4N9LA

Crystal structure of beta-lactamse penp_e166s in complex with meropenem
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
256
structure length
256
Chain Sequence
b'DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFSPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Perturbing the General Base Residue Glu166 in the Active Site of Class A beta-Lactamase Leads to Enhanced Carbapenem Binding and Acylation
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase/antibiotic
total genus 93
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4n9lA00
2WKIA 2WGWB 2OV5A 4E3JA 1PYYA 2Y2LA 1FSWA 4JLFA 4KZ3A 4JPMA 1FOFA 3WS1A 3IHAA 2HP5A 4X55A 3FKWA 4Y0UA 1IKGA 4RYEA 4OPQA 3NC8A 3BM6A 5DTSA 4PM9A 1NYMA 3M6HA 1K38A 3V39A 5JYPA 4M3KA 5GLBA 5CEDA 5F83A 1CI9A 4P87A 1KE4A 1YLPA 1NJ4A 2PU4A 4R0QA 3W4QA 4S2PA 5DF8A 4BL2A 1XKZA 5HAIA 1G6AA 1QMEA 3V50A 3ZGAB 3G30A 3PBNA 1SKFA 3BFGA 3OC2A 2ZC7A 3IWIA 1K25A 4K0XA 3Q1FA 4P0MA 5FI2A 3P98A 3PAGA 4KZ7A 5IHVA 2I72A 3AGFA 3ITBA 1RGYA 3QNCA 1BT5A 4GNUA 3BECA 1ERMA 1O07A 2ZC6B 1CEFA 4KZ8A 3FYZA 5FSRA 3OCNA 4S2NC 5KMWA 3A3FA 1GA9A 3N6IA 3Q7VA 4OLDA 5E43A 2JC7A 3EQVA 5EVLA 1KVMA 1PIOA 1PW8A 4EQIA 1YLYA 3NDGA 5FQ9A 4PMAA 4EBLA 3G35A 4FH2A 2ZQ7A 1H5XA 3C4OA 2ZC4B 3IF6C 4S2IA 1GHIA 3UO9A 3BYDA 4OPZA 1E3UA 2A3UA 4E3OA 5BOHA 2WUQA 1NZUA 4HESA 2BG1A 5FI7A 4E3MA 1XA1A 1BZAA 1ESUA 1W8YA 2V2FF 5CRFA 3UY6A 1DJBA 4IBRA 3SS4A 4N9LA 3ZNYA 1L0DA 1XGIA 5GHZA 2EX8A 3A3DA 4OQ0A 4MBHA 3RJUA 1DJAA 1LHYA 4R1GA 5E2GA 3V3SA 4GB7A 3CZDA 4S2LA 4OPYA 4Z9QA 2WAFA 4EV4A 3EQUA 4DE1A 5I94A 1DJCA 1K55A 1NY0A 4XUZA 3WS2A 4F94A 4GD6A 1BLSA 1XP4A 2XF3A 5AQ9A 4DKIA 4Y7PA 3DW0A 1KE0A 1PWGA 2J7VA 1SDEA 4KG5A 3VP0A 2ZM0A 3HLDA 3N8RA 1JTDA 4CPKA 1YLZA 2GDNA 3SS3A 3UE0A 5CTNA 3ZHHA 5U47A 3ZG0A 1H8YA 4JF6A 1SCWA 4IBXA 2XD5A 4YINA 5AQBA 1Y54A 3G2ZA 2R9XA 1HZOA 5EUAA 2EXBA 2XR0A 3PTEA 2XFTA 2R9WA 3VP1A 3WRTA 3ZG9B 4EBPA 4UA7A 3HUMA 1W5DA 1W7FA 3O88A 4JKTA 3M2KA 4OLGA 4PPRA 2Y2QA 3VMAA 4C75A 2IWBA 3IH9A 2A49A 3QHYA 4N9KA 5CHUA 4UAAA 1KVLA 3SH9A 3SOIA 1ESIA 3IXHA 3UPOA 5CXWA 4L0LA 1GCEA 4GKUA 5EOOA 4KG6A 1G68A 5FA7A 3VOZA 1IYPA 1LI9A 3N8LA 1BLCA 3HREA 5DTKA 4U0TA 3QNBA 4PM7A 2ZC3B 3CJMA 1MBLA 3G4PA 1K56D 3WS5A 3NI9A 4OP5A 1CEGA 1E25A 3JYIA 4H8RA 1EWZA 3MKEA 4MNRA 4PM8A 1L0EA 1CK3A 1EROA 5F82A 1CI8A 1L2SA 4E3LA 3O87A 3ZDJA 4GOGA 3MFDA 2G2UA 4LV2A 1WYCA 5FAPA 1TDGA 1ZG6A 3G34A 1TVFA 3FKVA 1FCOA 3MKFA 2Y2KA 5FQKA 3VOYA 2RCXA 1YT4A 4KZ5A 2Q9MA 4S2MA 5CEBA 3BFFA 4U3TA 4E3NA 3UNWA 4DDSA 4JXWA 4KENB 4KG2A 4BENA 1MWRA 3FV7A 3IH8A 3ZG8B 5M18A 2Y2PA 4WBGA 4P85A 1KGFA 3HUNA 3IWOA 4UA9A 5FQQA 4RA7A 3IXGA 4OVDA 5E2HA 3UPPA 1XGJA 3NCKA 2WK0A 5DVAA 5HFOA 5CHMA 5HL1A 2Y2HA 4OOLA 5EVID 4ZDXA 1LL5A 2XH9A 4ZJ3A 4HEFA 1M6KA 5FQMA 4A5RA 4IVIA 3Q7VB 2V1ZA 3OCLA 3OPHA 1ERQA 5GLCA 1I2SA 4NK3A 5HX9A 4R4RA 2HDQA 4QU3A 2DNSA 4B4ZA 1IYOA 5G18A 2PBYA 4Y0OA 4JBFA 2OLVA 5GHYA 4BJPA 2XD1A 1JWZA 5HW3A 3ZG5A 4PM6A 2H0YA 2OSUA 2ZD8A 3E2LA 2HP6A 1RCJA 2FFFB 4ID4A 3HLGA 4X56A 1EI5A 3VP4A 3ZG7B 2ZLYA 5J8XA 1K55C 4OKPA 4WYYA 4LENA 4BL3A 1YMXA 4QHCA 3IXBA 2Y55A 1WYBA 1ONGA 3GRJA 4K0WA 1NYYA 2WKHA 1FR1A 5KSCA 3W4PA 1FCMA 1JWVA 4EUZA 3HLFA 3GTCA 2J9PA 2WYXA 2Y2MA 3DTMA 4RX2A 3UDXA 4N92A 2BLSA 4KQRA 4OH0A 3BEBA 4WEKA 4JXSA 4WEJA 3LCEA 1JWPA 4GDNA 3UPNA 3WS4A 1I5QA 3UDIA 1MWTA 5FI6A 4B88A 4DE3A 1FSYA 2OLUA 1GA0A 1IKIA 1YLWA 2QZ6A 2UWXA 1ONHA 3FZCA 4QY6A 2WGVA 2Y2IA 1BSGA 3D4FA 3DWZA 4QY5A 4X53A 4OQHA 1ALQA 3RXXA 1E4DA 4R23A 4UA6A 4BLMA 2EXAA 1PWDA 5EECA 3O86A 2ZJ9A 5A90A 4MLLA 1ZKJA 4OP8A 3AGDA 5JYOA 5E2EA 1FCNA 3B3XA 5GHXA 4P6BA 3HLBA 3PAEA 1N4OA 4KZ4A 1K57C 1MY8A 2VGKA 3OPRA 2RL3A 3UDFA 3GR2A 3BFEA 3LEZA 4ZAMA 3HLCA 4X69A 4D2OA 4OONA 3ZVTA 1ES5A 1GHPA 4CJNA 1BLHA 3A3EA 3IT9A 3MZDA 1K54A 2P74A 2Y2GA 4MBKA 1PZOA 1FQGA 2Q9NA 3MXRA 4JXVA 4KZ9A 4S2KA 3FWLA 5FDHA 5A92A 3Q82A 5F1GA 2V20A 2Z2LB 4ZJ2A 1IEMA 2WAEA 3UE3A 3BLSA 1PW1A 1VQQA 1HVBA 3CG5A 3N8SA 1K56A 5D3OA 2Y2OA 3C7VA 2EX6A 3ZCZA 2IWDA 1SDNA 1HD8A 2HDRA 3TOIA 2HP9A 1GHMA 1K57A 1LL9A 1DY6A 3GVBA 2DRWA 3A3IA 5HARA 3GV9A 4OOMA 1YLTA 1XA7A 1PWCA 2JBFA 3Q7ZA 4NETA 4WMCD 3SS5A 3W8KA 4PM5A 3C7UA 3VP2A 1AXBA 1PI5A 1Q2QA 3VSLA 3HUOA 4DXCA 4MBFA 1RP5A 2ZMAA 4QB8A 4E6WA 1HTZA 2XQZA 4Y0TA 3BLMA 2EFUA 1NXYA 1XXMA 3HBRA 4S2OA 3VFFA 1SHVA 1YQSA 4RVAA 2ZM2A 4O7DA 3ITAA 1K6RA 5TR7A 1JTGA 4DE0A 3C5AA 2PU2A 3PBTA 3NBLA 2XLNA 3ZNTA 2XK1A 4LV0A 1IYSA 4KQQA 1NRFA 1L0FA 3MXSA 5FAQA 5EPHA 1I2WA 4LCLA 1MWSA 4LV3A 3IXDA 2Y4AA 2J9OA 3WS0A 4X68A 2HDUA 1ZC2A 3S4XA 4E6XA 4YFMA 1KDWA 4GDBA 3PBSA 1K6SA 3OPLA 1WE4A 2ZM8A 3GSGA 3M6BA 3S22A 2VGJA 5FAOA 3UN7A 4DRTA 1W79A 4B4XA 3MZFA 2X71A 3SH8A 3E2KA 1K4FA 3LY4A 1ZG4A 1BULA 3G2YA 4BQMA 1ES3A 4GD8A 2WGWA 3C4PA 3OPPA 2XEPA 2EX2A 5CGSA 3S1YA 4RX3A 2H10A 3A3JA 4UHUA 3WRZA 4HBTA 1J9MA 4Q8IA 4K91A 4WZ4A 3HLWA 2ZQ9A 2EX9A 5HAQA 3VFHA 2EFXA 1C3BA 1Q2PA 3ISGA 2CC1A 2E8IA 2P9VB 5L2FA 1VM1A 4FSFA 1KDSA 1OMEA 3VP3A 3AGEA 2QPNA 4ZTKA 4DE2A 3IQAA 3V5MA 4R3BA 1MKIA 3W4OA 1S6RA 5A93A 5CGXA 4KQOA 1JVJA 1U60A 2FFYA 4X6TA 3DWKA 3PBOA 4U0XA 2HDSA 4FD8A 5CHJA 2HPBA 1K4EA 2JCHA 2XDMA 4JF4A 5DF9A 5CERA 2P9VA 2Y59A 3LO7A 1BTLA 1BUEA 3HLEA 1K54C 2XFSA 2XGNA 4WM9A 3WWXA 4XXRA 1L0GA 1IELA 3V3RA 2WZZA 1KGGA 4HBUA 5CGWA 5GLAA 4DF6A 2C6WB 4BD0A 3ZFZA 3HVFA 3G32A 4FCFA 4KZBA 4QJGA 2DCFA 1KE3A 1RGZA 3N4IA 3RXWA 5DTTA 1TDLA 5EE8A 5M1AA 3MZEA 3BRMA 2JE5A 3OZHA 1Z6FA 5HAPA 1PI4A 3I7JA 1TEMA 2H0TA 3IF6B 1LLBA 3O3VA 3M2JA 1E3UD 2J8YA 4GN2A 1YLJA 1MWUA 3VSKA 1IYQA 1LI0A 1XX2A 2ZC5B 5M19A 4S2NA 4LV1A 4IEDA 4DXBA 2WADA 1N9BA 1MXOA 4JXGA 3SH7A 3TG9A 4EWFA 4EBNA 2X02A 3Q07A 4IVKA 4ZBEA 4JF5A 3IF6A 5FQJA 4MEZA 3G31A 3BFDA 3NDEA 5AQAA 3HL9A 4WZ5C 4WMCA 2ZQ8A 3N7WA 5F1FA 4LCMA 3ZVWA 1S0WA 2WZXA 2G2WA 2H5SA 4KZ6A 4ZJ1A 4FH4A 5CTMA 5EVIC 1YM1A 4OOYA 3UE1A 5FASA 5TGFA 3PBRA 3PBQA 2B5RA 1QMFA 5DF7A 2ZQAA 1H8ZA 4N1HA 4R4SA 4BD1A 4KZAA 3MBZA 2ZQCA 5E2FA 3P09A 1XPBA 5EOEA 5KSHA 1O7EA 3TSGA 4E3IA 1ES4A 3IWQA 5EVIB 4DDYA 4OQGA 2Y2JA 4C3QA 5GLDA 3GQZA 3IF5A 2Y91A 4C6YA 3IHBA 3NIAA 2Z2MB 3Q81A 5FATA 4WZ5A 4GZBA 1YMSA 4OPRA 3NY4A 5TFQA 4S2JA 3BFCA 4N1XA 5GL9A 1ES2A 5A91A 4E3KA 5CECA 2X01A 1KGEA 1BLPA 4OQIA 3GMWA 4XUXA 1W8QA 5EVIA 1M40A 1FR6A 2QMIA 5KZHA 2ZQDA 4QD4A 1NZOA 4WELA 5AQ7A 2C5WB 2WKEA 3LY3A 3CMZA 5FQIA 2Y2NA 4R3JA 1PZPA 1MPLA 2IWCA 2WGIA
chains in the Genus database with same CATH superfamily
