2QZ6A

First crystal structure of a psychrophile class c beta-lactamase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
354
structure length
349
Chain Sequence
DIRQVVDSTVEPLMQQQDIAGLSVAVIQNGKAQYFNYGVANKDSKQPITENTLFEIGSVSKTFTATLAGYALANGKLKLSDPASQYLPALRGDKFDHISLLNLGTYTAGGLPLQFPTGKMISYYQHWKPAFAPGTQRLYSNPSIGLFGHLAAQSLGQPFEKLMEQTVLPKLGLKHTFISVPETQMSLYAQGYDKAGKPVRVSPGALDAEAYGIKTSTSDLIHYVEVNMHPAKLEKPLQQAIAATHTGYYTVDGMTQGLGWEMYPYPIKVDALVEGNSTQMAMEPHKVNWLTPPQAAPLDTLVNKTGSTGGFGAYVAYVPSKGLGVVILANKNYPNAERVKAAHAILSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Crystal structure of a cold-adapted class C beta-lactamase
pubmed doi rcsb
total genus 113
structure length 349
sequence length 354
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2qz6A00
3O87A 5CTMA 1BZAA 4DE1A 5I94A 1XX2A 5CHUA 1FSWA 1YM1A 4R23A 4OKPA 2ZQ8A 2Y2OA 2WZXA 3BRMA 3IXGA 3PBQA 2JE5A 2DNSA 4B4XA 1PZPA 5TR7A 1TDLA 2EX9A 3C5AA 2XQZA 2CC1A 3MBZA 4HESA 3VSKA 4EQIA 4OQGA 1K6SA 3N8LA 4ZBEA 4OPQA 1G68A 1MBLA 2OLUA 3V39A 1CI8A 3M6BA 4NETA 5FASA 5HAQA 5IHVA 4H8RA 3G32A 2H0YA 3NY4A 4N9KA 5DF7A 3N7WA 1W8YA 3BECA 1YLPA 3PBOA 5EUAA 1ES4A 3UY6A 3ZG0A 1RGYA 1C3BA 3TG9A 3MXSA 3D4FA 3WRTA 1IYQA 4U3TA 5EOEA 1NZOA 2WADA 2A49A 3IF6A 4MLLA 5M19A 2IWDA 1IYPA 3N8RA 5CGXA 3Q7ZA 3BFCA 1TDGA 2EFXA 4ZAMA 1U60A 1NY0A 5HX9A 1GCEA 1IELA 3B3XA 1OMEA 2Y2GA 5L2FA 4MBKA 2WAFA 3G4PA 4E3KA 4E3JA 1PWCA 5CHMA 1NZUA 4BENA 3IHBA 4K91A 4KQRA 2Y2QA 4KZAA 1LL5A 4GD6A 2P9VA 3UPNA 1EROA 4BLMA 1NYYA 1HD8A 4CPKA 1PI5A 2Y2LA 4R4RA 4EWFA 1KE0A 4WMCD 3HLGA 1G6AA 3LEZA 4XUZA 4JBFA 4XUXA 3UO9A 3MKFA 1LI0A 5KMWA 1K57A 3ZDJA 1MWRA 4WZ4A 2WGIA 2ZQ7A 1W7FA 1ZG4A 3IH8A 3ITAA 4MBFA 2Y2JA 4MEZA 3S22A 3HLEA 1GA0A 3RXWA 5GHXA 3G30A 5JYPA 1CEGA 3Q07A 1FCMA 5KSCA 1EWZA 1BLPA 4EBLA 1E3UD 1K25A 2Q9NA 4S2IA 2Y59A 1TVFA 1JTGA 1ERQA 3AGEA 4FD8A 1L0DA 1RGZA 4IBRA 1MPLA 3ZG8B 2VGKA 4GD8A 4GOGA 3SOIA 1PIOA 3A3EA 2WGVA 2EX6A 1K55C 3HL9A 2Y2HA 4S2OA 4DE2A 1PWDA 2ZC5B 3GRJA 4WEJA 4JF6A 3W4QA 4DXCA 1IYOA 2HP5A 3IF6C 2Z2LB 2RCXA 5AQ7A 4CJNA 4EBNA 4OPRA 5CXWA 5EVID 4PM6A 1QMEA 1FSYA 2R9WA 3W8KA 5DF8A 2ZC4B 3BYDA 4KG6A 3NBLA 5FQJA 1ERMA 3EQUA 2H0TA 3O86A 4S2NA 3IF5A 4X56A 1KE4A 1XA7A 4B88A 3BFFA 1ZKJA 3V50A 4DF6A 5HFOA 4QB8A 2Y2PA 4X69A 1DJAA 1NYMA 4Y7PA 1IYSA 4IVIA 3CG5A 1RP5A 1ES3A 3OPRA 3ZNYA 2A3UA 1MWUA 1EI5A 4KZ7A 4N1XA 4DRTA 3TSGA 1K54A 3M2KA 1K57C 2XFTA 2OLVA 2PBYA 2Y91A 4FCFA 3G31A 1I5QA 3EQVA 1S6RA 4OQ0A 2DRWA 5GLBA 5FI7A 3ZVTA 4BD0A 2JC7A 4C6YA 4DE3A 4E3IA 3ZGAB 4Y0UA 4WBGA 4PM7A 1GA9A 4GDNA 1YMSA 2ZLYA 4KZ6A 4R4SA 4X53A 1LL9A 4Z9QA 5HAIA 4S2JA 3HLBA 5E43A 3ZG5A 3I7JA 3O3VA 5FAQA 3NI9A 5FDHA 5J8XA 3SH9A 4OH0A 5FAOA 2BLSA 3IXDA 1CEFA 4KZ9A 4PM5A 2EXAA 5EVIB 4BL2A 2X01A 2UWXA 4E3OA 3FZCA 4OOYA 3GMWA 2ZQDA 4OOLA 5CERA 3VP0A 1NJ4A 3Q7VA 1BSGA 1WE4A 4OVDA 2HDUA 1FR6A 4EV4A 5CHJA 1HZOA 3LY4A 2ZM8A 4P87A 5CEDA 3LO7A 2Y55A 4GNUA 4S2KA 2Z2MB 4UHUA 4OP5A 2V20A 4WEKA 3WS0A 1IKIA 1K55A 3G2ZA 3ZG7B 1GHMA 1MXOA 1J9MA 1FCNA 3HUNA 4KZ5A 4QHCA 1BTLA 3LY3A 4UA6A 3HLCA 4S2NC 1K6RA 3HBRA 1CI9A 3BM6A 1RCJA 1YLJA 5GHZA 1W79A 4R0QA 5F82A 1PWGA 5TGFA 1YT4A 2P74A 5U47A 1DY6A 3GTCA 3W4PA 2X02A 3NCKA 4IVKA 3WWXA 4C3QA 1PZOA 2WKHA 3IWIA 2XD1A 3P09A 2ZC7A 4LV1A 1NRFA 3TOIA 1PW1A 3MXRA 3WS2A 2JCHA 4Y0OA 1Q2QA 2HP9A 5M1AA 1BUEA 3VP3A 2J8YA 1N9BA 1YLZA 2Y2IA 3MZFA 1K54C 3N8SA 4JXVA 5EVIC 5KSHA 1YMXA 1KGGA 2DCFA 4MNRA 5KZHA 2ZQ9A 4GDBA 4WM9A 1O07A 3MZDA 1XXMA 2J9OA 5CGSA 1Y54A 1LI9A 4PMAA 2XF3A 5DVAA 3A3FA 3HLFA 3E2LA 2Y2KA 4OQHA 4A5RA 2EX8A 4HBTA 4OPYA 1MY8A 4PPRA 4DXBA 4N9LA 1KDWA 4YINA 3ISGA 3UE0A 2ZQAA 2H5SA 2XR0A 2R9XA 3N4IA 3PBRA 1SDEA 3HUOA 3DWKA 4KQQA 1BLCA 3C7VA 3RXXA 2I72A 1VQQA 3FV7A 3M6HA 1IEMA 5GLAA 4IEDA 4WMCA 1K56D 3ZNTA 4NK3A 1IKGA 5EPHA 1H8YA 4P6BA 3ZG9B 3HLWA 4UAAA 5DTSA 5D3OA 3RJUA 1KE3A 5EECA 5E2EA 1XGJA 2OSUA 2PU4A 1FR1A 4EBPA 5GHYA 3UDIA 2XH9A 4KZ4A 3ZHHA 5F1FA 4GKUA 2V1ZA 2P9VB 4L0LA 4OLGA 3MZEA 2QZ6A 3A3JA 1N4OA 1WYCA 4MBHA 1E3UA 4U0XA 5FQ9A 3ZFZA 1H8ZA 2C6WB 3IXBA 3HREA 1ESUA 1GHPA 5E2GA 4P85A 5FQIA 2H10A 4X6TA 4LV2A 1XA1A 3GQZA 3SH8A 1FCOA 4OOMA 2XDMA 1DJBA 4DDSA 2G2UA 4DDYA 2WGWB 3S1YA 5A93A 4BJPA 4FH4A 3G34A 3GV9A 2GDNA 1H5XA 3FKWA 1FQGA 3PBNA 3QNCA 1XGIA 4OONA 5EOOA 2ZC3B 3S4XA 1M6KA 4N1HA 3VP4A 5EVIA 3IH9A 3V3RA 1MWTA 2ZC6B 3W4OA 3VOZA 2ZM2A 1DJCA 2HPBA 4UA7A 3BEBA 4RA7A 2ZQCA 3V3SA 3PAEA 3IHAA 1JWZA 5GL9A 4E3LA 4WZ5A 1L0FA 4JXGA 1CK3A 4QU3A 3VP1A 4OPZA 3CMZA 2J9PA 4C75A 3IT9A 3UE1A 3UE3A 4RX3A 3GVBA 3NIAA 1E25A 3C4PA 3MKEA 1KGEA 2XEPA 1K38A 2XFSA 4JXSA 1Z6FA 5JYOA 2HP6A 3PBTA 3VFHA 3QHYA 4KZBA 3BFEA 1YLTA 4LCLA 4E3NA 1HVBA 5GLCA 1JTDA 1ONHA 1SCWA 2HDRA 2ZD8A 3A3IA 3OZHA 3Q1FA 4GZBA 4HEFA 1SKFA 2WK0A 3BFGA 3OCLA 2ZMAA 5FQMA 3E2KA 4LENA 2OV5A 3SS3A 3PTEA 5EE8A 4E6XA 1ES5A 5HAPA 4JKTA 4QY6A 4GB7A 3HVFA 3MFDA 3GSGA 2WAEA 2WKEA 3M2JA 3ZVWA 5HW3A 2WZZA 3DW0A 3FWLA 4K0WA 4YFMA 5FA7A 1ESIA 3V5MA 1I2SA 1PW8A 4QY5A 3Q81A 5CRFA 4U0TA 4GN2A 4UA9A 5DTKA 3LCEA 4Q8IA 1XKZA 1BULA 4S2PA 2EXBA 3IQAA 3BLMA 3VP2A 1W5DA 1WYBA 4HBUA 4E3MA 1SDNA 5FAPA 2IWBA 4R3JA 3UDXA 1YQSA 3WS5A 3BLSA 1YLYA 4ZJ1A 2HDQA 4X55A 2WKIA 1XP4A 4KENB 5FATA 3SH7A 4F94A 3GR2A 2Y2NA 1PYYA 4JPMA 4WYYA 5FI2A 4QJGA 1JWVA 1PI4A 4WZ5C 2EFUA 1L2SA 4R3BA 5M18A 3A3DA 4FSFA 2G2WA 3HUMA 3WS1A 3Q7VB 3VSLA 3JYIA 2XD5A 2Y2MA 5CGWA 1HTZA 3OPLA 4ID4A 1LLBA 4KG2A 4E6WA 3PBSA 1XPBA 4LCMA 3P98A 2C5WB 3OC2A 3IWOA 3UN7A 1E4DA 3N6IA 5FQQA 1L0EA 5AQAA 4QD4A 1L0GA 3Q82A 2XGNA 3IF6B 3C4OA 5FSRA 1VM1A 5A90A 4BQMA 2QPNA 3OPHA 3BFDA 4N92A 3IWQA 1KVMA 1MWSA 1ALQA 2B5RA 4RX2A 5HL1A 4WELA 1Q2PA 5G18A 2WGWA 4EUZA 3AGFA 1JVJA 1K4FA 4LV0A 3UNWA 1ZC2A 1ES2A 2EX2A 4RVAA 3OCNA 5AQ9A 4JF5A 3C7UA 3CZDA 1SHVA 4R1GA 5F1GA 4ZJ3A 3SS4A 1NXYA 1JWPA 2WYXA 4KZ8A 3SS5A 3FYZA 2JBFA 1M40A 1BT5A 4BD1A 1K56A 5DF9A 1TEMA 2ZJ9A 2IWCA 1ONGA 4Y0TA 1KDSA 1ZG6A 1BLSA 3HLDA 4JLFA 4OQIA 1S0WA 3WS4A 4DE0A 3OPPA 1GHIA 1YLWA 5A91A 1KGFA 3UDFA 4BL3A 4KQOA 5FQKA 4OP8A 2PU2A 3FKVA 2FFFB 1MKIA 4K0XA 4O7DA 3G2YA 2RL3A 4XXRA 4JXWA 3VOYA 4M3KA 4OLDA 3VFFA 4D2OA 5E2FA 1LHYA 5FI6A 2Q9MA 4S2LA 3QNBA 4KG5A 2V2FF 4IBXA 3PAGA 3ITBA 1AXBA 4S2MA 5HARA 1QMFA 4ZJ2A 3NC8A 4PM9A 1KVLA 4FH2A 1FOFA 4JF4A 2BG1A 3IXHA 2XLNA 5CTNA 5E2HA 5TFQA 5GLDA 1BLHA 2WUQA 2VGJA 2FFYA 2QMIA 2Y4AA 3O88A 4PM8A 3DTMA 1I2WA 4LV3A 4B4ZA 5BOHA 4P0MA 4RYEA 5AQBA 2HDSA 3AGDA 3UPPA 3ZCZA 1O7EA 3UPOA 3G35A 4ZTKA 5A92A 1W8QA 2X71A 4KZ3A 4X68A 3NDGA 5CECA 2E8IA 3VMAA 3DWZA 5EVLA 3CJMA 3NDEA 1K4EA 3WRZA 4DKIA 4ZDXA 2ZM0A 5CEBA 5DTTA 2XK1A 5F83A 2J7VA
chains in the Genus database with same CATH superfamily
