2QZ6A

First crystal structure of a psychrophile class c beta-lactamase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
354
structure length
349
Chain Sequence
DIRQVVDSTVEPLMQQQDIAGLSVAVIQNGKAQYFNYGVANKDSKQPITENTLFEIGSVSKTFTATLAGYALANGKLKLSDPASQYLPALRGDKFDHISLLNLGTYTAGGLPLQFPTGKMISYYQHWKPAFAPGTQRLYSNPSIGLFGHLAAQSLGQPFEKLMEQTVLPKLGLKHTFISVPETQMSLYAQGYDKAGKPVRVSPGALDAEAYGIKTSTSDLIHYVEVNMHPAKLEKPLQQAIAATHTGYYTVDGMTQGLGWEMYPYPIKVDALVEGNSTQMAMEPHKVNWLTPPQAAPLDTLVNKTGSTGGFGAYVAYVPSKGLGVVILANKNYPNAERVKAAHAILSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystal structure of a cold-adapted class C beta-lactamase
pubmed doi rcsb
molecule tags Hydrolase
total genus 113
structure length 349
sequence length 354
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2qz6A00
1DJBA 3LY3A 3MBZA 3BECA 1WE4A 1H8YA 3GTCA 3IWOA 3IF6A 4Y0UA 1CEGA 1K6SA 1W79A 5GHZA 4BD0A 1ESUA 1FSYA 3IXGA 3WRTA 2P9VB 4KZAA 2ZD8A 4UA9A 2C6WB 5AQ7A 1IYQA 5GHXA 2I72A 1IYOA 1S0WA 3AGFA 4N92A 2XF3A 1L0EA 3C4OA 3BYDA 5F1GA 5KSCA 3TOIA 1KE3A 4WEJA 4X55A 1NZUA 4EWFA 1BULA 1FR1A 2PBYA 3UDIA 3IXDA 3P09A 4UA7A 4DE3A 4KENB 3GMWA 3ZG0A 3VP3A 2JE5A 1L0GA 2BG1A 2ZQCA 4P6BA 4IVIA 1QMFA 1H5XA 1XP4A 2ZQAA 3C7UA 1MKIA 3RXWA 4R1GA 4BL2A 2RL3A 4X53A 4FH2A 3NI9A 4FSFA 3NDEA 2ZM8A 4BL3A 3BEBA 4C3QA 1WYBA 2ZQ7A 3QNBA 4JF5A 4XUXA 5L2FA 1JTDA 3LCEA 1J9MA 3EQVA 1GA0A 5CRFA 3UPNA 5GLBA 4GB7A 1PZOA 1YLZA 4S2MA 1JWVA 2X02A 4DKIA 1XGIA 2J9PA 1LL9A 3FZCA 1PWCA 4WMCD 4FCFA 5EECA 4OQHA 3G2ZA 1I2SA 1LI0A 1BTLA 4MBHA 2XEPA 5M19A 1FQGA 4K91A 1EWZA 3GRJA 2EFUA 4OONA 4LV1A 5HL1A 1TDGA 2HP9A 4OPZA 4BJPA 2HDQA 1O7EA 4DXBA 3PBRA 3ZG7B 5FAQA 3LEZA 2WAEA 5A93A 1RGZA 2P74A 5I94A 2HDRA 3IT9A 2XFTA 4DXCA 2R9XA 2ZLYA 4M3KA 1TEMA 2VGJA 4WZ5C 3BM6A 4UA6A 5BOHA 4KQQA 1FCNA 1C3BA 4K0XA 3G31A 1PI4A 3Q07A 4WMCA 4WELA 3UPPA 4N9LA 3BFGA 5KSHA 5A91A 1Q2QA 5FAOA 1IKIA 2E8IA 2J7VA 3N8RA 4ZTKA 4IVKA 5A92A 3HBRA 5M18A 1G68A 4BENA 1FSWA 5EVIC 3M2JA 3RXXA 2XQZA 4PM7A 1WYCA 1MBLA 4JXSA 4U0TA 1W8QA 3C7VA 5GLAA 2H5SA 1L0FA 2P9VA 2ZC3B 5E2FA 3HLGA 3MZEA 4GN2A 1ZKJA 3G35A 3TG9A 3SS3A 2JCHA 3M6BA 5FQMA 3WS1A 3VP0A 2QZ6A 5EOOA 4Y0TA 2WZXA 4B4XA 2Y91A 1MWTA 1KGGA 3Q7VB 4RA7A 4LCMA 4QU3A 4OKPA 5CGWA 1YMXA 4PMAA 1O07A 1KDSA 1XXMA 4PM9A 1TDLA 2HP5A 3HVFA 2IWBA 1NRFA 5EOEA 5EVIA 3E2KA 4H8RA 5F83A 5GHYA 1YLPA 2V2FF 1DY6A 1K55A 4EQIA 4GOGA 4JPMA 5CHUA 2Z2LB 4FD8A 1YLYA 1JTGA 1PZPA 4GNUA 4KZ6A 3SOIA 3PAGA 5HAPA 4KQRA 2WGWB 1K56D 4X68A 3UN7A 3GV9A 4YFMA 4B4ZA 3MKFA 4MLLA 3V3RA 5FAPA 2Q9NA 4JKTA 2J9OA 3HLWA 3UE0A 2WYXA 1ES2A 3V39A 4DDSA 3MXRA 4D2OA 1NXYA 2A49A 4KZ3A 3BFCA 4S2KA 1XA7A 4C6YA 4KZ9A 4KZ7A 1G6AA 1I2WA 3BFDA 1IKGA 1ERMA 3FYZA 2VGKA 5GLDA 1AXBA 3IHBA 4R4SA 4EBLA 3WS0A 4U3TA 1N4OA 4JF6A 2ZJ9A 4OOLA 5JYPA 1ESIA 1XGJA 4OP8A 5FATA 1FCMA 4HEFA 4IBXA 3SH7A 2ZQ8A 1DJCA 5CTMA 4OH0A 4PM6A 3Q81A 1XKZA 1PWGA 4RX3A 5CXWA 2ZM0A 5KZHA 3VP1A 3NDGA 3UE3A 2Y59A 5TR7A 5M1AA 4FH4A 1K54A 3WRZA 1RGYA 1E4DA 1GHIA 1PW1A 3UE1A 1KE4A 1SHVA 1BLCA 4ZJ2A 5J8XA 5CGXA 4EBNA 3FV7A 3G30A 4ZBEA 3NY4A 5AQ9A 3WS5A 5F82A 4YINA 3A3IA 2X01A 4N1HA 4XUZA 2EFXA 2XK1A 3N8SA 4R4RA 3VFHA 1ES4A 2PU2A 1KVMA 3OPRA 4OPYA 4GD8A 1I5QA 2OV5A 2Z2MB 3GQZA 3SS5A 3AGDA 4NK3A 4RVAA 3UY6A 4LV3A 1YT4A 4JF4A 3UDFA 4OLGA 2Y2MA 3IWIA 4N9KA 1K6RA 2XD5A 3A3FA 3W4QA 1YLJA 2G2WA 3E2LA 4IEDA 3I7JA 3HLEA 2GDNA 5IHVA 5FASA 1NZOA 4OQ0A 2HP6A 2EX9A 4P85A 5TGFA 3G2YA 4ZJ3A 1ZG4A 3BLSA 2ZC7A 1TVFA 2Y2JA 3W8KA 1K25A 4EV4A 1BLSA 5CHJA 3S22A 3ZDJA 4DF6A 3Q82A 2V1ZA 2WKHA 5FDHA 4XXRA 3HREA 2WGWA 4HBUA 3V3SA 2H10A 3ITAA 3PBTA 3HLFA 3ZHHA 4X69A 3AGEA 3CMZA 1HD8A 5D3OA 1XX2A 5CHMA 3S1YA 3CG5A 1PIOA 2EX8A 3PBNA 4JXWA 2RCXA 3N7WA 1EI5A 4JXGA 3ZVTA 2WUQA 3IXHA 2Y2NA 4JBFA 3SS4A 1BLPA 1K55C 3UDXA 3ISGA 3W4OA 1XA1A 5FQ9A 1S6RA 1W5DA 5HAIA 3OZHA 2FFFB 1KGFA 1BSGA 1KGEA 2H0YA 2UWXA 3HLDA 1ONHA 2EXAA 3BFEA 4A5RA 1HZOA 1IEMA 1M6KA 3VSLA 1YM1A 3N8LA 5E2EA 4R0QA 2WZZA 3MZFA 2ZC4B 1E25A 4PPRA 1H8ZA 5TFQA 2FFYA 5F1FA 3PAEA 1NY0A 1MY8A 5EE8A 4E3KA 1DJAA 1LHYA 1CI9A 5E2HA 1YLWA 3TSGA 4KZ4A 2ZC5B 4JXVA 1BUEA 1MPLA 2Y2HA 3ZG5A 1YQSA 1K38A 2Y2IA 3IH9A 3NCKA 4QB8A 4MEZA 1ES3A 3CJMA 2WADA 4DRTA 4OOYA 3MXSA 4PM8A 4UHUA 4ID4A 4N1XA 5GLCA 3ZCZA 5E2GA 1LLBA 3VMAA 1MXOA 3VOYA 4DE1A 2Q9MA 3CZDA 5FI7A 1PYYA 2OSUA 2ZC6B 2OLUA 3DTMA 4EBPA 3FWLA 4NETA 1HVBA 4Q8IA 2R9WA 1CI8A 4CJNA 3O86A 3LY4A 4ZDXA 4CPKA 1SCWA 3A3DA 4OP5A 5HX9A 1SDEA 2EX2A 3GVBA 2WGIA 5G18A 1KVLA 2Y2LA 2C5WB 4E6WA 1K54C 5DF9A 3MZDA 1YLTA 4Y7PA 4DE2A 3BLMA 1K56A 4S2IA 4S2PA 3W4PA 2DRWA 4BD1A 3UNWA 1ALQA 4BQMA 2Y55A 4KQOA 4QJGA 1SDNA 2IWDA 2PU4A 1NYMA 5HARA 4WEKA 4OLDA 3IF5A 3GSGA 3D4FA 4RYEA 4Y0OA 2WAFA 3ZNTA 4UAAA 5DTKA 4OQGA 4KG6A 4KZ5A 4DDYA 1MWRA 3BRMA 1RCJA 1PWDA 4E3LA 2XR0A 3N4IA 1KDWA 3M6HA 4E3OA 4E3JA 3C5AA 1K57C 1L2SA 2B5RA 4S2NC 4HESA 1BLHA 1GHMA 2HDSA 2OLVA 4KG2A 5AQBA 3V50A 4KG5A 4MBFA 2WK0A 5DTSA 3QNCA 2ZM2A 3IWQA 4ZAMA 5GL9A 1ZG6A 4GDNA 2IWCA 2QMIA 4X6TA 2JBFA 5DTTA 4PM5A 3VP4A 3C4PA 3Q1FA 3Q7VA 5EVIB 4OVDA 4LV0A 1VQQA 4X56A 3JYIA 4DE0A 2XFSA 5EVLA 5A90A 3QHYA 5U47A 1XPBA 3HLCA 2JC7A 2ZQ9A 4Z9QA 3O87A 2A3UA 5KMWA 1ES5A 1K57A 1ZC2A 2Y2GA 4S2NA 4WM9A 1BT5A 1PW8A 2HDUA 4L0LA 1GHPA 1FR6A 2WGVA 3S4XA 4EUZA 4HBTA 3HL9A 3OPPA 3VOZA 2HPBA 1W7FA 5AQAA 4S2JA 5FA7A 3G4PA 4KZBA 3ZNYA 2Y2PA 1VM1A 5CECA 3G34A 5EPHA 4QHCA 3VFFA 1FOFA 4QY5A 3EQUA 4IBRA 2G2UA 5CEBA 3PBQA 2X71A 3OPLA 4C75A 3SH8A 3G32A 5FQJA 3IQAA 3IF6B 4GD6A 1K4FA 1RP5A 3Q7ZA 4QD4A 2ZQDA 3ZFZA 5CEDA 1Y54A 1JVJA 4R23A 4MBKA 2XD1A 3DW0A 3HLBA 3P98A 1YMSA 3BFFA 5FI2A 3WS4A 3ZGAB 3ZVWA 2WKIA 3IH8A 1CEFA 3UPOA 2H0TA 3HUNA 5DVAA 3PBSA 1GCEA 1EROA 1NJ4A 3NBLA 3PBOA 3DWZA 1GA9A 4GZBA 3DWKA 4ZJ1A 3MKEA 4LV2A 2XGNA 3OCLA 1U60A 3O3VA 4OPRA 3M2KA 4U0XA 2Y2KA 1ERQA 3MFDA 2DCFA 4P87A 3VSKA 1L0DA 3LO7A 2XH9A 5FQKA 3OC2A 4KZ8A 1KE0A 2XDMA 4WYYA 3SH9A 4LENA 1FCOA 5FI6A 4B88A 3N6IA 5FQQA 5EVID 1OMEA 4P0MA 3VP2A 1PI5A 1E3UD 3IXBA 1BZAA 4MNRA 4OQIA 4WZ5A 4JLFA 4E3IA 3ZG9B 4WBGA 2WKEA 5HFOA 5E43A 4WZ4A 4K0WA 3HUOA 4O7DA 4R3JA 5CERA 3UO9A 2DNSA 3B3XA 3IHAA 4S2OA 4E6XA 1QMEA 3HUMA 3GR2A 5CTNA 4R3BA 1LI9A 1M40A 4QY6A 1NYYA 1IYPA 2EXBA 4GDBA 3RJUA 1Z6FA 1LL5A 4LCLA 1IYSA 5FQIA 5HW3A 4OOMA 3OCNA 3OPHA 1JWPA 4RX2A 2ZMAA 5EUAA 3V5MA 2BLSA 2Y2QA 2J8YA 3A3JA 1CK3A 2QPNA 1E3UA 1JWZA 1MWUA 2EX6A 4S2LA 3IF6C 3O88A 5DF7A 5JYOA 3ZG8B 1Q2PA 1W8YA 1HTZA 1N9BA 2V20A 3PTEA 4GKUA 5FSRA 1K4EA 3A3EA 3NIAA 3ITBA 1MWSA 3WWXA 4BLMA 5HAQA 4E3MA 1IELA 5DF8A 4F94A 3FKVA 2Y2OA 4E3NA 2CC1A 2XLNA 3WS2A 3FKWA 5CGSA 1SKFA 2Y4AA 3NC8A 4OPQA 1ONGA
chains in the Genus database with same CATH superfamily
