4N9LA

Crystal structure of beta-lactamse penp_e166s in complex with meropenem
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFSPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/antibiotic
molecule keywords Beta-lactamase
publication title Perturbing the General Base Residue Glu166 in the Active Site of Class A beta-Lactamase Leads to Enhanced Carbapenem Binding and Acylation
pubmed doi rcsb
source organism Bacillus licheniformis
total genus 93
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4n9lA00
1AXBA 2OSUA 5F83A 2ZD8A 4LV0A 3GQZA 4OOYA 4JXVA 4PMAA 3PBQA 5DTKA 4ZJ3A 1G6AA 3O86A 1M6KA 4N9LA 2PBYA 4GD6A 1KGFA 3Q07A 4YINA 4N92A 1RCJA 5EPHA 4KZ6A 4UA7A 5HW3A 4QY6A 1N4OA 3G30A 5GLAA 1GHIA 3VOZA 4P87A 3M6BA 3Q81A 4R4SA 1NYYA 4S2PA 3UDXA 5AQ7A 5EECA 3V50A 4BD0A 2Y59A 1BTLA 4IEDA 5TFQA 5KSCA 5FAQA 2WZZA 4QU3A 2DRWA 5D3OA 5BOHA 1L2SA 3A3DA 5CEBA 5GLDA 5U47A 3E2LA 4BLMA 1PI5A 1KVLA 2G2UA 3EQUA 4K0XA 4DDSA 3UPPA 2C6WB 4BL2A 3OPHA 4EBNA 4ZAMA 3SS3A 3WRZA 1WE4A 4C6YA 3TOIA 3QHYA 4PM9A 2EFUA 5EVID 3PTEA 1FQGA 4WZ5C 5FAOA 3RJUA 3ZVWA 1IKIA 2Q9MA 1SHVA 3OCLA 4S2NC 4Y0OA 2H5SA 2Y2PA 4EV4A 2QPNA 3GVBA 2J7VA 5FQQA 2P74A 1CI9A 5AQ9A 4JXWA 5HARA 3ZDJA 5DF7A 4DE1A 4EWFA 1YLTA 1FR1A 1ESIA 3O88A 4DKIA 1FSYA 1WYBA 4X55A 4GKUA 1VM1A 2DCFA 4PM6A 1SCWA 5J8XA 2Y2LA 2C5WB 4QJGA 3HLGA 3NC8A 4WBGA 2QMIA 3GTCA 5JYOA 3G2YA 4OLGA 3GV9A 2ZLYA 2H10A 1FOFA 2ZMAA 2ZQ8A 3C4PA 4JLFA 3CG5A 4BENA 1PIOA 1N9BA 2P9VB 1ZKJA 1YLPA 5TR7A 1IYOA 5EOOA 5A93A 1MXOA 1ALQA 1SKFA 3UO9A 1LI0A 3ZHHA 2Z2LB 2H0YA 4OOLA 3A3EA 3MZEA 3OCNA 4LV3A 1XPBA 2XFTA 4ZJ2A 1BLCA 4MBFA 4MEZA 4KQRA 5F1GA 3MXSA 5E2EA 1IELA 3IWQA 4FCFA 5CTNA 1K4FA 3VP0A 2FFYA 2WZXA 3WWXA 1DJAA 3W4PA 1E25A 2XK1A 1K6RA 2XQZA 4Y7PA 4KZ8A 5KSHA 1YLJA 2A49A 3CZDA 5FQMA 4DE0A 4X53A 2Y2HA 2E8IA 4E3JA 3PBTA 4DE3A 2EXAA 1XA7A 4KZ9A 4LV1A 2P9VA 4R0QA 3VP3A 4DXCA 1KE0A 1NXYA 4PM7A 1EI5A 1PZOA 1BLSA 3LEZA 2GDNA 5CTMA 1HVBA 4OOMA 3A3JA 3UNWA 4CPKA 4DRTA 5CRFA 3HUMA 1L0EA 1MWUA 2HP9A 2XDMA 3O87A 4Y0UA 3NCKA 3RXWA 2ZM0A 4R4RA 3ZGAB 3FZCA 4K91A 1IYPA 4OQIA 1NY0A 2B5RA 4WZ4A 3UDIA 5CGWA 2OV5A 3ZNYA 2XD1A 3DWZA 1QMEA 3TSGA 2Y2MA 4KQQA 3UE1A 2PU4A 5M18A 5KZHA 3W8KA 4R1GA 1IEMA 3Q7VB 1XX2A 3HBRA 2V20A 3FV7A 2HDSA 5IHVA 4UHUA 3TG9A 1PW1A 1XP4A 1K56D 4NK3A 4S2IA 5DF8A 4B4ZA 1YLZA 4OH0A 2WKHA 1ZG6A 4WZ5A 4C3QA 2XGNA 3UDFA 4RA7A 5GLBA 5CGXA 3N8RA 4S2NA 3V3SA 3BM6A 4MNRA 3VP1A 1L0DA 3BFGA 5HAIA 4B4XA 3SS5A 1ONHA 3ZNTA 1PW8A 3QNBA 1K56A 1I2SA 3M6HA 4LV2A 1GCEA 4Q8IA 5EOEA 2BG1A 5CHUA 3BLMA 3ZVTA 1ERMA 2EX9A 3IWIA 2ZC3B 3HL9A 3ITBA 5FI6A 4E3OA 1NYMA 3Q7VA 1WYCA 3IXBA 2ZC5B 4OP8A 5EE8A 3N6IA 3DTMA 1ES2A 3S4XA 1PWGA 1KGGA 1PZPA 4H8RA 3MZDA 3S1YA 4GD8A 5M19A 3VOYA 5EUAA 4GDBA 4ZTKA 1LL5A 3WS0A 1XA1A 3N4IA 4YFMA 3RXXA 2HP5A 3C7VA 1MKIA 3UY6A 4MLLA 3HLEA 4KZ3A 4HESA 5E2HA 1JWVA 3ITAA 5CHJA 4X6TA 3A3IA 2PU2A 2VGJA 3OC2A 4KQOA 4DXBA 4UA9A 3GRJA 5FI2A 5GHXA 1JWZA 3UPOA 1MPLA 4OPZA 3ZG5A 2Y2NA 1Q2QA 4FH2A 4ZJ1A 1OMEA 3LY4A 5DTSA 3ZFZA 3PBRA 3BFEA 5CEDA 3WS1A 4KZ5A 5F82A 4DE2A 3PBOA 4ZBEA 1S6RA 3G2ZA 1YMXA 4GDNA 4R3JA 4HEFA 4EBLA 3QNCA 3IQAA 3SH8A 1QMFA 4JKTA 3V39A 3DWKA 1GA0A 4RYEA 4XXRA 1MBLA 3LCEA 4MBHA 4U3TA 4HBUA 4KZAA 5FSRA 4OPQA 4WMCD 5FI7A 1RGYA 4BL3A 1PWDA 1JVJA 3JYIA 3IHBA 4PM8A 1O07A 1K54C 2HDRA 1Y54A 2ZJ9A 1EROA 1LI9A 4QB8A 5E43A 1K38A 3N8LA 1MWRA 1TDGA 1DJBA 4WMCA 1KGEA 3B3XA 5FDHA 1I5QA 4X69A 2V1ZA 4IVKA 3HLDA 3WS5A 1L0FA 1YLYA 1VQQA 4MBKA 4RX3A 5CXWA 3CMZA 1U60A 3PAGA 2UWXA 2EXBA 4FSFA 2ZQ9A 2DNSA 3AGFA 4CJNA 5FQKA 1PWCA 2G2WA 3ZCZA 3C5AA 1KE4A 1K25A 4LCMA 3NY4A 5A90A 3HVFA 4JF6A 3W4QA 1YMSA 4KZ4A 1K57A 3HLWA 5FATA 1YQSA 3NIAA 4OQHA 3O3VA 1FR6A 2JE5A 2ZQCA 4N1HA 3SH7A 1W8QA 3DW0A 4DDYA 3FKVA 1MWSA 2I72A 1YT4A 4LENA 4NETA 1ESUA 5I94A 3V3RA 4JBFA 3VSLA 2J9OA 3Q82A 5A92A 5GHYA 4L0LA 1JTGA 4JF5A 2IWCA 5G18A 2CC1A 3N8SA 3WRTA 5FASA 2ZQAA 1TDLA 4S2OA 3CJMA 4GN2A 3MZFA 2ZM8A 1NZUA 3M2KA 2ZC6B 4ZDXA 2XLNA 3IH9A 1FCNA 1G68A 3ISGA 1ONGA 3EQVA 5HX9A 2HDQA 4WEKA 3M2JA 4DF6A 1NZOA 1LLBA 1DJCA 1DY6A 2XH9A 3G34A 2ZC7A 4OPRA 4OONA 1CEGA 5JYPA 1ZG4A 3BFFA 1KE3A 3IT9A 4F94A 4U0XA 2X02A 2OLUA 2XD5A 1BSGA 3VMAA 2FFFB 4GNUA 4OPYA 2XR0A 4P0MA 4QHCA 5FAPA 1BUEA 2Y2GA 4BJPA 2WAFA 3W4OA 1CI8A 3MKFA 4WYYA 3I7JA 3IF6B 3PBNA 2IWDA 2BLSA 3VFFA 2OLVA 5M1AA 4JXSA 5FA7A 1E3UD 1K57C 2Y2JA 3IF5A 4XUZA 1BLPA 4B88A 3G31A 5HL1A 1JTDA 2HP6A 1CEFA 3HLCA 1KVMA 1K54A 3PAEA 1LL9A 1IYQA 5E2GA 2VGKA 2RL3A 3IXGA 3HLFA 1PI4A 1E3UA 1XGIA 3UE0A 4Y0TA 1RP5A 1FCMA 1BLHA 1Z6FA 2ZM2A 1H8YA 3C4OA 4IBRA 1LHYA 3C7UA 4S2JA 5CHMA 1GHPA 1E4DA 2WADA 3IF6A 2WKEA 3MFDA 4E6WA 2WGWB 4IBXA 2H0TA 4S2KA 3IWOA 4GZBA 2JCHA 3HUOA 4O7DA 4E6XA 1XXMA 4JPMA 4WM9A 1K55A 3UE3A 1NJ4A 1O7EA 2WUQA 3LO7A 2EFXA 4BQMA 5EVIB 2HDUA 3OPRA 1JWPA 4OLDA 4LCLA 3BEBA 3MBZA 1NRFA 3FKWA 4GB7A 3WS4A 4KZBA 3Q7ZA 3IHAA 1GHMA 1I2WA 1IKGA 4EBPA 4KG5A 3BRMA 3BFCA 4BD1A 5AQBA 3G35A 1J9MA 2WGWA 1YLWA 2IWBA 5F1FA 3P09A 1W5DA 4R23A 3NBLA 1S0WA 5L2FA 3MXRA 5CGSA 4S2LA 3NI9A 3IXHA 5HFOA 3NDGA 2XF3A 4QD4A 1W7FA 5FQ9A 4RVAA 2WKIA 2R9WA 2X01A 4PM5A 4EUZA 4A5RA 1ERQA 3HREA 5EVIA 4OP5A 5FQIA 4KZ7A 3G32A 2WYXA 1KDSA 1TEMA 3G4PA 1BULA 3IF6C 4HBTA 3VP4A 1IYSA 2WGVA 3BLSA 2WAEA 5TGFA 2WGIA 2WK0A 2Y2OA 3E2KA 3ZG7B 4PPRA 3OZHA 3FWLA 3IXDA 5HAQA 4KENB 4U0TA 4R3BA 5CERA 3LY3A 4IVIA 1W79A 2Q9NA 3VSKA 1BT5A 4EQIA 1MWTA 2XEPA 4KG2A 1K55C 5AQAA 1ES5A 4FH4A 2HPBA 4X68A 4N9KA 1K4EA 2XFSA 5EVLA 5GHZA 2JBFA 4XUXA 3OPPA 3V5MA 3ZG9B 4E3LA 5DTTA 3SS4A 1H5XA 3VP2A 4E3KA 1YM1A 4E3NA 2ZC4B 4ID4A 4E3IA 2Y55A 4S2MA 2Y91A 4P85A 4JF4A 3D4FA 3FYZA 1ES4A 3GSGA 3PBSA 5DF9A 1C3BA 4D2OA 3BYDA 2J8YA 4P6BA 1H8ZA 2EX6A 1ZC2A 3IH8A 1MY8A 4E3MA 1RGZA 3S22A 4M3KA 2ZQ7A 4OKPA 4KG6A 2Y2KA 3P98A 2ZQDA 1CK3A 4JXGA 2Y2IA 2RCXA 5HAPA 2J9PA 3GR2A 3AGDA 4K0WA 4GOGA 1HD8A 2EX2A 3MKEA 3OPLA 2V2FF 1Q2PA 3ZG8B 3AGEA 5EVIC 1GA9A 1XKZA 4X56A 5FQJA 1HTZA 1W8YA 1L0GA 3VFHA 3GMWA 3SOIA 3SH9A 1K6SA 1SDNA 4OVDA 1BZAA 5KMWA 1PYYA 2Z2MB 5DVAA 4FD8A 1EWZA 2A3UA 2QZ6A 2Y2QA 3BFDA 4OQ0A 2JC7A 2X71A 3UN7A 1ES3A 4OQGA 4WEJA 3HUNA 4WELA 1FCOA 3ZG0A 1FSWA 2R9XA 5GLCA 3Q1FA 2Y4AA 1HZOA 4UA6A 1TVFA 4QY5A 3NDEA 3BECA 4RX2A 3HLBA 3N7WA 4UAAA 3WS2A 5E2FA 1KDWA 4C75A 4N1XA 1XGJA 5CECA 5A91A 3A3FA 5GL9A 3UPNA 1M40A 2EX8A 1SDEA 4Z9QA
chains in the Genus database with same CATH superfamily
