4N9LA

Crystal structure of beta-lactamse penp_e166s in complex with meropenem
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFSPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Perturbing the General Base Residue Glu166 in the Active Site of Class A beta-Lactamase Leads to Enhanced Carbapenem Binding and Acylation
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase/antibiotic
total genus 93
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4n9lA00
4WZ5A 3M2JA 5DF7A 2ZLYA 1BLHA 3WS4A 3G2YA 3ZGAB 2WKIA 3ZDJA 1EI5A 5CTMA 1PWDA 3IT9A 4KG5A 2JCHA 4WBGA 1IKGA 3IQAA 1S0WA 4X55A 4RVAA 2H0YA 3ZG0A 4OQ0A 4KENB 1XP4A 3V3SA 2QPNA 3PBOA 4KZAA 3HVFA 3A3FA 4IEDA 5FA7A 4BQMA 4DRTA 4OKPA 4QD4A 1Q2QA 2C6WB 3PBNA 4S2NA 4C75A 2WYXA 3ISGA 3M2KA 1CI8A 1JWZA 1PZPA 2XLNA 3FKVA 3G34A 3HLGA 2ZC5B 4YFMA 4E3IA 1JWPA 2P9VA 3A3IA 4E6WA 4P6BA 1K57A 2C5WB 4Y7PA 1ZG4A 4KQOA 1KE3A 1RGZA 2ZM2A 3MZDA 2RL3A 1KGFA 3CJMA 3LO7A 1LI9A 2ZD8A 1K4FA 3IXBA 3V5MA 1KDWA 3VSKA 1BULA 1FCMA 1K38A 4OH0A 4OP8A 5FSRA 1YLJA 4DF6A 2QZ6A 3OPHA 1ESUA 1K54A 4N92A 2DRWA 4UA9A 2WAFA 2XF3A 2Y2NA 4Y0UA 2X01A 4RA7A 5FQMA 4QB8A 1YLZA 3NI9A 1RP5A 3PAEA 4A5RA 4KZ9A 1NZUA 3O3VA 1MWRA 1MPLA 1IYOA 3IXHA 2WGWA 2Y2GA 1KVLA 3FWLA 3GRJA 5CERA 3FKWA 3IXGA 1U60A 1K4EA 5GLAA 3IF6C 1ERMA 1ONGA 3N8SA 3A3DA 4U0XA 1HZOA 1I2SA 1LHYA 5DVAA 4MNRA 3TOIA 4DDYA 4S2OA 1FSYA 4PM7A 3DTMA 4OLDA 3VP1A 3EQVA 4LCLA 1XX2A 3UN7A 4QJGA 1HTZA 5FDHA 4BD0A 3VP2A 1IELA 3G30A 1PW1A 1RCJA 1SDEA 2WUQA 2Y2LA 1NYYA 1K55A 3G4PA 1DJBA 1JTGA 5FASA 2XK1A 3E2LA 1K56A 4IVIA 1GHIA 2XGNA 3SH9A 2XD1A 2WZXA 4OPZA 3WRTA 2BLSA 2XDMA 4UA6A 3PBTA 1E3UA 1I2WA 3QHYA 4R3BA 2HDRA 4S2JA 3SS5A 1M40A 2HP9A 4IBRA 3O86A 1GA9A 1KDSA 4JXGA 1BLSA 4P87A 1HD8A 1J9MA 1ZC2A 3LY4A 3UPNA 3HLFA 2V2FF 2X02A 5F83A 1PIOA 4DE2A 1Q2PA 4OOYA 4OONA 5EVIB 2IWDA 5GHZA 2G2WA 2XFSA 2WK0A 1MWTA 3AGDA 4GD8A 3ZVTA 2Y91A 4XXRA 1I5QA 3CMZA 5FAQA 2Y2JA 5CGWA 1CK3A 5E2EA 4UA7A 1GHPA 3N8RA 5CXWA 1LL5A 5JYPA 2PBYA 1N9BA 1YLYA 3Q07A 3UDXA 4O7DA 3P09A 1EWZA 2DNSA 1O7EA 1PWGA 2G2UA 5HARA 3MFDA 1W8QA 3FV7A 4JXVA 3DWZA 3MZFA 3NIAA 3GVBA 4FSFA 4E3KA 3BECA 1VQQA 3LEZA 3WWXA 3W8KA 1PW8A 5E2GA 3OPPA 5CHUA 4IVKA 1BT5A 1DJAA 1K6RA 4KG6A 3VP3A 4B88A 3VOZA 4N1HA 1ALQA 2OV5A 5DTKA 3HUNA 4OVDA 3HLWA 3W4OA 1FCOA 2PU4A 2WAEA 5FI6A 1ES2A 1SDNA 2DCFA 5CECA 3Q81A 5CGXA 1L0EA 3M6HA 2H10A 2EX2A 3PAGA 4EBLA 4PM5A 2CC1A 5TGFA 4WYYA 3ZNTA 4HEFA 4D2OA 4KZ7A 3W4PA 4JKTA 5IHVA 1SCWA 4L0LA 1MBLA 3G32A 4WZ5C 4R3JA 3PTEA 4R1GA 1JWVA 4U3TA 3PBQA 3ZNYA 5FAPA 2WKHA 3OPRA 4IBXA 1PI4A 3MKEA 3BFDA 3GV9A 3IWOA 3ZVWA 1K56D 1CI9A 3G31A 4JF4A 5AQ7A 2XH9A 5U47A 3QNBA 3P98A 2XFTA 4K91A 5GLDA 1E3UD 3IHBA 5HFOA 5JYOA 1XGJA 2Z2MB 4E3JA 3IH9A 4BD1A 1XPBA 4N9KA 2XD5A 4S2NC 3HLDA 4S2IA 4QY5A 3RXWA 2P74A 2H0TA 4NETA 2Y59A 1K57C 2ZQ8A 5EVIA 4KZ5A 5EOEA 2HP6A 3A3EA 3BLMA 4OOLA 3D4FA 1BSGA 4K0WA 2OSUA 3S22A 1IKIA 5CTNA 1NYMA 3ZG5A 1NY0A 1W79A 1GHMA 3IH8A 4Q8IA 1K54C 2WGIA 4E6XA 2R9XA 2R9WA 3HL9A 3ZG9B 1K25A 4XUXA 2V20A 1AXBA 3MXSA 4JF6A 4Z9QA 5EE8A 1E4DA 4OPYA 2WADA 2Q9NA 2JBFA 3G2ZA 1PZOA 3UE1A 4WEJA 2XR0A 4S2PA 3OC2A 5CHJA 1FOFA 1BTLA 3UDFA 1CEGA 5F1FA 1MKIA 1TVFA 5FATA 3Q7ZA 1BLCA 4X53A 4LV1A 4KZ4A 3ZFZA 4PMAA 4R4RA 1PYYA 4E3LA 4EV4A 5DTTA 3C5AA 5FQ9A 4GOGA 4WEKA 4KQQA 5J8XA 4LENA 1SHVA 1M6KA 4R0QA 3AGFA 5BOHA 1G68A 3Q82A 1XXMA 2XEPA 3IHAA 1L0DA 3JYIA 3ZG7B 1K55C 3IWIA 4WMCA 1DJCA 2ZC6B 3IXDA 4FD8A 1DY6A 4XUZA 1ES5A 4E3OA 3BEBA 2A3UA 1CEFA 5GLCA 1YLWA 2J9PA 1FCNA 4GNUA 4Y0OA 1IEMA 5HAIA 4ZJ2A 2EX9A 1H8ZA 3M6BA 4DKIA 5DTSA 4MBHA 5HL1A 2JE5A 4U0TA 1RGYA 1XA1A 1PWCA 3UE3A 1KGEA 3W4QA 3GMWA 1C3BA 3HLEA 4OOMA 5HAPA 2Y2IA 3OPLA 2FFFB 4BL3A 4P85A 4MBFA 4JPMA 1BLPA 3HUOA 3BLSA 4ZDXA 3FYZA 3HLBA 3PBRA 4CJNA 1XKZA 2E8IA 1W7FA 2ZQ7A 4C3QA 1KGGA 1WYBA 5FQJA 3G35A 4KZ3A 3GSGA 3ITAA 1TEMA 1FSWA 2ZM8A 2IWCA 2ZQDA 3N7WA 4X68A 4X69A 1NXYA 5CEBA 5EVID 5M18A 3OCLA 4WM9A 4KZ8A 2Y2KA 4JXWA 4OQIA 2Q9MA 2UWXA 3ZG8B 4NK3A 1KVMA 3BM6A 3E2KA 5EOOA 1IYQA 3UO9A 2RCXA 4GN2A 3UNWA 4EBPA 4F94A 1ONHA 2HDQA 1S6RA 4HBTA 3VOYA 2H5SA 3Q7VA 5AQ9A 4GD6A 5A90A 3DW0A 4K0XA 3SS4A 1GCEA 2B5RA 4P0MA 3V50A 5D3OA 1LI0A 4BLMA 1MY8A 3BFCA 1TDLA 1XGIA 1VM1A 3IF6B 2HP5A 3NDGA 5EUAA 2WKEA 4KZBA 4ZAMA 4X56A 4GDBA 4QU3A 2Y2OA 3NBLA 4RYEA 1LL9A 5KSHA 1WE4A 4PM8A 1JVJA 5FI2A 3SH8A 5A91A 1XA7A 3Q1FA 5M19A 3AGEA 1HVBA 2Y55A 4JLFA 2ZQCA 5CGSA 1W5DA 3RXXA 1NZOA 3UDIA 5A93A 1BUEA 1WYCA 3SS3A 1Z6FA 3B3XA 1YMSA 3NC8A 2FFYA 3IWQA 1NJ4A 1W8YA 4E3NA 1PI5A 4WMCD 5EECA 3NDEA 2ZQAA 5KMWA 2Z2LB 4FH2A 4FH4A 1LLBA 3UPPA 5CRFA 2WGVA 2Y2MA 5DF8A 3C7VA 4S2LA 4WZ4A 3I7JA 3TG9A 4HESA 4QY6A 4C6YA 2J9OA 3WS5A 5I94A 3O88A 4YINA 1FQGA 3WRZA 4JXSA 3UPOA 3VP0A 4DXBA 5FAOA 3S4XA 2Y2HA 2Y2QA 5DF9A 3VP4A 3BYDA 4X6TA 4PM9A 3LCEA 5EVIC 4B4XA 3O87A 3C4PA 5GHYA 1BZAA 4S2MA 1IYSA 2VGKA 4OQHA 1ES4A 2J8YA 3NCKA 4GDNA 3Q7VB 2V1ZA 3CG5A 3ZCZA 3S1YA 2ZC3B 2ZJ9A 4BENA 3SOIA 5HAQA 5HX9A 4GB7A 4N9LA 5EPHA 1ZG6A 3WS2A 5TFQA 2PU2A 1O07A 4DDSA 3DWKA 3V3RA 1H5XA 5GLBA 1L0GA 4ID4A 1SKFA 1NRFA 1FR1A 1TDGA 2X71A 5E2FA 4PPRA 2HPBA 3NY4A 2OLVA 3RJUA 1G6AA 4UAAA 5FI7A 3PBSA 4N1XA 1OMEA 5TR7A 2EX6A 4KG2A 1QMEA 2HDSA 2GDNA 5A92A 4EUZA 1MWSA 4ZJ1A 1MWUA 3TSGA 1YM1A 2ZM0A 4ZJ3A 4B4ZA 1EROA 4S2KA 3IF6A 4FCFA 4M3KA 4PM6A 5FQIA 5E2HA 3C7UA 2EXBA 3GTCA 3OZHA 4EQIA 2EFXA 1MXOA 5CEDA 4OP5A 4MBKA 4OPRA 4WELA 3CZDA 3FZCA 3MBZA 2Y2PA 4RX2A 4DXCA 4DE3A 4EWFA 1JTDA 4JF5A 3IF5A 1QMFA 2EXAA 2OLUA 2XQZA 1ES3A 4BL2A 4R23A 1K6SA 1Y54A 2I72A 4E3MA 1FR6A 4JBFA 4CPKA 2P9VB 3C4OA 3UY6A 5L2FA 3VFHA 3BFFA 1L2SA 2EFUA 4GZBA 4R4SA 2Y4AA 4MLLA 1ESIA 2J7VA 1H8YA 3HLCA 2VGJA 3A3JA 1YT4A 1YLPA 5FQKA 4LV3A 5GHXA 2ZMAA 1IYPA 5M1AA 1E25A 3VMAA 5AQBA 5KZHA 4GKUA 2ZC4B 3MZEA 2QMIA 5EVLA 2HDUA 5G18A 3HUMA 1ZKJA 3WS0A 5AQAA 3MKFA 1KE4A 2EX8A 5HW3A 2ZQ9A 4QHCA 4DE0A 3GR2A 1L0FA 2WGWB 2JC7A 4LV0A 3QNCA 4OLGA 3UE0A 5F1GA 3VFFA 4OPQA 4OQGA 4LV2A 2A49A 4H8RA 3ZHHA 2WZZA 3ITBA 3N4IA 4MEZA 2IWBA 3VSLA 3SH7A 4UHUA 4BJPA 4ZTKA 1GA0A 3HBRA 3BFEA 4LCMA 5FQQA 4KQRA 3N8LA 3EQUA 5CHMA 1YQSA 4KZ6A 4HBUA 4ZBEA 3BRMA 4EBNA 3OCNA 3N6IA 3BFGA 3V39A 1YLTA 3LY3A 4RX3A 4Y0TA 4DE1A 3HREA 5KSCA 3GQZA 5F82A 5GL9A 1YMXA 1ERQA 1N4OA 2BG1A 3MXRA 3WS1A 5E43A 2ZC7A 1KE0A
chains in the Genus database with same CATH superfamily