3LY3A 3RH8B 4NXEA 2PHYA 3EGDC 3IWOA 3IF6A 5GHZA 1FSYA 1DRMA 2P9VB 2ZD8A 4UA9A 1TD5A 2XF3A 1KE3A 2PBYA 3P09A 4UA7A 3VP3A 2PR6A 3PYPA 4IVIA 3C7UA 4BL2A 4O01A 4FH2A 3NI9A 4P6ZS 2ZM8A 3BEBA 2KX6A 2ZQ7A 2HGVA 3LCEA 4ARZB 1GA0A 1FILA 3C30A 1NLZA 2WKQA 2J9PA 1LL9A 3LGOA 4FCFA 4MBHA 1I2SA 3CUEA 1BTLA 4EU0A 5M19A 1FQGA 5HL1A 2W1TA 1TF1A 1O7EA 3IBJA 5FEGA 2XFTA 2I9VA 2ZL1B 2ZLYA 1TEMA 2VGJA 3BM6A 3MS6A 1CF0A 3QP1A 4N9LA 3BW6A 1Q2QA 2J7VA 1N9NA 4HH3A 3BJNA 3HBRA 1BYWA 1G68A 4BENA 2XQZA 4U0TA 2P9VA 3D9YA 1ZKJA 3G35A 3TG9A 1L3LA 3M6BA 3KYEA 4HIAA 2QZ6A 3NULA 3F1OB 5A8BA 4RA7A 4LCMA 3LFVA 4LPZA 2JHEA 1KDSA 1NLYA 5EV0A 5EVIA 5HPFA 4Y17A 3PHYA 1YLPA 2V2FF 4EQIA 1F9IA 5CX7A 4JPMA 3LR3A 1P97A 4PKYA 3MQOA 2WGWB 3UN7A 3T4QA 4KUOA 4YFMA 3O5YA 3V3RA 4ARZA 3UE0A 4D2OA 1NXYA 2A49A 5TBMB 5C5KA 3FYZA 3MQ0A 1AXBA 2PAVP 4R4SA 4XT2B 4NEED 1IOUA 4OOLA 5JYPA 1ESIA 4OP8A 2ZL1A 3SH7A 1GSVA 1DJCA 4I3JA 5IS1A 3H82A 5CXWA 4CLCC 5LBRA 3B47A 1TS6A 3VP1A 1PFLA 3UMDA 3NHQA 2QHKA 1GHIA 3UE1A 4Q0JA 4EBNA 4ZBEA 5F82A 3ULFA 2X01A 4N1HA 1W63M 2M7VA 1MKMA 4R4RA 4Y2FA 1ES4A 2A24B 3F1OA 4GD8A 1I5QA 4KUKA 2OV5A 3GQZA 4NK3A 3LR4A 5L07A 4RVAA 3UY6A 4UEYA 3UDFA 3CHWP 4IEDA 3HLEA 4MCWA 5IHVA 4P85A 2EX9A 1ZG4A 2Y2JA 1K25A 5CHJA 3ZDJA 4DF6A 3Q82A 2WKHA 4XXRA 4I3IA 3HREA 2WGWA 3V3SA 3ITAA 2BTFP 3ZHHA 4X69A 3AGEA 4H6JB 5TBMA 5CHMA 3CG5A 2LB9A 4JXWA 3LEQA 2RCXA 3CITA 3IXHA 2Y2NA 3KSFA 1BLPA 3W4OA 1W5DA 3LYXA 2FFFB 1BSGA 2YKFA 2H0YA 1LSXA 4XT2A 2GX5A 1ONHA 3G6OA 3QP8A 1YM1A 2J3WA 4R0QA 2PDRA 4PPRA 1H8ZA 5F1FA 3PAEA 1NY0A 1MY8A 4R6LA 4E3KA 2Z6CA 4F3LB 5E2HA 1YLWA 5DFYA 2Y2HA 1YQSA 3NOTC 2Y2IA 4MEZA 1ES3A 1ZHHB 3ZCZA 3VMAA 1OTBA 3VOYA 2Q9MA 3CZDA 4G3VA 4X1MA 2B95A 2ZC6B 2A24A 1P9RA 4EBPA 4NETA 4Q8IA 1T19A 5HWTA 3LY4A 3A3DA 1SDEA 2VZWA 5G18A 2Y2LA 4ME4A 1UGUA 3IX3A 4Y7PA 4DE2A 2OAP1 4S2PA 2DRWA 2B18A 4BD1A 5EM0A 2PU4A 4WEKA 3D4FA 3OBFA 4DDYA 1RCJA 1PWDA 2XR0A 2VV8A 3KYZA 3PXPA 3KO6A 3QP2A 4Y3IA 4HESA 2OLVA 3VE3A 5AQBA 5IU1A 4KG5A 1H8MA 4GJ4A 3MJQA 4ZAMA 5DTTA 4PM5A 3VP4A 3Q7VA 4OVDA 4X56A 1VQQA 4Z1WA 5U47A 1K57A 4S2NA 4WM9A 5HZHA 4LRZE 3S4XA 3EGXC 3EEHA 3G4PA 4Y5FA 3ZNYA 5J7EA 1FOFA 3LR5A 3SH8A 3G32A 2CMNA 3IQAA 1RP5A 2W27A 4QWOA 4LFUA 3P98A 1YMSA 5AVFA 1TS8A 1PRQA 1ZTUA 2PYRA 2V9AA 1J3WA 3UPOA 2H0TA 3F1NB 2UV0E 3NBLA 5F6AA 2P04A 3OCLA 3O3VA 3NJAA 5DFXA 2Y2KA 4P87A 2XH9A 1KE0A 2XDMA 3SH9A 4LENA 4B88A 3N6IA 5FQQA 3B33A 4O0PA 3IXBA 4MNRA 4Q0HA 4WZ5A 4JLFA 5E43A 3HUOA 1OPXA 3MQQA 1LI9A 2L1MA 4QY6A 1NYYA 3RJUA 1Z6FA 2XA7M 3OPHA 4GCZA 2ZMAA 2Y2QA 4Q0IA 3A3JA 1CK3A 1JWZA 4EEPA 5DF7A 3IF6C 4GKUA 3W2ZA 1CJFA 3NIAA 3ITBA 4JGRA 5HAQA 1IELA 4GS9B 1P0ZA 5CGSA 1SKFA 1H0MA 5HDDA 1ONGA 1EW0A 3BECA 4LLOB 4NXFA 4Y0UA 1CEGA 1K6SA 4BD0A 2FZ0A 4KZAA 2C6WB 1IYOA 4N92A 2PRFA 3C4OA 3R4KA 3BYDA 3QP4A 3TOIA 2OAQ1 4X55A 3CPTB 4KQDA 3C2WA 3MF0A 2BG1A 4P6BA 2PD8A 1H5XA 1XP4A 3RXWA 1MKIA 4R1GA 1A0KA 2QKPA 4X53A 3NDEA 2P08A 3QNBA 4XUXA 1IFQA 1JTDA 2ZMFA 5GLBA 2W3HA 4GB7A 2VA0A 2X02A 4DKIA 5DKKA 1PWCA 5FDSA 5EECA 4OQHA 5HD5A 3E98A 3GRJA 2EFUA 4LV1A 1TDGA 4OPZA 3K3DA 3ZG7B 3E4PA 5A93A 1RGZA 4GHIB 5I94A 1F5MA 2R9XA 3S7PA 4KQQA 1FCNA 4GS9A 4K0XA 5L10A 4DJ3A 3BFGA 3N8RA 2D01A 5EVIC 3M2JA 4JXSA 1W8QA 2H5SA 4Y15A 4ZRRA 2Q0OA 1GSWA 3SS3A 5FQMA 5EOOA 2B02A 2WZXA 4B4XA 2Y91A 4OKPA 5CGWA 3CPTA 1O07A 1XXMA 3DTKA 4PM9A 1TDLA 4UQIS 2IWBA 1UWPX 4EEUA 4H8RA 2EWVA 2L4RA 2J3TC 3CI6A 4FD8A 4FTXA 4MN6A 4KQRA 4MMNA 3MKFA 2XROA 4NKPA 2J9OA 3MXRA 4C6YA 4KZ9A 1I2WA 1D1JA 5J4EA 3T1QB 3JVVA 3IHBA 4GHIA 4U3TA 3UMEA 1FCMA 2XSSA 4HEFA 3EWKA 4OH0A 1XKZA 2GZAA 5KZHA 4FH4A 1K54A 2J80A 1W63Q 5EVEA 5J8XA 3FPVA 3T4LA 3WS5A 4XUZA 2PU2A 1KVMA 3MXQA 4B93A 1YT4A 1D7EA 4OLGA 2Y2MA 4N9KA 1K6RA 3W4QA 1NZOA 3F1PB 4PAUA 2ZC7A 4EV4A 5G4ZA 3S22A 3V67A 3B42A 2M7UA 3FPWA 3JPUA 3CMZA 2FH5A 1HD8A 5D3OA 1XX2A 3S1YA 3ZYTA 3N7WA 1H3QA 1K55C 3UDXA 5HAIA 1KGFA 5K5BA 1KGEA 2UWXA 3HLDA 2GJ3A 2A2LA 2IA2A 2WZZA 3VE4A 1E25A 4X1LA 2FFYA 1D06A 3CWFA 3HJIA 4KZ4A 2ZC5B 4JXVA 1JNUA 3ZG5A 3NCKA 4G3KA 2W1RA 5TJJA 4OOYA 5GLCA 4N1XA 1Z09A 4HOIA 3LI9A 2INWA 3DTMA 1S66L 1CI8A 4BBUA 3K3CA 4ZDXA 3LIDA 5HX9A 4FOFA 2EX2A 3P7NA 1KVLA 3BLMA 3JVUA 3F1PA 2W3DA 3W4PA 3UNWA 1ALQA 4QJGA 1SDNA 1NYMA 2VGLS 5FL3A 4OLDA 4Y0OA 3ZNTA 4UAAA 4KZ5A 4DN0A 3N4IA 1KDWA 1K57C 2YKHA 2B5RA 4S2NC 5L09A 1YSPA 1NRJA 1YKDA 3V50A 2AVXA 3A0VA 5L8MA 1XJ3A 1ACFA 2WK0A 2M1CA 5I5LA 3QNCA 2ZM2A 4GDNA 2QJ7A 3P01A 4X6TA 3Q1FA 1F98A 5F69A 5A90A 3SZTA 2JC7A 2ZQ9A 4Z9QA 5KMWA 2A3UA 2ZMVA 2Y2GA 4P6ZM 1BT5A 1FR6A 4HBTA 5AQAA 4X25A 4WUJA 3PBQA 3OPLA 4ESPA 3IBRA 4QD4A 4L9FA 3ZFZA 4D60A 5CEDA 3A0RA 1JVJA 1K0KA 4MBKA 3DW0A 2JKFA 3BFFA 3ZGAB 2WKIA 3IH8A 3A0SA 5DVAA 1HLUP 3KSIA 1GCEA 1EROA 2PBDP 3DWZA 1FIKA 4GZBA 4ZJ1A 4OPRA 1OJGA 4U0XA 3MFDA 3VSKA 3IS2B 3LO7A 4KZ8A 2K7SA 3TW8A 5FI6A 1FCOA 3CAXA 4P0MA 1AWIA 4E3IA 3QP6A 3OOVA 2WKEA 4WZ4A 4O7DA 3BWLA 3B3XA 1QMEA 4CLCB 3PR6A 1IYPA 4GDBA 1IYSA 3OCNA 2V1AA 1TS0A 1MWUA 3O88A 1Q2PA 1W8YA 1HTZA 5FSRA 1K4EA 4F94A 4LGWA 2CC1A 3WS2A 3FKWA 1OJ5A 1DJBA 2JKTI 4O8GA 1H8YA 4JGPA 3OLOA 1W79A 4H6JA 3T4JA 4I38A 4R3AA 5KSCA 3NOUC 1BULA 3IXDA 4GLQA 4DE3A 3UB6A 3ZG0A 2JE5A 2JKRI 2ZQCA 5HWVA 3IS2A 2GNXA 1VETB 2RL3A 4JGQA 3T4KA 4MN5A 2LB5A 4BL3A 4F3LA 1WYBA 3EQVA 3UPNA 1PZOA 4S2MA 1OTEA 2VV6A 1XGIA 3G2ZA 2XEPA 5DJTA 2HP9A 2HDQA 3PBRA 5FAQA 3LEZA 2WAEA 2P74A 4PKYG 1Y4OA 2E8JA 3Q07A 4WMCA 4WELA 5KSHA 1DP8A 5FAOA 3CLOA 2E8IA 3LIEA 2ZOHA 5A92A 1FSWA 3LICA 3C7VA 5AJGA 3D72A 5GLAA 5DJUA 4LRXC 5HL6A 3HLGA 3MZEA 4GN2A 3E4QA 2JCHA 3WS1A 3VP0A 3HJKA 2V8FA 4QU3A 1YMXA 3T1XA 1XFQA 1N9LA 2O0YA 1DY6A 4GOGA 2Z2LB 1VETA 3RFBA 1JTGA 1PZPA 4KZ6A 3PAGA 4HY8A 4II7A 1K56D 4B4ZA 4WF0A 5FAPA 3FG8A 2P7JA 3HLWA 4HJ3A 1ES2A 1XFNA 2VX8A 3TE8A 4S2KA 1G6AA 1SKOB 1IKGA 3L7HA 1ERMA 2W3GA 4HH2A 3WS0A 1MC0A 1N4OA 3F1NA 4IBXA 2OWHA 5CTMA 4PM6A 3Q81A 1PWGA 4RX3A 2ZM0A 3UE3A 5TR7A 5M1AA 1E4DA 3CUEC 4EXOA 1V9ZA 1KE4A 4ZJ2A 5CGXA 3FV7A 3G30A 3NY4A 3VV4A 3A3IA 3KSGA 3DTIA 3VFHA 3OPRA 3SS5A 4JF4A 4WL9A 3L9KA 4L9GA 3C38A 2XD5A 1YLJA 3UB7A 2GDNA 2VEAA 4OQ0A 4B9OA 1VEUB 1TVFA 3W8KA 1BLSA 2G7UA 3H9WA 1YSQA 2Z6DA 3BY8A 5FDHA 2O9AA 3HLFA 1PIOA 2EX8A 3LI8A 1YAXA 3PBNA 1DP6A 1T1AA 4JXGA 2V0WA 2WUQA 3SS4A 1S6RA 3OZHA 5G4YA 2ZBBA 3MR0A 2EXAA 3BFEA 1IEMA 1HZOA 3T50A 3FC7A 5E2EA 3MZFA 2ZC4B 5TFQA 3K2NA 1CI9A 1MPLA 4IUKA 1S4SA 4QB8A 4E04A 4QPRA 2H28A 2WADA 4DRTA 3MXSA 4UHUA 4ID4A 2V8CA 3HCYA 1MXOA 5EFWA 4DE1A 3UB9A 4HP9A 2OLUA 3FWLA 1HVBA 2V1BA 2R9WA 5HD3A 1OTDA 4BBTA 3S7QA 4OP5A 3GVBA 4MDZA 2C5WB 4EETB 5DF9A 1K56A 4S2IA 1VEUA 3LUQA 3KX0X 1OT6A 4BQMA 2Y55A 2IWDA 3IF5A 4RYEA 2JKTM 3DTEA 2WKRA 4KG6A 3BRMA 4E3LA 2QYBA 2O9BA 3M6HA 3C5AA 4HP4A 3TRCA 1BLHA 2HDSA 3UB5P 3TJZC 1PNEA 1XJ6A 4M4XA 4MBFA 2L0WA 5GL9A 1XJ4A 1ZG6A 2PYPA 3S7OA 2QMIA 2O9CA 5EVIB 4DE0A 2XFSA 5EVLA 3QHYA 1XPBA 2JKRM 3O87A 1ES5A 1ZC2A 4L0LA 1ODVA 3HL9A 2HPBA 4S2JA 5FA7A 5HPIA 1VM1A 1OT9A 4NG2A 5EPHA 4QHCA 3EQUA 2G2UA 5CEBA 3GECA 2OOLA 1K4FA 4GD6A 2ZQDA 2PD7A 1Y54A 2XD1A 3U4LP 3HLBA 3T1RA 3WS4A 3ZVWA 1CEFA 1G5UA 3HUNA 3MFXA 1GA9A 3DWKA 3KSHA 3H82B 2XGNA 1U60A 2VLGA 3M2KA 4I5SA 1ERQA 4EESA 