4MN6A

Crystal structure of truncated pas domain from s. aureus yycg
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
96
Chain Sequence
ITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIGYYMLSVLSLEDEFKLEEINNDSFLLDLEGLIARVNFSTIVQETGFVTGYIAVLHDVTEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of PAS domain of S. aureus YycG
rcsb
source organism Staphylococcus aureus
molecule tags Transferase
molecule keywords Sensor protein kinase WalK
total genus 14
structure length 96
sequence length 101
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4mn6A00
5TBMA 4M4XA 2ZBBA 4GHIB 2YKHA 4PKYG 3UB9A 2PYPA 2PYRA 1G28A 1XJ2A 2VV7A 3A0RA 3K3CA 3ZQ5A 3MFXA 4F3LB 4DJ2A 4HY8A 4DJ3A 2OWJA 1DP8A 4R3AA 1GSXA 3LICA 4JGPA 5AVFA 4HNBA 3VE3A 3ICYA 1OJ5A 3CAXA 1EW0A 3A0VA 1KOUA 3MXQA 4HH2A 4HI4A 1S1ZA 3VOLA 1T1BA 1V9ZA 3EWKA 4H6JB 3UMDA 3H9WA 4BBVA 4EQ1A 4JGRA 2PD7A 2QJ5A 2VEAA 3BY9A 4KUKA 1NWZA 2V1AA 4EW7A 2QHKA 1DP9A 2INWA 2D01A 5HZHA 3UB7A 4I5SA 3VE4A 4LLOB 2I9VA 2P7JA 1OJGA 4I3JA 4EXOA 1S67L 1T1AA 5HWVA 5TBMB 1XFQA 1T18A 1F98A 1GSVA 3A0SA 3HJIA 3NHQA 4RQ9A 1UWNX 2R78A 2VV8A 2Z6DA 3BY8A 3GECA 5IU1A 1UWPX 3UB6A 1P0ZA 1WA9A 3NJAA 4HHDA 2GJ3A 4R38A 4KUOA 5G4ZA 3LUQA 3MJQA 5I5LA 1OTDA 1OT6A 1T19A 4MN6A 4GCZA 4WL9A 3KX0X 3LIEA 1TS6A 3D72A 3PYPA 2V9AA 4JGOA 4L9GA 2QJ7A 4NXEA 5DJUA 2WKRA 2W27A 2YKFA 4HJ6A 4I3AA 4R70A 4HP9A 4WN5A 4L9FA 5F69A 5J3WA 3LIAA 2VV6A 4NXFA 5HWWA 4EERA 5A8BA 2L4RA 3FG8A 2KDKA 2L1MA 3F1PB 5HDSA 4E04A 3CLOA 2BASA 5HWTA 2PHYA 3LIDA 2OOLA 4H6JA 4HQAA 5EFWA 3T50A 4KQDA 5DKLA 1VB6A 2A24B 3C2WA 3PHYA 5F5YA 5HDDA 3LIFA 1X0OA 2V0UA 3CWFA 3H82B 1Y28A 3GDIA 3E4PA 3P7NA 3IBRA 3LI9A 2JHEA 1LSWA 2OWHA 5DJTA 1OT9A 3G6OA 3HJKA 1XFNA 1N9NA 1XJ3A 3EEHA 3C8CA 3K3DA 2QWSA 1MZUA 3LIBA 3MR0A 4HJ3A 1N9OA 5DKKA 1XJ4A 3IS2B 5F68A 4L9EA 5F6AA 3UB8A 3MQOA 1OTBA 2WKQA 2Z6CA 4LRYC 4B9OA 4F3LA 4HOIA 1S1YA 1TS8A 2JN7A 5AVEA 1JNUA 1S4RA 3IS2A 5HD3A 4EEUA 3FC7A 5HSQA 1DRMA 2A24A 3LYXA 1OTEA 4LRXC 3RTYA 3RH8B 4HP4A 1UGUA 1TS0A 2V1BA 5KIZA 3BWLA 4WUJA 4I3IA 3SW1A 3MQQA 1P97A 1LSVA 1S4SA 1S66L 3F1NA 4PKYA 3UE6A 1TS7A 2EA9A 4EETB 5HDCA 3F1PA 4K08A 3F1OA 1LSXA 1N9LA 1D7EA 2PDRA 4EESA 4HIAA 4LPZA 4XT2A 4GS9B 3H7WA 1LT0A 4WLAA 3H82A 3NOUC 4HH3A 4YWZA 3OLOA 4XT2B 1GSWA 2H28A 4I38A 3B33A 2D02A 4I39A 1BYWA 4WF0A 4R6LA 1ODVA 1V9YA 2J80A 2CMNA 2K7SA 2VLGA 2WKPA 4NXGA 5J7EA 3UMEA 1XJ6A 4JGQA 3E4QA 3F1NB 2ZOIA 4MN5A 1F9IA 2QKPA 4BBTA 4EEPA 3F1OB 1LL8A 2PD8A 1OTIA 2ZOHA 3NOTC 4GHIA 4HJ4A 2PR6A 1OTAA 2KX6A 2PR5A 2L0WA 2W0NA 4NXBA 3NOPC 5HD5A 5IS1A 2B02A 2V0WA 2M1CA 3E4OA 4GS9A 4LRZE 1T1CA 5G4YA 3ULFA 4BBUA 4GW9A 3LI8A 5J4EA 2HV1A 3H7WB 1D06A 1DP6A
chains in the Genus database with same CATH superfamily
3S4XA 2YKHA 3BRMA 3S7QA 4ZJ2A 4KZ5A 1G28A 1S0WA 3T4OA 4OPYA 4UAAA 3VE3A 5DF7A 3A0VA 3UDXA 4EBLA 1FCMA 3EWKA 5FQKA 1K56A 5I94A 2VGJA 4HBTA 3MQ0A 4E3IA 1S6RA 2Y2MA 4CLCC 2FFYA 3Q7ZA 1L3LA 1KE0A 4JXWA 3L7HA 4RVAA 1F98A 2I72A 3G32A 1UWPX 1TD5A 4HHDA 3TRCA 3Q7VA 1HLUP 2ZM0A 1FCOA 5L09A 4Q0JA 4P6ZM 1ZTUA 1YSPA 1TVFA 4S2PA 3S7OA 1VETB 3VP3A 2XFSA 3TJZC 3C2WA 5HDDA 3RFBA 1FSWA 3P7NA 4PMAA 4RX3A 2ZL1B 1YLPA 3WS2A 1DRMA 2XEPA 1OPXA 2B18A 3FKVA 4PM6A 1J9MA 4WEJA 2W3FA 4RA7A 4GS9B 3MZDA 2ZQAA 1NYMA 5DTTA 2XK1A 5D3OA 3Q1FA 4JGQA 1ZHHB 3F1OB 3LO7A 4HJ4A 3NOTC 4NXBA 2KX6A 1XX2A 3NOPC 5TR7A 1DJBA 3LI8A 2DNSA 4B93A 4DF6A 4PPRA 4KZ7A 2VV7A 4GN2A 1G68A 4HNBA 3GMWA 2HDQA 3CHWP 1P9RA 4PM9A 3N8LA 5HZHA 2UV0E 4I3JA 3NC8A 4E3MA 3EGDC 3SS3A 2VGLS 1UWNX 3NECA 4ETXA 1P0ZA 3DAVA 3BLMA 3LIEA 4Z1WA 4H8RA 4HP9A 5J3WA 5GHYA 1SDNA 3B42A 3LGOA 5DTKA 2ZLYA 1RGZA 3S7NA 3PBTA 3LIFA 1I2WA 1X0OA 3WWXA 4X55A 3HVFA 2JHEA 4E3KA 1QMFA 3FPVA 4WZ5C 4P85A 1YT4A 1MZUA 1H3QA 5KSHA 1TS8A 5HSQA 3IS2A 4IVIA 3WS0A 1TS0A 4GLQA 5K5BA 2W3HA 1NYYA 1S66L 3PR6A 5JYOA 3W4OA 4JF6A 4QB8A 3NOUC 1PRQA 2HGVA 1GSWA 3OZHA 1E3UA 2A3UA 2J80A 2CMNA 2X01A 1XJ6A 1K25A 3E4QA 1KDSA 2QKPA 2ZQDA 1PI5A 1PWDA 4X69A 4S2JA 1IEMA 4ESPA 1OTAA 2L0WA 1Z09A 3KSGA 3M6BA 2PU2A 3W4PA 1PIOA 2IA2A 3IF5A 3KSIA 4E6WA 1MC0A 4ZTKA 3LICA 2OAP1 4C75A 3BFCA 4DJ3A 4MBHA 4HEFA 3SOIA 1HVBA 4BJPA 2NUTC 5FA7A 4M3KA 3WS1A 2V2FF 3UPPA 1KE4A 4OOMA 5F1GA 3NHQA 5DF8A 5HW3A 4KZAA 5FQQA 2H10A 2E8JA 3KX0X 3IQAA 3G31A 3LY3A 3GQZA 1BT5A 2NUPC 4QHCA 4R3JA 4F94A 2PHYA 2OOLA 3T50A 3DTIA 1PW1A 5HL6A 5E2FA 2HDSA 2W1TB 2WKIA 1PI4A 3E2LA 4FH2A 2VZWA 3ITBA 4GDBA 1MPLA 4KG2A 1ALQA 2DMWA 1JNUA 2JBFA 2WKEA 2C6WB 2JCHA 3VFHA 5FAPA 4K08A 3NULA 1GA9A 1KE3A 1GHIA 2G2UA 3G34A 4MCWA 2Y59A 3CJMA 1SKOA 4Q8IA 1VEUA 1XPBA 4D2OA 2Y2KA 4JXVA 1K0KA 5HD5A 2WKHA 1L0GA 3H7WB 4M4XA 3CPTA 1Z6FA 3UE1A 4C6YA 4HY8A 5GLBA 1VQQA 4LGWA 3CUEA 3G4PA 1TDGA 5MC7A 2Q9MA 3EGXC 4B4ZA 3UPOA 2INWA 2D01A 3EQUA 3S1YA 4P0MA 2XRNA 1D1JA 3Q81A 5IU1A 2G2WA 4OOYA 4FTXA 3HUNA 1WYCA 2XD5A 3IXHA 1YAXA 5DVAA 2Y2QA 4GZBA 1CEFA 3BLSA 5CHJA 2L1MA 1W63Q 1IFQA 3IWQA 1LLBA 1M6KA 3KYQA 1PW8A 4Y0UA 3QP1A 2W3GA 3PBOA 3MZEA 4OLDA 1XJ3A 3O87A 3IH9A 5BOHA 5AQ9A 5FQIA 3VSKA 4KZ9A 3R7WB 3QNCA 5HPFA 1LSVA 3E98A 1NLYA 3DWZA 2O99A 2IWDA 2DRWA 