1PYYA 3IHAA 3V67A 4X25A 3NC8A 3BM6A 5DTSA 4PM9A 3V39A 5JYPA 2JN7A 2PU4A 3JPUA 1G6AA 3V50A 1UGUA 3T4TA 1SKFA 3EEAA 3OC2A 3IWIA 4YOFA 4WLAA 2GJ3A 3Q1FA 4P0MA 5FI2A 1P97A 5IHVA 3QNCA 3UB5P 1BT5A 4GNUA 4KZ8A 4S2NC 1GA9A 2INWA 1KVMA 1PW8A 4EQIA 5FQ9A 1UWPX 2ZQ7A 4S2IA 1GHIA 3BYDA 1E3UA 2O9CA 4HESA 2BG1A 4KQDA 2M1CA 2V2FF 1ESUA 3S7PA 3ZNYA 1GSVA 1YSPA 1XGIA 4OQ0A 4MBHA 1DJAA 4R1GA 3V3SA 4GB7A 5AVFA 5FDSA 4OPYA 4Z9QA 4DE1A 5FEFA 1XP4A 5AQ9A 5J3WA 1PWGA 1SDEA 3CAXA 3N8RA 1JTDA 3ZHHA 3NULA 1F2KA 1SCWA 3KYZA 1OPXA 5AQBA 5EUAA 3E4QA 4NXBA 2HZ5A 4EBPA 4B93A 4OLGA 4ARZA 2D02A 2NUPC 3IH9A 5FEGA 1W63Q 3BY9A 4AFIA 2B95A 3KO6A 3CWFA 4L0LA 3TE8A 5EOOA 1G68A 3VOZA 1BLCA 4PM7A 2ZC3B 3CJMA 1K56D 4HH2A 4E3LA 2W1TA 1TS6A 2G2UA 4LV2A 3VOLA 3G34A 3FKVA 1FCOA 2OWJA 4IHQA 5DFXA 2ZOHA 3IS2B 3CUEA 4KG2A 1KGFA 5FQQA 3IXGA 1XJ6A 4OVDA 3NCKA 4HP4A 4OOLA 5EVID 3KSGA 4A5RA 1T1AA 1M6KA 2YKFA 4IVIA 3MSHA 1ERQA 2XROA 4NK3A 3T1QB 3LI8A 4BJPA 2PBYA 4BWIA 5HW3A 1JWZA 3ZG5A 2P08A 1PFLA 2H0YA 2OSUA 4JGQA 2HP6A 1ZHHB 5TJJA 3HLGA 3VP4A 1DP6A 3ZG7B 1VETB 4OKPA 5L10A 5EM1A 4R38A 3DTEA 1FCMA 3C8CA 3DTMA 3UDXA 3GECA 1VETA 1XFQA 4OH0A 4EU0A 4JXSA 1JWPA 2VV8A 2PR6A 3UDIA 3EOIA 4UQIM 1MWTA 5FI6A 1FSYA 2QZ6A 4G3KA 1T18A 1Y4OA 1D1JA 2W3GA 2XA7M 5A90A 3AGDA 5JYOA 4MN7A 3B3XA 4P6BA 1OTBA 1N4OA 1MY8A 3OPRA 5K5BA 4XT2B 3UDFA 5A8BA 3CI6A 3HLCA 3A3EA 3MQOA 1XFNA 1XJ4A 4JXVA 1FQGA 4S2KA 3FWLA 4XT2A 4ZJ2A 1IEMA 1HVBA 3CG5A 3E4PA 1K56A 2EX6A 3ZCZA 4HJ4A 1OTIA 1SDNA 1HD8A 3TOIA 2JKFA 4X1LA 1K57A 1DY6A 4DJ3A 4OOMA 1YLTA 4PM5A 3W8KA 3VSLA 4QB8A 1RP5A 2ZMAA 4E6WA 3UMEA 4Y0TA 1NXYA 1XXMA 3HBRA 4O7DA 5TR7A 1JTGA 2W27A 2PU2A 2XLNA 3NOPC 3VV4A 1IYSA 2ZL1B 4LGWA 2VV6A 4LCLA 5HDSA 3LR3A 3WS0A 5HDDA 1CJFA 1KDWA 4GDBA 3PBSA 1OTAA 2J3TC 1S4SA 3LYXA 2VGJA 5HWWA 3BQAA 3LY4A 4CLCB 2PD7A 1ES3A 3C4PA 3OLOA 5MC7A 4UHUA 2ZQ9A 2EFXA 3LGOA 2CC1A 4ZRRA 3VP3A 3AGEA 2QPNA 4ZTKA 2VZWA 4H6JB 5A93A 4KQOA 1LL8A 2BASA 3FG8A 3NJAA 4U0XA 1VEUB 2V1BA 3DBAA 2JCHA 5DF9A 2WKQA 5CERA 5LBRA 3LO7A 3T4QA 3LFVA 1KGGA 2C6WB 4FCFA 1VEUA 2EWVA 1KE3A 2V9AA 2JE5A 4GW9A 5AJGA 3M2JA 1DP9A 2A2LA 4G3WA 4DXBA 3TG9A 4EBNA 3UMDA 3T4JA 2QYBA 3BFDA 5C5KA 4I3AA 4Y13A 2ZQ8A 3N7WA 3ZVWA 1F9IA 3ZYTA 4FH4A 4HJ6A 2JKRM 5FASA 2JKRI 2L4RA 1EW0A 1NLZA 3P09A 1XPBA 5KSHA 3TSGA 3IWQA 4DDYA 4OQGA 3GQZA 4C6YA 2OWHA 5FATA 1YMSA 4OPRA 3NY4A 5GL9A 1ES2A 4XUXA 1K0KA 1IFQA 5HD5A 2ZQDA 4QD4A 1D06A 1S4RA 1TS7A 4O01A 2PDRA 3CMZA 1MPLA 2WKIA 2WGWB 2UV0E 2Y2LA 4JLFA 1FOFA 3FKWA 1K38A 4M4XA 4M3KA 4R0QA 3W4QA 1QMEA 3R7WB 3G30A 3BFGA 4MDZA 4KZ7A 5L8MA 3MF0A 3AGFA 1S67L 2KOIA 3F1PA 3FYZA 4EEUA 5KMWA 3Q7VA 3ZGAB 2IA2A 2JC7A 3EQVA 4F3LB 5KIZA 1YLYA 1XJ2A 4PMAA 3G35A 2VK3A 2ZC4B 3C4OA 3HJKA 3UO9A 3LIAA 5BOHA 1TF1A 4BBUA 2QKPA 3MS6A 1BZAA 4WUJA 2JKGA 3QP8A 3SS4A 4FOFA 4NXGA 3F1OB 1LHYA 4Y5FA 2WAFA 4EV4A 3EQUA 1DJCA 1K55A 1NY0A 5HPIA 4CQHA 4DKIA 2J7VA 4I3JA 3T4KA 3F1OA 4EESA 1YLZA 2GDNA 3ZG0A 3UE0A 5CTNA 5J7EA 4JF6A 1TS8A 4CLCE 1HZOA 2XR0A 2ZMFA 3T12B 2XFTA 3WRTA 4UA7A 3HUMA 4PPRA 4N9KA 5CHUA 3SOIA 1ESIA 3IXHA 4LFUA 3S7QA 1GCEA 3PHYA 5DJTA 3PYPA 3TW8A 3G4PA 3NI9A 3MKEA 3NOUC 5EVEA 1CI8A 2Q0OA 3O87A 3T50A 5FAPA 3MKFA 5CEBA 4KZ5A 3PXPA 4S2MA 3DTIA 4U3TA 3T4OA 4E3NA 4DDSA 1ODVA 3H7WB 3LIDA 4KENB 4DMZA 1MWRA 3BJNA 3IH8A 1BYWA 3OBFA 4RA7A 3VE4A 1XGJA 5DVAA 5HFOA 2Y2HA 4LRXC 4ZJ3A 2PYPA 3H7WA 4QU3A 5G18A 4Y0OA 4JBFA 2XD1A 1GSWA 3L9KA 5HWVA 4ID4A 2HGVA 4Q0IA 3MJQA 1EI5A 1VB6A 5J8XA 4BL3A 4QHCA 3IXBA 2WKHA 1FR1A 3DTKA 3W4PA 3HLFA 3GTCA 4RX2A 2AVXA 2BLSA 4WEKA 3D72A 4P6ZS 3UPNA 1I5QA 1T1CA 4BBTA 4WL9A 4IJGA 2WKPA 2NUTC 3FZCA 4R70A 2DMWA 2QHKA 4X53A 3RXXA 1H8MA 4BLMA 2EXAA 5EECA 4OP8A 3EEHA 3PAEA 4ARZB 1K57C 4X69A 1BLHA 1STZA 4GLQA 3EGXC 2Y2GA 2XRNA 4EXOA 2Q9NA 5FDHA 3MXRA 2VX8A 3Q82A 2V20A 5F1GA 2WAEA 1PW1A 3N8SA 5TBMA 4R3AA 3C7VA 4PKYG 2HDRA 1GHMA 2ZMVA 1LL9A 2W1TB 4NG2A 2JBFA 4NETA 3C7UA 1AXBA 1PI5A 1MZUA 1HTZA 3BLMA 2EFUA 3KSIA 4PAUA 4S2OA 3VFFA 1UWNX 1K6RA 2M7VA 2W3DA 2HJ9C 1L0FA 5HDCA 3CHWP 2ZOIA 5IS1A 4LV3A 2PAVP 2Y4AA 4CLCC 4X1MA 2VLGA 3FPWA 1NWZA 4YFMA 1K6SA 1LSVA 2ZM8A 3M6BA 5FAOA 3UN7A 4DRTA 1W79A 3MZFA 3SH8A 3E2KA 3G2YA 4BQMA 3OPPA 2XEPA 3CPTB 3A3JA 3GDIA 3WRZA 1J9MA 4Q8IA 3NECA 5F5YA 2EX9A 5HAQA 1C3BA 1Q2PA 3ISGA 1P9RA 1VM1A 2FH5A 3CPTA 4II7A 1S6RA 5CGXA 4DJ2A 4X6TA 3DWKA 3PBOA 4MMNA 5EV0A 2HDSA 4FD8A 1BTLA 3HLEA 1K54C 4ME4A 4WM9A 2E8JA 2WZZA 5CGWA 5GLAA 4GJ4A 3HVFA 4FTXA 3RXWA 1TDLA 1LT0A 2H0TA 2L1MA 2J8YA 4GN2A 3CITA 1MWUA 3HJIA 1IYQA 3VSKA 1XX2A 5M19A 4S2NA 4LV1A 2WADA 1W63M 2GX5A 1N9BA 1MXOA 4JXGA 3SH7A 3MFXA 4IVKA 2K2NA 1OJGA 5FQJA 3NDEA 2JKTI 5AQAA 2OAP1 4Y2FA 1JNUA 4LCMA 1S0WA 2W1RA 2G2WA 2WZXA 1XJ3A 3IX8A 5CTMA 4L9EA 2YKHA 3UE1A 2B5RA 1QMFA 2ZQAA 4N1HA 4R4SA 4BD1A 2K7SA 2V1AA 3C2WA 2WKRA 2VJWA 5EOEA 2J80A 4E3IA 5EVIB 2Y2JA 2Y91A 3NIAA 3O5YA 2MJ6A 5J4EA 4WZ5A 3LR0A 4MN5A 4GZBA 1MKMA 5CECA 1KGEA 1BLPA 5EVIA 1W8QA 1M40A 1FR6A 2QMIA 4HQAA 5IU1A 4HJ3A 2PYRA 3WS2A 2IWCA 3A0VA 3WS1A 1GSXA 4JGOA 2HP5A 4X55A 1NYMA 1S1YA 2VGLS 1CI9A 4P87A 1V9ZA 1KE4A 1NJ4A 3BY8A 4BL2A 3H9WA 3E0YA 2ZC7A 1K25A 2EA9A 2KX6A 4YNRA 3P98A 3K3DA 1RGYA 2Z6CA 1O07A 2ZC6B 1CQAA 5FSRA 3OCNA 3A3FA 3N6IA 4OLDA 4Y3IA 1V9YA 2V0UA 1H5XA 3IF6C 3UB6A 4OPZA 4E3OA 2A3UA 2ZBBA 2WUQA 2PD8A 4HI4A 5FI7A 1XA1A 4IBRA 4N9LA 3QP1A 1ACFA 1L0DA 1D7EA 2EX8A 3A3DA 5E2GA 2J3TD 4S2LA 2VV7A 1OTDA 3T1SA 4Y7PA 3DW0A 1OT9A 2OAQ1 3SS3A 3JVVA 1DP8A 4MCWA 2XD5A 3PR6A 4GS9A 1PZPA 4HHDA 2EXBA 3PTEA 4I38A 2R9WA 3ZG9B 1W5DA 1W7FA 4JKTA 5F69A 3M2KA 2Y2QA 4C75A 1J3WA 2W3HA 2IWBA 3QHYA 3SH9A 4UQIS 3UPOA 5CXWA 3W2ZA 4GKUA 5FA7A 2KDKA 3U2AA 1IYPA 1LI9A 1YSQA 1DRMA 4U0TA 3MR0A 3QNBA 1MBLA 3IBRA 2XA7S 4HOIA 4OP5A 1CEGA 1E25A 3JYIA 4MNRA 1EWZA 3UB9A 2EWWA 3K2NA 1CK3A 5F82A 1L2SA 3RFBA 3ZDJA 4GOGA 1ZG6A 1TVFA 1Y28A 2Y2KA 5FQKA 3VOYA 1YT4A 2Q9MA 3UNWA 4JXWA 5M18A 4QPRA 5E2HA 3UPPA 5HL1A 2WK0A 5CHMA 3F1PB 5HAPA 4ZDXA 3Q7VB 1I2SA 5HX9A 4R4RA 2HDQA 1A0KA 2DNSA 1IYOA 4B4ZA 4PM6A 4EEPA 2ZD8A 3E2LA 1NLYA 1RCJA 4X56A 3E98A 4LENA 1YMXA 4I3IA 1WYBA 1ONGA 4K0WA 1MC0A 1NYYA 1SKOA 2QJ7A 2VEAA 5KSCA 2J9PA 2WYXA 4FUWA 4N92A 4KQRA 3BEBA 4GHIA 3H82A 1CF0A 1GA0A 5IT5A 1IKIA 1YLWA 3A0RA 3NOTC 3LR4A 2Y2IA 4QY5A 2I9VA 1ALQA 4R23A 1PWDA 2P04A 3O86A 2BTFP 5GHXA 4KUOA 2VGKA 2RL3A 3KYQA 3GR2A 3BFEA 4ZAMA 3QP5A 4D2OA 4OONA 1ES5A 4CJNA 3IT9A 2W3EA 3T4LA 2P74A 2O0YA 4PKYA 1X0OA 1ZTUA 3UE3A 3BLSA 1OJ5A 5D3OA 3SW1A 2B02A 3D9YA 3CUEC 3MQQA 2DRWA 5HARA 3GV9A 2KLIA 1XA7A 1PWCA 3SS5A 3VP2A 1G28A 5HPFA 3HUOA 4DXCA 4MBFA 1T1BA 3HCYA 3ULFA 2LB9A 5HD3A 2VA0A 3KSFA 1SHVA 3KYEA 2ZM2A 3ITAA 3L7HA 4DE0A 2K31A 3PBTA 5AVEA 2XK1A 4LV0A 3MQ0A 1NRFA 2GZAA 5EPHA 5FAQA 1MWSA 4LRZE 4Q0JA 1ZC2A 4NXEA 1S66L 4RQ9A 4EUVA 3OPLA 3GSGA 1P9WA 3ZQ5A 1K4FA 1BULA 2EX2A 3CLOA 3S1YA 4RX3A 2H10A 1NRJA 5HZHA 3VFHA 2J3WA 2E8IA 5L2FA 1OT6A 5FL3A 1OMEA 2M7UA 4DE2A 3IQAA 2V0WA 3LI9A 1MKIA 3UE6A 3W4OA 3BQ8A 1KOUA 2FFYA 2L0WA 5HSQA 2XDMA 4JF4A 3RH8B 2XGNA 1G5UA 3WWXA 1L0GA 1IELA 3KX0X 4HBUA 4DF6A 3C30A 3G32A 4GCZA 4KZBA 4QJGA 2DCFA 1RGZA 3N4IA 3OZHA 2PT7A 1TEMA 2HF6A 1LLBA 1IOUA 3O3VA 1LI0A 5HL6A 5TBMB 1YAXA 1PNEA 4I5SA 4ZBEA 4JF5A 4WZ5C 5F1FA 4ZJ1A 5EVIC 4OOYA 3PBQA 4I39A 2ACGA 5DF7A 5DFYA 2VGLM 3G6OA 2ZQCA 5E2FA 2XSSA 2PHYA 3TRCA 4C3QA 4Y15A 3IHBA 5F68A 3ICYA 