1L0DA 5FQKA 3OC2A 4WYYA 1OMEA 3VP2A 1PI5A 1WA9A 1VB6A 4OQIA 1S1YA 3ZG9B 4WBGA 5HFOA 3ZQ5A 4R3JA 4S2OA 3HUMA 4R3BA 1G6OA 2EWWA 4NXBA 4UQIM 3BQAA 2JN7A 3H7WB 4LCLA 5FQIA 5EUAA 4RX2A 3V5MA 3LR0A 2V0UA 4LRYC 2J8YA 2VV7A 1E3UA 2EX6A 4DMZA 3ZG8B 1N9BA 2V20A 3WWXA 4PHTA 2W3FA 5DF8A 3FKVA 2Y2OA 5IT5A 2HJEA 3NC8A 4OQGA 4OPQA 3SW1A 3IX8A 3DAVA 3MBZA 1WE4A 5AVEA 4FUWA 3GTCA 2HZ5A 1ESUA 3IXGA 2HV1A 3WRTA 1CQAA 1GSXA 5AQ7A 1LT0A 1IYQA 5GHXA 2I72A 1S0WA 3AGFA 1L0EA 5F1GA 2KDKA 4WEJA 4EWFA 1NZUA 1FR1A 3UDIA 4KENB 3BQ8A 3GMWA 1LL8A 2BASA 4HJ4A 1L0GA 4CLCD 1QMFA 2VK3A 2ZQAA 3MMHA 1TS7A 3R7WB 4FSFA 4C3QA 5HSQA 4JF5A 5L2FA 1J9MA 3T12B 5CRFA 1YLZA 1SZVA 1JWVA 3GDIA 3FZCA 4WMCD 2QWSA 1LI0A 3H7WA 4K91A 1EWZA 4OONA 2K31A 4BJPA 4DXBA 2JKGA 2HDRA 3D3OA 3IT9A 4DXCA 4M3KA 4WZ5C 1OTAA 4UA6A 5BOHA 1C3BA 3G31A 1PI4A 5HDSA 1VHMA 3UPPA 5A91A 1IKIA 4L9EA 4MN7A 4ZTKA 4IVKA 4HNBA 5M18A 3E0YA 4EW7A 3RXXA 4PM7A 1WYCA 1MBLA 2VKSA 3LIAA 1L0FA 2ZC3B 2NUPC 5E2FA 1S4RA 1T1CA 4Y0TA 1MWTA 1KGGA 3Q7VB 4PMAA 4GW9A 4HI4A 2HP5A 3HVFA 4WLAA 2XA7S 1NRFA 5EOEA 3E2KA 5F83A 3C8CA 5GHYA 1K55A 4Y13A 4EUVA 4YWZA 5CHUA 3R7WA 1YLYA 3SOIA 4GNUA 5HAPA 1P9WA 4X68A 4DJ2A 3QP5A 3GV9A 4MLLA 4R70A 4BMWA 2Q9NA 4JKTA 2WYXA 3V39A 4DDSA 2PR5A 3T1SA 4KZ3A 3BFCA 1XA7A 4KZ7A 3BFDA 2VGKA 5GLDA 4EBLA 5EM1A 4JF6A 2ZJ9A 4I39A 1XGJA 5FATA 2ZOIA 2XRNA 2ZQ8A 1F2KA 2VGLM 3NDGA 2Y59A 3WRZA 1RGYA 3MSHA 1PW1A 5MC7A 1SHVA 1BLCA 4CQHA 2DMWA 5AQ9A 4YINA 1DP9A 1LSVA 4R38A 2EFXA 2XK1A 3N8SA 1T1BA 1X0OA 4OPYA 5F68A 2Z2MB 4CLCA 3AGDA 4LV3A 3IWIA 3A3FA 2G2WA 3E2LA 3I7JA 4CLCE 2K2NA 4EQ1A 5FASA 2HP6A 5TGFA 3UB8A 3G2YA 3T4TA 4ZJ3A 3BLSA 3EOIA 2ACGA 1S67L 2V1ZA 2W3EA 4HBUA 2H10A 3PBTA 4IUHA 1MZUA 4BBVA 4IJGA 1EI5A 3ZVTA 4JBFA 3ISGA 1XA1A 5FQ9A 4HJ6A 4HQAA 4A5RA 3VSLA 1M6KA 3N8LA 2OWJA 1Y28A 2MJ6A 1NWZA 2R78A 5EE8A 2NUTC 4K08A 1DJAA 1YPRA 1LHYA 4EERA 3TSGA 3T4OA 3E4OA 1BUEA 1K38A 3IH9A 3CJMA 4PM8A 5E2GA 1LLBA 5FI7A 1OTIA 1PYYA 2OSUA 2WKPA 2KLIA 4ETXA 3KYQA 5J3WA 4CJNA 3O86A 4CPKA 1SCWA 2WGIA 3RTYA 4E6WA 1K54C 2EA9A 3MZDA 1YLTA 3U2AA 4G3WA 4I3AA 3BY9A 4KQOA 5KIZA 5HARA 3NECA 5DKLA 3GSGA 2WAFA 5DTKA 5HWWA 1UWNX 1MWRA 4WN5A 4E3OA 4E3JA 1N9OA 1L2SA 4AFIA 5HDCA 1GHMA 4KG2A 3DBAA 3LIFA 2Y79A 3LIBA 4YNRA 5DTSA 3IWQA 4IHQA 3ICYA 2IWCA 2JBFA 2QJ5A 3T4SA 3C4PA 1V9YA 4LV0A 3EEAA 4NXGA 3JYIA 2HJ9C 3HLCA 3IX4A 2W0NA 2PT7A 1PW8A 2HDUA 1GHPA 2WGVA 4EUZA 3OPPA 3VOZA 3NOPC 1W7FA 5CECA 4KZBA 2Y2PA 3G34A 3VFFA 2VJWA 3UE6A 4QY5A 4IBRA 2X71A 4C75A 5FQJA 3IF6B 3Q7ZA 1S1ZA 4ETZA 4R23A 5FI2A 1SKOA 1T18A 3PBSA 1NJ4A 2HF6A 1KOUA 3PBOA 1G28A 4JGOA 3MKEA 4LV2A 2DCFA 4RQ9A 5FEFA 5EVID 2KOIA 1E3UD 1BZAA 3VOLA 4K0WA 3UO9A 5CERA 2DNSA 3IHAA 4E6XA 3GR2A 5CTNA 1STZA 1XJ2A 1M40A 2EXBA 1LL5A 5HW3A 2O99A 4OOMA 1JWPA 2W1TB 3S7NA 2BLSA 2D02A 2J3TD 2QPNA 4S2LA 4BWIA 5JYOA 4HHDA 3PTEA 3A3EA 1MWSA 4BLMA 4E3MA 1LSWA 4E3NA 4YOFA 2XLNA 2Y8HA 5F5YA 2Y4AA
chains in the Genus database with same CATH topology
1DJBA 3LY3A 3MBZA 3BECA 1WE4A 1H8YA 3GTCA 3IWOA 3IF6A 4Y0UA 1CEGA 1K6SA 1W79A 5GHZA 4BD0A 1ESUA 1FSYA 3IXGA 3WRTA 2P9VB 4KZAA 2ZD8A 4UA9A 2C6WB 5AQ7A 1IYQA 5GHXA 2I72A 1IYOA 1S0WA 3AGFA 4N92A 2XF3A 1L0EA 3C4OA 3BYDA 5F1GA 5KSCA 3TOIA 1KE3A 4WEJA 4X55A 1NZUA 4EWFA 1BULA 1FR1A 2PBYA 3UDIA 3IXDA 3P09A 4UA7A 4DE3A 4KENB 3GMWA 3ZG0A 3VP3A 2JE5A 1L0GA 2BG1A 2ZQCA 4P6BA 4IVIA 1QMFA 1H5XA 1XP4A 2ZQAA 3C7UA 1MKIA 3RXWA 4R1GA 4BL2A 2RL3A 4X53A 4FH2A 3NI9A 4FSFA 3NDEA 2ZM8A 4BL3A 3BEBA 4C3QA 1WYBA 2ZQ7A 3QNBA 4JF5A 4XUXA 5L2FA 1JTDA 3LCEA 1J9MA 3EQVA 1GA0A 5CRFA 3UPNA 5GLBA 4GB7A 1PZOA 1YLZA 4S2MA 1JWVA 2X02A 4DKIA 1XGIA 2J9PA 1LL9A 3FZCA 1PWCA 4WMCD 4FCFA 5EECA 4OQHA 3G2ZA 1I2SA 1LI0A 1BTLA 4MBHA 2XEPA 5M19A 1FQGA 4K91A 1EWZA 3GRJA 2EFUA 4OONA 4LV1A 5HL1A 1TDGA 2HP9A 4OPZA 4BJPA 2HDQA 1O7EA 4DXBA 3PBRA 3ZG7B 5FAQA 3LEZA 2WAEA 5A93A 1RGZA 2P74A 5I94A 2HDRA 3IT9A 2XFTA 4DXCA 2R9XA 2ZLYA 4M3KA 1TEMA 2VGJA 4WZ5C 3BM6A 4UA6A 5BOHA 4KQQA 1FCNA 1C3BA 4K0XA 3G31A 1PI4A 3Q07A 4WMCA 4WELA 3UPPA 4N9LA 3BFGA 5KSHA 5A91A 1Q2QA 5FAOA 1IKIA 2E8IA 2J7VA 3N8RA 4ZTKA 4IVKA 5A92A 3HBRA 5M18A 1G68A 4BENA 1FSWA 5EVIC 3M2JA 3RXXA 2XQZA 4PM7A 1WYCA 1MBLA 4JXSA 4U0TA 1W8QA 3C7VA 5GLAA 2H5SA 1L0FA 2P9VA 2ZC3B 5E2FA 3HLGA 3MZEA 4GN2A 1ZKJA 3G35A 3TG9A 3SS3A 2JCHA 3M6BA 5FQMA 3WS1A 3VP0A 2QZ6A 5EOOA 4Y0TA 2WZXA 4B4XA 2Y91A 1MWTA 1KGGA 3Q7VB 4RA7A 4LCMA 4QU3A 4OKPA 5CGWA 1YMXA 4PMAA 1O07A 1KDSA 1XXMA 4PM9A 1TDLA 2HP5A 3HVFA 2IWBA 1NRFA 5EOEA 5EVIA 3E2KA 4H8RA 5F83A 5GHYA 1YLPA 2V2FF 1DY6A 1K55A 4EQIA 4GOGA 4JPMA 5CHUA 2Z2LB 4FD8A 1YLYA 1JTGA 1PZPA 4GNUA 4KZ6A 3SOIA 3PAGA 5HAPA 4KQRA 2WGWB 1K56D 4X68A 3UN7A 3GV9A 4YFMA 4B4ZA 3MKFA 4MLLA 3V3RA 5FAPA 2Q9NA 4JKTA 2J9OA 3HLWA 3UE0A 2WYXA 1ES2A 3V39A 4DDSA 3MXRA 4D2OA 1NXYA 2A49A 4KZ3A 3BFCA 4S2KA 1XA7A 4C6YA 4KZ9A 4KZ7A 1G6AA 1I2WA 3BFDA 1IKGA 1ERMA 3FYZA 2VGKA 5GLDA 1AXBA 3IHBA 4R4SA 4EBLA 3WS0A 4U3TA 1N4OA 4JF6A 2ZJ9A 4OOLA 5JYPA 1ESIA 1XGJA 4OP8A 5FATA 1FCMA 4HEFA 4IBXA 3SH7A 2ZQ8A 1DJCA 5CTMA 4OH0A 4PM6A 3Q81A 1XKZA 1PWGA 4RX3A 5CXWA 2ZM0A 5KZHA 3VP1A 3NDGA 3UE3A 2Y59A 5TR7A 5M1AA 4FH4A 1K54A 3WRZA 1RGYA 1E4DA 1GHIA 1PW1A 3UE1A 1KE4A 1SHVA 1BLCA 4ZJ2A 5J8XA 5CGXA 4EBNA 3FV7A 3G30A 4ZBEA 3NY4A 5AQ9A 3WS5A 5F82A 4YINA 3A3IA 2X01A 4N1HA 4XUZA 2EFXA 2XK1A 3N8SA 4R4RA 3VFHA 1ES4A 2PU2A 1KVMA 3OPRA 4OPYA 4GD8A 1I5QA 2OV5A 2Z2MB 3GQZA 3SS5A 3AGDA 4NK3A 4RVAA 3UY6A 4LV3A 1YT4A 4JF4A 3UDFA 4OLGA 2Y2MA 3IWIA 4N9KA 1K6RA 2XD5A 3A3FA 3W4QA 1YLJA 2G2WA 3E2LA 4IEDA 3I7JA 3HLEA 2GDNA 5IHVA 5FASA 1NZOA 4OQ0A 2HP6A 2EX9A 4P85A 5TGFA 3G2YA 4ZJ3A 1ZG4A 3BLSA 2ZC7A 1TVFA 2Y2JA 3W8KA 1K25A 4EV4A 1BLSA 5CHJA 3S22A 3ZDJA 4DF6A 3Q82A 2V1ZA 2WKHA 5FDHA 4XXRA 3HREA 2WGWA 4HBUA 3V3SA 2H10A 3ITAA 3PBTA 3HLFA 3ZHHA 4X69A 3AGEA 3CMZA 1HD8A 5D3OA 1XX2A 5CHMA 3S1YA 3CG5A 1PIOA 2EX8A 3PBNA 4JXWA 2RCXA 3N7WA 1EI5A 4JXGA 3ZVTA 2WUQA 3IXHA 2Y2NA 4JBFA 3SS4A 1BLPA 1K55C 3UDXA 3ISGA 3W4OA 1XA1A 5FQ9A 1S6RA 1W5DA 5HAIA 3OZHA 2FFFB 1KGFA 1BSGA 1KGEA 2H0YA 2UWXA 3HLDA 1ONHA 2EXAA 3BFEA 4A5RA 1HZOA 1IEMA 1M6KA 3VSLA 1YM1A 3N8LA 5E2EA 4R0QA 2WZZA 3MZFA 2ZC4B 1E25A 4PPRA 1H8ZA 5TFQA 2FFYA 5F1FA 3PAEA 1NY0A 1MY8A 5EE8A 4E3KA 1DJAA 1LHYA 1CI9A 5E2HA 1YLWA 3TSGA 4KZ4A 2ZC5B 4JXVA 1BUEA 1MPLA 2Y2HA 3ZG5A 1YQSA 1K38A 2Y2IA 3IH9A 3NCKA 4QB8A 4MEZA 1ES3A 3CJMA 2WADA 4DRTA 4OOYA 3MXSA 4PM8A 4UHUA 4ID4A 4N1XA 5GLCA 3ZCZA 5E2GA 1LLBA 3VMAA 1MXOA 3VOYA 4DE1A 2Q9MA 3CZDA 5FI7A 1PYYA 2OSUA 2ZC6B 2OLUA 3DTMA 4EBPA 3FWLA 4NETA 1HVBA 4Q8IA 2R9WA 1CI8A 4CJNA 3O86A 3LY4A 4ZDXA 4CPKA 1SCWA 3A3DA 4OP5A 5HX9A 1SDEA 2EX2A 3GVBA 2WGIA 5G18A 1KVLA 2Y2LA 2C5WB 4E6WA 1K54C 5DF9A 3MZDA 1YLTA 4Y7PA 4DE2A 3BLMA 1K56A 4S2IA 4S2PA 3W4PA 2DRWA 4BD1A 3UNWA 1ALQA 4BQMA 2Y55A 4KQOA 4QJGA 1SDNA 2IWDA 2PU4A 1NYMA 5HARA 4WEKA 4OLDA 3IF5A 3GSGA 3D4FA 4RYEA 4Y0OA 2WAFA 3ZNTA 4UAAA 5DTKA 4OQGA 4KG6A 4KZ5A 