2PDRA 3A3JA 1VHMA 4N9LA 4HH3A 3OLOA 1P9WA 2IWCA 2E8IA 2D02A 2VGLM 2VLGA 3ZFZA 1NZOA 2WAEA 2ZOIA 2Y2JA 4UA7A 4BBTA 1XXMA 3OBFA 4N1XA 2ZBBA 4DDYA 4GHIB 4S2NA 1LI0A 2EWVA 3GTCA 4K91A 3AGEA 4DMZA 1ACFA 1CI9A 4EQ1A 3NCKA 2J9OA 4O0PA 2QHKA 3VOZA 2XLNA 2HP5A 2I9VA 3T4SA 2EXAA 1K57A 1XFQA 2PBYA 4CLCB 5HWWA 1PFLA 3OPLA 1MXOA 3S22A 5I5LA 2O0YA 2VA0A 1H5XA 2YKFA 2XH9A 3LIAA 4EERA 5L2FA 3HLWA 1ESIA 5FDHA 4GD8A 1BUEA 1PWCA 1SHVA 1K55A 1MBLA 3TW8A 3CWFA 1Y28A 3HLDA 2ZL1A 1L0EA 4OH0A 5FI2A 5HFOA 3CPTB 3WS5A 1ES4A 5FEGA 4B9OA 1K54A 5GLDA 4EEUA 3FC7A 2VKSA 4LRXC 2IWBA 3FYZA 4JBFA 4FOFA 4ZJ3A 3MKFA 1SKOB 2Y2NA 3UE3A 1TS7A 4OONA 3DBAA 1HZOA 2FFFB 1ERMA 1MWTA 4R4SA 3KYEA 3LY4A 4I38A 1AXBA 4GD6A 3OOVA 3KSFA 2K31A 5J7EA 5CTMA 4L0LA 3IF6A 3LEZA 3ZG8B 3ZHHA 4WN5A 5CRFA 4Q0IA 3MMHA 3N8SA 3N4IA 1Y4OA 4KZ8A 3JYIA 5FAQA 2DCFA 1GSXA 1MWRA 3CAXA 1NLZA 1FOFA 4H6JB 2WADA 4DDSA 3R7WA 2EX9A 2WZZA 1HTZA 4NKPA 4GOGA 3TE8A 4RYEA 4Q0HA 3GECA 5L07A 3NJAA 2QZ6A 3EQVA 1M40A 4XT2B 5FL3A 3RXWA 3D9YA 4R3BA 2GNXA 3IWIA 3P98A 3W4QA 2O9AA 1EI5A 1RP5A 3PXPA 3M6HA 3ZDJA 3H82B 4OP5A 3NIAA 1OT9A 4S2LA 1XGJA 2QWSA 4B88A 2ZJ9A 4Y13A 2UWXA 2ZM2A 3AGDA 5AVEA 2JN7A 1NRJA 1S4RA 5U47A 1OTEA 5KIZA 2V1BA 1SZVA 4YFMA 3UDFA 2XGNA 2JKTM 2XSSA 3ZG5A 3UE6A 2Y79A 4S2NC 4HBUA 3N6IA 4LCLA 5FI7A 5C5KA 4HESA 3H82A 2V1ZA 5EVIB 3VP0A 3DWKA 3HREA 4P6BA 4ID4A 2PRFA 3T4QA 2J8YA 3PBRA 3OCNA 3BJNA 1KGFA 4OKPA 1PWGA 3IBJA 1J3WA 4IBRA 1PYYA 1F5MA 2RCXA 1RCJA 1NJ4A 3A3DA 4LENA 3EEAA 1FQGA 5KSCA 1OJ5A 1KOUA 5L10A 1GHMA 3LR0A 5E43A 1K4FA 2V20A 4BLMA 1K6SA 3VV4A 4X6TA 5TBMB 4DXCA 5TGFA 3PBNA 2R78A 3Q07A 2JKFA 4U0TA 3DTKA 3LUQA 2Z2LB 1ERQA 4WL9A 4JGOA 2EFXA 4L9FA 1WYBA 5EVIA 5F82A 4ARZA 4JF5A 1IOUA 4X68A 3TSGA 5EFWA 4KQDA 2A24B 1SKFA 4E3JA 3LI9A 4IBXA 1YLWA 4GNUA 4HJ3A 3TG9A 3QHYA 3MQOA 2W1TA 4WZ4A 4EUZA 3CITA 1TF1A 3DTEA 3W2ZA 5DF9A 5FATA 2EA9A 2PT7A 5HDCA 1FILA 4LCMA 3T12B 3PBSA 5CTNA 3SZTA 1K38A 4Y15A 4ZDXA 1I5QA 3BECA 2M7UA 4QY6A 4DXBA 2H0TA 1VEUB 2EWWA 2BTFP 3IXBA 4R6LA 2Y2OA 2EX2A 2VX8A 3IX3A 4Y0OA 4EU0A 4P87A 1YLZA 2WUQA 4MMNA 3ITAA 1H8YA 3QP8A 3ZNYA 2XDMA 3BFGA 2V8CA 4F3LB 3V5MA 1VM1A 5CXWA 4KZ6A 1BSGA 4JGPA 4OPRA 4KG6A 5A90A 4U3TA 4RX2A 2LB5A 2P04A 1NY0A 2V1AA 1E4DA 4EW7A 2P74A 3T1RA 1YQSA 4NK3A 1T18A 1PZPA 2H0YA 3BY8A 4YNRA 3FZCA 5G4ZA 3MJQA 1OT6A 3PYPA 5HAIA 2W27A 4I3AA 4PM8A 4ZRRA 4E04A 1KVMA 5HWTA 5EUAA 3HBRA 5M18A 3IBRA 1IKIA 5E2HA 5TBMA 3MR0A 3C8CA 4CJNA 5LBRA 2P08A 4HOIA 3VP4A 3N7WA 1G6OA 1PZOA 3LYXA 1W8QA 4HP4A 3G35A 3RH8B 2HPBA 3WRTA 1YKDA 4MLLA 1LSXA 1D7EA 3A3EA 4LPZA 1LL9A 3BFEA 3BM6A 5DTSA 1BTLA 5EPHA 5JYPA 1F9IA 2Z2MB 2C5WB 1CJFA 3BFDA 4CLCD 4BD1A 3GSGA 3WS4A 1BLSA 1IELA 2HDUA 1ES5A 2PYRA 1XJ2A 1QMEA 4XUZA 3CG5A 3UPNA 1DP8A 4R3AA 3BEBA 3ICYA 4HH2A 4R4RA 1EW0A 2XF3A 3UE0A 1I2SA 4KZ4A 1RGYA 3BY9A 5GLCA 4I5SA 4EXOA 2ZMVA 4LLOB 1DJCA 1T1AA 3ZVWA 4Y0TA 4QY5A 4FCFA 3FWLA 4R38A 3HUOA 2G7UA 5E2EA 3IT9A 4G3KA 4NXEA 5EE8A 3JVVA 4OQIA 1IYOA 4Y5FA 4FH4A 3BQAA 2Y91A 4OP8A 1W5DA 3O3VA 3UY6A 3GDIA 2VJWA 3QP2A 3G6OA 2QPNA 3NBLA 4PHTA 1ES2A 2Z6CA 3C7VA 4MBFA 3IXGA 5FI6A 3NDEA 4EV4A 2ZQ8A 4JF4A 4FSFA 4S2MA 3M2KA 2OAQ1 5M1AA 4KQQA 4WM9A 4E3LA 4Z9QA 4X1LA 2CC1A 3MXRA 4DE0A 1H8MA 4X53A 3B33A 2ZC6B 3ZYTA 4Y17A 3OCLA 4UHUA 1STZA 2WGWB 2ZOHA 1GHPA 2PR6A 3O5YA 4GKUA 4GS9A 2P9VB 1JWZA 2WGVA 3OC2A 4JXGA 1CEGA 5KMWA 5CERA 2PYPA 3SH7A 4DJ2A 2ACGA 2JC7A 4O01A 5CEDA 4N92A 4NETA 2BLSA 3K2NA 4KQOA 4BQMA 1CQAA 4XUXA 5EV0A 3KSHA 3C38A 3T1XA 1XGIA 3D3OA 4S2IA 5KZHA 3LR3A 3UB6A 1WA9A 4WMCA 1KGGA 4KUOA 2XA7M 4L9GA 4OPZA 1Q2PA 1BZAA 3IX8A 5EVID 2L4RA 2P9VA 1JTGA 3CLOA 1SDEA 1DY6A 4ME4A 3TOIA 1DJAA 3MKEA 2V8FA 1YMXA 2ZC3B 3E4PA 5CEBA 4Y7PA 2J3TD 3HJKA 4OQHA 4CLCA 1N9NA 2HP6A 3K3DA 3EEHA 3V67A 1IYSA 4EBNA 1O07A 3QP6A 1W7FA 3A3IA 4CQHA 4WUJA 4PM7A 2K2NA 4K0XA 4P6ZS 3F1NA 4IEDA 4JLFA 4A5RA 4C3QA 1YSQA 5FASA 1XA1A 3F1PA 1BLCA 4HIAA 2ZQ7A 2PU4A 4YWZA 1ODVA 2K7SA 2WKPA 1K56D 5CX7A 4MNRA 5AQAA 1IYQA 3LR4A 1YM1A 2EX6A 3MBZA 2V0WA 3G2ZA 3R4KA 4GB7A 4GW9A 4XXRA 2HV1A 5J4EA 3CUEC 3MFDA 4PKYG 3A0RA 3CMZA 2OWJA 4II7A 3FKWA 3VOLA 4HI4A 5F83A 4KUKA 1NWZA 4MEZA 3T4LA 4KZBA 1FSYA 2R9WA 3N8RA 5HWVA 4PAUA 1MKIA 5DKKA 4UQIM 2JE5A 4LV1A 4E6XA 3OPPA 3UNWA 1OTDA 5EM0A 2HZ5A 4DE2A 3IWOA 5EOEA 4BL2A 2RL3A 5FQMA 5HX9A 4QPRA 3C5AA 4BENA 2W3EA 2OWHA 3Q82A 5CHUA 1N9OA 3G2YA 5F6AA 3UB8A 2XROA 3GRJA 5HD3A 1S1YA 3L9KA 4GDNA 4YOFA 3C7UA 4X56A 1HD8A 3BWLA 3ZG0A 1L2SA 1N9LA 2HP9A 3ZG7B 2H28A 4Y2FA 4I39A 3HUMA 3UO9A 2JKRI 5A93A 5L8MA 3B3XA 5GHXA 3IHAA 5HAQA 4GJ4A 5GLAA 2PD8A 3PAEA 3HLEA 4GHIA 3T1SA 2B02A 1H8ZA 4E3OA 4PM5A 1FIKA 3M2JA 3P01A 1DP6A 2B95A 3BFFA 3HLCA 2ZD8A 2Q9NA 3ZQ5A 3LEQA 2A49A 3MXQA 2Y2LA 1EWZA 1V9ZA 1K54C 1JWPA 4JGRA 1N4OA 4JPMA 3PAGA 4IVKA 3UB7A 3CI6A 5EECA 5EVEA 1S67L 2J3WA 2Y2PA 2PBDP 1CF0A 1EROA 1T19A 1L0DA 4R23A 2EFUA 1YPRA 3VOYA 1ONGA 2OLVA 2VV6A 3F1PB 3A3FA 3LCEA 4HQAA 5IT5A 5CGSA 2V0UA 4OVDA 1LSWA 4NG2A 4R1GA 2BG1A 1XFNA 1JVJA 2GX5A 5F68A 1L0FA 4WYYA 2VK3A 4F3LA 5F1FA 2Y55A 1GCEA 1KDWA 3W8KA 4OOLA 2WYXA 4OLGA 4JKTA 3BW6A 3UDIA 4EETB 2ZMFA 