 1IELA 3C30A 1BULA 3NBLA 3C38A 1WA9A 1ACFA 1TS6A 3OOVA 2XFSA 3BM6A 2HZ5A 4JF6A 5DF9A 2A24B 5E2FA 5EFWA 2XEPA 1MWUA 2KLIA 3BFEA 1LL8A 1Z6FA 5CTMA 3HJIA 4O8GA 5D3OA 1V9ZA 2FZ0A 4YWZA 3UE3A 4G3VA 3T4OA 1QMEA 2W3DA 1GCEA 3OPRA 3BWLA 1LSWA 3KYQA 1OJ5A 2XD1A 4XXRA 2LB9A 5TGFA 3EQUA 3OPPA 1YLJA 3BECA 1UGUA 2J9PA 1LL5A 3B33A 1YMXA 4NXEA 3V3RA 2Q9NA 1KGGA 3A3DA 2C5WB 4KZ4A 4JGRA 2KOIA 4L0LA 4I5SA 5DVAA 3PXPA 3V50A 4IUKA 1XKZA 1SKOB 2W1TA 2ZM2A 5FAQA 2H28A 4OVDA 5DKLA 1HTZA 4RX2A 2WGWA 4ID4A 2HP9A 4XUZA 5DTSA 5HSQA 1PI4A 1ZG4A 2J3TC 4KQRA 4OQIA 2PD8A 1N9BA 4O7DA 1DJAA 1W8QA 2HPBA 1K55A 2JCHA 4WEKA 2HDSA 3TRCA 4EBNA 5EVLA 1NXYA 5A8BA 3IS2B 4WBGA 3FPVA 1PW8A 2Y79A 1H8MA 2HDUA 2PAVP 3ZFZA 3PBOA 4L9EA 3A3EA 4MBKA 1LL9A 5DJUA 1KDSA 3D4FA 4Y0TA 3H9WA 2B02A 3FG8A 3U2AA 1EWZA 1XXMA 4K0XA 4N92A 4DXBA 5HWVA 4WYYA 3LGOA 2PD7A 1PRQA 3PAGA 3DWZA 2QHKA 3MZDA 2WK0A 3IWQA 3OBFA 1PW1A 2V2FF 2ZC6B 4NEED 2ZLYA 2P74A 4HHDA 1YSQA 3RXWA 4FSFA 2XH9A 3JVVA 1DP9A 3IF5A 4NK3A 3MQQA 3LR3A 2VLGA 3QP1A 3ZYTA 2HP6A 4S2LA 4M3KA 1W7FA 3EGDC 3F1OB 4S2OA 3W8KA 4BBVA 4Y0OA 1BT5A 3VP3A 4GDBA 1FSYA 5E2GA 3CWFA 3G2ZA 3IH8A 5F82A 3T4LA 1H8ZA 4OP5A 3VOLA 4DE3A 5KSHA 1TS8A 3K3CA 4DJ3A 1W8YA 4MEZA 5FDHA 2JBFA 4ME4A 3AGFA 4KQDA 2V0WA 2Z2LB 2P7JA 2JC7A 2OV5A 4P6BA 4Y17A 1YLZA 5DTTA 5AVFA 5I5LA 3E4QA 4GS9A 5KMWA 1V9YA 4S2JA 2J3TD 4YFMA 4KZ3A 5KZHA 1PFLA 4X68A 3VV4A 1TDLA 4LFUA 2XK1A 1GSXA 4B9OA 1N9OA 3CHWP 3NECA 3T1RA 3LEZA 3LR5A 3BFFA 4R4SA 2Y59A 4PKYG 5DJTA 1W63M 1PZOA 4E6WA 2I72A 5FEFA 1OTAA 2V1ZA 3C8CA 3GRJA 2WKHA 3LR0A 4G3KA 4BMWA 5GHYA 1H3QA 3O5YA 1ES3A 4ESPA 1CEGA 3UPOA 1K6RA 1OTDA 5HL6A 4HQAA 4S2MA 5LBRA 2NUPC 3ZVWA 3L9KA 4PKYA 4OQHA 4ARZA 1Q2PA 1YAXA 2X71A 4KZ7A 3VP2A 4UQIM 2GJ3A 1D06A 2WKPA 1DRMA 4LENA 3TG9A 4GD8A 1GSWA 1DP6A 3Q82A 3G34A 1CJFA 5DTKA 4UHUA 3VE3A 5J8XA 5FATA 3QP5A 3GVBA 2EX2A 1A0KA 3UN7A 5CHUA 2L1MA 4YOFA 3VSKA 1CI9A 1XA1A 3BYDA 1FIKA 4S2NC 3ITAA 3MKEA 2A2LA 1E25A 4NXBA 3MFDA 4BLMA 1YLTA 3M6HA 2X01A 4WLAA 2J9OA 3UDIA 2HJ9C 3S7QA 3O3VA 1C3BA 5FQKA 3B42A 2YKFA 3O86A 1ESIA 1LT0A 1X0OA 1PIOA 3T50A 5GHXA 1OTBA 3MZEA 1EROA 2ZOIA 4I39A 1VETA 4KENB 2HDRA 2OWJA 4Y15A 4KG2A 3T12B 4E04A 4WMCD 5GLBA 1F9IA 4R4RA 3EQVA 4II7A 2P08A 2VV7A 1ZC2A 3PBQA 5G4ZA 5IHVA 3A3JA 1K38A 1JVJA 1ZG6A 3HLEA 2EA9A 2WAEA 4HNBA 2A24A 4I38A 2J3WA 2DCFA 3KSIA 4ZJ2A 1BLCA 3IT9A 4WL9A 4EUZA 5KIZA 1OPXA 5FI6A 3NOUC 1SZVA 4O01A 3E2LA 3BJNA 4CQHA 1MZUA 3GV9A 5F6AA 1M6KA 4JBFA 3ZNYA 2BASA 4ZRRA 4QY6A 2JKRM 2Q0OA 1FSWA 1PWDA 1P9RA 4GKUA 1N9NA 1TS7A 3CPTB 3PR6A 4OLGA 3ZG9B 2B18A 3ZHHA 2WZXA 4IVIA 4OPYA 1IYSA 3NHQA 4Z1WA 3D3OA 3SZTA 1K56D 2OWHA 3G32A 4KZ8A 1SKOA 4IHQA 1K55C 1S6RA 2ZMAA 2HF6A 4MN6A 1Y28A 2OSUA 5HX9A 3OCNA 1VEUA 1SKFA 5EVIB 4QB8A 3C5AA 1UWPX 3PYPA 4OONA 4EV4A 1S1YA 1WE4A 2PR6A 3IXDA 3HCYA 1VQQA 4IBXA 4B88A 1Y4OA 2DNSA 3IS2A 1DP8A 2EX6A 4R3JA 3MXRA 4JPMA 1XJ4A 1JTDA 1T19A 5HFOA 3DWKA 4R0QA 5FL3A 2XDMA 2KDKA 4BJPA 1AWIA 4NXGA 3DW0A 1ALQA 5L10A 3EEHA 3HLWA 1WYCA 1ZKJA 3PTEA 5CGWA 3H82B 3QNBA 2CMNA 4WF0A 3E4OA 4QJGA 3F1PB 4Y3IA 5G4YA 4E3JA 2Y2LA 1MWTA 3GECA 3WRZA 5FAOA 3TW8A 4LRYC 3CAXA 2WADA 3OLOA 4FTXA 4GOGA 4H6JB 5EV0A 1ES5A 4E6XA 1JWZA 1XP4A 3E98A 4OKPA 2Y2HA 4ZTKA 4HP9A 1STZA 4RA7A 2ZC7A 3IQAA 1L3LA 4CPKA 4F3LB 1KE0A 3NDEA 5TJJA 4CLCB 1MWSA 2A49A 3F1OA 2G2UA 3K2NA 4OOYA 4WEJA 1ES2A 2M7VA 5GLDA 3A3FA 4R38A 2JKTM 2V8CA 4EXOA 2QMIA 4KZ5A 1LI9A 3VE4A 4F94A 3WS5A 1NZOA 1DJCA 3RXXA 1O7EA 1BLHA 3MXSA 4Z9QA 5CTNA 3BLSA 3BFGA 3MBZA 3N8RA 3MZFA 4GW9A 2EX9A 3UE0A 3CMZA 1P9WA 1BYWA 3LR4A 4WN5A 2DMWA 2FFYA 3KX0X 4GLQA 1J9MA 3RFBA 5A92A 3SH9A 4KZ9A 4IBRA 1RP5A 3LIEA 2INWA 2Y4AA 1G5UA 3N4IA 1LSXA 2V8FA 1T18A 3EGXC 3MFXA 5U47A 