2OSUA 2PR6A 2ZD8A 3GQZA 1V9ZA 3PBQA 5DTKA 4ZJ3A 2JHEA 4N9LA 4YINA 5EPHA 2ZOHA 4UA7A 4QY6A 4S2PA 2Y59A 1OTAA 1T1BA 2DRWA 1T19A 4NG2A 5CEBA 5U47A 3E2LA 3LIAA 3L9KA 4K0XA 4ZAMA 3LR4A 3E98A 2EFUA 4EUVA 1FQGA 5FAOA 4BBTA 2YKFA 2Q9MA 4S2NC 2CMNA 2Y2PA 3GVBA 5AQ9A 5DF7A 4CLCB 1ESIA 4DKIA 4AFIA 1FSYA 1SCWA 5J8XA 2Y2LA 2C5WB 5F68A 1G6OA 5KIZA 4OLGA 2KLIA 1FOFA 4BENA 2L4RA 1PIOA 4Y3IA 1N9BA 5TBMA 3UO9A 2B18A 3OCNA 1XPBA 4ZJ2A 5E2EA 2L1MA 2WZXA 3CPTB 4BBUA 3VE3A 1S67L 3LEQA 2XQZA 3KSFA 4Y7PA 3PR6A 5FQMA 4DE0A 4X53A 2E8IA 1XA7A 2P9VA 3VP3A 1NXYA 3LFVA 4PM7A 5IT5A 4RQ9A 5CTMA 1LT0A 3A3JA 4CPKA 2HP9A 2XDMA 3NJAA 1T1CA 4WZ4A 3EWKA 4ZRRA 5CGWA 3ZNYA 2XD1A 3E4QA 4KQQA 3UE1A 4R1GA 3KYEA 5EVEA 2J80A 2GJ3A 4UHUA 4NK3A 1YLZA 4GHIB 2XGNA 4RA7A 5GLBA 5CGXA 3R7WB 1TS7A 3BFGA 5HAIA 4B4XA 3SS5A 3MMHA 3CI6A 4I5SA 2OOLA 3ZVTA 1JNUA 3HL9A 1H3QA 2K2NA 1NYMA 4OP8A 3N6IA 3S4XA 1PWGA 2HJ9C 3MZDA 3NOUC 3WS0A 1XA1A 3N4IA 4YFMA 2HP5A 4MLLA 1JWVA 5CHJA 3EEHA 3A3IA 4KQOA 2KX6A 5FI2A 2E8JA 1KOUA 1MPLA 3CUEA 3ZG5A 3LY4A 2V0WA 3QP2A 1YMXA 1S1YA 3QNCA 3DWKA 4XXRA 4KZAA 1Y4OA 1L3LA 5HD5A 2BASA 5FI7A 1PWDA 3IHBA 2HDRA 3OOVA 1EROA 3T4KA 5G4YA 1KGEA 4IVKA 4L9FA 1L0FA 3CMZA 1U60A 2UWXA 2EXBA 3S7PA 3R4KA 1ACFA 1K25A 4LCMA 3MS6A 3W4QA 4KZ4A 1N9OA 1YQSA 4DMZA 1FR6A 3EGXC 2A24A 3SH7A 3DW0A 3MXQA 2B02A 3FKVA 3V67A 4LENA 1T1AA 1XFNA 3TRCA 5F5YA 4JBFA 3VSLA 3UE6A 3Q82A 4JF5A 2IWCA 2CC1A 4EQ1A 1DRMA 3CJMA 3K2NA 2ZM8A 4IJGA 2Q0OA 1G68A 4HP9A 4GS9A 2KDKA 4DF6A 3U4LP 3RFBA 3LR3A 1LLBA 2LB5A 1DJCA 2J3WA 1PRQA 5HSQA 1KE3A 4F94A 2OLUA 2XD5A 3VMAA 2FFFB 4QHCA 5TJJA 3I7JA 4ETZA 3IF6B 3VFFA 5FA7A 1E3UD 4B88A 1CEFA 1KVMA 1K54A 3PAEA 1LL9A 5E2GA 2VGKA 3UE0A 1Z6FA 1H8YA 3K3DA 4UEYA 2JN7A 5CHMA 2WKEA 3MFDA 1DP6A 4E6WA 4CQHA 4R70A 4S2KA 3IX3A 2JCHA 3HUOA 4O7DA 4E6XA 3KSHA 4JPMA 5DJTA 1F2KA 3E0YA 2EFXA 3T4TA 4OLDA 1GSWA 3WS4A 4KZBA 2JKTM 1GHMA 2V0UA 3ZQ5A 4EBPA 3BRMA 2WGWA 3NBLA 5CGSA 5DKLA 1CQAA 2XF3A 2X01A 3T1RA 2HV1A 1ERQA 3C38A 5EVIA 4GJ4A 4PHTA 4OP5A 4KZ7A 2M1CA 3BLSA 2WGIA 2WK0A 3E2KA 2WKQA 3BWLA 3G6OA 3IXDA 4KENB 3LY3A 3QP5A 4EQIA 3E4OA 2DMWA 5AQAA 1ES5A 4D60A 2JKTI 1K4EA 2XFSA 3OPPA 2D02A 4E3LA 2ZL1A 4E3NA 4P85A 4JF4A 3GSGA 3PBSA 1C3BA 4P6BA 2AVXA 3S22A 4OKPA 2W1TA 2Y2KA 1J3WA 4JGRA 2ACGA 2Y2IA 3AGDA 1HD8A 1S4SA 2L0WA 3NULA 1Q2PA 5DJUA 3BJNA 3VFHA 4X56A 4Y15A 1K6SA 1SDNA 4OVDA 1EWZA 3D9YA 2QWSA 1FCOA 2FZ0A 1BYWA 3F1PA 3Q1FA 4EETB 3HLBA 5E2FA 3KO6A 2PRFA 3DTEA 1XGJA 1S1ZA 2ZQ8A 3MQQA 3NOTC 1SDEA 1AXBA 1S4RA 5FL3A 4LV0A 3O86A 1M6KA 4K08A 1KGFA 3Q07A 2V8CA 1N4OA 3IX4A 4WLAA 5GLAA 1GHIA 4L9EA 3Q81A 3UDXA 5AQ7A 5EECA 1OTDA 5TFQA 2OAP1 1L2SA 3A3DA 4LGWA 5GLDA 1PI5A 2G2UA 2Z6CA 3EQUA 4YOFA 1D7EA 4DDSA 2OAQ1 2C6WB 4EBNA 4PM9A 4WUJA 4HIAA 5TBMB 4NXFA 4MMNA 4Z1WA 3ULFA 1CI9A 3C2WA 1YLTA 2PR5A 5J7EA 4YWZA 3KSIA 4X55A 4PM6A 5HWVA 4EEUA 3HLGA 2QMIA 3GTCA 5JYOA 5CX7A 2ZMFA 3GV9A 2PYRA 2EWVA 4JLFA 2P9VB 1ZKJA 2V9AA 2W0NA 3ZHHA 1VHMA 4H6JA 2H0YA 3A3EA 3MZEA 2XFTA 1BLCA 5F1GA 3LIDA 1IELA 3IWQA 4DJ3A 3VP0A 2XK1A 1K6RA 3CUEC 4KZ8A 1EW0A 2A49A 3MR0A 3UB5P 4MN6A 5HDDA 4E3JA 4R0QA 2GZAA 4DXCA 3T50A 1OTEA 1OT9A 1BLSA 1HVBA 4OOMA 4DRTA 3UNWA 3NCKA 3ZGAB 3B42A 3FZCA 3UDIA 2W3HA 3DWZA 3TSGA 2PU4A 1IEMA 4EEPA 5IHVA 4OH0A 4C3QA 4WZ5A 3T4SA 3UDFA 5J3WA 3LYXA 5F6AA 4CLCC 4MNRA 3KYQA 3FC7A 1ONHA 1OJ5A 1LL8A 1PW8A 1K56A 1I2SA 4Y17A 1GCEA 4IUHA 2BG1A 5CHUA 2QYBA 1ERMA 3MFXA 3IWIA 3ITBA 3A0SA 4JGOA 3Q7VA 1WYCA 2ZC5B 4Q0JA 1ES2A 3EGDC 1PZPA 4H8RA 1HLUP 4GDBA 4ZTKA 2V1BA 2JKFA 4KZ3A 4HESA 4DXBA 4UA9A 3GRJA 1SZVA 5GHXA 1JWZA 4OPZA 1Q2QA 4FH2A 4ZJ1A 1OMEA 3ZFZA 3BFEA 4DE2A 4G3VA 2EWWA 5HWWA 3JPUA 4EBLA 4CLCE 2HJEA 2PHYA 2B95A 3ZYTA 4UQIS 1XJ4A 4NXEA 1O07A 1K54C 2ZJ9A 1Y54A 1LI9A 2A24B 3T4QA 4CLCD 5FDHA 3CWFA 2I9VA 2VX8A 3OBFA 4Y13A 3WS5A 1YLYA 1VQQA 2OWHA 4RX3A 4B9OA 4FSFA 2DNSA 4CJNA 2O9BA 5FQKA 3LIFA 1PWCA 3ZCZA 2O0YA 3C5AA 1KE4A 5A8BA 3NY4A 3TW8A 1K57A 3E4PA 5FATA 4GS9B 4OQHA 3O3VA 4F3LA 2INWA 4N1HA 2G7UA 5HDSA 4NETA 5I94A 4B93A 2J9OA 5A92A 4L0LA 5G18A 5FASA 3F1NA 4GN2A 3MZFA 1NZUA 3M2KA 2H28A 4ZDXA 1FCNA 2W27A 4PKYA 3MJQA 1ONGA 3EOIA 5HX9A 2HDQA 4DJ2A 1MZUA 4DN0A 3SZTA 4YNRA 1YAXA 4BMWA 2XH9A 4OONA 2ZC7A 4U0XA 3ICYA 3B47A 1BSGA 3BY8A 4GNUA 3LI8A 3W4OA 1CI8A 3MKFA 5HPIA 2PT7A 3PYPA 4LFUA 4XUZA 3G31A 5LBRA 3HLCA 1F98A 5HWTA 3LIEA 3A0VA 3EEAA 3IXGA 3HLFA 4Y0TA 1RP5A 3C4OA 3O5YA 4IBRA 1GHPA 2WGWB 3DAVA 4WL9A 2PYPA 3T1SA 3P7NA 2XRNA 2VV6A 2O9CA 1K55A 3NOPC 3UE3A 1NJ4A 1O7EA 4HOIA 4BQMA 5EVIB 4LCLA 4GB7A 3UB7A 3FKWA 2BTFP 1I2WA 4LPZA 3RTYA 1STZA 4HH2A 3BFCA 2IWBA 5F1FA 3P09A 4R23A 3NECA 5DFYA 1W7FA 2R9WA 3KYZA 1ZTUA 3UB8A 1ODVA 3HREA 4LRYC 3HJKA 2A2LA 4JGQA 1KDSA 1TEMA 3G4PA 1BULA 3IF6C 2ZL1B 4WF0A 1SKOA 3ZG7B 4NEED 5HAQA 4R3BA 2W1TB 2Q9NA 3VSKA 3S7OA 1BT5A 1MWTA 5HZHA 1IFQA 4HJ4A 2HPBA 5C5KA 5L10A 4N9KA 5EVLA 5GHZA 3V5MA 5DTTA 3D72A 4E3IA 4ID4A 3H82A 2W3DA 2YKHA 4LRZE 5HD3A 1RGZA 1IOUA 4KG6A 4JXGA 3F1PB 5HL6A 5EV0A 4IUKA 4EXOA 2O99A 3W2ZA 3MKEA 4M4XA 3ZG8B 1GA9A 4Q0IA 1A0KA 1TD5A 2FH5A 4G3KA 2A3UA 2Y2QA 1K0KA 2MJ6A 5FEFA 3ZG0A 2R9XA 1HZOA 1TVFA 4QY5A 4RX2A 3T1QB 3LI9A 3N7WA 4UAAA 5GL9A 3U2AA 4EW7A 3BM6A 3UB6A 2EX8A 1BTLA 3JVUA 5F83A 1WA9A 4PMAA 1G6AA 1NRJA 2XSSA 4N92A 4L9GA 5EM0A 1D1JA 3G30A 3VOZA 4KUKA 4R4SA 1NYYA 1TF1A 3BY9A 4X25A 4IEDA 5KSCA 4QU3A 5D3OA 4BLMA 4E04A 1PNEA 3OPHA 2XROA 3WRZA 4GW9A 5AVEA 3QHYA 5HPFA 2VV7A 4WZ5C 3OCLA 1SHVA 2QHKA 4Y0OA 4H6JB 2H5SA 2QPNA 3KSGA 2J7VA 4DE1A 5HARA 3ZDJA 1FR1A 1OT6A 3O88A 3QP4A 4R3AA 2DCFA 4ARZA 2W3GA 3QP6A 4QJGA 3HJIA 3G2YA 2ZLYA 5F69A 2H10A 3TE8A 2ZMAA 3C4PA 3CG5A 1YLPA 1IYOA 5EOOA 5A93A 1MXOA 1ALQA 1LSXA 2Z2LB 1LSVA 4OOLA 4MEZA 3MXSA 5CTNA 3DBAA 1K4FA 2FFYA 3W4PA 1E25A 4QPRA 5KSHA 3TJZC 3PBTA 4DE3A 2EXAA 4KZ9A 5HDCA 1VEUA 3CHWP 1KE0A 3LEZA 2GDNA 2UV0E 3O87A 3RXWA 4K91A 3VOLA 1IYPA 4OQIA 2B5RA 1MKMA 3S7NA 1QMEA 2Y2MA 3UMEA 5M18A 3IX8A 3Q7VB 2IA2A 1XX2A 2VA0A 2HDSA 3TG9A 1PW1A 1XP4A 1K56D 5DF8A 1W63Q 1ZG6A 3T1XA 4HQAA 3N8RA 3V3SA 4IHQA 3VV4A 1UGUA 3ZNTA 4LV2A 2PD8A 5EOEA 3BLMA 4I38A 4EERA 1YSPA 5EE8A 3DTMA 3S1YA 4GD8A 3VOYA 5EUAA 1LL5A 3RXXA 3HLEA 2QJ7A 5E2HA 4ETXA 2VGJA 3OC2A 2Y2NA 5IU1A 4MN7A 3PBRA 5CEDA 5F82A 1W63M 3PBOA 4ZBEA 3G2ZA 4R3JA 4HEFA 1S66L 3IQAA 3SH8A 1QMFA 4JKTA 3V39A 1GA0A 3LCEA 4U3TA 4HBUA 3CITA 5FSRA 5L8MA 3LR5A 4LLOB 1RGYA 4BL3A 1JVJA 2O9AA 4I3AA 4QB8A 1K38A 3C30A 4NXBA 3N8LA 4F3LB 4Y2FA 4Y5FA 1DJBA 4WMCA 3B3XA 4I3IA 4X69A 3HLDA 5CXWA 1CF0A 4PAUA 2ZQ9A 1TS0A 3AGFA 3DTKA 3QP8A 3F1NB 4XT2A 3NIAA 2ZQCA 3GECA 4DDYA 2VZWA 1MWSA 1YT4A 4R38A 1ESUA 1GSVA 1JTGA 2VKSA 3N8SA 3WRTA 2ZQAA 1TDLA 4S2OA 2ZC6B 3IH9A 2PDRA 4NKPA 3ISGA 3BQAA 2HZ5A 3G34A 4OPRA 5JYPA 1ZG4A 3LGOA 2X02A 2XR0A 1BUEA 2Y2GA 2VK3A 2IWDA 2OLVA 5M1AA 1OPXA 1BLPA 1JTDA 1T18A 4BWIA 3A0RA 2RL3A 1PI4A 4MCWA 5AJGA 1FCMA 1BLHA 2ZM2A 3T4LA 1LHYA 4S2JA 5EM1A 5I5LA 1E4DA 2WADA 1CJFA 2EA9A 4IBXA 2H0TA 2PD7A 4GZBA 3PHYA 1XJ6A 2WUQA 1VETA 5FEGA 2Y8HA 4HNBA 3IBRA 3IHAA 1IKGA 4BD1A 5AQBA 1SKOB 1J9MA 1YLWA 1W5DA 1S0WA 1TS6A 5L2FA 3NI9A 3NDGA 5J4EA 5FQ9A 2WKIA 2PAVP 4GCZA 5FQIA 4HI4A 3G32A 1GSXA 4UQIM 1IYSA 2WGVA 3MQ0A 3H82B 2Y2OA 4PPRA 5FDSA 4FUWA 4ESPA 4U0TA 5CERA 4IVIA 1W79A 4KG2A 3QP1A 4FH4A 4X68A 1F5MA 3ZG9B 2JBFA 4XUXA 1YKDA 1XJ3A 3IBJA 1H5XA 3B33A 3VP2A 2ZC4B 1P9RA 3BQ8A 3H7WA 2Y91A 3D4FA 1ZHHB 3FYZA 