3V50A 5FSRA 3IH8A 1O7EA 4XT2A 2O9CA 2XA7S 3CZDA 4ZAMA 1LT0A 2Y4AA 3NI9A 5CECA 1ZG6A 3OPHA 4U0XA 4NEED 1OTIA 4IJGA 2W0NA 5G4YA 2W1RA 2XQZA 1SCWA 3MSHA 2GDNA 3T4KA 3SH8A 4N1HA 3MFXA 3T4TA 3HLFA 3U4LP 3P09A 3UN7A 5AVFA 1FR1A 1T1BA 5DFYA 3FV7A 3UMDA 1PNEA 5A91A 2AVXA 2VEAA 4EQIA 4MDZA 1ONHA 3VE4A 2Q0OA 4KQRA 4DE1A 2M7VA 3KO6A 1Q2QA 4WBGA 3VFFA 3HJIA 2Z6DA 3UB5P 5IHVA 2LB9A 3D72A 1G5UA 3V39A 3I7JA 1JTDA 2BASA 3O86A 4CLCE 1ESUA 5HPIA 1G6AA 1F2KA 5EVIC 3IX4A 4IHQA 3T4JA 1BULA 1K55C 4LV0A 2H5SA 4YINA 3LIBA 5AQBA 1XJ4A 3SS5A 3DTMA 1ZC2A 4K0WA 2WZXA 5EM1A 5M19A 2QMIA 4E3NA 1UGUA 3SW1A 4QU3A 5FQ9A 4WZ5A 1N9BA 3FPWA 1K57C 5FDSA 5TJJA 2GZAA 4DRTA 1YLJA 1BYWA 2EXBA 4KG5A 4O7DA 4OQGA 4LFUA 3EOIA 5FQJA 1MWSA 3HLBA 3NDGA 2XFTA 4UA9A 2JKGA 4CPKA 4LRZE 4BBUA 3K3CA 4X1MA 3JPUA 4ETZA 3MZFA 3U2AA 4EEPA 4LV3A 1GA0A 4BD0A 2Y2IA 1DP9A 1IYPA 1OJGA 1K6RA 1GSVA 3ZNTA 3QP4A 4DKIA 2ZM8A 4MN6A 4AFIA 5DJUA 3KYZA 2OSUA 1MKMA 1VETA 2QJ7A 3OPRA 1BLHA 2JKRM 5CHMA 3ZVTA 3SS4A 1E25A 4KZ3A 5HDSA 3LR5A 4QWOA 3DW0A 3SH9A 1NZUA 2WK0A 3VP2A 5DKLA 1VB6A 2Y8HA 4QJGA 3Q7VB 4DE3A 2HDRA 3B47A 2O9BA 4B4XA 3LFVA 1OTBA 2Y2GA 1YLYA 1W63M 2R9XA 2XR0A 3S7PA 3RTYA 4I3IA 1P97A 4ZBEA 3VSLA 1JWVA 3F1OA 2J9PA 5HAPA 4WEKA 3HL9A 5AQ7A 4WLAA 4FUWA 3RJUA 2KOIA 5CGWA 4MBKA 2OV5A 3F1NB 4MN5A 1ES3A 1LL8A 4OPQA 5HARA 2ZQ9A 3IF6C 3QP5A 3ULFA 1D06A 4JXSA 3BQ8A 3UB9A 1LHYA 2OLUA 5A92A 4LV2A 1KGEA 1LL5A 2HJ9C 4Y3IA 4R0QA 1ZKJA 2KLIA 3H9WA 3WRZA 5GL9A 2ZC5B 1AWIA 3VMAA 4WELA 1NXYA 2JKTI 3E2KA 2ZC4B 2MJ6A 5CGXA 1CI8A 5HL1A 2W3DA 2ZMAA 3A0SA 4RQ9A 3ZG9B 1BLPA 4BWIA 4MN7A 1FR6A 2GJ3A 2FH5A 2J7VA 4O8GA 2ZQCA 2V9AA 2WKRA 5F69A 1ZG4A 1XP4A 4D60A 4NXFA 3HLGA 4BL3A 3FG8A 3PBQA 2KDKA 2XD1A 3IHBA 1NRFA 2A2LA 4H6JA 2FZ0A 5F5YA 1XKZA 3ZGAB 4BMWA 1YMSA 3IS2B 4L9EA 2WKQA 4LRYC 4X25A 3IXDA 4G3VA 1E3UD 2WGWA 1LI9A 4IUHA 4QD4A 2A24A 2VGKA 3MQQA 2B5RA 2X71A 3ZCZA 4ARZB 4KENB 3BYDA 3V3RA 3C4OA 3H7WA 3ISGA 4WF0A 1V9YA 3GR2A 4N9KA 3C30A 4EBPA 5IS1A 3HCYA 5E2GA 1MWUA 1CK3A 1KVLA 3QNBA 2QYBA 5AJGA 3T1QB 3GV9A 1IKGA 1W79A 4UA6A 1Y54A 4IUKA 2HF6A 1FCNA 1TDLA 1S1ZA 1C3BA 2PAVP 4BBVA 2WGIA 2PD7A 2QJ5A 2X02A 2HJEA 2P7JA 4EWFA 3RXXA 2ZC7A 3D4FA 2VV8A 3MS6A 5GHZA 3MXSA 4GCZA 3G30A 1TS6A 2WAFA 1OMEA 2J3TC 4HJ6A 5FAOA 4R70A 5A8BA 4G3WA 1WE4A 3LIDA 5J8XA 5G18A 3VP1A 3V3SA 3PHYA 4WMCD 1TEMA 5EVLA 5DJTA 5EOOA 4ZJ1A 5DFXA 4DN0A 5FEFA 1XA7A 3C4PA 4S2OA 1S4SA 3NY4A 4PKYA 3GVBA 2EX8A 3E0YA 1A0KA 1YLTA 4OQ0A 2Y2HA 4UQIS 4EESA 4UEYA 4EUVA 3AGFA 1K4EA 5TFQA 1H0MA 4S2KA 3O88A 1W8YA 4NXGA 3UMEA 1MY8A 3PTEA 2PR5A 1U60A 3IF6B 3MF0A 3E4OA 3JVUA 2M1CA 1T1CA 4FD8A
chains in the Genus database with same CATH topology
2ZBBA 4GHIB 2YKHA 3T4KA 2EWVA 3S7QA 2PYRA 1G28A 1XJ2A 3T4OA 3MFXA 3T4TA 1DP8A 4R3AA 5AVFA 3VE3A 3ICYA 4HH2A 1EW0A 3A0VA 4DMZA 1T1BA 3EWKA 5DFYA 3UMDA 4EQ1A 4O0PA 3MQ0A 2VEAA 3BY9A 4MDZA 2QHKA 4CLCC 4I5SA 3VE4A 2ZMVA 2I9VA 4LLOB 4EXOA 1T1AA 2M7VA 3T4SA 3KO6A 1XFQA 4CLCB 1F98A 5HWWA 3HJIA 2Z6DA 1UWPX 1TD5A 2LB9A 4HHDA 3TRCA 4R38A 5I5LA 2O0YA 2G7UA 2VA0A 4Q0JA 3D72A 4P6ZM 4G3KA 4NXEA 2YKFA 1ZTUA 3JVVA 1YSPA 3LIAA 4EERA 3S7OA 4Y5FA 2BASA 4CLCE 3BQAA 5HPIA 3TJZC 3C2WA 3TW8A 5HDDA 4IHQA 3CWFA 3RFBA 3T4JA 1Y28A 2VJWA 3GDIA 3P7NA 3G6OA 4PHTA 3LIBA 1XJ4A 2Z6CA 4B9OA 4EEUA 3FC7A 1DRMA 2VKSA 4LRXC 1UGUA 3SW1A 1OPXA 2B18A 4FOFA 3UE3A 4FSFA 1TS7A 2OAQ1 3DBAA 3FPWA 4WEJA 2W3FA 5TJJA 4GS9B 2GZAA 1H8MA 4I38A 3B33A 1BYWA 3OOVA 3KSFA 3ZYTA 2K31A 5J7EA 4JGQA 4L0LA 1ZHHB 3F1OB 3OCLA 1STZA 3EOIA 2ZOHA 3NOTC 4HJ4A 4WN5A 2PR6A 2KX6A 4NXBA 4Q0IA 3O5YA 3NOPC 4GS9A 4LRZE 4BBUA 3MMHA 3LI8A 3OC2A 4B93A 2PYPA 3K3CA 2VV7A 4DJ2A 4ETZA 1GSXA 4HNBA 4O01A 3U2AA 4EEPA 3CAXA 1NLZA 4H6JB 3K2NA 4KQOA 1P9RA 3KSHA 1DP9A 3C38A 5HZHA 3R7WA 3D3OA 1OJGA 4I3JA 4NKPA 3TE8A 3EGDC 1GSVA 2VGLS 3LR3A 1UWNX 4Q0HA 3GECA 3UB6A 1P0ZA 4ETXA 1WA9A 3NJAA 4KUOA 3EQVA 4MN6A 3LIEA 2XA7M 4XT2B 4AFIA 4L9GA 5DJUA 3KYZA 5FL3A 2QJ7A 1MKMA 4Z1WA 4HP9A 2JKRM 5J3WA 2L4RA 3B42A 2GNXA 5HDSA 3CLOA 3LR5A 3S7NA 2O9AA 3PBTA 3PXPA 5DKLA 1VB6A 2Y8HA 4ME4A 3LIFA 1X0OA 3H82B 3E4PA 2JHEA 2J3TD 1OT9A 3HJKA 3FPVA 4CLCA 1N9NA 3B47A 3EEHA 3K3DA 3V67A 2QWSA 1MZUA 2O9BA 1H3QA 3LFVA 5KSHA 1OTBA 1TS8A 1W63M 2JN7A 1NRJA 3IS2A 1S4RA 5AVEA 3S7PA 5HSQA 1OTEA 3RTYA 5KIZA 1TS0A 2V1BA 4CQHA 4WUJA 4GLQA 2K2NA 4I3IA 5K5BA 2W3HA 1P97A 2JKTM 2XSSA 4P6ZS 1S66L 3F1NA 3PR6A 3UE6A 2Y79A 1YSQA 3F1PA 3F1OA 4WEKA 5C5KA 4HIAA 4WLAA 3H82A 3NOUC 4YWZA 2HGVA 1GSWA 3T4QA 2KOIA 1ODVA 3PBRA 2J80A 2K7SA 2CMNA 2WKPA 3BJNA 3OCNA 1XJ6A 3E4QA 3F1NB 5CX7A 4MN5A 2QKPA 3IBJA 1LL8A 3LR4A 1OTAA 2L0WA 2V0WA 3R4KA 1F5MA 3KSGA 3ULFA 4GW9A 5J4EA 2HV1A 1D06A 3CUEC 3BQ8A 3UB9A 4PKYG 2IA2A 3A0RA 3EEAA 3KSIA 1MC0A 2OWJA 2HJ9C 3LICA 4Y3IA 2OAP1 1OJ5A 4II7A 4DJ3A 1KOUA 3VOLA 4HI4A 2KLIA 3H9WA 4BJPA 3LR0A 2NUTC 4KUKA 4WELA 1NWZA 3T4LA 2JKTI 2MJ6A 5HWVA 3VV4A 4OOMA 2W3DA 5TBMB 4PAUA 3A0SA 5DKKA 4RQ9A 3NHQA 3PBNA 2R78A 4UQIM 4BWIA 4MN7A 2GJ3A 2FH5A 3LUQA 4O8GA 1OTDA 4WL9A 3KX0X 4JGOA 2V9AA 2WKRA 5F69A 4L9FA 4NXFA 3FG8A 3PBQA 4ARZA 2NUPC 2KDKA 1IOUA 2PHYA 2A2LA 