3O87A 5CTMA 4DE1A 5CX7A 3LI8A 1FSWA 2VGLS 2WZXA 2M7UA 1PZPA 4DJ3A 4BWIA 1TF1A 5TR7A 2GZAA 2VV6A 3HCYA 4EQIA 4OQGA 1K6SA 4OPQA 1MBLA 1MZUA 5HAQA 4N9KA 1VEUA 1W8YA 2L4RA 1H0MA 4YOFA 4U3TA 3DAVA 4CLCE 2A49A 3BFCA 1TDGA 2HJ9C 1U60A 1NY0A 2MJ6A 2XRNA 2Y2GA 2WAFA 4XT2A 3G4PA 4E3JA 4BENA 1ZTUA 3ICYA 2Y2QA 1S1ZA 2Y2LA 4R4RA 1KE0A 3RH8B 4G3KA 2EWVA 4HIAA 3ZDJA 3IH8A 3KYEA 2Y2JA 5TBMA 1T1BA 3G30A 4MN5A 3MJQA 2Q9NA 4S2IA 3H9WA 4ESPA 4JGPA 4GOGA 2WGVA 1OTIA 3HL9A 4CLCB 4HJ4A 1GSXA 3GRJA 4JF6A 4HJ3A 2RCXA 1YSPA 3E4QA 5EVID 2XROA 4LRXC 3NBLA 5FQJA 1OT9A 4O8GA 4S2NA 1KE4A 4DF6A 1IYSA 3OPRA 2VV8A 3ZNYA 4DRTA 1CF0A 1K57C 2XFTA 3IBRA 5HDDA 5A8BA 3G31A 4ETZA 3ZVTA 2DRWA 5F68A 5GLBA 4DE3A 2V0WA 4Y0UA 1GA9A 4GDNA 4KZ6A 3U2AA 4R4SA 2W0NA 3C38A 1XJ2A 4S2JA 1NLYA 3FPVA 4GCZA 3ZG5A 3NOTC 3O3VA 5FAQA 3NI9A 3UB6A 3LR3A 3EOIA 4PM5A 4E3OA 3FZCA 4OOYA 5CERA 4Q0IA 1NJ4A 4EESA 1LSXA 4OVDA 3JPUA 3LO7A 2JHEA 4UHUA 3G2ZA 3UB8A 2K31A 3HUNA 4R70A 3HLCA 4H6JB 3MSHA 1W79A 4R0QA 1DY6A 5I5LA 3NCKA 3TOIA 1PW1A 1Q2QA 5M1AA 1N9BA 1K54C 1KGGA 2ZBBA 3KX0X 4EERA 1XXMA 2J9OA 3F1OA 3LIEA 3E2LA 2Y2KA 3L7HA 2P04A 4HBTA 4I3IA 1F5MA 4Q0HA 4N9LA 1KDWA 4YINA 4O0PA 2FH5A 2H5SA 1D7EA 3PBRA 1SDEA 3DWKA 3QP8A 4NK3A 2JKTI 1H8YA 2ZL1B 3HLWA 3S7PA 4XT2B 1XGJA 2PU4A 2G7UA 3UDIA 2W3DA 3D3OA 4F3LA 2V1ZA 2PRFA 3K3CA 2QZ6A 1T18A 1WYCA 3ZFZA 1H8ZA 1DP9A 3HREA 1ESUA 3LUQA 5FQIA 4X6TA 4LV2A 1NLZA 1FCOA 4OOMA 2XDMA 4BJPA 4FH4A 3G34A 5TBMB 1VETB 4OONA 5EOOA 4N1HA 3D72A 3IH9A 3BY9A 4CLCC 2HPBA 3BW6A 3V3SA 4WZ5A 5EM0A 3SZTA 1CK3A 3VP1A 3MF0A 4C75A 3UE1A 3UE3A 4RX3A 3GVBA 3LR5A 5JYOA 2XEPA 2XFSA 4JXSA 2B95A 4KZBA 3BFEA 4Y3IA 4D60A 5GLCA 2HDRA 1SCWA 1F9IA 4HEFA 3BFGA 3OCLA 2ZMAA 5FQMA 2GJ3A 3T4TA 5EE8A 3NECA 2Y8HA 3M2JA 1TS6A 3H82B 4Z1WA 3UMEA 3ZVWA 3FWLA 4YFMA 3V5MA 4HY8A 4WL9A 1PW8A 1YAXA 3S7NA 5DTKA 1XKZA 2EXBA 1W5DA 4HBUA 2P08A 2OAP1 5LBRA 4R3JA 2HDQA 4MDZA 2WKIA 4KENB 3TE8A 4F94A 3GR2A 4I5SA 4WYYA 2EFUA 3WS1A 3JYIA 2XD5A 2Y2MA 4ID4A 4E6WA 4PHTA 3UN7A 4EUVA 1W63M 2ZOHA 4BQMA 2QPNA 3OPHA 2NUPC 3IWQA 1ALQA 4EXOA 5F6AA 4EUZA 3DTIA 1YPRA 5G4ZA 2EX2A 1SHVA 4R1GA 5F1GA 4ZJ3A 4HQAA 3SS5A 3F1OB 3F1NA 1ZG6A 3QP4A 1GHIA 5A91A 3MS6A 3IX8A 4WN5A 3BJNA 5FEFA 2BTFP 4K0XA 3G2YA 4XXRA 1S4SA 4M3KA 4OLDA 3PHYA 1LHYA 2BASA 2Q9MA 3LR0A 3ITBA 4S2MA 3IS2B 4JF4A 1FOFA 2HV1A 2XLNA 5GLDA 2VGJA 2WUQA 5J3WA 3DTMA 4B4ZA 3LI9A 3AGDA 3B47A 2X71A 2PHYA 5CECA 2E8IA 3UB5P 2Z6CA 3VMAA 2VA0A 1OJGA 1K4EA 3WRZA 2ZM0A 5CEBA 3CAXA 2XK1A 5I94A 4FTXA 2OAQ1 4R23A 4OKPA 2ZQ8A 3BRMA 3IXGA 3PBQA 5AVFA 1TDLA 2XQZA 3MBZA 3VSKA 2GX5A 4L9EA 1CI8A 2QJ5A 3PYPA 3G32A 3O5YA 5KIZA 5DF7A 3N7WA 3BECA 1STZA 5EUAA 3E98A 3EWKA 5HZHA 3TG9A 3MXSA 4II7A 3ZYTA 3IF6A 2IWDA 1V9ZA 2EFXA 4ETXA 1GCEA 1OMEA 4CLCD 4DMZA 4ZRRA 2VX8A 3IHBA 4KQRA 3K2NA 2P9VA 3UPNA 1GSWA 4PKYG 3CI6A 3TW8A 1PI5A 4WMCD 1TS8A 1G6AA 3LEZA 4XUZA 4JBFA 2W3EA 3U4LP 3RTYA 3OLOA 2ZMFA 4WZ4A 2ZQ7A 1ZG4A 1P0ZA 4MEZA 3S22A 3HLEA 1GA0A 3RXWA 5JYPA 1CEGA 4MN6A 3A0RA 1BLPA 4EBLA 2VLGA 1E3UD 3F1PA 3EGDC 3VE4A 1DP6A 3AGEA 1RGZA 2KLIA 3ZG8B 2VGKA 4EEUA 3A3EA 2W3FA 3EEHA 4S2OA 2V1BA 5HPFA 3W4QA 4WEJA 1J3WA 1AWIA 1S4RA 5AQ7A 4GHIB 4BBVA 4EBNA 3QP1A 1OTEA 4GS9B 1PRQA 3CUEA 4PM6A 1QMEA 1T1AA 2R9WA 2ACGA 5DF8A 3BYDA 4KG6A 3EQUA 2H0TA 3O86A 1N9OA 4X56A 1XA7A 4Q0JA 3BFFA 1ZKJA 3V50A 4QB8A 2L0WA 4Y7PA 4IVIA 1FILA 3CG5A 3KYQA 1ES3A 3QP6A 4KZ7A 1NWZA 3TSGA 2OLVA 2PBYA 3BWLA 5FL3A 4EU0A 4C6YA 2E8JA 4WBGA 5HDCA 3F1NB 4LLOB 3HJKA 1LL9A 3IBJA 3KSGA 1CEFA 2JKFA 1Z09A 4KUKA 3IX4A 2UWXA 1TD5A 4FUWA 4OOLA 4L9GA 3Q7VA 1BSGA 1OJ5A 2PT7A 3LY4A 5CEDA 2Y55A 2QJ7A 1IFQA 2V8CA 4WEKA 3WS0A 1IKIA 3ZG7B 1FCNA 1BTLA 3MQOA 4JGRA 1LL8A 1K6RA 2K2NA 4GJ4A 3C8CA 1RCJA 1YLJA 5GHZA 5F82A 1YT4A 2P74A 3GTCA 3W4PA 2X02A 4IVKA 4C3QA 1PZOA 2WKHA 2XD1A 4LV1A 2ZC7A 3MXRA 3WS2A 4Y0OA 2HP9A 4R6LA 3VP3A 2J8YA 3MZFA 2XA7S 4MNRA 1O07A 1XFQA 3CLOA 2Z6DA 3HLFA 2OWJA 2H28A 3R7WA 2EX8A 4OPYA 3UE6A 3HUOA 4LRYC 3RXXA 1VQQA 5GLAA 1XFNA 5HD3A 4UAAA 5D3OA 3RJUA 2OSUA 1S66L 3BQAA 5MC7A 4I3JA 5DJTA 3CWFA 4GKUA 2P9VB 3MZEA 3A3JA 1N4OA 5FQ9A 4LRZE 5HPIA 1D06A 3C2WA 3T12B 4K08A 2GDNA 1FQGA 3PBNA 3QNCA 1Y4OA 3T4JA 5EVIA 2ZC6B 2V9AA 4IUKA 3A0SA 2ZM2A 2WKPA 5L07A 1DJCA 4RA7A 4NG2A 4E3LA 3IHAA 5GL9A 4WUJA 4QU3A 4OPZA 2J9PA 3IT9A 5J4EA 3NULA 4HP9A 3PXPA 1KGEA 1Z6FA 4NXFA 3VFHA 4EEPA 2J3TC 1JTDA 4GZBA 1FIKA 4P6ZS 2Y79A 4LFUA 4E6XA 4QY6A 4GB7A 3HVFA 2JKRM 2B02A 5TJJA 2WZZA 4K0WA 5FA7A 3E4PA 4ARZA 3BLMA 4E3MA 1SDNA 2ZMVA 2L1MA 3D9YA 1YQSA 4ZJ1A 1YLYA 4X55A 1KOUA 5FATA 5FI2A 1PYYA 4QJGA 1JWVA 1P9WA 1PI4A 4R3BA 5M18A 3A3DA 2G2WA 4UQIS 1H3QA 3Q7VB 4UEYA 4Y17A 1HTZA 1VEUB 4LCMA 2C5WB 3OC2A 2VEAA 3NJAA 5FQQA 1L0EA 3MXQA 1G5UA 5AQAA 3MR0A 4QD4A 1YSQA 2PAVP 3C4OA 1D1JA 4N92A 4R38A 5HL1A 4RX2A 4WELA 1Q2PA 5FEGA 2WGWA 3AGFA 3NOPC 4LV0A 3DBAA 1ES2A 1OPXA 1A0KA 1W63Q 5AQ9A 1F2KA 4JF5A 4Y2FA 1OTDA 2INWA 1JWPA 1UGUA 2WYXA 4KZ8A 1H8MA 3FYZA 2JBFA 1M40A 1BT5A 1OTAA 1TEMA 2IWCA 2V1AA 2OOLA 4HHDA 3HLDA 3WS4A 4OQIA 1S0WA 4DE0A 3R7WB 1IOUA 4WF0A 1KGFA 2O9CA 4OP8A 3FKVA 2A24A 3VOYA 4D2OA 5E2FA 2WKQA 1TS7A 4KG5A 2V2FF 1AXBA 5HARA 4IHQA 1KVLA 4FH2A 3IXHA 3QP2A 2Y4AA 2KOIA 1I2WA 4P0MA 3UPPA 1O7EA 3UPOA 4KZ3A 3VV4A 5DKLA 3CJMA 4DKIA 5F83A 1BZAA 1XX2A 2QWSA 1YM1A 2Y2OA 2DNSA 4DN0A 3C5AA 2CC1A 4HESA 2W3GA 4BBUA 4ZBEA 3V39A 4NETA 3TRCA 3NY4A 3PBOA 1YLPA 3UY6A 3ZG0A 1RGYA 3CITA 1C3BA 4BBTA 1VHMA 3D4FA 1VB6A 3WRTA 5EOEA 1NZOA 4MLLA 5CGXA 5HX9A 1IELA 3B3XA 4NEED 4MBKA 1PWCA 5CHMA 2PR6A 5FDSA 4NXBA 1S1YA 4CPKA 2VGLM 3HLGA 3UO9A 3MKFA 1LI0A 4EQ1A 5KMWA 1K57A 2J3TD 1MWRA 2WGIA 1W7FA 2XSSA 3ITAA 3S7QA 2W1TA 3Q07A 1FCMA 4Y5FA 1SKOA 2PR5A 1K25A 1TVFA 4FD8A 3SOIA 1XJ3A 1G28A 1PIOA 2P7JA 2KDKA 5HD5A 2VZWA 2ZC5B 2HP5A 4ME4A 5HWTA 3H7WA 4CJNA 3E4OA 1FSYA 3W8KA 2ZC4B 4LGWA 1NRJA 5DJUA 3IF5A 4B88A 2NUTC 5HFOA 2Y2PA 4F3LB 2A3UA 1MWUA 1EI5A 3B33A 1K54A 2Y91A 4BD0A 5M19A 2JC7A 4GLQA 4LPZA 1CQAA 3HLBA 3I7JA 2JKRI 4NXGA 5J8XA 2JKGA 3SH9A 2HZ5A 4OH0A 4KZ9A 2O0YA 4BL2A 1CJFA 3GMWA 1DRMA 1S67L 2HDUA 1P9RA 4PKYA 3G6OA 5CHJA 1HZOA 2ZM8A 4IJGA 4S2KA 2J3WA 2V20A 2VKSA 2CMNA 3LIAA 1K55A 4E04A 4I39A 4QHCA 3W2ZA 3LY3A 4UA6A 2W1RA 2HGVA 4S2NC 3HBRA 3OBFA 5TGFA 1PWGA 2LB9A 5HDSA 3WWXA 3IWIA 3P09A 1UWPX 2JCHA 1BUEA 1YLZA 3N8SA 1OTBA 5EVIC 5KSHA 4NKPA 2DCFA 2PD8A 2HJEA 4WM9A 3MZDA 3KO6A 5CGSA 1LI9A 4PMAA 2XF3A 4M4XA 3KSHA 1N9LA 3KYZA 4HH2A 2EWWA 4OQHA 4A5RA 3DTEA 4CLCA 1MY8A 4DXBA 2DMWA 2ZQAA 2R9XA 4KQQA 1BLCA 3M6HA 1G6OA 4IEDA 4WMCA 1K56D 1IKGA 4GW9A 1PFLA 5EPHA 4P6BA 3ZG9B 5DTSA 3T4OA 5EECA 5E2EA 1FR1A 4KZ4A 5F1FA 4L0LA 1E3UA 4U0XA 1LSVA 3IXBA 5HL6A 1GHPA 4NXEA 4P85A 2H10A 1XA1A 5A93A 3S1YA 3T4SA 3GV9A 3FKWA 3UB7A 3S4XA 3VP4A 1SKOB 1MWTA 4JGOA 3VOZA 3BEBA 3PAEA 1JWZA 3FG8A 4JXGA 2O99A 3CMZA 3C30A 3C4PA 5HWWA 4H6JA 3PBTA 3QHYA 1ONHA 2ZD8A 3A3IA 5AVEA 3Q1FA 2WK0A 3P01A 3E2KA 3EGXC 2OV5A 3PTEA 1L3LA 4EETB 3JVUA 4JKTA 2GNXA 3CPTA 3MFDA 2WKEA 3DTKA 4HI4A 3S7OA 3DW0A 3K3DA 3T1RA 1I2SA 4QY5A 3Q81A 4U0TA 3LCEA 4Q8IA 4S2PA 3LEQA 3VP2A 2IWBA 3BLSA 1XJ6A 1XP4A 4X25A 4QWOA 4WZ5C 1F98A 2LB5A 2FZ0A 3HUMA 4FSFA 2ZL1A 1XPBA 3IWOA 4YWZA 5J7EA 5DFXA 1L0GA 