4DE1A

Ctx-m-9 class a beta-lactamase complexed with compound 18
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
ETSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase
publication title Structure-Based Design of Potent and Ligand-Efficient Inhibitors of CTX-M Class A Beta-Lactamase
pubmed doi rcsb
source organism Escherichia coli
total genus 93
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4de1A00
4XXRA 5F82A 2OLUA 4D2OA 1Q2QA 2Y55A 5FI6A 1WE4A 4KQQA 5GLBA 2OSUA 3MZFA 4MBKA 5FATA 2HDUA 2WGVA 4KZAA 4WZ4A 4N1XA 5TR7A 4R3BA 1MY8A 3UNWA 2Y2HA 3N8LA 3TG9A 4GOGA 3RXXA 2EFUA 4UA6A 4WMCA 5CRFA 4KZ3A 1LI0A 4OPYA 4FCFA 4WZ5A 5FI2A 1BLSA 2ZQ9A 3VP3A 4KQRA 3GV9A 1FOFA 1LLBA 3G30A 1E3UA 1EI5A 1SCWA 3Q82A 5KSCA 5GLDA 3FYZA 2J8YA 2ZJ9A 3VSKA 5F83A 1RGZA 5L2FA 2J9OA 3ITBA 1K55C 2R9WA 1BSGA 2X71A 5U47A 3VP1A 4LCLA 4BQMA 5I94A 3VP4A 2Z2LB 1QMFA 2V1ZA 4QHCA 4S2KA 4H8RA 3HBRA 2RCXA 1KE0A 1VM1A 3VFFA 1K4FA 4B88A 3A3EA 1LHYA 4Y0OA 2EX9A 4ZAMA 5E2GA 1ONGA 3LEZA 5KZHA 2H0TA 1NYMA 1O07A 3C4OA 3VOZA 4JF4A 2J7VA 3HL9A 4KZ5A 2BG1A 4K0XA 4U0XA 2ZM0A 1QMEA 4GKUA 1W8YA 4LV1A 3O86A 5EVIA 5DTSA 5FAQA 1N9BA 3AGDA 4FD8A 3ZG8B 1IYSA 1C3BA 4OKPA 3O88A 1RCJA 5GHXA 4KENB 1ES4A 2IWDA 1K4EA 3NDEA 2R9XA 4S2NA 3S1YA 1RP5A 1IKIA 4ZJ3A 4IBXA 3TSGA 3HLCA 4EUZA 1ESUA 2FFFB 5JYPA 4M3KA 4KZBA 3UN7A 2G2UA 2GDNA 1KDWA 4OPRA 4C3QA 4GN2A 5JYOA 1ZC2A 1Z6FA 3SS5A 1N4OA 1M40A 2I72A 4LV0A 1K6RA 3PAEA 5M18A 4FH2A 3NCKA 4WM9A 1EWZA 1JWZA 1K57C 4CJNA 3PTEA 2UWXA 3GMWA 4U0TA 5E43A 4Q8IA 2H5SA 4E6XA 1YMSA 2H0YA 2ZQDA 5AQ7A 1NZUA 3UE0A 2DNSA 2A3UA 4KQOA 5CTMA 5EOEA 5CERA 4IVKA 5GLAA 1FCNA 3GSGA 3QHYA 3OPHA 1WYBA 2XK1A 1I5QA 4S2PA 4E3LA 1GCEA 3V39A 1YM1A 3M6BA 4GDNA 1MKIA 5D3OA 1BTLA 2Y2LA 3G2ZA 1SDNA 1K56D 3VOYA 4IVIA 1H8ZA 1J9MA 1FSWA 1MWTA 3MXRA 4ZJ1A 4E3KA 2P9VA 3GQZA 4JXWA 4EBPA 4OQGA 4LCMA 4QB8A 4PM5A 1NYYA 3BFEA 4GDBA 1YQSA 3O87A 4RYEA 4PM8A 5EVIB 4KZ8A 4C75A 1G68A 3UPPA 1MWUA 3IHAA 5FQIA 1CK3A 3SS3A 3ZFZA 4OOMA 1W79A 1XGIA 3ZG9B 3N6IA 4JF6A 3HLBA 1L0GA 4A5RA 4OQHA 4X6TA 1YT4A 3EQUA 4C6YA 3Q7VA 4OLDA 2ZC7A 2OV5A 2XFSA 1GHMA 2Y2JA 1PW8A 3VMAA 1PZOA 1PYYA 1L2SA 1K54A 4OH0A 4R3JA 2XLNA 4DF6A 2EX2A 1DJBA 1O7EA 3FKVA 3D4FA 3IH8A 5FAPA 4WEJA 4L0LA 4RA7A 4KG6A 3HUMA 4OONA 3C7UA 3FZCA 2Y2NA 1K25A 3RXWA 3W4QA 2WAEA 1K55A 2ZMAA 4PMAA 3HUOA 4DRTA 1JVJA 1H5XA 3A3IA 2WKHA 4JKTA 5FAOA 5E2EA 1FQGA 1YMXA 4GZBA 4P0MA 3BEBA 1CEGA 4OLGA 3UPOA 1K54C 4GB7A 4HEFA 1TDLA 3ZCZA 5HW3A 3G4PA 4O7DA 2EX8A 1BLCA 2QZ6A 4PPRA 3IH9A 3IWQA 4RX2A 1ONHA 3OPPA 1PIOA 4MLLA 2WGWA 4KZ7A 1PI4A 2P9VB 5TGFA 1IKGA 3OPRA 4MBFA 5DVAA 4UA9A 1XKZA 1LL9A 1BUEA 2WUQA 3IF6B 1K56A 1JWPA 1E4DA 1U60A 4BJPA 1L0DA 5FA7A 4E3MA 4E3JA 1ERQA 5HAQA 2XFTA 2VGJA 4DE0A 2XD5A 3NDGA 2DRWA 3PBSA 4JF5A 2VGKA 4Y0UA 3GRJA 2X02A 3OCLA 4DDYA 1KVMA 3AGEA 3CJMA 1MWSA 3GR2A 2XEPA 3QNBA 1TEMA 1MBLA 3JYIA 3G31A 3Q7VB 4BD1A 2E8IA 2BLSA 4GD8A 3S22A 1KGGA 2XGNA 5EOOA 2CC1A 3A3DA 3SH9A 1S0WA 1HD8A 1XPBA 1XA7A 4OP5A 3SOIA 5A91A 2XDMA 5A92A 4N92A 1K57A 5EE8A 2ZM2A 3AGFA 4P87A 1OMEA 1Y54A 5E2FA 3HLWA 2ZD8A 1M6KA 2Z2MB 4NETA 4ZTKA 1JTGA 5M1AA 2JE5A 3UPNA 5A93A 5EPHA 3NY4A 5F1GA 3FKWA 4KZ6A 3ZNTA 3GTCA 5AQAA 4IBRA 3IXBA 2JCHA 4WBGA 4ZBEA 5IHVA 3GVBA 3HLGA 4N9LA 4QU3A 3WS4A 1KGEA 3DWZA 3WS0A 1YLJA 5HARA 2Y2GA 4LV2A 4MEZA 3V3RA 5FI7A 4U3TA 5DF7A 3ISGA 4BL3A 2OLVA 1EROA 1ZG4A 2IWCA 4NK3A 2Q9MA 3BLSA 2ZC5B 4UHUA 3LCEA 5GLCA 3Q81A 2PU4A 4IEDA 4RX3A 4B4XA 5EUAA 1ESIA 5CXWA 4QY6A 1MWRA 1PWCA 1ES3A 1IYPA 3BRMA 1L0FA 3MKEA 2J9PA 1GA0A 4KZ9A 4S2LA 5GHZA 3ZHHA 3N8RA 4DDSA 3G32A 4LV3A 3SH8A 1YLTA 4CPKA 1SKFA 1KE4A 3HLDA 3ITAA 3LY4A 4R4RA 2XF3A 2G2WA 5TFQA 1NY0A 1ERMA 3ZNYA 2FFYA 1XP4A 1YLZA 3UDFA 4DE2A 2X01A 3BFGA 3IXHA 3E2KA 4DE3A 1W8QA 1LI9A 4PM6A 5FQQA 3PBOA 4DXCA 2HP6A 3Q7ZA 3UE3A 4UA7A 3C5AA 5DF9A 2HP9A 3IF5A 5FSRA 3V50A 4KG5A 4DE1A 2ZQCA 3M6HA 3IHBA 3FWLA 1YLYA 4WELA 1FCMA 1DY6A 3LO7A 1TVFA 1KE3A 1HVBA 3MKFA 4ZJ2A 4X68A 5CTNA 1SHVA 3A3JA 5EECA 2Y91A 1CEFA 1JTDA 4OP8A 4R23A 5J8XA 2C5WB 1KDSA 4E6WA 2XH9A 5HL1A 2HDSA 4Z9QA 1K6SA 3ZDJA 3FV7A 1NJ4A 4OVDA 4R4SA 4BENA 1NXYA 5A90A 3Q1FA 3BFFA 2C6WB 3WRTA 4GNUA 4ID4A 1ALQA 5FDHA 5CHJA 1ES5A 2PBYA 4S2JA 4QY5A 3HLFA 1YLPA 3W4PA 5HAIA 4OOLA 3BM6A 3IWOA 3HVFA 5DTTA 3IF6C 5KMWA 3DWKA 2HDRA 3ZG7B 5CECA 4OOYA 3OCNA 3EQVA 3NBLA 4QJGA 1AXBA 3V3SA 3W4OA 2Y2QA 3MXSA 4S2MA 3ZVTA 4HESA 2IWBA 2HP5A 3WS2A 4E3NA 1XXMA 3N8SA 2WYXA 4FH4A 2QMIA 3PBQA 3C7VA 5HFOA 4E3IA 4EQIA 5KSHA 3MZDA 2Y2OA 2QPNA 1G6AA 2Y59A 5CGXA 1FR6A 1Q2PA 3OZHA 3P98A 3PAGA 4S2OA 1DJCA 1XA1A 3IT9A 1E25A 4KG2A 5FQ9A 3WS5A 2DCFA 1BT5A 1BLPA 2WKIA 3NIAA 5DF8A 3VSLA 5BOHA 3MBZA 2ZQAA 1ZKJA 2WK0A 3RJUA 2ZC3B 1XX2A 1VQQA 1IEMA 4X69A 3I7JA 5FQMA 3UDIA 4EBNA 2Q9NA 3G35A 4E3OA 3SH7A 2WKEA 1BLHA 1NRFA 1ZG6A 3B3XA 5AQ9A 4JXVA 3IXGA 3BECA 2ZLYA 1IELA 4MBHA 4JXSA 4WZ5C 4K0WA 1FR1A 1RGYA 3HLEA 4JBFA 4P85A 2WGIA 1KVLA 1PW1A 5GL9A 2B5RA 3M2JA 3BFCA 4KZ4A 3UO9A 5F1FA 3NI9A 3A3FA 5FQJA 3P09A 1MXOA 5CEDA 5FASA 2JBFA 1H8YA 3LY3A 3O3VA 3WRZA 4EBLA 4Y0TA 4R0QA 4S2IA 1IYQA 1NZOA 3WS1A 3G34A 1L0EA 4XUZA 1MPLA 3VP0A 2ZM8A 3OPLA 3CMZA 4LENA 1W7FA 4YINA 3PBTA 4HBUA 1TDGA 2WGWB 3PBNA 4OPQA 4EWFA 1KGFA 2HPBA 1GA9A 4FSFA 2P74A 3PBRA 4JXGA 1BZAA 3BYDA 1I2WA 2ZQ8A 2RL3A 5EVLA 5CGWA 3CZDA 5CHMA 1FCOA 2WADA 2PU2A 1JWVA 1PWGA 4BD0A 3HREA 3BLMA 3N7WA 4XUXA 2JC7A 2HDQA 2EFXA 1CI8A 3BFDA 2EX6A 5EVIC 3MFDA 4EV4A 2EXAA 1PI5A 2XQZA 1ES2A 2Y2KA 2V20A 1CI9A 3SS4A 3UY6A 3ZGAB 4QD4A 3ZG5A 1HTZA 4MNRA 4HBTA 4DXBA 4PM7A 2A49A 1GHIA 2Y2MA 4OQ0A 4WMCD 3ZG0A 4S2NC 3ZVWA 2XD1A 4R1GA 3TOIA 1S6RA 1PZPA 3OC2A 4YFMA 1E3UD 3E2LA 3UDXA 4WEKA 3UE1A 3G2YA 3DW0A 3N4IA 4OQIA 1W5DA 5HX9A 4N9KA 5HAPA 3VP2A 4X55A 2ZC6B 1GHPA 3M2KA 4X56A 2WAFA 4X53A 5DTKA 4K91A 4F94A 3DTMA 1YLWA 3MZEA 4JPMA 5CGSA 1PWDA 2Y2PA 4DKIA 2Y4AA 3C4PA 4ZDXA 4UAAA 2EXBA 1LL5A 3W8KA 3HUNA 2XR0A 3IF6A 1WYCA 2ZC4B 2H10A 3CG5A 4N1HA 5AQBA 2Y2IA 1IYOA 3Q07A 1FSYA 1I2SA 1SDEA 3S4XA 5G18A 4OPZA 4B4ZA 5CHUA 3NC8A 5EVID 2WZZA 3IQAA 3IWIA 3IXDA 5GHYA 4RVAA 1K38A 3QNCA 4P6BA 3WWXA 2V2FF 5E2HA 5M19A 4BLMA 5CEBA 4Y7PA 1HZOA 4WYYA 3VFHA 4JLFA 5FQKA 2WZXA 1BULA 4PM9A 4BL2A 1XGJA 1DJAA 4GD6A 3V5MA 2ZQ7A
chains in the Genus database with same CATH superfamily