2OOLA 4H6JA 5EFWA 2FZ0A 4KQDA 3T50A 2A24B 5F5YA 4QPRA 5HL6A 2W3EA 3LI9A 2OWHA 2W1TB 4BMWA 4HJ3A 1N9OA 2VZWA 3IS2B 4L9EA 5F6AA 3UB8A 2XROA 3MQOA 2WKQA 4LRYC 2W1TA 4G3VA 2DMWA 1S1YA 5HD3A 1JNUA 4YOFA 4IUHA 3CITA 2A24A 3BWLA 3MQQA 1TF1A 3W2ZA 5DF9A 2EA9A 2PT7A 4ARZB 5HDCA 4K08A 3PBSA 1N9LA 3H7WA 4MCWA 2M7UA 2H28A 4Y2FA 4WF0A 2EWWA 4I39A 4R6LA 2JKRI 1V9YA 5L8MA 2VX8A 4GJ4A 2PD8A 3C30A 4EU0A 4GHIA 5IS1A 5HD5A 3HCYA 2B02A 4MMNA 2QYBA 3P01A 3H7WB 5AJGA 1DP6A 4M4XA 4F3LB 4IUKA 2HF6A 3ZQ5A 4HY8A 4JGPA 3MXQA 3CUEA 1S1ZA 1V9ZA 5MC7A 4BBVA 4JGRA 2LB5A 2P04A 2PD7A 2QJ5A 2V1AA 3EGXC 4EW7A 2INWA 2D01A 3UB7A 3CI6A 3EQUA 2HJEA 2P7JA 1S67L 2XRNA 1T18A 2J3WA 2VV8A 5IU1A 3BY8A 4YNRA 5G4ZA 3MJQA 1OT6A 1T19A 4GCZA 3PYPA 1TS6A 2J3TC 1YAXA 2W27A 4HJ6A 4I3AA 4R70A 4ZRRA 2VV6A 5A8BA 2L1MA 1W63Q 1IFQA 3F1PB 4E04A 5HWTA 4G3WA 3LIDA 4HQAA 5IT5A 3KYQA 3PHYA 2V0UA 2W3GA 3IBRA 1LSWA 5DJTA 3PBOA 1XFNA 1XJ3A 3MR0A 3C8CA 5TBMA 2GX5A 5LBRA 5F68A 4F3LA 2P08A 4HOIA 5DFXA 4DN0A 1G6OA 3LYXA 3R7WB 3RH8B 4HP4A 5HPFA 4OOLA 1LSVA 1S4SA 3E98A 1NLYA 4PKYA 3BW6A 1YKDA 2ZMFA 4EETB 3E0YA 2O99A 1LSXA 1D7EA 2PDRA 4UQIS 4EESA 4LPZA 4UEYA 4XT2A 1VHMA 2O9CA 2XA7S 4EUVA 1LT0A 4HH3A 3OLOA 1P9WA 2D02A 2VGLM 2VLGA 4NXGA 3UMEA 2ZOIA 1F9IA 4BBTA 4CLCD 4NEED 1OTIA 4IJGA 3OBFA 2PR5A 2W0NA 3MF0A 3E4OA 3JVUA 2M1CA 2W1RA 5G4YA 1T1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TBM A;  4M4X A;  2ZBB A;  4GHI B;  2YKH A;  4PKY G;  3UB9 A;  2PYP A;  2PYR A;  1G28 A;  1XJ2 A;  2VV7 A;  3A0R A;  3K3C A;  3ZQ5 A;  3MFX A;  4F3L B;  4DJ2 A;  4HY8 A;  4DJ3 A;  2OWJ A;  1DP8 A;  4R3A A;  1GSX A;  3LIC A;  4JGP A;  5AVF A;  4HNB A;  3VE3 A;  3ICY A;  1OJ5 A;  3CAX A;  1EW0 A;  3A0V A;  1KOU A;  3MXQ A;  4HH2 A;  4HI4 A;  1S1Z A;  3VOL A;  1T1B A;  1V9Z A;  3EWK A;  4H6J B;  3UMD A;  3H9W A;  4BBV A;  4EQ1 A;  4JGR A;  2PD7 A;  2QJ5 A;  2VEA A;  3BY9 A;  4KUK A;  1NWZ A;  2V1A A;  4EW7 A;  2QHK A;  1DP9 A;  2INW A;  2D01 A;  5HZH A;  3UB7 A;  4I5S A;  3VE4 A;  4LLO B;  2I9V A;  2P7J A;  1OJG A;  4I3J A;  4EXO A;  1S67 L;  1T1A A;  5HWV A;  5TBM B;  1XFQ A;  1T18 A;  1F98 A;  1GSV A;  3A0S A;  3HJI A;  3NHQ A;  4RQ9 A;  1UWN X;  2R78 A;  2VV8 A;  2Z6D A;  3BY8 A;  3GEC A;  5IU1 A;  1UWP X;  3UB6 A;  1P0Z A;  1WA9 A;  3NJA A;  4HHD A;  2GJ3 A;  4R38 A;  4KUO A;  5G4Z A;  3LUQ A;  3MJQ A;  5I5L A;  1OTD A;  1OT6 A;  1T19 A;  4MN6 A;  4GCZ A;  4WL9 A;  3KX0 X;  3LIE A;  1TS6 A;  3D72 A;  3PYP A;  2V9A A;  4JGO A;  4L9G A;  2QJ7 A;  4NXE A;  5DJU A;  2WKR A;  2W27 A;  2YKF A;  4HJ6 A;  4I3A A;  4R70 A;  4HP9 A;  4WN5 A;  4L9F A;  5F69 A;  5J3W A;  3LIA A;  2VV6 A;  4NXF A;  5HWW A;  4EER A;  5A8B A;  2L4R A;  3FG8 A;  2KDK A;  2L1M A;  3F1P B;  5HDS A;  4E04 A;  3CLO A;  2BAS A;  5HWT A;  2PHY A;  3LID A;  2OOL A;  4H6J A;  4HQA A;  5EFW A;  3T50 A;  4KQD A;  5DKL A;  1VB6 A;  2A24 B;  3C2W A;  3PHY A;  5F5Y A;  5HDD A;  3LIF A;  1X0O A;  2V0U A;  3CWF A;  3H82 B;  1Y28 A;  3GDI A;  3E4P A;  3P7N A;  3IBR A;  3LI9 A;  2JHE A;  1LSW A;  2OWH A;  5DJT A;  1OT9 A;  3G6O A;  3HJK A;  1XFN A;  1N9N A;  1XJ3 A;  3EEH A;  3C8C A;  3K3D A;  2QWS A;  1MZU A;  3LIB A;  3MR0 A;  4HJ3 A;  1N9O A;  5DKK A;  1XJ4 A;  3IS2 B;  5F68 A;  4L9E A;  5F6A A;  3UB8 A;  3MQO A;  1OTB A;  2WKQ A;  2Z6C A;  4LRY C;  4B9O A;  4F3L A;  4HOI A;  1S1Y A;  1TS8 A;  2JN7 A;  5AVE A;  1JNU A;  1S4R A;  3IS2 A;  5HD3 A;  4EEU A;  3FC7 A;  5HSQ A;  1DRM A;  2A24 A;  3LYX A;  1OTE A;  4LRX C;  3RTY A;  3RH8 B;  4HP4 A;  1UGU A;  1TS0 A;  2V1B A;  5KIZ A;  3BWL A;  4WUJ A;  4I3I A;  3SW1 A;  3MQQ A;  1P97 A;  1LSV A;  1S4S A;  1S66 L;  3F1N A;  4PKY A;  3UE6 A;  1TS7 A;  2EA9 A;  4EET B;  5HDC A;  3F1P A;  4K08 A;  3F1O A;  1LSX A;  1N9L A;  1D7E A;  2PDR A;  4EES A;  4HIA A;  4LPZ A;  4XT2 A;  4GS9 B;  3H7W A;  1LT0 A;  4WLA A;  3H82 A;  3NOU C;  4HH3 A;  4YWZ A;  3OLO A;  4XT2 B;  1GSW A;  2H28 A;  4I38 A;  3B33 A;  2D02 A;  4I39 A;  1BYW A;  4WF0 A;  4R6L A;  1ODV A;  1V9Y A;  2J80 A;  2CMN A;  2K7S A;  2VLG A;  2WKP A;  4NXG A;  5J7E A;  3UME A;  1XJ6 A;  4JGQ A;  3E4Q A;  3F1N B;  2ZOI A;  4MN5 A;  1F9I A;  2QKP A;  4BBT A;  4EEP A;  3F1O B;  1LL8 A;  2PD8 A;  1OTI A;  2ZOH A;  3NOT C;  4GHI A;  4HJ4 A;  2PR6 A;  1OTA A;  2KX6 A;  2PR5 A;  2L0W A;  2W0N A;  4NXB A;  3NOP C;  5HD5 A;  5IS1 A;  2B02 A;  2V0W A;  2M1C A;  3E4O A;  4GS9 A;  4LRZ E;  1T1C A;  5G4Y A;  3ULF A;  4BBU A;  4GW9 A;  3LI8 A;  5J4E A;  2HV1 A;  3H7W B;  1D06 A;  1DP6 A; 
#chains in the Genus database with same CATH topology