4X6TA 4DN0A 4R23A 3KO6A 3SW1A 1T1AA 4HBUA 4PPRA 3BY8A 4MBHA 4X1LA 4Y7PA 5F1GA 4GCZA 4NXFA 1ZTUA 1SHVA 3KSHA 1HZOA 3P01A 1NLYA 4OLDA 2VGLS 3MF0A 3MXQA 2D01A 4HY8A 4EBLA 3PAEA 2J7VA 3N7WA 1NYYA 4HOIA 2QKPA 4JGQA 4MBFA 3V5MA 2JKFA 2VA0A 3UO9A 3A0SA 5FA7A 3T1QB 2XFTA 5FQMA 3DAVA 4LPZA 4EESA 2Y2NA 3G4PA 4S2IA 3W2ZA 4Y5FA 3OCLA 1NLZA 3FKVA 5CRFA 4JLFA 3ZG7B 5HW3A 3HUOA 1L0FA 4KG6A 2IWCA 4I3AA 3KSFA 2PHYA 3HUMA 2QWSA 1SCWA 2GNXA 1GHPA 3OPHA 5FASA 3LIDA 4NKPA 1TD5A 2VJWA 4LLOB 2L4RA 5EUAA 2GX5A 1KGEA 2XD5A 3DTIA 3PBRA 3EWKA 5G18A 3HLCA 2K7SA 3FPWA 1IKIA 4JGOA 4LV0A 1F98A 1GHMA 5HAQA 3MQOA 5EECA 3RH8B 1YKDA 3ZG8B 1OTEA 3MMHA 2B5RA 2GZAA 5TR7A 1OT6A 4KQQA 4CLCE 3ZCZA 1XA7A 2ZC4B 5AQBA 1MKIA 3UNWA 3VP0A 4L9GA 1NY0A 1S1ZA 4XT2B 3WS1A 1LSVA 1IYPA 1KVMA 1PYYA 4PM5A 3C7VA 3R7WA 1OJGA 5CGSA 5J4EA 3S22A 2Z6CA 4R1GA 3IX4A 1Z09A 3TJZC 3IHBA 3L7HA 3E4PA 3T1SA 1TEMA 2QJ7A 1PI5A 5JYPA 1FR1A 4E3OA 4ZAMA 5J3WA 1CQAA 2OAP1 4MNRA 2G2WA 3TSGA 1S4RA 4JGPA 1K57A 2H10A 1JNUA 3IXBA 1KVLA 3MKFA 4EWFA 4YINA 2J8YA 1N9LA 4DXCA 4DF6A
chains in the Genus database with same CATH topology
3GDIA 3MJQA 2XA7S 4I3IA 5F69A 2KX6A 2P08A 2VV7A 3PBQA 5G4ZA 3B47A 4P6ZM 2EA9A 4HNBA 2O99A 2A24A 4I38A 4GJ4A 3BQAA 2J3WA 1IFQA 1ODVA 3UB7A 3LI9A 3KSIA 3T4JA 1P97A 4UEYA 4EW7A 1T1CA 3CI6A 3KSGA 4WL9A 5F5YA 5KIZA 3LFVA 1OPXA 4ETZA 5DFYA 2D02A 2WKRA 3HJKA 2L0WA 5HZHA 3PBNA 3NOUC 5AJGA 3NOPC 3T4SA 1F5MA 1T1BA 2W3HA 1GSVA 4UQIS 3BY9A 2V1AA 5J7EA 3S7OA 4O01A 3ICYA 3BJNA 1S4SA 2J80A 3EOIA 4CQHA 1MZUA 5F6AA 1IOUA 4IUHA 3C30A 2M1CA 1W63Q 4LRXC 2BASA 4ZRRA 3C38A 2JKRM 3IBRA 1WA9A 1P9RA 1NRJA 1N9NA 1TS7A 1TS6A 3OOVA 1XJ2A 2HV1A 3PR6A 2B18A 4HJ4A 2W0NA 5DF9A 5EFWA 2A24B 3MQ0A 4L9FA 4MN7A 3R4KA 2KLIA 1LL8A 2K31A 4CLCC 3HJIA 3NJAA 3NHQA 4O8GA 1V9ZA 2FZ0A 3A0RA 4YWZA 3S7PA 4Z1WA 3D3OA 2OWHA 3UE3A 3T4TA 1P0ZA 4G3VA 1VHMA 3T4OA 4IHQA 2HF6A 2W3DA 4MN6A 1Y28A 2IA2A 5DFXA 3BWLA 2NUTC 1LSWA 2OAQ1 3KYQA 3OCNA 1OJ5A 2VEAA 3FC7A 4HJ6A 4QPRA 3BQ8A 2LB9A 1UWPX 3PYPA 4MCWA 3EQUA 3F1PA 4BBUA 1S1YA 2PR6A 3EEAA 3HCYA 1UGUA 1TS0A 4Y2FA 3B33A 2JKTI 4NXEA 3BW6A 2PYRA 2YKHA 4P6ZS 3IS2A 1DP8A 4WELA 4EERA 4H6JA 4JGRA 2KOIA 4L0LA 3G6OA 4I5SA 3PHYA 1XJ4A 3D72A 1XFQA 1T19A 3PXPA 4AFIA 5HD5A 5FL3A 4IUKA 3LYXA 2KDKA 3RTYA 4BJPA 2W1TA 2W3FA 1S67L 4NXGA 2H28A 5DKLA 1XFNA 3JVUA 4CLCA 2JN7A 4WUJA 3EEHA 5HSQA 4YNRA 3H82B 2J3TC 2MJ6A 2PD8A 2CMNA 4WF0A 3CUEC 3E4OA 4GHIA 3F1PB 4LRZE 1S66L 4Y3IA 5G4YA 4WEKA 3TRCA 3GECA 3TW8A 5IS1A 4LRYC 2O0YA 1MC0A 2ZMVA 3LICA 3CAXA 5A8BA 3OLOA 3IS2B 2VV8A 2W1RA 5K5BA 4H6JB 3FPVA 4HJ3A 2Y79A 4MN5A 1H8MA 3PBOA 4L9EA 3UB9A 3UB6A 3E98A 3UMDA 2W1TB 4HP9A 1STZA 5DJUA 3TE8A 3S7NA 2ZMFA 4F3LB 2VGLM 3H9WA 2B02A 5TJJA 3FG8A 4CLCB 2HGVA 2O9CA 4MDZA 5HPIA 5IU1A 3U2AA 5HPFA 3F1OA 2P04A 2EWVA 3K2NA 2I9VA 4KUOA 4WEJA 3H7WA 2M7VA 4R38A 4GHIB 3CITA 5HWVA 2JKTM 5HDDA 4EXOA 2XSSA 3VE4A 1XJ3A 3V67A 4DJ2A 2PD7A 3MR0A 5TBMA 1EW0A 1VB6A 2W27A 4Q0JA 4OOMA 2QHKA 3CUEA 3UE6A 1OT9A 4PHTA 4GW9A 3OBFA 4NEED 3KYZA 4HHDA 4CLCD 3F1NA 1YSQA 3H82A 3LIAA 1P9WA 3PBSA 1BYWA 3LR4A 3JVVA 4FSFA 1DP9A 4WN5A 3MQQA 3ULFA 3LR3A 2VLGA 2DMWA 3ZYTA 1G6OA 4M4XA 3EGDC 3F1OB 3P7NA 3KX0X 4GLQA 2Y8HA 3RFBA 4BBVA 4IJGA 3C2WA 3H7WB 5HDCA 3CLOA 3UMEA 4MMNA 4EU0A 4ETXA 3LIEA 2INWA 3CWFA 2QYBA 4KQOA 1LSXA 2LB5A 3T4LA 5TBMB 2FH5A 1T18A 4R70A 3VOLA 5KSHA 3EGXC 3MFXA 1TS8A 3LUQA 4EQ1A 3K3CA 2VX8A 4DN0A 3KO6A 3SW1A 1T1AA 4F3LA 4DJ3A 3BY8A 1XJ6A 4ME4A 3F1NB 4KQDA 2ZOHA 2V0WA 4I3JA 5DKKA 4GCZA 2R78A 2P7JA 4NXFA 1ZTUA 3KSHA 2Z6DA 5AVEA 3OC2A 3P01A 2WKQA 4R3AA 1ZHHB 1NLYA 2VGLS 3MF0A 3MXQA 2D01A 4HY8A 2PDRA 5CX7A 3LIBA 4OOLA 5F68A 4HOIA 2QKPA 4JGQA 5AVFA 3R7WB 3LIFA 2HJEA 5I5LA 2QJ5A 