4WZ5A 3M2JA 2ZLYA 3G2YA 1BYWA 1N9NA 2ZBBA 1EI5A 5CTMA 2Y8HA 4WBGA 2J3TD 3IQAA 1S0WA 4OQ0A 4M4XA 1VB6A 2A24A 4KZAA 3HVFA 1LSXA 3A3FA 4IEDA 1OT9A 4C75A 3ISGA 3M2KA 2O9AA 4Z1WA 4P6BA 1ZG4A 2M1CA 2LB9A 1GSXA 1D06A 2VZWA 1KGFA 4I3AA 4NEED 4Y5FA 3VE4A 3VSKA 4OH0A 5FSRA 1YLJA 4LGWA 4UA9A 2X01A 3FG8A 3NI9A 4EETB 1MPLA 1K4EA 1ERMA 1ONGA 3CPTA 3A3DA 5DVAA 3DTEA 4GCZA 3CLOA 1SDEA 2WUQA 1JTGA 2XK1A 3E2LA 4IVIA 3WRTA 2XD1A 3NOPC 3BJNA 4R3BA 3QP8A 1M40A 1KDSA 3R7WB 3LY4A 3HLFA 2V2FF 1ZTUA 2G2WA 5E2EA 5JYPA 2HJ9C 1N9BA 5L09A 2OAP1 3UDXA 1S1YA 5EM1A 1EWZA 1O7EA 1PWGA 2G2UA 1W8QA 3FV7A 2VK3A 3LEZA 5AVFA 3OPPA 3KO6A 4F3LB 1BT5A 1K6RA 2J3WA 5IU1A 1H0MA 4R6LA 3KYQA 1FCOA 2PU4A 2WAEA 2HZ5A 2DCFA 5CGXA 2EX2A 4EBLA 4EEPA 3IBRA 3LR0A 4DN0A 4ETXA 5IHVA 1P97A 3G32A 4R3JA 4LPZA 1XJ2A 3PTEA 5C5KA 1T1AA 5FAPA 3MKEA 3BFDA 1OJ5A 3G31A 4JF4A 4K91A 2W1RA 1XGJA 2Z2MB 4S2NC 4G3VA 4QY5A 4NETA 4LLOB 1K57C 3PHYA 4EESA 4PKYG 1JNUA 1DRMA 2FH5A 3D4FA 3KX0X 4K0WA 3ZG5A 1H3QA 1W79A 1K54C 1OTBA 1XFQA 2R9WA 3DAVA 4XUXA 4JF6A 4OPYA 2JBFA 4Y2FA 1PZOA 3UE1A 1K0KA 1BTLA 3Q7ZA 4X53A 5HDCA 1CQAA 3MF0A 2HV1A 3C5AA 4GOGA 3BWLA 3QP1A 4R0QA 2KLIA 2P7JA 4FD8A 1PNEA 3IX8A 5GLCA 1YLWA 2J9PA 4GNUA 4ZJ2A 2EX9A 4FTXA 3M6BA 4U0TA 1RGYA 3F1PB 4FUWA 5HDDA 1HLUP 3HLEA 4OOMA 4P85A 4JPMA 1BLPA 3BLSA 3FYZA 1XKZA 4GJ4A 1WYBA 3LIAA 5FQJA 3GSGA 4X69A 2IWCA 2JKTM 3N7WA 2XA7S 2PD7A 5EVID 3OCLA 4OQIA 2Q9MA 4PAUA 5J3WA 3UO9A 2RCXA 3IBJA 3K3CA 5AQ9A 4BBVA 5EV0A 3T1QB 1GCEA 4ARZA 4ESPA 3V50A 4BLMA 1CF0A 2W3GA 1VM1A 3NDGA 2WKEA 2VX8A 2OAQ1 2HGVA 3NBLA 2P04A 1LT0A 3LI9A 2V0UA 3AGEA 1Z6FA 3MFXA 3B3XA 1PI5A 4WMCD 2ZQAA 4FH2A 3DBAA 2NUPC 5F68A 3K2NA 3CHWP 2J9OA 5I94A 5FL3A 3UPOA 4MN6A 4NXEA 5DF9A 3MQOA 3VP4A 3QP4A 3LCEA 2WKPA 3O87A 4LRXC 4Q0HA 2JKRI 1IYSA 4Y3IA 2VGKA 3LYXA 2VV8A 2ZL1B 3IS2B 3V3RA 1H5XA 3LGOA 2HPBA 3NY4A 2OLVA 3RJUA 5FI7A 4X25A 1P9WA 4EUZA 2O9BA 5L10A 2ZM0A 1CJFA 4FCFA 3CUEC 5E2HA 4R70A 5DKKA 4EQIA 2EFXA 4OPRA 5HPFA 2A24B 2Y2PA 4RX2A 4DXCA 3T4QA 3W2ZA 1QMFA 1Y54A 2I72A 5EFWA 5F6AA 4E3MA 1FR6A 3C4OA 3VFHA 2PBDP 4R4SA 4MLLA 2J7VA 1YT4A 4PKYA 2ZMAA 1E25A 2VLGA 4WF0A 3MZEA 2QMIA 2HDUA 3WS0A 1ZKJA 2EX8A 2XA7M 1NLYA 1L0FA 4X1LA 2W0NA 3CPTB 3KSGA 3A0SA 3MXQA 3S7NA 3ZHHA 4H8RA 3N4IA 2IWBA 3VSLA 3B33A 4ZTKA 3BFEA 3N8LA 4CQHA 2PT7A 1YQSA 4HBUA 1OPXA 2B02A 3N6IA 1VEUA 2V8CA 1YLTA 4RX3A 2LB5A 4DE1A 5KSCA 1YMXA 1ERQA 1N4OA 2ZC7A 1KE0A 4MN5A 2EWVA 1BLHA 3ZDJA 1T1BA 1PWDA 4KG5A 1IKGA 3ZG0A 4NXFA 3V3SA 2QPNA 4XT2A 2EA9A 1UWPX 2C6WB 3PBNA 4S2NA 4CLCC 1CI8A 1JWZA 2XLNA 3FKVA 4YFMA 2VKSA 1K57A 4ZRRA 4KQOA 3UB9A 3MZDA 4BWIA 2PR5A 2RL3A 3LO7A 1K4FA 3IXBA 4OP8A 4DF6A 2KOIA 1K54A 4N92A 2DRWA 3CI6A 4HQAA 1YLZA 3PAEA 1MWRA 3IXHA 2WGWA 2Y2GA 3GRJA 3FKWA 3T1RA 5GLAA 1NWZA 4U0XA 1LHYA 3VP1A 4OLDA 4GS9A 5FDHA 3G6OA 5FEGA 3VP2A 1IELA 3G30A 1PW1A 4FOFA 4WLAA 1NYYA 2J3TC 1GHIA 2Q0OA 3SS5A 1GA9A 4JXGA 1BLSA 4YOFA 4KUKA 4UQIM 2QHKA 4DE2A 3TE8A 4OONA 3F1NA 4XXRA 1N9OA 1CK3A 5IT5A 4O7DA 2Y79A 2W3EA 2OOLA 5HSQA 2JN7A 3C8CA 3BECA 1VQQA 2W3HA 5E2GA 3A0RA 1MC0A 5CHUA 3VP3A 2J80A 1ALQA 4OVDA 3W4OA 2BASA 1ES2A 5CECA 3Q81A 3PAGA 4O01A 4PM5A 5F5YA 5K5BA 3NULA 3F1OA 1SCWA 3RFBA 4R1GA 2WKHA 3OPRA 4IBXA 2HJEA 1PI4A 3ZVWA 3IWOA 1K56D 3QNBA 1E3UD 3IHBA 5HFOA 5JYOA 4E3JA 4BD1A 1XPBA 4N9KA 4IJGA 3U4LP 3HLDA 4HH3A 4HNBA 1OTDA 4KZ5A 3A3EA 3BLMA 1VETA 3SW1A 1NY0A 4NG2A 4Q8IA 3UMEA 2R9XA 4ARZB 4P6ZS 4Z9QA 3S7QA 4I3JA 2WADA 2Q9NA 2UV0E 1OTEA 1FOFA 1TVFA 5MC7A 1BLCA 4LV1A 3BW6A 3ZFZA 3E4PA 4R4RA 4EV4A 4I39A 5DTTA 3BY8A 4Y13A 1G68A 2XEPA 3JYIA 4MCWA 3ZG7B 2R78A 3CUEA 2ZC6B 3IXDA 4XUZA 1DY6A 1ES5A 5EVEA 2A3UA 4EEUA 4DKIA 5HL1A 2JE5A 1KGEA 4HH2A 1C3BA 5HAPA 2Y2IA 3T1XA 3H7WA 2YKHA 1H8MA 2E8IA 5I5LA 1W7FA 2Z6DA 4C3QA 1FSWA 1YPRA 2ZM8A 3MS6A 4X68A 4KUOA 5CEBA 4WM9A 1OTIA 3VV4A 4JXWA 1IOUA 3P01A 1SKOB 4GN2A 3UNWA 1S6RA 4QWOA 3VOYA 4K0XA 4R38A 2B5RA 1LSVA 3QP2A 3T4JA 1XGIA 2HP5A 4KZBA 4X56A 2HF6A 4GDBA 4QU3A 2Y2OA 2JHEA 3FPVA 1LL9A 5KSHA 4PM8A 1JVJA 3SH8A 2ZQCA 1XFNA 4LRYC 3OLOA 1D7EA 1W5DA 2ZOIA 3RXXA 5A93A 1BUEA 1WYCA 4GW9A 3NC8A 3MSHA 3IWQA 1V9YA 3E98A 5EECA 3NDEA 5KMWA 5CRFA 3TG9A 4C6YA 4HESA 4QY6A 3WS5A 5EM0A 5AVEA 3PXPA 2Y2HA 2Y2QA 2QWSA 3BYDA 5EVIC 2JKGA 2K31A 3C4PA 1BZAA 1ES4A 3NCKA 3Q7VB 4CLCA 3SOIA 4N9LA 5TFQA 2PU2A 4DDSA 3LFVA 1TS7A 5GLBA 1L0GA 4ID4A 1SKFA 1FR1A 3LR3A 3BQ8A 1G6AA 4UAAA 1YSPA 4N1XA 1OMEA 1OTAA 4HI4A 2XROA 1A0KA 4P6ZM 4ME4A 1VEUB 3TSGA 1YM1A 4ZJ3A 5FQIA 4M3KA 1SZVA 1NRJA 2VA0A 1MXOA 1G5UA 1OJGA 2P08A 4WN5A 4MBKA 5AJGA 3FZCA 1G28A 1UGUA 5HD3A 4I3IA 3EWKA 3MQ0A 4JF5A 2OLUA 2G7UA 4BL2A 4R23A 3OBFA 1L2SA 3E0YA 1UWNX 5HL6A 3B47A 3VMAA 3SZTA 5KZHA 4GKUA 5G18A 3K3DA 2V1AA 3A0VA 5HW3A 4DE0A 2K7SA 3GR2A 2WGWB 3HCYA 4LV0A 2VV7A 5F1GA 3KSFA 3VFFA 3FPWA 4OQGA 1OT6A 4MEZA 4GS9B 4UHUA 4BJPA 5FQQA 4LCMA 4MN7A 4JGQA 4KQRA 3EQUA 5CHMA 3KSIA 1V9ZA 3BFGA 1TS8A 4Y15A 4Y0TA 1P9RA 3HREA 5F82A 3WS1A 3MXRA 2QYBA 4RQ9A 5DF7A 5DJTA 3TW8A 3T1SA 3IT9A 2AVXA 1T1CA 1GSVA 1T19A 1NLZA 2H0YA 1MZUA 4BQMA 4OKPA 1IFQA 1PZPA 3HLGA 2ZC5B 1JWPA 4I38A 2P9VA 3A3IA 4NXGA 4E6WA 4IUHA 1KE3A 3H82A 3CJMA 1LI9A 2ZD8A 3T4KA 1K38A 1FCMA 2VV6A 1ESUA 3LEQA 4Y0UA 2WAFA 2XF3A 2JKTI 3PYPA 4RA7A 5FQMA 4QB8A 1RP5A 1XJ6A 4KZ9A 4O8GA 5HDSA 5CERA 1KVLA 3FWLA 3IF6C 1HZOA 3TOIA 3F1OB 4DDYA 2CMNA 4PM7A 3DTMA 3UN7A 1GSWA 1HTZA 1S4RA 3DTKA 5FASA 1DJBA 2XGNA 3SH9A 2WZXA 4OPZA 3BQAA 2XDMA 4UA6A 1I2WA 3QHYA 4EW7A 2HDRA 4S2JA 4IBRA 3O86A 4Q0IA 4P87A 1HD8A 1ZC2A 3UPNA 2X02A 5TJJA 5F83A 1PIOA 2IWDA 1DP9A 2XFSA 2WK0A 4GD8A 1VETB 2ZOHA 1I5QA 5FAQA 2Y2JA 5CGWA 4UA7A 1TF1A 1GHPA 3N8RA 5CXWA 4JGOA 1LL5A 5J4EA 1YLYA 4L9FA 2L1MA 3P09A 2DNSA 3R4KA 5HARA 3MFDA 3MZFA 3GVBA 4NXBA 4FSFA 4E3KA 3W8KA 2WKRA 4KG6A 1DJAA 4B88A 4JGRA 3VOZA 2OV5A 3IX4A 3LI8A 5DTKA 3HUNA 4LFUA 5FEFA 1F5MA 5FI6A 3UMDA 1SDNA 3ZQ5A 3E4OA 4WYYA 5TGFA 3ULFA 3ZNTA 4D2OA 4KZ7A 3V67A 4JKTA 4EERA 3KYEA 1JWVA 4EXOA 3PBQA 3ZNYA 3NECA 3H7WB 5AQ7A 5U47A 5GLDA 5HWTA 5KIZA 2IA2A 3IH9A 1F98A 2D01A 2ZQ8A 5EVIA 4BMWA 3QP5A 4Q0JA 2O99A 3S22A 5CTNA 1NYMA 1TD5A 3IH8A 2WGIA 3TJZC 3ZG9B 3MXSA 5EE8A 1W63M 4YWZA 3G2ZA 5CHJA 4WEJA 2XR0A 5F1FA 1CEGA 2DMWA 5FATA 3D3OA 2INWA 4PMAA 1PYYA 2O0YA 4WEKA 5J8XA 4LENA 1SHVA 3MMHA 1M6KA 3AGFA 5BOHA 3EEHA 4B93A 1XXMA 3IHAA 3EEAA 1K55C 3IWIA 3T4OA 3OOVA 4WMCA 1DJCA 1Y4OA 5IS1A 1CEFA 2WKQA 1FCNA 1IEMA 1H8ZA 3ZYTA 1XA1A 1PWCA 3LR4A 3UE3A 4QPRA 3GMWA 3W4QA 2M7UA 3OPLA 2FFFB 4BL3A 5F69A 1XJ3A 3PBRA 4CJNA 3T12B 4CLCB 1KGGA 3T4TA 3G35A 4KZ3A 3ITAA 2ZQDA 1NXYA 5M18A 2Y2KA 2UWXA 4NK3A 1KVMA 3E2KA 1IYQA 1ONHA 4JGPA 1S67L 4HBTA 4GD6A 3D72A 1VHMA 2PR6A 5A90A 3SS4A 4P0MA 2W1TA 5D3OA 2ZL1A 1MY8A 1TDLA 4LRZE 1PFLA 4ZAMA 3LUQA 4RYEA 5M19A 4ETZA 4JLFA 2OWHA 5CGSA 4HJ3A 1STZA 3UDIA 3QP6A 2FFYA 1W8YA 4MMNA 2GNXA 1TS6A 3UPPA 2Y2MA 3C7VA 4S2LA 2GX5A 4YINA 3WRZA 4JXSA 4DXBA 5FAOA 1Y28A 3S4XA 4BBUA 4X6TA 4PM9A 3EOIA 4WUJA 2Z6CA 5GHYA 2XRNA 2ZMVA 2I9VA 4OQHA 2J8YA 3L9KA 4GDNA 2V1ZA 3CG5A 4H6JA 2ZC3B 2ZJ9A 1YKDA 2PYRA 5HAQA 5HX9A 4EU0A 4GB7A 5EPHA 3WS2A 3VOLA 1O07A 3DWKA 3TRCA 3B42A 1NRFA 5HWVA 1TDGA 1LL8A 2X71A 1FILA 5E2FA 2GZAA 3FC7A 5TR7A 4KG2A 2KDKA 4E04A 1MWSA 1G6OA 1MWUA 4S2KA 3IF6A 1PRQA 4DJ2A 3C7UA 3GTCA 3OZHA 4GLQA 5CEDA 4OP5A 5HD5A 4WELA 1JTDA 2EXAA 2XQZA 4R3AA 1K6SA 3IX3A 4JBFA 4CPKA 2P9VB 3UY6A 3E4QA 4HJ4A 2EFUA 4GZBA 3H82B 2W3FA 1H8YA 5TBMA 1KOUA 1WA9A 