4DDYA 1MWRA 3BRMA 1RCJA 1PWDA 4E3LA 2XR0A 3N4IA 1KDWA 3M6HA 4E3OA 4E3JA 3C5AA 1K57C 1L2SA 2B5RA 4S2NC 4HESA 1BLHA 1GHMA 2HDSA 2OLVA 4KG2A 5AQBA 3V50A 4KG5A 4MBFA 2WK0A 5DTSA 3QNCA 2ZM2A 3IWQA 4ZAMA 5GL9A 1ZG6A 4GDNA 2IWCA 2QMIA 4X6TA 2JBFA 5DTTA 4PM5A 3VP4A 3C4PA 3Q1FA 3Q7VA 5EVIB 4OVDA 4LV0A 1VQQA 4X56A 3JYIA 4DE0A 2XFSA 5EVLA 5A90A 3QHYA 5U47A 1XPBA 3HLCA 2JC7A 2ZQ9A 4Z9QA 3O87A 2A3UA 5KMWA 1ES5A 1K57A 1ZC2A 2Y2GA 4S2NA 4WM9A 1BT5A 1PW8A 2HDUA 4L0LA 1GHPA 1FR6A 2WGVA 3S4XA 4EUZA 4HBTA 3HL9A 3OPPA 3VOZA 2HPBA 1W7FA 5AQAA 4S2JA 5FA7A 3G4PA 4KZBA 3ZNYA 2Y2PA 1VM1A 5CECA 3G34A 5EPHA 4QHCA 3VFFA 1FOFA 4QY5A 3EQUA 4IBRA 2G2UA 5CEBA 3PBQA 2X71A 3OPLA 4C75A 3SH8A 3G32A 5FQJA 3IQAA 3IF6B 4GD6A 1K4FA 1RP5A 3Q7ZA 4QD4A 2ZQDA 3ZFZA 5CEDA 1Y54A 1JVJA 4R23A 4MBKA 2XD1A 3DW0A 3HLBA 3P98A 1YMSA 3BFFA 5FI2A 3WS4A 3ZGAB 3ZVWA 2WKIA 3IH8A 1CEFA 3UPOA 2H0TA 3HUNA 5DVAA 3PBSA 1GCEA 1EROA 1NJ4A 3NBLA 3PBOA 3DWZA 1GA9A 4GZBA 3DWKA 4ZJ1A 3MKEA 4LV2A 2XGNA 3OCLA 1U60A 3O3VA 4OPRA 3M2KA 4U0XA 2Y2KA 1ERQA 3MFDA 2DCFA 4P87A 3VSKA 1L0DA 3LO7A 2XH9A 5FQKA 3OC2A 4KZ8A 1KE0A 2XDMA 4WYYA 3SH9A 4LENA 1FCOA 5FI6A 4B88A 3N6IA 5FQQA 5EVID 1OMEA 4P0MA 3VP2A 1PI5A 1E3UD 3IXBA 1BZAA 4MNRA 4OQIA 4WZ5A 4JLFA 4E3IA 3ZG9B 4WBGA 2WKEA 5HFOA 5E43A 4WZ4A 4K0WA 3HUOA 4O7DA 4R3JA 5CERA 3UO9A 2DNSA 3B3XA 3IHAA 4S2OA 4E6XA 1QMEA 3HUMA 3GR2A 5CTNA 4R3BA 1LI9A 1M40A 4QY6A 1NYYA 1IYPA 2EXBA 4GDBA 3RJUA 1Z6FA 1LL5A 4LCLA 1IYSA 5FQIA 5HW3A 4OOMA 3OCNA 3OPHA 1JWPA 4RX2A 2ZMAA 5EUAA 3V5MA 2BLSA 2Y2QA 2J8YA 3A3JA 1CK3A 2QPNA 1E3UA 1JWZA 1MWUA 2EX6A 4S2LA 3IF6C 3O88A 5DF7A 5JYOA 3ZG8B 1Q2PA 1W8YA 1HTZA 1N9BA 2V20A 3PTEA 4GKUA 5FSRA 1K4EA 3A3EA 3NIAA 3ITBA 1MWSA 3WWXA 4BLMA 5HAQA 4E3MA 1IELA 5DF8A 4F94A 3FKVA 2Y2OA 4E3NA 2CC1A 2XLNA 3WS2A 3FKWA 5CGSA 1SKFA 2Y4AA 3NC8A 4OPQA 1ONGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJB A;  3LY3 A;  3MBZ A;  3BEC A;  1WE4 A;  1H8Y A;  3GTC A;  3IWO A;  3IF6 A;  4Y0U A;  1CEG A;  1K6S A;  1W79 A;  5GHZ A;  4BD0 A;  1ESU A;  1FSY A;  3IXG A;  3WRT A;  2P9V B;  4KZA A;  2ZD8 A;  4UA9 A;  2C6W B;  5AQ7 A;  1IYQ A;  5GHX A;  2I72 A;  1IYO A;  1S0W A;  3AGF A;  4N92 A;  2XF3 A;  1L0E A;  3C4O A;  3BYD A;  5F1G A;  5KSC A;  3TOI A;  1KE3 A;  4WEJ A;  4X55 A;  1NZU A;  4EWF A;  1BUL A;  1FR1 A;  2PBY A;  3UDI A;  3IXD A;  3P09 A;  4UA7 A;  4DE3 A;  4KEN B;  3GMW A;  3ZG0 A;  3VP3 A;  2JE5 A;  1L0G A;  2BG1 A;  2ZQC A;  4P6B A;  4IVI A;  1QMF A;  1H5X A;  1XP4 A;  2ZQA A;  3C7U A;  1MKI A;  3RXW A;  4R1G A;  4BL2 A;  2RL3 A;  4X53 A;  4FH2 A;  3NI9 A;  4FSF A;  3NDE A;  2ZM8 A;  4BL3 A;  3BEB A;  4C3Q A;  1WYB A;  2ZQ7 A;  3QNB A;  4JF5 A;  4XUX A;  5L2F A;  1JTD A;  3LCE A;  1J9M A;  3EQV A;  1GA0 A;  5CRF A;  3UPN A;  5GLB A;  4GB7 A;  1PZO A;  1YLZ A;  4S2M A;  1JWV A;  2X02 A;  4DKI A;  1XGI A;  2J9P A;  1LL9 A;  3FZC A;  1PWC A;  4WMC D;  4FCF A;  5EEC A;  4OQH A;  3G2Z A;  1I2S A;  1LI0 A;  1BTL A;  4MBH A;  2XEP A;  5M19 A;  1FQG A;  4K91 A;  1EWZ A;  3GRJ A;  2EFU A;  4OON A;  4LV1 A;  5HL1 A;  1TDG A;  2HP9 A;  4OPZ A;  4BJP A;  2HDQ A;  1O7E A;  4DXB A;  3PBR A;  3ZG7 B;  5FAQ A;  3LEZ A;  2WAE A;  5A93 A;  1RGZ A;  2P74 A;  5I94 A;  2HDR A;  3IT9 A;  2XFT A;  4DXC A;  2R9X A;  2ZLY A;  4M3K A;  1TEM A;  2VGJ A;  4WZ5 C;  3BM6 A;  4UA6 A;  5BOH A;  4KQQ A;  1FCN A;  1C3B A;  4K0X A;  3G31 A;  1PI4 A;  3Q07 A;  4WMC A;  4WEL A;  3UPP A;  4N9L A;  3BFG A;  5KSH A;  5A91 A;  1Q2Q A;  5FAO A;  1IKI A;  2E8I A;  2J7V A;  3N8R A;  4ZTK A;  4IVK A;  5A92 A;  3HBR A;  5M18 A;  1G68 A;  4BEN A;  1FSW A;  5EVI C;  3M2J A;  3RXX A;  2XQZ A;  4PM7 A;  1WYC A;  1MBL A;  4JXS A;  4U0T A;  1W8Q A;  3C7V A;  5GLA A;  2H5S A;  1L0F A;  2P9V A;  2ZC3 B;  5E2F A;  3HLG A;  3MZE A;  4GN2 A;  1ZKJ A;  3G35 A;  3TG9 A;  3SS3 A;  2JCH A;  3M6B A;  5FQM A;  3WS1 A;  3VP0 A;  2QZ6 A;  5EOO A;  4Y0T A;  2WZX A;  4B4X A;  2Y91 A;  1MWT A;  1KGG A;  3Q7V B;  4RA7 A;  4LCM A;  4QU3 A;  4OKP A;  5CGW A;  1YMX A;  4PMA A;  1O07 A;  1KDS A;  1XXM A;  4PM9 A;  1TDL A;  2HP5 A;  3HVF A;  2IWB A;  1NRF A;  5EOE A;  5EVI A;  3E2K A;  4H8R A;  5F83 A;  5GHY A;  1YLP A;  2V2F F;  1DY6 A;  1K55 A;  4EQI A;  4GOG A;  4JPM A;  5CHU A;  2Z2L B;  4FD8 A;  1YLY A;  1JTG A;  1PZP A;  4GNU A;  4KZ6 A;  3SOI A;  3PAG A;  5HAP A;  4KQR A;  2WGW B;  1K56 D;  4X68 A;  3UN7 A;  3GV9 A;  4YFM A;  4B4Z A;  3MKF A;  4MLL A;  3V3R A;  5FAP A;  2Q9N A;  4JKT A;  2J9O A;  3HLW A;  3UE0 A;  2WYX A;  1ES2 A;  3V39 A;  4DDS A;  3MXR A;  4D2O A;  1NXY A;  2A49 A;  4KZ3 A;  3BFC A;  4S2K A;  1XA7 A;  4C6Y A;  4KZ9 A;  4KZ7 A;  1G6A A;  1I2W A;  3BFD A;  1IKG A;  1ERM A;  3FYZ A;  2VGK A;  5GLD A;  1AXB A;  3IHB A;  4R4S A;  4EBL A;  3WS0 A;  4U3T A;  1N4O A;  4JF6 A;  2ZJ9 A;  4OOL A;  5JYP A;  1ESI A;  1XGJ A;  4OP8 A;  5FAT A;  1FCM A;  4HEF A;  4IBX A;  3SH7 A;  2ZQ8 A;  1DJC A;  5CTM A;  4OH0 A;  4PM6 A;  3Q81 A;  1XKZ A;  1PWG A;  4RX3 A;  5CXW A;  2ZM0 A;  5KZH A;  3VP1 A;  3NDG A;  3UE3 A;  2Y59 A;  5TR7 A;  5M1A A;  4FH4 A;  1K54 A;  3WRZ A;  1RGY A;  1E4D A;  1GHI A;  1PW1 A;  3UE1 A;  1KE4 A;  1SHV A;  1BLC A;  4ZJ2 A;  5J8X A;  5CGX A;  4EBN A;  3FV7 A;  3G30 A;  4ZBE A;  3NY4 A;  5AQ9 A;  3WS5 A;  5F82 A;  4YIN A;  3A3I A;  2X01 A;  4N1H A;  4XUZ A;  2EFX A;  2XK1 A;  3N8S A;  4R4R A;  3VFH A;  1ES4 A;  2PU2 A;  1KVM A;  3OPR A;  4OPY A;  4GD8 A;  1I5Q A;  2OV5 A;  2Z2M B;  3GQZ A;  3SS5 A;  3AGD A;  4NK3 A;  4RVA A;  3UY6 A;  4LV3 A;  1YT4 A;  4JF4 A;  3UDF A;  4OLG A;  2Y2M A;  3IWI A;  4N9K A;  1K6R A;  2XD5 A;  3A3F A;  3W4Q A;  1YLJ A;  2G2W A;  3E2L A;  4IED A;  3I7J A;  3HLE A;  2GDN A;  5IHV A;  5FAS A;  1NZO A;  4OQ0 A;  2HP6 A;  2EX9 A;  4P85 A;  5TGF A;  3G2Y A;  4ZJ3 A;  1ZG4 A;  3BLS A;  2ZC7 A;  1TVF A;  2Y2J A;  3W8K A;  1K25 A;  4EV4 A;  1BLS A;  5CHJ A;  3S22 A;  3ZDJ A;  4DF6 A;  3Q82 A;  2V1Z A;  2WKH A;  5FDH A;  4XXR A;  3HRE A;  2WGW A;  4HBU A;  3V3S A;  2H10 A;  3ITA A;  3PBT A;  3HLF A;  3ZHH A;  4X69 A;  3AGE A;  3CMZ A;  1HD8 A;  5D3O A;  1XX2 A;  5CHM A;  3S1Y A;  3CG5 A;  1PIO A;  2EX8 A;  3PBN A;  4JXW A;  2RCX A;  3N7W A;  1EI5 A;  4JXG A;  3ZVT A;  2WUQ A;  3IXH A;  2Y2N A;  4JBF A;  3SS4 A;  1BLP A;  1K55 C;  3UDX A;  3ISG A;  3W4O A;  1XA1 A;  5FQ9 A;  1S6R A;  1W5D A;  5HAI A;  3OZH A;  2FFF B;  1KGF A;  1BSG A;  1KGE A;  2H0Y A;  2UWX A;  3HLD A;  1ONH A;  2EXA A;  3BFE A;  4A5R A;  1HZO A;  1IEM A;  1M6K A;  3VSL A;  1YM1 A;  3N8L A;  5E2E A;  4R0Q A;  2WZZ A;  3MZF A;  2ZC4 B;  1E25 A;  4PPR A;  1H8Z A;  5TFQ A;  2FFY A;  5F1F A;  3PAE A;  1NY0 A;  1MY8 A;  5EE8 A;  4E3K A;  1DJA A;  1LHY A;  1CI9 A;  5E2H A;  1YLW A;  3TSG A;  4KZ4 A;  2ZC5 B;  4JXV A;  1BUE A;  1MPL A;  2Y2H A;  3ZG5 A;  1YQS A;  1K38 A;  2Y2I A;  