4NXEA 5F82A 2Y55A 4Y5FA 2OSUA 3MZFA 5FATA 4WZ4A 4I5SA 3N8LA 2EFUA 4L9GA 1LI0A 4FCFA 4KQRA 1FOFA 3BQAA 1EI5A 5KSCA 1VHMA 3LIFA 3VSKA 1LL8A 3ITBA 1K55C 1BSGA 5U47A 3VP1A 4BQMA 1QMFA 1N9LA 5TJJA 5E2GA 3LEZA 4JF4A 2J7VA 3HL9A 1S66L 2BG1A 4FOFA 4GKUA 5AJGA 5EM1A 4FD8A 5GHXA 4S2NA 3S1YA 1RP5A 3T4TA 1KOUA 4ZJ3A 4IBXA 3HLCA 4EUZA 5JYPA 1F5MA 2GDNA 1KDWA 2W0NA 3EGDC 3HJKA 1ZC2A 1N4OA 3ZYTA 3PAEA 3KX0X 5FEFA 1EWZA 2OWJA 3T4JA 2H5SA 3EEAA 1YMSA 1NZUA 4HI4A 5EOEA 3QHYA 4E3LA 3M6BA 5D3OA 1BTLA 3UB8A 2B18A 3VOYA 1J9MA 4UQIS 4JXWA 1A0KA 4GLQA 4LCMA 4QB8A 3MF0A 4PM5A 4HQAA 3BFEA 4RYEA 2VV6A 1G68A 1T1BA 1CK3A 3NULA 4OOMA 3CPTB 4MN5A 3N6IA 3HLBA 4OQHA 2M7VA 3EQUA 4C6YA 4OLDA 2ZC7A 2OV5A 1L3LA 1GHMA 2Y2JA 3VMAA 3KSFA 3IX3A 1K54A 3KO6A 2QJ5A 4R3JA 2EX2A 1DJBA 1O7EA 4H6JA 3D4FA 3IH8A 5FAPA 4WEJA 4L0LA 4KG6A 3FZCA 1Y28A 3PR6A 2JKFA 3NOUC 3A3IA 4JKTA 1NLZA 5FAOA 4GZBA 4EUVA 5HDDA 4GB7A 3ZCZA 1S4SA 2JN7A 3DTKA 3OPPA 4WUJA 4KZ7A 1PI4A 1IKGA 3QP6A 3OPRA 4UA9A 1XKZA 5DFXA 4HIAA 1LL9A 2P7JA 1K56A 1S1YA 4E3MA 5HAQA 4DE0A 3CWFA 3NDGA 4YOFA 3PBSA 2X02A 3AGEA 2VEAA 3QNBA 3F1OA 3S22A 4KUOA 3LUQA 2Z6DA 3JPUA 3A3DA 2O0YA 1S0WA 1XFQA 2PD8A 1XPBA 4H6JB 5HWTA 4OP5A 1OPXA 3SOIA 5A91A 2XDMA 5A92A 5EE8A 3AGFA 4P87A 3UB5P 1OMEA 4ZRRA 2P08A 2JE5A 5A93A 3FKWA 3SZTA 4IBRA 2WKPA 5IHVA 3HLGA 3WS4A 3F1NA 3WS0A 5FI7A 4BL3A 3ISGA 2L0WA 3LCEA 1GSWA 4LRZE 5EUAA 3FPWA 4PKYA 5CXWA 4QY6A 1PWCA 2NUTC 3BRMA 1L0FA 2J9PA 4KZ9A 5GHZA 4DDSA 3SH8A 2GX5A 3F1OB 1UWPX 5HDCA 5TFQA 1YLZA 3UDFA 3DBAA 2X01A 3BFGA 3IXHA 5IS1A 4GHIA 4G3VA 4UA7A 2JHEA 5FSRA 4KG5A 5DKLA 4DE1A 2VV7A 2ZMVA 3FWLA 1V9YA 1HVBA 4LPZA 3T4OA 5CTNA 1SHVA 3A3JA 1D7EA 5EECA 1CEFA 4R23A 2HDSA 3ZDJA 4R4SA 4BENA 1P9WA 1NXYA 3BFFA 4EEUA 3NECA 3H82A 2VA0A 2V8FA 4QY5A 3S7PA 4PHTA 2JKGA 3W4PA 4R6LA 3CAXA 3BM6A 1JNUA 5CECA 4LGWA 3EQVA 3V3SA 3MQQA 5EVEA 3WS2A 2JKRI 5KSHA 4E3IA 1G6AA 1DJCA 5FQ9A 2DCFA 2CMNA 3LEQA 3KSHA 5F68A 4BBVA 2ZC3B 1XX2A 4X69A 4E3OA 4JXVA 3BECA 2ZLYA 4JXSA 1GSXA 3IX8A 2K31A 5CX7A 5F1FA 3A3FA 5IU1A 3P09A 2HF6A 4EBLA 4R0QA 1BYWA 2W3DA 3WS1A 1MPLA 2ZM8A 3V67A 4YINA 1TDGA 2WGWB 4PKYG 2HPBA 3ICYA 4HP9A 4FSFA 1W63M 2GJ3A 1LSXA 3RTYA 1TS6A 3HREA 3BLMA 4HHDA 2HDQA 4Z1WA 2EX6A 2EXAA 3RH8B 3SS4A 5KIZA 1IFQA 3ZG5A 1HTZA 4MNRA 1G28A 4OQ0A 3ZVWA 2JKTI 2XD1A 3JVUA 3CLOA 4YFMA 3UDXA 1YAXA 2ZMFA 3N4IA 5HSQA 1G5UA 2KLIA 4WL9A 4XT2A 2ZC6B 5I5LA 3M2KA 3T12B 1YLWA 3IS2B 2Y2PA 5HL6A 4ZDXA 1OTIA 2XR0A 1FILA 2FZ0A 1IYOA 3Q07A 2O9BA 3S4XA 3LIBA 2VGLM 4B4ZA 4L9EA 4UEYA 4IUHA 5E2HA 1HZOA 3IBJA 3FC7A 1DJAA 3TG9A 4B93A 4EU0A 4D2OA 3PHYA 1Q2QA 5FI6A 1WE4A 4KQQA 3UPNA 2HDUA 2WGVA 4KZAA 2QWSA 3UNWA 2Y2HA 2PRFA 4NG2A 4KZ3A 4XT2B 4WZ5A 5FI2A 1E3UA 3CI6A 1SCWA 5GLDA 2J8YA 4QPRA 5F83A 5DJUA 2QYBA 4LCLA 1CJFA 3VP4A 2V1ZA 2O9AA 3HBRA 1ZTUA 1VM1A 3UB7A 3VFFA 1K4FA 4Y0OA 4ZAMA 1ONGA 3BJNA 3VOZA 2YKHA 4KZ5A 3KSIA 4U0XA 2ZM0A 1QMEA 3O86A 5DTSA 4CLCC 5FAQA 3AGDA 4OKPA 3O88A 2IWDA 5HZHA 3G6OA 1OT9A 4C3QA 4OPRA 4GN2A 3B42A 1Z6FA 4LV0A 1M40A 4G3KA 5M18A 5MC7A 1EW0A 4WM9A 1JWZA 1K57C 3GMWA 4K08A 3P7NA 2D01A 2ZQDA 2DNSA 5HWWA 1OTDA 5CTMA 4IVKA 3GSGA 1GCEA 1YM1A 4GDNA 2B02A 2Y2LA 3S7QA 4IVIA 2G7UA 4CLCD 1MWTA 2OAQ1 4AFIA 4OQGA 1OTBA 4O01A 1YQSA 3B47A 4UQIM 4C75A 5FQIA 3TJZC 1T18A 5DFYA 4HP4A 2Y79A 1PW8A 1T1CA 2PYRA 4X1MA 4FUWA 4BBTA 1VEUA 2HJEA 4RA7A 1YSQA 2BTFP 2V0WA 3RXWA 5FDSA 2ZMAA 3FG8A 1H5XA 2WKHA 4P0MA 1SZVA 1XJ6A 3G4PA 4O7DA 2EX8A 1BLCA 3IWQA 1X0OA 4FTXA 4RX2A 1PIOA 4Q0JA 1OT6A 2W3GA 4MBFA 5DVAA 4NEED 2WUQA 1JWPA 1U60A 4BJPA 1L0DA 4E3JA 1ERQA 4EETB 2VGJA 2XD5A 5G4YA 2DRWA 4DDYA 3GRJA 3OCLA 1KVMA 3CJMA 2XEPA 3JYIA 2E8IA 2BLSA 4GD8A 4MN6A 2XGNA 2CC1A 3JVVA 5L07A 1HD8A 2V0UA 1VEUB 4RQ9A 2WKQA 1OTEA 4ETXA 4NETA 2YKFA 2OAP1 5F1GA 3ZNTA 4CQHA 3D3OA 4WBGA 3GVBA 3DWZA 2Y2GA 3DAVA 4MEZA 3UB9A 3V3RA 2OLVA 2B95A 1EROA 2IWCA 4JGPA 4NK3A 2Q9MA 2EWVA 4RX3A 5EFWA 5F5YA 3R4KA 4I3JA 4LRYC 3K3DA 1ES3A 1IYPA 2J80A 4S2LA 1GA0A 4LV3A 2XRNA 4M4XA 4F3LA 3CUEC 1NY0A 2P04A 4DE3A 1W8QA 4PM6A 5FQQA 3Q7ZA 1SKOA 3C5AA 5DF9A 3V50A 2D02A 4WELA 1FCMA 5K5BA 4YWZA 1D1JA 1TVFA 1KE3A 3MKFA 1S1ZA 4ZJ2A 4X68A 3T1RA 2QHKA 2Y91A 4OVDA 1NJ4A 3Q1FA 3ULFA 2XA7M 4ID4A 5HWVA 5FDHA 1OJGA 2PBYA 4S2JA 4HJ4A 5HAIA 3DWKA 3ZG7B 4OOYA 3OCNA 4QJGA 4P6ZM 4F3LB 2Y2QA 3MXSA 4HESA 4JGOA 4E3NA 1XXMA 2QMIA 4EQIA 3W2ZA 3T1XA 3PAGA 3OZHA 4S2OA 3VOLA 1ODVA 1E25A 3WS5A 4WLAA 2WKIA 5DF8A 4LRXC 2OWHA 1VQQA 1IEMA 2Q9NA 3G35A 3EOIA 1BLHA 2J3TC 4I39A 4MBHA 1IELA 3HLEA 4KZ4A 3BFCA 3NI9A 2W3HA 1H8YA 3O3VA 5J7EA 3LI8A 1NZOA 1WA9A 1L0EA 4XUZA 3CMZA 4HBUA 3PBNA 4BBUA 1GA9A 1XJ2A 1BZAA 2ZQ8A 5LBRA 5CGWA 4BD0A 3N7WA 2JC7A 2EFXA 3BFDA 3MFDA 2V20A 3ZGAB 2ZOHA 3H9WA 4QD4A 4HBTA 2Y8HA 1GHIA 4S2NC 2PR6A 4R1GA 4MN7A 4WEKA 5A8BA 3G2YA 4DMZA 5HX9A 4N9KA 5HAPA 3VP2A 2HZ5A 1GHPA 2QJ7A 2WAFA 5DTKA 3A0RA 5CGSA 4HNBA 4WN5A 4DKIA 3C4PA 4UAAA 3C2WA 3MMHA 1FIKA 3F1NB 3IF6A 2XA7S 2HV1A 2H10A 1K0KA 4OPZA 5CHUA 4Y2FA 3IQAA 3IWIA 2DMWA 1K38A 3QP5A 3QNCA 4P6ZS 3MFXA 4P6BA 3WWXA 2V2FF 4KQDA 4Y7PA 4WYYA 2WZXA 4PM9A 5HDSA 1XGJA 4GD6A 4Y13A 4GJ4A 3V5MA 2OLUA 4L9FA 5GLBA 4R3BA 3IBRA 4GHIB 4GOGA 3RXXA 4WMCA 1LSVA 5CRFA 1BLSA 2ZQ9A 2VV8A 3GV9A 1LLBA 4EXOA 4II7A 3CHWP 3H7WA 3FYZA 2ZJ9A 2KDKA 2PYPA 1RGZA 2R9WA 4Y3IA 2X71A 2Z2LB 4S2KA 4QHCA 4H8RA 2R78A 2KX6A 2RCXA 5J3WA 3C38A 1F98A 2M7UA 4B88A 1TS7A 3H82B 3A3EA 1LHYA 2EX9A 5KZHA 2H0TA 1NYMA 3KYZA 4K0XA 4EW7A 1W8YA 5EVIA 4R70A 4EQ1A 1TS0A 1IYSA 1C3BA 1RCJA 1ES4A 3NDEA 2R9XA 2V1BA 4HJ6A 3TSGA 1T19A 5EM0A 3UN7A 3UB6A 5JYOA 1K6RA 4Y17A 4I38A 3PTEA 2UWXA 3LFVA 4CJNA 5E43A 3MS6A 4E6XA 2H0YA 3SW1A 3T4LA 3T1QB 1FCNA 4NKPA 3TW8A 4KUKA 3V39A 4DN0A 1MKIA 2GZAA 3G2ZA 1K56D 3MXRA 4ZJ1A 4R3AA 4E3KA 2P9VA 3GQZA 3O87A 5EVIB 3BQ8A 1MWUA 3SS3A 1D06A 3QP4A 1W63Q 2EWWA 5HPIA 3T1SA 4JF6A 1L0GA 1IOUA 2J3WA 2V9AA 1YT4A 3Q7VA 5DKKA 1PNEA 5TBMA 1PZOA 1L2SA 2JKRM 1MC0A 4OH0A 3QP1A 3FKVA 3TE8A 5F6AA 3HUMA 4OONA 3C7UA 3U4LP 1LT0A 2WAEA 1K55A 2AVXA 4PMAA 3HUOA 3F1PA 4DRTA 1JVJA 5E2EA 1FQGA 1YMXA 4I3IA 4D60A 4OLGA 3UPOA 5HW3A 3BWLA 4PPRA 3IH9A 3LR5A 1NLYA 5TGFA 2P9VB 4ARZA 3A0VA 3FPVA 1E4DA 5FA7A 2XFTA 4HH3A 3EEHA 2VGKA 4JF5A 3GR2A 1MWSA 3Q7VB 4BD1A 4YNRA 3NJAA 2LB5A 5EOOA 5TBMB 4IHQA 5C5KA 2PAVP 3VE4A 1N9OA 4N92A 3ZQ5A 1Y54A 3HLWA 2ZD8A 1M6KA 2Z2MB 4ZTKA 3P01A 1JTGA 1XJ4A 5M1AA 1PFLA 2JKTM 5AQAA 2JCHA 4QU3A 4LV2A 4X1LA 4U3TA 5DF7A 4ARZB 1ZG4A 2VJWA 3BLSA 3LI9A 4IEDA 4B4XA 1MWRA 1S67L 3MKEA 3O5YA 3N8RA 3G32A 1NWZA 4CPKA 3LY4A 4R4RA 2ZOIA 2XF3A 1ERMA 1ACFA 3E2KA 5L8MA 1STZA 1PRQA 3PBOA 5HD5A 1DRMA 3M6HA 1YLYA 3E98A 3LO7A 3LYXA 4Q0IA 5AVEA 4OP8A 1JTDA 1OJ5A 5HL1A 4Z9QA 3K3CA 2W1TA 5A90A 2C6WB 1VB6A 1ALQA 4B9OA 5CHJA 3EGXC 1OTAA 1N9NA 3HLFA 1YLPA 3UMEA 3HVFA 4NXBA 1AXBA 3QP2A 3W4OA 4S2MA 3ZVTA 2IWBA 2HP5A 2INWA 4FH4A 3PBQA 3C7VA 5HFOA 5AVFA 3MZDA 2Y59A 1FR6A 1J3WA 1XA1A 3IT9A 3NOTC 2H28A 1BT5A 1BLPA 5BOHA 3NIAA 1ZKJA 4DJ3A 2V8CA 2WK0A 1H3QA 1NRJA 3UDIA 4EBNA 2WKEA 1ZG6A 3B3XA 5AQ9A 3IXGA 2W1TB 4WZ5C 4K0WA 4IUKA 1RGYA 3D72A 4JBFA 4P85A 2WGIA 5GL9A 1PW1A 2B5RA 4CLCE 2NUPC 1MKMA 2MJ6A 4IJGA 3NOPC 3WRZA 3EWKA 1YKDA 4E04A 4LENA 1W7FA 5J4EA 4EWFA 1KGFA 3CPTA 2P74A 4I3AA 3BY9A 5EVLA 1MZUA 3CZDA 1FCOA 3PXPA 2PU2A 4XUXA 2HGVA 3MSHA 4EV4A 1PI5A 2Y2KA 3UY6A 1CI9A 1F9IA 4PM7A 2A49A 2EA9A 5HD3A 3ZG0A 1E3UD 3DTEA 1P97A 3E2LA 3DW0A 4LFUA 4X55A 2PD7A 4X53A 2L4RA 1HLUP 4K91A 4F94A 3MZEA 1PWDA 2Y4AA 2GNXA 3DTIA 