 3S4X A;  2YKH A;  3BRM A;  3S7Q A;  4ZJ2 A;  4KZ5 A;  1G28 A;  1S0W A;  3T4O A;  4OPY A;  4UAA A;  3VE3 A;  5DF7 A;  3A0V A;  3UDX A;  4EBL A;  1FCM A;  3EWK A;  5FQK A;  1K56 A;  5I94 A;  2VGJ A;  4HBT A;  3MQ0 A;  4E3I A;  1S6R A;  2Y2M A;  4CLC C;  2FFY A;  3Q7Z A;  1L3L A;  1KE0 A;  4JXW A;  3L7H A;  4RVA A;  1F98 A;  2I72 A;  3G32 A;  1UWP X;  1TD5 A;  4HHD A;  3TRC A;  3Q7V A;  1HLU P;  2ZM0 A;  1FCO A;  5L09 A;  4Q0J A;  4P6Z M;  1ZTU A;  1YSP A;  1TVF A;  4S2P A;  3S7O A;  1VET B;  3VP3 A;  2XFS A;  3TJZ C;  3C2W A;  5HDD A;  3RFB A;  1FSW A;  3P7N A;  4PMA A;  4RX3 A;  2ZL1 B;  1YLP A;  3WS2 A;  1DRM A;  2XEP A;  1OPX A;  2B18 A;  3FKV A;  4PM6 A;  1J9M A;  4WEJ A;  2W3F A;  4RA7 A;  4GS9 B;  3MZD A;  2ZQA A;  1NYM A;  5DTT A;  2XK1 A;  5D3O A;  3Q1F A;  4JGQ A;  1ZHH B;  3F1O B;  3LO7 A;  4HJ4 A;  3NOT C;  4NXB A;  2KX6 A;  1XX2 A;  3NOP C;  5TR7 A;  1DJB A;  3LI8 A;  2DNS A;  4B93 A;  4DF6 A;  4PPR A;  4KZ7 A;  2VV7 A;  4GN2 A;  1G68 A;  4HNB A;  3GMW A;  2HDQ A;  3CHW P;  1P9R A;  4PM9 A;  3N8L A;  5HZH A;  2UV0 E;  4I3J A;  3NC8 A;  4E3M A;  3EGD C;  3SS3 A;  2VGL S;  1UWN X;  3NEC A;  4ETX A;  1P0Z A;  3DAV A;  3BLM A;  3LIE A;  4Z1W A;  4H8R A;  4HP9 A;  5J3W A;  5GHY A;  1SDN A;  3B42 A;  3LGO A;  5DTK A;  2ZLY A;  1RGZ A;  3S7N A;  3PBT A;  3LIF A;  1I2W A;  1X0O A;  3WWX A;  4X55 A;  3HVF A;  2JHE A;  4E3K A;  1QMF A;  3FPV A;  4WZ5 C;  4P85 A;  1YT4 A;  1MZU A;  1H3Q A;  5KSH A;  1TS8 A;  5HSQ A;  3IS2 A;  4IVI A;  3WS0 A;  1TS0 A;  4GLQ A;  5K5B A;  2W3H A;  1NYY A;  1S66 L;  3PR6 A;  5JYO A;  3W4O A;  4JF6 A;  4QB8 A;  3NOU C;  1PRQ A;  2HGV A;  1GSW A;  3OZH A;  1E3U A;  2A3U A;  2J80 A;  2CMN A;  2X01 A;  1XJ6 A;  1K25 A;  3E4Q A;  1KDS A;  2QKP A;  2ZQD A;  1PI5 A;  1PWD A;  4X69 A;  4S2J A;  1IEM A;  4ESP A;  1OTA A;  2L0W A;  1Z09 A;  3KSG A;  3M6B A;  2PU2 A;  3W4P A;  1PIO A;  2IA2 A;  3IF5 A;  3KSI A;  4E6W A;  1MC0 A;  4ZTK A;  3LIC A;  2OAP 1;  4C75 A;  3BFC A;  4DJ3 A;  4MBH A;  4HEF A;  3SOI A;  1HVB A;  4BJP A;  2NUT C;  5FA7 A;  4M3K A;  3WS1 A;  2V2F F;  3UPP A;  1KE4 A;  4OOM A;  5F1G A;  3NHQ A;  5DF8 A;  5HW3 A;  4KZA A;  5FQQ A;  2H10 A;  2E8J A;  3KX0 X;  3IQA A;  3G31 A;  3LY3 A;  3GQZ A;  1BT5 A;  2NUP C;  4QHC A;  4R3J A;  4F94 A;  2PHY A;  2OOL A;  3T50 A;  3DTI A;  1PW1 A;  5HL6 A;  5E2F A;  2HDS A;  2W1T B;  2WKI A;  1PI4 A;  3E2L A;  4FH2 A;  2VZW A;  3ITB A;  4GDB A;  1MPL A;  4KG2 A;  1ALQ A;  2DMW A;  1JNU A;  2JBF A;  2WKE A;  2C6W B;  2JCH A;  3VFH A;  5FAP A;  4K08 A;  3NUL A;  1GA9 A;  1KE3 A;  1GHI A;  2G2U A;  3G34 A;  4MCW A;  2Y59 A;  3CJM A;  1SKO A;  4Q8I A;  1VEU A;  1XPB A;  4D2O A;  2Y2K A;  4JXV A;  1K0K A;  5HD5 A;  2WKH A;  1L0G A;  3H7W B;  4M4X A;  3CPT A;  1Z6F A;  3UE1 A;  4C6Y A;  4HY8 A;  5GLB A;  1VQQ A;  4LGW A;  3CUE A;  3G4P A;  1TDG A;  5MC7 A;  2Q9M A;  3EGX C;  4B4Z A;  3UPO A;  2INW A;  2D01 A;  3EQU A;  3S1Y A;  4P0M A;  2XRN A;  1D1J A;  3Q81 A;  5IU1 A;  2G2W A;  4OOY A;  4FTX A;  3HUN A;  1WYC A;  2XD5 A;  3IXH A;  1YAX A;  5DVA A;  2Y2Q A;  4GZB A;  1CEF A;  3BLS A;  5CHJ A;  2L1M A;  1W63 Q;  1IFQ A;  3IWQ A;  1LLB A;  1M6K A;  3KYQ A;  1PW8 A;  4Y0U A;  3QP1 A;  2W3G A;  3PBO A;  3MZE A;  4OLD A;  1XJ3 A;  3O87 A;  3IH9 A;  5BOH A;  5AQ9 A;  5FQI A;  3VSK A;  4KZ9 A;  3R7W B;  3QNC A;  5HPF A;  1LSV A;  3E98 A;  1NLY A;  3DWZ A;  2O99 A;  2IWD A;  2DRW A;  2PDR A;  3A3J A;  1VHM A;  4N9L A;  4HH3 A;  3OLO A;  1P9W A;  2IWC A;  2E8I A;  2D02 A;  2VGL M;  2VLG A;  3ZFZ A;  1NZO A;  2WAE A;  2ZOI A;  2Y2J A;  4UA7 A;  4BBT A;  1XXM A;  3OBF A;  4N1X A;  2ZBB A;  4DDY A;  4GHI B;  4S2N A;  1LI0 A;  2EWV A;  3GTC A;  4K91 A;  3AGE A;  4DMZ A;  1ACF A;  1CI9 A;  4EQ1 A;  3NCK A;  2J9O A;  4O0P A;  2QHK A;  3VOZ A;  2XLN A;  2HP5 A;  2I9V A;  3T4S A;  2EXA A;  1K57 A;  1XFQ A;  2PBY A;  4CLC B;  5HWW A;  1PFL A;  3OPL A;  1MXO A;  3S22 A;  5I5L A;  2O0Y A;  2VA0 A;  1H5X A;  2YKF A;  2XH9 A;  3LIA A;  4EER A;  5L2F A;  3HLW A;  1ESI A;  5FDH A;  4GD8 A;  1BUE A;  1PWC A;  1SHV A;  1K55 A;  1MBL A;  3TW8 A;  3CWF A;  1Y28 A;  3HLD A;  2ZL1 A;  1L0E A;  4OH0 A;  5FI2 A;  5HFO A;  3CPT B;  3WS5 A;  1ES4 A;  5FEG A;  4B9O A;  1K54 A;  5GLD A;  4EEU A;  3FC7 A;  2VKS A;  4LRX C;  2IWB A;  3FYZ A;  4JBF A;  4FOF A;  4ZJ3 A;  3MKF A;  1SKO B;  2Y2N A;  3UE3 A;  1TS7 A;  4OON A;  3DBA A;  1HZO A;  2FFF B;  1ERM A;  1MWT A;  4R4S A;  3KYE A;  3LY4 A;  4I38 A;  1AXB A;  4GD6 A;  3OOV A;  3KSF A;  2K31 A;  5J7E A;  5CTM A;  4L0L A;  3IF6 A;  3LEZ A;  3ZG8 B;  3ZHH A;  4WN5 A;  5CRF A;  4Q0I A;  3MMH A;  3N8S A;  3N4I A;  1Y4O A;  4KZ8 A;  3JYI A;  5FAQ A;  2DCF A;  1GSX A;  1MWR A;  3CAX A;  1NLZ A;  1FOF A;  4H6J B;  2WAD A;  4DDS A;  3R7W A;  2EX9 A;  2WZZ A;  1HTZ A;  4NKP A;  4GOG A;  3TE8 A;  4RYE A;  4Q0H A;  3GEC A;  5L07 A;  3NJA A;  2QZ6 A;  3EQV A;  1M40 A;  4XT2 B;  5FL3 A;  3RXW A;  3D9Y A;  4R3B A;  2GNX A;  3IWI A;  3P98 A;  3W4Q A;  2O9A A;  1EI5 A;  1RP5 A;  3PXP A;  3M6H A;  3ZDJ A;  3H82 B;  4OP5 A;  3NIA A;  1OT9 A;  4S2L A;  1XGJ A;  2QWS A;  4B88 A;  2ZJ9 A;  4Y13 A;  2UWX A;  2ZM2 A;  3AGD A;  5AVE A;  2JN7 A;  1NRJ A;  1S4R A;  5U47 A;  1OTE A;  5KIZ A;  2V1B A;  1SZV A;  4YFM A;  3UDF A;  2XGN A;  2JKT M;  2XSS A;  3ZG5 A;  3UE6 A;  2Y79 A;  4S2N C;  4HBU A;  3N6I A;  4LCL A;  5FI7 A;  5C5K A;  4HES A;  3H82 A;  2V1Z A;  5EVI B;  3VP0 A;  3DWK A;  3HRE A;  4P6B A;  4ID4 