3IH9 A;  3NCK A;  4QB8 A;  4MEZ A;  1ES3 A;  3CJM A;  2WAD A;  4DRT A;  4OOY A;  3MXS A;  4PM8 A;  4UHU A;  4ID4 A;  4N1X A;  5GLC A;  3ZCZ A;  5E2G A;  1LLB A;  3VMA A;  1MXO A;  3VOY A;  4DE1 A;  2Q9M A;  3CZD A;  5FI7 A;  1PYY A;  2OSU A;  2ZC6 B;  2OLU A;  3DTM A;  4EBP A;  3FWL A;  4NET A;  1HVB A;  4Q8I A;  2R9W A;  1CI8 A;  4CJN A;  3O86 A;  3LY4 A;  4ZDX A;  4CPK A;  1SCW A;  3A3D A;  4OP5 A;  5HX9 A;  1SDE A;  2EX2 A;  3GVB A;  2WGI A;  5G18 A;  1KVL A;  2Y2L A;  2C5W B;  4E6W A;  1K54 C;  5DF9 A;  3MZD A;  1YLT A;  4Y7P A;  4DE2 A;  3BLM A;  1K56 A;  4S2I A;  4S2P A;  3W4P A;  2DRW A;  4BD1 A;  3UNW A;  1ALQ A;  4BQM A;  2Y55 A;  4KQO A;  4QJG A;  1SDN A;  2IWD A;  2PU4 A;  1NYM A;  5HAR A;  4WEK A;  4OLD A;  3IF5 A;  3GSG A;  3D4F A;  4RYE A;  4Y0O A;  2WAF A;  3ZNT A;  4UAA A;  5DTK A;  4OQG A;  4KG6 A;  4KZ5 A;  4DDY A;  1MWR A;  3BRM A;  1RCJ A;  1PWD A;  4E3L A;  2XR0 A;  3N4I A;  1KDW A;  3M6H A;  4E3O A;  4E3J A;  3C5A A;  1K57 C;  1L2S A;  2B5R A;  4S2N C;  4HES A;  1BLH A;  1GHM A;  2HDS A;  2OLV A;  4KG2 A;  5AQB A;  3V50 A;  4KG5 A;  4MBF A;  2WK0 A;  5DTS A;  3QNC A;  2ZM2 A;  3IWQ A;  4ZAM A;  5GL9 A;  1ZG6 A;  4GDN A;  2IWC A;  2QMI A;  4X6T A;  2JBF A;  5DTT A;  4PM5 A;  3VP4 A;  3C4P A;  3Q1F A;  3Q7V A;  5EVI B;  4OVD A;  4LV0 A;  1VQQ A;  4X56 A;  3JYI A;  4DE0 A;  2XFS A;  5EVL A;  5A90 A;  3QHY A;  5U47 A;  1XPB A;  3HLC A;  2JC7 A;  2ZQ9 A;  4Z9Q A;  3O87 A;  2A3U A;  5KMW A;  1ES5 A;  1K57 A;  1ZC2 A;  2Y2G A;  4S2N A;  4WM9 A;  1BT5 A;  1PW8 A;  2HDU A;  4L0L A;  1GHP A;  1FR6 A;  2WGV A;  3S4X A;  4EUZ A;  4HBT A;  3HL9 A;  3OPP A;  3VOZ A;  2HPB A;  1W7F A;  5AQA A;  4S2J A;  5FA7 A;  3G4P A;  4KZB A;  3ZNY A;  2Y2P A;  1VM1 A;  5CEC A;  3G34 A;  5EPH A;  4QHC A;  3VFF A;  1FOF A;  4QY5 A;  3EQU A;  4IBR A;  2G2U A;  5CEB A;  3PBQ A;  2X71 A;  3OPL A;  4C75 A;  3SH8 A;  3G32 A;  5FQJ A;  3IQA A;  3IF6 B;  4GD6 A;  1K4F A;  1RP5 A;  3Q7Z A;  4QD4 A;  2ZQD A;  3ZFZ A;  5CED A;  1Y54 A;  1JVJ A;  4R23 A;  4MBK A;  2XD1 A;  3DW0 A;  3HLB A;  3P98 A;  1YMS A;  3BFF A;  5FI2 A;  3WS4 A;  3ZGA B;  3ZVW A;  2WKI A;  3IH8 A;  1CEF A;  3UPO A;  2H0T A;  3HUN A;  5DVA A;  3PBS A;  1GCE A;  1ERO A;  1NJ4 A;  3NBL A;  3PBO A;  3DWZ A;  1GA9 A;  4GZB A;  3DWK A;  4ZJ1 A;  3MKE A;  4LV2 A;  2XGN A;  3OCL A;  1U60 A;  3O3V A;  4OPR A;  3M2K A;  4U0X A;  2Y2K A;  1ERQ A;  3MFD A;  2DCF A;  4P87 A;  3VSK A;  1L0D A;  3LO7 A;  2XH9 A;  5FQK A;  3OC2 A;  4KZ8 A;  1KE0 A;  2XDM A;  4WYY A;  3SH9 A;  4LEN A;  1FCO A;  5FI6 A;  4B88 A;  3N6I A;  5FQQ A;  5EVI D;  1OME A;  4P0M A;  3VP2 A;  1PI5 A;  1E3U D;  3IXB A;  1BZA A;  4MNR A;  4OQI A;  4WZ5 A;  4JLF A;  4E3I A;  3ZG9 B;  4WBG A;  2WKE A;  5HFO A;  5E43 A;  4WZ4 A;  4K0W A;  3HUO A;  4O7D A;  4R3J A;  5CER A;  3UO9 A;  2DNS A;  3B3X A;  3IHA A;  4S2O A;  4E6X A;  1QME A;  3HUM A;  3GR2 A;  5CTN A;  4R3B A;  1LI9 A;  1M40 A;  4QY6 A;  1NYY A;  1IYP A;  2EXB A;  4GDB A;  3RJU A;  1Z6F A;  1LL5 A;  4LCL A;  1IYS A;  5FQI A;  5HW3 A;  4OOM A;  3OCN A;  3OPH A;  1JWP A;  4RX2 A;  2ZMA A;  5EUA A;  3V5M A;  2BLS A;  2Y2Q A;  2J8Y A;  3A3J A;  1CK3 A;  2QPN A;  1E3U A;  1JWZ A;  1MWU A;  2EX6 A;  4S2L A;  3IF6 C;  3O88 A;  5DF7 A;  5JYO A;  3ZG8 B;  1Q2P A;  1W8Y A;  1HTZ A;  1N9B A;  2V20 A;  3PTE A;  4GKU A;  5FSR A;  1K4E A;  3A3E A;  3NIA A;  3ITB A;  1MWS A;  3WWX A;  4BLM A;  5HAQ A;  4E3M A;  1IEL A;  5DF8 A;  4F94 A;  3FKV A;  2Y2O A;  4E3N A;  2CC1 A;  2XLN A;  3WS2 A;  3FKW A;  5CGS A;  1SKF A;  2Y4A A;  3NC8 A;  4OPQ A;  1ONG A; 
#chains in the Genus database with same CATH topology
 3LY3 A;  3RH8 B;  4NXE A;  2PHY A;  3EGD C;  3IWO A;  3IF6 A;  5GHZ A;  1FSY A;  1DRM A;  2P9V B;  2ZD8 A;  4UA9 A;  1TD5 A;  2XF3 A;  1KE3 A;  2PBY A;  3P09 A;  4UA7 A;  3VP3 A;  2PR6 A;  3PYP A;  4IVI A;  3C7U A;  4BL2 A;  4O01 A;  4FH2 A;  3NI9 A;  4P6Z S;  2ZM8 A;  3BEB A;  2KX6 A;  2ZQ7 A;  2HGV A;  3LCE A;  4ARZ B;  1GA0 A;  1FIL A;  3C30 A;  1NLZ A;  2WKQ A;  2J9P A;  1LL9 A;  3LGO A;  4FCF A;  4MBH A;  1I2S A;  3CUE A;  1BTL A;  4EU0 A;  5M19 A;  1FQG A;  5HL1 A;  2W1T A;  1TF1 A;  1O7E A;  3IBJ A;  5FEG A;  2XFT A;  2I9V A;  2ZL1 B;  2ZLY A;  1TEM A;  2VGJ A;  3BM6 A;  3MS6 A;  1CF0 A;  3QP1 A;  4N9L A;  3BW6 A;  1Q2Q A;  2J7V A;  1N9N A;  4HH3 A;  3BJN A;  3HBR A;  1BYW A;  1G68 A;  4BEN A;  2XQZ A;  4U0T A;  2P9V A;  3D9Y A;  1ZKJ A;  3G35 A;  3TG9 A;  1L3L A;  3M6B A;  3KYE A;  4HIA A;  2QZ6 A;  3NUL A;  3F1O B;  5A8B A;  4RA7 A;  4LCM A;  3LFV A;  4LPZ A;  2JHE A;  1KDS A;  1NLY A;  5EV0 A;  5EVI A;  5HPF A;  4Y17 A;  3PHY A;  1YLP A;  2V2F F;  4EQI A;  1F9I A;  5CX7 A;  4JPM A;  3LR3 A;  1P97 A;  4PKY A;  3MQO A;  2WGW B;  3UN7 A;  3T4Q A;  4KUO A;  4YFM A;  3O5Y A;  3V3R A;  4ARZ A;  3UE0 A;  4D2O A;  1NXY A;  2A49 A;  5TBM B;  5C5K A;  3FYZ A;  3MQ0 A;  1AXB A;  2PAV P;  4R4S A;  4XT2 B;  4NEE D;  1IOU A;  4OOL A;  5JYP A;  1ESI A;  4OP8 A;  2ZL1 A;  3SH7 A;  1GSV A;  1DJC A;  4I3J A;  5IS1 A;  3H82 A;  5CXW A;  4CLC C;  5LBR A;  3B47 A;  1TS6 A;  3VP1 A;  1PFL A;  3UMD A;  3NHQ A;  2QHK A;  1GHI A;  3UE1 A;  4Q0J A;  4EBN A;  4ZBE A;  5F82 A;  3ULF A;  2X01 A;  4N1H A;  1W63 M;  2M7V A;  1MKM A;  4R4R A;  4Y2F A;  1ES4 A;  2A24 B;  3F1O A;  4GD8 A;  1I5Q A;  4KUK A;  2OV5 A;  3GQZ A;  4NK3 A;  3LR4 A;  5L07 A;  4RVA A;  3UY6 A;  4UEY A;  3UDF A;  3CHW P;  4IED A;  3HLE A;  4MCW A;  5IHV A;  4P85 A;  2EX9 A;  1ZG4 A;  2Y2J A;  1K25 A;  5CHJ A;  3ZDJ A;  4DF6 A;  3Q82 A;  2WKH A;  4XXR A;  4I3I A;  3HRE A;  2WGW A;  3V3S A;  3ITA A;  2BTF P;  3ZHH A;  4X69 A;  3AGE A;  4H6J B;  5TBM A;  5CHM A;  3CG5 A;  2LB9 A;  4JXW A;  3LEQ A;  2RCX A;  3CIT A;  3IXH A;  2Y2N A;  3KSF A;  1BLP A;  3W4O A;  1W5D A;  3LYX A;  2FFF B;  1BSG A;  2YKF A;  2H0Y A;  1LSX A;  4XT2 A;  2GX5 A;  1ONH A;  3G6O A;  3QP8 A;  1YM1 A;  2J3W A;  4R0Q A;  2PDR A;  4PPR A;  1H8Z A;  5F1F A;  3PAE A;  1NY0 A;  1MY8 A;  4R6L A;  4E3K A;  2Z6C A;  4F3L B;  5E2H A;  1YLW A;  5DFY A;  2Y2H A;  1YQS A;  3NOT C;  2Y2I A;  4MEZ A;  1ES3 A;  1ZHH B;  3ZCZ A;  3VMA A;  1OTB A;  3VOY A;  2Q9M A;  3CZD A;  4G3V A;  4X1M A;  2B95 A;  2ZC6 B;  2A24 A;  1P9R A;  4EBP A;  4NET A;  4Q8I A;  1T19 A;  5HWT A;  3LY4 A;  3A3D A;  1SDE A;  2VZW A;  5G18 A;  2Y2L A;  4ME4 A;  1UGU A;  3IX3 A;  4Y7P A;  4DE2 A;  2OAP 1;  4S2P A;  2DRW A;  2B18 A;  4BD1 A;  5EM0 A;  2PU4 A;  4WEK A;  3D4F A;  3OBF A;  4DDY A;  1RCJ A;  1PWD A;  2XR0 A;  2VV8 A;  3KYZ A;  3PXP A;  3KO6 A;  3QP2 A;  4Y3I A;  4HES A;  2OLV A;  3VE3 A;  5AQB A;  5IU1 A;  4KG5 A;  1H8M A;  4GJ4 A;  3MJQ A;  4ZAM A;  5DTT A;  4PM5 A;  3VP4 A;  3Q7V A;  4OVD A;  4X56 A;  1VQQ A;  4Z1W A;  5U47 A;  1K57 A;  4S2N A;  4WM9 A;  