2V0WA 2VGJA 3KSHA 1YLPA 5FQKA 4LV3A 1IYPA 3GDIA 1Z09A 2ZC4B 2VGLS 5EVLA 5AQAA 3MKFA 2ZQ9A 4QHCA 3LIFA 2NUTC 3UB5P 4OLGA 3UE0A 2W3DA 3HJIA 4LV2A 2A49A 5G4YA 2WZZA 3ITBA 4DJ3A 4DMZA 2H28A 3SH7A 3BRMA 4EBNA 3OCNA 3BY9A 3LY3A 4KQDA 5DFXA 3GQZA 5CX7A 3C38A 1ODVA 2QJ5A 3WS4A 3ZGAB 2WKIA 2JCHA 4X55A 4RVAA 4KENB 1F2KA 1XP4A 4G3WA 3PBOA 3T4LA 5FA7A 4DRTA 4QD4A 1Q2QA 2WYXA 3S7PA 4E3IA 3G34A 5HZHA 2C5WB 4Y7PA 5LBRA 1RGZA 3P7NA 2ZM2A 3MR0A 3ICYA 3V5MA 1KDWA 1BULA 2QZ6A 2L4RA 3OPHA 1X0OA 3CWFA 2Y2NA 2OWJA 4A5RA 1NZUA 3O3VA 1IYOA 3IXGA 1U60A 3N8SA 1I2SA 4MNRA 3S7OA 4S2OA 4GHIA 1FSYA 4QJGA 3EQVA 4LCLA 1XX2A 4BD0A 1RCJA 2Y2LA 4CLCE 1K55A 3G4PA 1K56A 4XT2B 2PDRA 2BLSA 5L07A 2JKRM 2PAVP 3PBTA 1E3UA 3CAXA 3D9YA 1FIKA 2HP9A 1T18A 1XJ4A 1J9MA 1Q2PA 4OOYA 5EVIB 5GHZA 1MWTA 3AGDA 3ZVTA 2Y91A 1DP8A 4II7A 3CMZA 2PBYA 2JKFA 2VEAA 2B95A 3Q07A 1LSWA 1D1JA 4JXVA 3DWZA 3NIAA 3LIDA 3WWXA 1PW8A 2L0WA 4IVKA 2VGLM 4N1HA 2V8FA 3HLWA 3C2WA 1L0EA 3M6HA 2H10A 3LICA 2CC1A 3GECA 4HEFA 3W4PA 4X1MA 4K08A 4L0LA 1MBLA 5L8MA 4WZ5C 4U3TA 3F1NB 4L9GA 3JVUA 3MJQA 3MQQA 3GV9A 1CI9A 3C30A 2XH9A 3P98A 1YSQA 2XFTA 3RTYA 5DFYA 4PHTA 3VE3A 2XD5A 4HIAA 4S2IA 3R7WA 3RXWA 2P74A 2H0TA 2Y59A 2ZMFA 5EOEA 2HP6A 4OOLA 1BSGA 2OSUA 1IKIA 1GHMA 4E6XA 3HL9A 1P0ZA 1K25A 2W1TB 2V20A 1AXBA 5J7EA 1E4DA 2VJWA 4S2PA 3OC2A 5DKLA 3UDFA 2A2LA 1MKIA 2B18A 4KZ4A 3EGDC 4E3LA 4F3LA 1SKOA 5FQ9A 4KQQA 4I5SA 2ACGA 3O5YA 3Q82A 3NOUC 1L0DA 5A8BA 3T50A 4E3OA 3EGXC 3BEBA 3NOTC 4Y0OA 2GJ3A 2QKPA 3JVVA 5HAIA 3KYZA 5DTSA 4MBHA 2PHYA 4UQIS 2MJ6A 4MBFA 3HUOA 4ZDXA 1S4SA 3HLBA 4H6JB 2ZQ7A 2V9AA 1TEMA 4AFIA 4KZ8A 2FZ0A 2BTFP 5G4ZA 4HP9A 3LR5A 4HHDA 3ZG8B 3H9WA 4IUKA 3BM6A 5EOOA 4EBPA 4F94A 2HDQA 2PYPA 4HY8A 2H5SA 3Q7VA 3JPUA 3LIBA 3DW0A 1LI0A 3L7HA 4MDZA 3BFCA 3IF6B 5EUAA 4EUVA 1L3LA 2EWWA 1WE4A 5FI2A 5A91A 1XA7A 1ZHHB 3Q1FA 1HVBA 2Y55A 1NZOA 5HWWA 4UEYA 1ACFA 3SS3A 1YMSA 2K2NA 1NJ4A 3NJAA 4E3NA 4O0PA 2V1BA 2Z2LB 4FH4A 4YNRA 1LLBA 5DF8A 2WGVA 4WZ4A 3UB7A 3I7JA 4B9OA 3O88A 1FQGA 3VP0A 1AWIA 2XSSA 2W27A 4IHQA 5TBMB 3F1PA 4B4XA 4S2MA 2D02A 3ZCZA 3S1YA 3LIEA 4BENA 1DP6A 1W63Q 1ZG6A 3DTIA 4PPRA 3T4SA 1MKMA 2O9CA 3PBSA 2EX6A 2KX6A 1QMEA 4D60A 2HDSA 1S1ZA 2GDNA 5A92A 4ZJ1A 1YAXA 1F9IA 4B4ZA 1EROA 4PM6A 4BBTA 2EXBA 4Y17A 4HJ6A 3RH8B 1J3WA 3CZDA 3MBZA 3HJKA 2YKFA 4DE3A 4EWFA 3CITA 3IF5A 5DJUA 1ES3A 4G3KA 5L2FA 3BFFA 1S66L 2QJ7A 3UB8A 2Y4AA 1ESIA 1TS0A 3HLCA 3A3JA 5M1AA 5GHXA 5AQBA 4CLCD 3PR6A 3HUMA 4WL9A 1KE4A 4L9EA 2M7VA 4HOIA 3IS2A 2PRFA 1N9LA 5FDSA 3UB6A 3UE6A 4HP4A 2JC7A 3QNCA 2PD8A 4OPQA 1EW0A 4GHIB 4NKPA 3NHQA 1GA0A 3HBRA 3U2AA 4KZ6A 4ZBEA 5HPIA 4EQ1A 3V39A 5GL9A 2BG1A 2E8JA 5E43A
chains in the Genus database with same CATH topology
4WZ5A 3M2JA 5DF7A 2ZLYA 1BLHA 3WS4A 3G2YA 3ZGAB 2WKIA 3ZDJA 1EI5A 5CTMA 1PWDA 3IT9A 4KG5A 2JCHA 4WBGA 1IKGA 3IQAA 1S0WA 4X55A 4RVAA 2H0YA 3ZG0A 4OQ0A 4KENB 1XP4A 3V3SA 2QPNA 3PBOA 4KZAA 3HVFA 3A3FA 4IEDA 5FA7A 4BQMA 4DRTA 4OKPA 4QD4A 1Q2QA 2C6WB 3PBNA 4S2NA 4C75A 2WYXA 3ISGA 3M2KA 1CI8A 1JWZA 1PZPA 2XLNA 3FKVA 3G34A 3HLGA 2ZC5B 4YFMA 4E3IA 1JWPA 2P9VA 3A3IA 4E6WA 4P6BA 1K57A 2C5WB 4Y7PA 1ZG4A 4KQOA 1KE3A 1RGZA 2ZM2A 3MZDA 2RL3A 1KGFA 3CJMA 3LO7A 1LI9A 2ZD8A 1K4FA 3IXBA 3V5MA 1KDWA 3VSKA 1BULA 1FCMA 1K38A 4OH0A 4OP8A 5FSRA 1YLJA 4DF6A 2QZ6A 3OPHA 1ESUA 1K54A 4N92A 2DRWA 4UA9A 2WAFA 2XF3A 2Y2NA 4Y0UA 2X01A 4RA7A 5FQMA 4QB8A 1YLZA 3NI9A 1RP5A 3PAEA 4A5RA 4KZ9A 1NZUA 3O3VA 1MWRA 1MPLA 1IYOA 3IXHA 2WGWA 2Y2GA 1KVLA 3FWLA 3GRJA 5CERA 3FKWA 3IXGA 1U60A 1K4EA 5GLAA 3IF6C 1ERMA 1ONGA 3N8SA 3A3DA 4U0XA 1HZOA 1I2SA 1LHYA 5DVAA 4MNRA 3TOIA 4DDYA 4S2OA 1FSYA 4PM7A 3DTMA 4OLDA 3VP1A 3EQVA 4LCLA 1XX2A 3UN7A 4QJGA 1HTZA 5FDHA 4BD0A 3VP2A 1IELA 3G30A 1PW1A 1RCJA 1SDEA 2WUQA 2Y2LA 1NYYA 1K55A 3G4PA 1DJBA 1JTGA 5FASA 2XK1A 3E2LA 1K56A 4IVIA 1GHIA 2XGNA 3SH9A 2XD1A 2WZXA 4OPZA 3WRTA 2BLSA 2XDMA 4UA6A 3PBTA 1E3UA 1I2WA 3QHYA 4R3BA 2HDRA 4S2JA 3SS5A 1M40A 2HP9A 4IBRA 3O86A 1GA9A 1KDSA 4JXGA 1BLSA 4P87A 1HD8A 1J9MA 1ZC2A 3LY4A 3UPNA 3HLFA 2V2FF 2X02A 5F83A 1PIOA 4DE2A 1Q2PA 4OOYA 4OONA 5EVIB 2IWDA 5GHZA 2G2WA 2XFSA 2WK0A 1MWTA 3AGDA 4GD8A 3ZVTA 2Y91A 4XXRA 1I5QA 3CMZA 5FAQA 2Y2JA 5CGWA 1CK3A 5E2EA 4UA7A 1GHPA 3N8RA 5CXWA 1LL5A 5JYPA 2PBYA 1N9BA 1YLYA 3Q07A 3UDXA 4O7DA 3P09A 1EWZA 2DNSA 1O7EA 1PWGA 2G2UA 5HARA 3MFDA 1W8QA 3FV7A 4JXVA 3DWZA 3MZFA 3NIAA 3GVBA 4FSFA 4E3KA 3BECA 1VQQA 3LEZA 3WWXA 3W8KA 1PW8A 5E2GA 3OPPA 5CHUA 4IVKA 1BT5A 1DJAA 1K6RA 4KG6A 3VP3A 4B88A 3VOZA 4N1HA 1ALQA 2OV5A 5DTKA 3HUNA 4OVDA 3HLWA 3W4OA 1FCOA 2PU4A 2WAEA 5FI6A 1ES2A 1SDNA 2DCFA 5CECA 3Q81A 5CGXA 1L0EA 3M6HA 2H10A 2EX2A 3PAGA 4EBLA 4PM5A 2CC1A 5TGFA 4WYYA 3ZNTA 4HEFA 4D2OA 4KZ7A 3W4PA 4JKTA 5IHVA 1SCWA 4L0LA 1MBLA 3G32A 4WZ5C 4R3JA 3PTEA 4R1GA 1JWVA 4U3TA 3PBQA 3ZNYA 5FAPA 2WKHA 3OPRA 4IBXA 1PI4A 3MKEA 3BFDA 3GV9A 3IWOA 3ZVWA 1K56D 1CI9A 3G31A 4JF4A 5AQ7A 2XH9A 5U47A 3QNBA 3P98A 2XFTA 4K91A 5GLDA 1E3UD 3IHBA 5HFOA 5JYOA 1XGJA 2Z2MB 4E3JA 3IH9A 4BD1A 1XPBA 4N9KA 2XD5A 4S2NC 3HLDA 4S2IA 4QY5A 3RXWA 2P74A 2H0TA 4NETA 2Y59A 1K57C 2ZQ8A 5EVIA 4KZ5A 5EOEA 2HP6A 3A3EA 3BLMA 4OOLA 3D4FA 1BSGA 4K0WA 2OSUA 3S22A 1IKIA 5CTNA 1NYMA 3ZG5A 1NY0A 1W79A 1GHMA 3IH8A 4Q8IA 1K54C 2WGIA 4E6XA 2R9XA 2R9WA 3HL9A 3ZG9B 1K25A 4XUXA 2V20A 1AXBA 3MXSA 4JF6A 4Z9QA 5EE8A 1E4DA 4OPYA 2WADA 2Q9NA 2JBFA 3G2ZA 1PZOA 3UE1A 4WEJA 2XR0A 4S2PA 3OC2A 5CHJA 1FOFA 1BTLA 3UDFA 1CEGA 5F1FA 1MKIA 1TVFA 5FATA 3Q7ZA 1BLCA 4X53A 4LV1A 4KZ4A 3ZFZA 4PMAA 4R4RA 1PYYA 4E3LA 4EV4A 5DTTA 3C5AA 5FQ9A 4GOGA 4WEKA 4KQQA 5J8XA 4LENA 1SHVA 1M6KA 4R0QA 3AGFA 5BOHA 1G68A 3Q82A 1XXMA 2XEPA 3IHAA 1L0DA 3JYIA 3ZG7B 1K55C 3IWIA 4WMCA 1DJCA 2ZC6B 3IXDA 4FD8A 1DY6A 4XUZA 1ES5A 4E3OA 3BEBA 2A3UA 1CEFA 5GLCA 1YLWA 2J9PA 1FCNA 4GNUA 4Y0OA 1IEMA 5HAIA 4ZJ2A 2EX9A 1H8ZA 3M6BA 4DKIA 5DTSA 4MBHA 5HL1A 2JE5A 4U0TA 1RGYA 1XA1A 1PWCA 3UE3A 1KGEA 3W4QA 3GMWA 1C3BA 3HLEA 4OOMA 5HAPA 2Y2IA 3OPLA 2FFFB 4BL3A 4P85A 4MBFA 4JPMA 1BLPA 3HUOA 3BLSA 4ZDXA 3FYZA 3HLBA 3PBRA 4CJNA 1XKZA 2E8IA 1W7FA 2ZQ7A 4C3QA 1KGGA 1WYBA 5FQJA 3G35A 4KZ3A 3GSGA 3ITAA 1TEMA 1FSWA 2ZM8A 2IWCA 2ZQDA 3N7WA 4X68A 4X69A 1NXYA 5CEBA 5EVID 5M18A 3OCLA 4WM9A 4KZ8A 2Y2KA 4JXWA 4OQIA 2Q9MA 2UWXA 3ZG8B 4NK3A 1KVMA 3BM6A 3E2KA 5EOOA 1IYQA 3UO9A 2RCXA 4GN2A 3UNWA 4EBPA 4F94A 1ONHA 2HDQA 1S6RA 4HBTA 3VOYA 2H5SA 3Q7VA 5AQ9A 4GD6A 5A90A 3DW0A 4K0XA 3SS4A 1GCEA 2B5RA 4P0MA 3V50A 5D3OA 1LI0A 4BLMA 1MY8A 3BFCA 1TDLA 1XGIA 1VM1A 3IF6B 2HP5A 3NDGA 5EUAA 2WKEA 4KZBA 4ZAMA 4X56A 4GDBA 4QU3A 2Y2OA 3NBLA 4RYEA 1LL9A 5KSHA 1WE4A 4PM8A 1JVJA 5FI2A 3SH8A 5A91A 1XA7A 3Q1FA 5M19A 3AGEA 1HVBA 2Y55A 4JLFA 2ZQCA 5CGSA 1W5DA 3RXXA 1NZOA 3UDIA 5A93A 1BUEA 1WYCA 3SS3A 1Z6FA 3B3XA 1YMSA 3NC8A 2FFYA 3IWQA 1NJ4A 1W8YA 4E3NA 1PI5A 4WMCD 5EECA 3NDEA 2ZQAA 5KMWA 2Z2LB 4FH2A 4FH4A 1LLBA 3UPPA 5CRFA 2WGVA 2Y2MA 