2Q0OA 3GDIA 2ZC4B 3CG5A 4N1HA 2L1MA 2IA2A 3E4PA 5G18A 3OOVA 2WZZA 3IXDA 5GHYA 4RVAA 2E8JA 5M19A 4BLMA 5CEBA 2V1AA 2ACGA 3VFHA 4JLFA 1BULA 4BL2A 3HCYA 1DP9A 4XXRA 1CQAA 3GECA 3LR3A 5TR7A 4MBKA 3K2NA 3MXQA 1DP8A 4GCZA 4N1XA 1MY8A 1SKOB 2K7SA 4UA6A 4LLOB 4OPYA 3VP3A 3D9YA 3IX4A 1P0ZA 3G30A 3Q82A 4EEPA 3E0YA 5L2FA 2J9OA 3C30A 5I94A 4EESA 2I9VA 1KE0A 3R7WA 2XROA 4ETZA 1VETA 1O07A 3C4OA 2O9CA 4QWOA 4PAUA 4LV1A 5L10A 1N9BA 4R38A 3ZG8B 4KENB 3UE6A 2PR5A 3UMDA 1G6OA 1K4EA 2FH5A 3LR0A 2W1RA 3E4OA 1IKIA 1ESUA 2FFFB 3VE3A 4M3KA 4KZBA 2G2UA 1DP6A 4BMWA 3SS5A 2I72A 3C8CA 4FH2A 3RFBA 3NCKA 2J3TD 4U0TA 4Q8IA 5AQ7A 3UE0A 2A3UA 4KQOA 1TF1A 1TS8A 5CERA 4JGQA 5GLAA 4GW9A 3OPHA 1WYBA 2XK1A 1I5QA 4S2PA 3E4QA 1SDNA 3R7WB 1H8ZA 1FSWA 2VK3A 1VETB 3MQOA 4EBPA 4BWIA 2ZBBA 1NYYA 4GDBA 4PM8A 4KZ8A 3UPPA 3IHAA 3ZFZA 1W79A 1XGIA 3ZG9B 3OBFA 4A5RA 4X6TA 5L09A 2XFSA 4JGRA 4Q0HA 1PYYA 2XLNA 4DF6A 1P9RA 3T4KA 2Y2NA 1K25A 3W4QA 4Y15A 2M1CA 3BEBA 1CEGA 1K54C 4HEFA 1TDLA 2QZ6A 2A2LA 3T4SA 1ONHA 4MLLA 5F69A 1F2KA 1S4RA 2WGWA 3BY8A 3LIAA 3LICA 1BUEA 3IF6B 3L9KA 4CLCA 2Z6CA 4Y0UA 1H0MA 5HPFA 1TEMA 1MBLA 4NXFA 3G31A 1H8MA 1KGGA 3SH9A 3U2AA 1XA7A 1K57A 2ZM2A 5E2FA 5EPHA 3NY4A 4KZ6A 3GTCA 3IS2A 3IXBA 2BASA 3KSGA 4ZBEA 4MMNA 4N9LA 2VLGA 2KOIA 1KGEA 1YLJA 5HARA 3H7WB 4MCWA 4ESPA 2PDRA 4WF0A 5GLCA 2ZC5B 4UHUA 3T4QA 2PBDP 1TD5A 3Q81A 2PT7A 1LSWA 2PU4A 1ESIA 4CLCB 3B33A 3ZHHA 1YLTA 1SKFA 1KE4A 3HLDA 3ITAA 4GS9A 2G2WA 1GSVA 3ZNYA 2FFYA 1XP4A 1XFNA 4DE2A 1Z09A 1LI9A 5DJTA 3HJIA 2HP6A 3UE3A 4DXCA 2HP9A 3MQ0A 3IF5A 4DJ2A 2ZQCA 3IHBA 4MDZA 3A0SA 5IT5A 2K2NA 1DY6A 3NHQA 5G4ZA 3KYEA 4G3WA 5J8XA 2C5WB 1KDSA 4EERA 4E6WA 2XH9A 3TRCA 1K6SA 3FV7A 2LB9A 3KYQA 3WRTA 1CF0A 4GNUA 2UV0E 4HJ3A 1T1AA 1ES5A 3LIDA 3L7HA 4OOLA 2XSSA 3IWOA 5DTTA 5KMWA 3IF6C 2HDRA 4HY8A 2VX8A 2HJ9C 3NBLA 4GS9B 3N8SA 2WYXA 2W27A 2ZL1A 3MJQA 1V9ZA 2Y2OA 2QPNA 4ME4A 1YPRA 5CGXA 1Q2PA 3P98A 4KG2A 4O0PA 3VSLA 3MBZA 1XJ3A 2A24A 2ZQAA 5FL3A 4X25A 3RJUA 3I7JA 5FQMA 2OOLA 3VV4A 3SH7A 1NRFA 3S7OA 1FR1A 1KVLA 3UO9A 3M2JA 3F1PB 5FQJA 1MXOA 5CEDA 5FASA 2JBFA 3S7NA 3LY3A 4Y0TA 2O99A 4S2IA 1IYQA 3G34A 3VP0A 3OPLA 1YSPA 2W3FA 3PBTA 4OPQA 3CUEA 4HH2A 3PBRA 4JXGA 3BYDA 1I2WA 2ZL1B 2RL3A 5CHMA 2WADA 3LR4A 1JWVA 1PWGA 2VKSA 3LIEA 1CI8A 1UWNX 5EVIC 1Y4OA 2XQZA 1ES2A 2A24B 4DXBA 2Y2MA 4WMCD 3TOIA 5EV0A 3PYPA 3LGOA 1S6RA 1PZPA 3OC2A 3UE1A 3CITA 2QKPA 4OQIA 1W5DA 2PHYA 4O8GA 4NXGA 2VZWA 3QP8A 3OLOA 4X56A 1UGUA 3DTMA 3MR0A 4JPMA 5FEGA 2EXBA 1LL5A 3W8KA 3HUNA 2VGLS 1WYCA 5AQBA 2Y2IA 1FSYA 1I2SA 1SDEA 1ZHHB 3NC8A 5EVID 4HOIA 2WKRA 3BW6A 2W3EA 3T50A 5FQKA 1AWIA 2ZQ7A
chains in the Genus database with same CATH topology
4XXRA 5F82A 2OLUA 4D2OA 1Q2QA 2Y55A 5FI6A 1WE4A 4KQQA 5GLBA 2OSUA 3MZFA 4MBKA 5FATA 2HDUA 2WGVA 4KZAA 4WZ4A 4N1XA 5TR7A 4R3BA 1MY8A 3UNWA 2Y2HA 3N8LA 3TG9A 4GOGA 3RXXA 2EFUA 4UA6A 4WMCA 5CRFA 4KZ3A 1LI0A 4OPYA 4FCFA 4WZ5A 5FI2A 1BLSA 2ZQ9A 3VP3A 4KQRA 3GV9A 1FOFA 1LLBA 3G30A 1E3UA 1EI5A 1SCWA 3Q82A 5KSCA 5GLDA 3FYZA 2J8YA 2ZJ9A 3VSKA 5F83A 1RGZA 5L2FA 2J9OA 3ITBA 1K55C 2R9WA 1BSGA 2X71A 5U47A 3VP1A 4LCLA 4BQMA 5I94A 3VP4A 2Z2LB 1QMFA 2V1ZA 4QHCA 4S2KA 4H8RA 3HBRA 2RCXA 1KE0A 1VM1A 3VFFA 1K4FA 4B88A 3A3EA 1LHYA 4Y0OA 2EX9A 4ZAMA 5E2GA 1ONGA 3LEZA 5KZHA 2H0TA 1NYMA 1O07A 3C4OA 3VOZA 4JF4A 2J7VA 3HL9A 4KZ5A 2BG1A 4K0XA 4U0XA 2ZM0A 1QMEA 4GKUA 1W8YA 4LV1A 3O86A 5EVIA 5DTSA 5FAQA 1N9BA 3AGDA 4FD8A 3ZG8B 1IYSA 1C3BA 4OKPA 3O88A 1RCJA 5GHXA 4KENB 1ES4A 2IWDA 1K4EA 3NDEA 2R9XA 4S2NA 3S1YA 1RP5A 1IKIA 4ZJ3A 4IBXA 3TSGA 3HLCA 4EUZA 1ESUA 2FFFB 5JYPA 4M3KA 4KZBA 3UN7A 2G2UA 2GDNA 1KDWA 4OPRA 4C3QA 4GN2A 5JYOA 1ZC2A 1Z6FA 3SS5A 1N4OA 1M40A 2I72A 4LV0A 1K6RA 3PAEA 5M18A 4FH2A 3NCKA 4WM9A 1EWZA 1JWZA 1K57C 4CJNA 3PTEA 2UWXA 3GMWA 4U0TA 5E43A 4Q8IA 2H5SA 4E6XA 1YMSA 2H0YA 2ZQDA 5AQ7A 1NZUA 3UE0A 2DNSA 2A3UA 4KQOA 5CTMA 5EOEA 5CERA 4IVKA 5GLAA 1FCNA 3GSGA 3QHYA 3OPHA 1WYBA 2XK1A 1I5QA 4S2PA 4E3LA 1GCEA 3V39A 1YM1A 3M6BA 4GDNA 1MKIA 5D3OA 1BTLA 2Y2LA 3G2ZA 1SDNA 1K56D 3VOYA 4IVIA 1H8ZA 1J9MA 1FSWA 1MWTA 3MXRA 4ZJ1A 4E3KA 2P9VA 3GQZA 4JXWA 4EBPA 4OQGA 4LCMA 4QB8A 4PM5A 1NYYA 3BFEA 4GDBA 1YQSA 3O87A 4RYEA 4PM8A 5EVIB 4KZ8A 4C75A 1G68A 3UPPA 1MWUA 3IHAA 5FQIA 1CK3A 3SS3A 3ZFZA 4OOMA 1W79A 1XGIA 3ZG9B 3N6IA 4JF6A 3HLBA 1L0GA 4A5RA 4OQHA 4X6TA 1YT4A 3EQUA 4C6YA 3Q7VA 4OLDA 2ZC7A 2OV5A 2XFSA 1GHMA 2Y2JA 1PW8A 3VMAA 1PZOA 1PYYA 1L2SA 1K54A 4OH0A 4R3JA 2XLNA 4DF6A 2EX2A 1DJBA 1O7EA 3FKVA 3D4FA 3IH8A 5FAPA 4WEJA 4L0LA 4RA7A 4KG6A 3HUMA 4OONA 3C7UA 3FZCA 2Y2NA 1K25A 3RXWA 3W4QA 2WAEA 1K55A 2ZMAA 4PMAA 3HUOA 4DRTA 1JVJA 1H5XA 3A3IA 2WKHA 4JKTA 5FAOA 5E2EA 1FQGA 1YMXA 4GZBA 4P0MA 3BEBA 1CEGA 4OLGA 3UPOA 1K54C 4GB7A 4HEFA 1TDLA 3ZCZA 5HW3A 3G4PA 4O7DA 2EX8A 1BLCA 2QZ6A 4PPRA 3IH9A 3IWQA 4RX2A 1ONHA 3OPPA 1PIOA 4MLLA 2WGWA 4KZ7A 1PI4A 2P9VB 5TGFA 1IKGA 3OPRA 4MBFA 5DVAA 4UA9A 1XKZA 1LL9A 1BUEA 2WUQA 3IF6B 1K56A 1JWPA 1E4DA 1U60A 4BJPA 1L0DA 5FA7A 4E3MA 4E3JA 1ERQA 5HAQA 2XFTA 2VGJA 4DE0A 2XD5A 3NDGA 2DRWA 3PBSA 4JF5A 2VGKA 4Y0UA 3GRJA 2X02A 3OCLA 4DDYA 1KVMA 3AGEA 3CJMA 1MWSA 3GR2A 2XEPA 3QNBA 1TEMA 1MBLA 3JYIA 3G31A 3Q7VB 4BD1A 2E8IA 2BLSA 4GD8A 3S22A 1KGGA 2XGNA 5EOOA 2CC1A 3A3DA 3SH9A 1S0WA 1HD8A 1XPBA 1XA7A 4OP5A 3SOIA 5A91A 2XDMA 5A92A 4N92A 1K57A 5EE8A 2ZM2A 3AGFA 4P87A 1OMEA 1Y54A 5E2FA 3HLWA 2ZD8A 1M6KA 2Z2MB 4NETA 4ZTKA 1JTGA 5M1AA 2JE5A 3UPNA 5A93A 5EPHA 3NY4A 5F1GA 3FKWA 4KZ6A 3ZNTA 3GTCA 5AQAA 4IBRA 3IXBA 2JCHA 4WBGA 4ZBEA 5IHVA 3GVBA 3HLGA 4N9LA 4QU3A 3WS4A 1KGEA 3DWZA 3WS0A 1YLJA 5HARA 2Y2GA 4LV2A 4MEZA 3V3RA 5FI7A 4U3TA 5DF7A 3ISGA 4BL3A 2OLVA 1EROA 1ZG4A 2IWCA 4NK3A 2Q9MA 3BLSA 2ZC5B 4UHUA 3LCEA 5GLCA 3Q81A 2PU4A 4IEDA 4RX3A 4B4XA 5EUAA 1ESIA 5CXWA 4QY6A 1MWRA 1PWCA 1ES3A 1IYPA 3BRMA 1L0FA 3MKEA 2J9PA 1GA0A 4KZ9A 4S2LA 5GHZA 3ZHHA 3N8RA 4DDSA 3G32A 4LV3A 3SH8A 1YLTA 4CPKA 1SKFA 1KE4A 3HLDA 3ITAA 3LY4A 4R4RA 2XF3A 2G2WA 5TFQA 1NY0A 1ERMA 3ZNYA 2FFYA 1XP4A 1YLZA 3UDFA 4DE2A 2X01A 3BFGA 3IXHA 3E2KA 4DE3A 1W8QA 1LI9A 4PM6A 5FQQA 3PBOA 4DXCA 2HP6A 3Q7ZA 3UE3A 4UA7A 3C5AA 5DF9A 2HP9A 3IF5A 5FSRA 3V50A 4KG5A 4DE1A 2ZQCA 3M6HA 3IHBA 3FWLA 1YLYA 4WELA 1FCMA 1DY6A 3LO7A 1TVFA 1KE3A 1HVBA 3MKFA 4ZJ2A 4X68A 5CTNA 1SHVA 3A3JA 5EECA 2Y91A 1CEFA 1JTDA 4OP8A 4R23A 5J8XA 2C5WB 1KDSA 4E6WA 2XH9A 5HL1A 2HDSA 4Z9QA 1K6SA 3ZDJA 3FV7A 1NJ4A 4OVDA 4R4SA 4BENA 1NXYA 5A90A 3Q1FA 3BFFA 2C6WB 3WRTA 4GNUA 4ID4A 1ALQA 5FDHA 5CHJA 1ES5A 2PBYA 4S2JA 4QY5A 3HLFA 1YLPA 3W4PA 5HAIA 4OOLA 3BM6A 3IWOA 3HVFA 5DTTA 3IF6C 5KMWA 3DWKA 2HDRA 3ZG7B 5CECA 4OOYA 3OCNA 3EQVA 3NBLA 4QJGA 1AXBA 3V3SA 3W4OA 2Y2QA 3MXSA 4S2MA 3ZVTA 4HESA 2IWBA 2HP5A 3WS2A 4E3NA 1XXMA 3N8SA 2WYXA 4FH4A 2QMIA 3PBQA 3C7VA 5HFOA 4E3IA 4EQIA 5KSHA 3MZDA 2Y2OA 2QPNA 1G6AA 2Y59A 5CGXA 1FR6A 1Q2PA 3OZHA 3P98A 3PAGA 4S2OA 1DJCA 1XA1A 3IT9A 