5HZH A;  4LRZ E;  3S4X A;  3EGX C;  3EEH A;  3G4P A;  4Y5F A;  3ZNY A;  5J7E A;  1FOF A;  3LR5 A;  3SH8 A;  3G32 A;  2CMN A;  3IQA A;  1RP5 A;  2W27 A;  4QWO A;  4LFU A;  3P98 A;  1YMS A;  5AVF A;  1TS8 A;  1PRQ A;  1ZTU A;  2PYR A;  2V9A A;  1J3W A;  3UPO A;  2H0T A;  3F1N B;  2UV0 E;  3NBL A;  5F6A A;  2P04 A;  3OCL A;  3O3V A;  3NJA A;  5DFX A;  2Y2K A;  4P87 A;  2XH9 A;  1KE0 A;  2XDM A;  3SH9 A;  4LEN A;  4B88 A;  3N6I A;  5FQQ A;  3B33 A;  4O0P A;  3IXB A;  4MNR A;  4Q0H A;  4WZ5 A;  4JLF A;  5E43 A;  3HUO A;  1OPX A;  3MQQ A;  1LI9 A;  2L1M A;  4QY6 A;  1NYY A;  3RJU A;  1Z6F A;  2XA7 M;  3OPH A;  4GCZ A;  2ZMA A;  2Y2Q A;  4Q0I A;  3A3J A;  1CK3 A;  1JWZ A;  4EEP A;  5DF7 A;  3IF6 C;  4GKU A;  3W2Z A;  1CJF A;  3NIA A;  3ITB A;  4JGR A;  5HAQ A;  1IEL A;  4GS9 B;  1P0Z A;  5CGS A;  1SKF A;  1H0M A;  5HDD A;  1ONG A;  1EW0 A;  3BEC A;  4LLO B;  4NXF A;  4Y0U A;  1CEG A;  1K6S A;  4BD0 A;  2FZ0 A;  4KZA A;  2C6W B;  1IYO A;  4N92 A;  2PRF A;  3C4O A;  3R4K A;  3BYD A;  3QP4 A;  3TOI A;  2OAQ 1;  4X55 A;  3CPT B;  4KQD A;  3C2W A;  3MF0 A;  2BG1 A;  4P6B A;  2PD8 A;  1H5X A;  1XP4 A;  3RXW A;  1MKI A;  4R1G A;  1A0K A;  2QKP A;  4X53 A;  3NDE A;  2P08 A;  3QNB A;  4XUX A;  1IFQ A;  1JTD A;  2ZMF A;  5GLB A;  2W3H A;  4GB7 A;  2VA0 A;  2X02 A;  4DKI A;  5DKK A;  1PWC A;  5FDS A;  5EEC A;  4OQH A;  5HD5 A;  3E98 A;  3GRJ A;  2EFU A;  4LV1 A;  1TDG A;  4OPZ A;  3K3D A;  3ZG7 B;  3E4P A;  5A93 A;  1RGZ A;  4GHI B;  5I94 A;  1F5M A;  2R9X A;  3S7P A;  4KQQ A;  1FCN A;  4GS9 A;  4K0X A;  5L10 A;  4DJ3 A;  3BFG A;  3N8R A;  2D01 A;  5EVI C;  3M2J A;  4JXS A;  1W8Q A;  2H5S A;  4Y15 A;  4ZRR A;  2Q0O A;  1GSW A;  3SS3 A;  5FQM A;  5EOO A;  2B02 A;  2WZX A;  4B4X A;  2Y91 A;  4OKP A;  5CGW A;  3CPT A;  1O07 A;  1XXM A;  3DTK A;  4PM9 A;  1TDL A;  4UQI S;  2IWB A;  1UWP X;  4EEU A;  4H8R A;  2EWV A;  2L4R A;  2J3T C;  3CI6 A;  4FD8 A;  4FTX A;  4MN6 A;  4KQR A;  4MMN A;  3MKF A;  2XRO A;  4NKP A;  2J9O A;  3MXR A;  4C6Y A;  4KZ9 A;  1I2W A;  1D1J A;  5J4E A;  3T1Q B;  3JVV A;  3IHB A;  4GHI A;  4U3T A;  3UME A;  1FCM A;  2XSS A;  4HEF A;  3EWK A;  4OH0 A;  1XKZ A;  2GZA A;  5KZH A;  4FH4 A;  1K54 A;  2J80 A;  1W63 Q;  5EVE A;  5J8X A;  3FPV A;  3T4L A;  3WS5 A;  4XUZ A;  2PU2 A;  1KVM A;  3MXQ A;  4B93 A;  1YT4 A;  1D7E A;  4OLG A;  2Y2M A;  4N9K A;  1K6R A;  3W4Q A;  1NZO A;  3F1P B;  4PAU A;  2ZC7 A;  4EV4 A;  5G4Z A;  3S22 A;  3V67 A;  3B42 A;  2M7U A;  3FPW A;  3JPU A;  3CMZ A;  2FH5 A;  1HD8 A;  5D3O A;  1XX2 A;  3S1Y A;  3ZYT A;  3N7W A;  1H3Q A;  1K55 C;  3UDX A;  5HAI A;  1KGF A;  5K5B A;  1KGE A;  2UWX A;  3HLD A;  2GJ3 A;  2A2L A;  2IA2 A;  2WZZ A;  3VE4 A;  1E25 A;  4X1L A;  2FFY A;  1D06 A;  3CWF A;  3HJI A;  4KZ4 A;  2ZC5 B;  4JXV A;  1JNU A;  3ZG5 A;  3NCK A;  4G3K A;  2W1R A;  5TJJ A;  4OOY A;  5GLC A;  4N1X A;  1Z09 A;  4HOI A;  3LI9 A;  2INW A;  3DTM A;  1S66 L;  1CI8 A;  4BBU A;  3K3C A;  4ZDX A;  3LID A;  5HX9 A;  4FOF A;  2EX2 A;  3P7N A;  1KVL A;  3BLM A;  3JVU A;  3F1P A;  2W3D A;  3W4P A;  3UNW A;  1ALQ A;  4QJG A;  1SDN A;  1NYM A;  2VGL S;  5FL3 A;  4OLD A;  4Y0O A;  3ZNT A;  4UAA A;  4KZ5 A;  4DN0 A;  3N4I A;  1KDW A;  1K57 C;  2YKH A;  2B5R A;  4S2N C;  5L09 A;  1YSP A;  1NRJ A;  1YKD A;  3V50 A;  2AVX A;  3A0V A;  5L8M A;  1XJ3 A;  1ACF A;  2WK0 A;  2M1C A;  5I5L A;  3QNC A;  2ZM2 A;  4GDN A;  2QJ7 A;  3P01 A;  4X6T A;  3Q1F A;  1F98 A;  5F69 A;  5A90 A;  3SZT A;  2JC7 A;  2ZQ9 A;  4Z9Q A;  5KMW A;  2A3U A;  2ZMV A;  2Y2G A;  4P6Z M;  1BT5 A;  1FR6 A;  4HBT A;  5AQA A;  4X25 A;  4WUJ A;  3PBQ A;  3OPL A;  4ESP A;  3IBR A;  4QD4 A;  4L9F A;  3ZFZ A;  4D60 A;  5CED A;  3A0R A;  1JVJ A;  1K0K A;  4MBK A;  3DW0 A;  2JKF A;  3BFF A;  3ZGA B;  2WKI A;  3IH8 A;  3A0S A;  5DVA A;  1HLU P;  3KSI A;  1GCE A;  1ERO A;  2PBD P;  3DWZ A;  1FIK A;  4GZB A;  4ZJ1 A;  4OPR A;  1OJG A;  4U0X A;  3MFD A;  3VSK A;  3IS2 B;  3LO7 A;  4KZ8 A;  2K7S A;  3TW8 A;  5FI6 A;  1FCO A;  3CAX A;  4P0M A;  1AWI A;  4E3I A;  3QP6 A;  3OOV A;  2WKE A;  4WZ4 A;  4O7D A;  3BWL A;  3B3X A;  1QME A;  4CLC B;  3PR6 A;  1IYP A;  4GDB A;  1IYS A;  3OCN A;  2V1A A;  1TS0 A;  1MWU A;  3O88 A;  1Q2P A;  1W8Y A;  1HTZ A;  5FSR A;  1K4E A;  4F94 A;  4LGW A;  2CC1 A;  3WS2 A;  3FKW A;  1OJ5 A;  1DJB A;  2JKT I;  4O8G A;  1H8Y A;  4JGP A;  3OLO A;  1W79 A;  4H6J A;  3T4J A;  4I38 A;  4R3A A;  5KSC A;  3NOU C;  1BUL A;  3IXD A;  4GLQ A;  4DE3 A;  3UB6 A;  3ZG0 A;  2JE5 A;  2JKR I;  2ZQC A;  5HWV A;  3IS2 A;  2GNX A;  1VET B;  2RL3 A;  4JGQ A;  3T4K A;  4MN5 A;  2LB5 A;  4BL3 A;  4F3L A;  1WYB A;  3EQV A;  3UPN A;  1PZO A;  4S2M A;  1OTE A;  2VV6 A;  1XGI A;  3G2Z A;  2XEP A;  5DJT A;  2HP9 A;  2HDQ A;  3PBR A;  5FAQ A;  3LEZ A;  2WAE A;  2P74 A;  4PKY G;  1Y4O A;  2E8J A;  3Q07 A;  4WMC A;  4WEL A;  5KSH A;  1DP8 A;  5FAO A;  3CLO A;  2E8I A;  3LIE A;  2ZOH A;  5A92 A;  1FSW A;  3LIC A;  3C7V A;  5AJG A;  3D72 A;  5GLA A;  5DJU A;  4LRX C;  5HL6 A;  3HLG A;  3MZE A;  4GN2 A;  3E4Q A;  2JCH A;  3WS1 A;  3VP0 A;  3HJK A;  2V8F A;  4QU3 A;  1YMX A;  3T1X A;  1XFQ A;  1N9L A;  2O0Y A;  1DY6 A;  4GOG A;  2Z2L B;  1VET A;  3RFB A;  1JTG A;  1PZP A;  4KZ6 A;  3PAG A;  4HY8 A;  4II7 A;  1K56 D;  4B4Z A;  4WF0 A;  5FAP A;  3FG8 A;  2P7J A;  3HLW A;  4HJ3 A;  1ES2 A;  1XFN A;  2VX8 A;  3TE8 A;  4S2K A;  1G6A A;  1SKO B;  1IKG A;  3L7H A;  1ERM A;  2W3G A;  4HH2 A;  3WS0 A;  1MC0 A;  1N4O A;  3F1N A;  4IBX A;  2OWH A;  5CTM A;  4PM6 A;  3Q81 A;  1PWG A;  4RX3 A;  2ZM0 A;  3UE3 A;  5TR7 A;  5M1A A;  1E4D A;  3CUE C;  4EXO A;  1V9Z A;  1KE4 A;  4ZJ2 A;  5CGX A;  3FV7 A;  3G30 A;  3NY4 A;  3VV4 A;  3A3I A;  3KSG A;  3DTI A;  3VFH A;  3OPR A;  3SS5 A;  4JF4 A;  4WL9 A;  3L9K A;  4L9G A;  3C38 A;  2XD5 A;  1YLJ A;  3UB7 A;  2GDN A;  2VEA A;  4OQ0 A;  4B9O A;  1VEU B;  1TVF A;  3W8K A;  1BLS A;  2G7U A;  3H9W A;  1YSQ A;  2Z6D A;  3BY8 A;  5FDH A;  2O9A A;  3HLF A;  1PIO A;  2EX8 A;  3LI8 A;  1YAX A;  3PBN A;  1DP6 A;  1T1A A;  4JXG A;  2V0W A;  2WUQ A;  3SS4 A;  1S6R A;  3OZH A;  5G4Y A;  2ZBB A;  3MR0 A;  2EXA A;  3BFE A;  1IEM A;  1HZO A;  3T50 A;  3FC7 A;  5E2E A;  3MZF A;  2ZC4 B;  5TFQ A;  3K2N A;  1CI9 A;  1MPL A;  4IUK A;  1S4S A;  4QB8 A;  4E04 A;  4QPR A;  2H28 A;  2WAD A;  4DRT A;  3MXS A;  4UHU A;  4ID4 A;  2V8C A;  3HCY A;  1MXO A;  5EFW A;  4DE1 A;  3UB9 A;  4HP9 A;  2OLU A;  3FWL A;  1HVB A;  2V1B A;  2R9W A;  5HD3 A;  1OTD A;  4BBT A;  3S7Q A;  4OP5 A;  3GVB A;  4MDZ A;  2C5W B;  4EET B;  5DF9 A;  1K56 A;  4S2I A;  1VEU A;  3LUQ A;  3KX0 X;  1OT6 A;  4BQM A;  2Y55 A;  2IWD A;  3IF5 A;  4RYE A;  2JKT M;  3DTE A;  2WKR A;  4KG6 A;  3BRM A;  4E3L A;  2QYB A;  2O9B A;  3M6H A;  3C5A A;  4HP4 A;  3TRC A;  1BLH A;  2HDS A;  3UB5 