2XRNA 3E4QA 4GS9A 5HWWA 1V9YA 2O9AA 2J3TD 5HDSA 2VA0A 3A0SA 3VV4A 1D7EA 4LPZA 4EESA 3A0VA 3T4QA 4EUVA 5MC7A 3W2ZA 1G28A 1GSXA 3LI8A 4B9OA 4Y5FA 1N9OA 3OCLA 1NLZA 3LR5A 4PKYG 5DJTA 4I3AA 3DBAA 1W63M 3KSFA 2JHEA 2XA7M 2K2NA 2PHYA 4O0PA 4XT2A 5HD3A 1OTAA 1YSPA 2QWSA 2GNXA 3C8CA 3LIDA 4NKPA 1TD5A 2VJWA 3LR0A 4LLOB 2L4RA 4G3KA 3IBJA 4BMWA 2EWWA 1H3QA 3O5YA 2GX5A 3PBRA 3EWKA 4HP4A 5HL6A 1OTDA 1TF1A 2K7SA 4HQAA 1KOUA 5LBRA 2NUPC 2O9BA 3E0YA 2V9AA 3FPWA 4PKYA 4JGOA 2OOLA 1F98A 4GS9B 4KUKA 2XROA 5HWTA 4ARZA 2G7UA 4Q0HA 1YAXA 4UQIM 3MQOA 2GJ3A 1D06A 3K3DA 4HI4A 4BWIA 2ZBBA 2WKPA 1DRMA 3RH8B 3T4KA 1YKDA 1OTEA 3UB8A 4K08A 2VV6A 1GSWA 1DP6A 3MMHA 2GZAA 4CLCE 1OT6A 3VE3A 3NOTC 4RQ9A 4G3WA 3ZQ5A 1OTIA 4L9GA 1S1ZA 1UWNX 4XT2B 1LSVA 2VKSA 4HH2A 2L1MA 4YOFA 1NWZA 3R7WA 1OJGA 5J4EA 4DMZA 4EETB 2Z6CA 4FOFA 2JKRI 2W3EA 2A2LA 4NXBA 3TJZC 2VZWA 2PR5A 2W3GA 3E4PA 2QJ7A 4WLAA 4BBTA 4HH3A 2HJ9C 3S7QA 4B93A 4EEUA 3B42A 2YKFA 5J3WA 4ARZB 1LT0A 1MKMA 2OAP1 4PAUA 3PBTA 1X0OA 3T50A 5L8MA 2PT7A 1OTBA 4EEPA 2V0UA 1S4RA 4JGPA 2ZOIA 4I39A 4HIAA 1JNUA 5C5KA 5IT5A 2V1BA 2OWJA 4R6LA 4E04A 1N9LA 1F9IA 3EQVA 4II7A 2M7UA 2PYPA 4Q0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W63 M;  1NRJ A;  2XA7 S;  2HF6 A;  2JKT I;  2XA7 M;  4P6Z S;  4P6Z M;  4NEE D;  4UQI S;  4UQI M;  2JKR I;  2JKT M;  5MC7 A;  3TJZ C;  2FH5 A;  1W63 Q;  2VGL S;  2JKR M;  2VGL M; 
#chains in the Genus database with same CATH topology
 3MJQ A;  2XA7 S;  4I3I A;  3ZG5 A;  4QD4 A;  1K4F A;  3CPT A;  3B47 A;  1CEF A;  5FQ9 A;  2O99 A;  3BQA A;  3BEB A;  2BTF P;  4JXS A;  3G31 A;  4EW7 A;  4KG5 A;  4OQ0 A;  3CI6 A;  2ZM8 A;  4E3N A;  3SS5 A;  4ETZ A;  5DFY A;  2D02 A;  3HJK A;  1I5Q A;  2L0W A;  2R9X A;  1HLU P;  4C75 A;  1FR6 A;  5AJG A;  3NOP C;  3T4S A;  2XLN A;  2ZM0 A;  3NI9 A;  2W3H A;  3BY9 A;  5J7E A;  4DDS A;  2PRF A;  3EOI A;  1RGZ A;  4FH4 A;  4IUH A;  5EVI A;  2OLV A;  4LRX C;  4ZJ3 A;  4N1H A;  3ZVT A;  1XJ2 A;  4KZB A;  4HJ4 A;  2W0N A;  5M18 A;  2R9W A;  3MQ0 A;  4L9F A;  3QP6 A;  4MN7 A;  3NIA A;  3R4K A;  1BTL A;  3LO7 A;  1K25 A;  3NJA A;  1H5X A;  4PM7 A;  3A0R A;  3S7P A;  3P09 A;  3T4T A;  3HLF A;  1VHM A;  1IKG A;  2IA2 A;  1RCJ A;  1BUE A;  2NUT C;  3M6B A;  3C7U A;  3FC7 A;  4HJ6 A;  2WUQ A;  2BG1 A;  4UAA A;  5EOE A;  4MCW A;  1ONG A;  3F1P A;  3ISG A;  2ZD8 A;  3IF6 B;  3HUN A;  1DY6 A;  4Y2F A;  3BW6 A;  5CEC A;  2PYR A;  2YKH A;  4P6Z S;  4X69 A;  1EI5 A;  3IX3 A;  5F1F A;  4EER A;  4H6J A;  4RVA A;  3PHY A;  3D72 A;  4AFI A;  5HD5 A;  4A5R A;  2VGK A;  3LYX A;  3RTY A;  2W3F A;  3AGD A;  1YLP A;  1E4D A;  1XFN A;  3JVU A;  4CLC A;  3CG5 A;  5M1A A;  1MPL A;  3RJU A;  4LRZ E;  1S66 L;  1PWG A;  2O0Y A;  1MC0 A;  3IX8 A;  3LIC A;  2X02 A;  4X55 A;  3VMA A;  3GSG A;  5E2E A;  3SS3 A;  3NUL A;  3HLG A;  2WZZ A;  3UMD A;  5DF7 A;  3DTM A;  4JXG A;  1XGI A;  1SDN A;  4BD0 A;  2ZMF A;  5FI2 A;  2VGL M;  1FCN A;  2HGV A;  2O9C A;  5HPI A;  5IU1 A;  5HPF A;  4X1M A;  2I9V A;  4P0M A;  1TDG A;  4GD6 A;  4GHI B;  3CIT A;  1E3U D;  1YLW A;  5HDD A;  2XSS A;  1QMF A;  1XJ3 A;  3V67 A;  4DJ2 A;  4Y0U A;  3LY4 A;  3MR0 A;  1EW0 A;  2ZL1 B;  1CK3 A;  1VB6 A;  3GR2 A;  5FQJ A;  1BLP A;  3CUE A;  3IH9 A;  1JTG A;  2Y55 A;  4PHT A;  4LV1 A;  5AQ9 A;  3Q7V B;  4PM6 A;  3VFH A;  5EE8 A;  3KYZ A;  5CHM A;  3PBS A;  4R3B A;  5E2H A;  1G6O A;  2Z2M B;  4M4X A;  3P7N A;  3SS4 A;  5FAP A;  3GTC A;  4IJG A;  3UPN A;  4Y13 A;  3C2W A;  3H7W B;  3CLO A;  4OQG A;  4MMN A;  4ETX A;  5FQI A;  4UA9 A;  4KQO A;  3HVF A;  2PBY A;  5TBM B;  2FH5 A;  4R70 A;  3LUQ A;  3BFC A;  2VX8 A;  1I2W A;  5CHJ A;  3UB5 P;  1L0D A;  5EM0 A;  