1NRJA

Signal recognition particle receptor beta-subunit in complex with the srx domain from the alpha-subunit
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
155
structure length
147
Chain Sequence
MFDQLAVFTPQGQVLYQYNCLGKKFSEIQINSFISQLITSPVTRKESVANANTDGFDFNLLTINFNALFYLNKQPELYFVVTFAEQTLELNQETQQTLALVLKLWNSLHLSESILKNRQGQNEKNKHNYVDILQGIEDDLKKFEQYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition particle receptor alpha subunit homolog
publication title Structural Basis for the Function of the beta Subunit of the Eukaryotic Signal Recognition Particle Receptor
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 36
structure length 147
sequence length 155
ec nomenclature
pdb deposition date 2003-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09201 SRX SRX, signal recognition particle receptor alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1nrjA00
1NRJA 2XA7S 4NEED 2XA7M 2JKRI 5MC7A 2FH5A 4UQIS 4P6ZS 2HF6A 2VGLS 1W63Q 4UQIM 2JKTI 4P6ZM 2VGLM 2JKRM 1W63M 2JKTM 3TJZC
chains in the Genus database with same CATH superfamily
4Z1WA 3IH8A 4OQHA 4GDBA 4FSFA 1JVJA 3MZDA 3H7WA 5AQAA 4P0MA 2FZ0A 3GECA 1G28A 5CERA 5CGSA 1CK3A 2PHYA 4P87A 3AGEA 3FKVA 1UGUA 1NYMA 3E2KA 5TGFA 4Q8IA 2WKEA 4N1XA 2XROA 1XJ4A 4GNUA 3KSGA 1N9BA 2WKPA 2V1ZA 1V9ZA 2OLUA 3P09A 2O9BA 2O9CA 1GHPA 2D01A 5A91A 3PBRA 1ONHA 4Q0JA 3VP1A 2WKRA 4DRTA 1VEUA 2Y59A 1KE3A 5EV0A 2CMNA 4CLCB 5DFYA 3FG8A 3N8RA 2ZM2A 1D1JA 3BFDA 1Q2PA 3QHYA 5DJTA 5KSHA 3IF6A 4P6ZM 4LCLA 4HI4A 1H8ZA 5BOHA 1Y54A 2QMIA 1SDEA 3VP4A 3NCKA 2G7UA 1MC0A 1E25A 1K0KA 4LFUA 1DY6A 3IF5A 4NXFA 3BLMA 3D3OA 4R70A 5DF7A 3VE4A 4DXCA 3BQAA 5CGXA 5J7EA 1Z6FA 3QP8A 4A5RA 4E3MA 1W5DA 2VKSA 3NOUC 2P9VB 4KUOA 3ZG8B 5HZHA 1BLPA 1PW1A 3GMWA 3MF0A 5FEGA 4UQIS 2R78A 1XKZA 2M7UA 4R3JA 5IHVA 3T12B 4CLCA 4GD6A 2MJ6A 1WA9A 1H5XA 4BD0A 2XRNA 3VV4A 4DJ2A 1KE4A 4JXSA 5DTTA 3PBOA 3E4PA 3UE6A 4JGPA 2ZMVA 4II7A 5FQQA 3NOTC 3IF6C 3S7NA 3BY9A 2IWBA 2H0YA 3E4QA 1JWPA 3NJAA 2W3GA 3OCNA 3UPPA 1WE4A 2M7VA 5HFOA 1MKIA 3BECA 3RJUA 1GHMA 3T1RA 4BMWA 3LEQA 1YMSA 2Y2LA 2P04A 3HUMA 4I3JA 1OJ5A 3HCYA 4OPZA 2UWXA 3M2KA 1L0EA 4QPRA 4IVIA 4MN7A 2P9VA 5CHMA 3IX8A 1YT4A 2WK0A 1PIOA 5A93A 3RH8B 3C38A 5F69A 3DTIA 2A3UA 3WS2A 1EI5A 3T4TA 4OKPA 3QP5A 1EROA 5FI7A 5CX7A 1W8QA 5E2GA 1K4EA 4KZ4A 4E3KA 5IU1A 1OT6A 1JWZA 3UB6A 2JKRI 1ES4A 2XGNA 2Y2HA 1BT5A 4MEZA 2X01A 3LFVA 1PYYA 1HVBA 1O07A 2ZQAA 2PYRA 3AGDA 3PAEA 4WM9A 3ZG9B 1GSVA 3F1NB 4MBKA 1M6KA 3HLDA 3B33A 1OPXA 2XSSA 1NLYA 3DTEA 3D4FA 5GHXA 2B95A 3S1YA 4WELA 4NK3A 3FPWA 2NUTC 1Y28A 1FR6A 5FAPA 1NXYA 5G4ZA 4ZDXA 2BG1A 3LR3A 3NDEA 5HDCA 3KSFA 1HLUP 1K56D 5F82A 2XFTA 3SH8A 3WRZA 4R0QA 2E8JA 4RVAA 2CC1A 5CHUA 5FI2A 2V9AA 3A3IA 3VSLA 4O01A 2XFSA 2ZLYA 1ESUA 5EVIB 5HAPA 5CEBA 1ZG6A 1ES2A 1XFNA 3HLBA 4WZ5A 4FD8A 1NRJA 4OVDA 3C8CA 5MC7A 2Y91A 4D2OA 1L3LA 2C6WB 3G32A 3F1NA 4LV2A 3D9YA 2WAEA 4GD8A 1MWUA 4B4XA 1DJAA 4JGQA 4E6XA 2HP5A 2G2WA 1ZHHB 3K2NA 4ZRRA 2OV5A 4IJGA 1V9YA 4NKPA 3LUQA 3T4KA 3NC8A 2I9VA 2PT7A 3BY8A 3SS5A 4H8RA 3T1XA 1T18A 3CJMA 2VZWA 2KDKA 3BLSA 2ZBBA 4KQDA 2VEAA 2PRFA 3Q7VB 5EVIA 5HWVA 3FWLA 1H0MA 4EBNA 4LV1A 1W63M 1SKFA 1W8YA 4C6YA 2Q9NA 1OTAA 2A49A 2Q0OA 4X53A 4WZ5C 1XGIA 2HZ5A 1RCJA 1S6RA 3W4OA 3S7QA 2XA7S 5F1FA 2INWA 3PBSA 4RYEA 4UQIM 4HH2A 3DTKA 4I3AA 2ZC7A 3ZGAB 1CI8A 4DXBA 4HP4A 3LIBA 3C7VA 1PW8A 1MXOA 1ALQA 3ULFA 3S7PA 4BQMA 4E3LA 2WZXA 2L0WA 5EECA 4B4ZA 1S67L 1TS8A 3C30A 4PM5A 3OC2A 1ES3A 4E3JA 3CMZA 3PBQA 3PAGA 1TS0A 4S2LA 4ZTKA 5HAIA 1Z09A 3IBRA 5HX9A 4MN6A 4JPMA 3OOVA 3IT9A 3Q7VA 3Q82A 1K54A 3E0YA 5KMWA 2ZC4B 4HNBA 2R9WA 1FILA 1UWPX 2C5WB 4KZBA 3S7OA 1X0OA 3V50A 4U3TA 4DDSA 1MZUA 5GLCA 4E6WA 1ACFA 1LL9A 4Y2FA 2B5RA 1XP4A 3U2AA 3MR0A 5EOEA 1FOFA 1H8MA 4HOIA 4GS9B 5TJJA 2JN7A 2PR6A 2A24A 4MMNA 3W4PA 1XX2A 2ZC5B 2O0YA 3AGFA 4HP9A 4NG2A 2RCXA 4R3BA 3IHBA 3BFEA 3WS5A 1N9LA 4DN0A 2DCFA 3KYQA 5DKLA 5A8BA 3T4JA 2XD1A 1E3UD 4Q0IA 1OMEA 3M6HA 4EV4A 2QJ5A 4U0TA 3VOZA 3MQOA 3FKWA 4N1HA 2V1BA 4JXGA 3GTCA 1K54C 5FEFA 4L9EA 2HP6A 4I38A 1LL8A 3L9KA 2Z6CA 4I3IA 5FQJA 3KX0X 2HF6A 4N9LA 4D60A 3UE3A 2YKFA 4I5SA 1DJCA 1DJBA 3ZNYA 2QYBA 3ISGA 3ZYTA 4EEUA 3A0VA 1K25A 4C75A 2WKHA 2XK1A 4JGRA 1PWCA 3CI6A 3ITAA 4EWFA 2Y8HA 4XT2A 3E2LA 3ZG7B 4UA7A 2B02A 3PXPA 4S2OA 1LSVA 4EEPA 3BFFA 4Y5FA 3UE0A 1T1BA 3TSGA 2ZQ9A 5FATA 4WF0A 3G2ZA 2V0UA 3CUEA 1GSWA 4EQ1A 4FH4A 4GJ4A 4QY5A 3UPNA 2PBDP 4FUWA 1PFLA 1OT9A 1G6OA 1T19A 2BTFP 1W63Q 3N8LA 3G2YA 3Q7ZA 3E98A 3RTYA 