4MN6A

Crystal structure of truncated pas domain from s. aureus yycg
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
96
Chain Sequence
ITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIGYYMLSVLSLEDEFKLEEINNDSFLLDLEGLIARVNFSTIVQETGFVTGYIAVLHDVTEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Sensor protein kinase WalK
publication title Crystal structure of PAS domain of S. aureus YycG
rcsb
source organism Staphylococcus aureus
total genus 14
structure length 96
sequence length 101
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4mn6A00
2B02A 5HZHA 2I9VA 2R78A 2V9AA 2W0NA 4DJ3A 2QKPA 4HIAA 2PR6A 3H82B 1OTDA 4LRXC 3LI9A 2H28A 1ODVA 1N9OA 4R38A 3G6OA 5G4YA 3LI8A 3UB8A 1V9ZA 2OWJA 1BYWA 4HP4A 2Z6CA 5TBMA 1WA9A 2PYPA 4GCZA 2K7SA 1DP6A 3H9WA 4HJ6A 5J7EA 4JGPA 5A8BA 1T1CA 1XJ3A 1UWNX 5F68A 1LSXA 5HDCA 4RQ9A 4HHDA 4E04A 4LLOB 3NHQA 4GHIB 4WLAA 2QJ7A 4PKYA 1TS7A 2Z6DA 1T19A 2EA9A 2YKHA 4I3IA 1S4SA 3LIFA 4NXEA 3IBRA 1S1YA 2ZOIA 3H82A 4HH2A 1F9IA 3BWLA 4EEUA 2V0UA 3ICYA 4XT2B 3H7WB 4LPZA 2KX6A 3LIEA 3NOUC 4GS9B 3LUQA 3FG8A 3NOTC 1T1BA 1OTBA 2D01A 1S67L 3UMEA 2OOLA 3F1PB 2M1CA 3E4PA 4LRZE 3MXQA 5J4EA 2PDRA 1N9LA 2WKPA 4GHIA 1XJ2A 5IU1A 5F69A 3T50A 2J80A 2PR5A 3FC7A 1DP8A 1OT9A 5HWTA 3C2WA 3CLOA 1LT0A 1Y28A 2PHYA 4EQ1A 5DJUA 2INWA 3GECA 4H6JB 2D02A 4JGRA 1OTIA 3E4QA 4KUOA 3K3DA 4NXFA 4XT2A 3H7WA 1S4RA 5HD3A 1S66L 1DP9A 3P7NA 1XJ6A 3UB9A 3KX0X 2PD7A 1KOUA 1X0OA 4GS9A 4R70A 1VB6A 4WF0A 1OT6A 3EEHA 5HWVA 1EW0A 1F98A 3D72A 1LSWA 3VE4A 4R6LA 3E4OA 1XFQA 3K3CA 1GSWA 2JN7A 1N9NA 3B33A 5DJTA 2V1BA 2PYRA 4L9GA 3HJKA 2WKQA 4LRYC 4KUKA 1TS8A 3MFXA 2A24B 3CWFA 5G4ZA 2VEAA 3ULFA 1XFNA 3MQQA 4GW9A 1LSVA 4L9EA 1D06A 5EFWA 1TS6A 5DKLA 4BBVA 4WL9A 1LL8A 2BASA 4EXOA 3CAXA 4EW7A 2KDKA 1V9YA 2L0WA 4BBTA 1MZUA 2VV7A 2L1MA 3SW1A 3F1NB 3UB6A 1P97A 4NXGA 4PKYG 5J3WA 4HOIA 5I5LA 5TBMB 4M4XA 4I39A 4WN5A 1GSVA 4B9OA 4JGQA 5AVEA 2VV6A 3A0RA 4KQDA 4L9FA 5IS1A 4HH3A 4K08A 4HNBA 2A24A 2QHKA 3PHYA 2PD8A 3MQOA 3OLOA 2HV1A 3EWKA 2VLGA 2W27A 4HI4A 5HDSA 1OJGA 5HSQA 3F1OB 4I3AA 2ZBBA 4EESA 3LIBA 3MR0A 3NJAA 3F1NA 3F1PA 3UE6A 3UB7A 3VE3A 3LIAA 1JNUA 1UGUA 5HD5A 1TS0A 2OWHA 4HJ3A 3RTYA 3MJQA 2P7JA 3GDIA 3ZQ5A 4BBUA 3RH8B 3PYPA 3IS2B 2CMNA 4F3LB 3C8CA 2VV8A 4MN6A 5HWWA 1P0ZA 2WKRA 3LICA 1G28A 2GJ3A 2L4RA 4R3AA 4HP9A 2QJ5A 4H6JA 1S1ZA 2JHEA 3A0SA 3LIDA 4I5SA 4EERA 4JGOA 4EETB 4WUJA 4HY8A 5DKKA 2YKFA 3BY8A 3BY9A 4MN5A 1T1AA 4I38A 3F1OA 3LYXA 5F5YA 5AVFA 1D7EA 1DRMA 3VOLA 4I3JA 2QWSA 3NOPC 4EEPA 3HJIA 4NXBA 1GSXA 5HDDA 3A0VA 1NWZA 4HQAA 4DJ2A 4YWZA 1XJ4A 4HJ4A 1OJ5A 3UMDA 1T18A 2V1AA 5KIZA 2ZOHA 5F6AA 1OTEA 1OTAA 3IS2A 1UWPX 2V0WA 4F3LA
chains in the Genus database with same CATH superfamily
5BOHA 1TVFA 1VEUB 3UB5P 4X6TA 3MQ0A 5F1FA 4DE0A 4XUZA 2QKPA 3G35A 3O86A 2GDNA 1OTDA 5HW3A 4X55A 4ETZA 1HLUP 4LENA 4ESPA 1ERQA 4IVKA 4Q0IA 2IA2A 3IF5A 4QY5A 4P6ZS 1QMEA 4IBXA 4R38A 1F5MA 3QNBA 3UB8A 2H10A 2OWJA 2OV5A 4JF4A 5E2FA 1WA9A 2K7SA 5J8XA 5J7EA 4YNRA 2XR0A 3HLWA 4MMNA 1XJ3A 5GLAA 3MF0A 4II7A 5HDCA 4GDBA 2EX2A 2QZ6A 3MMHA 4HHDA 4E04A 4LLOB 2X01A 3NHQA 3VFHA 2V8FA 4GHIB 2QJ7A 1TS7A 1K54C 2Y2GA 4LGWA 3S7NA 2O0YA 4E3OA 2HPBA 1S1YA 5EOEA 4RX2A 1IKIA 1F9IA 3LEQA 2ZMFA 4KQOA 2Y2LA 4KZBA 5K5BA 3IX4A 4Z1WA 4LPZA 2OAP1 2H5SA 5FQIA 1Y4OA 1LL5A 3BJNA 2W1TA 3FZCA 3VP0A 1J3WA 2Y2HA 5L10A 3T12B 3KYEA 5L8MA 1K57C 5FQKA 3HL9A 3MXRA 1T1BA 1W7FA 3L7HA 1PYYA 3UMEA 3SH9A 3F1PB 5EVIC 2DRWA 4OPYA 3AGEA 1M6KA 2VZWA 3NI9A 3E4PA 2Z2MB 1FCNA 5J4EA 3GR2A 4OQIA 1N9LA 1PW8A 5EV0A 5IT5A 4OQ0A 5CRFA 3DBAA 3LY4A 2VKSA 1GHIA 3C2WA 5A90A 4QD4A 2PHYA 3OCNA 5DJUA 2INWA 3GECA 4S2JA 3W4QA 4H6JB 3U2AA 3DTMA 4Y0TA 3TG9A 4OLDA 4NXFA 4XT2A 3H7WA 4RVAA 3LR5A 1S4RA 1E3UD 3BQ8A 3P7NA 3SH8A 1YPRA 3UB9A 1LL9A 5HAQA 2PD7A 4KZ7A 1X0OA 4R70A 1YLZA 3OPPA 3GQZA 1NXYA 3IH9A 4MEZA 4WF0A 3KYZA 4X53A 3EEHA 2XSSA 2XF3A 1OMEA 3OBFA 4R6LA 3E4OA 3KYQA 4UA9A 1Q2PA 2G2UA 5EVEA 3HREA 1N9NA 3ZVWA 5DJTA 4L9GA 3NC8A 2WKQA 4P6BA 3UE0A 1CI8A 2R9WA 1XGJA 1TS8A 2P08A 3MFXA 2A24B 5EVIA 4BL3A 3CWFA 3ULFA 2VEAA 3GRJA 4E3IA 2XFSA 3MQQA 2EFUA 1LSVA 2B18A 4FD8A 5FQQA 4MDZA 3LEZA 3QP4A 4BBVA 4WL9A 1F2KA 3KSGA 1YLYA 3BFCA 4NG2A 3CAXA 5JYPA 2XQZA 3EQUA 3QP1A 4Y3IA 4GNUA 2ZMAA 2M7UA 3HUNA 1MZUA 3I7JA 2LB9A 5EM0A 5C5KA 4WBGA 3N4IA 1KGGA 5J3WA 3ZVTA 4ZRRA 2X71A 5GHYA 4I39A 3EQVA 1GSVA 3A0RA 4Y5FA 3Q7VA 2XGNA 1YMXA 3L9KA 1IEMA 4WELA 3SH7A 1SCWA 3BLSA 4CQHA 4L9FA 5IS1A 2ZQ8A 2HDSA 3TRCA 2V20A 2QYBA 3FV7A 3D4FA 1ESIA 2W1RA 1WYBA 2V8CA 4JBFA 1NYMA 3TW8A 5L09A 3OLOA 1DJAA 3G34A 1GCEA 2VLGA 3N8LA 2JCHA 4HBTA 1ES5A 4FCFA 5E43A 3UY6A 4E3JA 1MPLA 3N8SA 4EUVA 3OOVA 5HSQA 3WS4A 1ES2A 1PRQA 3FKVA 1XP4A 3QP6A 3JPUA 1A0KA 3F1PA 4G3VA 5GLCA 3LIAA 2AVXA 4PM8A 2K31A 1OPXA 1Q2QA 1TDLA 3CZDA 3IXBA 1UGUA 1GHPA 1FR6A 3O88A 5FI6A 4U3TA 4ZBEA 5GL9A 3Q07A 4KZ3A 2OWHA 1DJBA 3ITBA 1ZKJA 4ZTKA 4MCWA 2P7JA 3ZQ5A 3RH8B 3NCKA 1I5QA 1TF1A 4S2LA 3C8CA 2XD5A 1TDGA 5HWWA 4IEDA 2W3GA 1CK3A 2L4RA 3MSHA 5LBRA 1XXMA 4H6JA 1BLSA 3QP8A 1FIKA 4JGOA 1XKZA 4EETB 3BEBA 2WAEA 2EWWA 3MS6A 