3T4KA 3IF6B 3LIDA 1K0KA 1VM1A 5A90A 1MWSA 2B5RA 2PYRA 5G4YA 5G18A 1K4FA 3UNWA 3MFXA 3OCNA 1VETA 3C7UA 2VV7A 3SS4A 1NXYA 4I38A 4BD1A 5DF9A 2ZJ9A 1ONGA 4Y0TA 4JLFA 4X1LA 5FQKA 2PU2A 2FFFB 1MKIA 4L9FA 2RL3A 4JXWA 4HOIA 4KUOA 3QNBA 4IBXA 3F1PB 3LICA 4ZJ2A 3NC8A 4PM9A 5CTNA 5E2HA 5TFQA 3ULFA 1BLHA 2FFYA 2QMIA 2W27A 4RYEA 5HSQA 3ZCZA 1T19A 3G35A 4ZTKA 4X68A 3NDGA 3H82A 4EW7A 5DTTA 2V0UA 3VOLA 5CHUA 2QKPA 2JE5A 4B4XA 4X1MA 2EX9A 2KX6A 3N8LA 1G68A 2OLUA 4BMWA 3M6BA 5FASA 5IHVA 4H8RA 2H0YA 5AJGA 2AVXA 1ES4A 2YKFA 3B42A 1XJ4A 1IYQA 2WADA 4HNBA 2A2LA 1IYPA 2QHKA 3N8RA 3Q7ZA 2R78A 4ZAMA 4WLAA 1ACFA 1YKDA 5L2FA 4E3KA 1NZUA 4DJ2A 2V8FA 4K91A 1N9NA 4KZAA 1LL5A 4GD6A 3CPTB 1EROA 4BLMA 1NYYA 1HD8A 2O9BA 4EWFA 4XUXA 3BY8A 4MBFA 2M1CA 5GHXA 3L9KA 3PR6A 1BYWA 1UWNX 1EWZA 5KSCA 2Y59A 1OT6A 1JTGA 1ERQA 1L0DA 3IS2A 4IBRA 1MPLA 4GD8A 5IS1A 2EX6A 1K55C 2Y2HA 4DE2A 1SZVA 1PWDA 2ZOIA 4DXCA 1IYOA 3IF6C 2Z2LB 2PBDP 4OPRA 3LYXA 5CXWA 1LSWA 2QYBA 1ERMA 3GDIA 2W3HA 3ZQ5A 4X69A 1DJAA 1NYMA 5DKKA 3IX3A 3CHWP 1RP5A 4N1XA 1WA9A 3RFBA 3M2KA 4FCFA 1I5QA 3EQVA 1S6RA 4OQ0A 4E3IA 5FI7A 3ZGAB 4PM7A 3LR4A 2PYPA 1YMSA 2ZLYA 4X53A 3MMHA 4Z9QA 5HAIA 3P7NA 5E43A 3FPWA 5FDHA 3R4KA 3LFVA 5FAOA 2BLSA 3IXDA 2EXAA 4MCWA 5EVIB 5IU1A 1X0OA 2X01A 2ZQDA 3VP0A 1WE4A 1FR6A 4EV4A 4HH3A 3EEAA 4P87A 4GNUA 3OOVA 4MN7A 2Z2MB 4OP5A 3CUEC 1T1CA 1GHMA 1MXOA 1J9MA 4KZ5A 4Y13A 1CI9A 3BM6A 5U47A 1NRFA 2I9VA 4I3AA 2JN7A 2Y2IA 4JXVA 4HJ6A 1YMXA 1EW0A 5KZHA 3LGOA 2ZQ9A 4GDBA 3JVVA 1Y54A 1V9YA 5DVAA 1HLUP 3A3FA 1ZHHB 2YKHA 3E0YA 4ARZB 4PPRA 3ISGA 4G3VA 3UE0A 2XR0A 4GHIA 3N4IA 3C7VA 5EVEA 4G3WA 2I72A 3FV7A 4GS9A 2D01A 1IEMA 5F69A 3LIFA 3FC7A 3KSIA 2IA2A 3ZNTA 5F5YA 1KE3A 3TJZC 4EBPA 5GHYA 2XH9A 3ZHHA 4OLGA 2EA9A 4MBHA 1MKMA 2C6WB 3GECA 2XA7M 5EM1A 5HWVA 5E2GA 3GQZA 3SH8A 4DDSA 1DJBA 2G2UA 4DDYA 2WGWB 1H5XA 2UV0E 1XGIA 2ZC3B 2M7VA 1M6KA 5L10A 3V3RA 3W4OA 4Y15A 4UA7A 2ZQCA 2PD7A 1L0FA 2A24B 3NIAA 1E25A 4O01A 3MKEA 1K38A 2HP6A 4LCLA 1YLTA 4E3NA 1HVBA 3OZHA 1JNUA 5EV0A 1SKFA 2HF6A 2O9AA 1LT0A 4LENA 1DP8A 3SS3A 3SW1A 1P97A 1ES5A 2OWHA 5HAPA 3GSGA 2D02A 2WAEA 5HW3A 1GSVA 3V67A 1ESIA 3T1QB 5CRFA 4GN2A 4UA9A 5K5BA 5EFWA 3A0VA 1BULA 3IQAA 1ODVA 3T4QA 1WYBA 4JGQA 3KSFA 5FAPA 3MQQA 3NHQA 3UDXA 2VK3A 3WS5A 2B18A 2WKRA 3T1SA 3SH7A 2Y2NA 4JPMA 1L2SA 3VSLA 3VE3A 5CGWA 3OPLA 1LLBA 4KG2A 2VJWA 3PBSA 5DFYA 3QP5A 3P98A 3NOUC 1E4DA 3N6IA 3LIBA 5L09A 3UMDA 3Q82A 2XGNA 4P6ZM 1Y28A 5FSRA 3T4LA 3BFDA 4YNRA 1KVMA 3T1XA 1JVJA 1ZC2A 4RVAA 3CZDA 3UB9A 5C5KA 4IUHA 1MC0A 4AFIA 4PAUA 1K56A 4B93A 1KDSA 1BLSA 3OPPA 4RQ9A 1YLWA 2JKTM 4QPRA 1TS0A 3UDFA 4KQDA 4BL3A 4R3AA 4KQOA 5L8MA 4O7DA 2K7SA 4UQIM 2W1TB 3VFFA 5IT5A 2Q0OA 5FI6A 4S2LA 3BQ8A 3PAGA 1PNEA 4MMNA 1QMFA 4HP4A 2BG1A 4PM8A 3O88A 4LV3A 3MQ0A 5BOHA 5AQBA 2HDSA 4FOFA 3H7WB 4B9OA 5A92A 1W8QA 2PDRA 4CQHA 3HJIA 3T50A 3DWZA 5EVLA 3NDEA 2J80A 4ZDXA 2J7VA
chains in the Genus database with same CATH topology
3O87A 5CTMA 1BZAA 4DE1A 5I94A 1XX2A 5CHUA 1FSWA 1YM1A 4R23A 4OKPA 2ZQ8A 2Y2OA 2WZXA 3BRMA 3IXGA 3PBQA 2JE5A 2DNSA 4B4XA 1PZPA 5TR7A 1TDLA 2EX9A 3C5AA 2XQZA 2CC1A 3MBZA 4HESA 3VSKA 4EQIA 4OQGA 1K6SA 3N8LA 4ZBEA 4OPQA 1G68A 1MBLA 2OLUA 3V39A 1CI8A 3M6BA 4NETA 5FASA 5HAQA 5IHVA 4H8RA 3G32A 2H0YA 3NY4A 4N9KA 5DF7A 3N7WA 1W8YA 3BECA 1YLPA 3PBOA 5EUAA 1ES4A 3UY6A 3ZG0A 1RGYA 1C3BA 3TG9A 3MXSA 3D4FA 3WRTA 1IYQA 4U3TA 5EOEA 1NZOA 2WADA 2A49A 3IF6A 4MLLA 5M19A 2IWDA 1IYPA 3N8RA 5CGXA 3Q7ZA 3BFCA 1TDGA 2EFXA 4ZAMA 1U60A 1NY0A 5HX9A 1GCEA 1IELA 3B3XA 1OMEA 2Y2GA 5L2FA 4MBKA 2WAFA 3G4PA 4E3KA 4E3JA 1PWCA 5CHMA 1NZUA 4BENA 3IHBA 4K91A 4KQRA 2Y2QA 4KZAA 1LL5A 4GD6A 2P9VA 3UPNA 1EROA 4BLMA 1NYYA 1HD8A 4CPKA 1PI5A 2Y2LA 4R4RA 4EWFA 1KE0A 4WMCD 3HLGA 1G6AA 3LEZA 4XUZA 4JBFA 4XUXA 3UO9A 3MKFA 1LI0A 5KMWA 1K57A 3ZDJA 1MWRA 4WZ4A 2WGIA 2ZQ7A 1W7FA 1ZG4A 3IH8A 3ITAA 4MBFA 2Y2JA 4MEZA 3S22A 3HLEA 1GA0A 3RXWA 5GHXA 3G30A 5JYPA 1CEGA 3Q07A 1FCMA 5KSCA 1EWZA 1BLPA 4EBLA 1E3UD 1K25A 2Q9NA 4S2IA 2Y59A 1TVFA 1JTGA 1ERQA 3AGEA 4FD8A 1L0DA 1RGZA 4IBRA 1MPLA 3ZG8B 2VGKA 4GD8A 4GOGA 3SOIA 1PIOA 3A3EA 2WGVA 2EX6A 1K55C 3HL9A 2Y2HA 4S2OA 4DE2A 1PWDA 2ZC5B 3GRJA 4WEJA 4JF6A 3W4QA 4DXCA 1IYOA 2HP5A 3IF6C 2Z2LB 2RCXA 5AQ7A 4CJNA 4EBNA 4OPRA 5CXWA 5EVID 4PM6A 1QMEA 1FSYA 2R9WA 3W8KA 5DF8A 2ZC4B 3BYDA 4KG6A 3NBLA 5FQJA 1ERMA 3EQUA 2H0TA 3O86A 4S2NA 3IF5A 4X56A 1KE4A 1XA7A 4B88A 3BFFA 1ZKJA 3V50A 4DF6A 5HFOA 4QB8A 2Y2PA 4X69A 1DJAA 1NYMA 4Y7PA 1IYSA 4IVIA 3CG5A 1RP5A 1ES3A 3OPRA 3ZNYA 2A3UA 1MWUA 1EI5A 4KZ7A 4N1XA 4DRTA 3TSGA 1K54A 3M2KA 1K57C 2XFTA 2OLVA 2PBYA 2Y91A 4FCFA 3G31A 1I5QA 3EQVA 1S6RA 4OQ0A 2DRWA 5GLBA 5FI7A 3ZVTA 4BD0A 2JC7A 4C6YA 4DE3A 4E3IA 3ZGAB 4Y0UA 4WBGA 4PM7A 1GA9A 4GDNA 1YMSA 2ZLYA 4KZ6A 4R4SA 4X53A 1LL9A 4Z9QA 5HAIA 4S2JA 3HLBA 5E43A 3ZG5A 3I7JA 3O3VA 5FAQA 3NI9A 5FDHA 5J8XA 3SH9A 4OH0A 5FAOA 2BLSA 3IXDA 1CEFA 4KZ9A 4PM5A 2EXAA 5EVIB 4BL2A 2X01A 2UWXA 4E3OA 3FZCA 4OOYA 3GMWA 2ZQDA 4OOLA 5CERA 3VP0A 1NJ4A 3Q7VA 1BSGA 1WE4A 4OVDA 2HDUA 1FR6A 4EV4A 5CHJA 1HZOA 3LY4A 2ZM8A 4P87A 5CEDA 3LO7A 2Y55A 4GNUA 4S2KA 2Z2MB 4UHUA 4OP5A 2V20A 4WEKA 3WS0A 1IKIA 1K55A 3G2ZA 3ZG7B 1GHMA 1MXOA 1J9MA 1FCNA 3HUNA 4KZ5A 4QHCA 1BTLA 3LY3A 4UA6A 3HLCA 4S2NC 1K6RA 3HBRA 1CI9A 3BM6A 1RCJA 1YLJA 5GHZA 1W79A 4R0QA 5F82A 1PWGA 5TGFA 1YT4A 2P74A 5U47A 1DY6A 3GTCA 3W4PA 2X02A 3NCKA 4IVKA 3WWXA 4C3QA 1PZOA 2WKHA 3IWIA 2XD1A 3P09A 2ZC7A 4LV1A 1NRFA 3TOIA 1PW1A 3MXRA 3WS2A 2JCHA 4Y0OA 1Q2QA 2HP9A 5M1AA 1BUEA 3VP3A 2J8YA 1N9BA 1YLZA 2Y2IA 3MZFA 1K54C 3N8SA 4JXVA 5EVIC 5KSHA 1YMXA 1KGGA 2DCFA 4MNRA 5KZHA 2ZQ9A 4GDBA 4WM9A 1O07A 3MZDA 1XXMA 2J9OA 5CGSA 1Y54A 1LI9A 4PMAA 2XF3A 5DVAA 3A3FA 3HLFA 3E2LA 2Y2KA 4OQHA 4A5RA 2EX8A 4HBTA 4OPYA 1MY8A 4PPRA 4DXBA 4N9LA 1KDWA 4YINA 3ISGA 3UE0A 2ZQAA 2H5SA 2XR0A 2R9XA 3N4IA 3PBRA 1SDEA 3HUOA 3DWKA 4KQQA 1BLCA 3C7VA 3RXXA 2I72A 1VQQA 3FV7A 3M6HA 1IEMA 5GLAA 4IEDA 4WMCA 1K56D 3ZNTA 4NK3A 1IKGA 5EPHA 1H8YA 4P6BA 3ZG9B 3HLWA 4UAAA 5DTSA 5D3OA 3RJUA 1KE3A 5EECA 5E2EA 1XGJA 2OSUA 2PU4A 1FR1A 4EBPA 5GHYA 3UDIA 2XH9A 4KZ4A 3ZHHA 5F1FA 4GKUA 2V1ZA 2P9VB 4L0LA 4OLGA 3MZEA 2QZ6A 3A3JA 1N4OA 1WYCA 4MBHA 1E3UA 4U0XA 5FQ9A 3ZFZA 1H8ZA 2C6WB 3IXBA 3HREA 1ESUA 1GHPA 5E2GA 4P85A 5FQIA 2H10A 4X6TA 4LV2A 1XA1A 3GQZA 3SH8A 1FCOA 4OOMA 2XDMA 1DJBA 4DDSA 2G2UA 4DDYA 2WGWB 3S1YA 5A93A 4BJPA 4FH4A 3G34A 3GV9A 2GDNA 1H5XA 3FKWA 1FQGA 3PBNA 3QNCA 1XGIA 4OONA 5EOOA 2ZC3B 3S4XA 1M6KA 4N1HA 3VP4A 5EVIA 3IH9A 3V3RA 1MWTA 2ZC6B 3W4OA 3VOZA 2ZM2A 1DJCA 2HPBA 4UA7A 3BEBA 4RA7A 2ZQCA 3V3SA 3PAEA 3IHAA 1JWZA 5GL9A 4E3LA 4WZ5A 1L0FA 4JXGA 1CK3A 4QU3A 3VP1A 4OPZA 3CMZA 2J9PA 4C75A 3IT9A 3UE1A 3UE3A 4RX3A 3GVBA 3NIAA 1E25A 3C4PA 3MKEA 1KGEA 2XEPA 1K38A 2XFSA 4JXSA 1Z6FA 5JYOA 2HP6A 3PBTA 3VFHA 3QHYA 4KZBA 3BFEA 1YLTA 4LCLA 4E3NA 1HVBA 5GLCA 1JTDA 1ONHA 1SCWA 2HDRA 2ZD8A 3A3IA 3OZHA 3Q1FA 4GZBA 4HEFA 