3T4SA 2HV1A 3OOVA 4BBVA 4L9FA 3BFCA 4E3KA 1YPRA 1H0MA 2X01A 3GMWA 5KZHA 5F6AA 4EQ1A 4E04A 2C5WB 3LY3A 1Z09A 2Y2NA 4R3JA 3TJZC 2OV5A 4E3JA 1FSWA 4KZ3A 4JPMA 1N9LA 3NHQA 4HNBA 4Y0UA 1IKGA 4RYEA 4OPQA 4ESPA 3BW6A 3M6HA 5GLBA 5CEDA 5F83A 4WF0A 2O9BA 1YLPA 4S2PA 5DF8A 1XKZA 5HAIA 2VKSA 2FZ0A 4JGRA 3PBNA 4B9OA 3IS2A 4K0XA 2Z6DA 3PAGA 2I72A 3QP6A 3ITBA 3LIFA 2V8FA 3BECA 1ERMA 1CEFA 1VHMA 1T19A 2O9AA 5E43A 5EVLA 1PIOA 3NDGA 1TS0A 4EBLA 4FH2A 3RTYA 2G7UA 3S7NA 1NZUA 4E3MA 3B47A 1W8YA 5CRFA 4YWZA 3UY6A 1DJBA 1OTEA 3LUQA 5GHZA 2Y8HA 4CLCD 3RJUA 3C38A 3CZDA 4Y17A 2H28A 5L09A 2D01A 5I94A 4HY8A 4F94A 4XUZA 4GD6A 1BLSA 2XF3A 1KE0A 2JKTM 4KG5A 3VP0A 2ZM0A 3HLDA 4CPKA 5DKLA 3UB7A 5U47A 2LB5A 4ETXA 1H8YA 2W3FA 3FC7A 1H3QA 4IBXA 4YINA 1Y54A 3G2ZA 2R9XA 3T1RA 3IBJA 1L3LA 4LRYC 3VP1A 3IX4A 3O88A 3VMAA 2A49A 4UEYA 4UAAA 1KVLA 2QWSA 2O99A 3LEQA 4KG6A 3N8LA 3B33A 3HREA 5HWTA 5DTKA 3WS5A 4H8RA 4PM8A 2PR5A 1L0EA 2OOLA 1EROA 1F5MA 4O8GA 5G4YA 3MFDA 1WYCA 1TDGA 5G4ZA 2RCXA 2W0NA 3BFFA 3P7NA 3F1NB 4BENA 3FV7A 3ZG8B 2Y2PA 4WBGA 4P85A 3HUNA 3IWOA 4UA9A 2PBDP 4K08A 3U4LP 1LL5A 2XH9A 4HEFA 5FQMA 2V1ZA 3OCLA 3OPHA 3F1NA 5GLCA 2ZL1A 3K3CA 5GHYA 2OLVA 1P0ZA 2FFFB 2B18A 2ZLYA 1K55C 4WYYA 3EGDC 2Y55A 4KUKA 4CLCA 3A0SA 3GRJA 5L07A 1S1ZA 1JWVA 3QP4A 4EUZA 4MN6A 2Y2MA 2V8CA 3BWLA 4WEJA 3LCEA 4GDNA 3WS4A 3B42A 4B88A 4DE3A 2OLUA 5CX7A 2UWXA 1ONHA 4QY6A 2WGVA 4H6JA 1BSGA 3D4FA 3DWZA 4OQHA 1E4DA 3MXQA 4UA6A 4GS9B 2ZJ9A 4MLLA 1ZKJA 5E2EA 1FCNA 5DJUA 3SZTA 3HLBA 3P01A 4KZ4A 5EM0A 2CMNA 3S7OA 3KSHA 3LEZA 3ZVTA 1GHPA 3JVUA 3MZDA 1K54A 4MBKA 1PZOA 4KZ9A 5A92A 2Z2LB 1F98A 4R6LA 1VQQA 5DKKA 2Y2OA 3R4KA 2IWDA 4ETZA 3D3OA 4HIAA 2HP9A 4IUHA 1FILA 3GVBA 3A3IA 4BMWA 4WMCD 1Q2QA 1G6OA 2P7JA 4NEED 2XQZA 3DAVA 3E4OA 2Y79A 1FIKA 1YQSA 4RVAA 2QJ5A 4QWOA 2GNXA 3C5AA 3LIEA 2HJEA 3FPVA 1TD5A 3NBLA 3LR5A 3ZNTA 4KQQA 3MXSA 1I2WA 3IXDA 4P6ZM 2J9OA 4X68A 2R78A 2HDUA 3S4XA 4E6XA 4D60A 5EFWA 1WE4A 3MMHA 4WN5A 1HLUP 3S22A 4B4XA 4EW7A 2JHEA 2X71A 1ZG4A 1SKOB 3IX3A 4GD8A 2WGWA 5CGSA 4HBTA 4K91A 4WZ4A 3HLWA 5I5LA 4GHIB 3H82B 2P9VB 3LIBA 4FSFA 1KDSA 4PHTA 3V5MA 4R3BA 3R7WA 4EETB 1WA9A 1JVJA 2A24B 1U60A 1N9OA 4Z1WA 5CHJA 2HPBA 1K4EA 2P9VA 2Y59A 1BUEA 2XFSA 4HP9A 4HH3A 4XXRA 3V3RA 4BD0A 2A24A 3ZFZA 5DTTA 4F3LA 5EE8A 5M1AA 3MZEA 1LSWA 1SZVA 3BRMA 1Z6FA 1PI4A 3I7JA 3IF6B 4NXFA 1E3UD 1YLJA 3T1XA 2ZC5B 4IEDA 3LICA 4NKPA 1LSXA 4EWFA 2X02A 3Q07A 2PRFA 3IF6A 3EWKA 4MEZA 3G31A 3HL9A 4WMCA 3UB8A 4JGPA 4LLOB 4O0PA 2H5SA 4KZ6A 4EERA 1AWIA 4LPZA 1YM1A 4L9GA 5TGFA 3PBRA 3QP2A 1H8ZA 4KZAA 3MBZA 4DN0A 1O7EA 1ES4A 1YKDA 5GLDA 3IF5A 1PRQA 2Z2MB 3Q81A 1N9NA 4IUKA 3VE3A 5TFQA 4S2JA 4N1XA 5A91A 4OQIA 4G3VA 1NZOA 4WELA 5AQ7A 4Q0HA 2WKEA 5FQIA 3Q7ZA 2WGIA
chains in the Genus database with same CATH topology
2WKIA 2WGWB 2OV5A 4E3JA 1PYYA 2Y2LA 1FSWA 4JLFA 4KZ3A 4JPMA 1FOFA 3WS1A 3IHAA 2HP5A 4X55A 3FKWA 4Y0UA 1IKGA 4RYEA 4OPQA 3NC8A 3BM6A 5DTSA 4PM9A 1NYMA 3M6HA 1K38A 3V39A 5JYPA 4M3KA 5GLBA 5CEDA 5F83A 1CI9A 4P87A 1KE4A 1YLPA 1NJ4A 2PU4A 4R0QA 3W4QA 4S2PA 5DF8A 4BL2A 1XKZA 5HAIA 1G6AA 1QMEA 3V50A 3ZGAB 3G30A 3PBNA 1SKFA 3BFGA 3OC2A 2ZC7A 3IWIA 1K25A 4K0XA 3Q1FA 4P0MA 5FI2A 3P98A 3PAGA 4KZ7A 5IHVA 2I72A 3AGFA 3ITBA 1RGYA 3QNCA 1BT5A 4GNUA 3BECA 1ERMA 1O07A 2ZC6B 1CEFA 4KZ8A 3FYZA 5FSRA 3OCNA 4S2NC 5KMWA 3A3FA 1GA9A 3N6IA 3Q7VA 4OLDA 5E43A 2JC7A 3EQVA 5EVLA 1KVMA 1PIOA 1PW8A 4EQIA 1YLYA 3NDGA 5FQ9A 4PMAA 4EBLA 3G35A 4FH2A 2ZQ7A 1H5XA 3C4OA 2ZC4B 3IF6C 4S2IA 1GHIA 3UO9A 3BYDA 4OPZA 1E3UA 2A3UA 4E3OA 5BOHA 2WUQA 1NZUA 4HESA 2BG1A 5FI7A 4E3MA 1XA1A 1BZAA 1ESUA 1W8YA 2V2FF 5CRFA 3UY6A 1DJBA 4IBRA 3SS4A 4N9LA 3ZNYA 1L0DA 1XGIA 5GHZA 2EX8A 3A3DA 4OQ0A 4MBHA 3RJUA 1DJAA 1LHYA 4R1GA 5E2GA 3V3SA 4GB7A 3CZDA 4S2LA 4OPYA 4Z9QA 2WAFA 4EV4A 3EQUA 4DE1A 5I94A 1DJCA 1K55A 1NY0A 4XUZA 3WS2A 4F94A 4GD6A 1BLSA 1XP4A 2XF3A 5AQ9A 4DKIA 4Y7PA 3DW0A 1KE0A 1PWGA 2J7VA 1SDEA 4KG5A 3VP0A 2ZM0A 3HLDA 3N8RA 1JTDA 4CPKA 1YLZA 2GDNA 3SS3A 3UE0A 5CTNA 3ZHHA 5U47A 3ZG0A 1H8YA 4JF6A 1SCWA 4IBXA 2XD5A 4YINA 5AQBA 1Y54A 3G2ZA 2R9XA 1HZOA 5EUAA 2EXBA 2XR0A 3PTEA 2XFTA 2R9WA 3VP1A 3WRTA 3ZG9B 4EBPA 4UA7A 3HUMA 1W5DA 1W7FA 3O88A 4JKTA 3M2KA 4OLGA 4PPRA 2Y2QA 3VMAA 4C75A 2IWBA 3IH9A 2A49A 3QHYA 4N9KA 5CHUA 4UAAA 1KVLA 3SH9A 3SOIA 1ESIA 3IXHA 3UPOA 5CXWA 4L0LA 1GCEA 4GKUA 5EOOA 4KG6A 1G68A 5FA7A 3VOZA 1IYPA 1LI9A 3N8LA 1BLCA 3HREA 5DTKA 4U0TA 3QNBA 4PM7A 2ZC3B 3CJMA 1MBLA 3G4PA 1K56D 3WS5A 3NI9A 4OP5A 1CEGA 1E25A 3JYIA 4H8RA 1EWZA 3MKEA 4MNRA 4PM8A 1L0EA 1CK3A 1EROA 5F82A 1CI8A 1L2SA 4E3LA 3O87A 3ZDJA 4GOGA 3MFDA 2G2UA 4LV2A 1WYCA 5FAPA 1TDGA 1ZG6A 3G34A 1TVFA 3FKVA 1FCOA 3MKFA 2Y2KA 5FQKA 3VOYA 2RCXA 1YT4A 4KZ5A 2Q9MA 4S2MA 5CEBA 3BFFA 4U3TA 4E3NA 3UNWA 4DDSA 4JXWA 4KENB 4KG2A 4BENA 1MWRA 3FV7A 3IH8A 3ZG8B 5M18A 2Y2PA 4WBGA 4P85A 1KGFA 3HUNA 3IWOA 4UA9A 5FQQA 4RA7A 3IXGA 4OVDA 5E2HA 3UPPA 1XGJA 3NCKA 2WK0A 5DVAA 5HFOA 5CHMA 5HL1A 2Y2HA 4OOLA 5EVID 4ZDXA 1LL5A 2XH9A 4ZJ3A 4HEFA 1M6KA 5FQMA 4A5RA 4IVIA 3Q7VB 2V1ZA 3OCLA 3OPHA 1ERQA 5GLCA 1I2SA 4NK3A 5HX9A 4R4RA 2HDQA 4QU3A 2DNSA 4B4ZA 1IYOA 5G18A 2PBYA 4Y0OA 4JBFA 2OLVA 5GHYA 4BJPA 2XD1A 1JWZA 5HW3A 3ZG5A 4PM6A 2H0YA 2OSUA 2ZD8A 3E2LA 2HP6A 1RCJA 2FFFB 4ID4A 3HLGA 4X56A 1EI5A 3VP4A 3ZG7B 2ZLYA 5J8XA 1K55C 4OKPA 4WYYA 4LENA 4BL3A 1YMXA 4QHCA 3IXBA 2Y55A 1WYBA 1ONGA 3GRJA 4K0WA 1NYYA 2WKHA 1FR1A 5KSCA 3W4PA 1FCMA 1JWVA 4EUZA 3HLFA 3GTCA 2J9PA 2WYXA 2Y2MA 3DTMA 4RX2A 3UDXA 4N92A 2BLSA 4KQRA 4OH0A 3BEBA 4WEKA 4JXSA 4WEJA 3LCEA 1JWPA 4GDNA 3UPNA 3WS4A 1I5QA 3UDIA 1MWTA 5FI6A 4B88A 4DE3A 1FSYA 2OLUA 1GA0A 1IKIA 1YLWA 2QZ6A 2UWXA 1ONHA 3FZCA 4QY6A 2WGVA 2Y2IA 1BSGA 3D4FA 3DWZA 4QY5A 4X53A 4OQHA 1ALQA 3RXXA 1E4DA 4R23A 4UA6A 4BLMA 2EXAA 1PWDA 5EECA 3O86A 2ZJ9A 5A90A 4MLLA 1ZKJA 4OP8A 3AGDA 5JYOA 5E2EA 1FCNA 3B3XA 5GHXA 4P6BA 3HLBA 3PAEA 1N4OA 4KZ4A 1K57C 1MY8A 2VGKA 3OPRA 2RL3A 3UDFA 3GR2A 3BFEA 3LEZA 4ZAMA 3HLCA 4X69A 4D2OA 4OONA 3ZVTA 1ES5A 1GHPA 4CJNA 1BLHA 3A3EA 3IT9A 3MZDA 1K54A 2P74A 2Y2GA 4MBKA 1PZOA 1FQGA 2Q9NA 3MXRA 4JXVA 4KZ9A 4S2KA 3FWLA 5FDHA 5A92A 3Q82A 5F1GA 2V20A 2Z2LB 4ZJ2A 1IEMA 2WAEA 3UE3A 3BLSA 1PW1A 1VQQA 1HVBA 3CG5A 3N8SA 1K56A 5D3OA 2Y2OA 3C7VA 2EX6A 3ZCZA 2IWDA 1SDNA 1HD8A 2HDRA 3TOIA 2HP9A 1GHMA 1K57A 1LL9A 1DY6A 3GVBA 2DRWA 3A3IA 5HARA 3GV9A 4OOMA 1YLTA 1XA7A 1PWCA 2JBFA 3Q7ZA 4NETA 4WMCD 3SS5A 3W8KA 4PM5A 3C7UA 3VP2A 1AXBA 1PI5A 1Q2QA 3VSLA 3HUOA 4DXCA 4MBFA 1RP5A 2ZMAA 4QB8A 4E6WA 1HTZA 2XQZA 4Y0TA 3BLMA 2EFUA 1NXYA 1XXMA 3HBRA 4S2OA 3VFFA 1SHVA 1YQSA 4RVAA 2ZM2A 4O7DA 3ITAA 1K6RA 5TR7A 1JTGA 4DE0A 3C5AA 2PU2A 3PBTA 3NBLA 2XLNA 3ZNTA 2XK1A 4LV0A 1IYSA 4KQQA 1NRFA 1L0FA 3MXSA 5FAQA 5EPHA 1I2WA 4LCLA 1MWSA 4LV3A 3IXDA 2Y4AA 2J9OA 3WS0A 4X68A 2HDUA 1ZC2A 3S4XA 4E6XA 4YFMA 1KDWA 4GDBA 3PBSA 1K6SA 3OPLA 1WE4A 2ZM8A 3GSGA 3M6BA 3S22A 2VGJA 5FAOA 