1L3LA 1YLJA 3IX3A 3CG5A 3BY9A 1BLPA 3T4QA 3OPRA 5FAQA 1PWCA 3T1QB 4I38A 5FATA 3HBRA 4DE1A 3PR6A 3LYXA 3A3FA 1D7EA 1DRMA 4I3JA 1ZG4A 2EX8A 2WZZA 5KZHA 2Y59A 4ZJ1A 1NLZA 3LR0A 4Y13A 5FA7A 1NWZA 1XA1A 4MLLA 5AJGA 4RA7A 4HJ4A 4QPRA 1OJ5A 1AWIA 2Y2MA 3SS4A 3E2LA 2V1AA 1FSWA 4Y7PA 5EVLA 2ZOHA 4XUXA 2A2LA 1YQSA 1OTEA 3IS2A 4F94A 1S0WA 4MBKA 1K55C 3BM6A 1O7EA 2ZQ7A 3BYDA 1I2SA 3B3XA 5FDHA 2I9VA 3P09A 1YM1A 1N9BA 2W0NA 4HEFA 5L2FA 3VP1A 3TJZC 1YLTA 4E6WA 5U47A 2H28A 4NETA 4ZJ3A 4KZ5A 1MWSA 3WRTA 3PBTA 5TJJA 2W1TB 3OPLA 3HLBA 3OPHA 4Y0UA 4BWIA 5KSHA 1KGFA 1RP5A 1V9ZA 3GMWA 3MXSA 4OVDA 2J9PA 1KDSA 2P04A 3MBZA 4UEYA 4PMAA 1PW1A 4HJ6A 4GD6A 2JC7A 4JGPA 3UPPA 5A8BA 1T1CA 1YSPA 2WADA 4N1XA 2V2FF 1MWTA 4RQ9A 3D9YA 2P9VA 4S2OA 4WLAA 4X68A 3ZCZA 1ZC2A 2Q9MA 1NZOA 4WZ5A 4R1GA 1PI5A 4I3IA 3LIFA 4N9LA 2WKHA 2WGIA 2XLNA 2ZOIA 3IBRA 3N7WA 4N1HA 2Y2KA 2PU4A 3W8KA 3PBOA 4D2OA 5KMWA 4XT2B 1IYQA 3H7WB 2HJ9C 4GB7A 1DJCA 2KX6A 2DCFA 3W4PA 3LUQA 3NOTC 5HL1A 3RXWA 3EOIA 3UE1A 2D01A 1VETA 3G30A 2M1CA 5HARA 2ACGA 4KZ6A 4LRZE 3MXQA 3IQAA 2PDRA 1Z09A 5HAIA 3T4OA 4IUHA 3SS3A 3T50A 2GX5A 3HVFA 2J80A 1LHYA 4YOFA 1WYCA 3T4TA 5EM1A 3FPVA 3V5MA 3NBLA 4CLCC 1LI9A 5EVIB 5CEBA 1H3QA 1Y28A 3KSIA 2EWVA 1OTIA 3PAGA 3E4QA 3QHYA 4KUOA 3K3DA 2H0TA 3W4OA 2VK3A 2VX8A 2JKGA 4EV4A 4EWFA 1DP9A 2WGVA 5E2EA 5L07A 4LV1A 1KOUA 1P9RA 3R4KA 4E6XA 1BSGA 4KG2A 4DXCA 2ZL1A 1VB6A 1ES3A 1HZOA 4OOYA 1SHVA 1OT6A 1W79A 2JKFA 3WS2A 3IF6C 5HWVA 3NY4A 1F98A 2B95A 1I2WA 3D72A 1LSWA 1G68A 1XFQA 2Y2OA 1FOFA 1MBLA 3FPWA 3Q7VB 3SZTA 1GSWA 3CUEA 1K0KA 2JN7A 3O5YA 4QJGA 2J3TD 4N9KA 3IHBA 4WYYA 4LRYC 2O99A 4KUKA 4UA7A 5F83A 1L0FA 4C6YA 4DDYA 1XFNA 3T1RA 1E4DA 5A92A 1PIOA 5FQJA 4JXGA 1K6RA 3VP2A 3O3VA 5MC7A 4WM9A 5DKLA 4Q8IA 2FFFB 3BFGA 2PAVP 3HLDA 5A91A 2KDKA 3LO7A 2H0YA 4IBRA 4OLGA 2L1MA 3C7VA 3CPTA 4DN0A 4PM9A 3V3SA 5M18A 4EU0A 3UB6A 1P97A 1GA0A 4PKYG 3VMAA 5TBMB 2BG1A 4WN5A 1H8MA 3B42A 5AVEA 1MWRA 4B4XA 5CGXA 3FKWA 1VQQA 3W2ZA 4K08A 3ZDJA 1MWUA 1BT5A 1BZAA 3PHYA 1XPBA 1FR1A 3S7QA 4RX3A 4ZAMA 5FAPA 3Q1FA 1K54A 4PM6A 1BUEA 3NIAA 2ZC6B 1JWPA 5AQ7A 4I3AA 3IBJA 1PWGA 1ES4A 3DTEA 4EESA 2JE5A 3LIBA 2O9AA 3DW0A 4OKPA 3UE6A 3VE3A 4WEKA 1VHMA 1JNUA 1IELA 4BENA 1BLCA 2RL3A 4HBUA 2UWXA 1TS0A 4HJ3A 3RTYA 1K57A 2FH5A 3MJQA 3ZG9B 4ETXA 4OOLA 1YMSA 1KE4A 4OQGA 2ZQAA 3PYPA 3IS2B 4QY6A 4X1LA 2PRFA 2ZLYA 3BW6A 3MZEA 4MBHA 5M1AA 4D60A 1P0ZA 3BFFA 5F82A 5DVAA 2QJ5A 1K38A 1RCJA 2QPNA 3IX8A 4IUKA 3A0SA 4X25A 3BQAA 3WS5A 4ZDXA 2DMWA 2PU2A 4WUJA 2UV0E 3D3OA 3PBNA 4PAUA 3BY8A 3G2ZA 3DWZA 5KSCA 1E25A 1K56A 3F1OA 1WE4A 5F5YA 1L2SA 3R7WA 2EX9A 1W5DA 1NYYA 1RGZA 4OPQA 3NOPC 4S2PA 4EEPA 3HJIA 4GN2A 4NXBA 3IWQA 3VP3A 1VM1A 4GDNA 3CMZA 5G18A 3RFBA 4UQIM 1J9MA 3QP5A 1PI4A 3ZNYA 3OC2A 4GZBA 1SDEA 2P9VB 5KIZA 1L0EA 4DDSA 1OTAA 2V0WA 3SOIA 4F3LA 1PZPA 4JPMA 1KE3A 2B02A 4OPRA 2R78A 1YAXA 4DJ3A 4HIAA 2PR6A 2W3FA 5AQ9A 4B4ZA 1JTGA 4L0LA 5CERA 4GJ4A 4LRXC 3LI9A 4YFMA 2G7UA 1N9OA 2E8IA 1YSQA 4BLMA 1CI9A 1SZVA 2HDQA 4EBLA 3PXPA 2RCXA 1CEGA 5CTNA 1BTLA 5D3OA 3LI8A 3IHAA 1C3BA 3CJMA 5FEGA 1H0MA 4S2NC 2Z6CA 5TBMA 2PYPA 3UDXA 1VETB 3A3EA 5CTMA 1DP6A 2C6WB 3H9WA 4MN7A 3GTCA 4JXVA 2Y2QA 3VFFA 3ISGA 1LSXA 1IKGA 3E98A 4Y0OA 3UE3A 1YT4A 2M7VA 2W3EA 4AFIA 4PKYA 5CXWA 2Z6DA 3WS0A 1T19A 3ZNTA 2EA9A 2YKHA 4O7DA 5FAOA 1ERMA 5E2GA 3T4JA 1MKMA 3E2KA 3H82A 1LLBA 4HH2A 4DF6A 4UQIS 3EGDC 3ICYA 3WS1A 4BD1A 1ONGA 5HFOA 2XK1A 5FQMA 1ZG6A 1U60A 3LIEA 3NOUC 4G3WA 4Y15A 1XX2A 3FG8A 1M40A 5EVID 2HJEA 5CHJA 5GHZA 3VOZA 1YLPA 2ZL1B 3QNCA 4GLQA 4Y2FA 4EBNA 3DWKA 2JKRM 2IWCA 2OOLA 3MKEA 1ACFA 2MJ6A 4KZ9A 2IWBA 3O87A 2ZM0A 3G32A 1XJ2A 3P01A 5IHVA 3NDEA 2PR5A 2Y55A 3C5AA 1GA9A 1G5UA 4P85A 5HWTA 3ZFZA 4BJPA 4O8GA 4OP8A 3CLOA 4EQ1A 4H8RA 5E2HA 3MZFA 2D02A 4JGRA 3S7PA 3ZG5A 2J3WA 2XA7M 4UAAA 1S66L 4ZJ2A 3KX0X 3C7UA 4IJGA 2ZC3B 4GS9A 3M2JA 1G6OA 3RXXA 4KQQA 3CPTB 1LI0A 3AGDA 5AQAA 4LFUA 3OZHA 3VV4A 2B5RA 3HLGA 4P0MA 3VE4A 1XA7A 3CITA 5DTKA 3M6BA 3T4SA 2HGVA 4WMCA 3LCEA 4CPKA 2V1BA 4OQHA 3HJKA 1W63Q 2WYXA 2WGWA 3TE8A 4LCLA 4P6ZM 2Y2JA 5G4ZA 5JYOA 2J7VA 2Y2NA 4L9EA 1D06A 4C75A 3HUOA 5DTSA 5TGFA 4BD0A 1TS6A 1K55A 4MNRA 4FH4A 1LL8A 2WUQA 3ZGAB 4RYEA 2ZQCA 4P87A 2Z2LB 4EW7A 4BQMA 5AQBA 4Q0HA 2L0WA 3E0YA 4BBTA 3HLFA 1JWVA 2VV7A 1PFLA 3CHWP 2Q9NA 4NXGA 1KDWA 3PBQA 1EROA 4JXSA 4HOIA 1K4FA 4KENB 5EOOA 2XDMA 4M4XA 1JTDA 4FH2A 1K25A 4B9OA 4JGQA 2VV6A 3OCLA 3A3DA 4KQDA 4R3JA 3NDGA 1PNEA 1E3UA 2GNXA 2LB5A 2Q0OA 4HH3A 4OPZA 2VGKA 1GHMA 4HNBA 3V3RA 2NUTC 3LGOA 4X56A 5F1GA 2XD1A 3UDIA 4PHTA 4DE3A 3MQOA 3M6HA 3ZYTA 2HP5A 2K2NA 4FSFA 4KG5A 3ZG0A 2W27A 2ZM2A 4JF5A 1DY6A 1OJGA 2I72A 3BECA 3F1OB 1Z6FA 4QB8A 1IYSA 3R7WB 2ZBBA 3UNWA 1H8ZA 4QHCA 3MR0A 4S2IA 3CI6A 4JXWA 1ZHHB 3F1NA 5FQ9A 5FEFA 4FOFA 3IXGA 3NULA 4ID4A 4BBUA 1QMFA 3IH8A 5HPIA 3A3JA 2CMNA 3FWLA 5TFQA 4JLFA 3WWXA 4F3LB 2VV8A 4MN6A 4IVIA 3LICA 3RJUA 1G28A 4R3AA 1FCOA 3M2KA 3S22A 1S1ZA 3JVVA 2JHEA 3K2NA 2Y4AA 3JVUA 4CLCE 4DXBA 4E3MA 3U4LP 4HY8A 5DKKA 2YKFA 4XXRA 1RGYA 1SDNA 4MN5A 4WMCD 3T4KA 2OSUA 3HLCA 5FI7A 4CLCA 1IYOA 5AVFA 3GV9A 5CECA 3VOLA 