5DF8A 3C7VA 4S2LA 4WZ4A 3I7JA 3TG9A 4HESA 4QY6A 4C6YA 2J9OA 3WS5A 5I94A 3O88A 4YINA 1FQGA 3WRZA 4JXSA 3UPOA 3VP0A 4DXBA 5FAOA 3S4XA 2Y2HA 2Y2QA 5DF9A 3VP4A 3BYDA 4X6TA 4PM9A 3LCEA 5EVIC 4B4XA 3O87A 3C4PA 5GHYA 1BZAA 4S2MA 1IYSA 2VGKA 4OQHA 1ES4A 2J8YA 3NCKA 4GDNA 3Q7VB 2V1ZA 3CG5A 3ZCZA 3S1YA 2ZC3B 2ZJ9A 4BENA 3SOIA 5HAQA 5HX9A 4GB7A 4N9LA 5EPHA 1ZG6A 3WS2A 5TFQA 2PU2A 1O07A 4DDSA 3DWKA 3V3RA 1H5XA 5GLBA 1L0GA 4ID4A 1SKFA 1NRFA 1FR1A 1TDGA 2X71A 5E2FA 4PPRA 2HPBA 3NY4A 2OLVA 3RJUA 1G6AA 4UAAA 5FI7A 3PBSA 4N1XA 1OMEA 5TR7A 2EX6A 4KG2A 1QMEA 2HDSA 2GDNA 5A92A 4EUZA 1MWSA 4ZJ1A 1MWUA 3TSGA 1YM1A 2ZM0A 4ZJ3A 4B4ZA 1EROA 4S2KA 3IF6A 4FCFA 4M3KA 4PM6A 5FQIA 5E2HA 3C7UA 2EXBA 3GTCA 3OZHA 4EQIA 2EFXA 1MXOA 5CEDA 4OP5A 4MBKA 4OPRA 4WELA 3CZDA 3FZCA 3MBZA 2Y2PA 4RX2A 4DXCA 4DE3A 4EWFA 1JTDA 4JF5A 3IF5A 1QMFA 2EXAA 2OLUA 2XQZA 1ES3A 4BL2A 4R23A 1K6SA 1Y54A 2I72A 4E3MA 1FR6A 4JBFA 4CPKA 2P9VB 3C4OA 3UY6A 5L2FA 3VFHA 3BFFA 1L2SA 2EFUA 4GZBA 4R4SA 2Y4AA 4MLLA 1ESIA 2J7VA 1H8YA 3HLCA 2VGJA 3A3JA 1YT4A 1YLPA 5FQKA 4LV3A 5GHXA 2ZMAA 1IYPA 5M1AA 1E25A 3VMAA 5AQBA 5KZHA 4GKUA 2ZC4B 3MZEA 2QMIA 5EVLA 2HDUA 5G18A 3HUMA 1ZKJA 3WS0A 5AQAA 3MKFA 1KE4A 2EX8A 5HW3A 2ZQ9A 4QHCA 4DE0A 3GR2A 1L0FA 2WGWB 2JC7A 4LV0A 3QNCA 4OLGA 3UE0A 5F1GA 3VFFA 4OPQA 4OQGA 4LV2A 2A49A 4H8RA 3ZHHA 2WZZA 3ITBA 3N4IA 4MEZA 2IWBA 3VSLA 3SH7A 4UHUA 4BJPA 4ZTKA 1GA0A 3HBRA 3BFEA 4LCMA 5FQQA 4KQRA 3N8LA 3EQUA 5CHMA 1YQSA 4KZ6A 4HBUA 4ZBEA 3BRMA 4EBNA 3OCNA 3N6IA 3BFGA 3V39A 1YLTA 3LY3A 4RX3A 4Y0TA 4DE1A 3HREA 5KSCA 3GQZA 5F82A 5GL9A 1YMXA 1ERQA 1N4OA 2BG1A 3MXRA 3WS1A 5E43A 2ZC7A 1KE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZ5 A;  3M2J A;  5DF7 A;  2ZLY A;  1BLH A;  3WS4 A;  3G2Y A;  3ZGA B;  2WKI A;  3ZDJ A;  1EI5 A;  5CTM A;  1PWD A;  3IT9 A;  4KG5 A;  2JCH A;  4WBG A;  1IKG A;  3IQA A;  1S0W A;  4X55 A;  4RVA A;  2H0Y A;  3ZG0 A;  4OQ0 A;  4KEN B;  1XP4 A;  3V3S A;  2QPN A;  3PBO A;  4KZA A;  3HVF A;  3A3F A;  4IED A;  5FA7 A;  4BQM A;  4DRT A;  4OKP A;  4QD4 A;  1Q2Q A;  2C6W B;  3PBN A;  4S2N A;  4C75 A;  2WYX A;  3ISG A;  3M2K A;  1CI8 A;  1JWZ A;  1PZP A;  2XLN A;  3FKV A;  3G34 A;  3HLG A;  2ZC5 B;  4YFM A;  4E3I A;  1JWP A;  2P9V A;  3A3I A;  4E6W A;  4P6B A;  1K57 A;  2C5W B;  4Y7P A;  1ZG4 A;  4KQO A;  1KE3 A;  1RGZ A;  2ZM2 A;  3MZD A;  2RL3 A;  1KGF A;  3CJM A;  3LO7 A;  1LI9 A;  2ZD8 A;  1K4F A;  3IXB A;  3V5M A;  1KDW A;  3VSK A;  1BUL A;  1FCM A;  1K38 A;  4OH0 A;  4OP8 A;  5FSR A;  1YLJ A;  4DF6 A;  2QZ6 A;  3OPH A;  1ESU A;  1K54 A;  4N92 A;  2DRW A;  4UA9 A;  2WAF A;  2XF3 A;  2Y2N A;  4Y0U A;  2X01 A;  4RA7 A;  5FQM A;  4QB8 A;  1YLZ A;  3NI9 A;  1RP5 A;  3PAE A;  4A5R A;  4KZ9 A;  1NZU A;  3O3V A;  1MWR A;  1MPL A;  1IYO A;  3IXH A;  2WGW A;  2Y2G A;  1KVL A;  3FWL A;  3GRJ A;  5CER A;  3FKW A;  3IXG A;  1U60 A;  1K4E A;  5GLA A;  3IF6 C;  1ERM A;  1ONG A;  3N8S A;  3A3D A;  4U0X A;  1HZO A;  1I2S A;  1LHY A;  5DVA A;  4MNR A;  3TOI A;  4DDY A;  4S2O A;  1FSY A;  4PM7 A;  3DTM A;  4OLD A;  3VP1 A;  3EQV A;  4LCL A;  1XX2 A;  3UN7 A;  4QJG A;  1HTZ A;  5FDH A;  4BD0 A;  3VP2 A;  1IEL A;  3G30 A;  1PW1 A;  1RCJ A;  1SDE A;  2WUQ A;  2Y2L A;  1NYY A;  1K55 A;  3G4P A;  1DJB A;  1JTG A;  5FAS A;  2XK1 A;  3E2L A;  1K56 A;  4IVI A;  1GHI A;  2XGN A;  3SH9 A;  2XD1 A;  2WZX A;  4OPZ A;  3WRT A;  2BLS A;  2XDM A;  4UA6 A;  3PBT A;  1E3U A;  1I2W A;  3QHY A;  4R3B A;  2HDR A;  4S2J A;  3SS5 A;  1M40 A;  2HP9 A;  4IBR A;  3O86 A;  1GA9 A;  1KDS A;  4JXG A;  1BLS A;  4P87 A;  1HD8 A;  1J9M A;  1ZC2 A;  3LY4 A;  3UPN A;  3HLF A;  2V2F F;  2X02 A;  5F83 A;  1PIO A;  4DE2 A;  1Q2P A;  4OOY A;  4OON A;  5EVI B;  2IWD A;  5GHZ A;  2G2W A;  2XFS A;  2WK0 A;  1MWT A;  3AGD A;  4GD8 A;  3ZVT A;  2Y91 A;  4XXR A;  1I5Q A;  3CMZ A;  5FAQ A;  2Y2J A;  5CGW A;  1CK3 A;  5E2E A;  4UA7 A;  1GHP A;  3N8R A;  5CXW A;  1LL5 A;  5JYP A;  2PBY A;  1N9B A;  1YLY A;  3Q07 A;  3UDX A;  4O7D A;  3P09 A;  1EWZ A;  2DNS A;  1O7E A;  1PWG A;  2G2U A;  5HAR A;  3MFD A;  1W8Q A;  3FV7 A;  4JXV A;  3DWZ A;  3MZF A;  3NIA A;  3GVB A;  4FSF A;  4E3K A;  3BEC A;  1VQQ A;  3LEZ A;  3WWX A;  3W8K A;  1PW8 A;  5E2G A;  3OPP A;  5CHU A;  4IVK A;  1BT5 A;  1DJA A;  1K6R A;  4KG6 A;  3VP3 A;  4B88 A;  3VOZ A;  4N1H A;  1ALQ A;  2OV5 A;  5DTK A;  3HUN A;  4OVD A;  3HLW A;  3W4O A;  1FCO A;  2PU4 A;  2WAE A;  5FI6 A;  1ES2 A;  1SDN A;  2DCF A;  5CEC A;  3Q81 A;  5CGX A;  1L0E A;  3M6H A;  2H10 A;  2EX2 A;  3PAG A;  4EBL A;  4PM5 A;  2CC1 A;  5TGF A;  4WYY A;  3ZNT A;  4HEF A;  4D2O A;  4KZ7 A;  3W4P A;  4JKT A;  5IHV A;  1SCW A;  4L0L A;  1MBL A;  3G32 A;  4WZ5 C;  4R3J A;  3PTE A;  4R1G A;  1JWV A;  4U3T A;  3PBQ A;  3ZNY A;  5FAP A;  2WKH A;  3OPR A;  4IBX A;  1PI4 A;  3MKE A;  3BFD A;  3GV9 A;  3IWO A;  3ZVW A;  1K56 D;  1CI9 A;  3G31 A;  4JF4 A;  5AQ7 A;  2XH9 A;  5U47 A;  3QNB A;  3P98 A;  2XFT A;  4K91 A;  5GLD A;  1E3U D;  3IHB A;  5HFO A;  5JYO A;  1XGJ A;  2Z2M B;  4E3J A;  3IH9 A;  4BD1 A;  1XPB A;  4N9K A;  2XD5 A;  4S2N C;  3HLD A;  4S2I A;  4QY5 A;  3RXW A;  2P74 A;  2H0T A;  4NET A;  2Y59 A;  1K57 C;  2ZQ8 A;  5EVI A;  4KZ5 A;  5EOE A;  2HP6 A;  3A3E A;  3BLM A;  4OOL A;  3D4F A;  1BSG A;  4K0W A;  2OSU A;  3S22 A;  1IKI A;  5CTN A;  1NYM A;  3ZG5 A;  1NY0 A;  1W79 A;  1GHM A;  3IH8 A;  4Q8I A;  1K54 C;  2WGI A;  4E6X A;  2R9X A;  2R9W A;  3HL9 A;  3ZG9 B;  1K25 A;  4XUX A;  2V20 A;  1AXB A;  3MXS A;  4JF6 A;  4Z9Q A;  5EE8 A;  1E4D A;  4OPY A;  2WAD A;  2Q9N A;  2JBF A;  3G2Z A;  1PZO A;  3UE1 A;  4WEJ A;  2XR0 A;  4S2P A;  3OC2 A;  5CHJ A;  1FOF A;  1BTL A;  3UDF A;  1CEG A;  5F1F A;  1MKI A;  1TVF A;  5FAT A;  3Q7Z A;  1BLC A;  4X53 A;  4LV1 A;  4KZ4 A;  3ZFZ A;  4PMA A;  4R4R A;  1PYY A;  4E3L A;  4EV4 A;  5DTT A;  3C5A A;  5FQ9 A;  4GOG A;  4WEK A;  4KQQ A;  5J8X A;  4LEN A;  1SHV A;  1M6K A;  4R0Q A;  3AGF A;  5BOH A;  1G68 A;  3Q82 A;  1XXM A;  2XEP A;  3IHA A;  1L0D A;  3JYI A;  3ZG7 B;  1K55 C;  3IWI A;  4WMC A;  1DJC A;  2ZC6 B;  3IXD A;  4FD8 A;  1DY6 A;  4XUZ A;  1ES5 A;  4E3O A;  3BEB A;  2A3U A;  1CEF A;  5GLC A;  1YLW A;  2J9P A;  1FCN A;  4GNU A;  4Y0O A;  1IEM A;  5HAI A;  4ZJ2 A;  2EX9 A;  1H8Z A;  3M6B A;  4DKI A;  5DTS A;  4MBH A;  5HL1 A;  2JE5 A;  4U0T A;  1RGY A;  1XA1 A;  1PWC A;  3UE3 A;  1KGE A;  3W4Q A;  3GMW A;  1C3B A;  3HLE A;  4OOM A;  5HAP A;  2Y2I A;  3OPL A;  2FFF B;  4BL3 A;  4P85 A;  4MBF A;  4JPM A;  1BLP A;  3HUO A;  3BLS A;  4ZDX A;  3FYZ A;  3HLB A;  3PBR A;  4CJN A;  1XKZ A;  2E8I A;  1W7F A;  2ZQ7 A;  4C3Q A;  1KGG A;  1WYB A;  5FQJ A;  3G35 A;  4KZ3 A;  3GSG A;  3ITA A;  1TEM A;  1FSW A;  2ZM8 A;  2IWC A;  2ZQD A;  3N7W A;  4X68 A;  4X69 A;  1NXY A;  5CEB A;  5EVI D;  