3UN7A 4DRTA 1W79A 4B4XA 3MZFA 2X71A 3SH8A 3E2KA 1K4FA 3LY4A 1ZG4A 1BULA 3G2YA 4BQMA 1ES3A 4GD8A 2WGWA 3C4PA 3OPPA 2XEPA 2EX2A 5CGSA 3S1YA 4RX3A 2H10A 3A3JA 4UHUA 3WRZA 4HBTA 1J9MA 4Q8IA 4K91A 4WZ4A 3HLWA 2ZQ9A 2EX9A 5HAQA 3VFHA 2EFXA 1C3BA 1Q2PA 3ISGA 2CC1A 2E8IA 2P9VB 5L2FA 1VM1A 4FSFA 1KDSA 1OMEA 3VP3A 3AGEA 2QPNA 4ZTKA 4DE2A 3IQAA 3V5MA 4R3BA 1MKIA 3W4OA 1S6RA 5A93A 5CGXA 4KQOA 1JVJA 1U60A 2FFYA 4X6TA 3DWKA 3PBOA 4U0XA 2HDSA 4FD8A 5CHJA 2HPBA 1K4EA 2JCHA 2XDMA 4JF4A 5DF9A 5CERA 2P9VA 2Y59A 3LO7A 1BTLA 1BUEA 3HLEA 1K54C 2XFSA 2XGNA 4WM9A 3WWXA 4XXRA 1L0GA 1IELA 3V3RA 2WZZA 1KGGA 4HBUA 5CGWA 5GLAA 4DF6A 2C6WB 4BD0A 3ZFZA 3HVFA 3G32A 4FCFA 4KZBA 4QJGA 2DCFA 1KE3A 1RGZA 3N4IA 3RXWA 5DTTA 1TDLA 5EE8A 5M1AA 3MZEA 3BRMA 2JE5A 3OZHA 1Z6FA 5HAPA 1PI4A 3I7JA 1TEMA 2H0TA 3IF6B 1LLBA 3O3VA 3M2JA 1E3UD 2J8YA 4GN2A 1YLJA 1MWUA 3VSKA 1IYQA 1LI0A 1XX2A 2ZC5B 5M19A 4S2NA 4LV1A 4IEDA 4DXBA 2WADA 1N9BA 1MXOA 4JXGA 3SH7A 3TG9A 4EWFA 4EBNA 2X02A 3Q07A 4IVKA 4ZBEA 4JF5A 3IF6A 5FQJA 4MEZA 3G31A 3BFDA 3NDEA 5AQAA 3HL9A 4WZ5C 4WMCA 2ZQ8A 3N7WA 5F1FA 4LCMA 3ZVWA 1S0WA 2WZXA 2G2WA 2H5SA 4KZ6A 4ZJ1A 4FH4A 5CTMA 5EVIC 1YM1A 4OOYA 3UE1A 5FASA 5TGFA 3PBRA 3PBQA 2B5RA 1QMFA 5DF7A 2ZQAA 1H8ZA 4N1HA 4R4SA 4BD1A 4KZAA 3MBZA 2ZQCA 5E2FA 3P09A 1XPBA 5EOEA 5KSHA 1O7EA 3TSGA 4E3IA 1ES4A 3IWQA 5EVIB 4DDYA 4OQGA 2Y2JA 4C3QA 5GLDA 3GQZA 3IF5A 2Y91A 4C6YA 3IHBA 3NIAA 2Z2MB 3Q81A 5FATA 4WZ5A 4GZBA 1YMSA 4OPRA 3NY4A 5TFQA 4S2JA 3BFCA 4N1XA 5GL9A 1ES2A 5A91A 4E3KA 5CECA 2X01A 1KGEA 1BLPA 4OQIA 3GMWA 4XUXA 1W8QA 5EVIA 1M40A 1FR6A 2QMIA 5KZHA 2ZQDA 4QD4A 1NZOA 4WELA 5AQ7A 2C5WB 2WKEA 3LY3A 3CMZA 5FQIA 2Y2NA 4R3JA 1PZPA 1MPLA 2IWCA 2WGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKI A;  2WGW B;  2OV5 A;  4E3J A;  1PYY A;  2Y2L A;  1FSW A;  4JLF A;  4KZ3 A;  4JPM A;  1FOF A;  3WS1 A;  3IHA A;  2HP5 A;  4X55 A;  3FKW A;  4Y0U A;  1IKG A;  4RYE A;  4OPQ A;  3NC8 A;  3BM6 A;  5DTS A;  4PM9 A;  1NYM A;  3M6H A;  1K38 A;  3V39 A;  5JYP A;  4M3K A;  5GLB A;  5CED A;  5F83 A;  1CI9 A;  4P87 A;  1KE4 A;  1YLP A;  1NJ4 A;  2PU4 A;  4R0Q A;  3W4Q A;  4S2P A;  5DF8 A;  4BL2 A;  1XKZ A;  5HAI A;  1G6A A;  1QME A;  3V50 A;  3ZGA B;  3G30 A;  3PBN A;  1SKF A;  3BFG A;  3OC2 A;  2ZC7 A;  3IWI A;  1K25 A;  4K0X A;  3Q1F A;  4P0M A;  5FI2 A;  3P98 A;  3PAG A;  4KZ7 A;  5IHV A;  2I72 A;  3AGF A;  3ITB A;  1RGY A;  3QNC A;  1BT5 A;  4GNU A;  3BEC A;  1ERM A;  1O07 A;  2ZC6 B;  1CEF A;  4KZ8 A;  3FYZ A;  5FSR A;  3OCN A;  4S2N C;  5KMW A;  3A3F A;  1GA9 A;  3N6I A;  3Q7V A;  4OLD A;  5E43 A;  2JC7 A;  3EQV A;  5EVL A;  1KVM A;  1PIO A;  1PW8 A;  4EQI A;  1YLY A;  3NDG A;  5FQ9 A;  4PMA A;  4EBL A;  3G35 A;  4FH2 A;  2ZQ7 A;  1H5X A;  3C4O A;  2ZC4 B;  3IF6 C;  4S2I A;  1GHI A;  3UO9 A;  3BYD A;  4OPZ A;  1E3U A;  2A3U A;  4E3O A;  5BOH A;  2WUQ A;  1NZU A;  4HES A;  2BG1 A;  5FI7 A;  4E3M A;  1XA1 A;  1BZA A;  1ESU A;  1W8Y A;  2V2F F;  5CRF A;  3UY6 A;  1DJB A;  4IBR A;  3SS4 A;  4N9L A;  3ZNY A;  1L0D A;  1XGI A;  5GHZ A;  2EX8 A;  3A3D A;  4OQ0 A;  4MBH A;  3RJU A;  1DJA A;  1LHY A;  4R1G A;  5E2G A;  3V3S A;  4GB7 A;  3CZD A;  4S2L A;  4OPY A;  4Z9Q A;  2WAF A;  4EV4 A;  3EQU A;  4DE1 A;  5I94 A;  1DJC A;  1K55 A;  1NY0 A;  4XUZ A;  3WS2 A;  4F94 A;  4GD6 A;  1BLS A;  1XP4 A;  2XF3 A;  5AQ9 A;  4DKI A;  4Y7P A;  3DW0 A;  1KE0 A;  1PWG A;  2J7V A;  1SDE A;  4KG5 A;  3VP0 A;  2ZM0 A;  3HLD A;  3N8R A;  1JTD A;  4CPK A;  1YLZ A;  2GDN A;  3SS3 A;  3UE0 A;  5CTN A;  3ZHH A;  5U47 A;  3ZG0 A;  1H8Y A;  4JF6 A;  1SCW A;  4IBX A;  2XD5 A;  4YIN A;  5AQB A;  1Y54 A;  3G2Z A;  2R9X A;  1HZO A;  5EUA A;  2EXB A;  2XR0 A;  3PTE A;  2XFT A;  2R9W A;  3VP1 A;  3WRT A;  3ZG9 B;  4EBP A;  4UA7 A;  3HUM A;  1W5D A;  1W7F A;  3O88 A;  4JKT A;  3M2K A;  4OLG A;  4PPR A;  2Y2Q A;  3VMA A;  4C75 A;  2IWB A;  3IH9 A;  2A49 A;  3QHY A;  4N9K A;  5CHU A;  4UAA A;  1KVL A;  3SH9 A;  3SOI A;  1ESI A;  3IXH A;  3UPO A;  5CXW A;  4L0L A;  1GCE A;  4GKU A;  5EOO A;  4KG6 A;  1G68 A;  5FA7 A;  3VOZ A;  1IYP A;  1LI9 A;  3N8L A;  1BLC A;  3HRE A;  5DTK A;  4U0T A;  3QNB A;  4PM7 A;  2ZC3 B;  3CJM A;  1MBL A;  3G4P A;  1K56 D;  3WS5 A;  3NI9 A;  4OP5 A;  1CEG A;  1E25 A;  3JYI A;  4H8R A;  1EWZ A;  3MKE A;  4MNR A;  4PM8 A;  1L0E A;  1CK3 A;  1ERO A;  5F82 A;  1CI8 A;  1L2S A;  4E3L A;  3O87 A;  3ZDJ A;  4GOG A;  3MFD A;  2G2U A;  4LV2 A;  1WYC A;  5FAP A;  1TDG A;  1ZG6 A;  3G34 A;  1TVF A;  3FKV A;  1FCO A;  3MKF A;  2Y2K A;  5FQK A;  3VOY A;  2RCX A;  1YT4 A;  4KZ5 A;  2Q9M A;  4S2M A;  5CEB A;  3BFF A;  4U3T A;  4E3N A;  3UNW A;  4DDS A;  4JXW A;  4KEN B;  4KG2 A;  4BEN A;  1MWR A;  3FV7 A;  3IH8 A;  3ZG8 B;  5M18 A;  2Y2P A;  4WBG A;  4P85 A;  1KGF A;  3HUN A;  3IWO A;  4UA9 A;  5FQQ A;  4RA7 A;  3IXG A;  4OVD A;  5E2H A;  3UPP A;  1XGJ A;  3NCK A;  2WK0 A;  5DVA A;  5HFO A;  5CHM A;  5HL1 A;  2Y2H A;  4OOL A;  5EVI D;  4ZDX A;  1LL5 A;  2XH9 A;  4ZJ3 A;  4HEF A;  1M6K A;  5FQM A;  4A5R A;  4IVI A;  3Q7V B;  2V1Z A;  3OCL A;  3OPH A;  1ERQ A;  5GLC A;  1I2S A;  4NK3 A;  5HX9 A;  4R4R A;  2HDQ A;  4QU3 A;  2DNS A;  4B4Z A;  1IYO A;  5G18 A;  2PBY A;  4Y0O A;  4JBF A;  2OLV A;  5GHY A;  4BJP A;  2XD1 A;  1JWZ A;  5HW3 A;  3ZG5 A;  4PM6 A;  2H0Y A;  2OSU A;  2ZD8 A;  3E2L A;  2HP6 A;  1RCJ A;  2FFF B;  4ID4 A;  3HLG A;  4X56 A;  1EI5 A;  3VP4 A;  3ZG7 B;  2ZLY A;  5J8X A;  1K55 C;  4OKP A;  4WYY A;  4LEN A;  4BL3 A;  1YMX A;  4QHC A;  3IXB A;  2Y55 A;  1WYB A;  1ONG A;  3GRJ A;  4K0W A;  1NYY A;  2WKH A;  1FR1 A;  5KSC A;  3W4P A;  1FCM A;  1JWV A;  4EUZ A;  3HLF A;  3GTC A;  2J9P A;  2WYX A;  2Y2M A;  3DTM A;  4RX2 A;  3UDX A;  4N92 A;  2BLS A;  4KQR A;  4OH0 A;  3BEB A;  4WEK A;  4JXS A;  4WEJ A;  3LCE A;  1JWP A;  4GDN A;  3UPN A;  3WS4 A;  1I5Q A;  3UDI A;  1MWT A;  5FI6 A;  4B88 A;  4DE3 A;  1FSY A;  2OLU A;  1GA0 A;  1IKI A;  1YLW A;  2QZ6 A;  2UWX A;  1ONH A;  3FZC A;  4QY6 A;  2WGV A;  2Y2I A;  1BSG A;  3D4F A;  3DWZ A;  4QY5 A;  4X53 A;  4OQH A;  1ALQ A;  3RXX A;  1E4D A;  4R23 A;  4UA6 A;  4BLM A;  2EXA A;  1PWD A;  5EEC A;  3O86 A;  2ZJ9 A;  5A90 A;  4MLL A;  1ZKJ A;  4OP8 A;  3AGD A;  5JYO A;  5E2E A;  1FCN A;  3B3X A;  5GHX A;  4P6B A;  3HLB A;  3PAE A;  1N4O A;  4KZ4 A;  1K57 C;  1MY8 A;  2VGK A;  3OPR A;  2RL3 A;  3UDF A;  3GR2 A;  3BFE A;  3LEZ A;  4ZAM A;  3HLC A;  4X69 A;  4D2O A;  4OON A;  3ZVT A;  1ES5 A;  1GHP A;  4CJN A;  1BLH A;  3A3E A;  3IT9 A;  3MZD A;  1K54 A;  2P74 A;  2Y2G A;  4MBK A;  1PZO A;  1FQG A;  2Q9N A;  3MXR A;  4JXV A;  4KZ9 A;  4S2K A;  3FWL A;  5FDH A;  5A92 A;  3Q82 A;  5F1G A;  2V20 A;  2Z2L B;  4ZJ2 A;  1IEM A;  2WAE A;  3UE3 A;  3BLS A;  1PW1 A;  1VQQ A;  1HVB A;  3CG5 A;  3N8S A;  1K56 A;  5D3O A;  2Y2O