1E25A 4KG2A 5FQ9A 3WS5A 2DCFA 1BT5A 1BLPA 2WKIA 3NIAA 5DF8A 3VSLA 5BOHA 3MBZA 2ZQAA 1ZKJA 2WK0A 3RJUA 2ZC3B 1XX2A 1VQQA 1IEMA 4X69A 3I7JA 5FQMA 3UDIA 4EBNA 2Q9NA 3G35A 4E3OA 3SH7A 2WKEA 1BLHA 1NRFA 1ZG6A 3B3XA 5AQ9A 4JXVA 3IXGA 3BECA 2ZLYA 1IELA 4MBHA 4JXSA 4WZ5C 4K0WA 1FR1A 1RGYA 3HLEA 4JBFA 4P85A 2WGIA 1KVLA 1PW1A 5GL9A 2B5RA 3M2JA 3BFCA 4KZ4A 3UO9A 5F1FA 3NI9A 3A3FA 5FQJA 3P09A 1MXOA 5CEDA 5FASA 2JBFA 1H8YA 3LY3A 3O3VA 3WRZA 4EBLA 4Y0TA 4R0QA 4S2IA 1IYQA 1NZOA 3WS1A 3G34A 1L0EA 4XUZA 1MPLA 3VP0A 2ZM8A 3OPLA 3CMZA 4LENA 1W7FA 4YINA 3PBTA 4HBUA 1TDGA 2WGWB 3PBNA 4OPQA 4EWFA 1KGFA 2HPBA 1GA9A 4FSFA 2P74A 3PBRA 4JXGA 1BZAA 3BYDA 1I2WA 2ZQ8A 2RL3A 5EVLA 5CGWA 3CZDA 5CHMA 1FCOA 2WADA 2PU2A 1JWVA 1PWGA 4BD0A 3HREA 3BLMA 3N7WA 4XUXA 2JC7A 2HDQA 2EFXA 1CI8A 3BFDA 2EX6A 5EVIC 3MFDA 4EV4A 2EXAA 1PI5A 2XQZA 1ES2A 2Y2KA 2V20A 1CI9A 3SS4A 3UY6A 3ZGAB 4QD4A 3ZG5A 1HTZA 4MNRA 4HBTA 4DXBA 4PM7A 2A49A 1GHIA 2Y2MA 4OQ0A 4WMCD 3ZG0A 4S2NC 3ZVWA 2XD1A 4R1GA 3TOIA 1S6RA 1PZPA 3OC2A 4YFMA 1E3UD 3E2LA 3UDXA 4WEKA 3UE1A 3G2YA 3DW0A 3N4IA 4OQIA 1W5DA 5HX9A 4N9KA 5HAPA 3VP2A 4X55A 2ZC6B 1GHPA 3M2KA 4X56A 2WAFA 4X53A 5DTKA 4K91A 4F94A 3DTMA 1YLWA 3MZEA 4JPMA 5CGSA 1PWDA 2Y2PA 4DKIA 2Y4AA 3C4PA 4ZDXA 4UAAA 2EXBA 1LL5A 3W8KA 3HUNA 2XR0A 3IF6A 1WYCA 2ZC4B 2H10A 3CG5A 4N1HA 5AQBA 2Y2IA 1IYOA 3Q07A 1FSYA 1I2SA 1SDEA 3S4XA 5G18A 4OPZA 4B4ZA 5CHUA 3NC8A 5EVID 2WZZA 3IQAA 3IWIA 3IXDA 5GHYA 4RVAA 1K38A 3QNCA 4P6BA 3WWXA 2V2FF 5E2HA 5M19A 4BLMA 5CEBA 4Y7PA 1HZOA 4WYYA 3VFHA 4JLFA 5FQKA 2WZXA 1BULA 4PM9A 4BL2A 1XGJA 1DJAA 4GD6A 3V5MA 2ZQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XXR A;  5F82 A;  2OLU A;  4D2O A;  1Q2Q A;  2Y55 A;  5FI6 A;  1WE4 A;  4KQQ A;  5GLB A;  2OSU A;  3MZF A;  4MBK A;  5FAT A;  2HDU A;  2WGV A;  4KZA A;  4WZ4 A;  4N1X A;  5TR7 A;  4R3B A;  1MY8 A;  3UNW A;  2Y2H A;  3N8L A;  3TG9 A;  4GOG A;  3RXX A;  2EFU A;  4UA6 A;  4WMC A;  5CRF A;  4KZ3 A;  1LI0 A;  4OPY A;  4FCF A;  4WZ5 A;  5FI2 A;  1BLS A;  2ZQ9 A;  3VP3 A;  4KQR A;  3GV9 A;  1FOF A;  1LLB A;  3G30 A;  1E3U A;  1EI5 A;  1SCW A;  3Q82 A;  5KSC A;  5GLD A;  3FYZ A;  2J8Y A;  2ZJ9 A;  3VSK A;  5F83 A;  1RGZ A;  5L2F A;  2J9O A;  3ITB A;  1K55 C;  2R9W A;  1BSG A;  2X71 A;  5U47 A;  3VP1 A;  4LCL A;  4BQM A;  5I94 A;  3VP4 A;  2Z2L B;  1QMF A;  2V1Z A;  4QHC A;  4S2K A;  4H8R A;  3HBR A;  2RCX A;  1KE0 A;  1VM1 A;  3VFF A;  1K4F A;  4B88 A;  3A3E A;  1LHY A;  4Y0O A;  2EX9 A;  4ZAM A;  5E2G A;  1ONG A;  3LEZ A;  5KZH A;  2H0T A;  1NYM A;  1O07 A;  3C4O A;  3VOZ A;  4JF4 A;  2J7V A;  3HL9 A;  4KZ5 A;  2BG1 A;  4K0X A;  4U0X A;  2ZM0 A;  1QME A;  4GKU A;  1W8Y A;  4LV1 A;  3O86 A;  5EVI A;  5DTS A;  5FAQ A;  1N9B A;  3AGD A;  4FD8 A;  3ZG8 B;  1IYS A;  1C3B A;  4OKP A;  3O88 A;  1RCJ A;  5GHX A;  4KEN B;  1ES4 A;  2IWD A;  1K4E A;  3NDE A;  2R9X A;  4S2N A;  3S1Y A;  1RP5 A;  1IKI A;  4ZJ3 A;  4IBX A;  3TSG A;  3HLC A;  4EUZ A;  1ESU A;  2FFF B;  5JYP A;  4M3K A;  4KZB A;  3UN7 A;  2G2U A;  2GDN A;  1KDW A;  4OPR A;  4C3Q A;  4GN2 A;  5JYO A;  1ZC2 A;  1Z6F A;  3SS5 A;  1N4O A;  1M40 A;  2I72 A;  4LV0 A;  1K6R A;  3PAE A;  5M18 A;  4FH2 A;  3NCK A;  4WM9 A;  1EWZ A;  1JWZ A;  1K57 C;  4CJN A;  3PTE A;  2UWX A;  3GMW A;  4U0T A;  5E43 A;  4Q8I A;  2H5S A;  4E6X A;  1YMS A;  2H0Y A;  2ZQD A;  5AQ7 A;  1NZU A;  3UE0 A;  2DNS A;  2A3U A;  4KQO A;  5CTM A;  5EOE A;  5CER A;  4IVK A;  5GLA A;  1FCN A;  3GSG A;  3QHY A;  3OPH A;  1WYB A;  2XK1 A;  1I5Q A;  4S2P A;  4E3L A;  1GCE A;  3V39 A;  1YM1 A;  3M6B A;  4GDN A;  1MKI A;  5D3O A;  1BTL A;  2Y2L A;  3G2Z A;  1SDN A;  1K56 D;  3VOY A;  4IVI A;  1H8Z A;  1J9M A;  1FSW A;  1MWT A;  3MXR A;  4ZJ1 A;  4E3K A;  2P9V A;  3GQZ A;  4JXW A;  4EBP A;  4OQG A;  4LCM A;  4QB8 A;  4PM5 A;  1NYY A;  3BFE A;  4GDB A;  1YQS A;  3O87 A;  4RYE A;  4PM8 A;  5EVI B;  4KZ8 A;  4C75 A;  1G68 A;  3UPP A;  1MWU A;  3IHA A;  5FQI A;  1CK3 A;  3SS3 A;  3ZFZ A;  4OOM A;  1W79 A;  1XGI A;  3ZG9 B;  3N6I A;  4JF6 A;  3HLB A;  1L0G A;  4A5R A;  4OQH A;  4X6T A;  1YT4 A;  3EQU A;  4C6Y A;  3Q7V A;  4OLD A;  2ZC7 A;  2OV5 A;  2XFS A;  1GHM A;  2Y2J A;  1PW8 A;  3VMA A;  1PZO A;  1PYY A;  1L2S A;  1K54 A;  4OH0 A;  4R3J A;  2XLN A;  4DF6 A;  2EX2 A;  1DJB A;  1O7E A;  3FKV A;  3D4F A;  3IH8 A;  5FAP A;  4WEJ A;  4L0L A;  4RA7 A;  4KG6 A;  3HUM A;  4OON A;  3C7U A;  3FZC A;  2Y2N A;  1K25 A;  3RXW A;  3W4Q A;  2WAE A;  1K55 A;  2ZMA A;  4PMA A;  3HUO A;  4DRT A;  1JVJ A;  1H5X A;  3A3I A;  2WKH A;  4JKT A;  5FAO A;  5E2E A;  1FQG A;  1YMX A;  4GZB A;  4P0M A;  3BEB A;  1CEG A;  4OLG A;  3UPO A;  1K54 C;  4GB7 A;  4HEF A;  1TDL A;  3ZCZ A;  5HW3 A;  3G4P A;  4O7D A;  2EX8 A;  1BLC A;  2QZ6 A;  4PPR A;  3IH9 A;  3IWQ A;  4RX2 A;  1ONH A;  3OPP A;  1PIO A;  4MLL A;  2WGW A;  4KZ7 A;  1PI4 A;  2P9V B;  5TGF A;  1IKG A;  3OPR A;  4MBF A;  5DVA A;  4UA9 A;  1XKZ A;  1LL9 A;  1BUE A;  2WUQ A;  3IF6 B;  1K56 A;  1JWP A;  1E4D A;  1U60 A;  4BJP A;  1L0D A;  5FA7 A;  4E3M A;  4E3J A;  1ERQ A;  5HAQ A;  2XFT A;  2VGJ A;  4DE0 A;  2XD5 A;  3NDG A;  2DRW A;  3PBS A;  4JF5 A;  2VGK A;  4Y0U A;  3GRJ A;  2X02 A;  3OCL A;  4DDY A;  1KVM A;  3AGE A;  3CJM A;  1MWS A;  3GR2 A;  2XEP A;  3QNB A;  1TEM A;  1MBL A;  3JYI A;  3G31 A;  3Q7V B;  4BD1 A;  2E8I A;  2BLS A;  4GD8 A;  3S22 A;  1KGG A;  2XGN A;  5EOO A;  2CC1 A;  3A3D A;  3SH9 A;  1S0W A;  1HD8 A;  1XPB A;  1XA7 A;  4OP5 A;  3SOI A;  5A91 A;  2XDM A;  5A92 A;  4N92 A;  1K57 A;  5EE8 A;  2ZM2 A;  3AGF A;  4P87 A;  1OME A;  1Y54 A;  5E2F A;  3HLW A;  2ZD8 A;  1M6K A;  2Z2M B;  4NET A;  4ZTK A;  1JTG A;  5M1A A;  2JE5 A;  3UPN A;  5A93 A;  5EPH A;  3NY4 A;  5F1G A;  3FKW A;  4KZ6 A;  3ZNT A;  3GTC A;  5AQA A;  4IBR A;  3IXB A;  2JCH A;  4WBG A;  4ZBE A;  5IHV A;  3GVB A;  3HLG A;  4N9L A;  4QU3 A;  3WS4 A;  1KGE A;  3DWZ A;  3WS0 A;  1YLJ A;  5HAR A;  2Y2G A;  4LV2 A;  4MEZ A;  3V3R A;  5FI7 A;  4U3T A;  5DF7 A;  3ISG A;  4BL3 A;  2OLV A;  1ERO A;  1ZG4 A;  2IWC A;  4NK3 A;  2Q9M A;  3BLS A;  2ZC5 B;  4UHU A;  3LCE A;  5GLC A;  3Q81 A;  2PU4 A;  4IED A;  4RX3 A;  4B4X A;  5EUA A;  1ESI A;  5CXW A;  4QY6 A;  1MWR A;  1PWC A;  1ES3 A;  1IYP A;  3BRM A;  1L0F A;  3MKE A;  2J9P A;  1GA0 A;  4KZ9 A;  4S2L A;  5GHZ A;  3ZHH A;  3N8R A;  4DDS A;  3G32 A;  4LV3 A;  3SH8 A;  1YLT A;  4CPK A;  1SKF A;  1KE4 A;  3HLD A;  3ITA A;  3LY4 A;  4R4R A;  2XF3 A;  2G2W A;  5TFQ A;  1NY0 A;  1ERM A;  3ZNY A;  2FFY A;  1XP4 A;  1YLZ A;  3UDF A;  4DE2 A;  2X01 A;  3BFG A;  3IXH A;  3E2K A;  4DE3 A;  1W8Q A;  1LI9 A;  4PM6 A;  5FQQ A;  3PBO A;  4DXC A;  2HP6 A;  3Q7Z A;  3UE3 A;  4UA7 A;  3C5A A;  5DF9 A;  2HP9 A;  3IF5 A;  5FSR A;  3V50 A;  4KG5 A;  4DE1 A;  2ZQC A;  3M6H A;  