1SKFA 2WK0A 3BFGA 3OCLA 2ZMAA 5FQMA 3E2KA 4LENA 2OV5A 3SS3A 3PTEA 5EE8A 4E6XA 1ES5A 5HAPA 4JKTA 4QY6A 4GB7A 3HVFA 3MFDA 3GSGA 2WAEA 2WKEA 3M2JA 3ZVWA 5HW3A 2WZZA 3DW0A 3FWLA 4K0WA 4YFMA 5FA7A 1ESIA 3V5MA 1I2SA 1PW8A 4QY5A 3Q81A 5CRFA 4U0TA 4GN2A 4UA9A 5DTKA 3LCEA 4Q8IA 1XKZA 1BULA 4S2PA 2EXBA 3IQAA 3BLMA 3VP2A 1W5DA 1WYBA 4HBUA 4E3MA 1SDNA 5FAPA 2IWBA 4R3JA 3UDXA 1YQSA 3WS5A 3BLSA 1YLYA 4ZJ1A 2HDQA 4X55A 2WKIA 1XP4A 4KENB 5FATA 3SH7A 4F94A 3GR2A 2Y2NA 1PYYA 4JPMA 4WYYA 5FI2A 4QJGA 1JWVA 1PI4A 4WZ5C 2EFUA 1L2SA 4R3BA 5M18A 3A3DA 4FSFA 2G2WA 3HUMA 3WS1A 3Q7VB 3VSLA 3JYIA 2XD5A 2Y2MA 5CGWA 1HTZA 3OPLA 4ID4A 1LLBA 4KG2A 4E6WA 3PBSA 1XPBA 4LCMA 3P98A 2C5WB 3OC2A 3IWOA 3UN7A 1E4DA 3N6IA 5FQQA 1L0EA 5AQAA 4QD4A 1L0GA 3Q82A 2XGNA 3IF6B 3C4OA 5FSRA 1VM1A 5A90A 4BQMA 2QPNA 3OPHA 3BFDA 4N92A 3IWQA 1KVMA 1MWSA 1ALQA 2B5RA 4RX2A 5HL1A 4WELA 1Q2PA 5G18A 2WGWA 4EUZA 3AGFA 1JVJA 1K4FA 4LV0A 3UNWA 1ZC2A 1ES2A 2EX2A 4RVAA 3OCNA 5AQ9A 4JF5A 3C7UA 3CZDA 1SHVA 4R1GA 5F1GA 4ZJ3A 3SS4A 1NXYA 1JWPA 2WYXA 4KZ8A 3SS5A 3FYZA 2JBFA 1M40A 1BT5A 4BD1A 1K56A 5DF9A 1TEMA 2ZJ9A 2IWCA 1ONGA 4Y0TA 1KDSA 1ZG6A 1BLSA 3HLDA 4JLFA 4OQIA 1S0WA 3WS4A 4DE0A 3OPPA 1GHIA 1YLWA 5A91A 1KGFA 3UDFA 4BL3A 4KQOA 5FQKA 4OP8A 2PU2A 3FKVA 2FFFB 1MKIA 4K0XA 4O7DA 3G2YA 2RL3A 4XXRA 4JXWA 3VOYA 4M3KA 4OLDA 3VFFA 4D2OA 5E2FA 1LHYA 5FI6A 2Q9MA 4S2LA 3QNBA 4KG5A 2V2FF 4IBXA 3PAGA 3ITBA 1AXBA 4S2MA 5HARA 1QMFA 4ZJ2A 3NC8A 4PM9A 1KVLA 4FH2A 1FOFA 4JF4A 2BG1A 3IXHA 2XLNA 5CTNA 5E2HA 5TFQA 5GLDA 1BLHA 2WUQA 2VGJA 2FFYA 2QMIA 2Y4AA 3O88A 4PM8A 3DTMA 1I2WA 4LV3A 4B4ZA 5BOHA 4P0MA 4RYEA 5AQBA 2HDSA 3AGDA 3UPPA 3ZCZA 1O7EA 3UPOA 3G35A 4ZTKA 5A92A 1W8QA 2X71A 4KZ3A 4X68A 3NDGA 5CECA 2E8IA 3VMAA 3DWZA 5EVLA 3CJMA 3NDEA 1K4EA 3WRZA 4DKIA 4ZDXA 2ZM0A 5CEBA 5DTTA 2XK1A 5F83A 2J7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O87 A;  5CTM A;  1BZA A;  4DE1 A;  5I94 A;  1XX2 A;  5CHU A;  1FSW A;  1YM1 A;  4R23 A;  4OKP A;  2ZQ8 A;  2Y2O A;  2WZX A;  3BRM A;  3IXG A;  3PBQ A;  2JE5 A;  2DNS A;  4B4X A;  1PZP A;  5TR7 A;  1TDL A;  2EX9 A;  3C5A A;  2XQZ A;  2CC1 A;  3MBZ A;  4HES A;  3VSK A;  4EQI A;  4OQG A;  1K6S A;  3N8L A;  4ZBE A;  4OPQ A;  1G68 A;  1MBL A;  2OLU A;  3V39 A;  1CI8 A;  3M6B A;  4NET A;  5FAS A;  5HAQ A;  5IHV A;  4H8R A;  3G32 A;  2H0Y A;  3NY4 A;  4N9K A;  5DF7 A;  3N7W A;  1W8Y A;  3BEC A;  1YLP A;  3PBO A;  5EUA A;  1ES4 A;  3UY6 A;  3ZG0 A;  1RGY A;  1C3B A;  3TG9 A;  3MXS A;  3D4F A;  3WRT A;  1IYQ A;  4U3T A;  5EOE A;  1NZO A;  2WAD A;  2A49 A;  3IF6 A;  4MLL A;  5M19 A;  2IWD A;  1IYP A;  3N8R A;  5CGX A;  3Q7Z A;  3BFC A;  1TDG A;  2EFX A;  4ZAM A;  1U60 A;  1NY0 A;  5HX9 A;  1GCE A;  1IEL A;  3B3X A;  1OME A;  2Y2G A;  5L2F A;  4MBK A;  2WAF A;  3G4P A;  4E3K A;  4E3J A;  1PWC A;  5CHM A;  1NZU A;  4BEN A;  3IHB A;  4K91 A;  4KQR A;  2Y2Q A;  4KZA A;  1LL5 A;  4GD6 A;  2P9V A;  3UPN A;  1ERO A;  4BLM A;  1NYY A;  1HD8 A;  4CPK A;  1PI5 A;  2Y2L A;  4R4R A;  4EWF A;  1KE0 A;  4WMC D;  3HLG A;  1G6A A;  3LEZ A;  4XUZ A;  4JBF A;  4XUX A;  3UO9 A;  3MKF A;  1LI0 A;  5KMW A;  1K57 A;  3ZDJ A;  1MWR A;  4WZ4 A;  2WGI A;  2ZQ7 A;  1W7F A;  1ZG4 A;  3IH8 A;  3ITA A;  4MBF A;  2Y2J A;  4MEZ A;  3S22 A;  3HLE A;  1GA0 A;  3RXW A;  5GHX A;  3G30 A;  5JYP A;  1CEG A;  3Q07 A;  1FCM A;  5KSC A;  1EWZ A;  1BLP A;  4EBL A;  1E3U D;  1K25 A;  2Q9N A;  4S2I A;  2Y59 A;  1TVF A;  1JTG A;  1ERQ A;  3AGE A;  4FD8 A;  1L0D A;  1RGZ A;  4IBR A;  1MPL A;  3ZG8 B;  2VGK A;  4GD8 A;  4GOG A;  3SOI A;  1PIO A;  3A3E A;  2WGV A;  2EX6 A;  1K55 C;  3HL9 A;  2Y2H A;  4S2O A;  4DE2 A;  1PWD A;  2ZC5 B;  3GRJ A;  4WEJ A;  4JF6 A;  3W4Q A;  4DXC A;  1IYO A;  2HP5 A;  3IF6 C;  2Z2L B;  2RCX A;  5AQ7 A;  4CJN A;  4EBN A;  4OPR A;  5CXW A;  5EVI D;  4PM6 A;  1QME A;  1FSY A;  2R9W A;  3W8K A;  5DF8 A;  2ZC4 B;  3BYD A;  4KG6 A;  3NBL A;  5FQJ A;  1ERM A;  3EQU A;  2H0T A;  3O86 A;  4S2N A;  3IF5 A;  4X56 A;  1KE4 A;  1XA7 A;  4B88 A;  3BFF A;  1ZKJ A;  3V50 A;  4DF6 A;  5HFO A;  4QB8 A;  2Y2P A;  4X69 A;  1DJA A;  1NYM A;  4Y7P A;  1IYS A;  4IVI A;  3CG5 A;  1RP5 A;  1ES3 A;  3OPR A;  3ZNY A;  2A3U A;  1MWU A;  1EI5 A;  4KZ7 A;  4N1X A;  4DRT A;  3TSG A;  1K54 A;  3M2K A;  1K57 C;  2XFT A;  2OLV A;  2PBY A;  2Y91 A;  4FCF A;  3G31 A;  1I5Q A;  3EQV A;  1S6R A;  4OQ0 A;  2DRW A;  5GLB A;  5FI7 A;  3ZVT A;  4BD0 A;  2JC7 A;  4C6Y A;  4DE3 A;  4E3I A;  3ZGA B;  4Y0U A;  4WBG A;  4PM7 A;  1GA9 A;  4GDN A;  1YMS A;  2ZLY A;  4KZ6 A;  4R4S A;  4X53 A;  1LL9 A;  4Z9Q A;  5HAI A;  4S2J A;  3HLB A;  5E43 A;  3ZG5 A;  3I7J A;  3O3V A;  5FAQ A;  3NI9 A;  5FDH A;  5J8X A;  3SH9 A;  4OH0 A;  5FAO A;  2BLS A;  3IXD A;  1CEF A;  4KZ9 A;  4PM5 A;  2EXA A;  5EVI B;  4BL2 A;  2X01 A;  2UWX A;  4E3O A;  3FZC A;  4OOY A;  3GMW A;  2ZQD A;  4OOL A;  5CER A;  3VP0 A;  1NJ4 A;  3Q7V A;  1BSG A;  1WE4 A;  4OVD A;  2HDU A;  1FR6 A;  4EV4 A;  5CHJ A;  1HZO A;  3LY4 A;  2ZM8 A;  4P87 A;  5CED A;  3LO7 A;  2Y55 A;  4GNU A;  4S2K A;  2Z2M B;  4UHU A;  4OP5 A;  2V20 A;  4WEK A;  3WS0 A;  1IKI A;  1K55 A;  3G2Z A;  3ZG7 B;  1GHM A;  1MXO A;  1J9M A;  1FCN A;  3HUN A;  4KZ5 A;  4QHC A;  1BTL A;  3LY3 A;  4UA6 A;  3HLC A;  4S2N C;  1K6R A;  3HBR A;  1CI9 A;  3BM6 A;  1RCJ A;  1YLJ A;  5GHZ A;  1W79 A;  4R0Q A;  5F82 A;  1PWG A;  5TGF A;  1YT4 A;  2P74 A;  5U47 A;  1DY6 A;  3GTC A;  3W4P A;  2X02 A;  3NCK A;  4IVK A;  3WWX A;  4C3Q A;  1PZO A;  2WKH A;  3IWI A;  2XD1 A;  3P09 A;  2ZC7 A;  4LV1 A;  1NRF A;  3TOI A;  1PW1 A;  3MXR A;  3WS2 A;  2JCH A;  4Y0O A;  1Q2Q A;  2HP9 A;  5M1A A;  1BUE A;  3VP3 A;  2J8Y A;  1N9B A;  1YLZ A;  2Y2I A;  3MZF A;  1K54 C;  3N8S A;  4JXV A;  5EVI C;  5KSH A;  1YMX A;  1KGG A;  2DCF A;  4MNR A;  5KZH A;  2ZQ9 A;  4GDB A;  4WM9 A;  1O07 A;  3MZD A;  1XXM A;  2J9O A;  5CGS A;  1Y54 A;  1LI9 A;  4PMA A;  2XF3 A;  5DVA A;  3A3F A;  3HLF A;  3E2L A;  2Y2K A;  4OQH A;  4A5R A;  2EX8 A;  4HBT A;  4OPY A;  1MY8 A;  4PPR A;  4DXB A;  4N9L A;  1KDW A;  4YIN A;  3ISG A;  3UE0 A;  2ZQA A;  2H5S A;  2XR0 A;  2R9X A;  3N4I A;  3PBR A;  1SDE A;  3HUO A;  3DWK A;  4KQQ A;  1BLC A;  3C7V A;  3RXX A;  2I72 A;  1VQQ A;  3FV7 A;  3M6H A;  1IEM A;  5GLA A;  4IED A;  4WMC A;  1K56 D;  3ZNT A;  4NK3 A;  1IKG A;  5EPH A;  1H8Y A;  4P6B A;  3ZG9 B;  3HLW A;  4UAA A;  5DTS A;  5D3O A;  3RJU A;  1KE3 A;  5EEC A;  5E2E A;  1XGJ A;  2OSU A;  2PU4 A;  1FR1 A;  4EBP A;  5GHY A;  3UDI A;  2XH9 A;  4KZ4 A;  3ZHH A;  5F1F A;  4GKU A;  2V1Z A;  2P9V B;  4L0L A;  4OLG A;  3MZE A;  2QZ6 A;  3A3J A;  1N4O A;  1WYC A;  4MBH A;  1E3U A;  4U0X A;  5FQ9 A;  3ZFZ A;  1H8Z A;  2C6W B;  3IXB A;  3HRE A;  1ESU A;  1GHP A;  5E2G A;  4P85 A;  5FQI A;  2H10 A;  4X6T A;  4LV2 A;  1XA1 A;  3GQZ A;  3SH8 A;  1FCO A;  