A;  2PRF A;  3T4Q A;  2J8Y A;  3PBR A;  3OCN A;  3BJN A;  1KGF A;  4OKP A;  1PWG A;  3IBJ A;  1J3W A;  4IBR A;  1PYY A;  1F5M A;  2RCX A;  1RCJ A;  1NJ4 A;  3A3D A;  4LEN A;  3EEA A;  1FQG A;  5KSC A;  1OJ5 A;  1KOU A;  5L10 A;  1GHM A;  3LR0 A;  5E43 A;  1K4F A;  2V20 A;  4BLM A;  1K6S A;  3VV4 A;  4X6T A;  5TBM B;  4DXC A;  5TGF A;  3PBN A;  2R78 A;  3Q07 A;  2JKF A;  4U0T A;  3DTK A;  3LUQ A;  2Z2L B;  1ERQ A;  4WL9 A;  4JGO A;  2EFX A;  4L9F A;  1WYB A;  5EVI A;  5F82 A;  4ARZ A;  4JF5 A;  1IOU A;  4X68 A;  3TSG A;  5EFW A;  4KQD A;  2A24 B;  1SKF A;  4E3J A;  3LI9 A;  4IBX A;  1YLW A;  4GNU A;  4HJ3 A;  3TG9 A;  3QHY A;  3MQO A;  2W1T A;  4WZ4 A;  4EUZ A;  3CIT A;  1TF1 A;  3DTE A;  3W2Z A;  5DF9 A;  5FAT A;  2EA9 A;  2PT7 A;  5HDC A;  1FIL A;  4LCM A;  3T12 B;  3PBS A;  5CTN A;  3SZT A;  1K38 A;  4Y15 A;  4ZDX A;  1I5Q A;  3BEC A;  2M7U A;  4QY6 A;  4DXB A;  2H0T A;  1VEU B;  2EWW A;  2BTF P;  3IXB A;  4R6L A;  2Y2O A;  2EX2 A;  2VX8 A;  3IX3 A;  4Y0O A;  4EU0 A;  4P87 A;  1YLZ A;  2WUQ A;  4MMN A;  3ITA A;  1H8Y A;  3QP8 A;  3ZNY A;  2XDM A;  3BFG A;  2V8C A;  4F3L B;  3V5M A;  1VM1 A;  5CXW A;  4KZ6 A;  1BSG A;  4JGP A;  4OPR A;  4KG6 A;  5A90 A;  4U3T A;  4RX2 A;  2LB5 A;  2P04 A;  1NY0 A;  2V1A A;  1E4D A;  4EW7 A;  2P74 A;  3T1R A;  1YQS A;  4NK3 A;  1T18 A;  1PZP A;  2H0Y A;  3BY8 A;  4YNR A;  3FZC A;  5G4Z A;  3MJQ A;  1OT6 A;  3PYP A;  5HAI A;  2W27 A;  4I3A A;  4PM8 A;  4ZRR A;  4E04 A;  1KVM A;  5HWT A;  5EUA A;  3HBR A;  5M18 A;  3IBR A;  1IKI A;  5E2H A;  5TBM A;  3MR0 A;  3C8C A;  4CJN A;  5LBR A;  2P08 A;  4HOI A;  3VP4 A;  3N7W A;  1G6O A;  1PZO A;  3LYX A;  1W8Q A;  4HP4 A;  3G35 A;  3RH8 B;  2HPB A;  3WRT A;  1YKD A;  4MLL A;  1LSX A;  1D7E A;  3A3E A;  4LPZ A;  1LL9 A;  3BFE A;  3BM6 A;  5DTS A;  1BTL A;  5EPH A;  5JYP A;  1F9I A;  2Z2M B;  2C5W B;  1CJF A;  3BFD A;  4CLC D;  4BD1 A;  3GSG A;  3WS4 A;  1BLS A;  1IEL A;  2HDU A;  1ES5 A;  2PYR A;  1XJ2 A;  1QME A;  4XUZ A;  3CG5 A;  3UPN A;  1DP8 A;  4R3A A;  3BEB A;  3ICY A;  4HH2 A;  4R4R A;  1EW0 A;  2XF3 A;  3UE0 A;  1I2S A;  4KZ4 A;  1RGY A;  3BY9 A;  5GLC A;  4I5S A;  4EXO A;  2ZMV A;  4LLO B;  1DJC A;  1T1A A;  3ZVW A;  4Y0T A;  4QY5 A;  4FCF A;  3FWL A;  4R38 A;  3HUO A;  2G7U A;  5E2E A;  3IT9 A;  4G3K A;  4NXE A;  5EE8 A;  3JVV A;  4OQI A;  1IYO A;  4Y5F A;  4FH4 A;  3BQA A;  2Y91 A;  4OP8 A;  1W5D A;  3O3V A;  3UY6 A;  3GDI A;  2VJW A;  3QP2 A;  3G6O A;  2QPN A;  3NBL A;  4PHT A;  1ES2 A;  2Z6C A;  3C7V A;  4MBF A;  3IXG A;  5FI6 A;  3NDE A;  4EV4 A;  2ZQ8 A;  4JF4 A;  4FSF A;  4S2M A;  3M2K A;  2OAQ 1;  5M1A A;  4KQQ A;  4WM9 A;  4E3L A;  4Z9Q A;  4X1L A;  2CC1 A;  3MXR A;  4DE0 A;  1H8M A;  4X53 A;  3B33 A;  2ZC6 B;  3ZYT A;  4Y17 A;  3OCL A;  4UHU A;  1STZ A;  2WGW B;  2ZOH A;  1GHP A;  2PR6 A;  3O5Y A;  4GKU A;  4GS9 A;  2P9V B;  1JWZ A;  2WGV A;  3OC2 A;  4JXG A;  1CEG A;  5KMW A;  5CER A;  2PYP A;  3SH7 A;  4DJ2 A;  2ACG A;  2JC7 A;  4O01 A;  5CED A;  4N92 A;  4NET A;  2BLS A;  3K2N A;  4KQO A;  4BQM A;  1CQA A;  4XUX A;  5EV0 A;  3KSH A;  3C38 A;  3T1X A;  1XGI A;  3D3O A;  4S2I A;  5KZH A;  3LR3 A;  3UB6 A;  1WA9 A;  4WMC A;  1KGG A;  4KUO A;  2XA7 M;  4L9G A;  4OPZ A;  1Q2P A;  1BZA A;  3IX8 A;  5EVI D;  2L4R A;  2P9V A;  1JTG A;  3CLO A;  1SDE A;  1DY6 A;  4ME4 A;  3TOI A;  1DJA A;  3MKE A;  2V8F A;  1YMX A;  2ZC3 B;  3E4P A;  5CEB A;  4Y7P A;  2J3T D;  3HJK A;  4OQH A;  4CLC A;  1N9N A;  2HP6 A;  3K3D A;  3EEH A;  3V67 A;  1IYS A;  4EBN A;  1O07 A;  3QP6 A;  1W7F A;  3A3I A;  4CQH A;  4WUJ A;  4PM7 A;  2K2N A;  4K0X A;  4P6Z S;  3F1N A;  4IED A;  4JLF A;  4A5R A;  4C3Q A;  1YSQ A;  5FAS A;  1XA1 A;  3F1P A;  1BLC A;  4HIA A;  2ZQ7 A;  2PU4 A;  4YWZ A;  1ODV A;  2K7S A;  2WKP A;  1K56 D;  5CX7 A;  4MNR A;  5AQA A;  1IYQ A;  3LR4 A;  1YM1 A;  2EX6 A;  3MBZ A;  2V0W A;  3G2Z A;  3R4K A;  4GB7 A;  4GW9 A;  4XXR A;  2HV1 A;  5J4E A;  3CUE C;  3MFD A;  4PKY G;  3A0R A;  3CMZ A;  2OWJ A;  4II7 A;  3FKW A;  3VOL A;  4HI4 A;  5F83 A;  4KUK A;  1NWZ A;  4MEZ A;  3T4L A;  4KZB A;  1FSY A;  2R9W A;  3N8R A;  5HWV A;  4PAU A;  1MKI A;  5DKK A;  4UQI M;  2JE5 A;  4LV1 A;  4E6X A;  3OPP A;  3UNW A;  1OTD A;  5EM0 A;  2HZ5 A;  4DE2 A;  3IWO A;  5EOE A;  4BL2 A;  2RL3 A;  5FQM A;  5HX9 A;  4QPR A;  3C5A A;  4BEN A;  2W3E A;  2OWH A;  3Q82 A;  5CHU A;  1N9O A;  3G2Y A;  5F6A A;  3UB8 A;  2XRO A;  3GRJ A;  5HD3 A;  1S1Y A;  3L9K A;  4GDN A;  4YOF A;  3C7U A;  4X56 A;  1HD8 A;  3BWL A;  3ZG0 A;  1L2S A;  1N9L A;  2HP9 A;  3ZG7 B;  2H28 A;  4Y2F A;  4I39 A;  3HUM A;  3UO9 A;  2JKR I;  5A93 A;  5L8M A;  3B3X A;  5GHX A;  3IHA A;  5HAQ A;  4GJ4 A;  5GLA A;  2PD8 A;  3PAE A;  3HLE A;  4GHI A;  3T1S A;  2B02 A;  1H8Z A;  4E3O A;  4PM5 A;  1FIK A;  3M2J A;  3P01 A;  1DP6 A;  2B95 A;  3BFF A;  3HLC A;  2ZD8 A;  2Q9N A;  3ZQ5 A;  3LEQ A;  2A49 A;  3MXQ A;  2Y2L A;  1EWZ A;  1V9Z A;  1K54 C;  1JWP A;  4JGR A;  1N4O A;  4JPM A;  3PAG A;  4IVK A;  3UB7 A;  3CI6 