3IHB A;  3FWL A;  1YLY A;  4WEL A;  1FCM A;  1DY6 A;  3LO7 A;  1TVF A;  1KE3 A;  1HVB A;  3MKF A;  4ZJ2 A;  4X68 A;  5CTN A;  1SHV A;  3A3J A;  5EEC A;  2Y91 A;  1CEF A;  1JTD A;  4OP8 A;  4R23 A;  5J8X A;  2C5W B;  1KDS A;  4E6W A;  2XH9 A;  5HL1 A;  2HDS A;  4Z9Q A;  1K6S A;  3ZDJ A;  3FV7 A;  1NJ4 A;  4OVD A;  4R4S A;  4BEN A;  1NXY A;  5A90 A;  3Q1F A;  3BFF A;  2C6W B;  3WRT A;  4GNU A;  4ID4 A;  1ALQ A;  5FDH A;  5CHJ A;  1ES5 A;  2PBY A;  4S2J A;  4QY5 A;  3HLF A;  1YLP A;  3W4P A;  5HAI A;  4OOL A;  3BM6 A;  3IWO A;  3HVF A;  5DTT A;  3IF6 C;  5KMW A;  3DWK A;  2HDR A;  3ZG7 B;  5CEC A;  4OOY A;  3OCN A;  3EQV A;  3NBL A;  4QJG A;  1AXB A;  3V3S A;  3W4O A;  2Y2Q A;  3MXS A;  4S2M A;  3ZVT A;  4HES A;  2IWB A;  2HP5 A;  3WS2 A;  4E3N A;  1XXM A;  3N8S A;  2WYX A;  4FH4 A;  2QMI A;  3PBQ A;  3C7V A;  5HFO A;  4E3I A;  4EQI A;  5KSH A;  3MZD A;  2Y2O A;  2QPN A;  1G6A A;  2Y59 A;  5CGX A;  1FR6 A;  1Q2P A;  3OZH A;  3P98 A;  3PAG A;  4S2O A;  1DJC A;  1XA1 A;  3IT9 A;  1E25 A;  4KG2 A;  5FQ9 A;  3WS5 A;  2DCF A;  1BT5 A;  1BLP A;  2WKI A;  3NIA A;  5DF8 A;  3VSL A;  5BOH A;  3MBZ A;  2ZQA A;  1ZKJ A;  2WK0 A;  3RJU A;  2ZC3 B;  1XX2 A;  1VQQ A;  1IEM A;  4X69 A;  3I7J A;  5FQM A;  3UDI A;  4EBN A;  2Q9N A;  3G35 A;  4E3O A;  3SH7 A;  2WKE A;  1BLH A;  1NRF A;  1ZG6 A;  3B3X A;  5AQ9 A;  4JXV A;  3IXG A;  3BEC A;  2ZLY A;  1IEL A;  4MBH A;  4JXS A;  4WZ5 C;  4K0W A;  1FR1 A;  1RGY A;  3HLE A;  4JBF A;  4P85 A;  2WGI A;  1KVL A;  1PW1 A;  5GL9 A;  2B5R A;  3M2J A;  3BFC A;  4KZ4 A;  3UO9 A;  5F1F A;  3NI9 A;  3A3F A;  5FQJ A;  3P09 A;  1MXO A;  5CED A;  5FAS A;  2JBF A;  1H8Y A;  3LY3 A;  3O3V A;  3WRZ A;  4EBL A;  4Y0T A;  4R0Q A;  4S2I A;  1IYQ A;  1NZO A;  3WS1 A;  3G34 A;  1L0E A;  4XUZ A;  1MPL A;  3VP0 A;  2ZM8 A;  3OPL A;  3CMZ A;  4LEN A;  1W7F A;  4YIN A;  3PBT A;  4HBU A;  1TDG A;  2WGW B;  3PBN A;  4OPQ A;  4EWF A;  1KGF A;  2HPB A;  1GA9 A;  4FSF A;  2P74 A;  3PBR A;  4JXG A;  1BZA A;  3BYD A;  1I2W A;  2ZQ8 A;  2RL3 A;  5EVL A;  5CGW A;  3CZD A;  5CHM A;  1FCO A;  2WAD A;  2PU2 A;  1JWV A;  1PWG A;  4BD0 A;  3HRE A;  3BLM A;  3N7W A;  4XUX A;  2JC7 A;  2HDQ A;  2EFX A;  1CI8 A;  3BFD A;  2EX6 A;  5EVI C;  3MFD A;  4EV4 A;  2EXA A;  1PI5 A;  2XQZ A;  1ES2 A;  2Y2K A;  2V20 A;  1CI9 A;  3SS4 A;  3UY6 A;  3ZGA B;  4QD4 A;  3ZG5 A;  1HTZ A;  4MNR A;  4HBT A;  4DXB A;  4PM7 A;  2A49 A;  1GHI A;  2Y2M A;  4OQ0 A;  4WMC D;  3ZG0 A;  4S2N C;  3ZVW A;  2XD1 A;  4R1G A;  3TOI A;  1S6R A;  1PZP A;  3OC2 A;  4YFM A;  1E3U D;  3E2L A;  3UDX A;  4WEK A;  3UE1 A;  3G2Y A;  3DW0 A;  3N4I A;  4OQI A;  1W5D A;  5HX9 A;  4N9K A;  5HAP A;  3VP2 A;  4X55 A;  2ZC6 B;  1GHP A;  3M2K A;  4X56 A;  2WAF A;  4X53 A;  5DTK A;  4K91 A;  4F94 A;  3DTM A;  1YLW A;  3MZE A;  4JPM A;  5CGS A;  1PWD A;  2Y2P A;  4DKI A;  2Y4A A;  3C4P A;  4ZDX A;  4UAA A;  2EXB A;  1LL5 A;  3W8K A;  3HUN A;  2XR0 A;  3IF6 A;  1WYC A;  2ZC4 B;  2H10 A;  3CG5 A;  4N1H A;  5AQB A;  2Y2I A;  1IYO A;  3Q07 A;  1FSY A;  1I2S A;  1SDE A;  3S4X A;  5G18 A;  4OPZ A;  4B4Z A;  5CHU A;  3NC8 A;  5EVI D;  2WZZ A;  3IQA A;  3IWI A;  3IXD A;  5GHY A;  4RVA A;  1K38 A;  3QNC A;  4P6B A;  3WWX A;  2V2F F;  5E2H A;  5M19 A;  4BLM A;  5CEB A;  4Y7P A;  1HZO A;  4WYY A;  3VFH A;  4JLF A;  5FQK A;  2WZX A;  1BUL A;  4PM9 A;  4BL2 A;  1XGJ A;  1DJA A;  4GD6 A;  3V5M A;  2ZQ7 A; 
#chains in the Genus database with same CATH topology
 4NXE A;  5F82 A;  2Y55 A;  4Y5F A;  2OSU A;  3MZF A;  5FAT A;  4WZ4 A;  4I5S A;  3N8L A;  2EFU A;  4L9G A;  1LI0 A;  4FCF A;  4KQR A;  1FOF A;  3BQA A;  1EI5 A;  5KSC A;  1VHM A;  3LIF A;  3VSK A;  1LL8 A;  3ITB A;  1K55 C;  1BSG A;  5U47 A;  3VP1 A;  4BQM A;  1QMF A;  1N9L A;  5TJJ A;  5E2G A;  3LEZ A;  4JF4 A;  2J7V A;  3HL9 A;  1S66 L;  2BG1 A;  4FOF A;  4GKU A;  5AJG A;  5EM1 A;  4FD8 A;  5GHX A;  4S2N A;  3S1Y A;  1RP5 A;  3T4T A;  1KOU A;  4ZJ3 A;  4IBX A;  3HLC A;  4EUZ A;  5JYP A;  1F5M A;  2GDN A;  1KDW A;  2W0N A;  3EGD C;  3HJK A;  1ZC2 A;  1N4O A;  3ZYT A;  3PAE A;  3KX0 X;  5FEF A;  1EWZ A;  2OWJ A;  3T4J A;  2H5S A;  3EEA A;  1YMS A;  1NZU A;  4HI4 A;  5EOE A;  3QHY A;  4E3L A;  3M6B A;  5D3O A;  1BTL A;  3UB8 A;  2B18 A;  3VOY A;  1J9M A;  4UQI S;  4JXW A;  1A0K A;  4GLQ A;  4LCM A;  4QB8 A;  3MF0 A;  4PM5 A;  4HQA A;  3BFE A;  4RYE A;  2VV6 A;  1G68 A;  1T1B A;  1CK3 A;  3NUL A;  4OOM A;  3CPT B;  4MN5 A;  3N6I A;  3HLB A;  4OQH A;  2M7V A;  3EQU A;  4C6Y A;  4OLD A;  2ZC7 A;  2OV5 A;  1L3L A;  1GHM A;  2Y2J A;  3VMA A;  3KSF A;  3IX3 A;  1K54 A;  3KO6 A;  2QJ5 A;  4R3J A;  2EX2 A;  1DJB A;  1O7E A;  4H6J A;  3D4F A;  3IH8 A;  5FAP A;  4WEJ A;  4L0L A;  4KG6 A;  3FZC A;  1Y28 A;  3PR6 A;  2JKF A;  3NOU C;  3A3I A;  4JKT A;  1NLZ A;  5FAO A;  4GZB A;  4EUV A;  5HDD A;  4GB7 A;  3ZCZ A;  1S4S A;  2JN7 A;  3DTK A;  3OPP A;  4WUJ A;  4KZ7 A;  1PI4 A;  1IKG A;  3QP6 A;  3OPR A;  4UA9 A;  1XKZ A;  5DFX A;  4HIA A;  1LL9 A;  2P7J A;  1K56 A;  1S1Y A;  4E3M A;  5HAQ A;  4DE0 A;  3CWF A;  3NDG A;  4YOF A;  3PBS A;  2X02 A;  3AGE A;  2VEA A;  3QNB A;  3F1O A;  3S22 A;  4KUO A;  3LUQ A;  2Z6D A;  3JPU A;  3A3D A;  2O0Y A;  1S0W A;  1XFQ A;  2PD8 A;  1XPB A;  4H6J B;  5HWT A;  4OP5 A;  1OPX A;  3SOI A;  5A91 A;  2XDM A;  5A92 A;  5EE8 A;  3AGF A;  4P87 A;  3UB5 P;  1OME A;  4ZRR A;  2P08 A;  2JE5 A;  5A93 A;  3FKW A;  3SZT A;  4IBR A;  2WKP A;  5IHV A;  3HLG A;  3WS4 A;  3F1N A;  3WS0 A;  5FI7 A;  4BL3 A;  3ISG A;  2L0W A;  3LCE A;  1GSW A;  4LRZ E;  5EUA A;  3FPW A;  4PKY A;  5CXW A;  4QY6 A;  1PWC A;  2NUT C;  3BRM A;  1L0F A;  2J9P A;  4KZ9 A;  5GHZ A;  4DDS A;  3SH8 A;  2GX5 A;  3F1O B;  1UWP X;  5HDC A;  5TFQ A;  1YLZ A;  3UDF A;  3DBA A;  2X01 A;  3BFG A;  3IXH A;  5IS1 A;  4GHI A;  4G3V A;  4UA7 A;  2JHE A;  5FSR A;  4KG5 A;  5DKL A;  4DE1 A;  2VV7 A;  2ZMV A;  3FWL A;  1V9Y A;  1HVB A;  4LPZ A;  3T4O A;  5CTN A;  1SHV A;  3A3J A;  1D7E A;  5EEC A;  1CEF A;  4R23 A;  2HDS A;  3ZDJ A;  4R4S A;  4BEN A;  1P9W A;  1NXY A;  3BFF A;  4EEU A;  3NEC A;  3H82 A;  2VA0 A;  2V8F A;  4QY5 A;  3S7P A;  4PHT A;  2JKG A;  3W4P A;  4R6L A;  3CAX A;  3BM6 A;  1JNU A;  5CEC A;  4LGW A;  3EQV A;  3V3S A;  3MQQ A;  5EVE A;  3WS2 A;  2JKR I;  5KSH A;  4E3I A;  1G6A A;  1DJC A;  5FQ9 A;  2DCF A;  2CMN A;  3LEQ A;  3KSH A;  5F68 A;  4BBV A;  2ZC3 B;  1XX2 A;  4X69 A;  4E3O A;  4JXV A;  3BEC A;  2ZLY A;  4JXS A;  1GSX A;  3IX8 A;  2K31 A;  5CX7 A;  5F1F A;  3A3F A;  5IU1 A;  3P09 A;  2HF6 A;  4EBL A;  4R0Q A;  1BYW A;  2W3D A;  3WS1 A;  1MPL A;  2ZM8 A;  3V67 A;  4YIN A;  1TDG A;  2WGW B;  4PKY G;  2HPB A;  3ICY A;  4HP9 A;  4FSF A;  1W63 M;  2GJ3 A;  1LSX A;  3RTY A;  1TS6 A;  3HRE A;  