5CHJA 3SW1A 4LRXC 2GDNA 1CI9A 5A90A 1K55A 4R6LA 2LB9A 1TS7A 2X02A 3IXHA 3LI9A 2WAFA 3B3XA 1NLZA 1J3WA 3KYEA 3GDIA 4LRYC 2UV0E 3UB7A 2Y2PA 2JKTI 2G2UA 5K5BA 4YFMA 1IYPA 5GLDA 3F1PA 1N9OA 2H28A 4OPQA 1P0ZA 3DAVA 1ZG4A 1CJFA 4O7DA 5HD5A 4Y0UA 4EUVA 3LY3A 4BBUA 4G3WA 4JBFA 3H9WA 3T4LA 4KZAA 5EE8A 2EXAA 1F98A 3OLOA 3GSGA 4B88A 1GHIA 3CUEC 4Y13A 1IEMA 4ESPA 3EEAA 4KUKA 3PBTA 2WYXA 1SCWA 1MY8A 1XA1A 4QB8A 2OAQ1 2PDRA 3O86A 1AXBA 4KQQA 3UB8A 2XA7M 1PWGA 2WGWA 2XF3A 4EESA 2VGKA 3ZCZA 3IWQA 1K55C 2EX8A 2PD8A 3P98A 3MXQA 5M18A 1OTEA 2K31A 1W7FA 3LR5A 3LO7A 4F3LB 4MCWA 5G4YA 4LLOB 2K2NA 2JC7A 1W79A 4ARZB 4P6BA 1T1CA 2ZMAA 2P7JA 4E3NA 1XA7A 5IS1A 1MWSA 4HHDA 3VSKA 1K4FA 4IEDA 2ACGA 4BENA 1LHYA 1ERQA 1EWZA 3HLEA 1OJGA 3ZQ5A 1IKIA 5DF9A 3KSHA 5FA7A 3EWKA 5I5LA 2L1MA 3B42A 3ZG5A 5TBMA 1LT0A 5FL3A 4LENA 4B93A 4CLCE 3NULA 4K08A 4R1GA 5FDHA 4KZ9A 3BRMA 2FFYA 2IWCA 1F5MA 3V3RA 4LRZE 1K56A 4KZ6A 3MQ0A 4K0WA 4F3LA 2HDUA 5CXWA 1UWNX 2Q9MA 2Y2IA 3UO9A 1YSQA 1HD8A 3JYIA 3LR4A 4ARZA 5HAQA 4EU0A 3ZDJA 1YLYA 1YLTA 2PU4A 1PI5A 2DMWA 1JWVA 3CAXA 3EGDC 4EERA 1Y4OA 4WYYA 4QJGA 1FR1A 4CPKA 3N8SA 4KG2A 2L4RA 2JKFA 1XJ6A 1BYWA 2XR0A 5AQBA 5F1GA 2OSUA 1XJ3A 3A3JA 1F9IA 3UMDA 4QU3A 2OLVA 2KLIA 3WS4A 3V5MA 3VMAA 3JVVA 2W3DA 3BWLA 4IHQA 1S1ZA 4KQOA 4L9GA 3UDFA 2JE5A 4JXVA 3CWFA 1IYSA 4EXOA 2W1RA 1VETB 3U4LP 3FZCA 3NDGA 4Y15A 3LIAA 4OLDA 5J8XA 5EVLA 3GV9A 2GX5A 3CPTB 1YLJA 5FAQA 4PM8A 1ESIA 3DWZA 3VE3A 2HDQA 3O87A 4NXEA 4S2PA 2QWSA 4WL9A 2H5SA 3A3FA 4X69A 3OPLA 3TG9A 1FIKA 2GZAA 2H10A 4GCZA 3OPPA 3SH7A 4PAUA 4YOFA 1PWDA 3IXGA 1ERMA 2AVXA 4ETXA 3BM6A 2D02A 3CHWP 1VETA 3PBNA 3N7WA 3MBZA 1IYOA 2VX8A 2GNXA 2R9XA 3G31A 4RQ9A 3VP0A 1GSXA 1VB6A 3ZFZA 1FSWA 5HARA 3FPVA 1MWTA 3CPTA 1VHMA 2YKHA 1NRFA 3WRTA 4PM9A 1I2WA 4GDNA 4M4XA 3G30A 4GW9A 3MKFA 4U0XA 5EUAA 5TFQA 3M2JA 3QP6A 3LGOA 5JYPA 1K38A 1K6SA 4KG5A 4RX3A 4E3OA 5FI6A 2ZOIA 5E2HA 4M3KA 3TRCA 1IOUA 1H3QA 3IXDA 5DF8A 3DBAA 4ZJ1A 1YLWA 3E4OA 1IYQA 4MBFA 4ZBEA 2EX9A 3MKEA 3KO6A 2OWHA 4XUZA 4EUZA 5GHYA 2HDSA 5GL9A 2A24B 2JHEA 3L7HA 4HJ3A 1E3UA 3HLWA 1KOUA 4NXBA 4Y0OA 5FSRA 3W4QA 3UMEA 3FV7A 1BULA 2A2LA 2FH5A 1SHVA 2EXBA 3IS2B 3SZTA 1JTDA 5HWWA 3QP2A 3GRJA 3IWOA 2P08A 2HJEA 4MBHA 4G3KA 2ZD8A 3P7NA 1OTBA 3Q81A 2EX2A 3LEZA 3QNCA 4O8GA 2BASA 3RXWA 3JVUA 1NZUA 4ETZA 1LSWA 4DE1A 4QD4A 3ICYA 1U60A 1PZPA 4IUKA 3LIDA 4YINA 3IH9A 4EBLA 3BFCA 5FDSA 2QHKA 4OQGA 4X56A 4KZ8A 3MS6A 4Y17A 4HESA 1G68A 2O99A 1DP8A 4EQIA 1KE0A 3HUNA 2IA2A 2ZQ8A 3HREA 2DRWA 3R7WB 1SKOA 1HTZA 2PR5A 1I5QA 2B18A 4K0XA 4FTXA 1S4SA 4XT2B 4IUHA 5A92A 1BSGA 5AQ7A 3I7JA 1P9RA 3IS2A 3G34A 1WYBA 1NYYA 4IVKA 4BWIA 3VFFA 5EVEA 4UEYA 2V0WA 1TVFA 1CF0A 2M1CA 3BJNA 4ME4A 2WKQA 4PKYG 4R4RA 5L07A 4GKUA 4GN2A 1XGJA 3HVFA 1K6RA 2GJ3A 2Y2GA 4FCFA 3MQQA 1IFQA 4JGOA 5C5KA 4N92A 3LICA 2XEPA 3EQUA 3T4QA 4X6TA 2OAP1 2J3WA 1XXMA 1ZTUA 2EFXA 1N4OA 2VA0A 2WUQA 3F1PB 2V2FF 1I2SA 4DMZA 3R7WA 3O5YA 3PHYA 1YPRA 2Y2MA 4UA6A 1A0KA 1L0FA 3B47A 4JF4A 1FCMA 3HL9A 3LR0A 1BTLA 3G6OA 5IT5A 3C4PA 1BLCA 1L0DA 1TF1A 3HUOA 3OPRA 5HPIA 2PD7A 4RA7A 3TE8A 2X71A 3S4XA 4BJPA 4DE0A 1HZOA 3NHQA 2ZMFA 5FAOA 1PNEA 5L09A 2Y2QA 2WGWB 2Y4AA 1SDNA 3IX3A 4Y3IA 2J3TD 3HLFA 2ZC3B 2ZM8A 4DF6A 4WLAA 2EX6A 5HD3A 4GHIB 4KZ7A 4X68A 5FQKA 1FSYA 4R23A 4YWZA 2PBYA 1KDWA 1Q2QA 1RGYA 3MMHA 2WZZA 1FCOA 3ZNTA 3UY6A 1P97A 3CLOA 2PAVP 1ONGA 2VJWA 3WS1A 2Y2JA 3N6IA 4HBTA 1BZAA 4R38A 3EGXC 1ODVA 1TEMA 3MZFA 4WEKA 2VV7A 4GZBA 2LB5A 1BUEA 1YQSA 3ITBA 3LI8A 5TBMB 4HJ6A 4OP5A 2PU2A 3F1OA 4JLFA 4HIAA 1YAXA 1AWIA 4LPZA 3Q07A 4NEED 1L2SA 3Q1FA 2P74A 3OPHA 5TR7A 2JKRM 3C5AA 4S2IA 4GHIA 4R3AA 2J8YA 4QWOA 2J9PA 3DW0A 3CITA 3QNBA 5HPFA 5CEDA 1TS6A 4OH0A 3W2ZA 4UHUA 1VQQA 2E8IA 4OLGA 1TD5A 1J9MA 4ZJ2A 3VFHA 3S22A 3G4PA 4IBXA 2HJ9C 5FQMA 1BLHA 5AQ9A 1YLPA 1TDLA 1QMEA 4PM6A 3ZVWA 4FOFA 4KZ5A 5KSCA 3K3DA 2J80A 3UN7A 1K57A 2HGVA 2OWJA 4WEJA 4E3IA 3NY4A 1NZOA 2Y2OA 3C7UA 2VV6A 5DVAA 4OPYA 5CECA 3BYDA 3C4OA 1NWZA 4UA9A 2ZQCA 3KSIA 3CZDA 1OTDA 2IWDA 4KZ3A 3MSHA 4XXRA 3T50A 5L2FA 4BL3A 4KENB 1SZVA 3ZHHA 3FC7A 3HLGA 2W3FA 2VGLS 4NXGA 1MPLA 4OOMA 3A0SA 1PRQA 3UDXA 4EETB 1ES5A 2WADA 2VK3A 3NOPC 4O0PA 3KYZA 3NI9A 4DDYA 2JBFA 5KIZA 4LCMA 2ZQ7A 4DJ3A 2JKGA 4S2KA 4EW7A 2W3EA 4CQHA 5F5YA 3PYPA 3FYZA 1NY0A 4P85A 2KX6A 5EM0A 3WS0A 3MFDA 1CQAA 3UNWA 2J7VA 1PI4A 3HJKA 1S1YA 4BL2A 1KGGA 4ZJ3A 2HV1A 4BD1A 2NUPC 2Z2LB 1IELA 4HY8A 4S2NA 3SS4A 3N4IA 1K57C 4BBTA 1N9NA 2O9AA 4L9FA 1LL5A 4PHTA 4KQRA 1E4DA 1PZOA 4KG6A 5HWTA 1MKMA 2XD5A 2VGJA 