2HF6A 1YPRA 3BYDA 3IH8A 4E3MA 2ZQ7A 3P98A 2EX2A 2M7UA 2Y79A 2ZOIA 1OTIA 3NHQA 2V2FF 5EVIC 1HTZA 4O01A 2Z2MB 5DVAA 2V1AA 2JC7A 2X71A 2W3EA 3UN7A 1ES3A 4OQGA 4WEJA 3HUNA 4WELA 3IS2A 1FSWA 2Y4AA 1G5UA 3JVVA 4JGPA 4C75A 2W1RA 4N1XA 1XFQA 3UPNA 5DFXA 3F1OA 5MC7A 3BW6A 4Z9QA 3T12B 4OOYA 3LICA 4JXVA 3LIBA 2PBYA 4GD6A 1RCJA 4KZ6A 4HP4A 5HW3A 5K5BA 4P87A 3M6BA 3LUQA 4FTXA 3V50A 3OLOA 4BD0A 5FAQA 2WZZA 4MDZA 5BOHA 1P0ZA 4ARZB 1KVLA 3UPPA 4BL2A 3SS3A 1WE4A 5DKKA 4C6YA 4X1LA 3TOIA 5EVID 2P04A 3PTEA 3RJUA 3FG8A 3ZVWA 1IKIA 1NLZA 4G3WA 4EV4A 3L7HA 5FQQA 2P74A 4JXWA 4EWFA 1P9WA 1WYBA 5L09A 4GKUA 1VM1A 3GDIA 3NC8A 4WBGA 1VEUB 5TR7A 3T4JA 1H8MA 1SKFA 1LI0A 4LV3A 4HJ6A 2K7SA 4MBFA 4KQRA 4CLCA 4FCFA 3WWXA 1DJAA 2VEAA 3H9WA 2JKGA 1YLJA 2LB9A 3SW1A 3CZDA 2Y2HA 1DP9A 4LV1A 2V8FA 1N9LA 1EI5A 1PZOA 1H0MA 5CRFA 3HUMA 1L0EA 1MWUA 4Y0UA 2ZM0A 4R4RA 3CAXA 1NY0A 3CPTA 2OV5A 4LRXC 5KZHA 3W8KA 3HBRA 2V20A 5EFWA 3FV7A 4O0PA 4S2IA 5AVFA 4B4ZA 2WKHA 4S2NA 3T4OA 2GNXA 3VP1A 1L0DA 2VLGA 3QNBA 3M6HA 4Q8IA 1N9NA 2M7VA 2EX9A 2ZC3B 5FI6A 1FILA 3S7QA 4E3OA 3IXBA 1Y28A 1KGGA 4GHIA 5M19A 3R7WA 1NWZA 3C7VA 3UY6A 1MKIA 3CLOA 4HHDA 3ITAA 4X6TA 3KX0X 2PU2A 2PBDP 3MSHA 3UPOA 5DTSA 2XA7S 3WS1A 4KZ5A 2QKPA 1S6RA 4GDNA 5L07A 4RYEA 1MBLA 3PXPA 4MBHA 4PKYG 4OPQA 4WMCD 3JYIA 1DP8A 2XA7M 4PM8A 4XT2B 3UB9A 5E43A 1MWRA 1TDGA 1I5QA 3HCYA 2V1ZA 4HH3A 5G4ZA 4MBKA 3PAGA 2WKRA 2ZMVA 4QWOA 2G2WA 3FPVA 2R78A 1UWNX 5A90A 3HVFA 4JF6A 4R6LA 1YMSA 3HLWA 1X0OA 2JE5A 4I39A 1G28A 1W8QA 2I72A 3V3RA 5GHYA 4HJ3A 1FIKA 1UWPX 2XLNA 2GX5A 1OJGA 2VGLS 3VE4A 3EQVA 4FOFA 4WEKA 3M2JA 4X1MA 1NZOA 1DY6A 1CEGA 3BFFA 3IT9A 3P01A 4OPYA 4P0MA 5FAPA 4BJPA 2P7JA 2WAFA 4WYYA 2K31A 3PBNA 2VGLM 2BLSA 4ME4A 1F9IA 4JXSA 4HY8A 2J3TC 1K57C 2Y2JA 3IF5A 5HL1A 1AWIA 2HP6A 2VJWA 2ZBBA 2JKRM 4EU0A 1IYQA 4BBVA 3C8CA 1E3UA 1XGIA 3D3OA 2WKPA 3DTIA 2NUPC 1VETB 3C7UA 1D06A 3IF6A 1XJ2A 3RH8B 2QJ5A 3IWOA 4Q0HA 2HGVA 1XXMA 4KQDA 4I3JA 4WM9A 4P6ZS 3LO7A 2Z6DA 2HDUA 3OPRA 1JWPA 1OTBA 3BEBA 3MBZA 1NRFA 3Q7ZA 3LR0A 1Z09A 4KG5A 2JKRI 3G35A 3UMDA 3MXRA 4S2LA 3IXHA 4P6ZM 1PFLA 5HFOA 4QD4A 4RVAA 2OWJA 4PM5A 4EUZA 4A5RA 2J3TD 2WYXA 4HBTA 3VP4A 3H7WB 5IS1A 2KOIA 2WAEA 5TGFA 1YSQA 3OZHA 3FWLA 4MN5A 4EESA 4NXGA 1MC0A 3MQOA 2XEPA 1K55C 2NUTC 2D01A 3SS4A 4II7A 4E3KA 1YM1A 2Y55A 4S2MA 1NLYA 1ES4A 5DF9A 4D2OA 1LSWA 2J8YA 1H8ZA 2EX6A 1ZC2A 1MY8A 4O8GA 3MF0A 4M3KA 3IS2B 2ZQDA 1CK3A 2RCXA 5HAPA 2J9PA 3GR2A 4K0WA 4GOGA 3OPLA 4GLQA 4KUOA 3AGEA 1V9YA 1XKZA 5FQJA 1W8YA 1L0GA 3GMWA 3SOIA 3SH9A 3K3CA 1BZAA 5KMWA 1PYYA 3F1OB 4FD8A 2QZ6A 2VV8A 3BFDA 4OQ0A 1TS8A 5GLCA 4UA6A 3NDEA 3BECA 3FPWA 3WS2A 1KDWA 1P97A 2W3FA 5CECA 5A91A 3A3FA 2P08A 1M40A 1VB6A 4WN5A
chains in the Genus database with same CATH topology
1AXBA 2OSUA 5F83A 2ZD8A 4LV0A 3GQZA 4OOYA 4JXVA 4PMAA 3PBQA 5DTKA 4ZJ3A 1G6AA 3O86A 1M6KA 4N9LA 2PBYA 4GD6A 1KGFA 3Q07A 4YINA 4N92A 1RCJA 5EPHA 4KZ6A 4UA7A 5HW3A 4QY6A 1N4OA 3G30A 5GLAA 1GHIA 3VOZA 4P87A 3M6BA 3Q81A 4R4SA 1NYYA 4S2PA 3UDXA 5AQ7A 5EECA 3V50A 4BD0A 2Y59A 1BTLA 4IEDA 5TFQA 5KSCA 5FAQA 2WZZA 4QU3A 2DRWA 5D3OA 5BOHA 1L2SA 3A3DA 5CEBA 5GLDA 5U47A 3E2LA 4BLMA 1PI5A 1KVLA 2G2UA 3EQUA 4K0XA 4DDSA 3UPPA 2C6WB 4BL2A 3OPHA 4EBNA 4ZAMA 3SS3A 3WRZA 1WE4A 4C6YA 3TOIA 3QHYA 4PM9A 2EFUA 5EVID 3PTEA 1FQGA 4WZ5C 5FAOA 3RJUA 3ZVWA 1IKIA 2Q9MA 1SHVA 3OCLA 4S2NC 4Y0OA 2H5SA 2Y2PA 4EV4A 2QPNA 3GVBA 2J7VA 5FQQA 2P74A 1CI9A 5AQ9A 4JXWA 5HARA 3ZDJA 5DF7A 4DE1A 4EWFA 1YLTA 1FR1A 1ESIA 3O88A 4DKIA 1FSYA 1WYBA 4X55A 4GKUA 1VM1A 2DCFA 4PM6A 1SCWA 5J8XA 2Y2LA 2C5WB 4QJGA 3HLGA 3NC8A 4WBGA 2QMIA 3GTCA 5JYOA 3G2YA 4OLGA 3GV9A 2ZLYA 2H10A 1FOFA 2ZMAA 2ZQ8A 3C4PA 4JLFA 3CG5A 4BENA 1PIOA 1N9BA 2P9VB 1ZKJA 1YLPA 5TR7A 1IYOA 5EOOA 5A93A 1MXOA 1ALQA 1SKFA 3UO9A 1LI0A 3ZHHA 2Z2LB 2H0YA 4OOLA 3A3EA 3MZEA 3OCNA 4LV3A 1XPBA 2XFTA 4ZJ2A 1BLCA 4MBFA 4MEZA 4KQRA 5F1GA 3MXSA 5E2EA 1IELA 3IWQA 4FCFA 5CTNA 1K4FA 3VP0A 2FFYA 2WZXA 3WWXA 1DJAA 3W4PA 1E25A 2XK1A 1K6RA 2XQZA 4Y7PA 4KZ8A 5KSHA 1YLJA 2A49A 3CZDA 5FQMA 4DE0A 4X53A 2Y2HA 2E8IA 4E3JA 3PBTA 4DE3A 2EXAA 1XA7A 4KZ9A 4LV1A 2P9VA 4R0QA 3VP3A 4DXCA 1KE0A 1NXYA 4PM7A 1EI5A 1PZOA 1BLSA 3LEZA 2GDNA 5CTMA 1HVBA 4OOMA 3A3JA 3UNWA 4CPKA 4DRTA 5CRFA 3HUMA 1L0EA 1MWUA 2HP9A 2XDMA 3O87A 4Y0UA 3NCKA 3RXWA 2ZM0A 4R4RA 3ZGAB 3FZCA 4K91A 1IYPA 4OQIA 1NY0A 2B5RA 4WZ4A 3UDIA 5CGWA 2OV5A 3ZNYA 2XD1A 3DWZA 1QMEA 3TSGA 2Y2MA 4KQQA 3UE1A 2PU4A 5M18A 5KZHA 3W8KA 4R1GA 1IEMA 3Q7VB 1XX2A 3HBRA 2V20A 3FV7A 2HDSA 5IHVA 4UHUA 3TG9A 1PW1A 1XP4A 1K56D 4NK3A 4S2IA 5DF8A 4B4ZA 1YLZA 4OH0A 2WKHA 1ZG6A 4WZ5A 4C3QA 2XGNA 3UDFA 4RA7A 5GLBA 5CGXA 3N8RA 4S2NA 3V3SA 3BM6A 4MNRA 3VP1A 1L0DA 3BFGA 5HAIA 4B4XA 3SS5A 1ONHA 3ZNTA 1PW8A 3QNBA 1K56A 1I2SA 3M6HA 4LV2A 1GCEA 4Q8IA 5EOEA 2BG1A 5CHUA 3BLMA 3ZVTA 1ERMA 2EX9A 3IWIA 2ZC3B 3HL9A 3ITBA 5FI6A 4E3OA 1NYMA 3Q7VA 1WYCA 3IXBA 2ZC5B 4OP8A 5EE8A 3N6IA 3DTMA 1ES2A 3S4XA 1PWGA 1KGGA 1PZPA 4H8RA 3MZDA 3S1YA 4GD8A 5M19A 3VOYA 5EUAA 4GDBA 4ZTKA 1LL5A 3WS0A 1XA1A 3N4IA 4YFMA 3RXXA 2HP5A 3C7VA 1MKIA 3UY6A 4MLLA 3HLEA 4KZ3A 4HESA 5E2HA 1JWVA 3ITAA 5CHJA 4X6TA 3A3IA 2PU2A 2VGJA 3OC2A 4KQOA 4DXBA 4UA9A 3GRJA 5FI2A 5GHXA 1JWZA 3UPOA 1MPLA 4OPZA 3ZG5A 2Y2NA 1Q2QA 4FH2A 4ZJ1A 1OMEA 3LY4A 5DTSA 3ZFZA 3PBRA 3BFEA 5CEDA 3WS1A 4KZ5A 5F82A 4DE2A 3PBOA 4ZBEA 1S6RA 3G2ZA 1YMXA 4GDNA 4R3JA 4HEFA 4EBLA 3QNCA 3IQAA 3SH8A 1QMFA 4JKTA 3V39A 3DWKA 1GA0A 4RYEA 4XXRA 1MBLA 3LCEA 4MBHA 4U3TA 4HBUA 4KZAA 5FSRA 4OPQA 4WMCD 5FI7A 1RGYA 4BL3A 1PWDA 1JVJA 3JYIA 3IHBA 4PM8A 1O07A 1K54C 2HDRA 1Y54A 2ZJ9A 1EROA 1LI9A 4QB8A 5E43A 1K38A 3N8LA 1MWRA 1TDGA 1DJBA 4WMCA 1KGEA 3B3XA 5FDHA 1I5QA 4X69A 2V1ZA 4IVKA 3HLDA 3WS5A 1L0FA 1YLYA 1VQQA 4MBKA 4RX3A 5CXWA 3CMZA 1U60A 3PAGA 2UWXA 2EXBA 4FSFA 2ZQ9A 2DNSA 3AGFA 4CJNA 5FQKA 1PWCA 2G2WA 3ZCZA 3C5AA 1KE4A 1K25A 4LCMA 3NY4A 5A90A 3HVFA 4JF6A 3W4QA 1YMSA 4KZ4A 1K57A 3HLWA 5FATA 1YQSA 3NIAA 4OQHA 3O3VA 1FR6A 2JE5A 2ZQCA 4N1HA 3SH7A 1W8QA 3DW0A 4DDYA 3FKVA 1MWSA 2I72A 1YT4A 4LENA 4NETA 1ESUA 5I94A 3V3RA 4JBFA 3VSLA 2J9OA 3Q82A 5A92A 5GHYA 4L0LA 1JTGA 4JF5A 2IWCA 5G18A 2CC1A 3N8SA 3WRTA 5FASA 2ZQAA 1TDLA 4S2OA 3CJMA 4GN2A 3MZFA 2ZM8A 1NZUA 3M2KA 2ZC6B 4ZDXA 2XLNA 3IH9A 1FCNA 1G68A 3ISGA 1ONGA 3EQVA 5HX9A 2HDQA 4WEKA 3M2JA 4DF6A 1NZOA 1LLBA 1DJCA 1DY6A 2XH9A 3G34A 2ZC7A 4OPRA 4OONA 1CEGA 5JYPA 1ZG4A 3BFFA 1KE3A 3IT9A 4F94A 4U0XA 2X02A 2OLUA 2XD5A 1BSGA 3VMAA 2FFFB 4GNUA 4OPYA 2XR0A 4P0MA 4QHCA 5FAPA 1BUEA 2Y2GA 4BJPA 2WAFA 3W4OA 1CI8A 3MKFA 4WYYA 3I7JA 3IF6B 3PBNA 2IWDA 2BLSA 3VFFA 2OLVA 5M1AA 4JXSA 5FA7A 1E3UD 1K57C 2Y2JA 3IF5A 4XUZA 1BLPA 4B88A 3G31A 5HL1A 1JTDA 2HP6A 1CEFA 3HLCA 1KVMA 1K54A 3PAEA 1LL9A 1IYQA 5E2GA 2VGKA 2RL3A 3IXGA 3HLFA 1PI4A 1E3UA 1XGIA 3UE0A 4Y0TA 1RP5A 1FCMA 1BLHA 1Z6FA 2ZM2A 1H8YA 3C4OA 4IBRA 1LHYA 3C7UA 4S2JA 5CHMA 1GHPA 1E4DA 2WADA 3IF6A 