A;  3C7V A;  2EX6 A;  3ZCZ A;  2IWD A;  1SDN A;  1HD8 A;  2HDR A;  3TOI A;  2HP9 A;  1GHM A;  1K57 A;  1LL9 A;  1DY6 A;  3GVB A;  2DRW A;  3A3I A;  5HAR A;  3GV9 A;  4OOM A;  1YLT A;  1XA7 A;  1PWC A;  2JBF A;  3Q7Z A;  4NET A;  4WMC D;  3SS5 A;  3W8K A;  4PM5 A;  3C7U A;  3VP2 A;  1AXB A;  1PI5 A;  1Q2Q A;  3VSL A;  3HUO A;  4DXC A;  4MBF A;  1RP5 A;  2ZMA A;  4QB8 A;  4E6W A;  1HTZ A;  2XQZ A;  4Y0T A;  3BLM A;  2EFU A;  1NXY A;  1XXM A;  3HBR A;  4S2O A;  3VFF A;  1SHV A;  1YQS A;  4RVA A;  2ZM2 A;  4O7D A;  3ITA A;  1K6R A;  5TR7 A;  1JTG A;  4DE0 A;  3C5A A;  2PU2 A;  3PBT A;  3NBL A;  2XLN A;  3ZNT A;  2XK1 A;  4LV0 A;  1IYS A;  4KQQ A;  1NRF A;  1L0F A;  3MXS A;  5FAQ A;  5EPH A;  1I2W A;  4LCL A;  1MWS A;  4LV3 A;  3IXD A;  2Y4A A;  2J9O A;  3WS0 A;  4X68 A;  2HDU A;  1ZC2 A;  3S4X A;  4E6X A;  4YFM A;  1KDW A;  4GDB A;  3PBS A;  1K6S A;  3OPL A;  1WE4 A;  2ZM8 A;  3GSG A;  3M6B A;  3S22 A;  2VGJ A;  5FAO A;  3UN7 A;  4DRT A;  1W79 A;  4B4X A;  3MZF A;  2X71 A;  3SH8 A;  3E2K A;  1K4F A;  3LY4 A;  1ZG4 A;  1BUL A;  3G2Y A;  4BQM A;  1ES3 A;  4GD8 A;  2WGW A;  3C4P A;  3OPP A;  2XEP A;  2EX2 A;  5CGS A;  3S1Y A;  4RX3 A;  2H10 A;  3A3J A;  4UHU A;  3WRZ A;  4HBT A;  1J9M A;  4Q8I A;  4K91 A;  4WZ4 A;  3HLW A;  2ZQ9 A;  2EX9 A;  5HAQ A;  3VFH A;  2EFX A;  1C3B A;  1Q2P A;  3ISG A;  2CC1 A;  2E8I A;  2P9V B;  5L2F A;  1VM1 A;  4FSF A;  1KDS A;  1OME A;  3VP3 A;  3AGE A;  2QPN A;  4ZTK A;  4DE2 A;  3IQA A;  3V5M A;  4R3B A;  1MKI A;  3W4O A;  1S6R A;  5A93 A;  5CGX A;  4KQO A;  1JVJ A;  1U60 A;  2FFY A;  4X6T A;  3DWK A;  3PBO A;  4U0X A;  2HDS A;  4FD8 A;  5CHJ A;  2HPB A;  1K4E A;  2JCH A;  2XDM A;  4JF4 A;  5DF9 A;  5CER A;  2P9V A;  2Y59 A;  3LO7 A;  1BTL A;  1BUE A;  3HLE A;  1K54 C;  2XFS A;  2XGN A;  4WM9 A;  3WWX A;  4XXR A;  1L0G A;  1IEL A;  3V3R A;  2WZZ A;  1KGG A;  4HBU A;  5CGW A;  5GLA A;  4DF6 A;  2C6W B;  4BD0 A;  3ZFZ A;  3HVF A;  3G32 A;  4FCF A;  4KZB A;  4QJG A;  2DCF A;  1KE3 A;  1RGZ A;  3N4I A;  3RXW A;  5DTT A;  1TDL A;  5EE8 A;  5M1A A;  3MZE A;  3BRM A;  2JE5 A;  3OZH A;  1Z6F A;  5HAP A;  1PI4 A;  3I7J A;  1TEM A;  2H0T A;  3IF6 B;  1LLB A;  3O3V A;  3M2J A;  1E3U D;  2J8Y A;  4GN2 A;  1YLJ A;  1MWU A;  3VSK A;  1IYQ A;  1LI0 A;  1XX2 A;  2ZC5 B;  5M19 A;  4S2N A;  4LV1 A;  4IED A;  4DXB A;  2WAD A;  1N9B A;  1MXO A;  4JXG A;  3SH7 A;  3TG9 A;  4EWF A;  4EBN A;  2X02 A;  3Q07 A;  4IVK A;  4ZBE A;  4JF5 A;  3IF6 A;  5FQJ A;  4MEZ A;  3G31 A;  3BFD A;  3NDE A;  5AQA A;  3HL9 A;  4WZ5 C;  4WMC A;  2ZQ8 A;  3N7W A;  5F1F A;  4LCM A;  3ZVW A;  1S0W A;  2WZX A;  2G2W A;  2H5S A;  4KZ6 A;  4ZJ1 A;  4FH4 A;  5CTM A;  5EVI C;  1YM1 A;  4OOY A;  3UE1 A;  5FAS A;  5TGF A;  3PBR A;  3PBQ A;  2B5R A;  1QMF A;  5DF7 A;  2ZQA A;  1H8Z A;  4N1H A;  4R4S A;  4BD1 A;  4KZA A;  3MBZ A;  2ZQC A;  5E2F A;  3P09 A;  1XPB A;  5EOE A;  5KSH A;  1O7E A;  3TSG A;  4E3I A;  1ES4 A;  3IWQ A;  5EVI B;  4DDY A;  4OQG A;  2Y2J A;  4C3Q A;  5GLD A;  3GQZ A;  3IF5 A;  2Y91 A;  4C6Y A;  3IHB A;  3NIA A;  2Z2M B;  3Q81 A;  5FAT A;  4WZ5 A;  4GZB A;  1YMS A;  4OPR A;  3NY4 A;  5TFQ A;  4S2J A;  3BFC A;  4N1X A;  5GL9 A;  1ES2 A;  5A91 A;  4E3K A;  5CEC A;  2X01 A;  1KGE A;  1BLP A;  4OQI A;  3GMW A;  4XUX A;  1W8Q A;  5EVI A;  1M40 A;  1FR6 A;  2QMI A;  5KZH A;  2ZQD A;  4QD4 A;  1NZO A;  4WEL A;  5AQ7 A;  2C5W B;  2WKE A;  3LY3 A;  3CMZ A;  5FQI A;  2Y2N A;  4R3J A;  1PZP A;  1MPL A;  2IWC A;  2WGI A; 
#chains in the Genus database with same CATH topology
 1PYY A;  3IHA A;  3V67 A;  4X25 A;  3NC8 A;  3BM6 A;  5DTS A;  4PM9 A;  3V39 A;  5JYP A;  2JN7 A;  2PU4 A;  3JPU A;  1G6A A;  3V50 A;  1UGU A;  3T4T A;  1SKF A;  3EEA A;  3OC2 A;  3IWI A;  4YOF A;  4WLA A;  2GJ3 A;  3Q1F A;  4P0M A;  5FI2 A;  1P97 A;  5IHV A;  3QNC A;  3UB5 P;  1BT5 A;  4GNU A;  4KZ8 A;  4S2N C;  1GA9 A;  2INW A;  1KVM A;  1PW8 A;  4EQI A;  5FQ9 A;  1UWP X;  2ZQ7 A;  4S2I A;  1GHI A;  3BYD A;  1E3U A;  2O9C A;  4HES A;  2BG1 A;  4KQD A;  2M1C A;  2V2F F;  1ESU A;  3S7P A;  3ZNY A;  1GSV A;  1YSP A;  1XGI A;  4OQ0 A;  4MBH A;  1DJA A;  4R1G A;  3V3S A;  4GB7 A;  5AVF A;  5FDS A;  4OPY A;  4Z9Q A;  4DE1 A;  5FEF A;  1XP4 A;  5AQ9 A;  5J3W A;  1PWG A;  1SDE A;  3CAX A;  3N8R A;  1JTD A;  3ZHH A;  3NUL A;  1F2K A;  1SCW A;  3KYZ A;  1OPX A;  5AQB A;  5EUA A;  3E4Q A;  4NXB A;  2HZ5 A;  4EBP A;  4B93 A;  4OLG A;  4ARZ A;  2D02 A;  2NUP C;  3IH9 A;  5FEG A;  1W63 Q;  3BY9 A;  4AFI A;  2B95 A;  3KO6 A;  3CWF A;  4L0L A;  3TE8 A;  5EOO A;  1G68 A;  3VOZ A;  1BLC A;  4PM7 A;  2ZC3 B;  3CJM A;  1K56 D;  4HH2 A;  4E3L A;  2W1T A;  1TS6 A;  2G2U A;  4LV2 A;  3VOL A;  3G34 A;  3FKV A;  1FCO A;  2OWJ A;  4IHQ A;  5DFX A;  2ZOH A;  3IS2 B;  3CUE A;  4KG2 A;  1KGF A;  5FQQ A;  3IXG A;  1XJ6 A;  4OVD A;  3NCK A;  4HP4 A;  4OOL A;  5EVI D;  3KSG A;  4A5R A;  1T1A A;  1M6K A;  2YKF A;  4IVI A;  3MSH A;  1ERQ A;  2XRO A;  4NK3 A;  3T1Q B;  3LI8 A;  4BJP A;  2PBY A;  4BWI A;  5HW3 A;  1JWZ A;  3ZG5 A;  2P08 A;  1PFL A;  2H0Y A;  2OSU A;  4JGQ A;  2HP6 A;  1ZHH B;  5TJJ A;  3HLG A;  3VP4 A;  1DP6 A;  3ZG7 B;  1VET B;  4OKP A;  5L10 A;  5EM1 A;  4R38 A;  3DTE A;  1FCM A;  3C8C A;  3DTM A;  3UDX A;  3GEC A;  1VET A;  1XFQ A;  4OH0 A;  4EU0 A;  4JXS A;  1JWP A;  2VV8 A;  2PR6 A;  3UDI A;  3EOI A;  4UQI M;  1MWT A;  5FI6 A;  1FSY A;  2QZ6 A;  4G3K A;  1T18 A;  1Y4O A;  1D1J A;  2W3G A;  2XA7 M;  5A90 A;  3AGD A;  5JYO A;  4MN7 A;  3B3X A;  4P6B A;  1OTB A;  1N4O A;  1MY8 A;  3OPR A;  5K5B A;  4XT2 B;  3UDF A;  5A8B A;  3CI6 A;  3HLC A;  3A3E A;  3MQO A;  1XFN A;  1XJ4 A;  4JXV A;  1FQG A;  4S2K A;  3FWL A;  4XT2 A;  4ZJ2 A;  1IEM A;  1HVB A;  3CG5 A;  3E4P A;  1K56 A;  2EX6 A;  3ZCZ A;  4HJ4 A;  1OTI A;  1SDN A;  1HD8 A;  3TOI A;  2JKF A;  4X1L A;  1K57 A;  1DY6 A;  4DJ3 A;  4OOM A;  1YLT A;  4PM5 A;  3W8K A;  3VSL A;  4QB8 A;  1RP5 A;  2ZMA A;  4E6W A;  3UME A;  4Y0T A;  1NXY A;  1XXM A;  3HBR A;  4O7D A;  5TR7 A;  1JTG A;  2W27 A;  2PU2 A;  2XLN A;  3NOP C;  3VV4 A;  1IYS A;  2ZL1 B;  4LGW A;  2VV6 A;  4LCL A;  5HDS A;  3LR3 A;  3WS0 A;  5HDD A;  1CJF A;  1KDW A;  4GDB A;  3PBS A;  1OTA A;  2J3T C;  1S4S A;  3LYX A;  2VGJ A;  5HWW A;  3BQA A;  3LY4 A;  4CLC B;  2PD7 A;  1ES3 A;  3C4P A;  3OLO A;  5MC7 A;  4UHU A;  2ZQ9 A;  2EFX A;  3LGO A;  2CC1 A;  4ZRR A;  3VP3 A;  3AGE A;  2QPN A;  4ZTK A;  2VZW A;  4H6J B;  5A93 A;  4KQO A;  1LL8 A;  2BAS A;  3FG8 A;  3NJA A;  4U0X A;  1VEU B;  2V1B A;  3DBA A;  2JCH A;  5DF9 A;  2WKQ A;  5CER A;  5LBR A;  3LO7 A;  3T4Q A;  3LFV A;  1KGG A;  2C6W B;  4FCF A;  1VEU A;  2EWV A;  1KE3 A;  2V9A A;  2JE5 A;  4GW9 A;  5AJG A;  3M2J A;  1DP9 A;  2A2L A;  4G3W A;  4DXB A;  3TG9 A;  4EBN A;  3UMD A;  