5M18 A;  3OCL A;  4WM9 A;  4KZ8 A;  2Y2K A;  4JXW A;  4OQI A;  2Q9M A;  2UWX A;  3ZG8 B;  4NK3 A;  1KVM A;  3BM6 A;  3E2K A;  5EOO A;  1IYQ A;  3UO9 A;  2RCX A;  4GN2 A;  3UNW A;  4EBP A;  4F94 A;  1ONH A;  2HDQ A;  1S6R A;  4HBT A;  3VOY A;  2H5S A;  3Q7V A;  5AQ9 A;  4GD6 A;  5A90 A;  3DW0 A;  4K0X A;  3SS4 A;  1GCE A;  2B5R A;  4P0M A;  3V50 A;  5D3O A;  1LI0 A;  4BLM A;  1MY8 A;  3BFC A;  1TDL A;  1XGI A;  1VM1 A;  3IF6 B;  2HP5 A;  3NDG A;  5EUA A;  2WKE A;  4KZB A;  4ZAM A;  4X56 A;  4GDB A;  4QU3 A;  2Y2O A;  3NBL A;  4RYE A;  1LL9 A;  5KSH A;  1WE4 A;  4PM8 A;  1JVJ A;  5FI2 A;  3SH8 A;  5A91 A;  1XA7 A;  3Q1F A;  5M19 A;  3AGE A;  1HVB A;  2Y55 A;  4JLF A;  2ZQC A;  5CGS A;  1W5D A;  3RXX A;  1NZO A;  3UDI A;  5A93 A;  1BUE A;  1WYC A;  3SS3 A;  1Z6F A;  3B3X A;  1YMS A;  3NC8 A;  2FFY A;  3IWQ A;  1NJ4 A;  1W8Y A;  4E3N A;  1PI5 A;  4WMC D;  5EEC A;  3NDE A;  2ZQA A;  5KMW A;  2Z2L B;  4FH2 A;  4FH4 A;  1LLB A;  3UPP A;  5CRF A;  2WGV A;  2Y2M A;  5DF8 A;  3C7V A;  4S2L A;  4WZ4 A;  3I7J A;  3TG9 A;  4HES A;  4QY6 A;  4C6Y A;  2J9O A;  3WS5 A;  5I94 A;  3O88 A;  4YIN A;  1FQG A;  3WRZ A;  4JXS A;  3UPO A;  3VP0 A;  4DXB A;  5FAO A;  3S4X A;  2Y2H A;  2Y2Q A;  5DF9 A;  3VP4 A;  3BYD A;  4X6T A;  4PM9 A;  3LCE A;  5EVI C;  4B4X A;  3O87 A;  3C4P A;  5GHY A;  1BZA A;  4S2M A;  1IYS A;  2VGK A;  4OQH A;  1ES4 A;  2J8Y A;  3NCK A;  4GDN A;  3Q7V B;  2V1Z A;  3CG5 A;  3ZCZ A;  3S1Y A;  2ZC3 B;  2ZJ9 A;  4BEN A;  3SOI A;  5HAQ A;  5HX9 A;  4GB7 A;  4N9L A;  5EPH A;  1ZG6 A;  3WS2 A;  5TFQ A;  2PU2 A;  1O07 A;  4DDS A;  3DWK A;  3V3R A;  1H5X A;  5GLB A;  1L0G A;  4ID4 A;  1SKF A;  1NRF A;  1FR1 A;  1TDG A;  2X71 A;  5E2F A;  4PPR A;  2HPB A;  3NY4 A;  2OLV A;  3RJU A;  1G6A A;  4UAA A;  5FI7 A;  3PBS A;  4N1X A;  1OME A;  5TR7 A;  2EX6 A;  4KG2 A;  1QME A;  2HDS A;  2GDN A;  5A92 A;  4EUZ A;  1MWS A;  4ZJ1 A;  1MWU A;  3TSG A;  1YM1 A;  2ZM0 A;  4ZJ3 A;  4B4Z A;  1ERO A;  4S2K A;  3IF6 A;  4FCF A;  4M3K A;  4PM6 A;  5FQI A;  5E2H A;  3C7U A;  2EXB A;  3GTC A;  3OZH A;  4EQI A;  2EFX A;  1MXO A;  5CED A;  4OP5 A;  4MBK A;  4OPR A;  4WEL A;  3CZD A;  3FZC A;  3MBZ A;  2Y2P A;  4RX2 A;  4DXC A;  4DE3 A;  4EWF A;  1JTD A;  4JF5 A;  3IF5 A;  1QMF A;  2EXA A;  2OLU A;  2XQZ A;  1ES3 A;  4BL2 A;  4R23 A;  1K6S A;  1Y54 A;  2I72 A;  4E3M A;  1FR6 A;  4JBF A;  4CPK A;  2P9V B;  3C4O A;  3UY6 A;  5L2F A;  3VFH A;  3BFF A;  1L2S A;  2EFU A;  4GZB A;  4R4S A;  2Y4A A;  4MLL A;  1ESI A;  2J7V A;  1H8Y A;  3HLC A;  2VGJ A;  3A3J A;  1YT4 A;  1YLP A;  5FQK A;  4LV3 A;  5GHX A;  2ZMA A;  1IYP A;  5M1A A;  1E25 A;  3VMA A;  5AQB A;  5KZH A;  4GKU A;  2ZC4 B;  3MZE A;  2QMI A;  5EVL A;  2HDU A;  5G18 A;  3HUM A;  1ZKJ A;  3WS0 A;  5AQA A;  3MKF A;  1KE4 A;  2EX8 A;  5HW3 A;  2ZQ9 A;  4QHC A;  4DE0 A;  3GR2 A;  1L0F A;  2WGW B;  2JC7 A;  4LV0 A;  3QNC A;  4OLG A;  3UE0 A;  5F1G A;  3VFF A;  4OPQ A;  4OQG A;  4LV2 A;  2A49 A;  4H8R A;  3ZHH A;  2WZZ A;  3ITB A;  3N4I A;  4MEZ A;  2IWB A;  3VSL A;  3SH7 A;  4UHU A;  4BJP A;  4ZTK A;  1GA0 A;  3HBR A;  3BFE A;  4LCM A;  5FQQ A;  4KQR A;  3N8L A;  3EQU A;  5CHM A;  1YQS A;  4KZ6 A;  4HBU A;  4ZBE A;  3BRM A;  4EBN A;  3OCN A;  3N6I A;  3BFG A;  3V39 A;  1YLT A;  3LY3 A;  4RX3 A;  4Y0T A;  4DE1 A;  3HRE A;  5KSC A;  3GQZ A;  5F82 A;  5GL9 A;  1YMX A;  1ERQ A;  1N4O A;  2BG1 A;  3MXR A;  3WS1 A;  5E43 A;  2ZC7 A;  1KE0 A; 
#chains in the Genus database with same CATH topology
 4WZ5 A;  3M2J A;  2ZLY A;  3G2Y A;  1BYW A;  1N9N A;  2ZBB A;  1EI5 A;  5CTM A;  2Y8H A;  4WBG A;  2J3T D;  3IQA A;  1S0W A;  4OQ0 A;  4M4X A;  1VB6 A;  2A24 A;  4KZA A;  3HVF A;  1LSX A;  3A3F A;  4IED A;  1OT9 A;  4C75 A;  3ISG A;  3M2K A;  2O9A A;  4Z1W A;  4P6B A;  1ZG4 A;  2M1C A;  2LB9 A;  1GSX A;  1D06 A;  2VZW A;  1KGF A;  4I3A A;  4NEE D;  4Y5F A;  3VE4 A;  3VSK A;  4OH0 A;  5FSR A;  1YLJ A;  4LGW A;  4UA9 A;  2X01 A;  3FG8 A;  3NI9 A;  4EET B;  1MPL A;  1K4E A;  1ERM A;  1ONG A;  3CPT A;  3A3D A;  5DVA A;  3DTE A;  4GCZ A;  3CLO A;  1SDE A;  2WUQ A;  1JTG A;  2XK1 A;  3E2L A;  4IVI A;  3WRT A;  2XD1 A;  3NOP C;  3BJN A;  4R3B A;  3QP8 A;  1M40 A;  1KDS A;  3R7W B;  3LY4 A;  3HLF A;  2V2F F;  1ZTU A;  2G2W A;  5E2E A;  5JYP A;  2HJ9 C;  1N9B A;  5L09 A;  2OAP 1;  3UDX A;  1S1Y A;  5EM1 A;  1EWZ A;  1O7E A;  1PWG A;  2G2U A;  1W8Q A;  3FV7 A;  2VK3 A;  3LEZ A;  5AVF A;  3OPP A;  3KO6 A;  4F3L B;  1BT5 A;  1K6R A;  2J3W A;  5IU1 A;  1H0M A;  4R6L A;  3KYQ A;  1FCO A;  2PU4 A;  2WAE A;  2HZ5 A;  2DCF A;  5CGX A;  2EX2 A;  4EBL A;  4EEP A;  3IBR A;  3LR0 A;  4DN0 A;  4ETX A;  5IHV A;  1P97 A;  3G32 A;  4R3J A;  4LPZ A;  1XJ2 A;  3PTE A;  5C5K A;  1T1A A;  5FAP A;  3MKE A;  3BFD A;  1OJ5 A;  3G31 A;  4JF4 A;  4K91 A;  2W1R A;  1XGJ A;  2Z2M B;  4S2N C;  4G3V A;  4QY5 A;  4NET A;  4LLO B;  1K57 C;  3PHY A;  4EES A;  4PKY G;  1JNU A;  1DRM A;  2FH5 A;  3D4F A;  3KX0 X;  4K0W A;  3ZG5 A;  1H3Q A;  1W79 A;  1K54 C;  1OTB A;  1XFQ A;  2R9W A;  3DAV A;  4XUX A;  4JF6 A;  4OPY A;  2JBF A;  4Y2F A;  1PZO A;  3UE1 A;  1K0K A;  1BTL A;  3Q7Z A;  4X53 A;  5HDC A;  1CQA A;  3MF0 A;  2HV1 A;  3C5A A;  4GOG A;  3BWL A;  3QP1 A;  4R0Q A;  2KLI A;  2P7J A;  4FD8 A;  1PNE A;  3IX8 A;  5GLC A;  1YLW A;  2J9P A;  4GNU A;  4ZJ2 A;  2EX9 A;  4FTX A;  3M6B A;  4U0T A;  1RGY A;  3F1P B;  4FUW A;  5HDD A;  1HLU P;  3HLE A;  4OOM A;  4P85 A;  4JPM A;  1BLP A;  3BLS A;  3FYZ A;  1XKZ A;  4GJ4 A;  1WYB A;  3LIA A;  5FQJ A;  3GSG A;  4X69 A;  2IWC A;  2JKT M;  3N7W A;  2XA7 S;  2PD7 A;  5EVI D;  3OCL A;  4OQI A;  2Q9M A;  4PAU A;  5J3W A;  3UO9 A;  2RCX A;  3IBJ A;  3K3C A;  5AQ9 A;  4BBV A;  5EV0 A;  3T1Q B;  1GCE A;  4ARZ A;  4ESP A;  3V50 A;  4BLM A;  1CF0 A;  2W3G A;  1VM1 A;  3NDG A;  2WKE A;  2VX8 A;  2OAQ 1;  2HGV A;  3NBL A;  2P04 A;  1LT0 A;  3LI9 A;  2V0U A;  3AGE A;  1Z6F A;  3MFX A;  3B3X A;  1PI5 A;  4WMC D;  2ZQA A;  4FH2 A;  3DBA A;  2NUP C;  5F68 A;  3K2N A;  3CHW P;  2J9O A;  5I94 A;  5FL3 A;  3UPO A;  4MN6 A;  4NXE A;  5DF9 A;  3MQO A;  3VP4 A;  3QP4 A;  3LCE A;  2WKP A;  3O87 A;  4LRX C;  4Q0H A;  2JKR I;  1IYS A;  4Y3I A;  2VGK A;  3LYX A;  2VV8 A;  2ZL1 B;  3IS2 B;  3V3R A;  1H5X A;  3LGO A;  2HPB A;  3NY4 A;  2OLV A;  3RJU A;  5FI7 A;  4X25 A;  1P9W A;  4EUZ A;  2O9B A;  5L10 A;  2ZM0 A;  1CJF A;  4FCF A;  3CUE C;  5E2H A;  4R70 A;  5DKK A;  4EQI A;  2EFX A;  4OPR A;  5HPF A;  2A24 B;  2Y2P A;  4RX2 A;  4DXC A;  3T4Q A;  3W2Z A;  1QMF A;  1Y54 A;  2I72 A;  5EFW A;  5F6A A;  4E3M A;  1FR6 A;  3C4O A;  3VFH A;  2PBD P;  4R4S A;  4MLL A;  2J7V A;  1YT4 A;  4PKY A;  2ZMA A;  1E25 A;  2VLG A;  4WF0 A;  3MZE A;  2QMI A;  2HDU A;  3WS0 A;  1ZKJ A;  2EX8 A;  2XA7 M;  