P;  3TJZ C;  1PNE A;  1XJ6 A;  4M4X A;  4MBF A;  2L0W A;  5GL9 A;  1XJ4 A;  1ZG6 A;  2PYP A;  3S7O A;  2QMI A;  2O9C A;  5EVI B;  4DE0 A;  2XFS A;  5EVL A;  3QHY A;  1XPB A;  2JKR M;  3O87 A;  1ES5 A;  1ZC2 A;  4L0L A;  1ODV A;  3HL9 A;  2HPB A;  4S2J A;  5FA7 A;  5HPI A;  1VM1 A;  1OT9 A;  4NG2 A;  5EPH A;  4QHC A;  3EQU A;  2G2U A;  5CEB A;  3GEC A;  2OOL A;  1K4F A;  4GD6 A;  2ZQD A;  2PD7 A;  1Y54 A;  2XD1 A;  3U4L P;  3HLB A;  3T1R A;  3WS4 A;  3ZVW A;  1CEF A;  1G5U A;  3HUN A;  3MFX A;  1GA9 A;  3DWK A;  3KSH A;  3H82 B;  2XGN A;  1U60 A;  2VLG A;  3M2K A;  4I5S A;  1ERQ A;  4EES A;  1L0D A;  5FQK A;  3OC2 A;  4WYY A;  1OME A;  3VP2 A;  1PI5 A;  1WA9 A;  1VB6 A;  4OQI A;  1S1Y A;  3ZG9 B;  4WBG A;  5HFO A;  3ZQ5 A;  4R3J A;  4S2O A;  3HUM A;  4R3B A;  1G6O A;  2EWW A;  4NXB A;  4UQI M;  3BQA A;  2JN7 A;  3H7W B;  4LCL A;  5FQI A;  5EUA A;  4RX2 A;  3V5M A;  3LR0 A;  2V0U A;  4LRY C;  2J8Y A;  2VV7 A;  1E3U A;  2EX6 A;  4DMZ A;  3ZG8 B;  1N9B A;  2V20 A;  3WWX A;  4PHT A;  2W3F A;  5DF8 A;  3FKV A;  2Y2O A;  5IT5 A;  2HJE A;  3NC8 A;  4OQG A;  4OPQ A;  3SW1 A;  3IX8 A;  3DAV A;  3MBZ A;  1WE4 A;  5AVE A;  4FUW A;  3GTC A;  2HZ5 A;  1ESU A;  3IXG A;  2HV1 A;  3WRT A;  1CQA A;  1GSX A;  5AQ7 A;  1LT0 A;  1IYQ A;  5GHX A;  2I72 A;  1S0W A;  3AGF A;  1L0E A;  5F1G A;  2KDK A;  4WEJ A;  4EWF A;  1NZU A;  1FR1 A;  3UDI A;  4KEN B;  3BQ8 A;  3GMW A;  1LL8 A;  2BAS A;  4HJ4 A;  1L0G A;  4CLC D;  1QMF A;  2VK3 A;  2ZQA A;  3MMH A;  1TS7 A;  3R7W B;  4FSF A;  4C3Q A;  5HSQ A;  4JF5 A;  5L2F A;  1J9M A;  3T12 B;  5CRF A;  1YLZ A;  1SZV A;  1JWV A;  3GDI A;  3FZC A;  4WMC D;  2QWS A;  1LI0 A;  3H7W A;  4K91 A;  1EWZ A;  4OON A;  2K31 A;  4BJP A;  4DXB A;  2JKG A;  2HDR A;  3D3O A;  3IT9 A;  4DXC A;  4M3K A;  4WZ5 C;  1OTA A;  4UA6 A;  5BOH A;  1C3B A;  3G31 A;  1PI4 A;  5HDS A;  1VHM A;  3UPP A;  5A91 A;  1IKI A;  4L9E A;  4MN7 A;  4ZTK A;  4IVK A;  4HNB A;  5M18 A;  3E0Y A;  4EW7 A;  3RXX A;  4PM7 A;  1WYC A;  1MBL A;  2VKS A;  3LIA A;  1L0F A;  2ZC3 B;  2NUP C;  5E2F A;  1S4R A;  1T1C A;  4Y0T A;  1MWT A;  1KGG A;  3Q7V B;  4PMA A;  4GW9 A;  4HI4 A;  2HP5 A;  3HVF A;  4WLA A;  2XA7 S;  1NRF A;  5EOE A;  3E2K A;  5F83 A;  3C8C A;  5GHY A;  1K55 A;  4Y13 A;  4EUV A;  4YWZ A;  5CHU A;  3R7W A;  1YLY A;  3SOI A;  4GNU A;  5HAP A;  1P9W A;  4X68 A;  4DJ2 A;  3QP5 A;  3GV9 A;  4MLL A;  4R70 A;  4BMW A;  2Q9N A;  4JKT A;  2WYX A;  3V39 A;  4DDS A;  2PR5 A;  3T1S A;  4KZ3 A;  3BFC A;  1XA7 A;  4KZ7 A;  3BFD A;  2VGK A;  5GLD A;  4EBL A;  5EM1 A;  4JF6 A;  2ZJ9 A;  4I39 A;  1XGJ A;  5FAT A;  2ZOI A;  2XRN A;  2ZQ8 A;  1F2K A;  2VGL M;  3NDG A;  2Y59 A;  3WRZ A;  1RGY A;  3MSH A;  1PW1 A;  5MC7 A;  1SHV A;  1BLC A;  4CQH A;  2DMW A;  5AQ9 A;  4YIN A;  1DP9 A;  1LSV A;  4R38 A;  2EFX A;  2XK1 A;  3N8S A;  1T1B A;  1X0O A;  4OPY A;  5F68 A;  2Z2M B;  4CLC A;  3AGD A;  4LV3 A;  3IWI A;  3A3F A;  2G2W A;  3E2L A;  3I7J A;  4CLC E;  2K2N A;  4EQ1 A;  5FAS A;  2HP6 A;  5TGF A;  3UB8 A;  3G2Y A;  3T4T A;  4ZJ3 A;  3BLS A;  3EOI A;  2ACG A;  1S67 L;  2V1Z A;  2W3E A;  4HBU A;  2H10 A;  3PBT A;  4IUH A;  1MZU A;  4BBV A;  4IJG A;  1EI5 A;  3ZVT A;  4JBF A;  3ISG A;  1XA1 A;  5FQ9 A;  4HJ6 A;  4HQA A;  4A5R A;  3VSL A;  1M6K A;  3N8L A;  2OWJ A;  1Y28 A;  2MJ6 A;  1NWZ A;  2R78 A;  5EE8 A;  2NUT C;  4K08 A;  1DJA A;  1YPR A;  1LHY A;  4EER A;  3TSG A;  3T4O A;  3E4O A;  1BUE A;  1K38 A;  3IH9 A;  3CJM A;  4PM8 A;  5E2G A;  1LLB A;  5FI7 A;  1OTI A;  1PYY A;  2OSU A;  2WKP A;  2KLI A;  4ETX A;  3KYQ A;  5J3W A;  4CJN A;  3O86 A;  4CPK A;  1SCW A;  2WGI A;  3RTY A;  4E6W A;  1K54 C;  2EA9 A;  3MZD A;  1YLT A;  3U2A A;  4G3W A;  4I3A A;  3BY9 A;  4KQO A;  5KIZ A;  5HAR A;  3NEC A;  5DKL A;  3GSG A;  2WAF A;  5DTK A;  5HWW A;  1UWN X;  1MWR A;  4WN5 A;  4E3O A;  4E3J A;  1N9O A;  1L2S A;  4AFI A;  5HDC A;  1GHM A;  4KG2 A;  3DBA A;  3LIF A;  2Y79 A;  3LIB A;  4YNR A;  5DTS A;  3IWQ A;  4IHQ A;  3ICY A;  2IWC A;  2JBF A;  2QJ5 A;  3T4S A;  3C4P A;  1V9Y A;  4LV0 A;  3EEA A;  4NXG A;  3JYI A;  2HJ9 C;  3HLC A;  3IX4 A;  2W0N A;  2PT7 A;  1PW8 A;  2HDU A;  1GHP A;  2WGV A;  4EUZ A;  3OPP A;  3VOZ A;  3NOP C;  1W7F A;  5CEC A;  4KZB A;  2Y2P A;  3G34 A;  3VFF A;  2VJW A;  3UE6 A;  4QY5 A;  4IBR A;  2X71 A;  4C75 A;  5FQJ A;  3IF6 B;  3Q7Z A;  1S1Z A;  4ETZ A;  4R23 A;  5FI2 A;  1SKO A;  1T18 A;  3PBS A;  1NJ4 A;  2HF6 A;  1KOU A;  3PBO A;  1G28 A;  4JGO A;  3MKE A;  4LV2 A;  2DCF A;  4RQ9 A;  5FEF A;  5EVI D;  2KOI A;  1E3U D;  1BZA A;  3VOL A;  4K0W A;  3UO9 A;  5CER A;  2DNS A;  3IHA A;  4E6X A;  3GR2 A;  5CTN A;  1STZ A;  1XJ2 A;  1M40 A;  2EXB A;  1LL5 A;  5HW3 A;  2O99 A;  4OOM A;  1JWP A;  2W1T B;  3S7N A;  2BLS A;  2D02 A;  2J3T D;  2QPN A;  4S2L A;  4BWI A;  5JYO A;  4HHD A;  3PTE A;  3A3E A;  1MWS A;  4BLM A;  4E3M A;  1LSW A;  4E3N A;  4YOF A;  2XLN A;  2Y8H A;  5F5Y A;  2Y4A A; 
#chains in the Genus database with same CATH homology
 1DJB A;  3LY3 A;  3MBZ A;  3BEC A;  1WE4 A;  1H8Y A;  3GTC A;  3IWO A;  3IF6 A;  4Y0U A;  1CEG A;  1K6S A;  1W79 A;  5GHZ A;  4BD0 A;  1ESU A;  1FSY A;  3IXG A;  3WRT A;  2P9V B;  4KZA A;  2ZD8 A;  4UA9 A;  2C6W B;  5AQ7 A;  1IYQ A;  5GHX A;  2I72 A;  1IYO A;  1S0W A;  3AGF A;  4N92 A;  2XF3 A;  1L0E A;  3C4O A;  3BYD A;  5F1G A;  5KSC A;  3TOI A;  1KE3 A;  4WEJ A;  4X55 A;  1NZU A;  4EWF A;  1BUL A;  1FR1 A;  2PBY A;  3UDI A;  3IXD A;  3P09 A;  4UA7 A;  4DE3 A;  4KEN B;  3GMW A;  3ZG0 A;  3VP3 A;  2JE5 A;  1L0G A;  2BG1 A;  2ZQC A;  4P6B A;  4IVI A;  1QMF A;  1H5X A;  1XP4 A;  2ZQA A;  3C7U A;  1MKI A;  3RXW A;  4R1G A;  4BL2 A;  2RL3 A;  4X53 A;  4FH2 A;  3NI9 A;  4FSF A;  3NDE A;  2ZM8 A;  4BL3 A;  3BEB A;  4C3Q A;  1WYB A;  2ZQ7 A;  3QNB A;  4JF5 A;  4XUX A;  5L2F A;  1JTD A;  3LCE A;  1J9M A;  3EQV A;  1GA0 A;  5CRF A;  3UPN A;  5GLB A;  4GB7 A;  1PZO A;  1YLZ A;  4S2M A;  1JWV A;  2X02 A;  4DKI A;  1XGI A;  2J9P A;  1LL9 A;  3FZC A;  1PWC A;  4WMC D;  4FCF A;  5EEC A;  4OQH A;  3G2Z A;  1I2S A;  1LI0 A;  1BTL A;  4MBH A;  2XEP A;  5M19 A;  1FQG A;  4K91 A;  1EWZ A;  3GRJ A;  2EFU A;  4OON A;  4LV1 A;  5HL1 A;  1TDG A;  2HP9 A;  4OPZ A;  4BJP A;  2HDQ A;  1O7E A;  4DXB A;  3PBR A;  3ZG7 B;  5FAQ A;  3LEZ A;  2WAE A;  5A93 A;  1RGZ A;  2P74 A;  5I94 A;  2HDR A;  3IT9 A;  2XFT A;  4DXC A;  2R9X A;  2ZLY A;  4M3K A;  1TEM A;  2VGJ A;  4WZ5 C;  3BM6 A;  4UA6 A;  5BOH A;  4KQQ A;  1FCN A;  1C3B A;  4K0X A;  3G31 A;  1PI4 A;  3Q07 A;  4WMC A;  4WEL A;  3UPP A;  4N9L A;  3BFG A;  5KSH A;  5A91 A;  1Q2Q A;  5FAO A;  1IKI A;  2E8I A;  2J7V A;  3N8R A;  4ZTK A;  4IVK A;  5A92 A;  3HBR A;  5M18 A;  1G68 A;  4BEN A;  1FSW A;  5EVI C;  3M2J A;  3RXX A;  2XQZ A;  4PM7 A;  1WYC A;  1MBL A;  4JXS