2WKEA 3MFDA 4E6WA 2WGWB 4IBXA 2H0TA 4S2KA 3IWOA 4GZBA 2JCHA 3HUOA 4O7DA 4E6XA 1XXMA 4JPMA 4WM9A 1K55A 3UE3A 1NJ4A 1O7EA 2WUQA 3LO7A 2EFXA 4BQMA 5EVIB 2HDUA 3OPRA 1JWPA 4OLDA 4LCLA 3BEBA 3MBZA 1NRFA 3FKWA 4GB7A 3WS4A 4KZBA 3Q7ZA 3IHAA 1GHMA 1I2WA 1IKGA 4EBPA 4KG5A 3BRMA 3BFCA 4BD1A 5AQBA 3G35A 1J9MA 2WGWA 1YLWA 2IWBA 5F1FA 3P09A 1W5DA 4R23A 3NBLA 1S0WA 5L2FA 3MXRA 5CGSA 4S2LA 3NI9A 3IXHA 5HFOA 3NDGA 2XF3A 4QD4A 1W7FA 5FQ9A 4RVAA 2WKIA 2R9WA 2X01A 4PM5A 4EUZA 4A5RA 1ERQA 3HREA 5EVIA 4OP5A 5FQIA 4KZ7A 3G32A 2WYXA 1KDSA 1TEMA 3G4PA 1BULA 3IF6C 4HBTA 3VP4A 1IYSA 2WGVA 3BLSA 2WAEA 5TGFA 2WGIA 2WK0A 2Y2OA 3E2KA 3ZG7B 4PPRA 3OZHA 3FWLA 3IXDA 5HAQA 4KENB 4U0TA 4R3BA 5CERA 3LY3A 4IVIA 1W79A 2Q9NA 3VSKA 1BT5A 4EQIA 1MWTA 2XEPA 4KG2A 1K55C 5AQAA 1ES5A 4FH4A 2HPBA 4X68A 4N9KA 1K4EA 2XFSA 5EVLA 5GHZA 2JBFA 4XUXA 3OPPA 3V5MA 3ZG9B 4E3LA 5DTTA 3SS4A 1H5XA 3VP2A 4E3KA 1YM1A 4E3NA 2ZC4B 4ID4A 4E3IA 2Y55A 4S2MA 2Y91A 4P85A 4JF4A 3D4FA 3FYZA 1ES4A 3GSGA 3PBSA 5DF9A 1C3BA 4D2OA 3BYDA 2J8YA 4P6BA 1H8ZA 2EX6A 1ZC2A 3IH8A 1MY8A 4E3MA 1RGZA 3S22A 4M3KA 2ZQ7A 4OKPA 4KG6A 2Y2KA 3P98A 2ZQDA 1CK3A 4JXGA 2Y2IA 2RCXA 5HAPA 2J9PA 3GR2A 3AGDA 4K0WA 4GOGA 1HD8A 2EX2A 3MKEA 3OPLA 2V2FF 1Q2PA 3ZG8B 3AGEA 5EVIC 1GA9A 1XKZA 4X56A 5FQJA 1HTZA 1W8YA 1L0GA 3VFHA 3GMWA 3SOIA 3SH9A 1K6SA 1SDNA 4OVDA 1BZAA 5KMWA 1PYYA 2Z2MB 5DVAA 4FD8A 1EWZA 2A3UA 2QZ6A 2Y2QA 3BFDA 4OQ0A 2JC7A 2X71A 3UN7A 1ES3A 4OQGA 4WEJA 3HUNA 4WELA 1FCOA 3ZG0A 1FSWA 2R9XA 5GLCA 3Q1FA 2Y4AA 1HZOA 4UA6A 1TVFA 4QY5A 3NDEA 3BECA 4RX2A 3HLBA 3N7WA 4UAAA 3WS2A 5E2FA 1KDWA 4C75A 4N1XA 1XGJA 5CECA 5A91A 3A3FA 5GL9A 3UPNA 1M40A 2EX8A 1SDEA 4Z9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AXB A;  2OSU A;  5F83 A;  2ZD8 A;  4LV0 A;  3GQZ A;  4OOY A;  4JXV A;  4PMA A;  3PBQ A;  5DTK A;  4ZJ3 A;  1G6A A;  3O86 A;  1M6K A;  4N9L A;  2PBY A;  4GD6 A;  1KGF A;  3Q07 A;  4YIN A;  4N92 A;  1RCJ A;  5EPH A;  4KZ6 A;  4UA7 A;  5HW3 A;  4QY6 A;  1N4O A;  3G30 A;  5GLA A;  1GHI A;  3VOZ A;  4P87 A;  3M6B A;  3Q81 A;  4R4S A;  1NYY A;  4S2P A;  3UDX A;  5AQ7 A;  5EEC A;  3V50 A;  4BD0 A;  2Y59 A;  1BTL A;  4IED A;  5TFQ A;  5KSC A;  5FAQ A;  2WZZ A;  4QU3 A;  2DRW A;  5D3O A;  5BOH A;  1L2S A;  3A3D A;  5CEB A;  5GLD A;  5U47 A;  3E2L A;  4BLM A;  1PI5 A;  1KVL A;  2G2U A;  3EQU A;  4K0X A;  4DDS A;  3UPP A;  2C6W B;  4BL2 A;  3OPH A;  4EBN A;  4ZAM A;  3SS3 A;  3WRZ A;  1WE4 A;  4C6Y A;  3TOI A;  3QHY A;  4PM9 A;  2EFU A;  5EVI D;  3PTE A;  1FQG A;  4WZ5 C;  5FAO A;  3RJU A;  3ZVW A;  1IKI A;  2Q9M A;  1SHV A;  3OCL A;  4S2N C;  4Y0O A;  2H5S A;  2Y2P A;  4EV4 A;  2QPN A;  3GVB A;  2J7V A;  5FQQ A;  2P74 A;  1CI9 A;  5AQ9 A;  4JXW A;  5HAR A;  3ZDJ A;  5DF7 A;  4DE1 A;  4EWF A;  1YLT A;  1FR1 A;  1ESI A;  3O88 A;  4DKI A;  1FSY A;  1WYB A;  4X55 A;  4GKU A;  1VM1 A;  2DCF A;  4PM6 A;  1SCW A;  5J8X A;  2Y2L A;  2C5W B;  4QJG A;  3HLG A;  3NC8 A;  4WBG A;  2QMI A;  3GTC A;  5JYO A;  3G2Y A;  4OLG A;  3GV9 A;  2ZLY A;  2H10 A;  1FOF A;  2ZMA A;  2ZQ8 A;  3C4P A;  4JLF A;  3CG5 A;  4BEN A;  1PIO A;  1N9B A;  2P9V B;  1ZKJ A;  1YLP A;  5TR7 A;  1IYO A;  5EOO A;  5A93 A;  1MXO A;  1ALQ A;  1SKF A;  3UO9 A;  1LI0 A;  3ZHH A;  2Z2L B;  2H0Y A;  4OOL A;  3A3E A;  3MZE A;  3OCN A;  4LV3 A;  1XPB A;  2XFT A;  4ZJ2 A;  1BLC A;  4MBF A;  4MEZ A;  4KQR A;  5F1G A;  3MXS A;  5E2E A;  1IEL A;  3IWQ A;  4FCF A;  5CTN A;  1K4F A;  3VP0 A;  2FFY A;  2WZX A;  3WWX A;  1DJA A;  3W4P A;  1E25 A;  2XK1 A;  1K6R A;  2XQZ A;  4Y7P A;  4KZ8 A;  5KSH A;  1YLJ A;  2A49 A;  3CZD A;  5FQM A;  4DE0 A;  4X53 A;  2Y2H A;  2E8I A;  4E3J A;  3PBT A;  4DE3 A;  2EXA A;  1XA7 A;  4KZ9 A;  4LV1 A;  2P9V A;  4R0Q A;  3VP3 A;  4DXC A;  1KE0 A;  1NXY A;  4PM7 A;  1EI5 A;  1PZO A;  1BLS A;  3LEZ A;  2GDN A;  5CTM A;  1HVB A;  4OOM A;  3A3J A;  3UNW A;  4CPK A;  4DRT A;  5CRF A;  3HUM A;  1L0E A;  1MWU A;  2HP9 A;  2XDM A;  3O87 A;  4Y0U A;  3NCK A;  3RXW A;  2ZM0 A;  4R4R A;  3ZGA B;  3FZC A;  4K91 A;  1IYP A;  4OQI A;  1NY0 A;  2B5R A;  4WZ4 A;  3UDI A;  5CGW A;  2OV5 A;  3ZNY A;  2XD1 A;  3DWZ A;  1QME A;  3TSG A;  2Y2M A;  4KQQ A;  3UE1 A;  2PU4 A;  5M18 A;  5KZH A;  3W8K A;  4R1G A;  1IEM A;  3Q7V B;  1XX2 A;  3HBR A;  2V20 A;  3FV7 A;  2HDS A;  5IHV A;  4UHU A;  3TG9 A;  1PW1 A;  1XP4 A;  1K56 D;  4NK3 A;  4S2I A;  5DF8 A;  4B4Z A;  1YLZ A;  4OH0 A;  2WKH A;  1ZG6 A;  4WZ5 A;  4C3Q A;  2XGN A;  3UDF A;  4RA7 A;  5GLB A;  5CGX A;  3N8R A;  4S2N A;  3V3S A;  3BM6 A;  4MNR A;  3VP1 A;  1L0D A;  3BFG A;  5HAI A;  4B4X A;  3SS5 A;  1ONH A;  3ZNT A;  1PW8 A;  3QNB A;  1K56 A;  1I2S A;  3M6H A;  4LV2 A;  1GCE A;  4Q8I A;  5EOE A;  2BG1 A;  5CHU A;  3BLM A;  3ZVT A;  1ERM A;  2EX9 A;  3IWI A;  2ZC3 B;  3HL9 A;  3ITB A;  5FI6 A;  4E3O A;  1NYM A;  3Q7V A;  1WYC A;  3IXB A;  2ZC5 B;  4OP8 A;  5EE8 A;  3N6I A;  3DTM A;  1ES2 A;  3S4X A;  1PWG A;  1KGG A;  1PZP A;  4H8R A;  3MZD A;  3S1Y A;  4GD8 A;  5M19 A;  3VOY A;  5EUA A;  4GDB A;  4ZTK A;  1LL5 A;  3WS0 A;  1XA1 A;  3N4I A;  4YFM A;  3RXX A;  2HP5 A;  3C7V A;  1MKI A;  3UY6 A;  4MLL A;  3HLE A;  4KZ3 A;  4HES A;  5E2H A;  1JWV A;  3ITA A;  5CHJ A;  4X6T A;  3A3I A;  2PU2 A;  2VGJ A;  3OC2 A;  4KQO A;  4DXB A;  4UA9 A;  3GRJ A;  5FI2 A;  5GHX A;  1JWZ A;  3UPO A;  1MPL A;  4OPZ A;  3ZG5 A;  2Y2N A;  1Q2Q A;  4FH2 A;  4ZJ1 A;  1OME A;  3LY4 A;  5DTS A;  3ZFZ A;  3PBR A;  3BFE A;  5CED A;  3WS1 A;  4KZ5 A;  5F82 A;  4DE2 A;  3PBO A;  4ZBE A;  1S6R A;  3G2Z A;  1YMX A;  4GDN A;  4R3J A;  4HEF A;  4EBL A;  3QNC A;  3IQA A;  3SH8 A;  1QMF A;  4JKT A;  3V39 A;  3DWK A;  1GA0 A;  4RYE A;  4XXR A;  1MBL A;  3LCE A;  4MBH A;  4U3T A;  4HBU A;  4KZA A;  5FSR A;  4OPQ A;  4WMC D;  5FI7 A;  1RGY A;  4BL3 A;  1PWD A;  1JVJ A;  3JYI A;  3IHB A;  4PM8 A;  1O07 A;  1K54 C;  2HDR A;  1Y54 A;  2ZJ9 A;  1ERO A;  1LI9 A;  4QB8 A;  5E43 A;  1K38 A;  3N8L A;  1MWR A;  1TDG A;  1DJB A;  4WMC A;  1KGE A;  3B3X A;  5FDH A;  1I5Q A;  4X69 A;  2V1Z A;  4IVK A;  3HLD A;  3WS5 A;  1L0F A;  1YLY A;  1VQQ A;  4MBK A;  4RX3 A;  5CXW A;  3CMZ A;  1U60 A;  3PAG A;  2UWX A;  2EXB A;  4FSF A;  2ZQ9 A;  2DNS A;  3AGF A;  4CJN A;  5FQK A;  1PWC A;  2G2W A;  3ZCZ A;  3C5A A;  1KE4 A;  1K25 A;  4LCM A;  3NY4 A;  5A90 A;  3HVF A;  4JF6 A;  3W4Q A;  1YMS A;  4KZ4 A;  1K57 A;  3HLW A;  5FAT A;  1YQS A;  3NIA A;  4OQH A;  3O3V A;  1FR6 A;  2JE5 A;  2ZQC A;  4N1H A;  3SH7 A;  1W8Q A;  3DW0 A;  4DDY A;  3FKV A;  1MWS A;  2I72 A;  1YT4 A;  4LEN A;  4NET A;  1ESU A;  5I94 A;  3V3R A;  4JBF A;  3VSL A;  2J9O A;  3Q82 A;  5A92 A;  5GHY A;  4L0L A;  1JTG A;  4JF5 A;  2IWC A;  5G18 A;  2CC1 A;  3N8S A;  3WRT A;  5FAS A;  2ZQA A;  1TDL A;  4S2O A;  3CJM A;  4GN2 A;  3MZF A;  2ZM8 A;  1NZU A;  3M2K