3T4J A;  2QYB A;  3BFD A;  5C5K A;  4I3A A;  4Y13 A;  2ZQ8 A;  3N7W A;  3ZVW A;  1F9I A;  3ZYT A;  4FH4 A;  4HJ6 A;  2JKR M;  5FAS A;  2JKR I;  2L4R A;  1EW0 A;  1NLZ A;  3P09 A;  1XPB A;  5KSH A;  3TSG A;  3IWQ A;  4DDY A;  4OQG A;  3GQZ A;  4C6Y A;  2OWH A;  5FAT A;  1YMS A;  4OPR A;  3NY4 A;  5GL9 A;  1ES2 A;  4XUX A;  1K0K A;  1IFQ A;  5HD5 A;  2ZQD A;  4QD4 A;  1D06 A;  1S4R A;  1TS7 A;  4O01 A;  2PDR A;  3CMZ A;  1MPL A;  2WKI A;  2WGW B;  2UV0 E;  2Y2L A;  4JLF A;  1FOF A;  3FKW A;  1K38 A;  4M4X A;  4M3K A;  4R0Q A;  3W4Q A;  1QME A;  3R7W B;  3G30 A;  3BFG A;  4MDZ A;  4KZ7 A;  5L8M A;  3MF0 A;  3AGF A;  1S67 L;  2KOI A;  3F1P A;  3FYZ A;  4EEU A;  5KMW A;  3Q7V A;  3ZGA B;  2IA2 A;  2JC7 A;  3EQV A;  4F3L B;  5KIZ A;  1YLY A;  1XJ2 A;  4PMA A;  3G35 A;  2VK3 A;  2ZC4 B;  3C4O A;  3HJK A;  3UO9 A;  3LIA A;  5BOH A;  1TF1 A;  4BBU A;  2QKP A;  3MS6 A;  1BZA A;  4WUJ A;  2JKG A;  3QP8 A;  3SS4 A;  4FOF A;  4NXG A;  3F1O B;  1LHY A;  4Y5F A;  2WAF A;  4EV4 A;  3EQU A;  1DJC A;  1K55 A;  1NY0 A;  5HPI A;  4CQH A;  4DKI A;  2J7V A;  4I3J A;  3T4K A;  3F1O A;  4EES A;  1YLZ A;  2GDN A;  3ZG0 A;  3UE0 A;  5CTN A;  5J7E A;  4JF6 A;  1TS8 A;  4CLC E;  1HZO A;  2XR0 A;  2ZMF A;  3T12 B;  2XFT A;  3WRT A;  4UA7 A;  3HUM A;  4PPR A;  4N9K A;  5CHU A;  3SOI A;  1ESI A;  3IXH A;  4LFU A;  3S7Q A;  1GCE A;  3PHY A;  5DJT A;  3PYP A;  3TW8 A;  3G4P A;  3NI9 A;  3MKE A;  3NOU C;  5EVE A;  1CI8 A;  2Q0O A;  3O87 A;  3T50 A;  5FAP A;  3MKF A;  5CEB A;  4KZ5 A;  3PXP A;  4S2M A;  3DTI A;  4U3T A;  3T4O A;  4E3N A;  4DDS A;  1ODV A;  3H7W B;  3LID A;  4KEN B;  4DMZ A;  1MWR A;  3BJN A;  3IH8 A;  1BYW A;  3OBF A;  4RA7 A;  3VE4 A;  1XGJ A;  5DVA A;  5HFO A;  2Y2H A;  4LRX C;  4ZJ3 A;  2PYP A;  3H7W A;  4QU3 A;  5G18 A;  4Y0O A;  4JBF A;  2XD1 A;  1GSW A;  3L9K A;  5HWV A;  4ID4 A;  2HGV A;  4Q0I A;  3MJQ A;  1EI5 A;  1VB6 A;  5J8X A;  4BL3 A;  4QHC A;  3IXB A;  2WKH A;  1FR1 A;  3DTK A;  3W4P A;  3HLF A;  3GTC A;  4RX2 A;  2AVX A;  2BLS A;  4WEK A;  3D72 A;  4P6Z S;  3UPN A;  1I5Q A;  1T1C A;  4BBT A;  4WL9 A;  4IJG A;  2WKP A;  2NUT C;  3FZC A;  4R70 A;  2DMW A;  2QHK A;  4X53 A;  3RXX A;  1H8M A;  4BLM A;  2EXA A;  5EEC A;  4OP8 A;  3EEH A;  3PAE A;  4ARZ B;  1K57 C;  4X69 A;  1BLH A;  1STZ A;  4GLQ A;  3EGX C;  2Y2G A;  2XRN A;  4EXO A;  2Q9N A;  5FDH A;  3MXR A;  2VX8 A;  3Q82 A;  2V20 A;  5F1G A;  2WAE A;  1PW1 A;  3N8S A;  5TBM A;  4R3A A;  3C7V A;  4PKY G;  2HDR A;  1GHM A;  2ZMV A;  1LL9 A;  2W1T B;  4NG2 A;  2JBF A;  4NET A;  3C7U A;  1AXB A;  1PI5 A;  1MZU A;  1HTZ A;  3BLM A;  2EFU A;  3KSI A;  4PAU A;  4S2O A;  3VFF A;  1UWN X;  1K6R A;  2M7V A;  2W3D A;  2HJ9 C;  1L0F A;  5HDC A;  3CHW P;  2ZOI A;  5IS1 A;  4LV3 A;  2PAV P;  2Y4A A;  4CLC C;  4X1M A;  2VLG A;  3FPW A;  1NWZ A;  4YFM A;  1K6S A;  1LSV A;  2ZM8 A;  3M6B A;  5FAO A;  3UN7 A;  4DRT A;  1W79 A;  3MZF A;  3SH8 A;  3E2K A;  3G2Y A;  4BQM A;  3OPP A;  2XEP A;  3CPT B;  3A3J A;  3GDI A;  3WRZ A;  1J9M A;  4Q8I A;  3NEC A;  5F5Y A;  2EX9 A;  5HAQ A;  1C3B A;  1Q2P A;  3ISG A;  1P9R A;  1VM1 A;  2FH5 A;  3CPT A;  4II7 A;  1S6R A;  5CGX A;  4DJ2 A;  4X6T A;  3DWK A;  3PBO A;  4MMN A;  5EV0 A;  2HDS A;  4FD8 A;  1BTL A;  3HLE A;  1K54 C;  4ME4 A;  4WM9 A;  2E8J A;  2WZZ A;  5CGW A;  5GLA A;  4GJ4 A;  3HVF A;  4FTX A;  3RXW A;  1TDL A;  1LT0 A;  2H0T A;  2L1M A;  2J8Y A;  4GN2 A;  3CIT A;  1MWU A;  3HJI A;  1IYQ A;  3VSK A;  1XX2 A;  5M19 A;  4S2N A;  4LV1 A;  2WAD A;  1W63 M;  2GX5 A;  1N9B A;  1MXO A;  4JXG A;  3SH7 A;  3MFX A;  4IVK A;  2K2N A;  1OJG A;  5FQJ A;  3NDE A;  2JKT I;  5AQA A;  2OAP 1;  4Y2F A;  1JNU A;  4LCM A;  1S0W A;  2W1R A;  2G2W A;  2WZX A;  1XJ3 A;  3IX8 A;  5CTM A;  4L9E A;  2YKH A;  3UE1 A;  2B5R A;  1QMF A;  2ZQA A;  4N1H A;  4R4S A;  4BD1 A;  2K7S A;  2V1A A;  3C2W A;  2WKR A;  2VJW A;  5EOE A;  2J80 A;  4E3I A;  5EVI B;  2Y2J A;  2Y91 A;  3NIA A;  3O5Y A;  2MJ6 A;  5J4E A;  4WZ5 A;  3LR0 A;  4MN5 A;  4GZB A;  1MKM A;  5CEC A;  1KGE A;  1BLP A;  5EVI A;  1W8Q A;  1M40 A;  1FR6 A;  2QMI A;  4HQA A;  5IU1 A;  4HJ3 A;  2PYR A;  3WS2 A;  2IWC A;  3A0V A;  3WS1 A;  1GSX A;  4JGO A;  2HP5 A;  4X55 A;  1NYM A;  1S1Y A;  2VGL S;  1CI9 A;  4P87 A;  1V9Z A;  1KE4 A;  1NJ4 A;  3BY8 A;  4BL2 A;  3H9W A;  3E0Y A;  2ZC7 A;  1K25 A;  2EA9 A;  2KX6 A;  4YNR A;  3P98 A;  3K3D A;  1RGY A;  2Z6C A;  1O07 A;  2ZC6 B;  1CQA A;  5FSR A;  3OCN A;  3A3F A;  3N6I A;  4OLD A;  4Y3I A;  1V9Y A;  2V0U A;  1H5X A;  3IF6 C;  3UB6 A;  4OPZ A;  4E3O A;  2A3U A;  2ZBB A;  2WUQ A;  2PD8 A;  4HI4 A;  5FI7 A;  1XA1 A;  4IBR A;  4N9L A;  3QP1 A;  1ACF A;  1L0D A;  1D7E A;  2EX8 A;  3A3D A;  5E2G A;  2J3T D;  4S2L A;  2VV7 A;  1OTD A;  3T1S A;  4Y7P A;  3DW0 A;  1OT9 A;  2OAQ 1;  3SS3 A;  3JVV A;  1DP8 A;  4MCW A;  2XD5 A;  3PR6 A;  4GS9 A;  1PZP A;  4HHD A;  2EXB A;  3PTE A;  4I38 A;  2R9W A;  3ZG9 B;  1W5D A;  1W7F A;  4JKT A;  5F69 A;  3M2K A;  2Y2Q A;  4C75 A;  1J3W A;  2W3H A;  2IWB A;  3QHY A;  3SH9 A;  4UQI S;  3UPO A;  5CXW A;  3W2Z A;  4GKU A;  5FA7 A;  2KDK A;  3U2A A;  1IYP A;  1LI9 A;  1YSQ A;  1DRM A;  4U0T A;  3MR0 A;  3QNB A;  1MBL A;  3IBR A;  2XA7 S;  4HOI A;  4OP5 A;  1CEG A;  1E25 A;  3JYI A;  4MNR A;  1EWZ A;  3UB9 A;  2EWW A;  3K2N A;  1CK3 A;  5F82 A;  1L2S A;  3RFB A;  3ZDJ A;  4GOG A;  1ZG6 A;  1TVF A;  1Y28 A;  2Y2K A;  5FQK A;  3VOY A;  1YT4 A;  2Q9M A;  3UNW A;  4JXW A;  5M18 A;  4QPR A;  5E2H A;  3UPP A;  5HL1 A;  2WK0 A;  5CHM A;  3F1P B;  5HAP A;  4ZDX A;  3Q7V B;  1I2S A;  5HX9 A;  4R4R A;  2HDQ A;  1A0K A;  2DNS A;  1IYO A;  4B4Z A;  4PM6 A;  4EEP A;  2ZD8 A;  3E2L A;  1NLY A;  1RCJ A;  4X56 A;  3E98 A;  4LEN A;  1YMX A;  4I3I A;  1WYB A;  1ONG A;  4K0W A;  1MC0 A;  1NYY A;  1SKO A;  2QJ7 A;  2VEA A;  5KSC A;  2J9P A;  2WYX A;  4FUW A;  4N92 A;  4KQR A;  3BEB A;  4GHI A;  3H82 A;  1CF0 A;  1GA0 A;  5IT5 A;  1IKI A;  1YLW A;  3A0R A;  3NOT C;  3LR4 A;  2Y2I A;  4QY5 A;  2I9V A;  1ALQ A;  4R23 A;  1PWD A;  2P04 A;  3O86 A;  2BTF P;  5GHX A;  4KUO A;  2VGK A;  2RL3 A;  3KYQ A;  3GR2 A;  3BFE A;  4ZAM A;  3QP5 A;  4D2O A;  4OON A;  1ES5 A;  4CJN A;  3IT9 A;  2W3E A;  3T4L A;  2P74 A;  2O0Y A;  4PKY A;  1X0O A;  1ZTU A;  3UE3 A;  3BLS A;  1OJ5 A;  5D3O A;  3SW1 A;  2B02 A;  3D9Y A;  3CUE C;  3MQQ A;  2DRW A;  5HAR A;  3GV9 A;  2KLI A;  1XA7 A;  1PWC A;  3SS5 A;  3VP2 A;  1G28 A;  5HPF A;  3HUO A;  4DXC A;  4MBF A;  1T1B A;  3HCY A;  3ULF A;  2LB9 A;  5HD3 A;  2VA0 A;  3KSF A;  1SHV A;  3KYE A;  2ZM2 A;  3ITA A;  3L7H A;  4DE0 A;  2K31 A;  3PBT A;  5AVE A;  2XK1 A;  4LV0 A;  3MQ0 A;  1NRF A;  2GZA A;  5EPH A;  5FAQ A;  1MWS A;  4LRZ E;  4Q0J A;  1ZC2 A;  4NXE A;  1S66 L;  4RQ9 A;  4EUV A;  3OPL A;  