3BLM A;  4HHD A;  2HDQ A;  4Z1W A;  2EX6 A;  2EXA A;  3RH8 B;  3SS4 A;  5KIZ A;  1IFQ A;  3ZG5 A;  1HTZ A;  4MNR A;  1G28 A;  4OQ0 A;  3ZVW A;  2JKT I;  2XD1 A;  3JVU A;  3CLO A;  4YFM A;  3UDX A;  1YAX A;  2ZMF A;  3N4I A;  5HSQ A;  1G5U A;  2KLI A;  4WL9 A;  4XT2 A;  2ZC6 B;  5I5L A;  3M2K A;  3T12 B;  1YLW A;  3IS2 B;  2Y2P A;  5HL6 A;  4ZDX A;  1OTI A;  2XR0 A;  1FIL A;  2FZ0 A;  1IYO A;  3Q07 A;  2O9B A;  3S4X A;  3LIB A;  2VGL M;  4B4Z A;  4L9E A;  4UEY A;  4IUH A;  5E2H A;  1HZO A;  3IBJ A;  3FC7 A;  1DJA A;  3TG9 A;  4B93 A;  4EU0 A;  4D2O A;  3PHY A;  1Q2Q A;  5FI6 A;  1WE4 A;  4KQQ A;  3UPN A;  2HDU A;  2WGV A;  4KZA A;  2QWS A;  3UNW A;  2Y2H A;  2PRF A;  4NG2 A;  4KZ3 A;  4XT2 B;  4WZ5 A;  5FI2 A;  1E3U A;  3CI6 A;  1SCW A;  5GLD A;  2J8Y A;  4QPR A;  5F83 A;  5DJU A;  2QYB A;  4LCL A;  1CJF A;  3VP4 A;  2V1Z A;  2O9A A;  3HBR A;  1ZTU A;  1VM1 A;  3UB7 A;  3VFF A;  1K4F A;  4Y0O A;  4ZAM A;  1ONG A;  3BJN A;  3VOZ A;  2YKH A;  4KZ5 A;  3KSI A;  4U0X A;  2ZM0 A;  1QME A;  3O86 A;  5DTS A;  4CLC C;  5FAQ A;  3AGD A;  4OKP A;  3O88 A;  2IWD A;  5HZH A;  3G6O A;  1OT9 A;  4C3Q A;  4OPR A;  4GN2 A;  3B42 A;  1Z6F A;  4LV0 A;  1M40 A;  4G3K A;  5M18 A;  5MC7 A;  1EW0 A;  4WM9 A;  1JWZ A;  1K57 C;  3GMW A;  4K08 A;  3P7N A;  2D01 A;  2ZQD A;  2DNS A;  5HWW A;  1OTD A;  5CTM A;  4IVK A;  3GSG A;  1GCE A;  1YM1 A;  4GDN A;  2B02 A;  2Y2L A;  3S7Q A;  4IVI A;  2G7U A;  4CLC D;  1MWT A;  2OAQ 1;  4AFI A;  4OQG A;  1OTB A;  4O01 A;  1YQS A;  3B47 A;  4UQI M;  4C75 A;  5FQI A;  3TJZ C;  1T18 A;  5DFY A;  4HP4 A;  2Y79 A;  1PW8 A;  1T1C A;  2PYR A;  4X1M A;  4FUW A;  4BBT A;  1VEU A;  2HJE A;  4RA7 A;  1YSQ A;  2BTF P;  2V0W A;  3RXW A;  5FDS A;  2ZMA A;  3FG8 A;  1H5X A;  2WKH A;  4P0M A;  1SZV A;  1XJ6 A;  3G4P A;  4O7D A;  2EX8 A;  1BLC A;  3IWQ A;  1X0O A;  4FTX A;  4RX2 A;  1PIO A;  4Q0J A;  1OT6 A;  2W3G A;  4MBF A;  5DVA A;  4NEE D;  2WUQ A;  1JWP A;  1U60 A;  4BJP A;  1L0D A;  4E3J A;  1ERQ A;  4EET B;  2VGJ A;  2XD5 A;  5G4Y A;  2DRW A;  4DDY A;  3GRJ A;  3OCL A;  1KVM A;  3CJM A;  2XEP A;  3JYI A;  2E8I A;  2BLS A;  4GD8 A;  4MN6 A;  2XGN A;  2CC1 A;  3JVV A;  5L07 A;  1HD8 A;  2V0U A;  1VEU B;  4RQ9 A;  2WKQ A;  1OTE A;  4ETX A;  4NET A;  2YKF A;  2OAP 1;  5F1G A;  3ZNT A;  4CQH A;  3D3O A;  4WBG A;  3GVB A;  3DWZ A;  2Y2G A;  3DAV A;  4MEZ A;  3UB9 A;  3V3R A;  2OLV A;  2B95 A;  1ERO A;  2IWC A;  4JGP A;  4NK3 A;  2Q9M A;  2EWV A;  4RX3 A;  5EFW A;  5F5Y A;  3R4K A;  4I3J A;  4LRY C;  3K3D A;  1ES3 A;  1IYP A;  2J80 A;  4S2L A;  1GA0 A;  4LV3 A;  2XRN A;  4M4X A;  4F3L A;  3CUE C;  1NY0 A;  2P04 A;  4DE3 A;  1W8Q A;  4PM6 A;  5FQQ A;  3Q7Z A;  1SKO A;  3C5A A;  5DF9 A;  3V50 A;  2D02 A;  4WEL A;  1FCM A;  5K5B A;  4YWZ A;  1D1J A;  1TVF A;  1KE3 A;  3MKF A;  1S1Z A;  4ZJ2 A;  4X68 A;  3T1R A;  2QHK A;  2Y91 A;  4OVD A;  1NJ4 A;  3Q1F A;  3ULF A;  2XA7 M;  4ID4 A;  5HWV A;  5FDH A;  1OJG A;  2PBY A;  4S2J A;  4HJ4 A;  5HAI A;  3DWK A;  3ZG7 B;  4OOY A;  3OCN A;  4QJG A;  4P6Z M;  4F3L B;  2Y2Q A;  3MXS A;  4HES A;  4JGO A;  4E3N A;  1XXM A;  2QMI A;  4EQI A;  3W2Z A;  3T1X A;  3PAG A;  3OZH A;  4S2O A;  3VOL A;  1ODV A;  1E25 A;  3WS5 A;  4WLA A;  2WKI A;  5DF8 A;  4LRX C;  2OWH A;  1VQQ A;  1IEM A;  2Q9N A;  3G35 A;  3EOI A;  1BLH A;  2J3T C;  4I39 A;  4MBH A;  1IEL A;  3HLE A;  4KZ4 A;  3BFC A;  3NI9 A;  2W3H A;  1H8Y A;  3O3V A;  5J7E A;  3LI8 A;  1NZO A;  1WA9 A;  1L0E A;  4XUZ A;  3CMZ A;  4HBU A;  3PBN A;  4BBU A;  1GA9 A;  1XJ2 A;  1BZA A;  2ZQ8 A;  5LBR A;  5CGW A;  4BD0 A;  3N7W A;  2JC7 A;  2EFX A;  3BFD A;  3MFD A;  2V20 A;  3ZGA B;  2ZOH A;  3H9W A;  4QD4 A;  4HBT A;  2Y8H A;  1GHI A;  4S2N C;  2PR6 A;  4R1G A;  4MN7 A;  4WEK A;  5A8B A;  3G2Y A;  4DMZ A;  5HX9 A;  4N9K A;  5HAP A;  3VP2 A;  2HZ5 A;  1GHP A;  2QJ7 A;  2WAF A;  5DTK A;  3A0R A;  5CGS A;  4HNB A;  4WN5 A;  4DKI A;  3C4P A;  4UAA A;  3C2W A;  3MMH A;  1FIK A;  3F1N B;  3IF6 A;  2XA7 S;  2HV1 A;  2H10 A;  1K0K A;  4OPZ A;  5CHU A;  4Y2F A;  3IQA A;  3IWI A;  2DMW A;  1K38 A;  3QP5 A;  3QNC A;  4P6Z S;  3MFX A;  4P6B A;  3WWX A;  2V2F F;  4KQD A;  4Y7P A;  4WYY A;  2WZX A;  4PM9 A;  5HDS A;  1XGJ A;  4GD6 A;  4Y13 A;  4GJ4 A;  3V5M A;  2OLU A;  4L9F A;  5GLB A;  4R3B A;  3IBR A;  4GHI B;  4GOG A;  3RXX A;  4WMC A;  1LSV A;  5CRF A;  1BLS A;  2ZQ9 A;  2VV8 A;  3GV9 A;  1LLB A;  4EXO A;  4II7 A;  3CHW P;  3H7W A;  3FYZ A;  2ZJ9 A;  2KDK A;  2PYP A;  1RGZ A;  2R9W A;  4Y3I A;  2X71 A;  2Z2L B;  4S2K A;  4QHC A;  4H8R A;  2R78 A;  2KX6 A;  2RCX A;  5J3W A;  3C38 A;  1F98 A;  2M7U A;  4B88 A;  1TS7 A;  3H82 B;  3A3E A;  1LHY A;  2EX9 A;  5KZH A;  2H0T A;  1NYM A;  3KYZ A;  4K0X A;  4EW7 A;  1W8Y A;  5EVI A;  4R70 A;  4EQ1 A;  1TS0 A;  1IYS A;  1C3B A;  1RCJ A;  1ES4 A;  3NDE A;  2R9X A;  2V1B A;  4HJ6 A;  3TSG A;  1T19 A;  5EM0 A;  3UN7 A;  3UB6 A;  5JYO A;  1K6R A;  4Y17 A;  4I38 A;  3PTE A;  2UWX A;  3LFV A;  4CJN A;  5E43 A;  3MS6 A;  4E6X A;  2H0Y A;  3SW1 A;  3T4L A;  3T1Q B;  1FCN A;  4NKP A;  3TW8 A;  4KUK A;  3V39 A;  4DN0 A;  1MKI A;  2GZA A;  3G2Z A;  1K56 D;  3MXR A;  4ZJ1 A;  4R3A A;  4E3K A;  2P9V A;  3GQZ A;  3O87 A;  5EVI B;  3BQ8 A;  1MWU A;  3SS3 A;  1D06 A;  3QP4 A;  1W63 Q;  2EWW A;  5HPI A;  3T1S A;  4JF6 A;  1L0G A;  1IOU A;  2J3W A;  2V9A A;  1YT4 A;  3Q7V A;  5DKK A;  1PNE A;  5TBM A;  1PZO A;  1L2S A;  2JKR M;  1MC0 A;  4OH0 A;  3QP1 A;  3FKV A;  3TE8 A;  5F6A A;  3HUM A;  4OON A;  3C7U A;  3U4L P;  1LT0 A;  2WAE A;  1K55 A;  2AVX A;  4PMA A;  3HUO A;  3F1P A;  4DRT A;  1JVJ A;  5E2E A;  1FQG A;  1YMX A;  4I3I A;  4D60 A;  4OLG A;  3UPO A;  5HW3 A;  3BWL A;  4PPR A;  3IH9 A;  3LR5 A;  1NLY A;  5TGF A;  2P9V B;  4ARZ A;  3A0V A;  3FPV A;  1E4D A;  5FA7 A;  2XFT A;  4HH3 A;  3EEH A;  2VGK A;  4JF5 A;  3GR2 A;  1MWS A;  3Q7V B;  4BD1 A;  4YNR A;  3NJA A;  2LB5 A;  5EOO A;  5TBM B;  4IHQ A;  5C5K A;  2PAV P;  3VE4 A;  1N9O A;  4N92 A;  3ZQ5 A;  1Y54 A;  3HLW A;  2ZD8 A;  1M6K A;  2Z2M B;  4ZTK A;  3P01 A;  1JTG A;  1XJ4 A;  5M1A A;  1PFL A;  2JKT M;  5AQA A;  2JCH A;  4QU3 A;  4LV2 A;  4X1L A;  4U3T A;  5DF7 A;  4ARZ B;  1ZG4 A;  2VJW A;  3BLS A;  3LI9 A;  4IED A;  4B4X A;  1MWR A;  1S67 L;  3MKE A;  3O5Y A;  3N8R A;  3G32 A;  1NWZ A;  4CPK A;  3LY4 A;  4R4R A;  2ZOI A;  2XF3 A;  1ERM A;  1ACF A;  3E2K A;  5L8M A;  1STZ A;  1PRQ A;  3PBO A;  5HD5 A;  1DRM A;  3M6H A;  1YLY A;  3E98 A;  3LO7 A;  3LYX A;  4Q0I A;  5AVE A;  4OP8 A;  1JTD A;  1OJ5 A;  5HL1 A;  4Z9Q A;  3K3C A;  2W1T A;  5A90 A;  2C6W B;  1VB6 A;  1ALQ A;  4B9O A;  5CHJ A;  3EGX C;  1OTA A;  1N9N A;  3HLF A;  1YLP A;  3UME A;  3HVF A;  4NXB A;  1AXB A;  3QP2 A;  3W4O A;  4S2M A;  3ZVT A;  