A;  2ZC6 B;  4ZDX A;  2XLN A;  3IH9 A;  1FCN A;  1G68 A;  3ISG A;  1ONG A;  3EQV A;  5HX9 A;  2HDQ A;  4WEK A;  3M2J A;  4DF6 A;  1NZO A;  1LLB A;  1DJC A;  1DY6 A;  2XH9 A;  3G34 A;  2ZC7 A;  4OPR A;  4OON A;  1CEG A;  5JYP A;  1ZG4 A;  3BFF A;  1KE3 A;  3IT9 A;  4F94 A;  4U0X A;  2X02 A;  2OLU A;  2XD5 A;  1BSG A;  3VMA A;  2FFF B;  4GNU A;  4OPY A;  2XR0 A;  4P0M A;  4QHC A;  5FAP A;  1BUE A;  2Y2G A;  4BJP A;  2WAF A;  3W4O A;  1CI8 A;  3MKF A;  4WYY A;  3I7J A;  3IF6 B;  3PBN A;  2IWD A;  2BLS A;  3VFF A;  2OLV A;  5M1A A;  4JXS A;  5FA7 A;  1E3U D;  1K57 C;  2Y2J A;  3IF5 A;  4XUZ A;  1BLP A;  4B88 A;  3G31 A;  5HL1 A;  1JTD A;  2HP6 A;  1CEF A;  3HLC A;  1KVM A;  1K54 A;  3PAE A;  1LL9 A;  1IYQ A;  5E2G A;  2VGK A;  2RL3 A;  3IXG A;  3HLF A;  1PI4 A;  1E3U A;  1XGI A;  3UE0 A;  4Y0T A;  1RP5 A;  1FCM A;  1BLH A;  1Z6F A;  2ZM2 A;  1H8Y A;  3C4O A;  4IBR A;  1LHY A;  3C7U A;  4S2J A;  5CHM A;  1GHP A;  1E4D A;  2WAD A;  3IF6 A;  2WKE A;  3MFD A;  4E6W A;  2WGW B;  4IBX A;  2H0T A;  4S2K A;  3IWO A;  4GZB A;  2JCH A;  3HUO A;  4O7D A;  4E6X A;  1XXM A;  4JPM A;  4WM9 A;  1K55 A;  3UE3 A;  1NJ4 A;  1O7E A;  2WUQ A;  3LO7 A;  2EFX A;  4BQM A;  5EVI B;  2HDU A;  3OPR A;  1JWP A;  4OLD A;  4LCL A;  3BEB A;  3MBZ A;  1NRF A;  3FKW A;  4GB7 A;  3WS4 A;  4KZB A;  3Q7Z A;  3IHA A;  1GHM A;  1I2W A;  1IKG A;  4EBP A;  4KG5 A;  3BRM A;  3BFC A;  4BD1 A;  5AQB A;  3G35 A;  1J9M A;  2WGW A;  1YLW A;  2IWB A;  5F1F A;  3P09 A;  1W5D A;  4R23 A;  3NBL A;  1S0W A;  5L2F A;  3MXR A;  5CGS A;  4S2L A;  3NI9 A;  3IXH A;  5HFO A;  3NDG A;  2XF3 A;  4QD4 A;  1W7F A;  5FQ9 A;  4RVA A;  2WKI A;  2R9W A;  2X01 A;  4PM5 A;  4EUZ A;  4A5R A;  1ERQ A;  3HRE A;  5EVI A;  4OP5 A;  5FQI A;  4KZ7 A;  3G32 A;  2WYX A;  1KDS A;  1TEM A;  3G4P A;  1BUL A;  3IF6 C;  4HBT A;  3VP4 A;  1IYS A;  2WGV A;  3BLS A;  2WAE A;  5TGF A;  2WGI A;  2WK0 A;  2Y2O A;  3E2K A;  3ZG7 B;  4PPR A;  3OZH A;  3FWL A;  3IXD A;  5HAQ A;  4KEN B;  4U0T A;  4R3B A;  5CER A;  3LY3 A;  4IVI A;  1W79 A;  2Q9N A;  3VSK A;  1BT5 A;  4EQI A;  1MWT A;  2XEP A;  4KG2 A;  1K55 C;  5AQA A;  1ES5 A;  4FH4 A;  2HPB A;  4X68 A;  4N9K A;  1K4E A;  2XFS A;  5EVL A;  5GHZ A;  2JBF A;  4XUX A;  3OPP A;  3V5M A;  3ZG9 B;  4E3L A;  5DTT A;  3SS4 A;  1H5X A;  3VP2 A;  4E3K A;  1YM1 A;  4E3N A;  2ZC4 B;  4ID4 A;  4E3I A;  2Y55 A;  4S2M A;  2Y91 A;  4P85 A;  4JF4 A;  3D4F A;  3FYZ A;  1ES4 A;  3GSG A;  3PBS A;  5DF9 A;  1C3B A;  4D2O A;  3BYD A;  2J8Y A;  4P6B A;  1H8Z A;  2EX6 A;  1ZC2 A;  3IH8 A;  1MY8 A;  4E3M A;  1RGZ A;  3S22 A;  4M3K A;  2ZQ7 A;  4OKP A;  4KG6 A;  2Y2K A;  3P98 A;  2ZQD A;  1CK3 A;  4JXG A;  2Y2I A;  2RCX A;  5HAP A;  2J9P A;  3GR2 A;  3AGD A;  4K0W A;  4GOG A;  1HD8 A;  2EX2 A;  3MKE A;  3OPL A;  2V2F F;  1Q2P A;  3ZG8 B;  3AGE A;  5EVI C;  1GA9 A;  1XKZ A;  4X56 A;  5FQJ A;  1HTZ A;  1W8Y A;  1L0G A;  3VFH A;  3GMW A;  3SOI A;  3SH9 A;  1K6S A;  1SDN A;  4OVD A;  1BZA A;  5KMW A;  1PYY A;  2Z2M B;  5DVA A;  4FD8 A;  1EWZ A;  2A3U A;  2QZ6 A;  2Y2Q A;  3BFD A;  4OQ0 A;  2JC7 A;  2X71 A;  3UN7 A;  1ES3 A;  4OQG A;  4WEJ A;  3HUN A;  4WEL A;  1FCO A;  3ZG0 A;  1FSW A;  2R9X A;  5GLC A;  3Q1F A;  2Y4A A;  1HZO A;  4UA6 A;  1TVF A;  4QY5 A;  3NDE A;  3BEC A;  4RX2 A;  3HLB A;  3N7W A;  4UAA A;  3WS2 A;  5E2F A;  1KDW A;  4C75 A;  4N1X A;  1XGJ A;  5CEC A;  5A91 A;  3A3F A;  5GL9 A;  3UPN A;  1M40 A;  2EX8 A;  1SDE A;  4Z9Q A; 
#chains in the Genus database with same CATH topology
 2OSU A;  2PR6 A;  2ZD8 A;  3GQZ A;  1V9Z A;  3PBQ A;  5DTK A;  4ZJ3 A;  2JHE A;  4N9L A;  4YIN A;  5EPH A;  2ZOH A;  4UA7 A;  4QY6 A;  4S2P A;  2Y59 A;  1OTA A;  1T1B A;  2DRW A;  1T19 A;  4NG2 A;  5CEB A;  5U47 A;  3E2L A;  3LIA A;  3L9K A;  4K0X A;  4ZAM A;  3LR4 A;  3E98 A;  2EFU A;  4EUV A;  1FQG A;  5FAO A;  4BBT A;  2YKF A;  2Q9M A;  4S2N C;  2CMN A;  2Y2P A;  3GVB A;  5AQ9 A;  5DF7 A;  4CLC B;  1ESI A;  4DKI A;  4AFI A;  1FSY A;  1SCW A;  5J8X A;  2Y2L A;  2C5W B;  5F68 A;  1G6O A;  5KIZ A;  4OLG A;  2KLI A;  1FOF A;  4BEN A;  2L4R A;  1PIO A;  4Y3I A;  1N9B A;  5TBM A;  3UO9 A;  2B18 A;  3OCN A;  1XPB A;  4ZJ2 A;  5E2E A;  2L1M A;  2WZX A;  3CPT B;  4BBU A;  3VE3 A;  1S67 L;  3LEQ A;  2XQZ A;  3KSF A;  4Y7P A;  3PR6 A;  5FQM A;  4DE0 A;  4X53 A;  2E8I A;  1XA7 A;  2P9V A;  3VP3 A;  1NXY A;  3LFV A;  4PM7 A;  5IT5 A;  4RQ9 A;  5CTM A;  1LT0 A;  3A3J A;  4CPK A;  2HP9 A;  2XDM A;  3NJA A;  1T1C A;  4WZ4 A;  3EWK A;  4ZRR A;  5CGW A;  3ZNY A;  2XD1 A;  3E4Q A;  4KQQ A;  3UE1 A;  4R1G A;  3KYE A;  5EVE A;  2J80 A;  2GJ3 A;  4UHU A;  4NK3 A;  1YLZ A;  4GHI B;  2XGN A;  4RA7 A;  5GLB A;  5CGX A;  3R7W B;  1TS7 A;  3BFG A;  5HAI A;  4B4X A;  3SS5 A;  3MMH A;  3CI6 A;  4I5S A;  2OOL A;  3ZVT A;  1JNU A;  3HL9 A;  1H3Q A;  2K2N A;  1NYM A;  4OP8 A;  3N6I A;  3S4X A;  1PWG A;  2HJ9 C;  3MZD A;  3NOU C;  3WS0 A;  1XA1 A;  3N4I A;  4YFM A;  2HP5 A;  4MLL A;  1JWV A;  5CHJ A;  3EEH A;  3A3I A;  4KQO A;  2KX6 A;  5FI2 A;  2E8J A;  1KOU A;  1MPL A;  3CUE A;  3ZG5 A;  3LY4 A;  2V0W A;  3QP2 A;  1YMX A;  1S1Y A;  3QNC A;  3DWK A;  4XXR A;  4KZA A;  1Y4O A;  1L3L A;  5HD5 A;  2BAS A;  5FI7 A;  1PWD A;  3IHB A;  2HDR A;  3OOV A;  1ERO A;  3T4K A;  5G4Y A;  1KGE A;  4IVK A;  4L9F A;  1L0F A;  3CMZ A;  1U60 A;  2UWX A;  2EXB A;  3S7P A;  3R4K A;  1ACF A;  1K25 A;  4LCM A;  3MS6 A;  3W4Q A;  4KZ4 A;  1N9O A;  1YQS A;  4DMZ A;  1FR6 A;  3EGX C;  2A24 A;  3SH7 A;  3DW0 A;  3MXQ A;  2B02 A;  3FKV A;  3V67 A;  4LEN A;  1T1A A;  1XFN A;  3TRC A;  5F5Y A;  4JBF A;  3VSL A;  3UE6 A;  3Q82 A;  4JF5 A;  2IWC A;  2CC1 A;  4EQ1 A;  1DRM A;  3CJM A;  3K2N A;  2ZM8 A;  4IJG A;  2Q0O A;  1G68 A;  4HP9 A;  4GS9 A;  2KDK A;  4DF6 A;  3U4L P;  3RFB A;  3LR3 A;  1LLB A;  2LB5 A;  1DJC A;  2J3W A;  1PRQ A;  5HSQ A;  1KE3 A;  4F94 A;  2OLU A;  2XD5 A;  3VMA A;  2FFF B;  4QHC A;  5TJJ A;  3I7J A;  4ETZ A;  3IF6 B;  3VFF A;  5FA7 A;  1E3U D;  4B88 A;  1CEF A;  1KVM A;  1K54 A;  3PAE A;  1LL9 A;  5E2G A;  2VGK A;  3UE0 A;  1Z6F A;  1H8Y A;  3K3D A;  4UEY A;  2JN7 A;  5CHM A;  2WKE A;  3MFD A;  1DP6 A;  4E6W A;  4CQH A;  4R70 A;  4S2K A;  3IX3 A;  2JCH A;  3HUO A;  4O7D A;  4E6X A;  3KSH A;  4JPM A;  5DJT A;  1F2K A;  3E0Y A;  2EFX A;  3T4T A;  4OLD A;  1GSW A;  3WS4 A;  4KZB A;  2JKT M;  1GHM A;  2V0U A;  3ZQ5 A;  4EBP A;  3BRM A;  2WGW A;  3NBL A;  5CGS A;  5DKL A;  1CQA A;  2XF3 A;  2X01 A;  3T1R A;  2HV1 A;  1ERQ A;  3C38 A;  5EVI A;  4GJ4 A;  4PHT A;  4OP5 A;  4KZ7 A;  2M1C A;  3BLS A;  2WGI A;  2WK0 A;  3E2K A;  2WKQ A;  3BWL A;  3G6O A;  3IXD A;  4KEN B;  3LY3 A;  3QP5 A;  4EQI A;  3E4O A;  2DMW A;  5AQA A;  1ES5 A;  4D60 A;  2JKT I;  1K4E A;  2XFS A;  3OPP A;  2D02 A;  