3GSG A;  1P9W A;  3ZQ5 A;  1K4F A;  1BUL A;  2EX2 A;  3CLO A;  3S1Y A;  4RX3 A;  2H10 A;  1NRJ A;  5HZH A;  3VFH A;  2J3W A;  2E8I A;  5L2F A;  1OT6 A;  5FL3 A;  1OME A;  2M7U A;  4DE2 A;  3IQA A;  2V0W A;  3LI9 A;  1MKI A;  3UE6 A;  3W4O A;  3BQ8 A;  1KOU A;  2FFY A;  2L0W A;  5HSQ A;  2XDM A;  4JF4 A;  3RH8 B;  2XGN A;  1G5U A;  3WWX A;  1L0G A;  1IEL A;  3KX0 X;  4HBU A;  4DF6 A;  3C30 A;  3G32 A;  4GCZ A;  4KZB A;  4QJG A;  2DCF A;  1RGZ A;  3N4I A;  3OZH A;  2PT7 A;  1TEM A;  2HF6 A;  1LLB A;  1IOU A;  3O3V A;  1LI0 A;  5HL6 A;  5TBM B;  1YAX A;  1PNE A;  4I5S A;  4ZBE A;  4JF5 A;  4WZ5 C;  5F1F A;  4ZJ1 A;  5EVI C;  4OOY A;  3PBQ A;  4I39 A;  2ACG A;  5DF7 A;  5DFY A;  2VGL M;  3G6O A;  2ZQC A;  5E2F A;  2XSS A;  2PHY A;  3TRC A;  4C3Q A;  4Y15 A;  3IHB A;  5F68 A;  3ICY A;  3T4S A;  2HV1 A;  3OOV A;  4BBV A;  4L9F A;  3BFC A;  4E3K A;  1YPR A;  1H0M A;  2X01 A;  3GMW A;  5KZH A;  5F6A A;  4EQ1 A;  4E04 A;  2C5W B;  3LY3 A;  1Z09 A;  2Y2N A;  4R3J A;  3TJZ C;  2OV5 A;  4E3J A;  1FSW A;  4KZ3 A;  4JPM A;  1N9L A;  3NHQ A;  4HNB A;  4Y0U A;  1IKG A;  4RYE A;  4OPQ A;  4ESP A;  3BW6 A;  3M6H A;  5GLB A;  5CED A;  5F83 A;  4WF0 A;  2O9B A;  1YLP A;  4S2P A;  5DF8 A;  1XKZ A;  5HAI A;  2VKS A;  2FZ0 A;  4JGR A;  3PBN A;  4B9O A;  3IS2 A;  4K0X A;  2Z6D A;  3PAG A;  2I72 A;  3QP6 A;  3ITB A;  3LIF A;  2V8F A;  3BEC A;  1ERM A;  1CEF A;  1VHM A;  1T19 A;  2O9A A;  5E43 A;  5EVL A;  1PIO A;  3NDG A;  1TS0 A;  4EBL A;  4FH2 A;  3RTY A;  2G7U A;  3S7N A;  1NZU A;  4E3M A;  3B47 A;  1W8Y A;  5CRF A;  4YWZ A;  3UY6 A;  1DJB A;  1OTE A;  3LUQ A;  5GHZ A;  2Y8H A;  4CLC D;  3RJU A;  3C38 A;  3CZD A;  4Y17 A;  2H28 A;  5L09 A;  2D01 A;  5I94 A;  4HY8 A;  4F94 A;  4XUZ A;  4GD6 A;  1BLS A;  2XF3 A;  1KE0 A;  2JKT M;  4KG5 A;  3VP0 A;  2ZM0 A;  3HLD A;  4CPK A;  5DKL A;  3UB7 A;  5U47 A;  2LB5 A;  4ETX A;  1H8Y A;  2W3F A;  3FC7 A;  1H3Q A;  4IBX A;  4YIN A;  1Y54 A;  3G2Z A;  2R9X A;  3T1R A;  3IBJ A;  1L3L A;  4LRY C;  3VP1 A;  3IX4 A;  3O88 A;  3VMA A;  2A49 A;  4UEY A;  4UAA A;  1KVL A;  2QWS A;  2O99 A;  3LEQ A;  4KG6 A;  3N8L A;  3B33 A;  3HRE A;  5HWT A;  5DTK A;  3WS5 A;  4H8R A;  4PM8 A;  2PR5 A;  1L0E A;  2OOL A;  1ERO A;  1F5M A;  4O8G A;  5G4Y A;  3MFD A;  1WYC A;  1TDG A;  5G4Z A;  2RCX A;  2W0N A;  3BFF A;  3P7N A;  3F1N B;  4BEN A;  3FV7 A;  3ZG8 B;  2Y2P A;  4WBG A;  4P85 A;  3HUN A;  3IWO A;  4UA9 A;  2PBD P;  4K08 A;  3U4L P;  1LL5 A;  2XH9 A;  4HEF A;  5FQM A;  2V1Z A;  3OCL A;  3OPH A;  3F1N A;  5GLC A;  2ZL1 A;  3K3C A;  5GHY A;  2OLV A;  1P0Z A;  2FFF B;  2B18 A;  2ZLY A;  1K55 C;  4WYY A;  3EGD C;  2Y55 A;  4KUK A;  4CLC A;  3A0S A;  3GRJ A;  5L07 A;  1S1Z A;  1JWV A;  3QP4 A;  4EUZ A;  4MN6 A;  2Y2M A;  2V8C A;  3BWL A;  4WEJ A;  3LCE A;  4GDN A;  3WS4 A;  3B42 A;  4B88 A;  4DE3 A;  2OLU A;  5CX7 A;  2UWX A;  1ONH A;  4QY6 A;  2WGV A;  4H6J A;  1BSG A;  3D4F A;  3DWZ A;  4OQH A;  1E4D A;  3MXQ A;  4UA6 A;  4GS9 B;  2ZJ9 A;  4MLL A;  1ZKJ A;  5E2E A;  1FCN A;  5DJU A;  3SZT A;  3HLB A;  3P01 A;  4KZ4 A;  5EM0 A;  2CMN A;  3S7O A;  3KSH A;  3LEZ A;  3ZVT A;  1GHP A;  3JVU A;  3MZD A;  1K54 A;  4MBK A;  1PZO A;  4KZ9 A;  5A92 A;  2Z2L B;  1F98 A;  4R6L A;  1VQQ A;  5DKK A;  2Y2O A;  3R4K A;  2IWD A;  4ETZ A;  3D3O A;  4HIA A;  2HP9 A;  4IUH A;  1FIL A;  3GVB A;  3A3I A;  4BMW A;  4WMC D;  1Q2Q A;  1G6O A;  2P7J A;  4NEE D;  2XQZ A;  3DAV A;  3E4O A;  2Y79 A;  1FIK A;  1YQS A;  4RVA A;  2QJ5 A;  4QWO A;  2GNX A;  3C5A A;  3LIE A;  2HJE A;  3FPV A;  1TD5 A;  3NBL A;  3LR5 A;  3ZNT A;  4KQQ A;  3MXS A;  1I2W A;  3IXD A;  4P6Z M;  2J9O A;  4X68 A;  2R78 A;  2HDU A;  3S4X A;  4E6X A;  4D60 A;  5EFW A;  1WE4 A;  3MMH A;  4WN5 A;  1HLU P;  3S22 A;  4B4X A;  4EW7 A;  2JHE A;  2X71 A;  1ZG4 A;  1SKO B;  3IX3 A;  4GD8 A;  2WGW A;  5CGS A;  4HBT A;  4K91 A;  4WZ4 A;  3HLW A;  5I5L A;  4GHI B;  3H82 B;  2P9V B;  3LIB A;  4FSF A;  1KDS A;  4PHT A;  3V5M A;  4R3B A;  3R7W A;  4EET B;  1WA9 A;  1JVJ A;  2A24 B;  1U60 A;  1N9O A;  4Z1W A;  5CHJ A;  2HPB A;  1K4E A;  2P9V A;  2Y59 A;  1BUE A;  2XFS A;  4HP9 A;  4HH3 A;  4XXR A;  3V3R A;  4BD0 A;  2A24 A;  3ZFZ A;  5DTT A;  4F3L A;  5EE8 A;  5M1A A;  3MZE A;  1LSW A;  1SZV A;  3BRM A;  1Z6F A;  1PI4 A;  3I7J A;  3IF6 B;  4NXF A;  1E3U D;  1YLJ A;  3T1X A;  2ZC5 B;  4IED A;  3LIC A;  4NKP A;  1LSX A;  4EWF A;  2X02 A;  3Q07 A;  2PRF A;  3IF6 A;  3EWK A;  4MEZ A;  3G31 A;  3HL9 A;  4WMC A;  3UB8 A;  4JGP A;  4LLO B;  4O0P A;  2H5S A;  4KZ6 A;  4EER A;  1AWI A;  4LPZ A;  1YM1 A;  4L9G A;  5TGF A;  3PBR A;  3QP2 A;  1H8Z A;  4KZA A;  3MBZ A;  4DN0 A;  1O7E A;  1ES4 A;  1YKD A;  5GLD A;  3IF5 A;  1PRQ A;  2Z2M B;  3Q81 A;  1N9N A;  4IUK A;  3VE3 A;  5TFQ A;  4S2J A;  4N1X A;  5A91 A;  4OQI A;  4G3V A;  1NZO A;  4WEL A;  5AQ7 A;  4Q0H A;  2WKE A;  5FQI A;  3Q7Z A;  2WGI A; 
#chains in the Genus database with same CATH homology
 2WKI A;  2WGW B;  2OV5 A;  4E3J A;  1PYY A;  2Y2L A;  1FSW A;  4JLF A;  4KZ3 A;  4JPM A;  1FOF A;  3WS1 A;  3IHA A;  2HP5 A;  4X55 A;  3FKW A;  4Y0U A;  1IKG A;  4RYE A;  4OPQ A;  3NC8 A;  3BM6 A;  5DTS A;  4PM9 A;  1NYM A;  3M6H A;  1K38 A;  3V39 A;  5JYP A;  4M3K A;  5GLB A;  5CED A;  5F83 A;  1CI9 A;  4P87 A;  1KE4 A;  1YLP A;  1NJ4 A;  2PU4 A;  4R0Q A;  3W4Q A;  4S2P A;  5DF8 A;  4BL2 A;  1XKZ A;  5HAI A;  1G6A A;  1QME A;  3V50 A;  3ZGA B;  3G30 A;  3PBN A;  1SKF A;  3BFG A;  3OC2 A;  2ZC7 A;  3IWI A;  1K25 A;  4K0X A;  3Q1F A;  4P0M A;  5FI2 A;  3P98 A;  3PAG A;  4KZ7 A;  5IHV A;  2I72 A;  3AGF A;  3ITB A;  1RGY A;  3QNC A;  1BT5 A;  4GNU A;  3BEC A;  1ERM A;  1O07 A;  2ZC6 B;  1CEF A;  4KZ8 A;  3FYZ A;  5FSR A;  3OCN A;  4S2N C;  5KMW A;  3A3F A;  1GA9 A;  3N6I A;  3Q7V A;  4OLD A;  5E43 A;  2JC7 A;  3EQV A;  5EVL A;  1KVM A;  1PIO A;  1PW8 A;  4EQI A;  1YLY A;  3NDG A;  5FQ9 A;  4PMA A;  4EBL A;  3G35 A;  4FH2 A;  2ZQ7 A;  1H5X A;  3C4O A;  2ZC4 B;  3IF6 C;  4S2I A;  1GHI A;  3UO9 A;  3BYD A;  4OPZ A;  1E3U A;  2A3U A;  4E3O A;  5BOH A;  2WUQ A;  1NZU A;  4HES A;  2BG1 A;  5FI7 A;  4E3M A;  1XA1 A;  1BZA A;  1ESU A;  1W8Y A;  2V2F F;  5CRF A;  3UY6 A;  1DJB A;  4IBR A;  3SS4 A;  4N9L A;  3ZNY A;  1L0D A;  1XGI A;  5GHZ A;  2EX8 A;  3A3D A;  4OQ0 A;  4MBH A;  3RJU A;  1DJA A;  1LHY A;  4R1G A;  5E2G A;  3V3S A;  4GB7 A;  3CZD A;  4S2L A;  4OPY A;  4Z9Q A;  2WAF A;  4EV4 A;  3EQU A;  4DE1 A;  5I94 A;  1DJC A;  1K55 A;  1NY0 A;  4XUZ A;  3WS2 A;  4F94 A;  4GD6 A;  1BLS A;  1XP4 A;  2XF3 A;  5AQ9 A;  4DKI A;  4Y7P A;  3DW0 A;  1KE0 A;  1PWG A;  2J7V A;  1SDE A;  4KG5 A;  3VP0 A;  2ZM0 A;  3HLD A;  3N8R A;  1JTD A;  4CPK A;  1YLZ A;  2GDN A;  3SS3 A;  3UE0 A;  5CTN A;  3ZHH A;  5U47 A;  3ZG0 A;  1H8Y A;  4JF6 