1NLY A;  1L0F A;  4X1L A;  2W0N A;  3CPT B;  3KSG A;  3A0S A;  3MXQ A;  3S7N A;  3ZHH A;  4H8R A;  3N4I A;  2IWB A;  3VSL A;  3B33 A;  4ZTK A;  3BFE A;  3N8L A;  4CQH A;  2PT7 A;  1YQS A;  4HBU A;  1OPX A;  2B02 A;  3N6I A;  1VEU A;  2V8C A;  1YLT A;  4RX3 A;  2LB5 A;  4DE1 A;  5KSC A;  1YMX A;  1ERQ A;  1N4O A;  2ZC7 A;  1KE0 A;  4MN5 A;  2EWV A;  1BLH A;  3ZDJ A;  1T1B A;  1PWD A;  4KG5 A;  1IKG A;  3ZG0 A;  4NXF A;  3V3S A;  2QPN A;  4XT2 A;  2EA9 A;  1UWP X;  2C6W B;  3PBN A;  4S2N A;  4CLC C;  1CI8 A;  1JWZ A;  2XLN A;  3FKV A;  4YFM A;  2VKS A;  1K57 A;  4ZRR A;  4KQO A;  3UB9 A;  3MZD A;  4BWI A;  2PR5 A;  2RL3 A;  3LO7 A;  1K4F A;  3IXB A;  4OP8 A;  4DF6 A;  2KOI A;  1K54 A;  4N92 A;  2DRW A;  3CI6 A;  4HQA A;  1YLZ A;  3PAE A;  1MWR A;  3IXH A;  2WGW A;  2Y2G A;  3GRJ A;  3FKW A;  3T1R A;  5GLA A;  1NWZ A;  4U0X A;  1LHY A;  3VP1 A;  4OLD A;  4GS9 A;  5FDH A;  3G6O A;  5FEG A;  3VP2 A;  1IEL A;  3G30 A;  1PW1 A;  4FOF A;  4WLA A;  1NYY A;  2J3T C;  1GHI A;  2Q0O A;  3SS5 A;  1GA9 A;  4JXG A;  1BLS A;  4YOF A;  4KUK A;  4UQI M;  2QHK A;  4DE2 A;  3TE8 A;  4OON A;  3F1N A;  4XXR A;  1N9O A;  1CK3 A;  5IT5 A;  4O7D A;  2Y79 A;  2W3E A;  2OOL A;  5HSQ A;  2JN7 A;  3C8C A;  3BEC A;  1VQQ A;  2W3H A;  5E2G A;  3A0R A;  1MC0 A;  5CHU A;  3VP3 A;  2J80 A;  1ALQ A;  4OVD A;  3W4O A;  2BAS A;  1ES2 A;  5CEC A;  3Q81 A;  3PAG A;  4O01 A;  4PM5 A;  5F5Y A;  5K5B A;  3NUL A;  3F1O A;  1SCW A;  3RFB A;  4R1G A;  2WKH A;  3OPR A;  4IBX A;  2HJE A;  1PI4 A;  3ZVW A;  3IWO A;  1K56 D;  3QNB A;  1E3U D;  3IHB A;  5HFO A;  5JYO A;  4E3J A;  4BD1 A;  1XPB A;  4N9K A;  4IJG A;  3U4L P;  3HLD A;  4HH3 A;  4HNB A;  1OTD A;  4KZ5 A;  3A3E A;  3BLM A;  1VET A;  3SW1 A;  1NY0 A;  4NG2 A;  4Q8I A;  3UME A;  2R9X A;  4ARZ B;  4P6Z S;  4Z9Q A;  3S7Q A;  4I3J A;  2WAD A;  2Q9N A;  2UV0 E;  1OTE A;  1FOF A;  1TVF A;  5MC7 A;  1BLC A;  4LV1 A;  3BW6 A;  3ZFZ A;  3E4P A;  4R4R A;  4EV4 A;  4I39 A;  5DTT A;  3BY8 A;  4Y13 A;  1G68 A;  2XEP A;  3JYI A;  4MCW A;  3ZG7 B;  2R78 A;  3CUE A;  2ZC6 B;  3IXD A;  4XUZ A;  1DY6 A;  1ES5 A;  5EVE A;  2A3U A;  4EEU A;  4DKI A;  5HL1 A;  2JE5 A;  1KGE A;  4HH2 A;  1C3B A;  5HAP A;  2Y2I A;  3T1X A;  3H7W A;  2YKH A;  1H8M A;  2E8I A;  5I5L A;  1W7F A;  2Z6D A;  4C3Q A;  1FSW A;  1YPR A;  2ZM8 A;  3MS6 A;  4X68 A;  4KUO A;  5CEB A;  4WM9 A;  1OTI A;  3VV4 A;  4JXW A;  1IOU A;  3P01 A;  1SKO B;  4GN2 A;  3UNW A;  1S6R A;  4QWO A;  3VOY A;  4K0X A;  4R38 A;  2B5R A;  1LSV A;  3QP2 A;  3T4J A;  1XGI A;  2HP5 A;  4KZB A;  4X56 A;  2HF6 A;  4GDB A;  4QU3 A;  2Y2O A;  2JHE A;  3FPV A;  1LL9 A;  5KSH A;  4PM8 A;  1JVJ A;  3SH8 A;  2ZQC A;  1XFN A;  4LRY C;  3OLO A;  1D7E A;  1W5D A;  2ZOI A;  3RXX A;  5A93 A;  1BUE A;  1WYC A;  4GW9 A;  3NC8 A;  3MSH A;  3IWQ A;  1V9Y A;  3E98 A;  5EEC A;  3NDE A;  5KMW A;  5CRF A;  3TG9 A;  4C6Y A;  4HES A;  4QY6 A;  3WS5 A;  5EM0 A;  5AVE A;  3PXP A;  2Y2H A;  2Y2Q A;  2QWS A;  3BYD A;  5EVI C;  2JKG A;  2K31 A;  3C4P A;  1BZA A;  1ES4 A;  3NCK A;  3Q7V B;  4CLC A;  3SOI A;  4N9L A;  5TFQ A;  2PU2 A;  4DDS A;  3LFV A;  1TS7 A;  5GLB A;  1L0G A;  4ID4 A;  1SKF A;  1FR1 A;  3LR3 A;  3BQ8 A;  1G6A A;  4UAA A;  1YSP A;  4N1X A;  1OME A;  1OTA A;  4HI4 A;  2XRO A;  1A0K A;  4P6Z M;  4ME4 A;  1VEU B;  3TSG A;  1YM1 A;  4ZJ3 A;  5FQI A;  4M3K A;  1SZV A;  1NRJ A;  2VA0 A;  1MXO A;  1G5U A;  1OJG A;  2P08 A;  4WN5 A;  4MBK A;  5AJG A;  3FZC A;  1G28 A;  1UGU A;  5HD3 A;  4I3I A;  3EWK A;  3MQ0 A;  4JF5 A;  2OLU A;  2G7U A;  4BL2 A;  4R23 A;  3OBF A;  1L2S A;  3E0Y A;  1UWN X;  5HL6 A;  3B47 A;  3VMA A;  3SZT A;  5KZH A;  4GKU A;  5G18 A;  3K3D A;  2V1A A;  3A0V A;  5HW3 A;  4DE0 A;  2K7S A;  3GR2 A;  2WGW B;  3HCY A;  4LV0 A;  2VV7 A;  5F1G A;  3KSF A;  3VFF A;  3FPW A;  4OQG A;  1OT6 A;  4MEZ A;  4GS9 B;  4UHU A;  4BJP A;  5FQQ A;  4LCM A;  4MN7 A;  4JGQ A;  4KQR A;  3EQU A;  5CHM A;  3KSI A;  1V9Z A;  3BFG A;  1TS8 A;  4Y15 A;  4Y0T A;  1P9R A;  3HRE A;  5F82 A;  3WS1 A;  3MXR A;  2QYB A;  4RQ9 A;  5DF7 A;  5DJT A;  3TW8 A;  3T1S A;  3IT9 A;  2AVX A;  1T1C A;  1GSV A;  1T19 A;  1NLZ A;  2H0Y A;  1MZU A;  4BQM A;  4OKP A;  1IFQ A;  1PZP A;  3HLG A;  2ZC5 B;  1JWP A;  4I38 A;  2P9V A;  3A3I A;  4NXG A;  4E6W A;  4IUH A;  1KE3 A;  3H82 A;  3CJM A;  1LI9 A;  2ZD8 A;  3T4K A;  1K38 A;  1FCM A;  2VV6 A;  1ESU A;  3LEQ A;  4Y0U A;  2WAF A;  2XF3 A;  2JKT I;  3PYP A;  4RA7 A;  5FQM A;  4QB8 A;  1RP5 A;  1XJ6 A;  4KZ9 A;  4O8G A;  5HDS A;  5CER A;  1KVL A;  3FWL A;  3IF6 C;  1HZO A;  3TOI A;  3F1O B;  4DDY A;  2CMN A;  4PM7 A;  3DTM A;  3UN7 A;  1GSW A;  1HTZ A;  1S4R A;  3DTK A;  5FAS A;  1DJB A;  2XGN A;  3SH9 A;  2WZX A;  4OPZ A;  3BQA A;  2XDM A;  4UA6 A;  1I2W A;  3QHY A;  4EW7 A;  2HDR A;  4S2J A;  4IBR A;  3O86 A;  4Q0I A;  4P87 A;  1HD8 A;  1ZC2 A;  3UPN A;  2X02 A;  5TJJ A;  5F83 A;  1PIO A;  2IWD A;  1DP9 A;  2XFS A;  2WK0 A;  4GD8 A;  1VET B;  2ZOH A;  1I5Q A;  5FAQ A;  2Y2J A;  5CGW A;  4UA7 A;  1TF1 A;  1GHP A;  3N8R A;  5CXW A;  4JGO A;  1LL5 A;  5J4E A;  1YLY A;  4L9F A;  2L1M A;  3P09 A;  2DNS A;  3R4K A;  5HAR A;  3MFD A;  3MZF A;  3GVB A;  4NXB A;  4FSF A;  4E3K A;  3W8K A;  2WKR A;  4KG6 A;  1DJA A;  4B88 A;  4JGR A;  3VOZ A;  2OV5 A;  3IX4 A;  3LI8 A;  5DTK A;  3HUN A;  4LFU A;  5FEF A;  1F5M A;  5FI6 A;  3UMD A;  1SDN A;  3ZQ5 A;  3E4O A;  4WYY A;  5TGF A;  3ULF A;  3ZNT A;  4D2O A;  4KZ7 A;  3V67 A;  4JKT A;  4EER A;  3KYE A;  1JWV A;  4EXO A;  3PBQ A;  3ZNY A;  3NEC A;  3H7W B;  5AQ7 A;  5U47 A;  5GLD A;  5HWT A;  5KIZ A;  2IA2 A;  3IH9 A;  1F98 A;  2D01 A;  2ZQ8 A;  5EVI A;  4BMW A;  3QP5 A;  4Q0J A;  2O99 A;  3S22 A;  5CTN A;  1NYM A;  1TD5 A;  3IH8 A;  2WGI A;  3TJZ C;  3ZG9 B;  3MXS A;  5EE8 A;  1W63 M;  4YWZ A;  3G2Z A;  5CHJ A;  4WEJ A;  2XR0 A;  5F1F A;  1CEG A;  2DMW A;  5FAT A;  3D3O A;  2INW A;  4PMA A;  1PYY A;  2O0Y A;  4WEK A;  5J8X A;  4LEN A;  1SHV A;  3MMH A;  1M6K A;  3AGF A;  5BOH A;  3EEH A;  4B93 A;  1XXM A;  3IHA A;  3EEA A;  1K55 C;  3IWI A;  3T4O A;  3OOV A;  4WMC A;  1DJC A;  1Y4O A;  5IS1 A;  1CEF A;  2WKQ A;  1FCN A;  1IEM A;  1H8Z A;  3ZYT A;  1XA1 A;  1PWC A;  3LR4 A;  3UE3 A;  4QPR A;  3GMW A;  3W4Q A;  2M7U A;  3OPL A;  2FFF B;  4BL3 A;  5F69 A;  1XJ3 A;  3PBR A;  4CJN A;  3T12 B;  4CLC B;  1KGG A;  3T4T A;  3G35 A;  4KZ3 A;  3ITA A;  2ZQD A;  1NXY A;  5M18 A;  2Y2K A;  2UWX A;  4NK3 A;  1KVM A;  3E2K A;  1IYQ A;  1ONH A;  4JGP A;  1S67 L;  4HBT A;  4GD6 A;  3D72 A;  1VHM A;  2PR6 A;  5A90 A;  3SS4 A;  4P0M A;  2W1T A;  5D3O A;  2ZL1 A;  1MY8 A;  1TDL A;  4LRZ E;  1PFL A;  4ZAM A;  3LUQ A;  4RYE A;  5M19 A;  4ETZ A;  4JLF A;  2OWH A;  5CGS A;  4HJ3 A;  1STZ A;  3UDI A;  3QP6 A;  