4E3L A;  2ZL1 A;  4E3N A;  4P85 A;  4JF4 A;  3GSG A;  3PBS A;  1C3B A;  4P6B A;  2AVX A;  3S22 A;  4OKP A;  2W1T A;  2Y2K A;  1J3W A;  4JGR A;  2ACG A;  2Y2I A;  3AGD A;  1HD8 A;  1S4S A;  2L0W A;  3NUL A;  1Q2P A;  5DJU A;  3BJN A;  3VFH A;  4X56 A;  4Y15 A;  1K6S A;  1SDN A;  4OVD A;  1EWZ A;  3D9Y A;  2QWS A;  1FCO A;  2FZ0 A;  1BYW A;  3F1P A;  3Q1F A;  4EET B;  3HLB A;  5E2F A;  3KO6 A;  2PRF A;  3DTE A;  1XGJ A;  1S1Z A;  2ZQ8 A;  3MQQ A;  3NOT C;  1SDE A;  1AXB A;  1S4R A;  5FL3 A;  4LV0 A;  3O86 A;  1M6K A;  4K08 A;  1KGF A;  3Q07 A;  2V8C A;  1N4O A;  3IX4 A;  4WLA A;  5GLA A;  1GHI A;  4L9E A;  3Q81 A;  3UDX A;  5AQ7 A;  5EEC A;  1OTD A;  5TFQ A;  2OAP 1;  1L2S A;  3A3D A;  4LGW A;  5GLD A;  1PI5 A;  2G2U A;  2Z6C A;  3EQU A;  4YOF A;  1D7E A;  4DDS A;  2OAQ 1;  2C6W B;  4EBN A;  4PM9 A;  4WUJ A;  4HIA A;  5TBM B;  4NXF A;  4MMN A;  4Z1W A;  3ULF A;  1CI9 A;  3C2W A;  1YLT A;  2PR5 A;  5J7E A;  4YWZ A;  3KSI A;  4X55 A;  4PM6 A;  5HWV A;  4EEU A;  3HLG A;  2QMI A;  3GTC A;  5JYO A;  5CX7 A;  2ZMF A;  3GV9 A;  2PYR A;  2EWV A;  4JLF A;  2P9V B;  1ZKJ A;  2V9A A;  2W0N A;  3ZHH A;  1VHM A;  4H6J A;  2H0Y A;  3A3E A;  3MZE A;  2XFT A;  1BLC A;  5F1G A;  3LID A;  1IEL A;  3IWQ A;  4DJ3 A;  3VP0 A;  2XK1 A;  1K6R A;  3CUE C;  4KZ8 A;  1EW0 A;  2A49 A;  3MR0 A;  3UB5 P;  4MN6 A;  5HDD A;  4E3J A;  4R0Q A;  2GZA A;  4DXC A;  3T50 A;  1OTE A;  1OT9 A;  1BLS A;  1HVB A;  4OOM A;  4DRT A;  3UNW A;  3NCK A;  3ZGA B;  3B42 A;  3FZC A;  3UDI A;  2W3H A;  3DWZ A;  3TSG A;  2PU4 A;  1IEM A;  4EEP A;  5IHV A;  4OH0 A;  4C3Q A;  4WZ5 A;  3T4S A;  3UDF A;  5J3W A;  3LYX A;  5F6A A;  4CLC C;  4MNR A;  3KYQ A;  3FC7 A;  1ONH A;  1OJ5 A;  1LL8 A;  1PW8 A;  1K56 A;  1I2S A;  4Y17 A;  1GCE A;  4IUH A;  2BG1 A;  5CHU A;  2QYB A;  1ERM A;  3MFX A;  3IWI A;  3ITB A;  3A0S A;  4JGO A;  3Q7V A;  1WYC A;  2ZC5 B;  4Q0J A;  1ES2 A;  3EGD C;  1PZP A;  4H8R A;  1HLU P;  4GDB A;  4ZTK A;  2V1B A;  2JKF A;  4KZ3 A;  4HES A;  4DXB A;  4UA9 A;  3GRJ A;  1SZV A;  5GHX A;  1JWZ A;  4OPZ A;  1Q2Q A;  4FH2 A;  4ZJ1 A;  1OME A;  3ZFZ A;  3BFE A;  4DE2 A;  4G3V A;  2EWW A;  5HWW A;  3JPU A;  4EBL A;  4CLC E;  2HJE A;  2PHY A;  2B95 A;  3ZYT A;  4UQI S;  1XJ4 A;  4NXE A;  1O07 A;  1K54 C;  2ZJ9 A;  1Y54 A;  1LI9 A;  2A24 B;  3T4Q A;  4CLC D;  5FDH A;  3CWF A;  2I9V A;  2VX8 A;  3OBF A;  4Y13 A;  3WS5 A;  1YLY A;  1VQQ A;  2OWH A;  4RX3 A;  4B9O A;  4FSF A;  2DNS A;  4CJN A;  2O9B A;  5FQK A;  3LIF A;  1PWC A;  3ZCZ A;  2O0Y A;  3C5A A;  1KE4 A;  5A8B A;  3NY4 A;  3TW8 A;  1K57 A;  3E4P A;  5FAT A;  4GS9 B;  4OQH A;  3O3V A;  4F3L A;  2INW A;  4N1H A;  2G7U A;  5HDS A;  4NET A;  5I94 A;  4B93 A;  2J9O A;  5A92 A;  4L0L A;  5G18 A;  5FAS A;  3F1N A;  4GN2 A;  3MZF A;  1NZU A;  3M2K A;  2H28 A;  4ZDX A;  1FCN A;  2W27 A;  4PKY A;  3MJQ A;  1ONG A;  3EOI A;  5HX9 A;  2HDQ A;  4DJ2 A;  1MZU A;  4DN0 A;  3SZT A;  4YNR A;  1YAX A;  4BMW A;  2XH9 A;  4OON A;  2ZC7 A;  4U0X A;  3ICY A;  3B47 A;  1BSG A;  3BY8 A;  4GNU A;  3LI8 A;  3W4O A;  1CI8 A;  3MKF A;  5HPI A;  2PT7 A;  3PYP A;  4LFU A;  4XUZ A;  3G31 A;  5LBR A;  3HLC A;  1F98 A;  5HWT A;  3LIE A;  3A0V A;  3EEA A;  3IXG A;  3HLF A;  4Y0T A;  1RP5 A;  3C4O A;  3O5Y A;  4IBR A;  1GHP A;  2WGW B;  3DAV A;  4WL9 A;  2PYP A;  3T1S A;  3P7N A;  2XRN A;  2VV6 A;  2O9C A;  1K55 A;  3NOP C;  3UE3 A;  1NJ4 A;  1O7E A;  4HOI A;  4BQM A;  5EVI B;  4LCL A;  4GB7 A;  3UB7 A;  3FKW A;  2BTF P;  1I2W A;  4LPZ A;  3RTY A;  1STZ A;  4HH2 A;  3BFC A;  2IWB A;  5F1F A;  3P09 A;  4R23 A;  3NEC A;  5DFY A;  1W7F A;  2R9W A;  3KYZ A;  1ZTU A;  3UB8 A;  1ODV A;  3HRE A;  4LRY C;  3HJK A;  2A2L A;  4JGQ A;  1KDS A;  1TEM A;  3G4P A;  1BUL A;  3IF6 C;  2ZL1 B;  4WF0 A;  1SKO A;  3ZG7 B;  4NEE D;  5HAQ A;  4R3B A;  2W1T B;  2Q9N A;  3VSK A;  3S7O A;  1BT5 A;  1MWT A;  5HZH A;  1IFQ A;  4HJ4 A;  2HPB A;  5C5K A;  5L10 A;  4N9K A;  5EVL A;  5GHZ A;  3V5M A;  5DTT A;  3D72 A;  4E3I A;  4ID4 A;  3H82 A;  2W3D A;  2YKH A;  4LRZ E;  5HD3 A;  1RGZ A;  1IOU A;  4KG6 A;  4JXG A;  3F1P B;  5HL6 A;  5EV0 A;  4IUK A;  4EXO A;  2O99 A;  3W2Z A;  3MKE A;  4M4X A;  3ZG8 B;  1GA9 A;  4Q0I A;  1A0K A;  1TD5 A;  2FH5 A;  4G3K A;  2A3U A;  2Y2Q A;  1K0K A;  2MJ6 A;  5FEF A;  3ZG0 A;  2R9X A;  1HZO A;  1TVF A;  4QY5 A;  4RX2 A;  3T1Q B;  3LI9 A;  3N7W A;  4UAA A;  5GL9 A;  3U2A A;  4EW7 A;  3BM6 A;  3UB6 A;  2EX8 A;  1BTL A;  3JVU A;  5F83 A;  1WA9 A;  4PMA A;  1G6A A;  1NRJ A;  2XSS A;  4N92 A;  4L9G A;  5EM0 A;  1D1J A;  3G30 A;  3VOZ A;  4KUK A;  4R4S A;  1NYY A;  1TF1 A;  3BY9 A;  4X25 A;  4IED A;  5KSC A;  4QU3 A;  5D3O A;  4BLM A;  4E04 A;  1PNE A;  3OPH A;  2XRO A;  3WRZ A;  4GW9 A;  5AVE A;  3QHY A;  5HPF A;  2VV7 A;  4WZ5 C;  3OCL A;  1SHV A;  2QHK A;  4Y0O A;  4H6J B;  2H5S A;  2QPN A;  3KSG A;  2J7V A;  4DE1 A;  5HAR A;  3ZDJ A;  1FR1 A;  1OT6 A;  3O88 A;  3QP4 A;  4R3A A;  2DCF A;  4ARZ A;  2W3G A;  3QP6 A;  4QJG A;  3HJI A;  3G2Y A;  2ZLY A;  5F69 A;  2H10 A;  3TE8 A;  2ZMA A;  3C4P A;  3CG5 A;  1YLP A;  1IYO A;  5EOO A;  5A93 A;  1MXO A;  1ALQ A;  1LSX A;  2Z2L B;  1LSV A;  4OOL A;  4MEZ A;  3MXS A;  5CTN A;  3DBA A;  1K4F A;  2FFY A;  3W4P A;  1E25 A;  4QPR A;  5KSH A;  3TJZ C;  3PBT A;  4DE3 A;  2EXA A;  4KZ9 A;  5HDC A;  1VEU A;  3CHW P;  1KE0 A;  3LEZ A;  2GDN A;  2UV0 E;  3O87 A;  3RXW A;  4K91 A;  3VOL A;  1IYP A;  4OQI A;  2B5R A;  1MKM A;  3S7N A;  1QME A;  2Y2M A;  3UME A;  5M18 A;  3IX8 A;  3Q7V B;  2IA2 A;  1XX2 A;  2VA0 A;  2HDS A;  3TG9 A;  1PW1 A;  1XP4 A;  1K56 D;  5DF8 A;  1W63 Q;  1ZG6 A;  3T1X A;  4HQA A;  3N8R A;  3V3S A;  4IHQ A;  3VV4 A;  1UGU A;  3ZNT A;  4LV2 A;  2PD8 A;  5EOE A;  3BLM A;  4I38 A;  4EER A;  1YSP A;  5EE8 A;  3DTM A;  3S1Y A;  4GD8 A;  3VOY A;  5EUA A;  1LL5 A;  3RXX A;  3HLE A;  2QJ7 A;  5E2H A;  4ETX A;  2VGJ A;  3OC2 A;  2Y2N A;  5IU1 A;  4MN7 A;  3PBR A;  5CED A;  5F82 A;  1W63 M;  3PBO A;  4ZBE A;  3G2Z A;  4R3J A;  4HEF A;  1S66 L;  3IQA A;  3SH8 A;  1QMF A;  4JKT A;  3V39 A;  1GA0 A;  3LCE A;  4U3T A;  4HBU A;  3CIT A;  5FSR A;  5L8M A;  3LR5 A;  4LLO B;  1RGY A;  4BL3 A;  1JVJ A;  2O9A A;  4I3A A;  4QB8 A;  1K38 A;  3C30 A;  4NXB A;  3N8L A;  4F3L B;  4Y2F A;  4Y5F A;  1DJB A;  4WMC A;  3B3X A;  4I3I A;  4X69 A;  3HLD A;  5CXW A;  1CF0 A;  4PAU A;  2ZQ9 A;  1TS0 A;  3AGF A;  3DTK A;  3QP8 A;  3F1N B;  4XT2 A;  3NIA A;  2ZQC A;  3GEC A;  4DDY A;  2VZW A;  1MWS A;  1YT4 A;  4R38 A;  1ESU A;  1GSV A;  1JTG A;  2VKS A;  3N8S A;  3WRT A;  2ZQA A;  1TDL A;  4S2O A;  2ZC6 B;  3IH9 A;  2PDR A;  4NKP A;  3ISG A;  3BQA A;  2HZ5 A;  3G34 A;  4OPR A;  5JYP A;  1ZG4 A;  3LGO A;  2X02 A;  2XR0 A;  1BUE A;  2Y2G A;  2VK3 A;  2IWD A;  2OLV A;  5M1A