1FCM A;  1XJ6 A;  4HES A;  4EBP A;  3IWO A;  4FH2 A;  2GDN A;  4HBT A;  1IYO A;  3F1N B;  3G35 A;  2UWX A;  4I3J A;  4QHC A;  5AQ7 A;  2Q9M A;  5AVE A;  2VK3 A;  3OC2 A;  2WKQ A;  4X53 A;  3UE1 A;  4GDN A;  1ZHH B;  1NYM A;  4KZA A;  1XPB A;  3LIB A;  5AQA A;  3LIF A;  2HJE A;  5EPH A;  2QJ5 A;  5HWW A;  2O9A A;  3ZNT A;  5HDS A;  1L0G A;  3A0V A;  4FD8 A;  4EUV A;  3LI8 A;  5KSC A;  3ITB A;  2P9V B;  4DE2 A;  3IWI A;  2XA7 M;  2K2N A;  4XT2 A;  5L07 A;  3NCK A;  4JXW A;  1PNE A;  4IED A;  5TFQ A;  5FSR A;  4OPQ A;  2EWW A;  3QHY A;  2Y2J A;  3LY3 A;  5GLA A;  1F2K A;  3FYZ A;  1K57 C;  2HP5 A;  1K54 C;  1HD8 A;  2XF3 A;  3E0Y A;  2V9A A;  1FIL A;  2H5S A;  2OOL A;  1WYB A;  3HLD A;  4Q0H A;  4LV2 A;  1H0M A;  3MS6 A;  4N9L A;  3HBR A;  1ONH A;  2RL3 A;  4BWI A;  4WZ5 A;  3N8S A;  3T4K A;  5A93 A;  3UB8 A;  1FOF A;  3DTK A;  4NET A;  4G3W A;  1JWP A;  4LCL A;  2XQZ A;  1JWV A;  5EM1 A;  3ZQ5 A;  2RCX A;  1OTI A;  2VKS A;  4HH2 A;  1BLS A;  1NWZ A;  4QU3 A;  4ZDX A;  5EOO A;  3HRE A;  4FOF A;  2JKR I;  2W3E A;  3N6I A;  3VOY A;  2PR5 A;  4BBT A;  4HH3 A;  4B93 A;  2DRW A;  3BLM A;  1FCO A;  3OPL A;  4EEU A;  4UA6 A;  5EVI C;  4JF5 A;  4E3L A;  2PT7 A;  3ZDJ A;  5HAP A;  2V0U A;  3IXH A;  3D9Y A;  4U3T A;  4PMA A;  3VSL A;  1D1J A;  3JYI A;  3W4Q A;  5IT5 A;  2V1B A;  5FI7 A;  1XGJ A;  4R6L A;  3C4O A;  3UY6 A;  4D2O A;  1CI8 A;  4DRT A;  2Y2O A;  2M7U A;  2PYP A;  4Q0I A;  3GDI A;  2C6W B;  5HAR A;  4QY5 A;  5F69 A;  1VEU B;  1G68 A;  4DDY A;  3HL9 A;  3CJM A;  4P6Z M;  2PU2 A;  3GQZ A;  3LCE A;  2A3U A;  2EX8 A;  4QWO A;  1IFQ A;  2XR0 A;  1ODV A;  3UB7 A;  3T4J A;  5CXW A;  4UEY A;  1T1C A;  5FQQ A;  3KSG A;  5F5Y A;  3UDF A;  3LFV A;  3P98 A;  4LGW A;  1ES4 A;  2WKR A;  1L2S A;  1NZU A;  3PBN A;  4E3M A;  3QP2 A;  2V20 A;  4PM8 A;  3WS0 A;  4JXV A;  5I94 A;  1PZP A;  2WGV A;  3ICY A;  5E43 A;  3NY4 A;  3O87 A;  2M1C A;  1W63 Q;  3AGE A;  3W4O A;  3IBR A;  1NRJ A;  4S2K A;  3IF6 A;  4DE1 A;  2HV1 A;  1N4O A;  5DF8 A;  4C6Y A;  3B3X A;  5CER A;  2K31 A;  3FZC A;  3M2K A;  4CLC C;  3FV7 A;  1PWC A;  5FEG A;  3Q7Z A;  4N1X A;  4S2P A;  1P0Z A;  3T1X A;  1K0K A;  1GHI A;  2H0Y A;  1RGY A;  2EFU A;  5DFX A;  3A3I A;  2OAQ 1;  1GA9 A;  5EVE A;  2VEA A;  4FUW A;  4QPR A;  3BQ8 A;  5L09 A;  2ZQA A;  1TVF A;  1YM1 A;  5CEB A;  3BRM A;  4BBU A;  4H8R A;  3V39 A;  3EEA A;  1TS0 A;  4Q8I A;  2FFF B;  2JKT I;  5L2F A;  4C3Q A;  3NC8 A;  3NDG A;  2ZQD A;  4WEL A;  3O88 A;  2BLS A;  3G6O A;  2EXA A;  1LI0 A;  1K54 A;  1KDW A;  5M19 A;  1XFQ A;  3DTE A;  4GNU A;  3WRT A;  3N8L A;  4JF4 A;  5GLC A;  3FWL A;  1S67 L;  4OPZ A;  3SH7 A;  5EVI D;  1O07 A;  1ERM A;  2VGJ A;  2JN7 A;  2ZQ9 A;  4WUJ A;  4YNR A;  2MJ6 A;  4WM9 A;  3CUE C;  2ACG A;  1ESU A;  4GHI A;  1KE4 A;  2Y2M A;  5IS1 A;  1U60 A;  2ZMV A;  2ZL1 A;  2XGN A;  4ZBE A;  2VV8 A;  2W1R A;  5A91 A;  5K5B A;  4B4X A;  4HJ3 A;  4E3K A;  4MN5 A;  4E3I A;  4BD1 A;  3G30 A;  3Q7V A;  4PM9 A;  4FCF A;  3UB6 A;  3UB9 A;  1YT4 A;  5HAI A;  4GB7 A;  2W1T B;  4RX3 A;  3TE8 A;  3S7N A;  1H8Y A;  2WGW B;  4GN2 A;  4MDZ A;  2P04 A;  2EWV A;  5HL1 A;  1K6S A;  4KUO A;  3H7W A;  3CZD A;  3HLB A;  3S4X A;  4NG2 A;  2WKI A;  3VP4 A;  1M40 A;  1L0E A;  1BZA A;  4UA7 A;  4U0X A;  5TBM A;  1CF0 A;  4P85 A;  3FKW A;  3WS2 A;  3OZH A;  2W27 A;  4Q0J A;  4BQM A;  4OOM A;  2Y2P A;  2AVX A;  3UE6 A;  1OT9 A;  4X25 A;  5GL9 A;  4D60 A;  2JE5 A;  4CLC D;  3F1N A;  3H82 A;  3LIA A;  1NJ4 A;  2IWB A;  2PU4 A;  3W4P A;  3I7J A;  4HEF A;  5JYO A;  3ULF A;  3M2J A;  4KZ6 A;  2Y8H A;  2Y2K A;  1IYQ A;  4X56 A;  1MWR A;  2Y91 A;  5HDC A;  3U4L