A;  1SCW A;  4IBX A;  2XD5 A;  4YIN A;  5AQB A;  1Y54 A;  3G2Z A;  2R9X A;  1HZO A;  5EUA A;  2EXB A;  2XR0 A;  3PTE A;  2XFT A;  2R9W A;  3VP1 A;  3WRT A;  3ZG9 B;  4EBP A;  4UA7 A;  3HUM A;  1W5D A;  1W7F A;  3O88 A;  4JKT A;  3M2K A;  4OLG A;  4PPR A;  2Y2Q A;  3VMA A;  4C75 A;  2IWB A;  3IH9 A;  2A49 A;  3QHY A;  4N9K A;  5CHU A;  4UAA A;  1KVL A;  3SH9 A;  3SOI A;  1ESI A;  3IXH A;  3UPO A;  5CXW A;  4L0L A;  1GCE A;  4GKU A;  5EOO A;  4KG6 A;  1G68 A;  5FA7 A;  3VOZ A;  1IYP A;  1LI9 A;  3N8L A;  1BLC A;  3HRE A;  5DTK A;  4U0T A;  3QNB A;  4PM7 A;  2ZC3 B;  3CJM A;  1MBL A;  3G4P A;  1K56 D;  3WS5 A;  3NI9 A;  4OP5 A;  1CEG A;  1E25 A;  3JYI A;  4H8R A;  1EWZ A;  3MKE A;  4MNR A;  4PM8 A;  1L0E A;  1CK3 A;  1ERO A;  5F82 A;  1CI8 A;  1L2S A;  4E3L A;  3O87 A;  3ZDJ A;  4GOG A;  3MFD A;  2G2U A;  4LV2 A;  1WYC A;  5FAP A;  1TDG A;  1ZG6 A;  3G34 A;  1TVF A;  3FKV A;  1FCO A;  3MKF A;  2Y2K A;  5FQK A;  3VOY A;  2RCX A;  1YT4 A;  4KZ5 A;  2Q9M A;  4S2M A;  5CEB A;  3BFF A;  4U3T A;  4E3N A;  3UNW A;  4DDS A;  4JXW A;  4KEN B;  4KG2 A;  4BEN A;  1MWR A;  3FV7 A;  3IH8 A;  3ZG8 B;  5M18 A;  2Y2P A;  4WBG A;  4P85 A;  1KGF A;  3HUN A;  3IWO A;  4UA9 A;  5FQQ A;  4RA7 A;  3IXG A;  4OVD A;  5E2H A;  3UPP A;  1XGJ A;  3NCK A;  2WK0 A;  5DVA A;  5HFO A;  5CHM A;  5HL1 A;  2Y2H A;  4OOL A;  5EVI D;  4ZDX A;  1LL5 A;  2XH9 A;  4ZJ3 A;  4HEF A;  1M6K A;  5FQM A;  4A5R A;  4IVI A;  3Q7V B;  2V1Z A;  3OCL A;  3OPH A;  1ERQ A;  5GLC A;  1I2S A;  4NK3 A;  5HX9 A;  4R4R A;  2HDQ A;  4QU3 A;  2DNS A;  4B4Z A;  1IYO A;  5G18 A;  2PBY A;  4Y0O A;  4JBF A;  2OLV A;  5GHY A;  4BJP A;  2XD1 A;  1JWZ A;  5HW3 A;  3ZG5 A;  4PM6 A;  2H0Y A;  2OSU A;  2ZD8 A;  3E2L A;  2HP6 A;  1RCJ A;  2FFF B;  4ID4 A;  3HLG A;  4X56 A;  1EI5 A;  3VP4 A;  3ZG7 B;  2ZLY A;  5J8X A;  1K55 C;  4OKP A;  4WYY A;  4LEN A;  4BL3 A;  1YMX A;  4QHC A;  3IXB A;  2Y55 A;  1WYB A;  1ONG A;  3GRJ A;  4K0W A;  1NYY A;  2WKH A;  1FR1 A;  5KSC A;  3W4P A;  1FCM A;  1JWV A;  4EUZ A;  3HLF A;  3GTC A;  2J9P A;  2WYX A;  2Y2M A;  3DTM A;  4RX2 A;  3UDX A;  4N92 A;  2BLS A;  4KQR A;  4OH0 A;  3BEB A;  4WEK A;  4JXS A;  4WEJ A;  3LCE A;  1JWP A;  4GDN A;  3UPN A;  3WS4 A;  1I5Q A;  3UDI A;  1MWT A;  5FI6 A;  4B88 A;  4DE3 A;  1FSY A;  2OLU A;  1GA0 A;  1IKI A;  1YLW A;  2QZ6 A;  2UWX A;  1ONH A;  3FZC A;  4QY6 A;  2WGV A;  2Y2I A;  1BSG A;  3D4F A;  3DWZ A;  4QY5 A;  4X53 A;  4OQH A;  1ALQ A;  3RXX A;  1E4D A;  4R23 A;  4UA6 A;  4BLM A;  2EXA A;  1PWD A;  5EEC A;  3O86 A;  2ZJ9 A;  5A90 A;  4MLL A;  1ZKJ A;  4OP8 A;  3AGD A;  5JYO A;  5E2E A;  1FCN A;  3B3X A;  5GHX A;  4P6B A;  3HLB A;  3PAE A;  1N4O A;  4KZ4 A;  1K57 C;  1MY8 A;  2VGK A;  3OPR A;  2RL3 A;  3UDF A;  3GR2 A;  3BFE A;  3LEZ A;  4ZAM A;  3HLC A;  4X69 A;  4D2O A;  4OON A;  3ZVT A;  1ES5 A;  1GHP A;  4CJN A;  1BLH A;  3A3E A;  3IT9 A;  3MZD A;  1K54 A;  2P74 A;  2Y2G A;  4MBK A;  1PZO A;  1FQG A;  2Q9N A;  3MXR A;  4JXV A;  4KZ9 A;  4S2K A;  3FWL A;  5FDH A;  5A92 A;  3Q82 A;  5F1G A;  2V20 A;  2Z2L B;  4ZJ2 A;  1IEM A;  2WAE A;  3UE3 A;  3BLS A;  1PW1 A;  1VQQ A;  1HVB A;  3CG5 A;  3N8S A;  1K56 A;  5D3O A;  2Y2O A;  3C7V A;  2EX6 A;  3ZCZ A;  2IWD A;  1SDN A;  1HD8 A;  2HDR A;  3TOI A;  2HP9 A;  1GHM A;  1K57 A;  1LL9 A;  1DY6 A;  3GVB A;  2DRW A;  3A3I A;  5HAR A;  3GV9 A;  4OOM A;  1YLT A;  1XA7 A;  1PWC A;  2JBF A;  3Q7Z A;  4NET A;  4WMC D;  3SS5 A;  3W8K A;  4PM5 A;  3C7U A;  3VP2 A;  1AXB A;  1PI5 A;  1Q2Q A;  3VSL A;  3HUO A;  4DXC A;  4MBF A;  1RP5 A;  2ZMA A;  4QB8 A;  4E6W A;  1HTZ A;  2XQZ A;  4Y0T A;  3BLM A;  2EFU A;  1NXY A;  1XXM A;  3HBR A;  4S2O A;  3VFF A;  1SHV A;  1YQS A;  4RVA A;  2ZM2 A;  4O7D A;  3ITA A;  1K6R A;  5TR7 A;  1JTG A;  4DE0 A;  3C5A A;  2PU2 A;  3PBT A;  3NBL A;  2XLN A;  3ZNT A;  2XK1 A;  4LV0 A;  1IYS A;  4KQQ A;  1NRF A;  1L0F A;  3MXS A;  5FAQ A;  5EPH A;  1I2W A;  4LCL A;  1MWS A;  4LV3 A;  3IXD A;  2Y4A A;  2J9O A;  3WS0 A;  4X68 A;  2HDU A;  1ZC2 A;  3S4X A;  4E6X A;  4YFM A;  1KDW A;  4GDB A;  3PBS A;  1K6S A;  3OPL A;  1WE4 A;  2ZM8 A;  3GSG A;  3M6B A;  3S22 A;  2VGJ A;  5FAO A;  3UN7 A;  4DRT A;  1W79 A;  4B4X A;  3MZF A;  2X71 A;  3SH8 A;  3E2K A;  1K4F A;  3LY4 A;  1ZG4 A;  1BUL A;  3G2Y A;  4BQM A;  1ES3 A;  4GD8 A;  2WGW A;  3C4P A;  3OPP A;  2XEP A;  2EX2 A;  5CGS A;  3S1Y A;  4RX3 A;  2H10 A;  3A3J A;  4UHU A;  3WRZ A;  4HBT A;  1J9M A;  4Q8I A;  4K91 A;  4WZ4 A;  3HLW A;  2ZQ9 A;  2EX9 A;  5HAQ A;  3VFH A;  2EFX A;  1C3B A;  1Q2P A;  3ISG A;  2CC1 A;  2E8I A;  2P9V B;  5L2F A;  1VM1 A;  4FSF A;  1KDS A;  1OME A;  3VP3 A;  3AGE A;  2QPN A;  4ZTK A;  4DE2 A;  3IQA A;  3V5M A;  4R3B A;  1MKI A;  3W4O A;  1S6R A;  5A93 A;  5CGX A;  4KQO A;  1JVJ A;  1U60 A;  2FFY A;  4X6T A;  3DWK A;  3PBO A;  4U0X A;  2HDS A;  4FD8 A;  5CHJ A;  2HPB A;  1K4E A;  2JCH A;  2XDM A;  4JF4 A;  5DF9 A;  5CER A;  2P9V A;  2Y59 A;  3LO7 A;  1BTL A;  1BUE A;  3HLE A;  1K54 C;  2XFS A;  2XGN A;  4WM9 A;  3WWX A;  4XXR A;  1L0G A;  1IEL A;  3V3R A;  2WZZ A;  1KGG A;  4HBU A;  5CGW A;  5GLA A;  4DF6 A;  2C6W B;  4BD0 A;  3ZFZ A;  3HVF A;  3G32 A;  4FCF A;  4KZB A;  4QJG A;  2DCF A;  1KE3 A;  1RGZ A;  3N4I A;  3RXW A;  5DTT A;  1TDL A;  5EE8 A;  5M1A A;  3MZE A;  3BRM A;  2JE5 A;  3OZH A;  1Z6F A;  5HAP A;  1PI4 A;  3I7J A;  1TEM A;  2H0T A;  3IF6 B;  1LLB A;  3O3V A;  3M2J A;  1E3U D;  2J8Y A;  4GN2 A;  1YLJ A;  1MWU A;  3VSK A;  1IYQ A;  1LI0 A;  1XX2 A;  2ZC5 B;  5M19 A;  4S2N A;  4LV1 A;  4IED A;  4DXB A;  2WAD A;  1N9B A;  1MXO A;  4JXG A;  3SH7 A;  3TG9 A;  4EWF A;  4EBN A;  2X02 A;  3Q07 A;  4IVK A;  4ZBE A;  4JF5 A;  3IF6 A;  5FQJ A;  4MEZ A;  3G31 A;  3BFD A;  3NDE A;  5AQA A;  3HL9 A;  4WZ5 C;  4WMC A;  2ZQ8 A;  3N7W A;  5F1F A;  4LCM A;  3ZVW A;  1S0W A;  2WZX A;  2G2W A;  2H5S A;  4KZ6 A;  4ZJ1 A;  4FH4 A;  5CTM A;  5EVI C;  1YM1 A;  4OOY A;  3UE1 A;  5FAS A;  5TGF A;  3PBR A;  3PBQ A;  2B5R A;  1QMF A;  5DF7 A;  2ZQA A;  1H8Z A;  4N1H A;  4R4S A;  4BD1 A;  4KZA A;  3MBZ A;  2ZQC A;  5E2F A;  3P09 A;  1XPB A;  5EOE A;  5KSH A;  1O7E A;  3TSG A;  4E3I A;  1ES4 A;  3IWQ A;  5EVI B;  4DDY A;  4OQG A;  2Y2J A;  4C3Q A;  5GLD A;  3GQZ A;  3IF5 A;  2Y91 A;  4C6Y A;  3IHB A;  3NIA A;  2Z2M B;  3Q81 A;  5FAT A;  4WZ5 A;  4GZB A;  1YMS A;  4OPR A;  3NY4 A;  5TFQ A;  4S2J A;  3BFC A;  4N1X A;  5GL9 A;  1ES2 A;  5A91 A;  4E3K A;  5CEC A;  2X01 A;  1KGE A;  1BLP A;  4OQI A;  3GMW A;  4XUX A;  1W8Q A;  5EVI A;  1M40 A;  1FR6 A;  2QMI A;  5KZH A;  2ZQD A;  4QD4 A;  1NZO A;  4WEL A;  5AQ7 A;  2C5W B;  2WKE A;  3LY3 A;  3CMZ A;  5FQI A;  2Y2N A;  4R3J A;  1PZP A;  1MPL A;  2IWC A;  2WGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...