A;  5EEC A;  5EVE A;  1S67 L;  2J3W A;  2Y2P A;  2PBD P;  1CF0 A;  1ERO A;  1T19 A;  1L0D A;  4R23 A;  2EFU A;  1YPR A;  3VOY A;  1ONG A;  2OLV A;  2VV6 A;  3F1P B;  3A3F A;  3LCE A;  4HQA A;  5IT5 A;  5CGS A;  2V0U A;  4OVD A;  1LSW A;  4NG2 A;  4R1G A;  2BG1 A;  1XFN A;  1JVJ A;  2GX5 A;  5F68 A;  1L0F A;  4WYY A;  2VK3 A;  4F3L A;  5F1F A;  2Y55 A;  1GCE A;  1KDW A;  3W8K A;  4OOL A;  2WYX A;  4OLG A;  4JKT A;  3BW6 A;  3UDI A;  4EET B;  2ZMF A;  3V50 A;  5FSR A;  3IH8 A;  1O7E A;  4XT2 A;  2O9C A;  2XA7 S;  3CZD A;  4ZAM A;  1LT0 A;  2Y4A A;  3NI9 A;  5CEC A;  1ZG6 A;  3OPH A;  4U0X A;  4NEE D;  1OTI A;  4IJG A;  2W0N A;  5G4Y A;  2W1R A;  2XQZ A;  1SCW A;  3MSH A;  2GDN A;  3T4K A;  3SH8 A;  4N1H A;  3MFX A;  3T4T A;  3HLF A;  3U4L P;  3P09 A;  3UN7 A;  5AVF A;  1FR1 A;  1T1B A;  5DFY A;  3FV7 A;  3UMD A;  1PNE A;  5A91 A;  2AVX A;  2VEA A;  4EQI A;  4MDZ A;  1ONH A;  3VE4 A;  2Q0O A;  4KQR A;  4DE1 A;  2M7V A;  3KO6 A;  1Q2Q A;  4WBG A;  3VFF A;  3HJI A;  2Z6D A;  3UB5 P;  5IHV A;  2LB9 A;  3D72 A;  1G5U A;  3V39 A;  3I7J A;  1JTD A;  2BAS A;  3O86 A;  4CLC E;  1ESU A;  5HPI A;  1G6A A;  1F2K A;  5EVI C;  3IX4 A;  4IHQ A;  3T4J A;  1BUL A;  1K55 C;  4LV0 A;  2H5S A;  4YIN A;  3LIB A;  5AQB A;  1XJ4 A;  3SS5 A;  3DTM A;  1ZC2 A;  4K0W A;  2WZX A;  5EM1 A;  5M19 A;  2QMI A;  4E3N A;  1UGU A;  3SW1 A;  4QU3 A;  5FQ9 A;  4WZ5 A;  1N9B A;  3FPW A;  1K57 C;  5FDS A;  5TJJ A;  2GZA A;  4DRT A;  1YLJ A;  1BYW A;  2EXB A;  4KG5 A;  4O7D A;  4OQG A;  4LFU A;  3EOI A;  5FQJ A;  1MWS A;  3HLB A;  3NDG A;  2XFT A;  4UA9 A;  2JKG A;  4CPK A;  4LRZ E;  4BBU A;  3K3C A;  4X1M A;  3JPU A;  4ETZ A;  3MZF A;  3U2A A;  4EEP A;  4LV3 A;  1GA0 A;  4BD0 A;  2Y2I A;  1DP9 A;  1IYP A;  1OJG A;  1K6R A;  1GSV A;  3ZNT A;  3QP4 A;  4DKI A;  2ZM8 A;  4MN6 A;  4AFI A;  5DJU A;  3KYZ A;  2OSU A;  1MKM A;  1VET A;  2QJ7 A;  3OPR A;  1BLH A;  2JKR M;  5CHM A;  3ZVT A;  3SS4 A;  1E25 A;  4KZ3 A;  5HDS A;  3LR5 A;  4QWO A;  3DW0 A;  3SH9 A;  1NZU A;  2WK0 A;  3VP2 A;  5DKL A;  1VB6 A;  2Y8H A;  4QJG A;  3Q7V B;  4DE3 A;  2HDR A;  3B47 A;  2O9B A;  4B4X A;  3LFV A;  1OTB A;  2Y2G A;  1YLY A;  1W63 M;  2R9X A;  2XR0 A;  3S7P A;  3RTY A;  4I3I A;  1P97 A;  4ZBE A;  3VSL A;  1JWV A;  3F1O A;  2J9P A;  5HAP A;  4WEK A;  3HL9 A;  5AQ7 A;  4WLA A;  4FUW A;  3RJU A;  2KOI A;  5CGW A;  4MBK A;  2OV5 A;  3F1N B;  4MN5 A;  1ES3 A;  1LL8 A;  4OPQ A;  5HAR A;  2ZQ9 A;  3IF6 C;  3QP5 A;  3ULF A;  1D06 A;  4JXS A;  3BQ8 A;  3UB9 A;  1LHY A;  2OLU A;  5A92 A;  4LV2 A;  1KGE A;  1LL5 A;  2HJ9 C;  4Y3I A;  4R0Q A;  1ZKJ A;  2KLI A;  3H9W A;  3WRZ A;  5GL9 A;  2ZC5 B;  1AWI A;  3VMA A;  4WEL A;  1NXY A;  2JKT I;  3E2K A;  2ZC4 B;  2MJ6 A;  5CGX A;  1CI8 A;  5HL1 A;  2W3D A;  2ZMA A;  3A0S A;  4RQ9 A;  3ZG9 B;  1BLP A;  4BWI A;  4MN7 A;  1FR6 A;  2GJ3 A;  2FH5 A;  2J7V A;  4O8G A;  2ZQC A;  2V9A A;  2WKR A;  5F69 A;  1ZG4 A;  1XP4 A;  4D60 A;  4NXF A;  3HLG A;  4BL3 A;  3FG8 A;  3PBQ A;  2KDK A;  2XD1 A;  3IHB A;  1NRF A;  2A2L A;  4H6J A;  2FZ0 A;  5F5Y A;  1XKZ A;  3ZGA B;  4BMW A;  1YMS A;  3IS2 B;  4L9E A;  2WKQ A;  4LRY C;  4X25 A;  3IXD A;  4G3V A;  1E3U D;  2WGW A;  1LI9 A;  4IUH A;  4QD4 A;  2A24 A;  2VGK A;  3MQQ A;  2B5R A;  2X71 A;  3ZCZ A;  4ARZ B;  4KEN B;  3BYD A;  3V3R A;  3C4O A;  3H7W A;  3ISG A;  4WF0 A;  1V9Y A;  3GR2 A;  4N9K A;  3C30 A;  4EBP A;  5IS1 A;  3HCY A;  5E2G A;  1MWU A;  1CK3 A;  1KVL A;  3QNB A;  2QYB A;  5AJG A;  3T1Q B;  3GV9 A;  1IKG A;  1W79 A;  4UA6 A;  1Y54 A;  4IUK A;  2HF6 A;  1FCN A;  1TDL A;  1S1Z A;  1C3B A;  2PAV P;  4BBV A;  2WGI A;  2PD7 A;  2QJ5 A;  2X02 A;  2HJE A;  2P7J A;  4EWF A;  3RXX A;  2ZC7 A;  3D4F A;  2VV8 A;  3MS6 A;  5GHZ A;  3MXS A;  4GCZ A;  3G30 A;  1TS6 A;  2WAF A;  1OME A;  2J3T C;  4HJ6 A;  5FAO A;  4R70 A;  5A8B A;  4G3W A;  1WE4 A;  3LID A;  5J8X A;  5G18 A;  3VP1 A;  3V3S A;  3PHY A;  4WMC D;  1TEM A;  5EVL A;  5DJT A;  5EOO A;  4ZJ1 A;  5DFX A;  4DN0 A;  5FEF A;  1XA7 A;  3C4P A;  4S2O A;  1S4S A;  3NY4 A;  4PKY A;  3GVB A;  2EX8 A;  3E0Y A;  1A0K A;  1YLT A;  4OQ0 A;  2Y2H A;  4UQI S;  4EES A;  4UEY A;  4EUV A;  3AGF A;  1K4E A;  5TFQ A;  1H0M A;  4S2K A;  3O88 A;  1W8Y A;  4NXG A;  3UME A;  1MY8 A;  3PTE A;  2PR5 A;  1U60 A;  3IF6 B;  3MF0 A;  3E4O A;  3JVU A;  2M1C A;  1T1C A;  4FD8 A; 
#chains in the Genus database with same CATH homology