A;  4U0T A;  1W8Q A;  3C7V A;  5GLA A;  2H5S A;  1L0F A;  2P9V A;  2ZC3 B;  5E2F A;  3HLG A;  3MZE A;  4GN2 A;  1ZKJ A;  3G35 A;  3TG9 A;  3SS3 A;  2JCH A;  3M6B A;  5FQM A;  3WS1 A;  3VP0 A;  2QZ6 A;  5EOO A;  4Y0T A;  2WZX A;  4B4X A;  2Y91 A;  1MWT A;  1KGG A;  3Q7V B;  4RA7 A;  4LCM A;  4QU3 A;  4OKP A;  5CGW A;  1YMX A;  4PMA A;  1O07 A;  1KDS A;  1XXM A;  4PM9 A;  1TDL A;  2HP5 A;  3HVF A;  2IWB A;  1NRF A;  5EOE A;  5EVI A;  3E2K A;  4H8R A;  5F83 A;  5GHY A;  1YLP A;  2V2F F;  1DY6 A;  1K55 A;  4EQI A;  4GOG A;  4JPM A;  5CHU A;  2Z2L B;  4FD8 A;  1YLY A;  1JTG A;  1PZP A;  4GNU A;  4KZ6 A;  3SOI A;  3PAG A;  5HAP A;  4KQR A;  2WGW B;  1K56 D;  4X68 A;  3UN7 A;  3GV9 A;  4YFM A;  4B4Z A;  3MKF A;  4MLL A;  3V3R A;  5FAP A;  2Q9N A;  4JKT A;  2J9O A;  3HLW A;  3UE0 A;  2WYX A;  1ES2 A;  3V39 A;  4DDS A;  3MXR A;  4D2O A;  1NXY A;  2A49 A;  4KZ3 A;  3BFC A;  4S2K A;  1XA7 A;  4C6Y A;  4KZ9 A;  4KZ7 A;  1G6A A;  1I2W A;  3BFD A;  1IKG A;  1ERM A;  3FYZ A;  2VGK A;  5GLD A;  1AXB A;  3IHB A;  4R4S A;  4EBL A;  3WS0 A;  4U3T A;  1N4O A;  4JF6 A;  2ZJ9 A;  4OOL A;  5JYP A;  1ESI A;  1XGJ A;  4OP8 A;  5FAT A;  1FCM A;  4HEF A;  4IBX A;  3SH7 A;  2ZQ8 A;  1DJC A;  5CTM A;  4OH0 A;  4PM6 A;  3Q81 A;  1XKZ A;  1PWG A;  4RX3 A;  5CXW A;  2ZM0 A;  5KZH A;  3VP1 A;  3NDG A;  3UE3 A;  2Y59 A;  5TR7 A;  5M1A A;  4FH4 A;  1K54 A;  3WRZ A;  1RGY A;  1E4D A;  1GHI A;  1PW1 A;  3UE1 A;  1KE4 A;  1SHV A;  1BLC A;  4ZJ2 A;  5J8X A;  5CGX A;  4EBN A;  3FV7 A;  3G30 A;  4ZBE A;  3NY4 A;  5AQ9 A;  3WS5 A;  5F82 A;  4YIN A;  3A3I A;  2X01 A;  4N1H A;  4XUZ A;  2EFX A;  2XK1 A;  3N8S A;  4R4R A;  3VFH A;  1ES4 A;  2PU2 A;  1KVM A;  3OPR A;  4OPY A;  4GD8 A;  1I5Q A;  2OV5 A;  2Z2M B;  3GQZ A;  3SS5 A;  3AGD A;  4NK3 A;  4RVA A;  3UY6 A;  4LV3 A;  1YT4 A;  4JF4 A;  3UDF A;  4OLG A;  2Y2M A;  3IWI A;  4N9K A;  1K6R A;  2XD5 A;  3A3F A;  3W4Q A;  1YLJ A;  2G2W A;  3E2L A;  4IED A;  3I7J A;  3HLE A;  2GDN A;  5IHV A;  5FAS A;  1NZO A;  4OQ0 A;  2HP6 A;  2EX9 A;  4P85 A;  5TGF A;  3G2Y A;  4ZJ3 A;  1ZG4 A;  3BLS A;  2ZC7 A;  1TVF A;  2Y2J A;  3W8K A;  1K25 A;  4EV4 A;  1BLS A;  5CHJ A;  3S22 A;  3ZDJ A;  4DF6 A;  3Q82 A;  2V1Z A;  2WKH A;  5FDH A;  4XXR A;  3HRE A;  2WGW A;  4HBU A;  3V3S A;  2H10 A;  3ITA A;  3PBT A;  3HLF A;  3ZHH A;  4X69 A;  3AGE A;  3CMZ A;  1HD8 A;  5D3O A;  1XX2 A;  5CHM A;  3S1Y A;  3CG5 A;  1PIO A;  2EX8 A;  3PBN A;  4JXW A;  2RCX A;  3N7W A;  1EI5 A;  4JXG A;  3ZVT A;  2WUQ A;  3IXH A;  2Y2N A;  4JBF A;  3SS4 A;  1BLP A;  1K55 C;  3UDX A;  3ISG A;  3W4O A;  1XA1 A;  5FQ9 A;  1S6R A;  1W5D A;  5HAI A;  3OZH A;  2FFF B;  1KGF A;  1BSG A;  1KGE A;  2H0Y A;  2UWX A;  3HLD A;  1ONH A;  2EXA A;  3BFE A;  4A5R A;  1HZO A;  1IEM A;  1M6K A;  3VSL A;  1YM1 A;  3N8L A;  5E2E A;  4R0Q A;  2WZZ A;  3MZF A;  2ZC4 B;  1E25 A;  4PPR A;  1H8Z A;  5TFQ A;  2FFY A;  5F1F A;  3PAE A;  1NY0 A;  1MY8 A;  5EE8 A;  4E3K A;  1DJA A;  1LHY A;  1CI9 A;  5E2H A;  1YLW A;  3TSG A;  4KZ4 A;  2ZC5 B;  4JXV A;  1BUE A;  1MPL A;  2Y2H A;  3ZG5 A;  1YQS A;  1K38 A;  2Y2I A;  3IH9 A;  3NCK A;  4QB8 A;  4MEZ A;  1ES3 A;  3CJM A;  2WAD A;  4DRT A;  4OOY A;  3MXS A;  4PM8 A;  4UHU A;  4ID4 A;  4N1X A;  5GLC A;  3ZCZ A;  5E2G A;  1LLB A;  3VMA A;  1MXO A;  3VOY A;  4DE1 A;  2Q9M A;  3CZD A;  5FI7 A;  1PYY A;  2OSU A;  2ZC6 B;  2OLU A;  3DTM A;  4EBP A;  3FWL A;  4NET A;  1HVB A;  4Q8I A;  2R9W A;  1CI8 A;  4CJN A;  3O86 A;  3LY4 A;  4ZDX A;  4CPK A;  1SCW A;  3A3D A;  4OP5 A;  5HX9 A;  1SDE A;  2EX2 A;  3GVB A;  2WGI A;  5G18 A;  1KVL A;  2Y2L A;  2C5W B;  4E6W A;  1K54 C;  5DF9 A;  3MZD A;  1YLT A;  4Y7P A;  4DE2 A;  3BLM A;  1K56 A;  4S2I A;  4S2P A;  3W4P A;  2DRW A;  4BD1 A;  3UNW A;  1ALQ A;  4BQM A;  2Y55 A;  4KQO A;  4QJG A;  1SDN A;  2IWD A;  2PU4 A;  1NYM A;  5HAR A;  4WEK A;  4OLD A;  3IF5 A;  3GSG A;  3D4F A;  4RYE A;  4Y0O A;  2WAF A;  3ZNT A;  4UAA A;  5DTK A;  4OQG A;  4KG6 A;  4KZ5 A;  4DDY A;  1MWR A;  3BRM A;  1RCJ A;  1PWD A;  4E3L A;  2XR0 A;  3N4I A;  1KDW A;  3M6H A;  4E3O A;  4E3J A;  3C5A A;  1K57 C;  1L2S A;  2B5R A;  4S2N C;  4HES A;  1BLH A;  1GHM A;  2HDS A;  2OLV A;  4KG2 A;  5AQB A;  3V50 A;  4KG5 A;  4MBF A;  2WK0 A;  5DTS A;  3QNC A;  2ZM2 A;  3IWQ A;  4ZAM A;  5GL9 A;  1ZG6 A;  4GDN A;  2IWC A;  2QMI A;  4X6T A;  2JBF A;  5DTT A;  4PM5 A;  3VP4 A;  3C4P A;  3Q1F A;  3Q7V A;  5EVI B;  4OVD A;  4LV0 A;  1VQQ A;  4X56 A;  3JYI A;  4DE0 A;  2XFS A;  5EVL A;  5A90 A;  3QHY A;  5U47 A;  1XPB A;  3HLC A;  2JC7 A;  2ZQ9 A;  4Z9Q A;  3O87 A;  2A3U A;  5KMW A;  1ES5 A;  1K57 A;  1ZC2 A;  2Y2G A;  4S2N A;  4WM9 A;  1BT5 A;  1PW8 A;  2HDU A;  4L0L A;  1GHP A;  1FR6 A;  2WGV A;  3S4X A;  4EUZ A;  4HBT A;  3HL9 A;  3OPP A;  3VOZ A;  2HPB A;  1W7F A;  5AQA A;  4S2J A;  5FA7 A;  3G4P A;  4KZB A;  3ZNY A;  2Y2P A;  1VM1 A;  5CEC A;  3G34 A;  5EPH A;  4QHC A;  3VFF A;  1FOF A;  4QY5 A;  3EQU A;  4IBR A;  2G2U A;  5CEB A;  3PBQ A;  2X71 A;  3OPL A;  4C75 A;  3SH8 A;  3G32 A;  5FQJ A;  3IQA A;  3IF6 B;  4GD6 A;  1K4F A;  1RP5 A;  3Q7Z A;  4QD4 A;  2ZQD A;  3ZFZ A;  5CED A;  1Y54 A;  1JVJ A;  4R23 A;  4MBK A;  2XD1 A;  3DW0 A;  3HLB A;  3P98 A;  1YMS A;  3BFF A;  5FI2 A;  3WS4 A;  3ZGA B;  3ZVW A;  2WKI A;  3IH8 A;  1CEF A;  3UPO A;  2H0T A;  3HUN A;  5DVA A;  3PBS A;  1GCE A;  1ERO A;  1NJ4 A;  3NBL A;  3PBO A;  3DWZ A;  1GA9 A;  4GZB A;  3DWK A;  4ZJ1 A;  3MKE A;  4LV2 A;  2XGN A;  3OCL A;  1U60 A;  3O3V A;  4OPR A;  3M2K A;  4U0X A;  2Y2K A;  1ERQ A;  3MFD A;  2DCF A;  4P87 A;  3VSK A;  1L0D A;  3LO7 A;  2XH9 A;  5FQK A;  3OC2 A;  4KZ8 A;  1KE0 A;  2XDM A;  4WYY A;  3SH9 A;  4LEN A;  1FCO A;  5FI6 A;  4B88 A;  3N6I A;  5FQQ A;  5EVI D;  1OME A;  4P0M A;  3VP2 A;  1PI5 A;  1E3U D;  3IXB A;  1BZA A;  4MNR A;  4OQI A;  4WZ5 A;  4JLF A;  4E3I A;  3ZG9 B;  4WBG A;  2WKE A;  5HFO A;  5E43 A;  4WZ4 A;  4K0W A;  3HUO A;  4O7D A;  4R3J A;  5CER A;  3UO9 A;  2DNS A;  3B3X A;  3IHA A;  4S2O A;  4E6X A;  1QME A;  3HUM A;  3GR2 A;  5CTN A;  4R3B A;  1LI9 A;  1M40 A;  4QY6 A;  1NYY A;  1IYP A;  2EXB A;  4GDB A;  3RJU A;  1Z6F A;  1LL5 A;  4LCL A;  1IYS A;  5FQI A;  5HW3 A;  4OOM A;  3OCN A;  3OPH A;  1JWP A;  4RX2 A;  2ZMA A;  5EUA A;  3V5M A;  2BLS A;  2Y2Q A;  2J8Y A;  3A3J A;  1CK3 A;  2QPN A;  1E3U A;  1JWZ A;  1MWU A;  2EX6 A;  4S2L A;  3IF6 C;  3O88 A;  5DF7 A;  5JYO A;  3ZG8 B;  1Q2P A;  1W8Y A;  1HTZ A;  1N9B A;  2V20 A;  3PTE A;  4GKU A;  5FSR A;  1K4E A;  3A3E A;  3NIA A;  3ITB A;  1MWS A;  3WWX A;  4BLM A;  5HAQ A;  4E3M A;  1IEL A;  5DF8 A;  4F94 A;  3FKV A;  2Y2O A;  4E3N A;  2CC1 A;  2XLN A;  3WS2 A;  3FKW A;  5CGS A;  1SKF A;  2Y4A A;  3NC8 A;  4OPQ A;  1ONG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...