4OOM A;  2XDM A;  1DJB A;  4DDS A;  2G2U A;  4DDY A;  2WGW B;  3S1Y A;  5A93 A;  4BJP A;  4FH4 A;  3G34 A;  3GV9 A;  2GDN A;  1H5X A;  3FKW A;  1FQG A;  3PBN A;  3QNC A;  1XGI A;  4OON A;  5EOO A;  2ZC3 B;  3S4X A;  1M6K A;  4N1H A;  3VP4 A;  5EVI A;  3IH9 A;  3V3R A;  1MWT A;  2ZC6 B;  3W4O A;  3VOZ A;  2ZM2 A;  1DJC A;  2HPB A;  4UA7 A;  3BEB A;  4RA7 A;  2ZQC A;  3V3S A;  3PAE A;  3IHA A;  1JWZ A;  5GL9 A;  4E3L A;  4WZ5 A;  1L0F A;  4JXG A;  1CK3 A;  4QU3 A;  3VP1 A;  4OPZ A;  3CMZ A;  2J9P A;  4C75 A;  3IT9 A;  3UE1 A;  3UE3 A;  4RX3 A;  3GVB A;  3NIA A;  1E25 A;  3C4P A;  3MKE A;  1KGE A;  2XEP A;  1K38 A;  2XFS A;  4JXS A;  1Z6F A;  5JYO A;  2HP6 A;  3PBT A;  3VFH A;  3QHY A;  4KZB A;  3BFE A;  1YLT A;  4LCL A;  4E3N A;  1HVB A;  5GLC A;  1JTD A;  1ONH A;  1SCW A;  2HDR A;  2ZD8 A;  3A3I A;  3OZH A;  3Q1F A;  4GZB A;  4HEF A;  1SKF A;  2WK0 A;  3BFG A;  3OCL A;  2ZMA A;  5FQM A;  3E2K A;  4LEN A;  2OV5 A;  3SS3 A;  3PTE A;  5EE8 A;  4E6X A;  1ES5 A;  5HAP A;  4JKT A;  4QY6 A;  4GB7 A;  3HVF A;  3MFD A;  3GSG A;  2WAE A;  2WKE A;  3M2J A;  3ZVW A;  5HW3 A;  2WZZ A;  3DW0 A;  3FWL A;  4K0W A;  4YFM A;  5FA7 A;  1ESI A;  3V5M A;  1I2S A;  1PW8 A;  4QY5 A;  3Q81 A;  5CRF A;  4U0T A;  4GN2 A;  4UA9 A;  5DTK A;  3LCE A;  4Q8I A;  1XKZ A;  1BUL A;  4S2P A;  2EXB A;  3IQA A;  3BLM A;  3VP2 A;  1W5D A;  1WYB A;  4HBU A;  4E3M A;  1SDN A;  5FAP A;  2IWB A;  4R3J A;  3UDX A;  1YQS A;  3WS5 A;  3BLS A;  1YLY A;  4ZJ1 A;  2HDQ A;  4X55 A;  2WKI A;  1XP4 A;  4KEN B;  5FAT A;  3SH7 A;  4F94 A;  3GR2 A;  2Y2N A;  1PYY A;  4JPM A;  4WYY A;  5FI2 A;  4QJG A;  1JWV A;  1PI4 A;  4WZ5 C;  2EFU A;  1L2S A;  4R3B A;  5M18 A;  3A3D A;  4FSF A;  2G2W A;  3HUM A;  3WS1 A;  3Q7V B;  3VSL A;  3JYI A;  2XD5 A;  2Y2M A;  5CGW A;  1HTZ A;  3OPL A;  4ID4 A;  1LLB A;  4KG2 A;  4E6W A;  3PBS A;  1XPB A;  4LCM A;  3P98 A;  2C5W B;  3OC2 A;  3IWO A;  3UN7 A;  1E4D A;  3N6I A;  5FQQ A;  1L0E A;  5AQA A;  4QD4 A;  1L0G A;  3Q82 A;  2XGN A;  3IF6 B;  3C4O A;  5FSR A;  1VM1 A;  5A90 A;  4BQM A;  2QPN A;  3OPH A;  3BFD A;  4N92 A;  3IWQ A;  1KVM A;  1MWS A;  1ALQ A;  2B5R A;  4RX2 A;  5HL1 A;  4WEL A;  1Q2P A;  5G18 A;  2WGW A;  4EUZ A;  3AGF A;  1JVJ A;  1K4F A;  4LV0 A;  3UNW A;  1ZC2 A;  1ES2 A;  2EX2 A;  4RVA A;  3OCN A;  5AQ9 A;  4JF5 A;  3C7U A;  3CZD A;  1SHV A;  4R1G A;  5F1G A;  4ZJ3 A;  3SS4 A;  1NXY A;  1JWP A;  2WYX A;  4KZ8 A;  3SS5 A;  3FYZ A;  2JBF A;  1M40 A;  1BT5 A;  4BD1 A;  1K56 A;  5DF9 A;  1TEM A;  2ZJ9 A;  2IWC A;  1ONG A;  4Y0T A;  1KDS A;  1ZG6 A;  1BLS A;  3HLD A;  4JLF A;  4OQI A;  1S0W A;  3WS4 A;  4DE0 A;  3OPP A;  1GHI A;  1YLW A;  5A91 A;  1KGF A;  3UDF A;  4BL3 A;  4KQO A;  5FQK A;  4OP8 A;  2PU2 A;  3FKV A;  2FFF B;  1MKI A;  4K0X A;  4O7D A;  3G2Y A;  2RL3 A;  4XXR A;  4JXW A;  3VOY A;  4M3K A;  4OLD A;  3VFF A;  4D2O A;  5E2F A;  1LHY A;  5FI6 A;  2Q9M A;  4S2L A;  3QNB A;  4KG5 A;  2V2F F;  4IBX A;  3PAG A;  3ITB A;  1AXB A;  4S2M A;  5HAR A;  1QMF A;  4ZJ2 A;  3NC8 A;  4PM9 A;  1KVL A;  4FH2 A;  1FOF A;  4JF4 A;  2BG1 A;  3IXH A;  2XLN A;  5CTN A;  5E2H A;  5TFQ A;  5GLD A;  1BLH A;  2WUQ A;  2VGJ A;  2FFY A;  2QMI A;  2Y4A A;  3O88 A;  4PM8 A;  3DTM A;  1I2W A;  4LV3 A;  4B4Z A;  5BOH A;  4P0M A;  4RYE A;  5AQB A;  2HDS A;  3AGD A;  3UPP A;  3ZCZ A;  1O7E A;  3UPO A;  3G35 A;  4ZTK A;  5A92 A;  1W8Q A;  2X71 A;  4KZ3 A;  4X68 A;  3NDG A;  5CEC A;  2E8I A;  3VMA A;  3DWZ A;  5EVL A;  3CJM A;  3NDE A;  1K4E A;  3WRZ A;  4DKI A;  4ZDX A;  2ZM0 A;  5CEB A;  5DTT A;  2XK1 A;  5F83 A;  2J7V A; 
#chains in the Genus database with same CATH topology
 3O87 A;  5CTM A;  4DE1 A;  5CX7 A;  3LI8 A;  1FSW A;  2VGL S;  2WZX A;  2M7U A;  1PZP A;  4DJ3 A;  4BWI A;  1TF1 A;  5TR7 A;  2GZA A;  2VV6 A;  3HCY A;  4EQI A;  4OQG A;  1K6S A;  4OPQ A;  1MBL A;  1MZU A;  5HAQ A;  4N9K A;  1VEU A;  1W8Y A;  2L4R A;  1H0M A;  4YOF A;  4U3T A;  3DAV A;  4CLC E;  2A49 A;  3BFC A;  1TDG A;  2HJ9 C;  1U60 A;  1NY0 A;  2MJ6 A;  2XRN A;  2Y2G A;  2WAF A;  4XT2 A;  3G4P A;  4E3J A;  4BEN A;  1ZTU A;  3ICY A;  2Y2Q A;  1S1Z A;  2Y2L A;  4R4R A;  1KE0 A;  3RH8 B;  4G3K A;  2EWV A;  4HIA A;  3ZDJ A;  3IH8 A;  3KYE A;  2Y2J A;  5TBM A;  1T1B A;  3G30 A;  4MN5 A;  3MJQ A;  2Q9N A;  4S2I A;  3H9W A;  4ESP A;  4JGP A;  4GOG A;  2WGV A;  1OTI A;  3HL9 A;  4CLC B;  4HJ4 A;  1GSX A;  3GRJ A;  4JF6 A;  4HJ3 A;  2RCX A;  1YSP A;  3E4Q A;  5EVI D;  2XRO A;  4LRX C;  3NBL A;  5FQJ A;  1OT9 A;  4O8G A;  4S2N A;  1KE4 A;  4DF6 A;  1IYS A;  3OPR A;  2VV8 A;  3ZNY A;  4DRT A;  1CF0 A;  1K57 C;  2XFT A;  3IBR A;  5HDD A;  5A8B A;  3G31 A;  4ETZ A;  3ZVT A;  2DRW A;  5F68 A;  5GLB A;  4DE3 A;  2V0W A;  4Y0U A;  1GA9 A;  4GDN A;  4KZ6 A;  3U2A A;  4R4S A;  2W0N A;  3C38 A;  1XJ2 A;  4S2J A;  1NLY A;  3FPV A;  4GCZ A;  3ZG5 A;  3NOT C;  3O3V A;  5FAQ A;  3NI9 A;  3UB6 A;  3LR3 A;  3EOI A;  4PM5 A;  4E3O A;  3FZC A;  4OOY A;  5CER A;  4Q0I A;  1NJ4 A;  4EES A;  1LSX A;  4OVD A;  3JPU A;  3LO7 A;  2JHE A;  4UHU A;  3G2Z A;  3UB8 A;  2K31 A;  3HUN A;  4R70 A;  3HLC A;  4H6J B;  3MSH A;  1W79 A;  4R0Q A;  1DY6 A;  5I5L A;  3NCK A;  3TOI A;  1PW1 A;  1Q2Q A;  5M1A A;  1N9B A;  1K54 C;  1KGG A;  2ZBB A;  3KX0 X;  4EER A;  1XXM A;  2J9O A;  3F1O A;  3LIE A;  3E2L A;  2Y2K A;  3L7H A;  2P04 A;  4HBT A;  4I3I A;  1F5M A;  4Q0H A;  4N9L A;  1KDW A;  4YIN A;  4O0P A;  2FH5 A;  2H5S A;  1D7E A;  3PBR A;  1SDE A;  3DWK A;  3QP8 A;  4NK3 A;  2JKT I;  1H8Y A;  2ZL1 B;  3HLW A;  3S7P A;  4XT2 B;  1XGJ A;  2PU4 A;  2G7U A;  3UDI A;  2W3D A;  3D3O A;  4F3L A;  2V1Z A;  2PRF A;  3K3C A;  2QZ6 A;  1T18 A;  1WYC A;  3ZFZ A;  1H8Z A;  1DP9 A;  3HRE A;  1ESU A;  3LUQ A;  5FQI A;  4X6T A;  4LV2 A;  1NLZ A;  1FCO A;  4OOM A;  2XDM A;  4BJP A;  4FH4 A;  3G34 A;  5TBM B;  1VET B;  4OON A;  5EOO A;  4N1H A;  3D72 A;  3IH9 A;  3BY9 A;  4CLC C;  2HPB A;  3BW6 A;  3V3S A;  4WZ5 A;  5EM0 A;  3SZT A;  1CK3 A;  3VP1 A;  3MF0 A;  4C75 A;  3UE1 A;  3UE3 A;  4RX3 A;  3GVB A;  3LR5 A;  5JYO A;  2XEP A;  2XFS A;  4JXS A;  2B95 A;  4KZB A;  3BFE A;  4Y3I A;  4D60 A;  5GLC A;  2HDR A;  1SCW A;  1F9I A;  4HEF A;  3BFG A;  3OCL A;  2ZMA A;  5FQM A;  2GJ3 A;  3T4T A;  5EE8 A;  3NEC A;  2Y8H A;  3M2J A;  1TS6 A;  3H82 B;  4Z1W A;  3UME A;  3ZVW A;  3FWL A;  4YFM A;  3V5M A;  4HY8 A;  4WL9 A;  1PW8 A;  1YAX A;  3S7N A;  5DTK A;  1XKZ A;  2EXB A;  1W5D A;  4HBU A;  2P08 A;  2OAP 1;  5LBR A;  4R3J A;  2HDQ A;  4MDZ A;  2WKI A;  4KEN B;  3TE8 A;  4F94 A;  3GR2 A;  4I5S A;  4WYY A;  2EFU A;  3WS1 A;  3JYI A;  2XD5 A;  2Y2M A;  4ID4 A;  4E6W A;  4PHT A;  3UN7 A;  4EUV A;  1W63 M;  2ZOH A;  4BQM A;  2QPN A;  3OPH A;  2NUP C;  3IWQ A;  1ALQ A;  4EXO A;  5F6A A;  4EUZ A;  3DTI A;  1YPR A;  5G4Z A;  