A;  1OPX A;  1BLP A;  1JTD A;  1T18 A;  4BWI A;  3A0R A;  2RL3 A;  1PI4 A;  4MCW A;  5AJG A;  1FCM A;  1BLH A;  2ZM2 A;  3T4L A;  1LHY A;  4S2J A;  5EM1 A;  5I5L A;  1E4D A;  2WAD A;  1CJF A;  2EA9 A;  4IBX A;  2H0T A;  2PD7 A;  4GZB A;  3PHY A;  1XJ6 A;  2WUQ A;  1VET A;  5FEG A;  2Y8H A;  4HNB A;  3IBR A;  3IHA A;  1IKG A;  4BD1 A;  5AQB A;  1SKO B;  1J9M A;  1YLW A;  1W5D A;  1S0W A;  1TS6 A;  5L2F A;  3NI9 A;  3NDG A;  5J4E A;  5FQ9 A;  2WKI A;  2PAV P;  4GCZ A;  5FQI A;  4HI4 A;  3G32 A;  1GSX A;  4UQI M;  1IYS A;  2WGV A;  3MQ0 A;  3H82 B;  2Y2O A;  4PPR A;  5FDS A;  4FUW A;  4ESP A;  4U0T A;  5CER A;  4IVI A;  1W79 A;  4KG2 A;  3QP1 A;  4FH4 A;  4X68 A;  1F5M A;  3ZG9 B;  2JBF A;  4XUX A;  1YKD A;  1XJ3 A;  3IBJ A;  1H5X A;  3B33 A;  3VP2 A;  2ZC4 B;  1P9R A;  3BQ8 A;  3H7W A;  2Y91 A;  3D4F A;  1ZHH B;  3FYZ A;  2HF6 A;  1YPR A;  3BYD A;  3IH8 A;  4E3M A;  2ZQ7 A;  3P98 A;  2EX2 A;  2M7U A;  2Y79 A;  2ZOI A;  1OTI A;  3NHQ A;  2V2F F;  5EVI C;  1HTZ A;  4O01 A;  2Z2M B;  5DVA A;  2V1A A;  2JC7 A;  2X71 A;  2W3E A;  3UN7 A;  1ES3 A;  4OQG A;  4WEJ A;  3HUN A;  4WEL A;  3IS2 A;  1FSW A;  2Y4A A;  1G5U A;  3JVV A;  4JGP A;  4C75 A;  2W1R A;  4N1X A;  1XFQ A;  3UPN A;  5DFX A;  3F1O A;  5MC7 A;  3BW6 A;  4Z9Q A;  3T12 B;  4OOY A;  3LIC A;  4JXV A;  3LIB A;  2PBY A;  4GD6 A;  1RCJ A;  4KZ6 A;  4HP4 A;  5HW3 A;  5K5B A;  4P87 A;  3M6B A;  3LUQ A;  4FTX A;  3V50 A;  3OLO A;  4BD0 A;  5FAQ A;  2WZZ A;  4MDZ A;  5BOH A;  1P0Z A;  4ARZ B;  1KVL A;  3UPP A;  4BL2 A;  3SS3 A;  1WE4 A;  5DKK A;  4C6Y A;  4X1L A;  3TOI A;  5EVI D;  2P04 A;  3PTE A;  3RJU A;  3FG8 A;  3ZVW A;  1IKI A;  1NLZ A;  4G3W A;  4EV4 A;  3L7H A;  5FQQ A;  2P74 A;  4JXW A;  4EWF A;  1P9W A;  1WYB A;  5L09 A;  4GKU A;  1VM1 A;  3GDI A;  3NC8 A;  4WBG A;  1VEU B;  5TR7 A;  3T4J A;  1H8M A;  1SKF A;  1LI0 A;  4LV3 A;  4HJ6 A;  2K7S A;  4MBF A;  4KQR A;  4CLC A;  4FCF A;  3WWX A;  1DJA A;  2VEA A;  3H9W A;  2JKG A;  1YLJ A;  2LB9 A;  3SW1 A;  3CZD A;  2Y2H A;  1DP9 A;  4LV1 A;  2V8F A;  1N9L A;  1EI5 A;  1PZO A;  1H0M A;  5CRF A;  3HUM A;  1L0E A;  1MWU A;  4Y0U A;  2ZM0 A;  4R4R A;  3CAX A;  1NY0 A;  3CPT A;  2OV5 A;  4LRX C;  5KZH A;  3W8K A;  3HBR A;  2V20 A;  5EFW A;  3FV7 A;  4O0P A;  4S2I A;  5AVF A;  4B4Z A;  2WKH A;  4S2N A;  3T4O A;  2GNX A;  3VP1 A;  1L0D A;  2VLG A;  3QNB A;  3M6H A;  4Q8I A;  1N9N A;  2M7V A;  2EX9 A;  2ZC3 B;  5FI6 A;  1FIL A;  3S7Q A;  4E3O A;  3IXB A;  1Y28 A;  1KGG A;  4GHI A;  5M19 A;  3R7W A;  1NWZ A;  3C7V A;  3UY6 A;  1MKI A;  3CLO A;  4HHD A;  3ITA A;  4X6T A;  3KX0 X;  2PU2 A;  2PBD P;  3MSH A;  3UPO A;  5DTS A;  2XA7 S;  3WS1 A;  4KZ5 A;  2QKP A;  1S6R A;  4GDN A;  5L07 A;  4RYE A;  1MBL A;  3PXP A;  4MBH A;  4PKY G;  4OPQ A;  4WMC D;  3JYI A;  1DP8 A;  2XA7 M;  4PM8 A;  4XT2 B;  3UB9 A;  5E43 A;  1MWR A;  1TDG A;  1I5Q A;  3HCY A;  2V1Z A;  4HH3 A;  5G4Z A;  4MBK A;  3PAG A;  2WKR A;  2ZMV A;  4QWO A;  2G2W A;  3FPV A;  2R78 A;  1UWN X;  5A90 A;  3HVF A;  4JF6 A;  4R6L A;  1YMS A;  3HLW A;  1X0O A;  2JE5 A;  4I39 A;  1G28 A;  1W8Q A;  2I72 A;  3V3R A;  5GHY A;  4HJ3 A;  1FIK A;  1UWP X;  2XLN A;  2GX5 A;  1OJG A;  2VGL S;  3VE4 A;  3EQV A;  4FOF A;  4WEK A;  3M2J A;  4X1M A;  1NZO A;  1DY6 A;  1CEG A;  3BFF A;  3IT9 A;  3P01 A;  4OPY A;  4P0M A;  5FAP A;  4BJP A;  2P7J A;  2WAF A;  4WYY A;  2K31 A;  3PBN A;  2VGL M;  2BLS A;  4ME4 A;  1F9I A;  4JXS A;  4HY8 A;  2J3T C;  1K57 C;  2Y2J A;  3IF5 A;  5HL1 A;  1AWI A;  2HP6 A;  2VJW A;  2ZBB A;  2JKR M;  4EU0 A;  1IYQ A;  4BBV A;  3C8C A;  1E3U A;  1XGI A;  3D3O A;  2WKP A;  3DTI A;  2NUP C;  1VET B;  3C7U A;  1D06 A;  3IF6 A;  1XJ2 A;  3RH8 B;  2QJ5 A;  3IWO A;  4Q0H A;  2HGV A;  1XXM A;  4KQD A;  4I3J A;  4WM9 A;  4P6Z S;  3LO7 A;  2Z6D A;  2HDU A;  3OPR A;  1JWP A;  1OTB A;  3BEB A;  3MBZ A;  1NRF A;  3Q7Z A;  3LR0 A;  1Z09 A;  4KG5 A;  2JKR I;  3G35 A;  3UMD A;  3MXR A;  4S2L A;  3IXH A;  4P6Z M;  1PFL A;  5HFO A;  4QD4 A;  4RVA A;  2OWJ A;  4PM5 A;  4EUZ A;  4A5R A;  2J3T D;  2WYX A;  4HBT A;  3VP4 A;  3H7W B;  5IS1 A;  2KOI A;  2WAE A;  5TGF A;  1YSQ A;  3OZH A;  3FWL A;  4MN5 A;  4EES A;  4NXG A;  1MC0 A;  3MQO A;  2XEP A;  1K55 C;  2NUT C;  2D01 A;  3SS4 A;  4II7 A;  4E3K A;  1YM1 A;  2Y55 A;  4S2M A;  1NLY A;  1ES4 A;  5DF9 A;  4D2O A;  1LSW A;  2J8Y A;  1H8Z A;  2EX6 A;  1ZC2 A;  1MY8 A;  4O8G A;  3MF0 A;  4M3K A;  3IS2 B;  2ZQD A;  1CK3 A;  2RCX A;  5HAP A;  2J9P A;  3GR2 A;  4K0W A;  4GOG A;  3OPL A;  4GLQ A;  4KUO A;  3AGE A;  1V9Y A;  1XKZ A;  5FQJ A;  1W8Y A;  1L0G A;  3GMW A;  3SOI A;  3SH9 A;  3K3C A;  1BZA A;  5KMW A;  1PYY A;  3F1O B;  4FD8 A;  2QZ6 A;  2VV8 A;  3BFD A;  4OQ0 A;  1TS8 A;  5GLC A;  4UA6 A;  3NDE A;  3BEC A;  3FPW A;  3WS2 A;  1KDW A;  1P97 A;  2W3F A;  5CEC A;  5A91 A;  3A3F A;  2P08 A;  1M40 A;  1VB6 A;  4WN5 A; 
#chains in the Genus database with same CATH homology
 1AXB A;  2OSU A;  5F83 A;  2ZD8 A;  4LV0 A;  3GQZ A;  4OOY A;  4JXV A;  4PMA A;  3PBQ A;  5DTK A;  4ZJ3 A;  1G6A A;  3O86 A;  1M6K A;  4N9L A;  2PBY A;  4GD6 A;  1KGF A;  3Q07 A;  4YIN A;  4N92 A;  1RCJ A;  5EPH A;  4KZ6 A;  4UA7 A;  5HW3 A;  4QY6 A;  1N4O A;  3G30 A;  5GLA A;  1GHI A;  3VOZ A;  4P87 A;  3M6B A;  3Q81 A;  4R4S A;  1NYY A;  4S2P A;  3UDX A;  5AQ7 A;  5EEC A;  3V50 A;  4BD0 A;  2Y59 A;  1BTL A;  4IED A;  5TFQ A;  5KSC A;  5FAQ A;  2WZZ A;  4QU3 A;  2DRW A;  5D3O A;  5BOH A;  1L2S A;  3A3D A;  5CEB A;  5GLD A;  5U47 A;  3E2L A;  4BLM A;  1PI5 A;  1KVL A;  2G2U A;  3EQU A;  4K0X A;  4DDS A;  3UPP A;  2C6W B;  4BL2 A;  3OPH A;  4EBN A;  4ZAM A;  3SS3 A;  3WRZ A;  1WE4 A;  4C6Y A;  3TOI A;  3QHY A;  4PM9 A;  2EFU A;  5EVI D;  3PTE A;  1FQG A;  4WZ5 C;  5FAO A;  3RJU A;  3ZVW A;  1IKI A;  2Q9M A;  1SHV A;  3OCL A;  4S2N C;  4Y0O A;  2H5S A;  2Y2P A;  4EV4 A;  2QPN A;  3GVB A;  2J7V A;  5FQQ A;  2P74 A;  1CI9 A;  5AQ9 A;  4JXW A;  5HAR A;  3ZDJ A;  5DF7 A;  4DE1 A;  4EWF A;  1YLT A;  1FR1 A;  1ESI A;  3O88 A;  4DKI A;  1FSY A;  1WYB A;  4X55 A;  4GKU A;  1VM1 A;  2DCF A;  4PM6 A;  1SCW A;  5J8X A;  2Y2L A;  2C5W B;  4QJG A;  3HLG A;  3NC8 A;  4WBG A;  2QMI A;  3GTC A;  5JYO A;  3G2Y A;  4OLG A;  3GV9 A;  2ZLY A;  2H10 A;  1FOF A;  2ZMA A;  2ZQ8 A;  3C4P A;  4JLF A;  3CG5 A;  4BEN A;  1PIO A;  1N9B A;  2P9V B;  1ZKJ A;  1YLP A;  5TR7 A;  1IYO A;  5EOO A;  5A93 A;  1MXO A;  1ALQ A;  1SKF A;  3UO9 A;  1LI0 A;  3ZHH A;  2Z2L B;  2H0Y A;  4OOL A;  3A3E A;  3MZE A;  3OCN A;  4LV3 A;  1XPB A;  2XFT A;  4ZJ2 A;  1BLC A;  4MBF A;  4MEZ A;  4KQR A;  5F1G A;  3MXS A;  5E2E A;  1IEL A;  3IWQ A;  4FCF A;  5CTN A;  1K4F A;  3VP0 A;  2FFY A;  2WZX A;  3WWX A;  1DJA A;  3W4P A;  1E25 A;  2XK1 A;  1K6R A;  2XQZ A;  4Y7P A;  