3HLEA 2QWSA 5EUAA 3C30A 1GSXA 1L0GA 5HDDA 3A0VA 2G2WA 3Q7ZA 2CC1A 4Q0JA 1NY0A 4YWZA 1NZUA 5GLBA 1XJ4A 3UMDA 5A93A 2R9XA 4K0XA 2EFXA 2JKTI 3Q82A 3KSHA 5CGWA 4KZ8A 4ARZA 2Y8HA 3V39A 2HP9A 1HVBA 3IF6A 1STZA 1UWPX 2ZM8A 2VGJA 3VOYA 2WKIA 5HZHA 4PPRA 3DTKA 2V9AA 1PZOA 3H82B 5M19A 4WEJA 3PBSA 2FFYA 1ODVA 1AXBA 1H8YA 1MY8A 2Y91A 3ZG8B 2VA0A 3G6OA 5G4YA 1FQGA 3VP4A 1BYWA 1ALQA 4U0TA 4HP4A 1KE0A 1EI5A 4GCZA 1HTZA 5FASA 2VJWA 2Y2PA 1UWNX 4N92A 5F68A 4OOMA 1D1JA 4OH0A 2EXAA 4X69A 1G6AA 3BRMA 3ZHHA 4R4SA 2WK0A 2HDRA 1SKOA 1H5XA 1W63M 1MKIA 1S4SA 1VEUA 4NXEA 4X1MA 3Q81A 2Y2IA 2ZQ9A 1CJFA 3BLMA 3GSGA 3MFDA 3BWLA 4EEUA 4LV3A 2V0UA 2W3HA 4FTXA 3BFDA 4KZ4A 2GZAA 5DF8A 2ZC5B 3LY3A 4U0XA 3S4XA 4GS9B 1K6SA 3IXDA 4E3NA 1OTBA 2PBYA 5FL3A 4K91A 3PTEA 4UA6A 1KVLA 1S67L 4E3KA 2OLUA 5CGSA 2JKRI 4R0QA 1MC0A 2ZMVA 4A5RA 5HAPA 2JKTM 4O0PA 1L0DA 3EGXC 4GKUA 3UPNA 3BFEA 3NECA 3P98A 5CEDA 2WAFA 1W8YA 1NJ4A 2WKPA 2XROA 4GHIA 5IU1A 4JF6A 5F69A 3SS5A 4CLCD 2XRNA 3FC7A 4BL2A 2WGWB 5FDSA 1DP8A 1FILA 2KLIA 4PM5A 1OT9A 3HCYA 5HX9A 4E3LA 1PWDA 3T1SA 1LT0A 4QWOA 5CHMA 4KQRA 2A3UA 4EUZA 1ONHA 3IXHA 4JKTA 3G31A 4GD8A 2VGLM 3C4OA 4YINA 3S1YA 2IWDA 5HD3A 2WZXA 5DFYA 1XJ6A 2Y79A 1CEFA 3PBRA 1K4EA 4OP5A 2OLVA 3N6IA 4B88A 3IWIA 3KO6A 2QMIA 2BLSA 3VSKA 1XGIA 4Y17A 5HL6A 2DNSA 3G4PA 1EW0A 2J9OA 2V1ZA 2W3DA 3K3CA 3N8RA 5DTTA 4Z9QA 5CX7A 1N4OA 5CHUA 3B33A 4KZAA 2PYRA 3T1XA 4IHQA 3IWOA 2JBFA 1SKFA 1KVMA 5I94A 2J3TC 4QU3A 2HP6A 3FYZA 3KSFA 1YLWA 5EPHA 4GW9A 3MKFA 5EFWA 1FSYA 4LCMA 4LV2A 5DFXA 2BASA 4EXOA 5HPFA 3HUMA 2EX6A 1V9YA 2HZ5A 3LR3A 3MZDA 3SW1A 4BMWA 3DAVA 3F1NB 3T4LA 2X02A 5I5LA 4G3KA 1ESUA 4WZ5C 4O01A 3PAEA 5FI2A 4LV0A 2VGLS 4MBFA 1K56D 3A3IA 1IFQA 4CJNA 4S2NA 5DF7A 4DRTA 1NRFA 3S7OA 4HESA 3DTIA 2NUPC 2P74A 3WRZA 5GLDA 2PBDP 2WKEA 2A24A 2QHKA 3LR4A 2PD8A 1O07A 4NKPA 1NLYA 1Y54A 2HV1A 3EWKA 3QP2A 3TSGA 2KOIA 3VSLA 4HI4A 5HDSA 4UHUA 4CLCB 1TD5A 3C38A 5EE8A 1MXOA 3GVBA 4DKIA 3NJAA 2O9BA 1P9WA 3UB7A 2C5WB 3V50A 2OAQ1 3TOIA 3EEAA 4K0WA 3AGFA 5HD5A 3UPOA 3B47A 4NK3A 4OONA 1TEMA 3GDIA 3G2YA 4ARZB 2E8JA 3ITAA 3UDFA 1JWZA 3IF6B 2XEPA 5DF9A 2HF6A 2BTFP 5EECA 1S6RA 3UN7A 2WKRA 1EWZA 2A49A 2GJ3A 2EXBA 4HP9A 1YKDA 3UO9A 4EBPA 2XFTA 4R3BA 3LFVA 4WZ4A 1BULA 4PM7A 3LIDA 3ZG7B 4DE2A 4C3QA 4I5SA 1BLHA 2FZ0A 1IOUA 4EERA 1ZTUA 4R4RA 4R23A 1HD8A 1JVJA 2PT7A 4FUWA 5FSRA 1CF0A 4S2MA 4EQIA 2ZC4B 1W8QA 1T1AA 2O9CA 5GHXA 3IT9A 4B93A 3JYIA 2HDUA 2XH9A 3CUEC 5TR7A 2ZC7A 4ME4A 1NRJA 4GOGA 4HQAA 3C4PA 2ZD8A 4DJ2A 3V67A 1FCMA 4DMZA 4S2KA 2J8YA 2XA7S 1IYPA 1T18A 4KG6A 1CQAA 4NEED 1KGEA 5F6AA 4M3KA 2ZQDA 2ZJ9A 1SKOB
chains in the Genus database with same CATH topology
2B02A 5HZHA 2I9VA 3MQ0A 2R78A 2V9AA 2W0NA 1YAXA 4DJ3A 2QKPA 4HIAA 2PR6A 2W3FA 3H82B 4L0LA 4WEJA 1OTDA 3TJZC 3PBSA 4GJ4A 4LRXC 3LI9A 2H28A 1ODVA 2G7UA 1N9OA 4ETZA 1YSQA 4Q0IA 2IA2A 3PBTA 3PXPA 5TJJA 2VA0A 2W1TB 4P6ZS 4R38A 4BWIA 5KSHA 3G6OA 5G4YA 1F5MA 3LI8A 3UB8A 1V9ZA 2OWJA 1BYWA 4HP4A 2Z6CA 5TBMA 1WA9A 2PYPA 4GCZA 2K7SA 2P04A 1DP6A 3H9WA 4MN7A 4UEYA 4HJ6A 5J7EA 4YNRA 4JGPA 4MMNA 2VJWA 5A8BA 1T1CA 1XJ3A 1UWNX 1YSPA 5F68A 3MF0A 4II7A 1LSXA 4OOMA 5HDCA 3MMHA 4RQ9A 4HHDA 4E04A 3E98A 3UE3A 2M7VA 4LLOB 3NHQA 4GHIB 4WLAA 2W3EA 2QJ7A 4AFIA 4PKYA 1TS7A 2Z6DA 1T19A 1W63M 2EA9A 2YKHA 4I3IA 1S4SA 3LIFA 3S7NA 4NXEA 2O0YA 3T4JA 3IBRA 1S1YA 2ZOIA 1MKMA 3H82A 4HH2A 1F9IA 3PBOA 2ZMFA 3BWLA 3EGDC 4KQOA 4UQIS 4EEUA 2V0UA 3ICYA 2W3HA 5K5BA 4XT2B 3H7WB 2HJ9C 4Z1WA 2GZAA 4LPZA 2OAP1 2KX6A 3BJNA 2W1TA 3LIEA 5L8MA 3NOUC 4GS9B 4G3WA 3LUQA 3FG8A 2HJEA 3NOTC 1T1BA 1OTBA 3EOIA 5FL3A 2D01A 4GLQA 1S67L 4Y2FA 3UMEA 2JKRI 2JKRM 1MC0A 2OOLA 2ZMVA 3F1PB 2M1CA 2JKTM 2MJ6A 4O0PA 3EGXC 2VZWA 3E4PA 4LRZE 3MXQA 5J4EA 2PDRA 1N9LA 3T4OA 4IUHA 2WKPA 2XROA 4GHIA 1XJ2A 5IU1A 3P01A 5F69A 4CLCD 3T50A 2GX5A 2XRNA 2J80A 2PR5A 3FC7A 4YOFA 5IT5A 3T4TA 3DBAA 1DP8A 2KLIA 2VKSA 3FPVA 1OT9A 3HCYA 5HWTA 4BJPA 3C2WA 4O8GA 4CLCC 3CLOA 1LT0A 1H3QA 1Y28A 2PHYA 4EQ1A 3OCNA 5DJUA 3KSIA 2INWA 3GECA 4H6JB 3U2AA 2D02A 2EWVA 4JGRA 1OTIA 3E4QA 3S7PA 4KUOA 2VGLM 3K3DA 4NXFA 4XT2A 3H7WA 3LR5A 1S4RA 2J3WA 2VX8A 5HD3A 3BQ8A 2XA7M 1S66L 1DP9A 3P7NA 5DFYA 1XJ6A 3UB9A 2Y79A 3KX0X 2PD7A 1KOUA 4IJGA 3PBRA 1P9RA 3R4KA 1X0OA 4GS9A 4R70A 1G6OA 3KO6A 1VB6A 4WF0A 5HL6A 1OT6A 3KYZA 3EEHA 5HWVA 1EW0A 1F98A 3VV4A 2XSSA 3D72A 1LSWA 3OBFA 3VE4A 4R6LA 2W3DA 3CITA 3E4OA 3KYQA 1XFQA 3K3CA 3FPWA 3T4SA 2HGVA 1GSWA 3CUEA 5CX7A 2JN7A 3O5YA 1N9NA 2J3TD 3B33A 5DJTA 2V1BA 2PYRA 4L9GA 3HJKA 4IHQA 1W63Q 2WKQA 4LRYC 2O99A 3TE8A 4KUKA 4P6ZM 1TS8A 2P08A 2J3TC 3MFXA 2A24B 3CWFA 5G4ZA 2VEAA 3KSFA 3ULFA 1XFNA 3MQQA 4GW9A 1LSVA 2B18A 4L9EA 1D06A 4MDZA 5EFWA 5MC7A 1TS6A 5DKLA 4BBVA 4WL9A 1LL8A 3KSGA 5DFXA 2BASA 4EXOA 5HPFA 3CAXA 4EW7A 3EQUA 4Q0HA 2KDKA 4Y3IA 1V9YA 2L0WA 3E0YA 4BBTA 2M7UA 3LR3A 1MZUA 2VV7A 2L1MA 4DN0A 3SW1A 2LB9A 4BMWA 4EU0A 5C5KA 3F1NB 3UB6A 1P97A 4NXGA 4PKYG 5J3WA 3PBQA 4HOIA 4ZRRA 3T4LA 5I5LA 4G3KA 5TBMB 4O01A 4M4XA 4I39A 4WN5A 3EQVA 1GSVA 4B9OA 4JGQA 2VGLS 1H8MA 2VV6A 3B42A 5AVEA 3A0RA 1IFQA 3OCLA 4Y5FA 4WELA 4KQDA 