2IWB A;  2HP5 A;  2INW A;  4FH4 A;  3PBQ A;  3C7V A;  5HFO A;  5AVF A;  3MZD A;  2Y59 A;  1FR6 A;  1J3W A;  1XA1 A;  3IT9 A;  3NOT C;  2H28 A;  1BT5 A;  1BLP A;  5BOH A;  3NIA A;  1ZKJ A;  4DJ3 A;  2V8C A;  2WK0 A;  1H3Q A;  1NRJ A;  3UDI A;  4EBN A;  2WKE A;  1ZG6 A;  3B3X A;  5AQ9 A;  3IXG A;  2W1T B;  4WZ5 C;  4K0W A;  4IUK A;  1RGY A;  3D72 A;  4JBF A;  4P85 A;  2WGI A;  5GL9 A;  1PW1 A;  2B5R A;  4CLC E;  2NUP C;  1MKM A;  2MJ6 A;  4IJG A;  3NOP C;  3WRZ A;  3EWK A;  1YKD A;  4E04 A;  4LEN A;  1W7F A;  5J4E A;  4EWF A;  1KGF A;  3CPT A;  2P74 A;  4I3A A;  3BY9 A;  5EVL A;  1MZU A;  3CZD A;  1FCO A;  3PXP A;  2PU2 A;  4XUX A;  2HGV A;  3MSH A;  4EV4 A;  1PI5 A;  2Y2K A;  3UY6 A;  1CI9 A;  1F9I A;  4PM7 A;  2A49 A;  2EA9 A;  5HD3 A;  3ZG0 A;  1E3U D;  3DTE A;  1P97 A;  3E2L A;  3DW0 A;  4LFU A;  4X55 A;  2PD7 A;  4X53 A;  2L4R A;  1HLU P;  4K91 A;  4F94 A;  3MZE A;  1PWD A;  2Y4A A;  2GNX A;  3DTI A;  2Q0O A;  3GDI A;  2ZC4 B;  3CG5 A;  4N1H A;  2L1M A;  2IA2 A;  3E4P A;  5G18 A;  3OOV A;  2WZZ A;  3IXD A;  5GHY A;  4RVA A;  2E8J A;  5M19 A;  4BLM A;  5CEB A;  2V1A A;  2ACG A;  3VFH A;  4JLF A;  1BUL A;  4BL2 A;  3HCY A;  1DP9 A;  4XXR A;  1CQA A;  3GEC A;  3LR3 A;  5TR7 A;  4MBK A;  3K2N A;  3MXQ A;  1DP8 A;  4GCZ A;  4N1X A;  1MY8 A;  1SKO B;  2K7S A;  4UA6 A;  4LLO B;  4OPY A;  3VP3 A;  3D9Y A;  3IX4 A;  1P0Z A;  3G30 A;  3Q82 A;  4EEP A;  3E0Y A;  5L2F A;  2J9O A;  3C30 A;  5I94 A;  4EES A;  2I9V A;  1KE0 A;  3R7W A;  2XRO A;  4ETZ A;  1VET A;  1O07 A;  3C4O A;  2O9C A;  4QWO A;  4PAU A;  4LV1 A;  5L10 A;  1N9B A;  4R38 A;  3ZG8 B;  4KEN B;  3UE6 A;  2PR5 A;  3UMD A;  1G6O A;  1K4E A;  2FH5 A;  3LR0 A;  2W1R A;  3E4O A;  1IKI A;  1ESU A;  2FFF B;  3VE3 A;  4M3K A;  4KZB A;  2G2U A;  1DP6 A;  4BMW A;  3SS5 A;  2I72 A;  3C8C A;  4FH2 A;  3RFB A;  3NCK A;  2J3T D;  4U0T A;  4Q8I A;  5AQ7 A;  3UE0 A;  2A3U A;  4KQO A;  1TF1 A;  1TS8 A;  5CER A;  4JGQ A;  5GLA A;  4GW9 A;  3OPH A;  1WYB A;  2XK1 A;  1I5Q A;  4S2P A;  3E4Q A;  1SDN A;  3R7W B;  1H8Z A;  1FSW A;  2VK3 A;  1VET B;  3MQO A;  4EBP A;  4BWI A;  2ZBB A;  1NYY A;  4GDB A;  4PM8 A;  4KZ8 A;  3UPP A;  3IHA A;  3ZFZ A;  1W79 A;  1XGI A;  3ZG9 B;  3OBF A;  4A5R A;  4X6T A;  5L09 A;  2XFS A;  4JGR A;  4Q0H A;  1PYY A;  2XLN A;  4DF6 A;  1P9R A;  3T4K A;  2Y2N A;  1K25 A;  3W4Q A;  4Y15 A;  2M1C A;  3BEB A;  1CEG A;  1K54 C;  4HEF A;  1TDL A;  2QZ6 A;  2A2L A;  3T4S A;  1ONH A;  4MLL A;  5F69 A;  1F2K A;  1S4R A;  2WGW A;  3BY8 A;  3LIA A;  3LIC A;  1BUE A;  3IF6 B;  3L9K A;  4CLC A;  2Z6C A;  4Y0U A;  1H0M A;  5HPF A;  1TEM A;  1MBL A;  4NXF A;  3G31 A;  1H8M A;  1KGG A;  3SH9 A;  3U2A A;  1XA7 A;  1K57 A;  2ZM2 A;  5E2F A;  5EPH A;  3NY4 A;  4KZ6 A;  3GTC A;  3IS2 A;  3IXB A;  2BAS A;  3KSG A;  4ZBE A;  4MMN A;  4N9L A;  2VLG A;  2KOI A;  1KGE A;  1YLJ A;  5HAR A;  3H7W B;  4MCW A;  4ESP A;  2PDR A;  4WF0 A;  5GLC A;  2ZC5 B;  4UHU A;  3T4Q A;  2PBD P;  1TD5 A;  3Q81 A;  2PT7 A;  1LSW A;  2PU4 A;  1ESI A;  4CLC B;  3B33 A;  3ZHH A;  1YLT A;  1SKF A;  1KE4 A;  3HLD A;  3ITA A;  4GS9 A;  2G2W A;  1GSV A;  3ZNY A;  2FFY A;  1XP4 A;  1XFN A;  4DE2 A;  1Z09 A;  1LI9 A;  5DJT A;  3HJI A;  2HP6 A;  3UE3 A;  4DXC A;  2HP9 A;  3MQ0 A;  3IF5 A;  4DJ2 A;  2ZQC A;  3IHB A;  4MDZ A;  3A0S A;  5IT5 A;  2K2N A;  1DY6 A;  3NHQ A;  5G4Z A;  3KYE A;  4G3W A;  5J8X A;  2C5W B;  1KDS A;  4EER A;  4E6W A;  2XH9 A;  3TRC A;  1K6S A;  3FV7 A;  2LB9 A;  3KYQ A;  3WRT A;  1CF0 A;  4GNU A;  2UV0 E;  4HJ3 A;  1T1A A;  1ES5 A;  3LID A;  3L7H A;  4OOL A;  2XSS A;  3IWO A;  5DTT A;  5KMW A;  3IF6 C;  2HDR A;  4HY8 A;  2VX8 A;  2HJ9 C;  3NBL A;  4GS9 B;  3N8S A;  2WYX A;  2W27 A;  2ZL1 A;  3MJQ A;  1V9Z A;  2Y2O A;  2QPN A;  4ME4 A;  1YPR A;  5CGX A;  1Q2P A;  3P98 A;  4KG2 A;  4O0P A;  3VSL A;  3MBZ A;  1XJ3 A;  2A24 A;  2ZQA A;  5FL3 A;  4X25 A;  3RJU A;  3I7J A;  5FQM A;  2OOL A;  3VV4 A;  3SH7 A;  1NRF A;  3S7O A;  1FR1 A;  1KVL A;  3UO9 A;  3M2J A;  3F1P B;  5FQJ A;  1MXO A;  5CED A;  5FAS A;  2JBF A;  3S7N A;  3LY3 A;  4Y0T A;  2O99 A;  4S2I A;  1IYQ A;  3G34 A;  3VP0 A;  3OPL A;  1YSP A;  2W3F A;  3PBT A;  4OPQ A;  3CUE A;  4HH2 A;  3PBR A;  4JXG A;  3BYD A;  1I2W A;  2ZL1 B;  2RL3 A;  5CHM A;  2WAD A;  3LR4 A;  1JWV A;  1PWG A;  2VKS A;  3LIE A;  1CI8 A;  1UWN X;  5EVI C;  1Y4O A;  2XQZ A;  1ES2 A;  2A24 B;  4DXB A;  2Y2M A;  4WMC D;  3TOI A;  5EV0 A;  3PYP A;  3LGO A;  1S6R A;  1PZP A;  3OC2 A;  3UE1 A;  3CIT A;  2QKP A;  4OQI A;  1W5D A;  2PHY A;  4O8G A;  4NXG A;  2VZW A;  3QP8 A;  3OLO A;  4X56 A;  1UGU A;  3DTM A;  3MR0 A;  4JPM A;  5FEG A;  2EXB A;  1LL5 A;  3W8K A;  3HUN A;  2VGL S;  1WYC A;  5AQB A;  2Y2I A;  1FSY A;  1I2S A;  1SDE A;  1ZHH B;  3NC8 A;  5EVI D;  4HOI A;  2WKR A;  3BW6 A;  2W3E A;  3T50 A;  5FQK A;  1AWI A;  2ZQ7 A; 
#chains in the Genus database with same CATH homology
 4XXR A;  5F82 A;  2OLU A;  4D2O A;  1Q2Q A;  2Y55 A;  5FI6 A;  1WE4 A;  4KQQ A;  5GLB A;  2OSU A;  3MZF A;  4MBK A;  5FAT A;  2HDU A;  2WGV A;  4KZA A;  4WZ4 A;  4N1X A;  5TR7 A;  4R3B A;  1MY8 A;  3UNW A;  2Y2H A;  3N8L A;  3TG9 A;  4GOG A;  3RXX A;  2EFU A;  4UA6 A;  4WMC A;  5CRF A;  4KZ3 A;  1LI0 A;  4OPY A;  4FCF A;  4WZ5 A;  5FI2 A;  1BLS A;  2ZQ9 A;  3VP3 A;  4KQR A;  3GV9 A;  1FOF A;  1LLB A;  3G30 A;  1E3U A;  1EI5 A;  1SCW A;  3Q82 A;  5KSC A;  5GLD A;  3FYZ A;  2J8Y A;  2ZJ9 A;  3VSK A;  5F83 A;  1RGZ A;  5L2F A;  2J9O A;  3ITB A;  1K55 C;  2R9W A;  1BSG A;  2X71 A;  5U47 A;  3VP1 A;  4LCL A;  4BQM A;  5I94 A;  3VP4 A;  2Z2L B;  1QMF A;  2V1Z A;  4QHC A;  4S2K A;  4H8R A;  3HBR A;  2RCX A;  1KE0 A;  1VM1 A;  3VFF A;  1K4F A;  4B88 A;  3A3E A;  1LHY A;  4Y0O A;  2EX9 A;  4ZAM A;  5E2G A;  1ONG A;  3LEZ A;  5KZH A;  2H0T A;  1NYM A;  1O07 A;  3C4O A;  3VOZ A;  4JF4 A;  2J7V A;  3HL9 A;  4KZ5 A;  2BG1 A;  4K0X A;  4U0X A;  2ZM0 A;  1QME A;  4GKU A;  1W8Y A;  4LV1 A;  3O86 A;  5EVI A;  5DTS A;  5FAQ A;  1N9B A;  3AGD A;  4FD8 A;  3ZG8 B;  1IYS A;  1C3B A;  4OKP A;  3O88 A;  1RCJ A;  5GHX A;  4KEN B;  1ES4 A;  2IWD A;  1K4E A;  3NDE A;  2R9X A;  4S2N A;  3S1Y A;  1RP5 A;  1IKI A;  4ZJ3 A;  4IBX A;  3TSG A;  3HLC A;  4EUZ A;  1ESU A;  2FFF B;  5JYP A;  4M3K A;  4KZB A;  3UN7 A;  2G2U A;  2GDN A;  1KDW A;  4OPR A;  4C3Q A;  4GN2 A;  5JYO A;  1ZC2 A;  1Z6F A;  3SS5 A;  1N4O A;  1M40 A;  2I72 A;  4LV0 A;  1K6R A;  3PAE A;  5M18 A;  4FH2 A;  3NCK A;  4WM9 A;  1EWZ A;  1JWZ A;  1K57 C;  4CJN A;  3PTE A;  2UWX A;  3GMW A;  4U0T A;  5E43 A;  4Q8I A;  2H5S A;  4E6X A;  1YMS A;  2H0Y A;  2ZQD A;  5AQ7 A;  1NZU A;  3UE0 A;  2DNS A;  2A3U A;  4KQO A;  5CTM A;  5EOE A;  5CER A;  4IVK A;  5GLA A;  1FCN A;  3GSG A;  3QHY A;  3OPH A;  1WYB