 2ZBB A;  4GHI B;  2YKH A;  3T4K A;  2EWV A;  3S7Q A;  2PYR A;  1G28 A;  1XJ2 A;  3T4O A;  3MFX A;  3T4T A;  1DP8 A;  4R3A A;  5AVF A;  3VE3 A;  3ICY A;  4HH2 A;  1EW0 A;  3A0V A;  4DMZ A;  1T1B A;  3EWK A;  5DFY A;  3UMD A;  4EQ1 A;  4O0P A;  3MQ0 A;  2VEA A;  3BY9 A;  4MDZ A;  2QHK A;  4CLC C;  4I5S A;  3VE4 A;  2ZMV A;  2I9V A;  4LLO B;  4EXO A;  1T1A A;  2M7V A;  3T4S A;  3KO6 A;  1XFQ A;  4CLC B;  1F98 A;  5HWW A;  3HJI A;  2Z6D A;  1UWP X;  1TD5 A;  2LB9 A;  4HHD A;  3TRC A;  4R38 A;  5I5L A;  2O0Y A;  2G7U A;  2VA0 A;  4Q0J A;  3D72 A;  4P6Z M;  4G3K A;  4NXE A;  2YKF A;  1ZTU A;  3JVV A;  1YSP A;  3LIA A;  4EER A;  3S7O A;  4Y5F A;  2BAS A;  4CLC E;  3BQA A;  5HPI A;  3TJZ C;  3C2W A;  3TW8 A;  5HDD A;  4IHQ A;  3CWF A;  3RFB A;  3T4J A;  1Y28 A;  2VJW A;  3GDI A;  3P7N A;  3G6O A;  4PHT A;  3LIB A;  1XJ4 A;  2Z6C A;  4B9O A;  4EEU A;  3FC7 A;  1DRM A;  2VKS A;  4LRX C;  1UGU A;  3SW1 A;  1OPX A;  2B18 A;  4FOF A;  3UE3 A;  4FSF A;  1TS7 A;  2OAQ 1;  3DBA A;  3FPW A;  4WEJ A;  2W3F A;  5TJJ A;  4GS9 B;  2GZA A;  1H8M A;  4I38 A;  3B33 A;  1BYW A;  3OOV A;  3KSF A;  3ZYT A;  2K31 A;  5J7E A;  4JGQ A;  4L0L A;  1ZHH B;  3F1O B;  3OCL A;  1STZ A;  3EOI A;  2ZOH A;  3NOT C;  4HJ4 A;  4WN5 A;  2PR6 A;  2KX6 A;  4NXB A;  4Q0I A;  3O5Y A;  3NOP C;  4GS9 A;  4LRZ E;  4BBU A;  3MMH A;  3LI8 A;  3OC2 A;  4B93 A;  2PYP A;  3K3C A;  2VV7 A;  4DJ2 A;  4ETZ A;  1GSX A;  4HNB A;  4O01 A;  3U2A A;  4EEP A;  3CAX A;  1NLZ A;  4H6J B;  3K2N A;  4KQO A;  1P9R A;  3KSH A;  1DP9 A;  3C38 A;  5HZH A;  3R7W A;  3D3O A;  1OJG A;  4I3J A;  4NKP A;  3TE8 A;  3EGD C;  1GSV A;  2VGL S;  3LR3 A;  1UWN X;  4Q0H A;  3GEC A;  3UB6 A;  1P0Z A;  4ETX A;  1WA9 A;  3NJA A;  4KUO A;  3EQV A;  4MN6 A;  3LIE A;  2XA7 M;  4XT2 B;  4AFI A;  4L9G A;  5DJU A;  3KYZ A;  5FL3 A;  2QJ7 A;  1MKM A;  4Z1W A;  4HP9 A;  2JKR M;  5J3W A;  2L4R A;  3B42 A;  2GNX A;  5HDS A;  3CLO A;  3LR5 A;  3S7N A;  2O9A A;  3PBT A;  3PXP A;  5DKL A;  1VB6 A;  2Y8H A;  4ME4 A;  3LIF A;  1X0O A;  3H82 B;  3E4P A;  2JHE A;  2J3T D;  1OT9 A;  3HJK A;  3FPV A;  4CLC A;  1N9N A;  3B47 A;  3EEH A;  3K3D A;  3V67 A;  2QWS A;  1MZU A;  2O9B A;  1H3Q A;  3LFV A;  5KSH A;  1OTB A;  1TS8 A;  1W63 M;  2JN7 A;  1NRJ A;  3IS2 A;  1S4R A;  5AVE A;  3S7P A;  5HSQ A;  1OTE A;  3RTY A;  5KIZ A;  1TS0 A;  2V1B A;  4CQH A;  4WUJ A;  4GLQ A;  2K2N A;  4I3I A;  5K5B A;  2W3H A;  1P97 A;  2JKT M;  2XSS A;  4P6Z S;  1S66 L;  3F1N A;  3PR6 A;  3UE6 A;  2Y79 A;  1YSQ A;  3F1P A;  3F1O A;  4WEK A;  5C5K A;  4HIA A;  4WLA A;  3H82 A;  3NOU C;  4YWZ A;  2HGV A;  1GSW A;  3T4Q A;  2KOI A;  1ODV A;  3PBR A;  2J80 A;  2K7S A;  2CMN A;  2WKP A;  3BJN A;  3OCN A;  1XJ6 A;  3E4Q A;  3F1N B;  5CX7 A;  4MN5 A;  2QKP A;  3IBJ A;  1LL8 A;  3LR4 A;  1OTA A;  2L0W A;  2V0W A;  3R4K A;  1F5M A;  3KSG A;  3ULF A;  4GW9 A;  5J4E A;  2HV1 A;  1D06 A;  3CUE C;  3BQ8 A;  3UB9 A;  4PKY G;  2IA2 A;  3A0R A;  3EEA A;  3KSI A;  1MC0 A;  2OWJ A;  2HJ9 C;  3LIC A;  4Y3I A;  2OAP 1;  1OJ5 A;  4II7 A;  4DJ3 A;  1KOU A;  3VOL A;  4HI4 A;  2KLI A;  3H9W A;  4BJP A;  3LR0 A;  2NUT C;  4KUK A;  4WEL A;  1NWZ A;  3T4L A;  2JKT I;  2MJ6 A;  5HWV A;  3VV4 A;  4OOM A;  2W3D A;  5TBM B;  4PAU A;  3A0S A;  5DKK A;  4RQ9 A;  3NHQ A;  3PBN A;  2R78 A;  4UQI M;  4BWI A;  4MN7 A;  2GJ3 A;  2FH5 A;  3LUQ A;  4O8G A;  1OTD A;  4WL9 A;  3KX0 X;  4JGO A;  2V9A A;  2WKR A;  5F69 A;  4L9F A;  4NXF A;  3FG8 A;  3PBQ A;  4ARZ A;  2NUP C;  2KDK A;  1IOU A;  2PHY A;  2A2L A;  2OOL A;  4H6J A;  5EFW A;  2FZ0 A;  4KQD A;  3T50 A;  2A24 B;  5F5Y A;  4QPR A;  5HL6 A;  2W3E A;  3LI9 A;  2OWH A;  2W1T B;  4BMW A;  4HJ3 A;  1N9O A;  2VZW A;  3IS2 B;  4L9E A;  5F6A A;  3UB8 A;  2XRO A;  3MQO A;  2WKQ A;  4LRY C;  2W1T A;  4G3V A;  2DMW A;  1S1Y A;  5HD3 A;  1JNU A;  4YOF A;  4IUH A;  3CIT A;  2A24 A;  3BWL A;  3MQQ A;  1TF1 A;  3W2Z A;  5DF9 A;  2EA9 A;  2PT7 A;  4ARZ B;  5HDC A;  4K08 A;  3PBS A;  1N9L A;  3H7W A;  4MCW A;  2M7U A;  2H28 A;  4Y2F A;  4WF0 A;  2EWW A;  4I39 A;  4R6L A;  2JKR I;  1V9Y A;  5L8M A;  2VX8 A;  4GJ4 A;  2PD8 A;  3C30 A;  4EU0 A;  4GHI A;  5IS1 A;  5HD5 A;  3HCY A;  2B02 A;  4MMN A;  2QYB A;  3P01 A;  3H7W B;  5AJG A;  1DP6 A;  4M4X A;  4F3L B;  4IUK A;  2HF6 A;  3ZQ5 A;  4HY8 A;  4JGP A;  3MXQ A;  3CUE A;  1S1Z A;  1V9Z A;  5MC7 A;  4BBV A;  4JGR A;  2LB5 A;  2P04 A;  2PD7 A;  2QJ5 A;  2V1A A;  3EGX C;  4EW7 A;  2INW A;  2D01 A;  3UB7 A;  3CI6 A;  3EQU A;  2HJE A;  2P7J A;  1S67 L;  2XRN A;  1T18 A;  2J3W A;  2VV8 A;  5IU1 A;  3BY8 A;  4YNR A;  5G4Z A;  3MJQ A;  1OT6 A;  1T19 A;  4GCZ A;  3PYP A;  1TS6 A;  2J3T C;  1YAX A;  2W27 A;  4HJ6 A;  4I3A A;  4R70 A;  4ZRR A;  2VV6 A;  5A8B A;  2L1M A;  1W63 Q;  1IFQ A;  3F1P B;  4E04 A;  5HWT A;  4G3W A;  3LID A;  4HQA A;  5IT5 A;  3KYQ A;  3PHY A;  2V0U A;  2W3G A;  3IBR A;  1LSW A;  5DJT A;  3PBO A;  1XFN A;  1XJ3 A;  3MR0 A;  3C8C A;  5TBM A;  2GX5 A;  5LBR A;  5F68 A;  4F3L A;  2P08 A;  4HOI A;  5DFX A;  4DN0 A;  1G6O A;  3LYX A;  3R7W B;  3RH8 B;  4HP4 A;  5HPF A;  4OOL A;  1LSV A;  1S4S A;  3E98 A;  1NLY A;  4PKY A;  3BW6 A;  1YKD A;  2ZMF A;  4EET B;  3E0Y A;  2O99 A;  1LSX A;  1D7E A;  2PDR A;  4UQI S;  4EES A;  4LPZ A;  4UEY A;  4XT2 A;  1VHM A;  2O9C A;  2XA7 S;  4EUV A;  1LT0 A;  4HH3 A;  3OLO A;  1P9W A;  2D02 A;  2VGL M;  2VLG A;  4NXG A;  3UME A;  2ZOI A;  1F9I A;  4BBT A;  4CLC D;  4NEE D;  1OTI A;  4IJG A;  3OBF A;  2PR5 A;  2W0N A;  3MF0 A;  3E4O A;  3JVU A;  2M1C A;  2W1R A;  5G4Y A;  1T1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...