3S7OA 4CQHA 4L9FA 5IS1A 2GNXA 2LB5A 3W2ZA 2NUPC 4HH3A 4K08A 3TRCA 4HNBA 2QYBA 2NUTC 2A24A 2QHKA 2W1RA 3PHYA 4PHTA 3LR4A 2PD8A 3TW8A 3MQOA 4NKPA 3OLOA 1NLYA 3S7QA 2HV1A 3EWKA 3ZYTA 2K2NA 4FSFA 2VLGA 2W27A 2KOIA 4HI4A 5HDSA 4EUVA 1OJGA 3OOVA 5HSQA 3F1OB 4CLCB 4I3AA 1TD5A 3IBJA 3R7WB 2ZBBA 3C38A 4EESA 3LIBA 3MR0A 2O9AA 3CI6A 3NJAA 2O9BA 1ZHHB 1P9WA 3F1NA 3F1PA 4G3VA 3UE6A 3UB7A 3VE3A 1VHMA 1JNUA 3LIAA 2K31A 4FOFA 4WEKA 2OAQ1 1OPXA 1UGUA 3EEAA 5HD5A 1TS0A 2OWHA 4HJ3A 3RTYA 2FH5A 3B47A 3MJQA 4ETXA 4MCWA 2P7JA 3GDIA 3ZQ5A 4OOLA 3RH8B 4BBUA 4ARZB 3PYPA 5HPIA 3IS2B 2CMNA 5DF9A 1TF1A 2HF6A 4F3LB 3C8CA 2VV8A 4MN6A 5HWWA 3BW6A 2W3GA 1P0ZA 2WKRA 3LICA 1G28A 2GJ3A 2L4RA 4R3AA 5LBRA 4HP9A 1YKDA 2QJ5A 4H6JA 1S1ZA 3JVVA 2JHEA 3LFVA 3K2NA 4IUKA 3JVUA 4CLCE 3A0SA 3LIDA 3BQAA 4I5SA 2FZ0A 2DMWA 1IOUA 4EERA 1ZTUA 4JGOA 4EETB 4WUJA 4HY8A 3D3OA 3PBNA 2EWWA 4PAUA 5DKKA 2PT7A 2YKFA 3BY8A 3BY9A 3T4QA 4MN5A 3T4KA 1T1AA 2O9CA 4I38A 3F1OA 4CLCA 3PR6A 3LYXA 5F5YA 3R7WA 4B93A 5AVFA 1D7EA 1DRMA 3VOLA 4I3JA 3CUEC 2QWSA 3NOPC 4EEPA 3HJIA 3C30A 4ME4A 1NLZA 4NXBA 1GSXA 1NRJA 5HDDA 3A0VA 3LR0A 1NWZA 4HQAA 4DJ2A 3RFBA 4Q0JA 3V67A 4DMZA 4UQIM 4YWZA 2XA7S 1XJ4A 4HJ4A 5AJGA 4QPRA 1OJ5A 3UMDA 1T18A 3OC2A 2JKTI 2V1AA 5KIZA 3KSHA 4NEED 2ZOHA 2A2LA 4ARZA 2Y8HA 5F6AA 1OTEA 1OTAA 3IS2A 1STZA 1UWPX 2V0WA 4F3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B02 A;  5HZH A;  2I9V A;  2R78 A;  2V9A A;  2W0N A;  4DJ3 A;  2QKP A;  4HIA A;  2PR6 A;  3H82 B;  1OTD A;  4LRX C;  3LI9 A;  2H28 A;  1ODV A;  1N9O A;  4R38 A;  3G6O A;  5G4Y A;  3LI8 A;  3UB8 A;  1V9Z A;  2OWJ A;  1BYW A;  4HP4 A;  2Z6C A;  5TBM A;  1WA9 A;  2PYP A;  4GCZ A;  2K7S A;  1DP6 A;  3H9W A;  4HJ6 A;  5J7E A;  4JGP A;  5A8B A;  1T1C A;  1XJ3 A;  1UWN X;  5F68 A;  1LSX A;  5HDC A;  4RQ9 A;  4HHD A;  4E04 A;  4LLO B;  3NHQ A;  4GHI B;  4WLA A;  2QJ7 A;  4PKY A;  1TS7 A;  2Z6D A;  1T19 A;  2EA9 A;  2YKH A;  4I3I A;  1S4S A;  3LIF A;  4NXE A;  3IBR A;  1S1Y A;  2ZOI A;  3H82 A;  4HH2 A;  1F9I A;  3BWL A;  4EEU A;  2V0U A;  3ICY A;  4XT2 B;  3H7W B;  4LPZ A;  2KX6 A;  3LIE A;  3NOU C;  4GS9 B;  3LUQ A;  3FG8 A;  3NOT C;  1T1B A;  1OTB A;  2D01 A;  1S67 L;  3UME A;  2OOL A;  3F1P B;  2M1C A;  3E4P A;  4LRZ E;  3MXQ A;  5J4E A;  2PDR A;  1N9L A;  2WKP A;  4GHI A;  1XJ2 A;  5IU1 A;  5F69 A;  3T50 A;  2J80 A;  2PR5 A;  3FC7 A;  1DP8 A;  1OT9 A;  5HWT A;  3C2W A;  3CLO A;  1LT0 A;  1Y28 A;  2PHY A;  4EQ1 A;  5DJU A;  2INW A;  3GEC A;  4H6J B;  2D02 A;  4JGR A;  1OTI A;  3E4Q A;  4KUO A;  3K3D A;  4NXF A;  4XT2 A;  3H7W A;  1S4R A;  5HD3 A;  1S66 L;  1DP9 A;  3P7N A;  1XJ6 A;  3UB9 A;  3KX0 X;  2PD7 A;  1KOU A;  1X0O A;  4GS9 A;  4R70 A;  1VB6 A;  4WF0 A;  1OT6 A;  3EEH A;  5HWV A;  1EW0 A;  1F98 A;  3D72 A;  1LSW A;  3VE4 A;  4R6L A;  3E4O A;  1XFQ A;  3K3C A;  1GSW A;  2JN7 A;  1N9N A;  3B33 A;  5DJT A;  2V1B A;  2PYR A;  4L9G A;  3HJK A;  2WKQ A;  4LRY C;  4KUK A;  1TS8 A;  3MFX A;  2A24 B;  3CWF A;  5G4Z A;  2VEA A;  3ULF A;  1XFN A;  3MQQ A;  4GW9 A;  1LSV A;  4L9E A;  1D06 A;  5EFW A;  1TS6 A;  5DKL A;  4BBV A;  4WL9 A;  1LL8 A;  2BAS A;  4EXO A;  3CAX A;  4EW7 A;  2KDK A;  1V9Y A;  2L0W A;  4BBT A;  1MZU A;  2VV7 A;  2L1M A;  3SW1 A;  3F1N B;  3UB6 A;  1P97 A;  4NXG A;  4PKY G;  5J3W A;  4HOI A;  5I5L A;  5TBM B;  4M4X A;  4I39 A;  4WN5 A;  1GSV A;  4B9O A;  4JGQ A;  5AVE A;  2VV6 A;  3A0R A;  4KQD A;  4L9F A;  5IS1 A;  4HH3 A;  4K08 A;  4HNB A;  2A24 A;  2QHK A;  3PHY A;  2PD8 A;  3MQO A;  3OLO A;  2HV1 A;  3EWK A;  2VLG A;  2W27 A;  4HI4 A;  5HDS A;  1OJG A;  5HSQ A;  3F1O B;  4I3A A;  2ZBB A;  4EES A;  3LIB A;  3MR0 A;  3NJA A;  3F1N A;  3F1P A;  3UE6 A;  3UB7 A;  3VE3 A;  3LIA A;  1JNU A;  1UGU A;  5HD5 A;  1TS0 A;  2OWH A;  4HJ3 A;  3RTY A;  3MJQ A;  2P7J A;  3GDI A;  3ZQ5 A;  4BBU A;  3RH8 B;  3PYP A;  3IS2 B;  2CMN A;  4F3L B;  3C8C A;  2VV8 A;  4MN6 A;  5HWW A;  1P0Z A;  2WKR A;  3LIC A;  1G28 A;  2GJ3 A;  2L4R A;  4R3A A;  4HP9 A;  2QJ5 A;  4H6J A;  1S1Z A;  2JHE A;  3A0S A;  3LID A;  4I5S A;  4EER A;  4JGO A;  4EET B;  4WUJ A;  4HY8 A;  5DKK A;  2YKF A;  3BY8 A;  3BY9 A;  4MN5 A;  1T1A A;  4I38 A;  3F1O A;  3LYX A;  5F5Y A;  5AVF A;  1D7E A;  1DRM A;  3VOL A;  4I3J A;  2QWS A;  3NOP C;  4EEP A;  3HJI A;  4NXB A;  1GSX A;  5HDD A;  3A0V A;  1NWZ A;  4HQA A;  4DJ2 A;  4YWZ A;  1XJ4 A;  4HJ4 A;  1OJ5 A;  3UMD A;  1T18 A;  2V1A A;  5KIZ A;  2ZOH A;  5F6A A;  1OTE A;  1OTA A;  3IS2 A;  1UWP X;  2V0W A;  4F3L A; 
#chains in the Genus database with same CATH topology