4CLCC 1ZKJA 2XDMA 4B9OA 1XFQA 3VP3A 3GQZA 5U47A 1IKGA 5JYOA 5G18A 1KGEA 1P9WA 5FQIA 2QZ6A 2DNSA 5DTKA 3QP4A 4CLCD 2OOLA 4MNRA 4JKTA 5E2EA 4X1MA 4Q0HA 4PKYA 5J4EA 4N9KA 5HW3A 3BW6A 5J3WA 5M1AA 2XQZA 5CTMA 4NETA 3V3SA 4I39A 2Z6DA 4EBPA 4UAAA 1S4RA 2EFUA 4HEFA 5EM1A 4OOYA 4GLQA 4OQIA 3IQAA 4S2NC 3LIEA 4GOGA 3TW8A 1D7EA 5M19A 5HDDA 4GB7A 5E43A 1NJ4A 4L0LA 1VM1A 4G3VA 1O7EA 3W8KA 5HDSA 1T1AA 3DWKA 5DTSA 1OTIA 1RGZA 1STZA 5I94A 1ZC2A 3GVBA 5AJGA 3SS3A 2Y2KA 4PPRA 3PTEA 1KVMA 3OBFA 4X25A 4S2MA 4H6JB 1FQGA 5D3OA 1KDSA 3MZEA 3NECA 2V8FA 2ZQDA 4WMCA 4OOLA 3NBLA 3MXSA 2W3HA 3WWXA 4F94A 4R4SA 3MJQA 1LI0A 5L10A 3SOIA 1YKDA 3LY4A 1XPBA 5EFWA 3BEBA 2ZOHA 2K7SA 3VOYA 4DE3A 3JPUA 2EWWA 5EPHA 3HBRA 2EWVA 3C2WA 3SH9A 4QY6A 4LV3A 4ZAMA 5F68A 4MN5A 3T1QB 3K3CA 4P6ZS 2HDRA 3T4SA 4X55A 2V1AA 5DFXA 4PMAA 3NIAA 4H6JA 3BFGA 3EQVA 3MFXA 2ZL1B 3G35A 1G6AA 1SKOB 4QHCA 3T1SA 3UPOA 4RX2A 5KZHA 4IBRA 4S2JA 1GA0A 3BQ8A 4DE2A 1YM1A 3A3EA 1JNUA 5HSQA 1FCNA 5GLBA 3LIFA 2RL3A 4OP8A 1GCEA 3TJZC 4WMCD 3O3VA 1C3BA 2Y79A 3GR2A 4DKIA 1BLSA 5CTNA 3HJIA 2VLGA 3UDIA 4LGWA 3O88A 3UE1A 2W1TB 2Y2NA 3D72A 5CGWA 2Y55A 2W0NA 1YSPA 3IX4A 5CRFA 1F2KA 5FASA 2VGLM 4PM7A 3OCLA 3R4KA 4BBVA 1JTGA 5LBRA 3VP2A 1MWRA 3IWIA 5DKKA 1H8YA 5EVIC 2VV8A 3OZHA 1LLBA 2WKIA 3UB9A 4HBUA 3T4OA 3IBJA 4AFIA 2ZL1A 2BLSA 5AVFA 2ZC6B 1DP6A 2JKTM 4WN5A 4HJ4A 3MXRA 5EVID 3EEHA 2FFFB 2QJ7A 4JF6A 4CJNA 3H82B 5F6AA 3QP1A 4HH3A 4K91A 5L8MA 4ID4A 2I72A 5F83A 3V67A 4MDZA 2QKPA 2Z2MB 3RXXA 1DP9A 2J9OA 1CEFA 1S0WA 3IHAA 4C3QA 2W27A 1GA9A 3A3DA 5HL6A 1KVLA 1YMXA 1M40A 4MLLA 3UB5P 2QPNA 5DJUA 4E04A 1RP5A 4JXWA 4OQ0A 4X1LA 2W1TA 2XH9A 3VOLA 2H0TA 4WZ4A 1CEGA 5GLAA 3IXBA 4HQAA 3PR6A 3H7WB 3LCEA 3M6BA 1S66L 3P01A 3RFBA 4BLMA 4Y7PA 1DRMA 4Z9QA 2XLNA 2HP9A 3CG5A 2KOIA 4LV0A 1L0GA 3V39A 2ZJ9A 3ZG0A 1QMFA 4JF5A 3ZVTA 1TDGA 2V8CA 4WUJA 5AVEA 2JCHA 2WGVA 1YLZA 2PYPA 5FQ9A 1LI9A 3H82A 5GHZA 1EW0A 1WYCA 4XUXA 3TOIA 1MBLA 3HLCA 4GS9A 1XJ2A 3DTMA 5E2FA 1LSXA 1VEUB 2J3TC 2EA9A 3A0RA 1G5UA 1KGFA 3LYXA 4OONA 1D06A 3F1OB 5EOOA 2HPBA 3EOIA 4FH2A 2V20A 4WBGA 4OPRA 3IF6B 2WGIA 4Y0TA 2ZM0A 4YNRA 5HL1A
chains in the Genus database with same CATH topology
1OTDA 4Z1WA 3OOVA 3T50A 2GZAA 4GCZA 4FSFA 3FC7A 3H7WA 3E0YA 2FZ0A 2W3FA 4HNBA 2VGLS 3GECA 4NXGA 1G28A 1UWPX 4OOMA 2PHYA 4PAUA 3S7OA 3A0SA 1X0OA 4YOFA 4EETB 1MZUA 3NOPC 1UGUA 4O0PA 3KYZA 4ETXA 2D02A 5KIZA 2XROA 1XJ4A 4Y2FA 4DJ3A 3PBNA 4EW7A 3KSGA 2W3EA 3U2AA 2VX8A 4CQHA 2GNXA 3PYPA 3MR0A 5F5YA 2KX6A 4RQ9A 1H8MA 4HOIA 4GS9B 2WKPA 1GSXA 5TJJA 2JN7A 1VB6A 1V9ZA 2PR6A 3HJKA 1S1YA 3FPVA 2A24A 2O9BA 2O9CA 2HV1A 2D01A 4MMNA 2NUPC 3PBRA 4HY8A 4Q0JA 2O0YA 2WKRA 4HP9A 1VHMA 4BBTA 2CMNA 2YKHA 1N9NA 4CLCB 2O9AA 4L9FA 5DFYA 1N9LA 3FG8A 4PHTA 4M4XA 4DN0A 4GW9A 3KYQA 5HWTA 1MKMA 5DKLA 5A8BA 3T4JA 4CLCC 4Q0IA 5DJTA 4B9OA 1XFQA 5KSHA 2QJ5A 4P6ZM 4HI4A 3MQOA 2ZOIA 3TRCA 1P9WA 1IOUA 2V1BA 1H3QA 2G7UA 4CLCD 1MC0A 2OOLA 4L9EA 3DBAA 1LL8A 4I38A 2Z6CA 4Q0HA 4I3IA 4PKYA 5J4EA 3KX0X 4NXFA 2HF6A 3E4OA 3D3OA 4R70A 3BW6A 5J3WA 3VE4A 3UE3A 2YKFA 4I5SA 3KO6A 2OWHA 3BQAA 4I39A 5J7EA 2Z6DA 2A24B 1S4RA 2QYBA 2JHEA 3ZYTA 4EEUA 4HJ3A 3A0VA 1KOUA 2VKSA 4NXBA 3NOUC 4KUOA 4GLQA 4JGRA 5HZHA 3UMEA 3CI6A 3MF0A 2A2LA 2FH5A 4UQIS 2R78A 3LIEA 2Y8HA 3IS2B 4XT2A 2M7UA 3TW8A 2B02A 3PXPA 1D7EA 5HWWA 1LSVA 4CLCA 4EEPA 5HDDA 2MJ6A 1WA9A 4Y5FA 2P08A 2HJEA 1T1BA 2XRNA 3VV4A 4DJ2A 4WF0A 3PBOA 3E4PA 4G3KA 4L0LA 2V0UA 3CUEA 3UE6A 3P7NA 1GSWA 4EQ1A 4G3VA 1OTBA 4JGPA 4GJ4A 2ZMVA 4II7A 5HDSA 1T1AA 3NOTC 3S7NA 1OTIA 1STZA 4O8GA 1OT9A 1G6OA 1T19A 3BY9A 2BASA 3E4QA 1W63Q 3NJAA 3JVUA 2W3GA 3E98A 5AJGA 3RTYA 4ETZA 1LSWA 3SW1A 4LRXC 3ICYA 3OCNA 2M7VA 4IUKA 3LIDA 3OBFA 4R6LA 2LB9A 1TS7A 3LI9A 2QHKA 4H6JB 4BMWA 1NLZA 2O99A 1DP8A 3GDIA 4LRYC 2P04A 3UB7A 2IA2A 4I3JA 2JKTI 4OOLA 5K5BA 1OJ5A 3HCYA 3R7WB 2W3HA 2PR5A 4QPRA 3F1PA 1N9OA 2B18A 3MJQA 1S4SA 4MN7A 2H28A 1YKDA 4XT2B 4IUHA 1P0ZA 5EFWA 5HD5A 3RH8B 2ZOHA 3IS2A 1P9RA 4EUVA 2K7SA 3C38A 5F69A 4BBUA 4G3WA 3H9WA 4BWIA 2EWWA 3T4LA 4UEYA 2V0WA 1F98A 3T4TA 2EWVA 3C2WA 3OLOA 2M1CA 3BJNA 3CUEC 5CX7A 4ME4A 2WKQA 4PKYG 3EEAA 4KUKA 3PBTA 5IU1A 2OAQ1 1OT6A 2GJ3A 2PDRA 5F68A 4MN5A 3MQQA 1IFQA 4JGOA 3UB8A 2XA7M 2JKRI 3UB6A 3K3CA 5C5KA 4P6ZS 4EESA 3LICA 3LFVA 3T4SA 2V1AA 3EQUA 5DFXA 3T4QA 2OAP1 2PYRA 2PD8A 2J3WA 4H6JA 1GSVA 3MXQA 3EQVA 3F1NB 1OTEA 2K31A 3LR5A 3MFXA 4F3LB 1ZTUA 4MCWA 2VA0A 1OPXA 3B33A 2XSSA 3F1PB 5G4YA 4LLOB 1NLYA 2K2NA 4DMZA 3BQ8A 3R7WA 3O5YA 4WELA 3PHYA 1JNUA 4ARZB 