A;  2XK1 A;  1I5Q A;  4S2P A;  4E3L A;  1GCE A;  3V39 A;  1YM1 A;  3M6B A;  4GDN A;  1MKI A;  5D3O A;  1BTL A;  2Y2L A;  3G2Z A;  1SDN A;  1K56 D;  3VOY A;  4IVI A;  1H8Z A;  1J9M A;  1FSW A;  1MWT A;  3MXR A;  4ZJ1 A;  4E3K A;  2P9V A;  3GQZ A;  4JXW A;  4EBP A;  4OQG A;  4LCM A;  4QB8 A;  4PM5 A;  1NYY A;  3BFE A;  4GDB A;  1YQS A;  3O87 A;  4RYE A;  4PM8 A;  5EVI B;  4KZ8 A;  4C75 A;  1G68 A;  3UPP A;  1MWU A;  3IHA A;  5FQI A;  1CK3 A;  3SS3 A;  3ZFZ A;  4OOM A;  1W79 A;  1XGI A;  3ZG9 B;  3N6I A;  4JF6 A;  3HLB A;  1L0G A;  4A5R A;  4OQH A;  4X6T A;  1YT4 A;  3EQU A;  4C6Y A;  3Q7V A;  4OLD A;  2ZC7 A;  2OV5 A;  2XFS A;  1GHM A;  2Y2J A;  1PW8 A;  3VMA A;  1PZO A;  1PYY A;  1L2S A;  1K54 A;  4OH0 A;  4R3J A;  2XLN A;  4DF6 A;  2EX2 A;  1DJB A;  1O7E A;  3FKV A;  3D4F A;  3IH8 A;  5FAP A;  4WEJ A;  4L0L A;  4RA7 A;  4KG6 A;  3HUM A;  4OON A;  3C7U A;  3FZC A;  2Y2N A;  1K25 A;  3RXW A;  3W4Q A;  2WAE A;  1K55 A;  2ZMA A;  4PMA A;  3HUO A;  4DRT A;  1JVJ A;  1H5X A;  3A3I A;  2WKH A;  4JKT A;  5FAO A;  5E2E A;  1FQG A;  1YMX A;  4GZB A;  4P0M A;  3BEB A;  1CEG A;  4OLG A;  3UPO A;  1K54 C;  4GB7 A;  4HEF A;  1TDL A;  3ZCZ A;  5HW3 A;  3G4P A;  4O7D A;  2EX8 A;  1BLC A;  2QZ6 A;  4PPR A;  3IH9 A;  3IWQ A;  4RX2 A;  1ONH A;  3OPP A;  1PIO A;  4MLL A;  2WGW A;  4KZ7 A;  1PI4 A;  2P9V B;  5TGF A;  1IKG A;  3OPR A;  4MBF A;  5DVA A;  4UA9 A;  1XKZ A;  1LL9 A;  1BUE A;  2WUQ A;  3IF6 B;  1K56 A;  1JWP A;  1E4D A;  1U60 A;  4BJP A;  1L0D A;  5FA7 A;  4E3M A;  4E3J A;  1ERQ A;  5HAQ A;  2XFT A;  2VGJ A;  4DE0 A;  2XD5 A;  3NDG A;  2DRW A;  3PBS A;  4JF5 A;  2VGK A;  4Y0U A;  3GRJ A;  2X02 A;  3OCL A;  4DDY A;  1KVM A;  3AGE A;  3CJM A;  1MWS A;  3GR2 A;  2XEP A;  3QNB A;  1TEM A;  1MBL A;  3JYI A;  3G31 A;  3Q7V B;  4BD1 A;  2E8I A;  2BLS A;  4GD8 A;  3S22 A;  1KGG A;  2XGN A;  5EOO A;  2CC1 A;  3A3D A;  3SH9 A;  1S0W A;  1HD8 A;  1XPB A;  1XA7 A;  4OP5 A;  3SOI A;  5A91 A;  2XDM A;  5A92 A;  4N92 A;  1K57 A;  5EE8 A;  2ZM2 A;  3AGF A;  4P87 A;  1OME A;  1Y54 A;  5E2F A;  3HLW A;  2ZD8 A;  1M6K A;  2Z2M B;  4NET A;  4ZTK A;  1JTG A;  5M1A A;  2JE5 A;  3UPN A;  5A93 A;  5EPH A;  3NY4 A;  5F1G A;  3FKW A;  4KZ6 A;  3ZNT A;  3GTC A;  5AQA A;  4IBR A;  3IXB A;  2JCH A;  4WBG A;  4ZBE A;  5IHV A;  3GVB A;  3HLG A;  4N9L A;  4QU3 A;  3WS4 A;  1KGE A;  3DWZ A;  3WS0 A;  1YLJ A;  5HAR A;  2Y2G A;  4LV2 A;  4MEZ A;  3V3R A;  5FI7 A;  4U3T A;  5DF7 A;  3ISG A;  4BL3 A;  2OLV A;  1ERO A;  1ZG4 A;  2IWC A;  4NK3 A;  2Q9M A;  3BLS A;  2ZC5 B;  4UHU A;  3LCE A;  5GLC A;  3Q81 A;  2PU4 A;  4IED A;  4RX3 A;  4B4X A;  5EUA A;  1ESI A;  5CXW A;  4QY6 A;  1MWR A;  1PWC A;  1ES3 A;  1IYP A;  3BRM A;  1L0F A;  3MKE A;  2J9P A;  1GA0 A;  4KZ9 A;  4S2L A;  5GHZ A;  3ZHH A;  3N8R A;  4DDS A;  3G32 A;  4LV3 A;  3SH8 A;  1YLT A;  4CPK A;  1SKF A;  1KE4 A;  3HLD A;  3ITA A;  3LY4 A;  4R4R A;  2XF3 A;  2G2W A;  5TFQ A;  1NY0 A;  1ERM A;  3ZNY A;  2FFY A;  1XP4 A;  1YLZ A;  3UDF A;  4DE2 A;  2X01 A;  3BFG A;  3IXH A;  3E2K A;  4DE3 A;  1W8Q A;  1LI9 A;  4PM6 A;  5FQQ A;  3PBO A;  4DXC A;  2HP6 A;  3Q7Z A;  3UE3 A;  4UA7 A;  3C5A A;  5DF9 A;  2HP9 A;  3IF5 A;  5FSR A;  3V50 A;  4KG5 A;  4DE1 A;  2ZQC A;  3M6H A;  3IHB A;  3FWL A;  1YLY A;  4WEL A;  1FCM A;  1DY6 A;  3LO7 A;  1TVF A;  1KE3 A;  1HVB A;  3MKF A;  4ZJ2 A;  4X68 A;  5CTN A;  1SHV A;  3A3J A;  5EEC A;  2Y91 A;  1CEF A;  1JTD A;  4OP8 A;  4R23 A;  5J8X A;  2C5W B;  1KDS A;  4E6W A;  2XH9 A;  5HL1 A;  2HDS A;  4Z9Q A;  1K6S A;  3ZDJ A;  3FV7 A;  1NJ4 A;  4OVD A;  4R4S A;  4BEN A;  1NXY A;  5A90 A;  3Q1F A;  3BFF A;  2C6W B;  3WRT A;  4GNU A;  4ID4 A;  1ALQ A;  5FDH A;  5CHJ A;  1ES5 A;  2PBY A;  4S2J A;  4QY5 A;  3HLF A;  1YLP A;  3W4P A;  5HAI A;  4OOL A;  3BM6 A;  3IWO A;  3HVF A;  5DTT A;  3IF6 C;  5KMW A;  3DWK A;  2HDR A;  3ZG7 B;  5CEC A;  4OOY A;  3OCN A;  3EQV A;  3NBL A;  4QJG A;  1AXB A;  3V3S A;  3W4O A;  2Y2Q A;  3MXS A;  4S2M A;  3ZVT A;  4HES A;  2IWB A;  2HP5 A;  3WS2 A;  4E3N A;  1XXM A;  3N8S A;  2WYX A;  4FH4 A;  2QMI A;  3PBQ A;  3C7V A;  5HFO A;  4E3I A;  4EQI A;  5KSH A;  3MZD A;  2Y2O A;  2QPN A;  1G6A A;  2Y59 A;  5CGX A;  1FR6 A;  1Q2P A;  3OZH A;  3P98 A;  3PAG A;  4S2O A;  1DJC A;  1XA1 A;  3IT9 A;  1E25 A;  4KG2 A;  5FQ9 A;  3WS5 A;  2DCF A;  1BT5 A;  1BLP A;  2WKI A;  3NIA A;  5DF8 A;  3VSL A;  5BOH A;  3MBZ A;  2ZQA A;  1ZKJ A;  2WK0 A;  3RJU A;  2ZC3 B;  1XX2 A;  1VQQ A;  1IEM A;  4X69 A;  3I7J A;  5FQM A;  3UDI A;  4EBN A;  2Q9N A;  3G35 A;  4E3O A;  3SH7 A;  2WKE A;  1BLH A;  1NRF A;  1ZG6 A;  3B3X A;  5AQ9 A;  4JXV A;  3IXG A;  3BEC A;  2ZLY A;  1IEL A;  4MBH A;  4JXS A;  4WZ5 C;  4K0W A;  1FR1 A;  1RGY A;  3HLE A;  4JBF A;  4P85 A;  2WGI A;  1KVL A;  1PW1 A;  5GL9 A;  2B5R A;  3M2J A;  3BFC A;  4KZ4 A;  3UO9 A;  5F1F A;  3NI9 A;  3A3F A;  5FQJ A;  3P09 A;  1MXO A;  5CED A;  5FAS A;  2JBF A;  1H8Y A;  3LY3 A;  3O3V A;  3WRZ A;  4EBL A;  4Y0T A;  4R0Q A;  4S2I A;  1IYQ A;  1NZO A;  3WS1 A;  3G34 A;  1L0E A;  4XUZ A;  1MPL A;  3VP0 A;  2ZM8 A;  3OPL A;  3CMZ A;  4LEN A;  1W7F A;  4YIN A;  3PBT A;  4HBU A;  1TDG A;  2WGW B;  3PBN A;  4OPQ A;  4EWF A;  1KGF A;  2HPB A;  1GA9 A;  4FSF A;  2P74 A;  3PBR A;  4JXG A;  1BZA A;  3BYD A;  1I2W A;  2ZQ8 A;  2RL3 A;  5EVL A;  5CGW A;  3CZD A;  5CHM A;  1FCO A;  2WAD A;  2PU2 A;  1JWV A;  1PWG A;  4BD0 A;  3HRE A;  3BLM A;  3N7W A;  4XUX A;  2JC7 A;  2HDQ A;  2EFX A;  1CI8 A;  3BFD A;  2EX6 A;  5EVI C;  3MFD A;  4EV4 A;  2EXA A;  1PI5 A;  2XQZ A;  1ES2 A;  2Y2K A;  2V20 A;  1CI9 A;  3SS4 A;  3UY6 A;  3ZGA B;  4QD4 A;  3ZG5 A;  1HTZ A;  4MNR A;  4HBT A;  4DXB A;  4PM7 A;  2A49 A;  1GHI A;  2Y2M A;  4OQ0 A;  4WMC D;  3ZG0 A;  4S2N C;  3ZVW A;  2XD1 A;  4R1G A;  3TOI A;  1S6R A;  1PZP A;  3OC2 A;  4YFM A;  1E3U D;  3E2L A;  3UDX A;  4WEK A;  3UE1 A;  3G2Y A;  3DW0 A;  3N4I A;  4OQI A;  1W5D A;  5HX9 A;  4N9K A;  5HAP A;  3VP2 A;  4X55 A;  2ZC6 B;  1GHP A;  3M2K A;  4X56 A;  2WAF A;  4X53 A;  5DTK A;  4K91 A;  4F94 A;  3DTM A;  1YLW A;  3MZE A;  4JPM A;  5CGS A;  1PWD A;  2Y2P A;  4DKI A;  2Y4A A;  3C4P A;  4ZDX A;  4UAA A;  2EXB A;  1LL5 A;  3W8K A;  3HUN A;  2XR0 A;  3IF6 A;  1WYC A;  2ZC4 B;  2H10 A;  3CG5 A;  4N1H A;  5AQB A;  2Y2I A;  1IYO A;  3Q07 A;  1FSY A;  1I2S A;  1SDE A;  3S4X A;  5G18 A;  4OPZ A;  4B4Z A;  5CHU A;  3NC8 A;  5EVI D;  2WZZ A;  3IQA A;  3IWI A;  3IXD A;  5GHY A;  4RVA A;  1K38 A;  3QNC A;  4P6B A;  3WWX A;  2V2F F;  5E2H A;  5M19 A;  4BLM A;  5CEB A;  4Y7P A;  1HZO A;  4WYY A;  3VFH A;  4JLF A;  5FQK A;  2WZX A;  1BUL A;  4PM9 A;  4BL2 A;  1XGJ A;  1DJA A;  4GD6 A;  3V5M A;  2ZQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...