 5BOH A;  1TVF A;  1VEU B;  3UB5 P;  4X6T A;  3MQ0 A;  5F1F A;  4DE0 A;  4XUZ A;  2QKP A;  3G35 A;  3O86 A;  2GDN A;  1OTD A;  5HW3 A;  4X55 A;  4ETZ A;  1HLU P;  4LEN A;  4ESP A;  1ERQ A;  4IVK A;  4Q0I A;  2IA2 A;  3IF5 A;  4QY5 A;  4P6Z S;  1QME A;  4IBX A;  4R38 A;  1F5M A;  3QNB A;  3UB8 A;  2H10 A;  2OWJ A;  2OV5 A;  4JF4 A;  5E2F A;  1WA9 A;  2K7S A;  5J8X A;  5J7E A;  4YNR A;  2XR0 A;  3HLW A;  4MMN A;  1XJ3 A;  5GLA A;  3MF0 A;  4II7 A;  5HDC A;  4GDB A;  2EX2 A;  2QZ6 A;  3MMH A;  4HHD A;  4E04 A;  4LLO B;  2X01 A;  3NHQ A;  3VFH A;  2V8F A;  4GHI B;  2QJ7 A;  1TS7 A;  1K54 C;  2Y2G A;  4LGW A;  3S7N A;  2O0Y A;  4E3O A;  2HPB A;  1S1Y A;  5EOE A;  4RX2 A;  1IKI A;  1F9I A;  3LEQ A;  2ZMF A;  4KQO A;  2Y2L A;  4KZB A;  5K5B A;  3IX4 A;  4Z1W A;  4LPZ A;  2OAP 1;  2H5S A;  5FQI A;  1Y4O A;  1LL5 A;  3BJN A;  2W1T A;  3FZC A;  3VP0 A;  1J3W A;  2Y2H A;  5L10 A;  3T12 B;  3KYE A;  5L8M A;  1K57 C;  5FQK A;  3HL9 A;  3MXR A;  1T1B A;  1W7F A;  3L7H A;  1PYY A;  3UME A;  3SH9 A;  3F1P B;  5EVI C;  2DRW A;  4OPY A;  3AGE A;  1M6K A;  2VZW A;  3NI9 A;  3E4P A;  2Z2M B;  1FCN A;  5J4E A;  3GR2 A;  4OQI A;  1N9L A;  1PW8 A;  5EV0 A;  5IT5 A;  4OQ0 A;  5CRF A;  3DBA A;  3LY4 A;  2VKS A;  1GHI A;  3C2W A;  5A90 A;  4QD4 A;  2PHY A;  3OCN A;  5DJU A;  2INW A;  3GEC A;  4S2J A;  3W4Q A;  4H6J B;  3U2A A;  3DTM A;  4Y0T A;  3TG9 A;  4OLD A;  4NXF A;  4XT2 A;  3H7W A;  4RVA A;  3LR5 A;  1S4R A;  1E3U D;  3BQ8 A;  3P7N A;  3SH8 A;  1YPR A;  3UB9 A;  1LL9 A;  5HAQ A;  2PD7 A;  4KZ7 A;  1X0O A;  4R70 A;  1YLZ A;  3OPP A;  3GQZ A;  1NXY A;  3IH9 A;  4MEZ A;  4WF0 A;  3KYZ A;  4X53 A;  3EEH A;  2XSS A;  2XF3 A;  1OME A;  3OBF A;  4R6L A;  3E4O A;  3KYQ A;  4UA9 A;  1Q2P A;  2G2U A;  5EVE A;  3HRE A;  1N9N A;  3ZVW A;  5DJT A;  4L9G A;  3NC8 A;  2WKQ A;  4P6B A;  3UE0 A;  1CI8 A;  2R9W A;  1XGJ A;  1TS8 A;  2P08 A;  3MFX A;  2A24 B;  5EVI A;  4BL3 A;  3CWF A;  3ULF A;  2VEA A;  3GRJ A;  4E3I A;  2XFS A;  3MQQ A;  2EFU A;  1LSV A;  2B18 A;  4FD8 A;  5FQQ A;  4MDZ A;  3LEZ A;  3QP4 A;  4BBV A;  4WL9 A;  1F2K A;  3KSG A;  1YLY A;  3BFC A;  4NG2 A;  3CAX A;  5JYP A;  2XQZ A;  3EQU A;  3QP1 A;  4Y3I A;  4GNU A;  2ZMA A;  2M7U A;  3HUN A;  1MZU A;  3I7J A;  2LB9 A;  5EM0 A;  5C5K A;  4WBG A;  3N4I A;  1KGG A;  5J3W A;  3ZVT A;  4ZRR A;  2X71 A;  5GHY A;  4I39 A;  3EQV A;  1GSV A;  3A0R A;  4Y5F A;  3Q7V A;  2XGN A;  1YMX A;  3L9K A;  1IEM A;  4WEL A;  3SH7 A;  1SCW A;  3BLS A;  4CQH A;  4L9F A;  5IS1 A;  2ZQ8 A;  2HDS A;  3TRC A;  2V20 A;  2QYB A;  3FV7 A;  3D4F A;  1ESI A;  2W1R A;  1WYB A;  2V8C A;  4JBF A;  1NYM A;  3TW8 A;  5L09 A;  3OLO A;  1DJA A;  3G34 A;  1GCE A;  2VLG A;  3N8L A;  2JCH A;  4HBT A;  1ES5 A;  4FCF A;  5E43 A;  3UY6 A;  4E3J A;  1MPL A;  3N8S A;  4EUV A;  3OOV A;  5HSQ A;  3WS4 A;  1ES2 A;  1PRQ A;  3FKV A;  1XP4 A;  3QP6 A;  3JPU A;  1A0K A;  3F1P A;  4G3V A;  5GLC A;  3LIA A;  2AVX A;  4PM8 A;  2K31 A;  1OPX A;  1Q2Q A;  1TDL A;  3CZD A;  3IXB A;  1UGU A;  1GHP A;  1FR6 A;  3O88 A;  5FI6 A;  4U3T A;  4ZBE A;  5GL9 A;  3Q07 A;  4KZ3 A;  2OWH A;  1DJB A;  3ITB A;  1ZKJ A;  4ZTK A;  4MCW A;  2P7J A;  3ZQ5 A;  3RH8 B;  3NCK A;  1I5Q A;  1TF1 A;  4S2L A;  3C8C A;  2XD5 A;  1TDG A;  5HWW A;  4IED A;  2W3G A;  1CK3 A;  2L4R A;  3MSH A;  5LBR A;  1XXM A;  4H6J A;  1BLS A;  3QP8 A;  1FIK A;  4JGO A;  1XKZ A;  4EET B;  3BEB A;  2WAE A;  2EWW A;  3MS6 A;  1L3L A;  1YLJ A;  3IX3 A;  3CG5 A;  3BY9 A;  1BLP A;  3T4Q A;  3OPR A;  5FAQ A;  1PWC A;  3T1Q B;  4I38 A;  5FAT A;  3HBR A;  4DE1 A;  3PR6 A;  3LYX A;  3A3F A;  1D7E A;  1DRM A;  4I3J A;  1ZG4 A;  2EX8 A;  2WZZ A;  5KZH A;  2Y59 A;  4ZJ1 A;  1NLZ A;  3LR0 A;  4Y13 A;  5FA7 A;  1NWZ A;  1XA1 A;  4MLL A;  5AJG A;  4RA7 A;  4HJ4 A;  4QPR A;  1OJ5 A;  1AWI A;  2Y2M A;  3SS4 A;  3E2L A;  2V1A A;  1FSW A;  4Y7P A;  5EVL A;  2ZOH A;  4XUX A;  2A2L A;  1YQS A;  1OTE A;  3IS2 A;  4F94 A;  1S0W A;  4MBK A;  1K55 C;  3BM6 A;  1O7E A;  2ZQ7 A;  3BYD A;  1I2S A;  3B3X A;  5FDH A;  2I9V A;  3P09 A;  1YM1 A;  1N9B A;  2W0N A;  4HEF A;  5L2F A;  3VP1 A;  3TJZ C;  1YLT A;  4E6W A;  5U47 A;  2H28 A;  4NET A;  4ZJ3 A;  4KZ5 A;  1MWS A;  3WRT A;  3PBT A;  5TJJ A;  2W1T B;  3OPL A;  3HLB A;  3OPH A;  4Y0U A;  4BWI A;  5KSH A;  1KGF A;  1RP5 A;  1V9Z A;  3GMW A;  3MXS A;  4OVD A;  2J9P A;  1KDS A;  2P04 A;  3MBZ A;  4UEY A;  4PMA A;  1PW1 A;  4HJ6 A;  4GD6 A;  2JC7 A;  4JGP A;  3UPP A;  5A8B A;  1T1C A;  1YSP A;  2WAD A;  4N1X A;  2V2F F;  1MWT A;  4RQ9 A;  3D9Y A;  2P9V A;  4S2O A;  4WLA A;  4X68 A;  3ZCZ A;  1ZC2 A;  2Q9M A;  1NZO A;  4WZ5 A;  4R1G A;  1PI5 A;  4I3I A;  3LIF A;  4N9L A;  2WKH A;  2WGI A;  2XLN A;  2ZOI A;  3IBR A;  3N7W A;  4N1H A;  2Y2K A;  2PU4 A;  3W8K A;  3PBO A;  4D2O A;  5KMW A;  4XT2 B;  1IYQ A;  3H7W B;  2HJ9 C;  4GB7 A;  1DJC A;  2KX6 A;  2DCF A;  3W4P A;  3LUQ A;  3NOT C;  5HL1 A;  3RXW A;  3EOI A;  3UE1 A;  2D01 A;  1VET A;  3G30 A;  2M1C A;  5HAR A;  2ACG A;  4KZ6 A;  4LRZ E;  3MXQ A;  3IQA A;  2PDR A;  1Z09 A;  5HAI A;  3T4O A;  4IUH A;  3SS3 A;  3T50 A;  2GX5 A;  3HVF A;  2J80 A;  1LHY A;  4YOF A;  1WYC A;  3T4T A;  5EM1 A;  3FPV A;  3V5M A;  3NBL A;  4CLC C;  1LI9 A;  5EVI B;  5CEB A;  1H3Q A;  1Y28 A;  3KSI A;  2EWV A;  1OTI A;  3PAG A;  3E4Q A;  3QHY A;  4KUO A;  3K3D A;  2H0T A;  3W4O A;  2VK3 A;  2VX8 A;  2JKG A;  4EV4 A;  4EWF A;  1DP9 A;  2WGV A;  5E2E A;  5L07 A;  4LV1 A;  1KOU A;  1P9R A;  3R4K A;  