3FPWA 2NUTC 1Y28A 1T1CA 5HSQA 2P7JA 3B47A 5G4ZA 5IS1A 4HHDA 3LR3A 3LIFA 3LR0A 5HDCA 3KSFA 3TJZC 3G6OA 5IT5A 1TF1A 2Y79A 5HPIA 2PD7A 1OJGA 3ZQ5A 3HJIA 2VLGA 5DF9A 3KSHA 3TE8A 2W1TB 3D72A 3EWKA 5I5LA 2V9AA 2W0NA 1YSPA 4BJPA 2L1MA 2VGLM 3B42A 5TBMA 3NHQA 2ZMFA 4O01A 3OCLA 3R4KA 1LT0A 5FL3A 4B93A 4Y3IA 4CLCE 4BBVA 2J3TD 4K08A 5LBRA 1XFNA 4WLAA 5HD3A 4GHIB 5DKKA 1NRJA 4YWZA 3C8CA 1F5MA 2VV8A 5MC7A 4LRZE 3UB9A 3T4OA 3IBJA 3F1NA 3MMHA 4AFIA 3MQ0A 5AVFA 4F3LA 1DP6A 1UWNX 2JKTM 4WN5A 4HJ4A 4JGQA 1P97A 3CLOA 3EEHA 2QJ7A 1YSQA 3H82B 2VJWA 3LR4A 5F6AA 3K2NA 1ZHHB 4ZRRA 4ARZA 4HH3A 4IJGA 4EU0A 1V9YA 4NKPA 5L8MA 3LUQA 3T4KA 2DMWA 3V67A 4MDZA 3CAXA 2QKPA 4R38A 2I9VA 1DP9A 2PT7A 3EGDC 3EGXC 3BY8A 1ODVA 4EERA 2W27A 4WEKA 5HL6A 2VV7A 1T18A 2LB5A 5DJUA 2L4RA 3LI8A 4E04A 5TBMB 4HJ6A 2W1TA 3F1OA 1XJ6A 1BYWA 2KDKA 2VZWA 1YAXA 4HIAA 4LPZA 4NEED 2ZBBA 1XJ3A 3VOLA 4KQDA 1F9IA 2VEAA 3UMDA 2KLIA 5HWVA 4HQAA 2JKRM 3H7WB 3PR6A 3P01A 1S66L 3RFBA 3JVVA 2W3DA 1W63M 1DRMA 3BWLA 4IHQA 1S1ZA 4KQOA 4GHIA 4R3AA 4L9GA 1OTAA 3CITA 2KOIA 3CWFA 5HPFA 1TS6A 3S7QA 2XA7S 4EXOA 2W1RA 3W2ZA 2INWA 3PBSA 1TD5A 4WUJA 5AVEA 4UQIM 4HH2A 3LIAA 4I3AA 2HJ9C 2PYPA 3H82A 1EW0A 4HP4A 3LIBA 4FOFA 2GX5A 3K3DA 2J80A 4GS9A 1XJ2A 1LSXA 3ULFA 3S7PA 2HGVA 2OWJA 2J3TC 2EA9A 2L0WA 4WEJA 1S67L 3A0RA 1TS8A 3C30A 3OC2A 2VV6A 3LYXA 3PBQA 3VE3A 1D06A 3F1OB 1TS0A 3EOIA 4NXEA 2QWSA 1NWZA 3IBRA 4WL9A 3KSIA 4MN6A 4YNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NRJ A;  2XA7 S;  4NEE D;  2XA7 M;  2JKR I;  5MC7 A;  2FH5 A;  4UQI S;  4P6Z S;  2HF6 A;  2VGL S;  1W63 Q;  4UQI M;  2JKT I;  4P6Z M;  2VGL M;  2JKR M;  1W63 M;  2JKT M;  3TJZ C; 
#chains in the Genus database with same CATH topology
 4Z1W A;  3IH8 A;  4OQH A;  4GDB A;  4FSF A;  1JVJ A;  3MZD A;  3H7W A;  5AQA A;  4P0M A;  2FZ0 A;  3GEC A;  1G28 A;  5CER A;  5CGS A;  1CK3 A;  2PHY A;  4P87 A;  3AGE A;  3FKV A;  1UGU A;  1NYM A;  3E2K A;  5TGF A;  4Q8I A;  2WKE A;  4N1X A;  2XRO A;  1XJ4 A;  4GNU A;  3KSG A;  1N9B A;  2WKP A;  2V1Z A;  1V9Z A;  2OLU A;  3P09 A;  2O9B A;  2O9C A;  1GHP A;  2D01 A;  5A91 A;  3PBR A;  1ONH A;  4Q0J A;  3VP1 A;  2WKR A;  4DRT A;  1VEU A;  2Y59 A;  1KE3 A;  5EV0 A;  2CMN A;  4CLC B;  5DFY A;  3FG8 A;  3N8R A;  2ZM2 A;  1D1J A;  3BFD A;  1Q2P A;  3QHY A;  5DJT A;  5KSH A;  3IF6 A;  4P6Z M;  4LCL A;  4HI4 A;  1H8Z A;  5BOH A;  1Y54 A;  2QMI A;  1SDE A;  3VP4 A;  3NCK A;  2G7U A;  1MC0 A;  1E25 A;  1K0K A;  4LFU A;  1DY6 A;  3IF5 A;  4NXF A;  3BLM A;  3D3O A;  4R70 A;  5DF7 A;  3VE4 A;  4DXC A;  3BQA A;  5CGX A;  5J7E A;  1Z6F A;  3QP8 A;  4A5R A;  4E3M A;  1W5D A;  2VKS A;  3NOU C;  2P9V B;  4KUO A;  3ZG8 B;  5HZH A;  1BLP A;  1PW1 A;  3GMW A;  3MF0 A;  5FEG A;  4UQI S;  2R78 A;  1XKZ A;  2M7U A;  4R3J A;  5IHV A;  3T12 B;  4CLC A;  4GD6 A;  2MJ6 A;  1WA9 A;  1H5X A;  4BD0 A;  2XRN A;  3VV4 A;  4DJ2 A;  1KE4 A;  4JXS A;  5DTT A;  3PBO A;  3E4P A;  3UE6 A;  4JGP A;  2ZMV A;  4II7 A;  5FQQ A;  3NOT C;  3IF6 C;  3S7N A;  3BY9 A;  2IWB A;  2H0Y A;  3E4Q A;  1JWP A;  3NJA A;  2W3G A;  3OCN A;  3UPP A;  1WE4 A;  2M7V A;  5HFO A;  1MKI A;  3BEC A;  3RJU A;  1GHM A;  3T1R A;  4BMW A;  3LEQ A;  1YMS A;  2Y2L A;  2P04 A;  3HUM A;  4I3J A;  1OJ5 A;  3HCY A;  4OPZ A;  2UWX A;  3M2K A;  1L0E A;  4QPR A;  4IVI A;  4MN7 A;  2P9V A;  5CHM A;  3IX8 A;  1YT4 A;  2WK0 A;  1PIO A;  5A93 A;  3RH8 B;  3C38 A;  5F69 A;  3DTI A;  2A3U A;  3WS2 A;  1EI5 A;  3T4T A;  4OKP A;  3QP5 A;  1ERO A;  5FI7 A;  5CX7 A;  1W8Q A;  5E2G A;  1K4E A;  4KZ4 A;  4E3K A;  5IU1 A;  1OT6 A;  1JWZ A;  3UB6 A;  2JKR I;  1ES4 A;  2XGN A;  2Y2H A;  1BT5 A;  4MEZ A;  2X01 A;  3LFV A;  1PYY A;  1HVB A;  1O07 A;  2ZQA A;  2PYR A;  3AGD A;  3PAE A;  4WM9 A;  3ZG9 B;  1GSV A;  3F1N B;  4MBK A;  1M6K A;  3HLD A;  3B33 A;  1OPX A;  2XSS A;  1NLY A;  3DTE A;  3D4F A;  5GHX A;  2B95 A;  3S1Y A;  4WEL A;  4NK3 A;  3FPW A;  2NUT C;  1Y28 A;  1FR6 A;  5FAP A;  1NXY A;  5G4Z A;  4ZDX A;  2BG1 A;  3LR3 A;  3NDE A;  5HDC A;  3KSF A;  1HLU P;  1K56 D;  5F82 A;  2XFT A;  3SH8 A;  3WRZ A;  4R0Q A;  2E8J A;  4RVA A;  2CC1 A;  5CHU A;  5FI2 A;  2V9A A;  3A3I A;  3VSL A;  4O01 A;  2XFS A;  2ZLY A;  1ESU A;  5EVI B;  5HAP A;  5CEB A;  1ZG6 A;  1ES2 A;  1XFN A;  3HLB A;  4WZ5 A;  4FD8 A;  1NRJ A;  4OVD A;  3C8C A;  5MC7 A;  2Y91 A;  4D2O A;  1L3L A;  2C6W B;  3G32 A;  3F1N A;  4LV2 A;  3D9Y A;  2WAE A;  4GD8 A;  1MWU A;  4B4X A;  1DJA A;  4JGQ A;  