P;  3UME A;  4EU0 A;  1W79 A;  2QYB A;  4N9K A;  2EXB A;  5BOH A;  4EQI A;  2LB5 A;  1Y54 A;  4OPR A;  3C4P A;  1MY8 A;  2IWD A;  4EQ1 A;  1K4E A;  2E8J A;  3JPU A;  4F3L A;  1DJB A;  2Y2G A;  1YPR A;  2ZQ7 A;  1MXO A;  1W5D A;  2P9V A;  4LV3 A;  2ZOH A;  5DKK A;  2R78 A;  2HDQ A;  3KYE A;  2Z6D A;  4ZJ1 A;  4R3A A;  5A90 A;  2Y2I A;  4WZ5 C;  2PDR A;  3TOI A;  5CX7 A;  2OLU A;  3S1Y A;  4OOL A;  5F68 A;  3R7W B;  2UV0 E;  2XRN A;  3QP4 A;  1YLY A;  2QZ6 A;  1D7E A;  1OME A;  3T4Q A;  5MC7 A;  2WAF A;  1G28 A;  3IHA A;  1FQG A;  2H0T A;  1HVB A;  2ZC5 B;  3IXG A;  3DBA A;  2JHE A;  1S0W A;  4MLL A;  4O0P A;  2ZQC A;  5HD3 A;  1YSP A;  4JKT A;  4IVK A;  1BSG A;  3IBJ A;  2E8I A;  4WMC A;  3SOI A;  3ZG0 A;  4HP4 A;  1GA0 A;  1TF1 A;  3V3S A;  1KOU A;  2O9B A;  1YQS A;  2XRO A;  4GS9 B;  4KUK A;  5HWT A;  2G7U A;  2Y2Q A;  3UDX A;  4HI4 A;  3K3D A;  2ZBB A;  2WGI A;  2WYX A;  4K08 A;  2VV6 A;  1VM1 A;  3NOT C;  2WKE A;  4K0W A;  4RQ9 A;  1AXB A;  1SDE A;  3VOZ A;  1KGF A;  1UWN X;  3LEQ A;  4LCM A;  1KE3 A;  3WS4 A;  2B95 A;  4DMZ A;  4EET B;  5FDS A;  2VZW A;  2W3G A;  2ZJ9 A;  3UPP A;  1G6A A;  4U0T A;  2EFX A;  5CED A;  4ARZ B;  1MKM A;  4PAU A;  3PBT A;  5L8M A;  1LHY A;  1E3U A;  1I2S A;  4EEP A;  4HIA A;  4OH0 A;  4P87 A;  1K56 A;  2QPN A;  3IF6 C;  5CGX A;  5C5K A;  3WWX A;  3VP1 A;  1IEM A;  2PBD P;  3ZGA B;  5F83 A;  3QNC A;  2KX6 A;  4BL3 A;  1NRF A;  4WZ4 A;  4GZB A;  3GMW A;  1YMS A;  2ZC3 B;  1XX2 A;  4DE0 A;  1J3W A;  3Q81 A;  4GJ4 A;  1MBL A;  1Q2Q A;  2CC1 A;  3Q07 A;  3LI9 A;  3Q1F A;  1P97 A;  3MSH A;  1LLB A;  1ERQ A;  3E2K A;  4XUX A;  3QP8 A;  2JKG A;  3VFF A;  4K91 A;  4S2N A;  5HZH A;  5GHZ A;  4RYE A;  4DKI A;  1F5M A;  4BL2 A;  1T1B A;  3SH8 A;  4B4Z A;  2ZQ8 A;  3G2Y A;  1GSV A;  1VET B;  4UQI S;  2V1A A;  3S7O A;  3BFD A;  4CJN A;  4BEN A;  1S4S A;  2J80 A;  4OP8 A;  1IOU A;  1IEL A;  3C30 A;  1BUL A;  3NBL A;  3C38 A;  1WA9 A;  1ACF A;  1TS6 A;  3OOV A;  2XFS A;  3BM6 A;  2HZ5 A;  4JF6 A;  5DF9 A;  2A24 B;  5E2F A;  5EFW A;  2XEP A;  1MWU A;  2KLI A;  3BFE A;  1LL8 A;  1Z6F A;  5CTM A;  3HJI A;  4O8G A;  5D3O A;  1V9Z A;  2FZ0 A;  4YWZ A;  3UE3 A;  4G3V A;  3T4O A;  1QME A;  2W3D A;  1GCE A;  3OPR A;  3BWL A;  1LSW A;  3KYQ A;  1OJ5 A;  2XD1 A;  4XXR A;  2LB9 A;  5TGF A;  3EQU A;  3OPP A;  1YLJ A;  3BEC A;  1UGU A;  2J9P A;  1LL5 A;  3B33 A;  1YMX A;  4NXE A;  3V3R A;  2Q9N A;  1KGG A;  3A3D A;  2C5W B;  4KZ4 A;  4JGR A;  2KOI A;  4L0L A;  4I5S A;  5DVA A;  3PXP A;  3V50 A;  4IUK A;  1XKZ A;  1SKO B;  2W1T A;  2ZM2 A;  5FAQ A;  2H28 A;  4OVD A;  5DKL A;  1HTZ A;  4RX2 A;  2WGW A;  4ID4 A;  2HP9 A;  4XUZ A;  5DTS A;  5HSQ A;  1PI4 A;  1ZG4 A;  2J3T C;  4KQR A;  4OQI A;  2PD8 A;  1N9B A;  4O7D A;  1DJA A;  1W8Q A;  2HPB A;  1K55 A;  2JCH A;  4WEK A;  2HDS A;  3TRC A;  4EBN A;  5EVL A;  1NXY A;  5A8B A;  3IS2 B;  4WBG A;  3FPV A;  1PW8 A;  2Y79 A;  1H8M A;  2HDU A;  2PAV P;  3ZFZ A;  3PBO A;  4L9E A;  3A3E A;  4MBK A;  1LL9 A;  5DJU A;  1KDS A;  3D4F A;  4Y0T A;  3H9W A;  2B02 A;  3FG8 A;  3U2A A;  1EWZ A;  1XXM A;  4K0X A;  4N92 A;  4DXB A;  5HWV A;  4WYY A;  3LGO A;  2PD7 A;  1PRQ A;  3PAG A;  3DWZ A;  2QHK A;  3MZD A;  2WK0 A;  3IWQ A;  3OBF A;  1PW1 A;  2V2F F;  2ZC6 B;  4NEE D;  2ZLY A;  2P74 A;  4HHD A;  1YSQ A;  3RXW A;  4FSF A;  2XH9 A;  3JVV A;  1DP9 A;  3IF5 A;  4NK3 A;  3MQQ A;  3LR3 A;  2VLG A;  3QP1 A;  3ZYT A;  2HP6 A;  4S2L A;  4M3K A;  1W7F A;  3EGD C;  3F1O B;  4S2O A;  3W8K A;  4BBV A;  4Y0O A;  1BT5 A;  3VP3 A;  4GDB A;  1FSY A;  5E2G A;  3CWF A;  3G2Z A;  3IH8 A;  5F82 A;  3T4L A;  1H8Z A;  4OP5 A;  3VOL A;  4DE3 