2FFY A;  1W8Y A;  4MMN A;  2GNX A;  1TS6 A;  3UPP A;  2Y2M A;  3C7V A;  4S2L A;  2GX5 A;  4YIN A;  3WRZ A;  4JXS A;  4DXB A;  5FAO A;  1Y28 A;  3S4X A;  4BBU A;  4X6T A;  4PM9 A;  3EOI A;  4WUJ A;  2Z6C A;  5GHY A;  2XRN A;  2ZMV A;  2I9V A;  4OQH A;  2J8Y A;  3L9K A;  4GDN A;  2V1Z A;  3CG5 A;  4H6J A;  2ZC3 B;  2ZJ9 A;  1YKD A;  2PYR A;  5HAQ A;  5HX9 A;  4EU0 A;  4GB7 A;  5EPH A;  3WS2 A;  3VOL A;  1O07 A;  3DWK A;  3TRC A;  3B42 A;  1NRF A;  5HWV A;  1TDG A;  1LL8 A;  2X71 A;  1FIL A;  5E2F A;  2GZA A;  3FC7 A;  5TR7 A;  4KG2 A;  2KDK A;  4E04 A;  1MWS A;  1G6O A;  1MWU A;  4S2K A;  3IF6 A;  1PRQ A;  4DJ2 A;  3C7U A;  3GTC A;  3OZH A;  4GLQ A;  5CED A;  4OP5 A;  5HD5 A;  4WEL A;  1JTD A;  2EXA A;  2XQZ A;  4R3A A;  1K6S A;  3IX3 A;  4JBF A;  4CPK A;  2P9V B;  3UY6 A;  3E4Q A;  4HJ4 A;  2EFU A;  4GZB A;  3H82 B;  2W3F A;  1H8Y A;  5TBM A;  1KOU A;  1WA9 A;  2V0W A;  2VGJ A;  3KSH A;  1YLP A;  5FQK A;  4LV3 A;  1IYP A;  3GDI A;  1Z09 A;  2ZC4 B;  2VGL S;  5EVL A;  5AQA A;  3MKF A;  2ZQ9 A;  4QHC A;  3LIF A;  2NUT C;  3UB5 P;  4OLG A;  3UE0 A;  2W3D A;  3HJI A;  4LV2 A;  2A49 A;  5G4Y A;  2WZZ A;  3ITB A;  4DJ3 A;  4DMZ A;  2H28 A;  3SH7 A;  3BRM A;  4EBN A;  3OCN A;  3BY9 A;  3LY3 A;  4KQD A;  5DFX A;  3GQZ A;  5CX7 A;  3C38 A;  1ODV A;  2QJ5 A;  3WS4 A;  3ZGA B;  2WKI A;  2JCH A;  4X55 A;  4RVA A;  4KEN B;  1F2K A;  1XP4 A;  4G3W A;  3PBO A;  3T4L A;  5FA7 A;  4DRT A;  4QD4 A;  1Q2Q A;  2WYX A;  3S7P A;  4E3I A;  3G34 A;  5HZH A;  2C5W B;  4Y7P A;  5LBR A;  1RGZ A;  3P7N A;  2ZM2 A;  3MR0 A;  3ICY A;  3V5M A;  1KDW A;  1BUL A;  2QZ6 A;  2L4R A;  3OPH A;  1X0O A;  3CWF A;  2Y2N A;  2OWJ A;  4A5R A;  1NZU A;  3O3V A;  1IYO A;  3IXG A;  1U60 A;  3N8S A;  1I2S A;  4MNR A;  3S7O A;  4S2O A;  4GHI A;  1FSY A;  4QJG A;  3EQV A;  4LCL A;  1XX2 A;  4BD0 A;  1RCJ A;  2Y2L A;  4CLC E;  1K55 A;  3G4P A;  1K56 A;  4XT2 B;  2PDR A;  2BLS A;  5L07 A;  2JKR M;  2PAV P;  3PBT A;  1E3U A;  3CAX A;  3D9Y A;  1FIK A;  2HP9 A;  1T18 A;  1XJ4 A;  1J9M A;  1Q2P A;  4OOY A;  5EVI B;  5GHZ A;  1MWT A;  3AGD A;  3ZVT A;  2Y91 A;  1DP8 A;  4II7 A;  3CMZ A;  2PBY A;  2JKF A;  2VEA A;  2B95 A;  3Q07 A;  1LSW A;  1D1J A;  4JXV A;  3DWZ A;  3NIA A;  3LID A;  3WWX A;  1PW8 A;  2L0W A;  4IVK A;  2VGL M;  4N1H A;  2V8F A;  3HLW A;  3C2W A;  1L0E A;  3M6H A;  2H10 A;  3LIC A;  2CC1 A;  3GEC A;  4HEF A;  3W4P A;  4X1M A;  4K08 A;  4L0L A;  1MBL A;  5L8M A;  4WZ5 C;  4U3T A;  3F1N B;  4L9G A;  3JVU A;  3MJQ A;  3MQQ A;  3GV9 A;  1CI9 A;  3C30 A;  2XH9 A;  3P98 A;  1YSQ A;  2XFT A;  3RTY A;  5DFY A;  4PHT A;  3VE3 A;  2XD5 A;  4HIA A;  4S2I A;  3R7W A;  3RXW A;  2P74 A;  2H0T A;  2Y59 A;  2ZMF A;  5EOE A;  2HP6 A;  4OOL A;  1BSG A;  2OSU A;  1IKI A;  1GHM A;  4E6X A;  3HL9 A;  1P0Z A;  1K25 A;  2W1T B;  2V20 A;  1AXB A;  5J7E A;  1E4D A;  2VJW A;  4S2P A;  3OC2 A;  5DKL A;  3UDF A;  2A2L A;  1MKI A;  2B18 A;  4KZ4 A;  3EGD C;  4E3L A;  4F3L A;  1SKO A;  5FQ9 A;  4KQQ A;  4I5S A;  2ACG A;  3O5Y A;  3Q82 A;  3NOU C;  1L0D A;  5A8B A;  3T50 A;  4E3O A;  3EGX C;  3BEB A;  3NOT C;  4Y0O A;  2GJ3 A;  2QKP A;  3JVV A;  5HAI A;  3KYZ A;  5DTS A;  4MBH A;  2PHY A;  4UQI S;  2MJ6 A;  4MBF A;  3HUO A;  4ZDX A;  1S4S A;  3HLB A;  4H6J B;  2ZQ7 A;  2V9A A;  1TEM A;  4AFI A;  4KZ8 A;  2FZ0 A;  2BTF P;  5G4Z A;  4HP9 A;  3LR5 A;  4HHD A;  3ZG8 B;  3H9W A;  4IUK A;  3BM6 A;  5EOO A;  4EBP A;  4F94 A;  2HDQ A;  2PYP A;  4HY8 A;  2H5S A;  3Q7V A;  3JPU A;  3LIB A;  3DW0 A;  1LI0 A;  3L7H A;  4MDZ A;  3BFC A;  3IF6 B;  5EUA A;  4EUV A;  1L3L A;  2EWW A;  1WE4 A;  5FI2 A;  5A91 A;  1XA7 A;  1ZHH B;  3Q1F A;  1HVB A;  2Y55 A;  1NZO A;  5HWW A;  4UEY A;  1ACF A;  3SS3 A;  1YMS A;  2K2N A;  1NJ4 A;  3NJA A;  4E3N A;  4O0P A;  2V1B A;  2Z2L B;  4FH4 A;  4YNR A;  1LLB A;  5DF8 A;  2WGV A;  4WZ4 A;  3UB7 A;  3I7J A;  4B9O A;  3O88 A;  1FQG A;  3VP0 A;  1AWI A;  2XSS A;  2W27 A;  4IHQ A;  5TBM B;  3F1P A;  4B4X A;  4S2M A;  2D02 A;  3ZCZ A;  3S1Y A;  3LIE A;  4BEN A;  1DP6 A;  1W63 Q;  1ZG6 A;  3DTI A;  4PPR A;  3T4S A;  1MKM A;  2O9C A;  3PBS A;  2EX6 A;  2KX6 A;  1QME A;  4D60 A;  2HDS A;  1S1Z A;  2GDN A;  5A92 A;  4ZJ1 A;  1YAX A;  1F9I A;  4B4Z A;  1ERO A;  4PM6 A;  4BBT A;  2EXB A;  4Y17 A;  4HJ6 A;  3RH8 B;  1J3W A;  3CZD A;  3MBZ A;  3HJK A;  2YKF A;  4DE3 A;  4EWF A;  3CIT A;  3IF5 A;  5DJU A;  1ES3 A;  4G3K A;  5L2F A;  3BFF A;  1S66 L;  2QJ7 A;  3UB8 A;  2Y4A A;  1ESI A;  1TS0 A;  3HLC A;  3A3J A;  5M1A A;  5GHX A;  5AQB A;  4CLC D;  3PR6 A;  3HUM A;  4WL9 A;  1KE4 A;  4L9E A;  2M7V A;  4HOI A;  3IS2 A;  2PRF A;  1N9L A;  5FDS A;  3UB6 A;  3UE6 A;  4HP4 A;  2JC7 A;  3QNC A;  2PD8 A;  4OPQ A;  1EW0 A;  4GHI B;  4NKP A;  3NHQ A;  1GA0 A;  3HBR A;  3U2A A;  4KZ6 A;  4ZBE A;  5HPI A;  4EQ1 A;  3V39 A;  5GL9 A;  2BG1 A;  2E8J A;  5E43 A; 
#chains in the Genus database with same CATH homology
 4WZ5 A;  3M2J A;  5DF7 A;  2ZLY A;  1BLH A;  3WS4 A;  3G2Y A;  3ZGA B;  2WKI A;  3ZDJ A;  1EI5 A;  5CTM A;  1PWD A;  3IT9 A;  4KG5 A;  2JCH A;  4WBG A;  1IKG A;  3IQA A;  1S0W A;  4X55 A;  4RVA A;  2H0Y A;  3ZG0 A;  4OQ0 A;  4KEN B;  1XP4 A;  3V3S A;  2QPN A;  3PBO A;  4KZA A;  3HVF A;  3A3F A;  4IED A;  5FA7 A;  4BQM A;  4DRT A;  4OKP A;  4QD4 A;  1Q2Q A;  2C6W B;  3PBN A;  4S2N A;  4C75 A;  2WYX A;  3ISG A;  3M2K A;  1CI8 A;  1JWZ A;  1PZP A;  2XLN A;  3FKV A;  3G34 A;  3HLG A;  2ZC5 B;  4YFM A;  4E3I A;  1JWP A;  2P9V A;  3A3I A;  4E6W A;  4P6B A;  1K57 A;  2C5W B;  4Y7P A;  1ZG4 A;  4KQO A;  1KE3 A;  1RGZ A;  2ZM2 A;  3MZD A;  2RL3 A;  1KGF A;  3CJM A;  3LO7 A;  1LI9 A;  2ZD8 A;  1K4F A;  3IXB A;  3V5M A;  1KDW A;  3VSK A;  1BUL A;  1FCM A;  1K38 A;  4OH0 A;  4OP8 A;  5FSR A;  1YLJ A;  4DF6 A;  2QZ6 A;  3OPH A;  1ESU A;  1K54 A;  4N92 A;  2DRW A;  4UA9 A;  2WAF A;  2XF3 A;  2Y2N A;  4Y0U A;  2X01 A;  4RA7 A;  5FQM A;  4QB8 A;  1YLZ A;  3NI9 A;  1RP5 A;  3PAE A;  4A5R A;  4KZ9 A;  1NZU A;  3O3V A;  1MWR A;  1MPL A;  1IYO A;  3IXH A;  2WGW A;  2Y2G A;  1KVL A;  3FWL A;  3GRJ A;  5CER A;  3FKW A;  3IXG A;  1U60 A;  1K4E A;  5GLA A;  3IF6 C;  1ERM A;  1ONG A;  3N8S A;  3A3D A;  4U0X A;  1HZO A;  1I2S A;  1LHY A;  5DVA A;  4MNR A;  3TOI A;  4DDY A;  4S2O A;  1FSY A;  4PM7 A;  3DTM A;  4OLD A;  3VP1 A;  3EQV A;  4LCL A;  1XX2 A;  3UN7 A;  4QJG A;  1HTZ A;  5FDH A;  4BD0 A;  3VP2 A;  1IEL A;  3G30 A;  1PW1 A;  1RCJ A;  1SDE A;  2WUQ A;  2Y2L A;  1NYY A;  1K55 A;  3G4P A;  1DJB A;  1JTG A;  5FAS A;  2XK1 A;  3E2L A;  1K56 A;  4IVI A;  1GHI A;  2XGN A;  3SH9 A;  2XD1 A;  2WZX A;  4OPZ A;  3WRT A;  2BLS A;  2XDM A;  4UA6 A;  3PBT A;  1E3U A;  1I2W A;  3QHY A;  4R3B A;  2HDR A;  4S2J A;  3SS5 A;  1M40 A;  2HP9 A;  4IBR A;  3O86 