2EX2 A;  1SHV A;  4R1G A;  5F1G A;  4ZJ3 A;  4HQA A;  3SS5 A;  3F1O B;  3F1N A;  1ZG6 A;  3QP4 A;  1GHI A;  5A91 A;  3MS6 A;  3IX8 A;  4WN5 A;  3BJN A;  5FEF A;  2BTF P;  4K0X A;  3G2Y A;  4XXR A;  1S4S A;  4M3K A;  4OLD A;  3PHY A;  1LHY A;  2BAS A;  2Q9M A;  3LR0 A;  3ITB A;  4S2M A;  3IS2 B;  4JF4 A;  1FOF A;  2HV1 A;  2XLN A;  5GLD A;  2VGJ A;  2WUQ A;  5J3W A;  3DTM A;  4B4Z A;  3LI9 A;  3AGD A;  3B47 A;  2X71 A;  2PHY A;  5CEC A;  2E8I A;  3UB5 P;  2Z6C A;  3VMA A;  2VA0 A;  1OJG A;  1K4E A;  3WRZ A;  2ZM0 A;  5CEB A;  3CAX A;  2XK1 A;  5I94 A;  4FTX A;  2OAQ 1;  4R23 A;  4OKP A;  2ZQ8 A;  3BRM A;  3IXG A;  3PBQ A;  5AVF A;  1TDL A;  2XQZ A;  3MBZ A;  3VSK A;  2GX5 A;  4L9E A;  1CI8 A;  2QJ5 A;  3PYP A;  3G32 A;  3O5Y A;  5KIZ A;  5DF7 A;  3N7W A;  3BEC A;  1STZ A;  5EUA A;  3E98 A;  3EWK A;  5HZH A;  3TG9 A;  3MXS A;  4II7 A;  3ZYT A;  3IF6 A;  2IWD A;  1V9Z A;  2EFX A;  4ETX A;  1GCE A;  1OME A;  4CLC D;  4DMZ A;  4ZRR A;  2VX8 A;  3IHB A;  4KQR A;  3K2N A;  2P9V A;  3UPN A;  1GSW A;  4PKY G;  3CI6 A;  3TW8 A;  1PI5 A;  4WMC D;  1TS8 A;  1G6A A;  3LEZ A;  4XUZ A;  4JBF A;  2W3E A;  3U4L P;  3RTY A;  3OLO A;  2ZMF A;  4WZ4 A;  2ZQ7 A;  1ZG4 A;  1P0Z A;  4MEZ A;  3S22 A;  3HLE A;  1GA0 A;  3RXW A;  5JYP A;  1CEG A;  4MN6 A;  3A0R A;  1BLP A;  4EBL A;  2VLG A;  1E3U D;  3F1P A;  3EGD C;  3VE4 A;  1DP6 A;  3AGE A;  1RGZ A;  2KLI A;  3ZG8 B;  2VGK A;  4EEU A;  3A3E A;  2W3F A;  3EEH A;  4S2O A;  2V1B A;  5HPF A;  3W4Q A;  4WEJ A;  1J3W A;  1AWI A;  1S4R A;  5AQ7 A;  4GHI B;  4BBV A;  4EBN A;  3QP1 A;  1OTE A;  4GS9 B;  1PRQ A;  3CUE A;  4PM6 A;  1QME A;  1T1A A;  2R9W A;  2ACG A;  5DF8 A;  3BYD A;  4KG6 A;  3EQU A;  2H0T A;  3O86 A;  1N9O A;  4X56 A;  1XA7 A;  4Q0J A;  3BFF A;  1ZKJ A;  3V50 A;  4QB8 A;  2L0W A;  4Y7P A;  4IVI A;  1FIL A;  3CG5 A;  3KYQ A;  1ES3 A;  3QP6 A;  4KZ7 A;  1NWZ A;  3TSG A;  2OLV A;  2PBY A;  3BWL A;  5FL3 A;  4EU0 A;  4C6Y A;  2E8J A;  4WBG A;  5HDC A;  3F1N B;  4LLO B;  3HJK A;  1LL9 A;  3IBJ A;  3KSG A;  1CEF A;  2JKF A;  1Z09 A;  4KUK A;  3IX4 A;  2UWX A;  1TD5 A;  4FUW A;  4OOL A;  4L9G A;  3Q7V A;  1BSG A;  1OJ5 A;  2PT7 A;  3LY4 A;  5CED A;  2Y55 A;  2QJ7 A;  1IFQ A;  2V8C A;  4WEK A;  3WS0 A;  1IKI A;  3ZG7 B;  1FCN A;  1BTL A;  3MQO A;  4JGR A;  1LL8 A;  1K6R A;  2K2N A;  4GJ4 A;  3C8C A;  1RCJ A;  1YLJ A;  5GHZ A;  5F82 A;  1YT4 A;  2P74 A;  3GTC A;  3W4P A;  2X02 A;  4IVK A;  4C3Q A;  1PZO A;  2WKH A;  2XD1 A;  4LV1 A;  2ZC7 A;  3MXR A;  3WS2 A;  4Y0O A;  2HP9 A;  4R6L A;  3VP3 A;  2J8Y A;  3MZF A;  2XA7 S;  4MNR A;  1O07 A;  1XFQ A;  3CLO A;  2Z6D A;  3HLF A;  2OWJ A;  2H28 A;  3R7W A;  2EX8 A;  4OPY A;  3UE6 A;  3HUO A;  4LRY C;  3RXX A;  1VQQ A;  5GLA A;  1XFN A;  5HD3 A;  4UAA A;  5D3O A;  3RJU A;  2OSU A;  1S66 L;  3BQA A;  5MC7 A;  4I3J A;  5DJT A;  3CWF A;  4GKU A;  2P9V B;  3MZE A;  3A3J A;  1N4O A;  5FQ9 A;  4LRZ E;  5HPI A;  1D06 A;  3C2W A;  3T12 B;  4K08 A;  2GDN A;  1FQG A;  3PBN A;  3QNC A;  1Y4O A;  3T4J A;  5EVI A;  2ZC6 B;  2V9A A;  4IUK A;  3A0S A;  2ZM2 A;  2WKP A;  5L07 A;  1DJC A;  4RA7 A;  4NG2 A;  4E3L A;  3IHA A;  5GL9 A;  4WUJ A;  4QU3 A;  4OPZ A;  2J9P A;  3IT9 A;  5J4E A;  3NUL A;  4HP9 A;  3PXP A;  1KGE A;  1Z6F A;  4NXF A;  3VFH A;  4EEP A;  2J3T C;  1JTD A;  4GZB A;  1FIK A;  4P6Z S;  2Y79 A;  4LFU A;  4E6X A;  4QY6 A;  4GB7 A;  3HVF A;  2JKR M;  2B02 A;  5TJJ A;  2WZZ A;  4K0W A;  5FA7 A;  3E4P A;  4ARZ A;  3BLM A;  4E3M A;  1SDN A;  2ZMV A;  2L1M A;  3D9Y A;  1YQS A;  4ZJ1 A;  1YLY A;  4X55 A;  1KOU A;  5FAT A;  5FI2 A;  1PYY A;  4QJG A;  1JWV A;  1P9W A;  1PI4 A;  4R3B A;  5M18 A;  3A3D A;  2G2W A;  4UQI S;  1H3Q A;  3Q7V B;  4UEY A;  4Y17 A;  1HTZ A;  1VEU B;  4LCM A;  2C5W B;  3OC2 A;  2VEA A;  3NJA A;  5FQQ A;  1L0E A;  3MXQ A;  1G5U A;  5AQA A;  3MR0 A;  4QD4 A;  1YSQ A;  2PAV P;  3C4O A;  1D1J A;  4N92 A;  4R38 A;  5HL1 A;  4RX2 A;  4WEL A;  1Q2P A;  5FEG A;  2WGW A;  3AGF A;  3NOP C;  4LV0 A;  3DBA A;  1ES2 A;  1OPX A;  1A0K A;  1W63 Q;  5AQ9 A;  1F2K A;  4JF5 A;  4Y2F A;  1OTD A;  2INW A;  1JWP A;  1UGU A;  2WYX A;  4KZ8 A;  1H8M A;  3FYZ A;  2JBF A;  1M40 A;  1BT5 A;  1OTA A;  1TEM A;  2IWC A;  2V1A A;  2OOL A;  4HHD A;  3HLD A;  3WS4 A;  4OQI A;  1S0W A;  4DE0 A;  3R7W B;  1IOU A;  4WF0 A;  1KGF A;  2O9C A;  4OP8 A;  3FKV A;  2A24 A;  3VOY A;  4D2O A;  5E2F A;  2WKQ A;  1TS7 A;  4KG5 A;  2V2F F;  1AXB A;  5HAR A;  4IHQ A;  1KVL A;  4FH2 A;  3IXH A;  3QP2 A;  2Y4A A;  2KOI A;  1I2W A;  4P0M A;  3UPP A;  1O7E A;  3UPO A;  4KZ3 A;  3VV4 A;  5DKL A;  3CJM A;  4DKI A;  5F83 A;  1BZA A;  1XX2 A;  2QWS A;  1YM1 A;  2Y2O A;  2DNS A;  4DN0 A;  3C5A A;  2CC1 A;  4HES A;  2W3G A;  4BBU A;  4ZBE A;  3V39 A;  4NET A;  3TRC A;  3NY4 A;  3PBO A;  1YLP A;  3UY6 A;  3ZG0 A;  1RGY A;  3CIT A;  1C3B A;  4BBT A;  1VHM A;  3D4F A;  1VB6 A;  3WRT A;  5EOE A;  1NZO A;  4MLL A;  5CGX A;  5HX9 A;  1IEL A;  3B3X A;  4NEE D;  4MBK A;  1PWC A;  5CHM A;  2PR6 A;  5FDS A;  4NXB A;  1S1Y A;  4CPK A;  2VGL M;  3HLG A;  3UO9 A;  3MKF A;  1LI0 A;  4EQ1 A;  5KMW A;  1K57 A;  2J3T D;  1MWR A;  2WGI A;  1W7F A;  2XSS A;  3ITA A;  3S7Q A;  2W1T A;  3Q07 A;  1FCM A;  4Y5F A;  1SKO A;  2PR5 A;  1K25 A;  1TVF A;  4FD8 A;  3SOI A;  1XJ3 A;  1G28 A;  1PIO A;  2P7J A;  2KDK A;  5HD5 A;  2VZW A;  2ZC5 B;  2HP5 A;  4ME4 A;  5HWT A;  3H7W A;  4CJN A;  3E4O A;  1FSY A;  3W8K A;  2ZC4 B;  4LGW A;  1NRJ A;  5DJU A;  3IF5 A;  4B88 A;  2NUT C;  5HFO A;  2Y2P A;  4F3L B;  2A3U A;  1MWU A;  1EI5 A;  3B33 A;  1K54 A;  2Y91 A;  4BD0 A;  5M19 A;  2JC7 A;  4GLQ A;  4LPZ A;  1CQA A;  3HLB A;  3I7J A;  2JKR I;  4NXG A;  5J8X A;  2JKG A;  3SH9 A;  2HZ5 A;  4OH0 A;  4KZ9 A;  2O0Y A;  4BL2 A;  1CJF A;  3GMW A;  1DRM A;  1S67 L;  2HDU A;  1P9R A;  4PKY A;  3G6O A;  5CHJ A;  1HZO A;  2ZM8 A;  4IJG A;  4S2K A;  2J3W A;  2V20 A;  2VKS A;  2CMN A;  3LIA A;  1K55 A;  4E04 A;  4I39 A;  4QHC A;  3W2Z A;  3LY3 A;  4UA6 A;  2W1R A;  2HGV A;  4S2N C;  3HBR A;  3OBF A;  5TGF A;  1PWG A;  2LB9 A;  5HDS A;  3WWX A;  3IWI A;  3P09 A;  1UWP X;  2JCH A;  1BUE A;  1YLZ A;  3N8S A;  1OTB A;  5EVI C;  5KSH A;  4NKP A;  2DCF A;  2PD8 A;  2HJE A;  4WM9 A;  3MZD A;  3KO6 A;  5CGS A;  1LI9 A;  4PMA A;  2XF3 A;  4M4X A;  3KSH A;  1N9L A;  3KYZ A;  4HH2 A;  2EWW A;  4OQH A;  4A5R A;  3DTE A;  4CLC A;  1MY8 A;  4DXB A;  2DMW A;  2ZQA A;  2R9X A;  4KQQ A;  1BLC A;  3M6H A;  1G6O A;  4IED A;  4WMC A;  1K56 D;  1IKG A;  4GW9 A;  1PFL A;  5EPH A;  4P6B A;  3ZG9 B;  5DTS A;  3T4O A;  5EEC A;  5E2E A;  1FR1 A;  4KZ4 A;  5F1F A;  4L0L A;  1E3U A;  4U0X A;  1LSV A;  3IXB A;  5HL6 A;  1GHP A;  4NXE A;  4P85 A;  2H10 A;  1XA1 A;  5A93 A;  3S1Y A;  3T4S A;  3GV9 A;  3FKW A;  3UB7 A;  3S4X A;  3VP4 A;  1SKO B;  