4E6X A;  2HP5 A;  2G2W A;  1ZHH B;  3K2N A;  4ZRR A;  2OV5 A;  4IJG A;  1V9Y A;  4NKP A;  3LUQ A;  3T4K A;  3NC8 A;  2I9V A;  2PT7 A;  3BY8 A;  3SS5 A;  4H8R A;  3T1X A;  1T18 A;  3CJM A;  2VZW A;  2KDK A;  3BLS A;  2ZBB A;  4KQD A;  2VEA A;  2PRF A;  3Q7V B;  5EVI A;  5HWV A;  3FWL A;  1H0M A;  4EBN A;  4LV1 A;  1W63 M;  1SKF A;  1W8Y A;  4C6Y A;  2Q9N A;  1OTA A;  2A49 A;  2Q0O A;  4X53 A;  4WZ5 C;  1XGI A;  2HZ5 A;  1RCJ A;  1S6R A;  3W4O A;  3S7Q A;  2XA7 S;  5F1F A;  2INW A;  3PBS A;  4RYE A;  4UQI M;  4HH2 A;  3DTK A;  4I3A A;  2ZC7 A;  3ZGA B;  1CI8 A;  4DXB A;  4HP4 A;  3LIB A;  3C7V A;  1PW8 A;  1MXO A;  1ALQ A;  3ULF A;  3S7P A;  4BQM A;  4E3L A;  2WZX A;  2L0W A;  5EEC A;  4B4Z A;  1S67 L;  1TS8 A;  3C30 A;  4PM5 A;  3OC2 A;  1ES3 A;  4E3J A;  3CMZ A;  3PBQ A;  3PAG A;  1TS0 A;  4S2L A;  4ZTK A;  5HAI A;  1Z09 A;  3IBR A;  5HX9 A;  4MN6 A;  4JPM A;  3OOV A;  3IT9 A;  3Q7V A;  3Q82 A;  1K54 A;  3E0Y A;  5KMW A;  2ZC4 B;  4HNB A;  2R9W A;  1FIL A;  1UWP X;  2C5W B;  4KZB A;  3S7O A;  1X0O A;  3V50 A;  4U3T A;  4DDS A;  1MZU A;  5GLC A;  4E6W A;  1ACF A;  1LL9 A;  4Y2F A;  2B5R A;  1XP4 A;  3U2A A;  3MR0 A;  5EOE A;  1FOF A;  1H8M A;  4HOI A;  4GS9 B;  5TJJ A;  2JN7 A;  2PR6 A;  2A24 A;  4MMN A;  3W4P A;  1XX2 A;  2ZC5 B;  2O0Y A;  3AGF A;  4HP9 A;  4NG2 A;  2RCX A;  4R3B A;  3IHB A;  3BFE A;  3WS5 A;  1N9L A;  4DN0 A;  2DCF A;  3KYQ A;  5DKL A;  5A8B A;  3T4J A;  2XD1 A;  1E3U D;  4Q0I A;  1OME A;  3M6H A;  4EV4 A;  2QJ5 A;  4U0T A;  3VOZ A;  3MQO A;  3FKW A;  4N1H A;  2V1B A;  4JXG A;  3GTC A;  1K54 C;  5FEF A;  4L9E A;  2HP6 A;  4I38 A;  1LL8 A;  3L9K A;  2Z6C A;  4I3I A;  5FQJ A;  3KX0 X;  2HF6 A;  4N9L A;  4D60 A;  3UE3 A;  2YKF A;  4I5S A;  1DJC A;  1DJB A;  3ZNY A;  2QYB A;  3ISG A;  3ZYT A;  4EEU A;  3A0V A;  1K25 A;  4C75 A;  2WKH A;  2XK1 A;  4JGR A;  1PWC A;  3CI6 A;  3ITA A;  4EWF A;  2Y8H A;  4XT2 A;  3E2L A;  3ZG7 B;  4UA7 A;  2B02 A;  3PXP A;  4S2O A;  1LSV A;  4EEP A;  3BFF A;  4Y5F A;  3UE0 A;  1T1B A;  3TSG A;  2ZQ9 A;  5FAT A;  4WF0 A;  3G2Z A;  2V0U A;  3CUE A;  1GSW A;  4EQ1 A;  4FH4 A;  4GJ4 A;  4QY5 A;  3UPN A;  2PBD P;  4FUW A;  1PFL A;  1OT9 A;  1G6O A;  1T19 A;  2BTF P;  1W63 Q;  3N8L A;  3G2Y A;  3Q7Z A;  3E98 A;  3RTY A;  5CHJ A;  3SW1 A;  4LRX C;  2GDN A;  1CI9 A;  5A90 A;  1K55 A;  4R6L A;  2LB9 A;  1TS7 A;  2X02 A;  3IXH A;  3LI9 A;  2WAF A;  3B3X A;  1NLZ A;  1J3W A;  3KYE A;  3GDI A;  4LRY C;  2UV0 E;  3UB7 A;  2Y2P A;  2JKT I;  2G2U A;  5K5B A;  4YFM A;  1IYP A;  5GLD A;  3F1P A;  1N9O A;  2H28 A;  4OPQ A;  1P0Z A;  3DAV A;  1ZG4 A;  1CJF A;  4O7D A;  5HD5 A;  4Y0U A;  4EUV A;  3LY3 A;  4BBU A;  4G3W A;  4JBF A;  3H9W A;  3T4L A;  4KZA A;  5EE8 A;  2EXA A;  1F98 A;  3OLO A;  3GSG A;  4B88 A;  1GHI A;  3CUE C;  4Y13 A;  1IEM A;  4ESP A;  3EEA A;  4KUK A;  3PBT A;  2WYX A;  1SCW A;  1MY8 A;  1XA1 A;  4QB8 A;  2OAQ 1;  2PDR A;  3O86 A;  1AXB A;  4KQQ A;  3UB8 A;  2XA7 M;  1PWG A;  2WGW A;  2XF3 A;  4EES A;  2VGK A;  3ZCZ A;  3IWQ A;  1K55 C;  2EX8 A;  2PD8 A;  3P98 A;  3MXQ A;  5M18 A;  1OTE A;  2K31 A;  1W7F A;  3LR5 A;  3LO7 A;  4F3L B;  4MCW A;  5G4Y A;  4LLO B;  2K2N A;  2JC7 A;  1W79 A;  4ARZ B;  4P6B A;  1T1C A;  2ZMA A;  2P7J A;  4E3N A;  1XA7 A;  5IS1 A;  1MWS A;  4HHD A;  3VSK A;  1K4F A;  4IED A;  2ACG A;  4BEN A;  1LHY A;  1ERQ A;  1EWZ A;  3HLE A;  1OJG A;  3ZQ5 A;  1IKI A;  5DF9 A;  3KSH A;  5FA7 A;  3EWK A;  5I5L A;  2L1M A;  3B42 A;  3ZG5 A;  5TBM A;  1LT0 A;  5FL3 A;  4LEN A;  4B93 A;  4CLC E;  3NUL A;  4K08 A;  4R1G A;  5FDH A;  4KZ9 A;  3BRM A;  2FFY A;  2IWC A;  1F5M A;  3V3R A;  4LRZ E;  1K56 A;  4KZ6 A;  3MQ0 A;  4K0W A;  4F3L A;  2HDU A;  5CXW A;  1UWN X;  2Q9M A;  2Y2I A;  3UO9 A;  1YSQ A;  1HD8 A;  3JYI A;  3LR4 A;  4ARZ A;  5HAQ A;  4EU0 A;  3ZDJ A;  1YLY A;  1YLT A;  2PU4 A;  1PI5 A;  2DMW A;  1JWV A;  3CAX A;  3EGD C;  4EER A;  1Y4O A;  4WYY A;  4QJG A;  1FR1 A;  4CPK A;  3N8S A;  4KG2 A;  2L4R A;  2JKF A;  1XJ6 A;  1BYW A;  2XR0 A;  5AQB A;  5F1G A;  2OSU A;  1XJ3 A;  3A3J A;  1F9I A;  3UMD A;  4QU3 A;  2OLV A;  2KLI A;  3WS4 A;  3V5M A;  3VMA A;  3JVV A;  2W3D A;  3BWL A;  4IHQ A;  1S1Z A;  4KQO A;  4L9G A;  3UDF A;  2JE5 A;  4JXV A;  3CWF A;  1IYS A;  4EXO A;  2W1R A;  1VET B;  3U4L P;  3FZC A;  3NDG A;  4Y15 A;  3LIA A;  4OLD A;  5J8X A;  5EVL A;  3GV9 A;  2GX5 A;  3CPT B;  1YLJ A;  5FAQ A;  4PM8 A;  1ESI A;  3DWZ A;  3VE3 A;  2HDQ A;  3O87 A;  4NXE A;  4S2P A;  2QWS A;  4WL9 A;  2H5S A;  3A3F A;  4X69 A;  3OPL A;  3TG9 A;  1FIK A;  2GZA A;  2H10 A;  4GCZ A;  3OPP A;  3SH7 A;  4PAU A;  4YOF A;  1PWD A;  3IXG A;  1ERM A;  2AVX A;  4ETX A;  3BM6 A;  2D02 A;  3CHW P;  1VET A;  3PBN A;  3N7W A;  3MBZ A;  1IYO A;  2VX8 A;  2GNX A;  2R9X A;  3G31 A;  4RQ9 A;  3VP0 A;  1GSX A;  1VB6 A;  3ZFZ A;  1FSW A;  5HAR A;  3FPV A;  1MWT A;  3CPT A;  1VHM A;  2YKH A;  1NRF A;  3WRT A;  4PM9 A;  1I2W A;  4GDN A;  4M4X A;  3G30 A;  4GW9 A;  3MKF A;  4U0X A;  5EUA A;  5TFQ A;  3M2J A;  3QP6 A;  3LGO A;  5JYP A;  1K38 A;  1K6S A;  4KG5 A;  4RX3 A;  4E3O A;  5FI6 A;  2ZOI A;  5E2H A;  4M3K A;  3TRC A;  1IOU A;  1H3Q A;  3IXD A;  5DF8 A;  3DBA A;  4ZJ1 A;  1YLW A;  3E4O A;  1IYQ A;  4MBF A;  4ZBE A;  2EX9 A;  3MKE A;  3KO6 A;  2OWH A;  4XUZ A;  4EUZ A;  5GHY A;  2HDS A;  5GL9 A;  2A24 B;  2JHE A;  3L7H A;  4HJ3 A;  1E3U A;  3HLW A;  1KOU A;  4NXB A;  4Y0O A;  5FSR A;  3W4Q A;  3UME A;  3FV7 A;  1BUL A;  2A2L A;  2FH5 A;  1SHV A;  2EXB A;  3IS2 B;  3SZT A;  1JTD A;  5HWW A;  3QP2 A;  3GRJ A;  3IWO A;  2P08 A;  2HJE A;  4MBH A;  4G3K A;  2ZD8 A;  3P7N A;  1OTB A;  3Q81 A;  2EX2 A;  3LEZ A;  3QNC A;  4O8G A;  2BAS A;  3RXW A;  3JVU A;  1NZU A;  4ETZ A;  1LSW A;  4DE1 A;  4QD4 A;  3ICY A;  1U60 A;  1PZP A;  4IUK A;  3LID A;  4YIN A;  3IH9 A;  4EBL A;  3BFC A;  5FDS A;  2QHK A;  4OQG A;  4X56 A;  4KZ8 A;  3MS6 A;  4Y17 A;  4HES A;  1G68 A;  2O99 A;  1DP8 A;  4EQI A;  1KE0 A;  3HUN A;  2IA2 A;  2ZQ8 A;  3HRE A;  2DRW A;  3R7W B;  1SKO A;  1HTZ A;  2PR5 A;  1I5Q A;  2B18 A;  4K0X A;  4FTX A;  1S4S A;  4XT2 B;  4IUH A;  5A92 A;  1BSG A;  5AQ7 A;  3I7J A;  1P9R A;  3IS2 A;  3G34 A;  1WYB A;  1NYY A;  4IVK A;  4BWI A;  3VFF A;  5EVE A;  4UEY A;  2V0W A;  1TVF A;  1CF0 A;  2M1C A;  3BJN A;  4ME4 A;  2WKQ A;  4PKY G;  4R4R A;  5L07 A;  4GKU A;  4GN2 A;  1XGJ A;  3HVF A;  1K6R A;  2GJ3 A;  2Y2G A;  4FCF A;  3MQQ A;  1IFQ A;  4JGO A;  5C5K A;  4N92 A;  3LIC A;  2XEP A;  3EQU A;  3T4Q A;  4X6T A;  2OAP 1;  2J3W A;  1XXM A;  1ZTU A;  2EFX A;  1N4O A;  2VA0 A;  2WUQ A;  3F1P B;  2V2F F;  1I2S A;  4DMZ A;  3R7W A;  3O5Y A;  3PHY A;  1YPR A;  2Y2M A;  4UA6 A;  1A0K A;  1L0F A;  3B47 A;  4JF4 A;  1FCM A;  3HL9 A;  3LR0 A;  1BTL A;  3G6O A;  5IT5 A;  3C4P A;  1BLC A;  1L0D A;  1TF1 A;  3HUO A;  3OPR A;  5HPI A;  2PD7 A;  4RA7 A;  3TE8 A;  2X71 A;  3S4X A;  4BJP A;  4DE0 A;  1HZO A;  3NHQ A;  2ZMF A;  5FAO A;  1PNE A;  5L09 A;  2Y2Q A;  2WGW B;  2Y4A A;  1SDN A;  3IX3 A;  4Y3I A;  2J3T D;  3HLF A;  2ZC3 B;  2ZM8 A;  4DF6 A;  4WLA A;  2EX6 A;  5HD3 A;  4GHI B;  4KZ7 A;  4X68 A;  5FQK A;  1FSY A;  4R23 A;  4YWZ A;  2PBY A;  1KDW A;  1Q2Q A;  1RGY A;  3MMH A;  2WZZ A;  1FCO A;  3ZNT A;  3UY6 A;  1P97 A;  3CLO A;  2PAV P;  1ONG A;  2VJW A;  3WS1 A;  2Y2J A;  3N6I A;  4HBT A;  1BZA A;  4R38 A;  3EGX C;  1ODV A;  1TEM A;  3MZF A;  4WEK A;  2VV7 A;  4GZB A;  2LB5 A;  1BUE A;  1YQS A;  3ITB A;  3LI8 A;  5TBM B;  4HJ6 A;  4OP5 A;  2PU2 A;  3F1O A;  4JLF A;  4HIA A;  1YAX A;  1AWI A;  4LPZ A;  3Q07 A;  4NEE D;  1L2S A;  3Q1F A;  2P74 A;  3OPH A;  5TR7 A;  2JKR M;  3C5A A;  4S2I A;  4GHI A;  4R3A A;  2J8Y A;  4QWO A;  2J9P A;  3DW0 A;  3CIT A;  3QNB A;  5HPF A;  5CED A;  1TS6 A;  4OH0 A;  3W2Z A;  4UHU A;  1VQQ A;  2E8I A;  4OLG A;  1TD5 A;  1J9M A;  4ZJ2 A;  3VFH A;  3S22 A;  3G4P A;  4IBX A;  2HJ9 C;  5FQM A;  1BLH A;  5AQ9 A;  1YLP A;  1TDL A;  1QME A;  4PM6 A;  3ZVW A;  4FOF A;  4KZ5 A;  5KSC A;  3K3D A;  2J80 A;  3UN7 A;  1K57 A;  2HGV A;  2OWJ A;  4WEJ A;  4E3I A;  3NY4 A;  1NZO A;  2Y2O A;  3C7U A;  2VV6 A;  5DVA A;  4OPY A;  5CEC A;  3BYD A;  3C4O A;  1NWZ A;  4UA9 A;  2ZQC A;  3KSI A;  3CZD A;  1OTD A;  2IWD A;  4KZ3 A;  3MSH A;  4XXR A;  3T50 A;  5L2F A;  4BL3 A;  4KEN B;  1SZV A;  3ZHH A;  3FC7 A;  3HLG A;  2W3F A;  2VGL S;  4NXG A;  1MPL A;  4OOM A;  3A0S A;  1PRQ A;  3UDX A;  4EET B;  1ES5 A;  2WAD A;  2VK3 A;  3NOP C;  4O0P A;  3KYZ A;  3NI9 A;  4DDY A;  2JBF A;  5KIZ A;  4LCM A;  2ZQ7 A;  4DJ3 A;  2JKG A;  4S2K A;  4EW7 A;  2W3E A;  4CQH A;  5F5Y A;  3PYP A;  3FYZ A;  1NY0 A;  4P85 A;  2KX6 A;  5EM0 A;  3WS0 A;  3MFD A;  1CQA A;  3UNW A;  2J7V A;  1PI4 A;  3HJK A;  1S1Y A;  4BL2 A;  1KGG A;  4ZJ3 A;  2HV1 A;  4BD1 A;  2NUP C;  2Z2L B;  1IEL A;  4HY8 A;  4S2N A;  3SS4 A;  3N4I A;  1K57 C;  4BBT A;  1N9N A;  2O9A A;  4L9F A;  1LL5 A;  4PHT A;  4KQR A;  1E4D