A;  1GA9 A;  1KDS A;  4JXG A;  1BLS A;  4P87 A;  1HD8 A;  1J9M A;  1ZC2 A;  3LY4 A;  3UPN A;  3HLF A;  2V2F F;  2X02 A;  5F83 A;  1PIO A;  4DE2 A;  1Q2P A;  4OOY A;  4OON A;  5EVI B;  2IWD A;  5GHZ A;  2G2W A;  2XFS A;  2WK0 A;  1MWT A;  3AGD A;  4GD8 A;  3ZVT A;  2Y91 A;  4XXR A;  1I5Q A;  3CMZ A;  5FAQ A;  2Y2J A;  5CGW A;  1CK3 A;  5E2E A;  4UA7 A;  1GHP A;  3N8R A;  5CXW A;  1LL5 A;  5JYP A;  2PBY A;  1N9B A;  1YLY A;  3Q07 A;  3UDX A;  4O7D A;  3P09 A;  1EWZ A;  2DNS A;  1O7E A;  1PWG A;  2G2U A;  5HAR A;  3MFD A;  1W8Q A;  3FV7 A;  4JXV A;  3DWZ A;  3MZF A;  3NIA A;  3GVB A;  4FSF A;  4E3K A;  3BEC A;  1VQQ A;  3LEZ A;  3WWX A;  3W8K A;  1PW8 A;  5E2G A;  3OPP A;  5CHU A;  4IVK A;  1BT5 A;  1DJA A;  1K6R A;  4KG6 A;  3VP3 A;  4B88 A;  3VOZ A;  4N1H A;  1ALQ A;  2OV5 A;  5DTK A;  3HUN A;  4OVD A;  3HLW A;  3W4O A;  1FCO A;  2PU4 A;  2WAE A;  5FI6 A;  1ES2 A;  1SDN A;  2DCF A;  5CEC A;  3Q81 A;  5CGX A;  1L0E A;  3M6H A;  2H10 A;  2EX2 A;  3PAG A;  4EBL A;  4PM5 A;  2CC1 A;  5TGF A;  4WYY A;  3ZNT A;  4HEF A;  4D2O A;  4KZ7 A;  3W4P A;  4JKT A;  5IHV A;  1SCW A;  4L0L A;  1MBL A;  3G32 A;  4WZ5 C;  4R3J A;  3PTE A;  4R1G A;  1JWV A;  4U3T A;  3PBQ A;  3ZNY A;  5FAP A;  2WKH A;  3OPR A;  4IBX A;  1PI4 A;  3MKE A;  3BFD A;  3GV9 A;  3IWO A;  3ZVW A;  1K56 D;  1CI9 A;  3G31 A;  4JF4 A;  5AQ7 A;  2XH9 A;  5U47 A;  3QNB A;  3P98 A;  2XFT A;  4K91 A;  5GLD A;  1E3U D;  3IHB A;  5HFO A;  5JYO A;  1XGJ A;  2Z2M B;  4E3J A;  3IH9 A;  4BD1 A;  1XPB A;  4N9K A;  2XD5 A;  4S2N C;  3HLD A;  4S2I A;  4QY5 A;  3RXW A;  2P74 A;  2H0T A;  4NET A;  2Y59 A;  1K57 C;  2ZQ8 A;  5EVI A;  4KZ5 A;  5EOE A;  2HP6 A;  3A3E A;  3BLM A;  4OOL A;  3D4F A;  1BSG A;  4K0W A;  2OSU A;  3S22 A;  1IKI A;  5CTN A;  1NYM A;  3ZG5 A;  1NY0 A;  1W79 A;  1GHM A;  3IH8 A;  4Q8I A;  1K54 C;  2WGI A;  4E6X A;  2R9X A;  2R9W A;  3HL9 A;  3ZG9 B;  1K25 A;  4XUX A;  2V20 A;  1AXB A;  3MXS A;  4JF6 A;  4Z9Q A;  5EE8 A;  1E4D A;  4OPY A;  2WAD A;  2Q9N A;  2JBF A;  3G2Z A;  1PZO A;  3UE1 A;  4WEJ A;  2XR0 A;  4S2P A;  3OC2 A;  5CHJ A;  1FOF A;  1BTL A;  3UDF A;  1CEG A;  5F1F A;  1MKI A;  1TVF A;  5FAT A;  3Q7Z A;  1BLC A;  4X53 A;  4LV1 A;  4KZ4 A;  3ZFZ A;  4PMA A;  4R4R A;  1PYY A;  4E3L A;  4EV4 A;  5DTT A;  3C5A A;  5FQ9 A;  4GOG A;  4WEK A;  4KQQ A;  5J8X A;  4LEN A;  1SHV A;  1M6K A;  4R0Q A;  3AGF A;  5BOH A;  1G68 A;  3Q82 A;  1XXM A;  2XEP A;  3IHA A;  1L0D A;  3JYI A;  3ZG7 B;  1K55 C;  3IWI A;  4WMC A;  1DJC A;  2ZC6 B;  3IXD A;  4FD8 A;  1DY6 A;  4XUZ A;  1ES5 A;  4E3O A;  3BEB A;  2A3U A;  1CEF A;  5GLC A;  1YLW A;  2J9P A;  1FCN A;  4GNU A;  4Y0O A;  1IEM A;  5HAI A;  4ZJ2 A;  2EX9 A;  1H8Z A;  3M6B A;  4DKI A;  5DTS A;  4MBH A;  5HL1 A;  2JE5 A;  4U0T A;  1RGY A;  1XA1 A;  1PWC A;  3UE3 A;  1KGE A;  3W4Q A;  3GMW A;  1C3B A;  3HLE A;  4OOM A;  5HAP A;  2Y2I A;  3OPL A;  2FFF B;  4BL3 A;  4P85 A;  4MBF A;  4JPM A;  1BLP A;  3HUO A;  3BLS A;  4ZDX A;  3FYZ A;  3HLB A;  3PBR A;  4CJN A;  1XKZ A;  2E8I A;  1W7F A;  2ZQ7 A;  4C3Q A;  1KGG A;  1WYB A;  5FQJ A;  3G35 A;  4KZ3 A;  3GSG A;  3ITA A;  1TEM A;  1FSW A;  2ZM8 A;  2IWC A;  2ZQD A;  3N7W A;  4X68 A;  4X69 A;  1NXY A;  5CEB A;  5EVI D;  5M18 A;  3OCL A;  4WM9 A;  4KZ8 A;  2Y2K A;  4JXW A;  4OQI A;  2Q9M A;  2UWX A;  3ZG8 B;  4NK3 A;  1KVM A;  3BM6 A;  3E2K A;  5EOO A;  1IYQ A;  3UO9 A;  2RCX A;  4GN2 A;  3UNW A;  4EBP A;  4F94 A;  1ONH A;  2HDQ A;  1S6R A;  4HBT A;  3VOY A;  2H5S A;  3Q7V A;  5AQ9 A;  4GD6 A;  5A90 A;  3DW0 A;  4K0X A;  3SS4 A;  1GCE A;  2B5R A;  4P0M A;  3V50 A;  5D3O A;  1LI0 A;  4BLM A;  1MY8 A;  3BFC A;  1TDL A;  1XGI A;  1VM1 A;  3IF6 B;  2HP5 A;  3NDG A;  5EUA A;  2WKE A;  4KZB A;  4ZAM A;  4X56 A;  4GDB A;  4QU3 A;  2Y2O A;  3NBL A;  4RYE A;  1LL9 A;  5KSH A;  1WE4 A;  4PM8 A;  1JVJ A;  5FI2 A;  3SH8 A;  5A91 A;  1XA7 A;  3Q1F A;  5M19 A;  3AGE A;  1HVB A;  2Y55 A;  4JLF A;  2ZQC A;  5CGS A;  1W5D A;  3RXX A;  1NZO A;  3UDI A;  5A93 A;  1BUE A;  1WYC A;  3SS3 A;  1Z6F A;  3B3X A;  1YMS A;  3NC8 A;  2FFY A;  3IWQ A;  1NJ4 A;  1W8Y A;  4E3N A;  1PI5 A;  4WMC D;  5EEC A;  3NDE A;  2ZQA A;  5KMW A;  2Z2L B;  4FH2 A;  4FH4 A;  1LLB A;  3UPP A;  5CRF A;  2WGV A;  2Y2M A;  5DF8 A;  3C7V A;  4S2L A;  4WZ4 A;  3I7J A;  3TG9 A;  4HES A;  4QY6 A;  4C6Y A;  2J9O A;  3WS5 A;  5I94 A;  3O88 A;  4YIN A;  1FQG A;  3WRZ A;  4JXS A;  3UPO A;  3VP0 A;  4DXB A;  5FAO A;  3S4X A;  2Y2H A;  2Y2Q A;  5DF9 A;  3VP4 A;  3BYD A;  4X6T A;  4PM9 A;  3LCE A;  5EVI C;  4B4X A;  3O87 A;  3C4P A;  5GHY A;  1BZA A;  4S2M A;  1IYS A;  2VGK A;  4OQH A;  1ES4 A;  2J8Y A;  3NCK A;  4GDN A;  3Q7V B;  2V1Z A;  3CG5 A;  3ZCZ A;  3S1Y A;  2ZC3 B;  2ZJ9 A;  4BEN A;  3SOI A;  5HAQ A;  5HX9 A;  4GB7 A;  4N9L A;  5EPH A;  1ZG6 A;  3WS2 A;  5TFQ A;  2PU2 A;  1O07 A;  4DDS A;  3DWK A;  3V3R A;  1H5X A;  5GLB A;  1L0G A;  4ID4 A;  1SKF A;  1NRF A;  1FR1 A;  1TDG A;  2X71 A;  5E2F A;  4PPR A;  2HPB A;  3NY4 A;  2OLV A;  3RJU A;  1G6A A;  4UAA A;  5FI7 A;  3PBS A;  4N1X A;  1OME A;  5TR7 A;  2EX6 A;  4KG2 A;  1QME A;  2HDS A;  2GDN A;  5A92 A;  4EUZ A;  1MWS A;  4ZJ1 A;  1MWU A;  3TSG A;  1YM1 A;  2ZM0 A;  4ZJ3 A;  4B4Z A;  1ERO A;  4S2K A;  3IF6 A;  4FCF A;  4M3K A;  4PM6 A;  5FQI A;  5E2H A;  3C7U A;  2EXB A;  3GTC A;  3OZH A;  4EQI A;  2EFX A;  1MXO A;  5CED A;  4OP5 A;  4MBK A;  4OPR A;  4WEL A;  3CZD A;  3FZC A;  3MBZ A;  2Y2P A;  4RX2 A;  4DXC A;  4DE3 A;  4EWF A;  1JTD A;  4JF5 A;  3IF5 A;  1QMF A;  2EXA A;  2OLU A;  2XQZ A;  1ES3 A;  4BL2 A;  4R23 A;  1K6S A;  1Y54 A;  2I72 A;  4E3M A;  1FR6 A;  4JBF A;  4CPK A;  2P9V B;  3C4O A;  3UY6 A;  5L2F A;  3VFH A;  3BFF A;  1L2S A;  2EFU A;  4GZB A;  4R4S A;  2Y4A A;  4MLL A;  1ESI A;  2J7V A;  1H8Y A;  3HLC A;  2VGJ A;  3A3J A;  1YT4 A;  1YLP A;  5FQK A;  4LV3 A;  5GHX A;  2ZMA A;  1IYP A;  5M1A A;  1E25 A;  3VMA A;  5AQB A;  5KZH A;  4GKU A;  2ZC4 B;  3MZE A;  2QMI A;  5EVL A;  2HDU A;  5G18 A;  3HUM A;  1ZKJ A;  3WS0 A;  5AQA A;  3MKF A;  1KE4 A;  2EX8 A;  5HW3 A;  2ZQ9 A;  4QHC A;  4DE0 A;  3GR2 A;  1L0F A;  2WGW B;  2JC7 A;  4LV0 A;  3QNC A;  4OLG A;  3UE0 A;  5F1G A;  3VFF A;  4OPQ A;  4OQG A;  4LV2 A;  2A49 A;  4H8R A;  3ZHH A;  2WZZ A;  3ITB A;  3N4I A;  4MEZ A;  2IWB A;  3VSL A;  3SH7 A;  4UHU A;  4BJP A;  4ZTK A;  1GA0 A;  3HBR A;  3BFE A;  4LCM A;  5FQQ A;  4KQR A;  3N8L A;  3EQU A;  5CHM A;  1YQS A;  4KZ6 A;  4HBU A;  4ZBE A;  3BRM A;  4EBN A;  3OCN A;  3N6I A;  3BFG A;  3V39 A;  1YLT A;  3LY3 A;  4RX3 A;  4Y0T A;  4DE1 A;  3HRE A;  5KSC A;  3GQZ A;  5F82 A;  5GL9 A;  1YMX A;  1ERQ A;  1N4O A;  2BG1 A;  3MXR A;  3WS1 A;  5E43 A;  2ZC7 A;  1KE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...