1MWT A;  4JGO A;  3VOZ A;  3BEB A;  3PAE A;  1JWZ A;  3FG8 A;  4JXG A;  2O99 A;  3CMZ A;  3C30 A;  3C4P A;  5HWW A;  4H6J A;  3PBT A;  3QHY A;  1ONH A;  2ZD8 A;  3A3I A;  5AVE A;  3Q1F A;  2WK0 A;  3P01 A;  3E2K A;  3EGX C;  2OV5 A;  3PTE A;  1L3L A;  4EET B;  3JVU A;  4JKT A;  2GNX A;  3CPT A;  3MFD A;  2WKE A;  3DTK A;  4HI4 A;  3S7O A;  3DW0 A;  3K3D A;  3T1R A;  1I2S A;  4QY5 A;  3Q81 A;  4U0T A;  3LCE A;  4Q8I A;  4S2P A;  3LEQ A;  3VP2 A;  2IWB A;  3BLS A;  1XJ6 A;  1XP4 A;  4X25 A;  4QWO A;  4WZ5 C;  1F98 A;  2LB5 A;  2FZ0 A;  3HUM A;  4FSF A;  2ZL1 A;  1XPB A;  3IWO A;  4YWZ A;  5J7E A;  5DFX A;  1L0G A;  3T4K A;  3IF6 B;  3LID A;  1K0K A;  1VM1 A;  5A90 A;  1MWS A;  2B5R A;  2PYR A;  5G4Y A;  5G18 A;  1K4F A;  3UNW A;  3MFX A;  3OCN A;  1VET A;  3C7U A;  2VV7 A;  3SS4 A;  1NXY A;  4I38 A;  4BD1 A;  5DF9 A;  2ZJ9 A;  1ONG A;  4Y0T A;  4JLF A;  4X1L A;  5FQK A;  2PU2 A;  2FFF B;  1MKI A;  4L9F A;  2RL3 A;  4JXW A;  4HOI A;  4KUO A;  3QNB A;  4IBX A;  3F1P B;  3LIC A;  4ZJ2 A;  3NC8 A;  4PM9 A;  5CTN A;  5E2H A;  5TFQ A;  3ULF A;  1BLH A;  2FFY A;  2QMI A;  2W27 A;  4RYE A;  5HSQ A;  3ZCZ A;  1T19 A;  3G35 A;  4ZTK A;  4X68 A;  3NDG A;  3H82 A;  4EW7 A;  5DTT A;  2V0U A;  3VOL A;  5CHU A;  2QKP A;  2JE5 A;  4B4X A;  4X1M A;  2EX9 A;  2KX6 A;  3N8L A;  1G68 A;  2OLU A;  4BMW A;  3M6B A;  5FAS A;  5IHV A;  4H8R A;  2H0Y A;  5AJG A;  2AVX A;  1ES4 A;  2YKF A;  3B42 A;  1XJ4 A;  1IYQ A;  2WAD A;  4HNB A;  2A2L A;  1IYP A;  2QHK A;  3N8R A;  3Q7Z A;  2R78 A;  4ZAM A;  4WLA A;  1ACF A;  1YKD A;  5L2F A;  4E3K A;  1NZU A;  4DJ2 A;  2V8F A;  4K91 A;  1N9N A;  4KZA A;  1LL5 A;  4GD6 A;  3CPT B;  1ERO A;  4BLM A;  1NYY A;  1HD8 A;  2O9B A;  4EWF A;  4XUX A;  3BY8 A;  4MBF A;  2M1C A;  5GHX A;  3L9K A;  3PR6 A;  1BYW A;  1UWN X;  1EWZ A;  5KSC A;  2Y59 A;  1OT6 A;  1JTG A;  1ERQ A;  1L0D A;  3IS2 A;  4IBR A;  1MPL A;  4GD8 A;  5IS1 A;  2EX6 A;  1K55 C;  2Y2H A;  4DE2 A;  1SZV A;  1PWD A;  2ZOI A;  4DXC A;  1IYO A;  3IF6 C;  2Z2L B;  2PBD P;  4OPR A;  3LYX A;  5CXW A;  1LSW A;  2QYB A;  1ERM A;  3GDI A;  2W3H A;  3ZQ5 A;  4X69 A;  1DJA A;  1NYM A;  5DKK A;  3IX3 A;  3CHW P;  1RP5 A;  4N1X A;  1WA9 A;  3RFB A;  3M2K A;  4FCF A;  1I5Q A;  3EQV A;  1S6R A;  4OQ0 A;  4E3I A;  5FI7 A;  3ZGA B;  4PM7 A;  3LR4 A;  2PYP A;  1YMS A;  2ZLY A;  4X53 A;  3MMH A;  4Z9Q A;  5HAI A;  3P7N A;  5E43 A;  3FPW A;  5FDH A;  3R4K A;  3LFV A;  5FAO A;  2BLS A;  3IXD A;  2EXA A;  4MCW A;  5EVI B;  5IU1 A;  1X0O A;  2X01 A;  2ZQD A;  3VP0 A;  1WE4 A;  1FR6 A;  4EV4 A;  4HH3 A;  3EEA A;  4P87 A;  4GNU A;  3OOV A;  4MN7 A;  2Z2M B;  4OP5 A;  3CUE C;  1T1C A;  1GHM A;  1MXO A;  1J9M A;  4KZ5 A;  4Y13 A;  1CI9 A;  3BM6 A;  5U47 A;  1NRF A;  2I9V A;  4I3A A;  2JN7 A;  2Y2I A;  4JXV A;  4HJ6 A;  1YMX A;  1EW0 A;  5KZH A;  3LGO A;  2ZQ9 A;  4GDB A;  3JVV A;  1Y54 A;  1V9Y A;  5DVA A;  1HLU P;  3A3F A;  1ZHH B;  2YKH A;  3E0Y A;  4ARZ B;  4PPR A;  3ISG A;  4G3V A;  3UE0 A;  2XR0 A;  4GHI A;  3N4I A;  3C7V A;  5EVE A;  4G3W A;  2I72 A;  3FV7 A;  4GS9 A;  2D01 A;  1IEM A;  5F69 A;  3LIF A;  3FC7 A;  3KSI A;  2IA2 A;  3ZNT A;  5F5Y A;  1KE3 A;  3TJZ C;  4EBP A;  5GHY A;  2XH9 A;  3ZHH A;  4OLG A;  2EA9 A;  4MBH A;  1MKM A;  2C6W B;  3GEC A;  2XA7 M;  5EM1 A;  5HWV A;  5E2G A;  3GQZ A;  3SH8 A;  4DDS A;  1DJB A;  2G2U A;  4DDY A;  2WGW B;  1H5X A;  2UV0 E;  1XGI A;  2ZC3 B;  2M7V A;  1M6K A;  5L10 A;  3V3R A;  3W4O A;  4Y15 A;  4UA7 A;  2ZQC A;  2PD7 A;  1L0F A;  2A24 B;  3NIA A;  1E25 A;  4O01 A;  3MKE A;  1K38 A;  2HP6 A;  4LCL A;  1YLT A;  4E3N A;  1HVB A;  3OZH A;  1JNU A;  5EV0 A;  1SKF A;  2HF6 A;  2O9A A;  1LT0 A;  4LEN A;  1DP8 A;  3SS3 A;  3SW1 A;  1P97 A;  1ES5 A;  2OWH A;  5HAP A;  3GSG A;  2D02 A;  2WAE A;  5HW3 A;  1GSV A;  3V67 A;  1ESI A;  3T1Q B;  5CRF A;  4GN2 A;  4UA9 A;  5K5B A;  5EFW A;  3A0V A;  1BUL A;  3IQA A;  1ODV A;  3T4Q A;  1WYB A;  4JGQ A;  3KSF A;  5FAP A;  3MQQ A;  3NHQ A;  3UDX A;  2VK3 A;  3WS5 A;  2B18 A;  2WKR A;  3T1S A;  3SH7 A;  2Y2N A;  4JPM A;  1L2S A;  3VSL A;  3VE3 A;  5CGW A;  3OPL A;  1LLB A;  4KG2 A;  2VJW A;  3PBS A;  5DFY A;  3QP5 A;  3P98 A;  3NOU C;  1E4D A;  3N6I A;  3LIB A;  5L09 A;  3UMD A;  3Q82 A;  2XGN A;  4P6Z M;  1Y28 A;  5FSR A;  3T4L A;  3BFD A;  4YNR A;  1KVM A;  3T1X A;  1JVJ A;  1ZC2 A;  4RVA A;  3CZD A;  3UB9 A;  5C5K A;  4IUH A;  1MC0 A;  4AFI A;  4PAU A;  1K56 A;  4B93 A;  1KDS A;  1BLS A;  3OPP A;  4RQ9 A;  1YLW A;  2JKT M;  4QPR A;  1TS0 A;  3UDF A;  4KQD A;  4BL3 A;  4R3A A;  4KQO A;  5L8M A;  4O7D A;  2K7S A;  4UQI M;  2W1T B;  3VFF A;  5IT5 A;  2Q0O A;  5FI6 A;  4S2L A;  3BQ8 A;  3PAG A;  1PNE A;  4MMN A;  1QMF A;  4HP4 A;  2BG1 A;  4PM8 A;  3O88 A;  4LV3 A;  3MQ0 A;  5BOH A;  5AQB A;  2HDS A;  4FOF A;  3H7W B;  4B9O A;  5A92 A;  1W8Q A;  2PDR A;  4CQH A;  3HJI A;  3T50 A;  3DWZ A;  5EVL A;  3NDE A;  2J80 A;  4ZDX A;  2J7V A; 
#chains in the Genus database with same CATH homology
 3O87 A;  5CTM A;  1BZA A;  4DE1 A;  5I94 A;  1XX2 A;  5CHU A;  1FSW A;  1YM1 A;  4R23 A;  4OKP A;  2ZQ8 A;  2Y2O A;  2WZX A;  3BRM A;  3IXG A;  3PBQ A;  2JE5 A;  2DNS A;  4B4X A;  1PZP A;  5TR7 A;  1TDL A;  2EX9 A;  3C5A A;  2XQZ A;  2CC1 A;  3MBZ A;  4HES A;  3VSK A;  4EQI A;  4OQG A;  1K6S A;  3N8L A;  4ZBE A;  4OPQ A;  1G68 A;  1MBL A;  2OLU A;  3V39 A;  1CI8 A;  3M6B A;  4NET A;  5FAS A;  5HAQ A;  5IHV A;  4H8R A;  3G32 A;  2H0Y A;  3NY4 A;  4N9K A;  5DF7 A;  3N7W A;  1W8Y A;  3BEC A;  1YLP A;  3PBO A;  5EUA A;  1ES4 A;  3UY6 A;  3ZG0 A;  1RGY A;  1C3B A;  3TG9 A;  3MXS A;  3D4F A;  3WRT A;  1IYQ A;  4U3T A;  5EOE A;  1NZO A;  2WAD A;  2A49 A;  3IF6 A;  4MLL A;  5M19 A;  2IWD A;  1IYP A;  3N8R A;  5CGX A;  3Q7Z A;  3BFC A;  1TDG A;  2EFX A;  4ZAM A;  1U60 A;  1NY0 A;  5HX9 A;  1GCE A;  1IEL A;  3B3X A;  1OME A;  2Y2G A;  5L2F A;  4MBK A;  2WAF A;  3G4P A;  4E3K A;  4E3J A;  1PWC A;  5CHM A;  1NZU A;  4BEN A;  3IHB A;  4K91 A;  4KQR A;  2Y2Q A;  4KZA A;  1LL5 A;  4GD6 A;  2P9V A;  3UPN A;  1ERO A;  4BLM A;  1NYY A;  1HD8 A;  4CPK A;  1PI5 A;  2Y2L A;  4R4R A;  4EWF A;  1KE0 A;  4WMC D;  3HLG A;  1G6A A;  3LEZ A;  4XUZ A;  4JBF A;  4XUX A;  3UO9 A;  3MKF A;  1LI0 A;  5KMW A;  1K57 A;  3ZDJ A;  1MWR A;  4WZ4 A;  2WGI A;  2ZQ7 A;  1W7F A;  1ZG4 A;  3IH8 A;  3ITA A;  4MBF A;  2Y2J A;  4MEZ A;  3S22 A;  3HLE A;  1GA0 A;  3RXW A;  5GHX A;  3G30 A;  5JYP A;  1CEG A;  3Q07 A;  1FCM A;  5KSC A;  1EWZ A;  1BLP A;  4EBL A;  1E3U D;  1K25 A;  2Q9N A;  4S2I A;  2Y59 A;  1TVF A;  1JTG A;  1ERQ A;  3AGE A;  4FD8 A;  1L0D A;  1RGZ A;  4IBR A;  1MPL A;  3ZG8 B;  2VGK A;  4GD8 A;  4GOG A;  3SOI A;  1PIO A;  3A3E A;  2WGV A;  2EX6 A;  1K55 C;  3HL9 A;  2Y2H A;  4S2O A;  4DE2 A;  1PWD A;  2ZC5 B;  3GRJ A;  4WEJ A;  4JF6 A;  3W4Q A;  4DXC A;  1IYO A;  2HP5 A;  3IF6 C;  2Z2L B;  2RCX A;  5AQ7 A;  4CJN A;  4EBN A;  4OPR A;  5CXW A;  5EVI D;  4PM6 A;  1QME A;  1FSY A;  2R9W A;  3W8K A;  5DF8 A;  2ZC4 B;  3BYD A;  4KG6 A;  3NBL A;  5FQJ A;  1ERM A;  3EQU A;  2H0T A;  3O86 A;  4S2N A;  3IF5 A;  4X56 A;  1KE4 A;  1XA7 A;  4B88 A;  3BFF A;  1ZKJ A;  3V50 A;  4DF6 A;  5HFO A;  4QB8 A;  2Y2P A;  4X69 A;  1DJA A;  1NYM A;  4Y7P A;  1IYS A;  4IVI A;  3CG5 A;  1RP5 A;  1ES3 A;  3OPR A;  3ZNY A;  2A3U A;  1MWU A;  1EI5 A;  4KZ7 A;  4N1X A;  4DRT A;  3TSG A;  1K54 A;  3M2K A;  1K57 C;  2XFT A;  2OLV A;  2PBY A;  2Y91 A;  4FCF A;  3G31 A;  1I5Q A;  3EQV A;  1S6R A;  4OQ0 A;  2DRW A;  5GLB A;  5FI7 A;  3ZVT A;  4BD0 A;  2JC7 A;  4C6Y A;  4DE3 A;  4E3I A;  3ZGA B;  4Y0U A;  4WBG A;  4PM7 A;  1GA9 A;  4GDN A;  1YMS A;  2ZLY A;  4KZ6 A;  4R4S A;  4X53 A;  1LL9 A;  4Z9Q A;  5HAI A;  4S2J A;  3HLB A;  5E43 A;  3ZG5 A;  3I7J A;  3O3V A;  5FAQ A;  3NI9 A;  5FDH A;  5J8X A;  3SH9 A;  4OH0 A;  5FAO A;  2BLS A;  3IXD A;  1CEF A;  4KZ9 A;  4PM5 A;  2EXA A;  5EVI B;  4BL2 A;  2X01 A;  2UWX A;  4E3O A;  3FZC A;  4OOY A;  3GMW A;  2ZQD A;  4OOL A;  5CER A;  3VP0 A;  1NJ4 A;  3Q7V A;  1BSG A;  1WE4 A;  4OVD A;  2HDU A;  1FR6 A;  4EV4 A;  5CHJ A;  1HZO A;  3LY4 A;  2ZM8 A;  4P87 A;  5CED A;  3LO7 A;  2Y55 A;  4GNU A;  4S2K A;  2Z2M B;  4UHU A;  4OP5 A;  2V20 A;  4WEK A;  3WS0 A;  1IKI A;  1K55 A;  3G2Z A;  3ZG7 B;  1GHM A;  1MXO A;  1J9M A;  1FCN A;  3HUN A;  4KZ5 A;  4QHC A;  1BTL A;  3LY3 A;  4UA6 A;  3HLC A;  4S2N C;  1K6R A;  3HBR A;  1CI9 A;  3BM6 A;  1RCJ A;  1YLJ A;  5GHZ A;  1W79 A;  4R0Q A;  5F82 A;  1PWG A;  5TGF A;  1YT4 A;  2P74 A;  5U47 A;  1DY6 A;  3GTC A;  3W4P A;  2X02 A;  3NCK A;  4IVK A;  3WWX A;  4C3Q A;  1PZO A;  2WKH A;  3IWI A;  2XD1 A;  3P09 A;  2ZC7 A;  4LV1 A;  1NRF A;  3TOI A;  1PW1 A;  3MXR A;  3WS2 A;  2JCH A;  4Y0O A;  1Q2Q A;  2HP9 A;  5M1A A;  1BUE A;  3VP3 A;  2J8Y A;  1N9B A;  1YLZ A;  2Y2I A;  3MZF A;  1K54 C;  3N8S A;  4JXV A;  5EVI C;  5KSH A;  1YMX A;  1KGG A;  2DCF A;  4MNR A;  5KZH A;  2ZQ9 A;  4GDB A;  4WM9 A;  1O07 A;  3MZD A;  1XXM A;  2J9O A;  5CGS A;  1Y54 A;  1LI9 A;  4PMA A;  2XF3 A;  5DVA A;  3A3F A;  3HLF A;  3E2L A;  2Y2K A;  4OQH A;  4A5R A;  2EX8 A;  4HBT A;  4OPY A;  1MY8 A;  4PPR A;  4DXB A;  4N9L A;  1KDW A;  4YIN A;  3ISG A;  3UE0 A;  2ZQA A;  2H5S A;  2XR0 A;  2R9X A;  3N4I A;  3PBR A;  1SDE A;  3HUO A;  3DWK A;  4KQQ A;  1BLC A;  3C7V A;  3RXX A;  2I72 A;  1VQQ A;  3FV7 A;  3M6H A;  1IEM A;  5GLA A;  4IED A;  4WMC A;  1K56 D;  3ZNT A;  4NK3 A;  1IKG A;  5EPH A;  1H8Y A;  4P6B A;  3ZG9 B;  3HLW A;  4UAA A;  5DTS A;  5D3O A;  3RJU A;  1KE3 A;  5EEC A;  5E2E A;  1XGJ A;  2OSU A;  2PU4 A;  1FR1 A;  4EBP A;  5GHY A;  3UDI A;  2XH9 A;  4KZ4 A;  3ZHH A;  5F1F A;  4GKU A;  2V1Z A;  2P9V B;  4L0L A;  4OLG A;  3MZE A;  2QZ6 A;  3A3J A;  1N4O A;  1WYC A;  4MBH A;  1E3U A;  4U0X A;  5FQ9 A;  3ZFZ A;  1H8Z A;  2C6W B;  3IXB A;  3HRE A;  1ESU A;  1GHP A;  5E2G A;  4P85 A;  5FQI A;  2H10 A;  4X6T A;  4LV2 A;  1XA1 A;  3GQZ A;  3SH8 A;  1FCO A;  4OOM A;  2XDM A;  1DJB A;  4DDS A;  2G2U A;  4DDY A;  2WGW B;  3S1Y A;  5A93 A;  4BJP A;  4FH4 A;  3G34 A;  3GV9 A;  2GDN A;  1H5X A;  3FKW A;  1FQG A;  3PBN A;  3QNC A;  1XGI A;  4OON A;  5EOO A;  2ZC3 B;  3S4X A;  1M6K A;  4N1H A;  3VP4 A;  5EVI A;  3IH9 A;  3V3R A;  1MWT A;  2ZC6 B;  3W4O A;  3VOZ A;  2ZM2 A;  1DJC A;  2HPB A;  4UA7 A;  3BEB A;  4RA7 A;  2ZQC A;  3V3S A;  3PAE A;  3IHA A;  1JWZ A;  5GL9 A;  4E3L A;  4WZ5 A;  1L0F A;  4JXG A;  1CK3 A;  4QU3 A;  3VP1 A;  4OPZ A;  3CMZ A;  2J9P A;  4C75 A;  3IT9 A;  3UE1 A;  3UE3 A;  4RX3 A;  3GVB A;  3NIA A;  1E25 A;  3C4P A;  3MKE A;  1KGE A;  2XEP A;  1K38 A;  2XFS A;  4JXS A;  1Z6F A;  5JYO A;  2HP6 A;  3PBT A;  3VFH A;  3QHY A;  4KZB A;  3BFE A;  1YLT A;  4LCL A;  4E3N A;  1HVB A;  5GLC A;  1JTD A;  1ONH A;  1SCW A;  2HDR A;  2ZD8 A;  3A3I A;  3OZH A;  3Q1F A;  4GZB A;  4HEF A;  1SKF A;  2WK0 A;  3BFG A;  3OCL A;  2ZMA A;  5FQM A;  3E2K A;  4LEN A;  2OV5 A;  3SS3 A;  3PTE A;  5EE8 A;  4E6X A;  1ES5 A;  5HAP A;  4JKT A;  4QY6 A;  4GB7 A;  3HVF A;  3MFD A;  3GSG A;  2WAE A;  2WKE A;  3M2J A;  3ZVW A;  5HW3 A;  2WZZ A;  3DW0 A;  3FWL A;  4K0W A;  4YFM A;  5FA7 A;  1ESI A;  3V5M A;  1I2S A;  1PW8 A;  4QY5 A;  3Q81 A;  5CRF A;  4U0T A;  4GN2 A;  4UA9 A;  5DTK A;  3LCE A;  4Q8I A;  1XKZ A;  1BUL A;  4S2P A;  2EXB A;  3IQA A;  3BLM A;  3VP2 A;  1W5D A;  1WYB A;  4HBU A;  4E3M A;  1SDN A;  5FAP A;  2IWB A;  4R3J A;  3UDX A;  1YQS A;  3WS5 A;  3BLS A;  1YLY A;  4ZJ1 A;  2HDQ A;  4X55 A;  2WKI A;  1XP4 A;  4KEN B;  5FAT A;  3SH7 A;  4F94 A;  3GR2 A;  2Y2N A;  1PYY A;  4JPM A;  4WYY A;  5FI2 A;  4QJG A;  1JWV A;  1PI4 A;  4WZ5 C;  2EFU A;  1L2S A;  4R3B A;  5M18 A;  3A3D A;  4FSF A;  2G2W A;  3HUM A;  3WS1 A;  3Q7V B;  3VSL A;  3JYI A;  2XD5 A;  2Y2M A;  5CGW A;  1HTZ A;  3OPL A;  4ID4 A;  1LLB A;  4KG2 A;  4E6W A;  3PBS A;  1XPB A;  4LCM A;  3P98 A;  2C5W B;  3OC2 A;  3IWO A;  3UN7 A;  1E4D A;  3N6I A;  5FQQ A;  1L0E A;  5AQA A;  4QD4 A;  1L0G A;  3Q82 A;  2XGN A;  3IF6 B;  3C4O A;  5FSR A;  1VM1 A;  5A90 A;  4BQM A;  2QPN A;  3OPH A;  3BFD A;  4N92 A;  3IWQ A;  1KVM A;  1MWS A;  1ALQ A;  2B5R A;  4RX2 A;  5HL1 A;  4WEL A;  1Q2P A;  5G18 A;  2WGW A;  4EUZ A;  3AGF A;  1JVJ A;  1K4F A;  4LV0 A;  3UNW A;  1ZC2 A;  1ES2 A;  2EX2 A;  4RVA A;  3OCN A;  5AQ9 A;  4JF5 A;  3C7U A;  3CZD A;  1SHV A;  4R1G A;  5F1G A;  4ZJ3 A;  3SS4 A;  1NXY A;  1JWP A;  2WYX A;  4KZ8 A;  3SS5 A;  3FYZ A;  2JBF A;  1M40 A;  1BT5 A;  4BD1 A;  1K56 A;  5DF9 A;  1TEM A;  2ZJ9 A;  2IWC A;  1ONG A;  4Y0T A;  1KDS A;  1ZG6 A;  1BLS A;  3HLD A;  4JLF A;  4OQI A;  1S0W A;  3WS4 A;  4DE0 A;  3OPP A;  1GHI A;  1YLW A;  5A91 A;  1KGF A;  3UDF A;  4BL3 A;  4KQO A;  5FQK A;  4OP8 A;  2PU2 A;  3FKV A;  2FFF B;  1MKI A;  4K0X A;  4O7D A;  3G2Y A;  2RL3 A;  4XXR A;  4JXW A;  3VOY A;  4M3K A;  4OLD A;  3VFF A;  4D2O A;  5E2F A;  1LHY A;  5FI6 A;  2Q9M A;  4S2L A;  3QNB A;  4KG5 A;  2V2F F;  4IBX A;  3PAG A;  3ITB A;  1AXB A;  4S2M A;  5HAR A;  1QMF A;  4ZJ2 A;  3NC8 A;  4PM9 A;  1KVL A;  4FH2 A;  1FOF A;  4JF4 A;  2BG1 A;  3IXH A;  2XLN A;  5CTN A;  5E2H A;  5TFQ A;  5GLD A;  1BLH A;  2WUQ A;  2VGJ A;  2FFY A;  2QMI A;  2Y4A A;  3O88 A;  4PM8 A;  3DTM A;  1I2W A;  4LV3 A;  4B4Z A;  5BOH A;  4P0M A;  4RYE A;  5AQB A;  2HDS A;  3AGD A;  3UPP A;  3ZCZ A;  1O7E A;  3UPO A;  3G35 A;  4ZTK A;  5A92 A;  1W8Q A;  2X71 A;  4KZ3 A;  4X68 A;  3NDG A;  5CEC A;  2E8I A;  3VMA A;  3DWZ A;  5EVL A;  3CJM A;  3NDE A;  1K4E A;  3WRZ A;  4DKI A;  4ZDX A;  2ZM0 A;  5CEB A;  5DTT A;  2XK1 A;  5F83 A;  2J7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...