4KZ8 A;  5KSH A;  1YLJ A;  2A49 A;  3CZD A;  5FQM A;  4DE0 A;  4X53 A;  2Y2H A;  2E8I A;  4E3J A;  3PBT A;  4DE3 A;  2EXA A;  1XA7 A;  4KZ9 A;  4LV1 A;  2P9V A;  4R0Q A;  3VP3 A;  4DXC A;  1KE0 A;  1NXY A;  4PM7 A;  1EI5 A;  1PZO A;  1BLS A;  3LEZ A;  2GDN A;  5CTM A;  1HVB A;  4OOM A;  3A3J A;  3UNW A;  4CPK A;  4DRT A;  5CRF A;  3HUM A;  1L0E A;  1MWU A;  2HP9 A;  2XDM A;  3O87 A;  4Y0U A;  3NCK A;  3RXW A;  2ZM0 A;  4R4R A;  3ZGA B;  3FZC A;  4K91 A;  1IYP A;  4OQI A;  1NY0 A;  2B5R A;  4WZ4 A;  3UDI A;  5CGW A;  2OV5 A;  3ZNY A;  2XD1 A;  3DWZ A;  1QME A;  3TSG A;  2Y2M A;  4KQQ A;  3UE1 A;  2PU4 A;  5M18 A;  5KZH A;  3W8K A;  4R1G A;  1IEM A;  3Q7V B;  1XX2 A;  3HBR A;  2V20 A;  3FV7 A;  2HDS A;  5IHV A;  4UHU A;  3TG9 A;  1PW1 A;  1XP4 A;  1K56 D;  4NK3 A;  4S2I A;  5DF8 A;  4B4Z A;  1YLZ A;  4OH0 A;  2WKH A;  1ZG6 A;  4WZ5 A;  4C3Q A;  2XGN A;  3UDF A;  4RA7 A;  5GLB A;  5CGX A;  3N8R A;  4S2N A;  3V3S A;  3BM6 A;  4MNR A;  3VP1 A;  1L0D A;  3BFG A;  5HAI A;  4B4X A;  3SS5 A;  1ONH A;  3ZNT A;  1PW8 A;  3QNB A;  1K56 A;  1I2S A;  3M6H A;  4LV2 A;  1GCE A;  4Q8I A;  5EOE A;  2BG1 A;  5CHU A;  3BLM A;  3ZVT A;  1ERM A;  2EX9 A;  3IWI A;  2ZC3 B;  3HL9 A;  3ITB A;  5FI6 A;  4E3O A;  1NYM A;  3Q7V A;  1WYC A;  3IXB A;  2ZC5 B;  4OP8 A;  5EE8 A;  3N6I A;  3DTM A;  1ES2 A;  3S4X A;  1PWG A;  1KGG A;  1PZP A;  4H8R A;  3MZD A;  3S1Y A;  4GD8 A;  5M19 A;  3VOY A;  5EUA A;  4GDB A;  4ZTK A;  1LL5 A;  3WS0 A;  1XA1 A;  3N4I A;  4YFM A;  3RXX A;  2HP5 A;  3C7V A;  1MKI A;  3UY6 A;  4MLL A;  3HLE A;  4KZ3 A;  4HES A;  5E2H A;  1JWV A;  3ITA A;  5CHJ A;  4X6T A;  3A3I A;  2PU2 A;  2VGJ A;  3OC2 A;  4KQO A;  4DXB A;  4UA9 A;  3GRJ A;  5FI2 A;  5GHX A;  1JWZ A;  3UPO A;  1MPL A;  4OPZ A;  3ZG5 A;  2Y2N A;  1Q2Q A;  4FH2 A;  4ZJ1 A;  1OME A;  3LY4 A;  5DTS A;  3ZFZ A;  3PBR A;  3BFE A;  5CED A;  3WS1 A;  4KZ5 A;  5F82 A;  4DE2 A;  3PBO A;  4ZBE A;  1S6R A;  3G2Z A;  1YMX A;  4GDN A;  4R3J A;  4HEF A;  4EBL A;  3QNC A;  3IQA A;  3SH8 A;  1QMF A;  4JKT A;  3V39 A;  3DWK A;  1GA0 A;  4RYE A;  4XXR A;  1MBL A;  3LCE A;  4MBH A;  4U3T A;  4HBU A;  4KZA A;  5FSR A;  4OPQ A;  4WMC D;  5FI7 A;  1RGY A;  4BL3 A;  1PWD A;  1JVJ A;  3JYI A;  3IHB A;  4PM8 A;  1O07 A;  1K54 C;  2HDR A;  1Y54 A;  2ZJ9 A;  1ERO A;  1LI9 A;  4QB8 A;  5E43 A;  1K38 A;  3N8L A;  1MWR A;  1TDG A;  1DJB A;  4WMC A;  1KGE A;  3B3X A;  5FDH A;  1I5Q A;  4X69 A;  2V1Z A;  4IVK A;  3HLD A;  3WS5 A;  1L0F A;  1YLY A;  1VQQ A;  4MBK A;  4RX3 A;  5CXW A;  3CMZ A;  1U60 A;  3PAG A;  2UWX A;  2EXB A;  4FSF A;  2ZQ9 A;  2DNS A;  3AGF A;  4CJN A;  5FQK A;  1PWC A;  2G2W A;  3ZCZ A;  3C5A A;  1KE4 A;  1K25 A;  4LCM A;  3NY4 A;  5A90 A;  3HVF A;  4JF6 A;  3W4Q A;  1YMS A;  4KZ4 A;  1K57 A;  3HLW A;  5FAT A;  1YQS A;  3NIA A;  4OQH A;  3O3V A;  1FR6 A;  2JE5 A;  2ZQC A;  4N1H A;  3SH7 A;  1W8Q A;  3DW0 A;  4DDY A;  3FKV A;  1MWS A;  2I72 A;  1YT4 A;  4LEN A;  4NET A;  1ESU A;  5I94 A;  3V3R A;  4JBF A;  3VSL A;  2J9O A;  3Q82 A;  5A92 A;  5GHY A;  4L0L A;  1JTG A;  4JF5 A;  2IWC A;  5G18 A;  2CC1 A;  3N8S A;  3WRT A;  5FAS A;  2ZQA A;  1TDL A;  4S2O A;  3CJM A;  4GN2 A;  3MZF A;  2ZM8 A;  1NZU A;  3M2K A;  2ZC6 B;  4ZDX A;  2XLN A;  3IH9 A;  1FCN A;  1G68 A;  3ISG A;  1ONG A;  3EQV A;  5HX9 A;  2HDQ A;  4WEK A;  3M2J A;  4DF6 A;  1NZO A;  1LLB A;  1DJC A;  1DY6 A;  2XH9 A;  3G34 A;  2ZC7 A;  4OPR A;  4OON A;  1CEG A;  5JYP A;  1ZG4 A;  3BFF A;  1KE3 A;  3IT9 A;  4F94 A;  4U0X A;  2X02 A;  2OLU A;  2XD5 A;  1BSG A;  3VMA A;  2FFF B;  4GNU A;  4OPY A;  2XR0 A;  4P0M A;  4QHC A;  5FAP A;  1BUE A;  2Y2G A;  4BJP A;  2WAF A;  3W4O A;  1CI8 A;  3MKF A;  4WYY A;  3I7J A;  3IF6 B;  3PBN A;  2IWD A;  2BLS A;  3VFF A;  2OLV A;  5M1A A;  4JXS A;  5FA7 A;  1E3U D;  1K57 C;  2Y2J A;  3IF5 A;  4XUZ A;  1BLP A;  4B88 A;  3G31 A;  5HL1 A;  1JTD A;  2HP6 A;  1CEF A;  3HLC A;  1KVM A;  1K54 A;  3PAE A;  1LL9 A;  1IYQ A;  5E2G A;  2VGK A;  2RL3 A;  3IXG A;  3HLF A;  1PI4 A;  1E3U A;  1XGI A;  3UE0 A;  4Y0T A;  1RP5 A;  1FCM A;  1BLH A;  1Z6F A;  2ZM2 A;  1H8Y A;  3C4O A;  4IBR A;  1LHY A;  3C7U A;  4S2J A;  5CHM A;  1GHP A;  1E4D A;  2WAD A;  3IF6 A;  2WKE A;  3MFD A;  4E6W A;  2WGW B;  4IBX A;  2H0T A;  4S2K A;  3IWO A;  4GZB A;  2JCH A;  3HUO A;  4O7D A;  4E6X A;  1XXM A;  4JPM A;  4WM9 A;  1K55 A;  3UE3 A;  1NJ4 A;  1O7E A;  2WUQ A;  3LO7 A;  2EFX A;  4BQM A;  5EVI B;  2HDU A;  3OPR A;  1JWP A;  4OLD A;  4LCL A;  3BEB A;  3MBZ A;  1NRF A;  3FKW A;  4GB7 A;  3WS4 A;  4KZB A;  3Q7Z A;  3IHA A;  1GHM A;  1I2W A;  1IKG A;  4EBP A;  4KG5 A;  3BRM A;  3BFC A;  4BD1 A;  5AQB A;  3G35 A;  1J9M A;  2WGW A;  1YLW A;  2IWB A;  5F1F A;  3P09 A;  1W5D A;  4R23 A;  3NBL A;  1S0W A;  5L2F A;  3MXR A;  5CGS A;  4S2L A;  3NI9 A;  3IXH A;  5HFO A;  3NDG A;  2XF3 A;  4QD4 A;  1W7F A;  5FQ9 A;  4RVA A;  2WKI A;  2R9W A;  2X01 A;  4PM5 A;  4EUZ A;  4A5R A;  1ERQ A;  3HRE A;  5EVI A;  4OP5 A;  5FQI A;  4KZ7 A;  3G32 A;  2WYX A;  1KDS A;  1TEM A;  3G4P A;  1BUL A;  3IF6 C;  4HBT A;  3VP4 A;  1IYS A;  2WGV A;  3BLS A;  2WAE A;  5TGF A;  2WGI A;  2WK0 A;  2Y2O A;  3E2K A;  3ZG7 B;  4PPR A;  3OZH A;  3FWL A;  3IXD A;  5HAQ A;  4KEN B;  4U0T A;  4R3B A;  5CER A;  3LY3 A;  4IVI A;  1W79 A;  2Q9N A;  3VSK A;  1BT5 A;  4EQI A;  1MWT A;  2XEP A;  4KG2 A;  1K55 C;  5AQA A;  1ES5 A;  4FH4 A;  2HPB A;  4X68 A;  4N9K A;  1K4E A;  2XFS A;  5EVL A;  5GHZ A;  2JBF A;  4XUX A;  3OPP A;  3V5M A;  3ZG9 B;  4E3L A;  5DTT A;  3SS4 A;  1H5X A;  3VP2 A;  4E3K A;  1YM1 A;  4E3N A;  2ZC4 B;  4ID4 A;  4E3I A;  2Y55 A;  4S2M A;  2Y91 A;  4P85 A;  4JF4 A;  3D4F A;  3FYZ A;  1ES4 A;  3GSG A;  3PBS A;  5DF9 A;  1C3B A;  4D2O A;  3BYD A;  2J8Y A;  4P6B A;  1H8Z A;  2EX6 A;  1ZC2 A;  3IH8 A;  1MY8 A;  4E3M A;  1RGZ A;  3S22 A;  4M3K A;  2ZQ7 A;  4OKP A;  4KG6 A;  2Y2K A;  3P98 A;  2ZQD A;  1CK3 A;  4JXG A;  2Y2I A;  2RCX A;  5HAP A;  2J9P A;  3GR2 A;  3AGD A;  4K0W A;  4GOG A;  1HD8 A;  2EX2 A;  3MKE A;  3OPL A;  2V2F F;  1Q2P A;  3ZG8 B;  3AGE A;  5EVI C;  1GA9 A;  1XKZ A;  4X56 A;  5FQJ A;  1HTZ A;  1W8Y A;  1L0G A;  3VFH A;  3GMW A;  3SOI A;  3SH9 A;  1K6S A;  1SDN A;  4OVD A;  1BZA A;  5KMW A;  1PYY A;  2Z2M B;  5DVA A;  4FD8 A;  1EWZ A;  2A3U A;  2QZ6 A;  2Y2Q A;  3BFD A;  4OQ0 A;  2JC7 A;  2X71 A;  3UN7 A;  1ES3 A;  4OQG A;  4WEJ A;  3HUN A;  4WEL A;  1FCO A;  3ZG0 A;  1FSW A;  2R9X A;  5GLC A;  3Q1F A;  2Y4A A;  1HZO A;  4UA6 A;  1TVF A;  4QY5 A;  3NDE A;  3BEC A;  4RX2 A;  3HLB A;  3N7W A;  4UAA A;  3WS2 A;  5E2F A;  1KDW A;  4C75 A;  4N1X A;  1XGJ A;  5CEC A;  5A91 A;  3A3F A;  5GL9 A;  3UPN A;  1M40 A;  2EX8 A;  1SDE A;  4Z9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...