A;  5KSH A;  1TS8 A;  3K3C A;  4DJ3 A;  1W8Y A;  4MEZ A;  5FDH A;  2JBF A;  4ME4 A;  3AGF A;  4KQD A;  2V0W A;  2Z2L B;  2P7J A;  2JC7 A;  2OV5 A;  4P6B A;  4Y17 A;  1YLZ A;  5DTT A;  5AVF A;  5I5L A;  3E4Q A;  4GS9 A;  5KMW A;  1V9Y A;  4S2J A;  2J3T D;  4YFM A;  4KZ3 A;  5KZH A;  1PFL A;  4X68 A;  3VV4 A;  1TDL A;  4LFU A;  2XK1 A;  1GSX A;  4B9O A;  1N9O A;  3CHW P;  3NEC A;  3T1R A;  3LEZ A;  3LR5 A;  3BFF A;  4R4S A;  2Y59 A;  4PKY G;  5DJT A;  1W63 M;  1PZO A;  4E6W A;  2I72 A;  5FEF A;  1OTA A;  2V1Z A;  3C8C A;  3GRJ A;  2WKH A;  3LR0 A;  4G3K A;  4BMW A;  5GHY A;  1H3Q A;  3O5Y A;  1ES3 A;  4ESP A;  1CEG A;  3UPO A;  1K6R A;  1OTD A;  5HL6 A;  4HQA A;  4S2M A;  5LBR A;  2NUP C;  3ZVW A;  3L9K A;  4PKY A;  4OQH A;  4ARZ A;  1Q2P A;  1YAX A;  2X71 A;  4KZ7 A;  3VP2 A;  4UQI M;  2GJ3 A;  1D06 A;  2WKP A;  1DRM A;  4LEN A;  3TG9 A;  4GD8 A;  1GSW A;  1DP6 A;  3Q82 A;  3G34 A;  1CJF A;  5DTK A;  4UHU A;  3VE3 A;  5J8X A;  5FAT A;  3QP5 A;  3GVB A;  2EX2 A;  1A0K A;  3UN7 A;  5CHU A;  2L1M A;  4YOF A;  3VSK A;  1CI9 A;  1XA1 A;  3BYD A;  1FIK A;  4S2N C;  3ITA A;  3MKE A;  2A2L A;  1E25 A;  4NXB A;  3MFD A;  4BLM A;  1YLT A;  3M6H A;  2X01 A;  4WLA A;  2J9O A;  3UDI A;  2HJ9 C;  3S7Q A;  3O3V A;  1C3B A;  5FQK A;  3B42 A;  2YKF A;  3O86 A;  1ESI A;  1LT0 A;  1X0O A;  1PIO A;  3T50 A;  5GHX A;  1OTB A;  3MZE A;  1ERO A;  2ZOI A;  4I39 A;  1VET A;  4KEN B;  2HDR A;  2OWJ A;  4Y15 A;  4KG2 A;  3T12 B;  4E04 A;  4WMC D;  5GLB A;  1F9I A;  4R4R A;  3EQV A;  4II7 A;  2P08 A;  2VV7 A;  1ZC2 A;  3PBQ A;  5G4Z A;  5IHV A;  3A3J A;  1K38 A;  1JVJ A;  1ZG6 A;  3HLE A;  2EA9 A;  2WAE A;  4HNB A;  2A24 A;  4I38 A;  2J3W A;  2DCF A;  3KSI A;  4ZJ2 A;  1BLC A;  3IT9 A;  4WL9 A;  4EUZ A;  5KIZ A;  1OPX A;  5FI6 A;  3NOU C;  1SZV A;  4O01 A;  3E2L A;  3BJN A;  4CQH A;  1MZU A;  3GV9 A;  5F6A A;  1M6K A;  4JBF A;  3ZNY A;  2BAS A;  4ZRR A;  4QY6 A;  2JKR M;  2Q0O A;  1FSW A;  1PWD A;  1P9R A;  4GKU A;  1N9N A;  1TS7 A;  3CPT B;  3PR6 A;  4OLG A;  3ZG9 B;  2B18 A;  3ZHH A;  2WZX A;  4IVI A;  4OPY A;  1IYS A;  3NHQ A;  4Z1W A;  3D3O A;  3SZT A;  1K56 D;  2OWH A;  3G32 A;  4KZ8 A;  1SKO A;  4IHQ A;  1K55 C;  1S6R A;  2ZMA A;  2HF6 A;  4MN6 A;  1Y28 A;  2OSU A;  5HX9 A;  3OCN A;  1VEU A;  1SKF A;  5EVI B;  4QB8 A;  3C5A A;  1UWP X;  3PYP A;  4OON A;  4EV4 A;  1S1Y A;  1WE4 A;  2PR6 A;  3IXD A;  3HCY A;  1VQQ A;  4IBX A;  4B88 A;  1Y4O A;  2DNS A;  3IS2 A;  1DP8 A;  2EX6 A;  4R3J A;  3MXR A;  4JPM A;  1XJ4 A;  1JTD A;  1T19 A;  5HFO A;  3DWK A;  4R0Q A;  5FL3 A;  2XDM A;  2KDK A;  4BJP A;  1AWI A;  4NXG A;  3DW0 A;  1ALQ A;  5L10 A;  3EEH A;  3HLW A;  1WYC A;  1ZKJ A;  3PTE A;  5CGW A;  3H82 B;  3QNB A;  2CMN A;  4WF0 A;  3E4O A;  4QJG A;  3F1P B;  4Y3I A;  5G4Y A;  4E3J A;  2Y2L A;  1MWT A;  3GEC A;  3WRZ A;  5FAO A;  3TW8 A;  4LRY C;  3CAX A;  2WAD A;  3OLO A;  4FTX A;  4GOG A;  4H6J B;  5EV0 A;  1ES5 A;  4E6X A;  1JWZ A;  1XP4 A;  3E98 A;  4OKP A;  2Y2H A;  4ZTK A;  4HP9 A;  1STZ A;  4RA7 A;  2ZC7 A;  3IQA A;  1L3L A;  4CPK A;  4F3L B;  1KE0 A;  3NDE A;  5TJJ A;  4CLC B;  1MWS A;  2A49 A;  3F1O A;  2G2U A;  3K2N A;  4OOY A;  4WEJ A;  1ES2 A;  2M7V A;  5GLD A;  3A3F A;  4R38 A;  2JKT M;  2V8C A;  4EXO A;  2QMI A;  4KZ5 A;  1LI9 A;  3VE4 A;  4F94 A;  3WS5 A;  1NZO A;  1DJC A;  3RXX A;  1O7E A;  1BLH A;  3MXS A;  4Z9Q A;  5CTN A;  3BLS A;  3BFG A;  3MBZ A;  3N8R A;  3MZF A;  4GW9 A;  2EX9 A;  3UE0 A;  3CMZ A;  1P9W A;  1BYW A;  3LR4 A;  4WN5 A;  2DMW A;  2FFY A;  3KX0 X;  4GLQ A;  1J9M A;  3RFB A;  5A92 A;  3SH9 A;  4KZ9 A;  4IBR A;  1RP5 A;  3LIE A;  2INW A;  2Y4A A;  