4E6X A;  1BSG A;  4KG2 A;  4DXC A;  2ZL1 A;  1VB6 A;  1ES3 A;  1HZO A;  4OOY A;  1SHV A;  1OT6 A;  1W79 A;  2JKF A;  3WS2 A;  3IF6 C;  5HWV A;  3NY4 A;  1F98 A;  2B95 A;  1I2W A;  3D72 A;  1LSW A;  1G68 A;  1XFQ A;  2Y2O A;  1FOF A;  1MBL A;  3FPW A;  3Q7V B;  3SZT A;  1GSW A;  3CUE A;  1K0K A;  2JN7 A;  3O5Y A;  4QJG A;  2J3T D;  4N9K A;  3IHB A;  4WYY A;  4LRY C;  2O99 A;  4KUK A;  4UA7 A;  5F83 A;  1L0F A;  4C6Y A;  4DDY A;  1XFN A;  3T1R A;  1E4D A;  5A92 A;  1PIO A;  5FQJ A;  4JXG A;  1K6R A;  3VP2 A;  3O3V A;  5MC7 A;  4WM9 A;  5DKL A;  4Q8I A;  2FFF B;  3BFG A;  2PAV P;  3HLD A;  5A91 A;  2KDK A;  3LO7 A;  2H0Y A;  4IBR A;  4OLG A;  2L1M A;  3C7V A;  3CPT A;  4DN0 A;  4PM9 A;  3V3S A;  5M18 A;  4EU0 A;  3UB6 A;  1P97 A;  1GA0 A;  4PKY G;  3VMA A;  5TBM B;  2BG1 A;  4WN5 A;  1H8M A;  3B42 A;  5AVE A;  1MWR A;  4B4X A;  5CGX A;  3FKW A;  1VQQ A;  3W2Z A;  4K08 A;  3ZDJ A;  1MWU A;  1BT5 A;  1BZA A;  3PHY A;  1XPB A;  1FR1 A;  3S7Q A;  4RX3 A;  4ZAM A;  5FAP A;  3Q1F A;  1K54 A;  4PM6 A;  1BUE A;  3NIA A;  2ZC6 B;  1JWP A;  5AQ7 A;  4I3A A;  3IBJ A;  1PWG A;  1ES4 A;  3DTE A;  4EES A;  2JE5 A;  3LIB A;  2O9A A;  3DW0 A;  4OKP A;  3UE6 A;  3VE3 A;  4WEK A;  1VHM A;  1JNU A;  1IEL A;  4BEN A;  1BLC A;  2RL3 A;  4HBU A;  2UWX A;  1TS0 A;  4HJ3 A;  3RTY A;  1K57 A;  2FH5 A;  3MJQ A;  3ZG9 B;  4ETX A;  4OOL A;  1YMS A;  1KE4 A;  4OQG A;  2ZQA A;  3PYP A;  3IS2 B;  4QY6 A;  4X1L A;  2PRF A;  2ZLY A;  3BW6 A;  3MZE A;  4MBH A;  5M1A A;  4D60 A;  1P0Z A;  3BFF A;  5F82 A;  5DVA A;  2QJ5 A;  1K38 A;  1RCJ A;  2QPN A;  3IX8 A;  4IUK A;  3A0S A;  4X25 A;  3BQA A;  3WS5 A;  4ZDX A;  2DMW A;  2PU2 A;  4WUJ A;  2UV0 E;  3D3O A;  3PBN A;  4PAU A;  3BY8 A;  3G2Z A;  3DWZ A;  5KSC A;  1E25 A;  1K56 A;  3F1O A;  1WE4 A;  5F5Y A;  1L2S A;  3R7W A;  2EX9 A;  1W5D A;  1NYY A;  1RGZ A;  4OPQ A;  3NOP C;  4S2P A;  4EEP A;  3HJI A;  4GN2 A;  4NXB A;  3IWQ A;  3VP3 A;  1VM1 A;  4GDN A;  3CMZ A;  5G18 A;  3RFB A;  4UQI M;  1J9M A;  3QP5 A;  1PI4 A;  3ZNY A;  3OC2 A;  4GZB A;  1SDE A;  2P9V B;  5KIZ A;  1L0E A;  4DDS A;  1OTA A;  2V0W A;  3SOI A;  4F3L A;  1PZP A;  4JPM A;  1KE3 A;  2B02 A;  4OPR A;  2R78 A;  1YAX A;  4DJ3 A;  4HIA A;  2PR6 A;  2W3F A;  5AQ9 A;  4B4Z A;  1JTG A;  4L0L A;  5CER A;  4GJ4 A;  4LRX C;  3LI9 A;  4YFM A;  2G7U A;  1N9O A;  2E8I A;  1YSQ A;  4BLM A;  1CI9 A;  1SZV A;  2HDQ A;  4EBL A;  3PXP A;  2RCX A;  1CEG A;  5CTN A;  1BTL A;  5D3O A;  3LI8 A;  3IHA A;  1C3B A;  3CJM A;  5FEG A;  1H0M A;  4S2N C;  2Z6C A;  5TBM A;  2PYP A;  3UDX A;  1VET B;  3A3E A;  5CTM A;  1DP6 A;  2C6W B;  3H9W A;  4MN7 A;  3GTC A;  4JXV A;  2Y2Q A;  3VFF A;  3ISG A;  1LSX A;  1IKG A;  3E98 A;  4Y0O A;  3UE3 A;  1YT4 A;  2M7V A;  2W3E A;  4AFI A;  4PKY A;  5CXW A;  2Z6D A;  3WS0 A;  1T19 A;  3ZNT A;  2EA9 A;  2YKH A;  4O7D A;  5FAO A;  1ERM A;  5E2G A;  3T4J A;  1MKM A;  3E2K A;  3H82 A;  1LLB A;  4HH2 A;  4DF6 A;  4UQI S;  3EGD C;  3ICY A;  3WS1 A;  4BD1 A;  1ONG A;  5HFO A;  2XK1 A;  5FQM A;  1ZG6 A;  1U60 A;  3LIE A;  3NOU C;  4G3W A;  4Y15 A;  1XX2 A;  3FG8 A;  1M40 A;  5EVI D;  2HJE A;  5CHJ A;  5GHZ A;  3VOZ A;  1YLP A;  2ZL1 B;  3QNC A;  4GLQ A;  4Y2F A;  4EBN A;  3DWK A;  2JKR M;  2IWC A;  2OOL A;  3MKE A;  1ACF A;  2MJ6 A;  4KZ9 A;  2IWB A;  3O87 A;  2ZM0 A;  3G32 A;  1XJ2 A;  3P01 A;  5IHV A;  3NDE A;  2PR5 A;  2Y55 A;  3C5A A;  1GA9 A;  1G5U A;  4P85 A;  5HWT A;  3ZFZ A;  4BJP A;  4O8G A;  4OP8 A;  3CLO A;  4EQ1 A;  4H8R A;  5E2H A;  3MZF A;  2D02 A;  4JGR A;  3S7P A;  3ZG5 A;  2J3W A;  2XA7 M;  4UAA A;  1S66 L;  4ZJ2 A;  3KX0 X;  3C7U A;  4IJG A;  2ZC3 B;  4GS9 A;  3M2J A;  1G6O A;  3RXX A;  4KQQ A;  3CPT B;  1LI0 A;  3AGD A;  5AQA A;  4LFU A;  3OZH A;  3VV4 A;  2B5R A;  3HLG A;  4P0M A;  3VE4 A;  1XA7 A;  3CIT A;  5DTK A;  3M6B A;  3T4S A;  2HGV A;  4WMC A;  3LCE A;  4CPK A;  2V1B A;  4OQH A;  3HJK A;  1W63 Q;  2WYX A;  2WGW A;  3TE8 A;  4LCL A;  4P6Z M;  2Y2J A;  5G4Z A;  5JYO A;  2J7V A;  2Y2N A;  4L9E A;  1D06 A;  4C75 A;  3HUO A;  5DTS A;  5TGF A;  4BD0 A;  1TS6 A;  1K55 A;  4MNR A;  4FH4 A;  1LL8 A;  2WUQ A;  3ZGA B;  4RYE A;  2ZQC A;  4P87 A;  2Z2L B;  4EW7 A;  4BQM A;  5AQB A;  4Q0H A;  2L0W A;  3E0Y A;  4BBT A;  3HLF A;  1JWV A;  2VV7 A;  1PFL A;  3CHW P;  2Q9N A;  4NXG A;  1KDW A;  3PBQ A;  1ERO A;  4JXS A;  4HOI A;  1K4F A;  4KEN B;  5EOO A;  2XDM A;  4M4X A;  1JTD A;  4FH2 A;  1K25 A;  4B9O A;  4JGQ A;  2VV6 A;  3OCL A;  3A3D A;  4KQD A;  4R3J A;  3NDG A;  1PNE A;  1E3U A;  2GNX A;  2LB5 A;  2Q0O A;  4HH3 A;  4OPZ A;  2VGK A;  1GHM A;  4HNB A;  3V3R A;  2NUT C;  3LGO A;  4X56 A;  5F1G A;  2XD1 A;  3UDI A;  4PHT A;  4DE3 A;  3MQO A;  3M6H A;  3ZYT A;  2HP5 A;  2K2N A;  4FSF A;  4KG5 A;  3ZG0 A;  2W27 A;  2ZM2 A;  4JF5 A;  1DY6 A;  1OJG A;  2I72 A;  3BEC A;  3F1O B;  1Z6F A;  4QB8 A;  1IYS A;  3R7W B;  2ZBB A;  3UNW A;  1H8Z A;  4QHC A;  3MR0 A;  4S2I A;  3CI6 A;  4JXW A;  1ZHH B;  3F1N A;  5FQ9 A;  5FEF A;  4FOF A;  3IXG