A;  1PZO A;  4KG6 A;  5HWT A;  1MKM A;  2XD5 A;  2VGJ A;  4CLC C;  1ZKJ A;  2XDM A;  4B9O A;  1XFQ A;  3VP3 A;  3GQZ A;  5U47 A;  1IKG A;  5JYO A;  5G18 A;  1KGE A;  1P9W A;  5FQI A;  2QZ6 A;  2DNS A;  5DTK A;  3QP4 A;  4CLC D;  2OOL A;  4MNR A;  4JKT A;  5E2E A;  4X1M A;  4Q0H A;  4PKY A;  5J4E A;  4N9K A;  5HW3 A;  3BW6 A;  5J3W A;  5M1A A;  2XQZ A;  5CTM A;  4NET A;  3V3S A;  4I39 A;  2Z6D A;  4EBP A;  4UAA A;  1S4R A;  2EFU A;  4HEF A;  5EM1 A;  4OOY A;  4GLQ A;  4OQI A;  3IQA A;  4S2N C;  3LIE A;  4GOG A;  3TW8 A;  1D7E A;  5M19 A;  5HDD A;  4GB7 A;  5E43 A;  1NJ4 A;  4L0L A;  1VM1 A;  4G3V A;  1O7E A;  3W8K A;  5HDS A;  1T1A A;  3DWK A;  5DTS A;  1OTI A;  1RGZ A;  1STZ A;  5I94 A;  1ZC2 A;  3GVB A;  5AJG A;  3SS3 A;  2Y2K A;  4PPR A;  3PTE A;  1KVM A;  3OBF A;  4X25 A;  4S2M A;  4H6J B;  1FQG A;  5D3O A;  1KDS A;  3MZE A;  3NEC A;  2V8F A;  2ZQD A;  4WMC A;  4OOL A;  3NBL A;  3MXS A;  2W3H A;  3WWX A;  4F94 A;  4R4S A;  3MJQ A;  1LI0 A;  5L10 A;  3SOI A;  1YKD A;  3LY4 A;  1XPB A;  5EFW A;  3BEB A;  2ZOH A;  2K7S A;  3VOY A;  4DE3 A;  3JPU A;  2EWW A;  5EPH A;  3HBR A;  2EWV A;  3C2W A;  3SH9 A;  4QY6 A;  4LV3 A;  4ZAM A;  5F68 A;  4MN5 A;  3T1Q B;  3K3C A;  4P6Z S;  2HDR A;  3T4S A;  4X55 A;  2V1A A;  5DFX A;  4PMA A;  3NIA A;  4H6J A;  3BFG A;  3EQV A;  3MFX A;  2ZL1 B;  3G35 A;  1G6A A;  1SKO B;  4QHC A;  3T1S A;  3UPO A;  4RX2 A;  5KZH A;  4IBR A;  4S2J A;  1GA0 A;  3BQ8 A;  4DE2 A;  1YM1 A;  3A3E A;  1JNU A;  5HSQ A;  1FCN A;  5GLB A;  3LIF A;  2RL3 A;  4OP8 A;  1GCE A;  3TJZ C;  4WMC D;  3O3V A;  1C3B A;  2Y79 A;  3GR2 A;  4DKI A;  1BLS A;  5CTN A;  3HJI A;  2VLG A;  3UDI A;  4LGW A;  3O88 A;  3UE1 A;  2W1T B;  2Y2N A;  3D72 A;  5CGW A;  2Y55 A;  2W0N A;  1YSP A;  3IX4 A;  5CRF A;  1F2K A;  5FAS A;  2VGL M;  4PM7 A;  3OCL A;  3R4K A;  4BBV A;  1JTG A;  5LBR A;  3VP2 A;  1MWR A;  3IWI A;  5DKK A;  1H8Y A;  5EVI C;  2VV8 A;  3OZH A;  1LLB A;  2WKI A;  3UB9 A;  4HBU A;  3T4O A;  3IBJ A;  4AFI A;  2ZL1 A;  2BLS A;  5AVF A;  2ZC6 B;  1DP6 A;  2JKT M;  4WN5 A;  4HJ4 A;  3MXR A;  5EVI D;  3EEH A;  2FFF B;  2QJ7 A;  4JF6 A;  4CJN A;  3H82 B;  5F6A A;  3QP1 A;  4HH3 A;  4K91 A;  5L8M A;  4ID4 A;  2I72 A;  5F83 A;  3V67 A;  4MDZ A;  2QKP A;  2Z2M B;  3RXX A;  1DP9 A;  2J9O A;  1CEF A;  1S0W A;  3IHA A;  4C3Q A;  2W27 A;  1GA9 A;  3A3D A;  5HL6 A;  1KVL A;  1YMX A;  1M40 A;  4MLL A;  3UB5 P;  2QPN A;  5DJU A;  4E04 A;  1RP5 A;  4JXW A;  4OQ0 A;  4X1L A;  2W1T A;  2XH9 A;  3VOL A;  2H0T A;  4WZ4 A;  1CEG A;  5GLA A;  3IXB A;  4HQA A;  3PR6 A;  3H7W B;  3LCE A;  3M6B A;  1S66 L;  3P01 A;  3RFB A;  4BLM A;  4Y7P A;  1DRM A;  4Z9Q A;  2XLN A;  2HP9 A;  3CG5 A;  2KOI A;  4LV0 A;  1L0G A;  3V39 A;  2ZJ9 A;  3ZG0 A;  1QMF A;  4JF5 A;  3ZVT A;  1TDG A;  2V8C A;  4WUJ A;  5AVE A;  2JCH A;  2WGV A;  1YLZ A;  2PYP A;  5FQ9 A;  1LI9 A;  3H82 A;  5GHZ A;  1EW0 A;  1WYC A;  4XUX A;  3TOI A;  1MBL A;  3HLC A;  4GS9 A;  1XJ2 A;  3DTM A;  5E2F A;  1LSX A;  1VEU B;  2J3T C;  2EA9 A;  3A0R A;  1G5U A;  1KGF A;  3LYX A;  4OON A;  1D06 A;  3F1O B;  5EOO A;  2HPB A;  3EOI A;  4FH2 A;  2V20 A;  4WBG A;  4OPR A;  3IF6 B;  2WGI A;  4Y0T A;  2ZM0 A;  4YNR A;  5HL1 A; 
#chains in the Genus database with same CATH homology
 1OTD A;  4Z1W A;  3OOV A;  3T50 A;  2GZA A;  4GCZ A;  4FSF A;  3FC7 A;  3H7W A;  3E0Y A;  2FZ0 A;  2W3F A;  4HNB A;  2VGL S;  3GEC A;  4NXG A;  1G28 A;  1UWP X;  4OOM A;  2PHY A;  4PAU A;  3S7O A;  3A0S A;  1X0O A;  4YOF A;  4EET B;  1MZU A;  3NOP C;  1UGU A;  4O0P A;  3KYZ A;  4ETX A;  2D02 A;  5KIZ A;  2XRO A;  1XJ4 A;  4Y2F A;  4DJ3 A;  3PBN A;  4EW7 A;  3KSG A;  2W3E A;  3U2A A;  2VX8 A;  4CQH A;  2GNX A;  3PYP A;  3MR0 A;  5F5Y A;  2KX6 A;  4RQ9 A;  1H8M A;  4HOI A;  4GS9 B;  2WKP A;  1GSX A;  5TJJ A;  2JN7 A;  1VB6 A;  1V9Z A;  2PR6 A;  3HJK A;  1S1Y A;  3FPV A;  2A24 A;  2O9B A;  2O9C A;  2HV1 A;  2D01 A;  4MMN A;  2NUP C;  3PBR A;  4HY8 A;  4Q0J A;  2O0Y A;  2WKR A;  4HP9 A;  1VHM A;  4BBT A;  2CMN A;  2YKH A;  1N9N A;  4CLC B;  2O9A A;  4L9F A;  5DFY A;  1N9L A;  3FG8 A;  4PHT A;  4M4X A;  4DN0 A;  4GW9 A;  3KYQ A;  5HWT A;  1MKM A;  5DKL A;  5A8B A;  3T4J A;  4CLC C;  4Q0I A;  5DJT A;  4B9O A;  1XFQ A;  5KSH A;  2QJ5 A;  4P6Z M;  4HI4 A;  3MQO A;  2ZOI A;  3TRC A;  1P9W A;  1IOU A;  2V1B A;  1H3Q A;  2G7U A;  4CLC D;  1MC0 A;  2OOL A;  4L9E A;  3DBA A;  1LL8 A;  4I38 A;  2Z6C A;  4Q0H A;  