1G5U A;  3N4I A;  1LSX A;  2V8F A;  1T18 A;  3EGX C;  3MFX A;  5U47 A;  4X6T A;  4DN0 A;  4R23 A;  3KO6 A;  3SW1 A;  1T1A A;  4HBU A;  4PPR A;  3BY8 A;  4MBH A;  4X1L A;  4Y7P A;  5F1G A;  4GCZ A;  4NXF A;  1ZTU A;  1SHV A;  3KSH A;  1HZO A;  3P01 A;  1NLY A;  4OLD A;  2VGL S;  3MF0 A;  3MXQ A;  2D01 A;  4HY8 A;  4EBL A;  3PAE A;  2J7V A;  3N7W A;  1NYY A;  4HOI A;  2QKP A;  4JGQ A;  4MBF A;  3V5M A;  2JKF A;  2VA0 A;  3UO9 A;  3A0S A;  5FA7 A;  3T1Q B;  2XFT A;  5FQM A;  3DAV A;  4LPZ A;  4EES A;  2Y2N A;  3G4P A;  4S2I A;  3W2Z A;  4Y5F A;  3OCL A;  1NLZ A;  3FKV A;  5CRF A;  4JLF A;  3ZG7 B;  5HW3 A;  3HUO A;  1L0F A;  4KG6 A;  2IWC A;  4I3A A;  3KSF A;  2PHY A;  3HUM A;  2QWS A;  1SCW A;  2GNX A;  1GHP A;  3OPH A;  5FAS A;  3LID A;  4NKP A;  1TD5 A;  2VJW A;  4LLO B;  2L4R A;  5EUA A;  2GX5 A;  1KGE A;  2XD5 A;  3DTI A;  3PBR A;  3EWK A;  5G18 A;  3HLC A;  2K7S A;  3FPW A;  1IKI A;  4JGO A;  4LV0 A;  1F98 A;  1GHM A;  5HAQ A;  3MQO A;  5EEC A;  3RH8 B;  1YKD A;  3ZG8 B;  1OTE A;  3MMH A;  2B5R A;  2GZA A;  5TR7 A;  1OT6 A;  4KQQ A;  4CLC E;  3ZCZ A;  1XA7 A;  2ZC4 B;  5AQB A;  1MKI A;  3UNW A;  3VP0 A;  4L9G A;  1NY0 A;  1S1Z A;  4XT2 B;  3WS1 A;  1LSV A;  1IYP A;  1KVM A;  1PYY A;  4PM5 A;  3C7V A;  3R7W A;  1OJG A;  5CGS A;  5J4E A;  3S22 A;  2Z6C A;  4R1G A;  3IX4 A;  1Z09 A;  3TJZ C;  3IHB A;  3L7H A;  3E4P A;  3T1S A;  1TEM A;  2QJ7 A;  1PI5 A;  5JYP A;  1FR1 A;  4E3O A;  4ZAM A;  5J3W A;  1CQA A;  2OAP 1;  4MNR A;  2G2W A;  3TSG A;  1S4R A;  4JGP A;  1K57 A;  2H10 A;  1JNU A;  3IXB A;  1KVL A;  3MKF A;  4EWF A;  4YIN A;  2J8Y A;  1N9L A;  4DXC A;  4DF6 A; 
#chains in the Genus database with same CATH homology
 3GDI A;  3MJQ A;  2XA7 S;  4I3I A;  5F69 A;  2KX6 A;  2P08 A;  2VV7 A;  3PBQ A;  5G4Z A;  3B47 A;  4P6Z M;  2EA9 A;  4HNB A;  2O99 A;  2A24 A;  4I38 A;  4GJ4 A;  3BQA A;  2J3W A;  1IFQ A;  1ODV A;  3UB7 A;  3LI9 A;  3KSI A;  3T4J A;  1P97 A;  4UEY A;  4EW7 A;  1T1C A;  3CI6 A;  3KSG A;  4WL9 A;  5F5Y A;  5KIZ A;  3LFV A;  1OPX A;  4ETZ A;  5DFY A;  2D02 A;  2WKR A;  3HJK A;  2L0W A;  5HZH A;  3PBN A;  3NOU C;  5AJG A;  3NOP C;  3T4S A;  1F5M A;  1T1B A;  2W3H A;  1GSV A;  4UQI S;  3BY9 A;  2V1A A;  5J7E A;  3S7O A;  4O01 A;  3ICY A;  3BJN A;  1S4S A;  2J80 A;  3EOI A;  4CQH A;  1MZU A;  5F6A A;  1IOU A;  4IUH A;  3C30 A;  2M1C A;  1W63 Q;  4LRX C;  2BAS A;  4ZRR A;  3C38 A;  2JKR M;  3IBR A;  1WA9 A;  1P9R A;  1NRJ A;  1N9N A;  1TS7 A;  1TS6 A;  3OOV A;  1XJ2 A;  2HV1 A;  3PR6 A;  2B18 A;  4HJ4 A;  2W0N A;  5DF9 A;  5EFW A;  2A24 B;  3MQ0 A;  4L9F A;  4MN7 A;  3R4K A;  2KLI A;  1LL8 A;  2K31 A;  4CLC C;  3HJI A;  3NJA A;  3NHQ A;  4O8G A;  1V9Z A;  2FZ0 A;  3A0R A;  4YWZ A;  3S7P A;  4Z1W A;  3D3O A;  2OWH A;  3UE3 A;  3T4T A;  1P0Z A;  4G3V A;  1VHM A;  3T4O A;  4IHQ A;  2HF6 A;  2W3D A;  4MN6 A;  1Y28 A;  2IA2 A;  5DFX A;  3BWL A;  2NUT C;  1LSW A;  2OAQ 1;  3KYQ A;  3OCN A;  1OJ5 A;  2VEA A;  3FC7 A;  4HJ6 A;  4QPR A;  3BQ8 A;  2LB9 A;  1UWP X;  3PYP A;  4MCW A;  3EQU A;  3F1P A;  4BBU A;  1S1Y A;  2PR6 A;  3EEA A;  3HCY A;  1UGU A;  1TS0 A;  4Y2F A;  3B33 A;  2JKT I;  4NXE A;  3BW6 A;  2PYR A;  2YKH A;  4P6Z S;  3IS2 A;  1DP8 A;  4WEL A;  4EER A;  4H6J A;  4JGR A;  2KOI A;  4L0L A;  3G6O A;  4I5S A;  3PHY A;  1XJ4 A;  3D72 A;  1XFQ A;  1T19 A;  3PXP A;  4AFI A;  5HD5 A;  5FL3 A;  4IUK A;  3LYX A;  2KDK A;  3RTY A;  4BJP A;  2W1T A;  2W3F A;  1S67 L;  4NXG A;  2H28 A;  5DKL A;  1XFN A;  3JVU A;  4CLC A;  2JN7 A;  4WUJ A;  3EEH A;  5HSQ A;  4YNR A;  3H82 B;  2J3T C;  2MJ6 A;  2PD8 A;  2CMN A;  4WF0 A;  3CUE C;  3E4O A;  4GHI A;  3F1P B;  