A;  3NUL A;  4ID4 A;  4BBU A;  1QMF A;  3IH8 A;  5HPI A;  3A3J A;  2CMN A;  3FWL A;  5TFQ A;  4JLF A;  3WWX A;  4F3L B;  2VV8 A;  4MN6 A;  4IVI A;  3LIC A;  3RJU A;  1G28 A;  4R3A A;  1FCO A;  3M2K A;  3S22 A;  1S1Z A;  3JVV A;  2JHE A;  3K2N A;  2Y4A A;  3JVU A;  4CLC E;  4DXB A;  4E3M A;  3U4L P;  4HY8 A;  5DKK A;  2YKF A;  4XXR A;  1RGY A;  1SDN A;  4MN5 A;  4WMC D;  3T4K A;  2OSU A;  3HLC A;  5FI7 A;  4CLC A;  1IYO A;  5AVF A;  3GV9 A;  5CEC A;  3VOL A;  3HLE A;  2QWS A;  5EUA A;  3C30 A;  1GSX A;  1L0G A;  5HDD A;  3A0V A;  2G2W A;  3Q7Z A;  2CC1 A;  4Q0J A;  1NY0 A;  4YWZ A;  1NZU A;  5GLB A;  1XJ4 A;  3UMD A;  5A93 A;  2R9X A;  4K0X A;  2EFX A;  2JKT I;  3Q82 A;  3KSH A;  5CGW A;  4KZ8 A;  4ARZ A;  2Y8H A;  3V39 A;  2HP9 A;  1HVB A;  3IF6 A;  1STZ A;  1UWP X;  2ZM8 A;  2VGJ A;  3VOY A;  2WKI A;  5HZH A;  4PPR A;  3DTK A;  2V9A A;  1PZO A;  3H82 B;  5M19 A;  4WEJ A;  3PBS A;  2FFY A;  1ODV A;  1AXB A;  1H8Y A;  1MY8 A;  2Y91 A;  3ZG8 B;  2VA0 A;  3G6O A;  5G4Y A;  1FQG A;  3VP4 A;  1BYW A;  1ALQ A;  4U0T A;  4HP4 A;  1KE0 A;  1EI5 A;  4GCZ A;  1HTZ A;  5FAS A;  2VJW A;  2Y2P A;  1UWN X;  4N92 A;  5F68 A;  4OOM A;  1D1J A;  4OH0 A;  2EXA A;  4X69 A;  1G6A A;  3BRM A;  3ZHH A;  4R4S A;  2WK0 A;  2HDR A;  1SKO A;  1H5X A;  1W63 M;  1MKI A;  1S4S A;  1VEU A;  4NXE A;  4X1M A;  3Q81 A;  2Y2I A;  2ZQ9 A;  1CJF A;  3BLM A;  3GSG A;  3MFD A;  3BWL A;  4EEU A;  4LV3 A;  2V0U A;  2W3H A;  4FTX A;  3BFD A;  4KZ4 A;  2GZA A;  5DF8 A;  2ZC5 B;  3LY3 A;  4U0X A;  3S4X A;  4GS9 B;  1K6S A;  3IXD A;  4E3N A;  1OTB A;  2PBY A;  5FL3 A;  4K91 A;  3PTE A;  4UA6 A;  1KVL A;  1S67 L;  4E3K A;  2OLU A;  5CGS A;  2JKR I;  4R0Q A;  1MC0 A;  2ZMV A;  4A5R A;  5HAP A;  2JKT M;  4O0P A;  1L0D A;  3EGX C;  4GKU A;  3UPN A;  3BFE A;  3NEC A;  3P98 A;  5CED A;  2WAF A;  1W8Y A;  1NJ4 A;  2WKP A;  2XRO A;  4GHI A;  5IU1 A;  4JF6 A;  5F69 A;  3SS5 A;  4CLC D;  2XRN A;  3FC7 A;  4BL2 A;  2WGW B;  5FDS A;  1DP8 A;  1FIL A;  2KLI A;  4PM5 A;  1OT9 A;  3HCY A;  5HX9 A;  4E3L A;  1PWD A;  3T1S A;  1LT0 A;  4QWO A;  5CHM A;  4KQR A;  2A3U A;  4EUZ A;  1ONH A;  3IXH A;  4JKT A;  3G31 A;  4GD8 A;  2VGL M;  3C4O A;  4YIN A;  3S1Y A;  2IWD A;  5HD3 A;  2WZX A;  5DFY A;  1XJ6 A;  2Y79 A;  1CEF A;  3PBR A;  1K4E A;  4OP5 A;  2OLV A;  3N6I A;  4B88 A;  3IWI A;  3KO6 A;  2QMI A;  2BLS A;  3VSK A;  1XGI A;  4Y17 A;  5HL6 A;  2DNS A;  3G4P A;  1EW0 A;  2J9O A;  2V1Z A;  2W3D A;  3K3C A;  3N8R A;  5DTT A;  4Z9Q A;  5CX7 A;  1N4O A;  5CHU A;  3B33 A;  4KZA A;  2PYR A;  3T1X A;  4IHQ A;  3IWO A;  2JBF A;  1SKF A;  1KVM A;  5I94 A;  2J3T C;  4QU3 A;  2HP6 A;  3FYZ A;  3KSF A;  1YLW A;  5EPH A;  4GW9 A;  3MKF A;  5EFW A;  1FSY A;  4LCM A;  4LV2 A;  5DFX A;  2BAS A;  4EXO A;  5HPF A;  3HUM A;  2EX6 A;  1V9Y A;  2HZ5 A;  3LR3 A;  3MZD A;  3SW1 A;  4BMW A;  3DAV A;  3F1N B;  3T4L A;  2X02 A;  5I5L A;  4G3K A;  1ESU A;  4WZ5 C;  4O01 A;  3PAE A;  5FI2 A;  4LV0 A;  2VGL S;  4MBF A;  1K56 D;  3A3I A;  1IFQ A;  4CJN A;  4S2N A;  5DF7 A;  4DRT A;  1NRF A;  3S7O A;  4HES A;  3DTI A;  2NUP C;  2P74 A;  3WRZ A;  5GLD A;  2PBD P;  2WKE A;  2A24 A;  2QHK A;  3LR4 A;  2PD8 A;  1O07 A;  4NKP A;  1NLY A;  1Y54 A;  2HV1 A;  3EWK A;  3QP2 A;  3TSG A;  2KOI A;  3VSL A;  4HI4 A;  5HDS A;  4UHU A;  4CLC B;  1TD5 A;  3C38 A;  5EE8 A;  1MXO A;  3GVB A;  4DKI A;  3NJA A;  2O9B A;  1P9W A;  3UB7 A;  2C5W B;  3V50 A;  2OAQ 1;  3TOI A;  3EEA A;  4K0W A;  3AGF A;  5HD5 A;  3UPO A;  3B47 A;  4NK3 A;  4OON A;  1TEM A;  3GDI A;  3G2Y A;  4ARZ B;  2E8J A;  3ITA A;  3UDF A;  1JWZ A;  3IF6 B;  2XEP A;  5DF9 A;  2HF6 A;  2BTF P;  5EEC A;  1S6R A;  3UN7 A;  2WKR A;  1EWZ A;  2A49 A;  2GJ3 A;  2EXB A;  4HP9 A;  1YKD A;  3UO9 A;  4EBP A;  2XFT A;  4R3B A;  3LFV A;  4WZ4 A;  1BUL A;  4PM7 A;  3LID A;  3ZG7 B;  4DE2 A;  4C3Q A;  4I5S A;  1BLH A;  2FZ0 A;  1IOU A;  4EER A;  1ZTU A;  4R4R A;  4R23 A;  1HD8 A;  1JVJ A;  2PT7 A;  4FUW A;  5FSR A;  1CF0 A;  4S2M A;  4EQI A;  2ZC4 B;  1W8Q A;  1T1A A;  2O9C A;  5GHX A;  3IT9 A;  4B93 A;  3JYI A;  2HDU A;  2XH9 A;  3CUE C;  5TR7 A;  2ZC7 A;  4ME4 A;  1NRJ A;  4GOG A;  4HQA A;  3C4P A;  2ZD8 A;  4DJ2 A;  3V67 A;  1FCM A;  4DMZ A;  4S2K A;  2J8Y A;  2XA7 S;  1IYP A;  1T18 A;  4KG6 A;  1CQA A;  4NEE D;  1KGE A;  5F6A A;  4M3K A;  2ZQD A;  2ZJ9 A;  1SKO B; 
#chains in the Genus database with same CATH homology