4I3I A;  4PKY A;  5J4E A;  3KX0 X;  4NXF A;  2HF6 A;  3E4O A;  3D3O A;  4R70 A;  3BW6 A;  5J3W A;  3VE4 A;  3UE3 A;  2YKF A;  4I5S A;  3KO6 A;  2OWH A;  3BQA A;  4I39 A;  5J7E A;  2Z6D A;  2A24 B;  1S4R A;  2QYB A;  2JHE A;  3ZYT A;  4EEU A;  4HJ3 A;  3A0V A;  1KOU A;  2VKS A;  4NXB A;  3NOU C;  4KUO A;  4GLQ A;  4JGR A;  5HZH A;  3UME A;  3CI6 A;  3MF0 A;  2A2L A;  2FH5 A;  4UQI S;  2R78 A;  3LIE A;  2Y8H A;  3IS2 B;  4XT2 A;  2M7U A;  3TW8 A;  2B02 A;  3PXP A;  1D7E A;  5HWW A;  1LSV A;  4CLC A;  4EEP A;  5HDD A;  2MJ6 A;  1WA9 A;  4Y5F A;  2P08 A;  2HJE A;  1T1B A;  2XRN A;  3VV4 A;  4DJ2 A;  4WF0 A;  3PBO A;  3E4P A;  4G3K A;  4L0L A;  2V0U A;  3CUE A;  3UE6 A;  3P7N A;  1GSW A;  4EQ1 A;  4G3V A;  1OTB A;  4JGP A;  4GJ4 A;  2ZMV A;  4II7 A;  5HDS A;  1T1A A;  3NOT C;  3S7N A;  1OTI A;  1STZ A;  4O8G A;  1OT9 A;  1G6O A;  1T19 A;  3BY9 A;  2BAS A;  3E4Q A;  1W63 Q;  3NJA A;  3JVU A;  2W3G A;  3E98 A;  5AJG A;  3RTY A;  4ETZ A;  1LSW A;  3SW1 A;  4LRX C;  3ICY A;  3OCN A;  2M7V A;  4IUK A;  3LID A;  3OBF A;  4R6L A;  2LB9 A;  1TS7 A;  3LI9 A;  2QHK A;  4H6J B;  4BMW A;  1NLZ A;  2O99 A;  1DP8 A;  3GDI A;  4LRY C;  2P04 A;  3UB7 A;  2IA2 A;  4I3J A;  2JKT I;  4OOL A;  5K5B A;  1OJ5 A;  3HCY A;  3R7W B;  2W3H A;  2PR5 A;  4QPR A;  3F1P A;  1N9O A;  2B18 A;  3MJQ A;  1S4S A;  4MN7 A;  2H28 A;  1YKD A;  4XT2 B;  4IUH A;  1P0Z A;  5EFW A;  5HD5 A;  3RH8 B;  2ZOH A;  3IS2 A;  1P9R A;  4EUV A;  2K7S A;  3C38 A;  5F69 A;  4BBU A;  4G3W A;  3H9W A;  4BWI A;  2EWW A;  3T4L A;  4UEY A;  2V0W A;  1F98 A;  3T4T A;  2EWV A;  3C2W A;  3OLO A;  2M1C A;  3BJN A;  3CUE C;  5CX7 A;  4ME4 A;  2WKQ A;  4PKY G;  3EEA A;  4KUK A;  3PBT A;  5IU1 A;  2OAQ 1;  1OT6 A;  2GJ3 A;  2PDR A;  5F68 A;  4MN5 A;  3MQQ A;  1IFQ A;  4JGO A;  3UB8 A;  2XA7 M;  2JKR I;  3UB6 A;  3K3C A;  5C5K A;  4P6Z S;  4EES A;  3LIC A;  3LFV A;  3T4S A;  2V1A A;  3EQU A;  5DFX A;  3T4Q A;  2OAP 1;  2PYR A;  2PD8 A;  2J3W A;  4H6J A;  1GSV A;  3MXQ A;  3EQV A;  3F1N B;  1OTE A;  2K31 A;  3LR5 A;  3MFX A;  4F3L B;  1ZTU A;  4MCW A;  2VA0 A;  1OPX A;  3B33 A;  2XSS A;  3F1P B;  5G4Y A;  4LLO B;  1NLY A;  2K2N A;  4DMZ A;  3BQ8 A;  3R7W A;  3O5Y A;  4WEL A;  3PHY A;  1JNU A;  4ARZ B;  3FPW A;  2NUT C;  1Y28 A;  1T1C A;  5HSQ A;  2P7J A;  3B47 A;  5G4Z A;  5IS1 A;  4HHD A;  3LR3 A;  3LIF A;  3LR0 A;  5HDC A;  3KSF A;  3TJZ C;  3G6O A;  5IT5 A;  1TF1 A;  2Y79 A;  5HPI A;  2PD7 A;  1OJG A;  3ZQ5 A;  3HJI A;  2VLG A;  5DF9 A;  3KSH A;  3TE8 A;  2W1T B;  3D72 A;  3EWK A;  5I5L A;  2V9A A;  2W0N A;  1YSP A;  4BJP A;  2L1M A;  2VGL M;  3B42 A;  5TBM A;  3NHQ A;  2ZMF A;  4O01 A;  3OCL A;  3R4K A;  1LT0 A;  5FL3 A;  4B93 A;  4Y3I A;  4CLC E;  4BBV A;  2J3T D;  4K08 A;  5LBR A;  1XFN A;  4WLA A;  5HD3 A;  4GHI B;  5DKK A;  1NRJ A;  4YWZ A;  3C8C A;  1F5M A;  2VV8 A;  5MC7 A;  4LRZ E;  3UB9 A;  3T4O A;  3IBJ A;  3F1N A;  3MMH A;  4AFI A;  3MQ0 A;  5AVF A;  4F3L A;  1DP6 A;  1UWN X;  2JKT M;  4WN5 A;  4HJ4 A;  4JGQ A;  1P97 A;  3CLO A;  3EEH A;  2QJ7 A;  1YSQ A;  3H82 B;  2VJW A;  3LR4 A;  5F6A A;  3K2N A;  1ZHH B;  4ZRR A;  4ARZ A;  4HH3 A;  4IJG A;  4EU0 A;  1V9Y A;  4NKP A;  5L8M A;  3LUQ A;  3T4K A;  2DMW A;  3V67 A;  4MDZ A;  3CAX A;  2QKP A;  4R38 A;  2I9V A;  1DP9 A;  2PT7 A;  3EGD C;  3EGX C;  3BY8 A;  1ODV A;  4EER A;  2W27 A;  4WEK A;  5HL6 A;  2VV7 A;  1T18 A;  2LB5 A;  5DJU A;  2L4R A;  3LI8 A;  4E04 A;  5TBM B;  4HJ6 A;  2W1T A;  3F1O A;  1XJ6 A;  1BYW A;  2KDK A;  2VZW A;  1YAX A;  4HIA A;  4LPZ A;  4NEE D;  2ZBB A;  1XJ3 A;  3VOL A;  4KQD A;  1F9I A;  2VEA A;  3UMD A;  2KLI A;  5HWV A;  4HQA A;  2JKR M;  3H7W B;  3PR6 A;  3P01 A;  1S66 L;  3RFB A;  3JVV A;  2W3D A;  1W63 M;  1DRM A;  3BWL A;  4IHQ A;  1S1Z A;  4KQO A;  4GHI A;  4R3A A;  4L9G A;  1OTA A;  3CIT A;  2KOI A;  3CWF A;  5HPF A;  1TS6 A;  3S7Q A;  2XA7 S;  4EXO A;  2W1R A;  3W2Z A;  2INW A;  3PBS A;  1TD5 A;  4WUJ A;  5AVE A;  4UQI M;  4HH2 A;  3LIA A;  4I3A A;  2HJ9 C;  2PYP A;  3H82 A;  1EW0 A;  4HP4 A;  3LIB A;  4FOF A;  2GX5 A;  3K3D A;  2J80 A;  4GS9 A;  1XJ2 A;  1LSX A;  3ULF A;  3S7P A;  2HGV A;  2OWJ A;  2J3T C;  2EA9 A;  2L0W A;  4WEJ A;  1S67 L;  3A0R A;  1TS8 A;  3C30 A;  3OC2 A;  2VV6 A;  3LYX A;  3PBQ A;  3VE3 A;  1D06 A;  3F1O B;  1TS0 A;  3EOI A;  4NXE A;  2QWS A;  1NWZ A;  3IBR A;  4WL9 A;  3KSI A;  4MN6 A;  4YNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...