4LRZ E;  1S66 L;  4Y3I A;  5G4Y A;  4WEK A;  3TRC A;  3GEC A;  3TW8 A;  5IS1 A;  4LRY C;  2O0Y A;  1MC0 A;  2ZMV A;  3LIC A;  3CAX A;  5A8B A;  3OLO A;  3IS2 B;  2VV8 A;  2W1R A;  5K5B A;  4H6J B;  3FPV A;  4HJ3 A;  2Y79 A;  4MN5 A;  1H8M A;  3PBO A;  4L9E A;  3UB9 A;  3UB6 A;  3E98 A;  3UMD A;  2W1T B;  4HP9 A;  1STZ A;  5DJU A;  3TE8 A;  3S7N A;  2ZMF A;  4F3L B;  2VGL M;  3H9W A;  2B02 A;  5TJJ A;  3FG8 A;  4CLC B;  2HGV A;  2O9C A;  4MDZ A;  5HPI A;  5IU1 A;  3U2A A;  5HPF A;  3F1O A;  2P04 A;  2EWV A;  3K2N A;  2I9V A;  4KUO A;  4WEJ A;  3H7W A;  2M7V A;  4R38 A;  4GHI B;  3CIT A;  5HWV A;  2JKT M;  5HDD A;  4EXO A;  2XSS A;  3VE4 A;  1XJ3 A;  3V67 A;  4DJ2 A;  2PD7 A;  3MR0 A;  5TBM A;  1EW0 A;  1VB6 A;  2W27 A;  4Q0J A;  4OOM A;  2QHK A;  3CUE A;  3UE6 A;  1OT9 A;  4PHT A;  4GW9 A;  3OBF A;  4NEE D;  3KYZ A;  4HHD A;  4CLC D;  3F1N A;  1YSQ A;  3H82 A;  3LIA A;  1P9W A;  3PBS A;  1BYW A;  3LR4 A;  3JVV A;  4FSF A;  1DP9 A;  4WN5 A;  3MQQ A;  3ULF A;  3LR3 A;  2VLG A;  2DMW A;  3ZYT A;  1G6O A;  4M4X A;  3EGD C;  3F1O B;  3P7N A;  3KX0 X;  4GLQ A;  2Y8H A;  3RFB A;  4BBV A;  4IJG A;  3C2W A;  3H7W B;  5HDC A;  3CLO A;  3UME A;  4MMN A;  4EU0 A;  4ETX A;  3LIE A;  2INW A;  3CWF A;  2QYB A;  4KQO A;  1LSX A;  2LB5 A;  3T4L A;  5TBM B;  2FH5 A;  1T18 A;  4R70 A;  3VOL A;  5KSH A;  3EGX C;  3MFX A;  1TS8 A;  3LUQ A;  4EQ1 A;  3K3C A;  2VX8 A;  4DN0 A;  3KO6 A;  3SW1 A;  1T1A A;  4F3L A;  4DJ3 A;  3BY8 A;  1XJ6 A;  4ME4 A;  3F1N B;  4KQD A;  2ZOH A;  2V0W A;  4I3J A;  5DKK A;  4GCZ A;  2R78 A;  2P7J A;  4NXF A;  1ZTU A;  3KSH A;  2Z6D A;  5AVE A;  3OC2 A;  3P01 A;  2WKQ A;  4R3A A;  1ZHH B;  1NLY A;  2VGL S;  3MF0 A;  3MXQ A;  2D01 A;  4HY8 A;  2PDR A;  5CX7 A;  3LIB A;  4OOL A;  5F68 A;  4HOI A;  2QKP A;  4JGQ A;  5AVF A;  3R7W B;  3LIF A;  2HJE A;  5I5L A;  2QJ5 A;  2XRN A;  3E4Q A;  4GS9 A;  5HWW A;  1V9Y A;  2O9A A;  2J3T D;  5HDS A;  2VA0 A;  3A0S A;  3VV4 A;  1D7E A;  4LPZ A;  4EES A;  3A0V A;  3T4Q A;  4EUV A;  5MC7 A;  3W2Z A;  1G28 A;  1GSX A;  3LI8 A;  4B9O A;  4Y5F A;  1N9O A;  3OCL A;  1NLZ A;  3LR5 A;  4PKY G;  5DJT A;  4I3A A;  3DBA A;  1W63 M;  3KSF A;  2JHE A;  2XA7 M;  2K2N A;  2PHY A;  4O0P A;  4XT2 A;  5HD3 A;  1OTA A;  1YSP A;  2QWS A;  2GNX A;  3C8C A;  3LID A;  4NKP A;  1TD5 A;  2VJW A;  3LR0 A;  4LLO B;  2L4R A;  4G3K A;  3IBJ A;  4BMW A;  2EWW A;  1H3Q A;  3O5Y A;  2GX5 A;  3PBR A;  3EWK A;  4HP4 A;  5HL6 A;  1OTD A;  1TF1 A;  2K7S A;  4HQA A;  1KOU A;  5LBR A;  2NUP C;  2O9B A;  3E0Y A;  2V9A A;  3FPW A;  4PKY A;  4JGO A;  2OOL A;  1F98 A;  4GS9 B;  4KUK A;  2XRO A;  5HWT A;  4ARZ A;  2G7U A;  4Q0H A;  1YAX A;  4UQI M;  3MQO A;  2GJ3 A;  1D06 A;  3K3D A;  4HI4 A;  4BWI A;  2ZBB A;  2WKP A;  1DRM A;  3RH8 B;  3T4K A;  1YKD A;  1OTE A;  3UB8 A;  4K08 A;  2VV6 A;  1GSW A;  1DP6 A;  3MMH A;  2GZA A;  4CLC E;  1OT6 A;  3VE3 A;  3NOT C;  4RQ9 A;  4G3W A;  3ZQ5 A;  1OTI A;  4L9G A;  1S1Z A;  1UWN X;  4XT2 B;  1LSV A;  2VKS A;  4HH2 A;  2L1M A;  4YOF A;  1NWZ A;  3R7W A;  1OJG A;  5J4E A;  4DMZ A;  4EET B;  2Z6C A;  4FOF A;  2JKR I;  2W3E A;  2A2L A;  4NXB A;  3TJZ C;  2VZW A;  2PR5 A;  2W3G A;  3E4P A;  2QJ7 A;  4WLA A;  4BBT A;  4HH3 A;  2HJ9 C;  3S7Q A;  4B93 A;  4EEU A;  3B42 A;  2YKF A;  5J3W A;  4ARZ B;  1LT0 A;  1MKM A;  2OAP 1;  4PAU A;  3PBT A;  1X0O A;  3T50 A;  5L8M A;  2PT7 A;  1OTB A;  4EEP A;  2V0U A;  1S4R A;  4JGP A;  2ZOI A;  4I39 A;  4HIA A;  1JNU A;  5C5K A;  5IT5 A;  2V1B A;  2OWJ A;  4R6L A;  4E04 A;  1N9L A;  1F9I A;  3EQV A;  4II7 A;  2M7U A;  2PYP A;  4Q0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...