 2B02 A;  5HZH A;  2I9V A;  3MQ0 A;  2R78 A;  2V9A A;  2W0N A;  1YAX A;  4DJ3 A;  2QKP A;  4HIA A;  2PR6 A;  2W3F A;  3H82 B;  4L0L A;  4WEJ A;  1OTD A;  3TJZ C;  3PBS A;  4GJ4 A;  4LRX C;  3LI9 A;  2H28 A;  1ODV A;  2G7U A;  1N9O A;  4ETZ A;  1YSQ A;  4Q0I A;  2IA2 A;  3PBT A;  3PXP A;  5TJJ A;  2VA0 A;  2W1T B;  4P6Z S;  4R38 A;  4BWI A;  5KSH A;  3G6O A;  5G4Y A;  1F5M A;  3LI8 A;  3UB8 A;  1V9Z A;  2OWJ A;  1BYW A;  4HP4 A;  2Z6C A;  5TBM A;  1WA9 A;  2PYP A;  4GCZ A;  2K7S A;  2P04 A;  1DP6 A;  3H9W A;  4MN7 A;  4UEY A;  4HJ6 A;  5J7E A;  4YNR A;  4JGP A;  4MMN A;  2VJW A;  5A8B A;  1T1C A;  1XJ3 A;  1UWN X;  1YSP A;  5F68 A;  3MF0 A;  4II7 A;  1LSX A;  4OOM A;  5HDC A;  3MMH A;  4RQ9 A;  4HHD A;  4E04 A;  3E98 A;  3UE3 A;  2M7V A;  4LLO B;  3NHQ A;  4GHI B;  4WLA A;  2W3E A;  2QJ7 A;  4AFI A;  4PKY A;  1TS7 A;  2Z6D A;  1T19 A;  1W63 M;  2EA9 A;  2YKH A;  4I3I A;  1S4S A;  3LIF A;  3S7N A;  4NXE A;  2O0Y A;  3T4J A;  3IBR A;  1S1Y A;  2ZOI A;  1MKM A;  3H82 A;  4HH2 A;  1F9I A;  3PBO A;  2ZMF A;  3BWL A;  3EGD C;  4KQO A;  4UQI S;  4EEU A;  2V0U A;  3ICY A;  2W3H A;  5K5B A;  4XT2 B;  3H7W B;  2HJ9 C;  4Z1W A;  2GZA A;  4LPZ A;  2OAP 1;  2KX6 A;  3BJN A;  2W1T A;  3LIE A;  5L8M A;  3NOU C;  4GS9 B;  4G3W A;  3LUQ A;  3FG8 A;  2HJE A;  3NOT C;  1T1B A;  1OTB A;  3EOI A;  5FL3 A;  2D01 A;  4GLQ A;  1S67 L;  4Y2F A;  3UME A;  2JKR I;  2JKR M;  1MC0 A;  2OOL A;  2ZMV A;  3F1P B;  2M1C A;  2JKT M;  2MJ6 A;  4O0P A;  3EGX C;  2VZW A;  3E4P A;  4LRZ E;  3MXQ A;  5J4E A;  2PDR A;  1N9L A;  3T4O A;  4IUH A;  2WKP A;  2XRO A;  4GHI A;  1XJ2 A;  5IU1 A;  3P01 A;  5F69 A;  4CLC D;  3T50 A;  2GX5 A;  2XRN A;  2J80 A;  2PR5 A;  3FC7 A;  4YOF A;  5IT5 A;  3T4T A;  3DBA A;  1DP8 A;  2KLI A;  2VKS A;  3FPV A;  1OT9 A;  3HCY A;  5HWT A;  4BJP A;  3C2W A;  4O8G A;  4CLC C;  3CLO A;  1LT0 A;  1H3Q A;  1Y28 A;  2PHY A;  4EQ1 A;  3OCN A;  5DJU A;  3KSI A;  2INW A;  3GEC A;  4H6J B;  3U2A A;  2D02 A;  2EWV A;  4JGR A;  1OTI A;  3E4Q A;  3S7P A;  4KUO A;  2VGL M;  3K3D A;  4NXF A;  4XT2 A;  3H7W A;  3LR5 A;  1S4R A;  2J3W A;  2VX8 A;  5HD3 A;  3BQ8 A;  2XA7 M;  1S66 L;  1DP9 A;  3P7N A;  5DFY A;  1XJ6 A;  3UB9 A;  2Y79 A;  3KX0 X;  2PD7 A;  1KOU A;  4IJG A;  3PBR A;  1P9R A;  3R4K A;  1X0O A;  4GS9 A;  4R70 A;  1G6O A;  3KO6 A;  1VB6 A;  4WF0 A;  5HL6 A;  1OT6 A;  3KYZ A;  3EEH A;  5HWV A;  1EW0 A;  1F98 A;  3VV4 A;  2XSS A;  3D72 A;  1LSW A;  3OBF A;  3VE4 A;  4R6L A;  2W3D A;  3CIT A;  3E4O A;  3KYQ A;  1XFQ A;  3K3C A;  3FPW A;  3T4S A;  2HGV A;  1GSW A;  3CUE A;  5CX7 A;  2JN7 A;  3O5Y A;  1N9N A;  2J3T D;  3B33 A;  5DJT A;  2V1B A;  2PYR A;  4L9G A;  3HJK A;  4IHQ A;  1W63 Q;  2WKQ A;  4LRY C;  2O99 A;  3TE8 A;  4KUK A;  4P6Z M;  1TS8 A;  2P08 A;  2J3T C;  3MFX A;  2A24 B;  3CWF A;  5G4Z A;  2VEA A;  3KSF A;  3ULF A;  1XFN A;  3MQQ A;  4GW9 A;  1LSV A;  2B18 A;  4L9E A;  1D06 A;  4MDZ A;  5EFW A;  5MC7 A;  1TS6 A;  5DKL A;  4BBV A;  4WL9 A;  1LL8 A;  3KSG A;  5DFX A;  2BAS A;  4EXO A;  5HPF A;  3CAX A;  4EW7 A;  3EQU A;  4Q0H A;  2KDK A;  4Y3I A;  1V9Y A;  2L0W A;  3E0Y A;  4BBT A;  2M7U A;  3LR3 A;  1MZU A;  2VV7 A;  2L1M A;  4DN0 A;  3SW1 A;  2LB9 A;  4BMW A;  4EU0 A;  5C5K A;  3F1N B;  3UB6 A;  1P97 A;  4NXG A;  4PKY G;  5J3W A;  3PBQ A;  4HOI A;  4ZRR A;  3T4L A;  5I5L A;  4G3K A;  5TBM B;  4O01 A;  4M4X A;  4I39 A;  4WN5 A;  3EQV A;  1GSV A;  4B9O A;  4JGQ A;  2VGL S;  1H8M A;  2VV6 A;  3B42 A;  5AVE A;  3A0R A;  1IFQ A;  3OCL A;  4Y5F A;  4WEL A;  4KQD A;  3S7O A;  4CQH A;  4L9F A;  5IS1 A;  2GNX A;  2LB5 A;  3W2Z A;  2NUP C;  4HH3 A;  4K08 A;  3TRC A;  4HNB A;  2QYB A;  2NUT C;  2A24 A;  2QHK A;  2W1R A;  3PHY A;  4PHT A;  3LR4 A;  2PD8 A;  3TW8 A;  3MQO A;  4NKP A;  3OLO A;  1NLY A;  3S7Q A;  2HV1 A;  3EWK A;  3ZYT A;  2K2N A;  4FSF A;  2VLG A;  2W27 A;  2KOI A;  4HI4 A;  5HDS A;  4EUV A;  1OJG A;  3OOV A;  5HSQ A;  3F1O B;  4CLC B;  4I3A A;  1TD5 A;  3IBJ A;  3R7W B;  2ZBB A;  3C38 A;  4EES A;  3LIB A;  3MR0 A;  2O9A A;  3CI6 A;  3NJA A;  2O9B A;  1ZHH B;  1P9W A;  3F1N A;  3F1P A;  4G3V A;  3UE6 A;  3UB7 A;  3VE3 A;  1VHM A;  1JNU A;  3LIA A;  2K31 A;  4FOF A;  4WEK A;  2OAQ 1;  1OPX A;  1UGU A;  3EEA A;  5HD5 A;  1TS0 A;  2OWH A;  4HJ3 A;  3RTY A;  2FH5 A;  3B47 A;  3MJQ A;  4ETX A;  4MCW A;  2P7J A;  3GDI A;  3ZQ5 A;  4OOL A;  3RH8 B;  4BBU A;  4ARZ B;  3PYP A;  5HPI A;  3IS2 B;  2CMN A;  5DF9 A;  1TF1 A;  2HF6 A;  4F3L B;  3C8C A;  2VV8 A;  4MN6 A;  5HWW A;  3BW6 A;  2W3G A;  1P0Z A;  2WKR A;  3LIC A;  1G28 A;  2GJ3 A;  2L4R A;  4R3A A;  5LBR A;  4HP9 A;  1YKD A;  2QJ5 A;  4H6J A;  1S1Z A;  3JVV A;  2JHE A;  3LFV A;  3K2N A;  4IUK A;  3JVU A;  4CLC E;  3A0S A;  3LID A;  3BQA A;  4I5S A;  2FZ0 A;  2DMW A;  1IOU A;  4EER A;  1ZTU A;  4JGO A;  4EET B;  4WUJ A;  4HY8 A;  3D3O A;  3PBN A;  2EWW A;  4PAU A;  5DKK A;  2PT7 A;  2YKF A;  3BY8 A;  3BY9 A;  3T4Q A;  4MN5 A;  3T4K A;  1T1A A;  2O9C A;  4I38 A;  3F1O A;  4CLC A;  3PR6 A;  3LYX A;  5F5Y A;  3R7W A;  4B93 A;  5AVF A;  1D7E A;  1DRM A;  3VOL A;  4I3J A;  3CUE C;  2QWS A;  3NOP C;  4EEP A;  3HJI A;  3C30 A;  4ME4 A;  1NLZ A;  4NXB A;  1GSX A;  1NRJ A;  5HDD A;  3A0V A;  3LR0 A;  1NWZ A;  4HQA A;  4DJ2 A;  3RFB A;  4Q0J A;  3V67 A;  4DMZ A;  4UQI M;  4YWZ A;  2XA7 S;  1XJ4 A;  4HJ4 A;  5AJG A;  4QPR A;  1OJ5 A;  3UMD A;  1T18 A;  3OC2 A;  2JKT I;  2V1A A;  5KIZ A;  3KSH A;  4NEE D;  2ZOH A;  2A2L A;  4ARZ A;  2Y8H A;  5F6A A;  1OTE A;  1OTA A;  3IS2 A;  1STZ A;  1UWP X;  2V0W A;  4F3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...