4I3IA

Structures of it intermediate of photoactive yellow prtein e46q muntant from time-resolved laue crystallography collected at 14id aps
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Photoactive yellow protein
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4i3iA00
1GSVA 1XFNA 5DJTA 3FG8A 1S1ZA 3H7WB 1T1CA 2VV8A 4WUJA 2GJ3A 4GS9A 2W0NA 4HH2A 3IS2A 3EEHA 5DJUA 2V0WA 4EQ1A 1LSVA 2L1MA 2PYRA 3BY8A 3E4PA 1G28A 4F3LA 4WF0A 5EFWA 3ULFA 1OTDA 3RTYA 3A0VA 4HJ6A 5J7EA 3E4OA 4WL9A 2V1AA 1OTAA 1XFQA 2VLGA 3OLOA 4JGRA 1N9LA 3H7WA 4L9GA 5DKLA 1XJ3A 2JN7A 3LIFA 4XT2A 1DP8A 3B33A 1F98A 3MJQA 4YWZA 1P0ZA 1VB6A 1TS8A 1Y28A 4GW9A 3P7NA 4LRXC 5AVFA 2VEAA 3C8CA 4K08A 1T19A 4I38A 3D72A 1DP6A 3IBRA 3UB9A 5AVEA 1TS7A 4KUOA 2Z6DA 3RH8B 1GSXA 4LRYC 5G4YA 1OJGA 4WN5A 4L9EA 2QJ5A 3LUQA 4I3JA 4HP4A 5HD3A 4I5SA 4HIAA 5HDCA 4HQAA 4F3LB 5F68A 4KQDA 5G4ZA 2VV7A 5F5YA 4MN6A 2INWA 1UGUA 3BWLA 2Z6CA 4EEUA 4HHDA 4XT2B 4GCZA 4RQ9A 2ZOIA 5HD5A 1LSXA 4I3IA 1DP9A 1LT0A 4EESA 5HWWA 3NJAA 3H9WA 4E04A 2QHKA 4LLOB 3C2WA 4R3AA 1X0OA 1WA9A 4BBTA 4EETB 3LIBA 3K3CA 3LIDA 2D02A 3F1PB 2WKPA 2YKHA 3PHYA 4GHIA 2L4RA 2KDKA 3K3DA 3FC7A 1MZUA 4LRZE 1S1YA 4NXGA 5KIZA 1OTEA 3UB8A 2QWSA 2WKQA 2V0UA 1LL8A 1P97A 4WLAA 3LI8A 5IU1A 1V9ZA 5F6AA 3VE4A 2CMNA 4M4XA 2KX6A 4NXBA 4L9FA 2L0WA 4LPZA 5TBMA 2HV1A 2V1BA 4BBUA 5HWVA 3GECA 5HWTA 1BYWA 1S4RA 3LYXA 4HJ3A 3H82B 3E4QA 3HJKA 5I5LA 3F1PA 3CLOA 4PKYG 2PD8A 2PYPA 2I9VA 2P7JA 3A0SA 2EA9A 2W27A 5A8BA 4HOIA 1N9NA 3LIAA 3NOUC 4GHIB 3MXQA 1TS0A 2OWHA 2PR6A 2YKFA 1LSWA 1D7EA 1DRMA 4EXOA 1OTBA 4PKYA 4EEPA 1D06A 3CWFA 5HSQA 4I39A 3H82A 1S66L 2B02A 1T18A 4R38A 2VV6A 1OT6A 4HI4A 3A0RA 2A24A 4KUKA 1S4SA 1TS6A 2OWJA 5TBMB 3MFXA 4EERA 1XJ2A 3VOLA 5J4EA 3ICYA 1JNUA 1OT9A 3F1OB 1N9OA 3MQOA 4JGQA 2PD7A 4DJ2A 2BASA 4HY8A 4EW7A 2M1CA 3NHQA 2V9AA 2PHYA 1T1AA 2JHEA 3UMEA 2ZBBA 1UWPX 1XJ4A 3NOTC 4H6JB 5IS1A 4BBVA 3BY9A 4I3AA 1NWZA 2QJ7A 3SW1A 1EW0A 4NXEA 1OJ5A 3CAXA 2H28A 5HZHA 3F1NB 1S67L 3EWKA 1F9IA 2OOLA 3UB6A 3G6OA 4MN5A 2D01A 1OTIA 3F1OA 4HP9A 4GS9B 3UE6A 4B9OA 5J3WA 3LIEA 3PYPA 3IS2B 4NXFA 2A24B 2R78A 2J80A 1ODVA 1GSWA 4HH3A 2PR5A 1V9YA 4R70A 3VE3A 3MR0A 2WKRA 2ZOHA 1T1BA 5F69A 3KX0X 3LICA 4JGOA 3LI9A 5DKKA 3UB7A 2K7SA 1KOUA 3ZQ5A 2PDRA 3GDIA 3MQQA 5HDSA 3NOPC 2QKPA 5HDDA 1XJ6A 3UMDA 4H6JA 4JGPA 4DJ3A 1UWNX 4R6LA 3T50A 3HJIA 4HJ4A 4HNBA 3F1NA
chains in the Genus database with same CATH superfamily
2Y79A 5DJTA 5IHVA 1QMFA 1K25A 1PW1A 3IF6C 4QD4A 4GS9A 3SS5A 4HH2A 3IS2A 3EEHA 4ME4A 1LSVA 2W3GA 4X1LA 4DE2A 2WAFA 1YKDA 3E4PA 3DWZA 2X02A 1XX2A 2W1TB 1BLHA 4GB7A 3N8SA 4GLQA 2Y2MA 4BD0A 3T1XA 3A0VA 5FEGA 4HJ6A 4WYYA 5CEBA 3Q82A 3E4OA 2KOIA 1OPXA 4KZAA 4PM6A 3U4LP 4HESA 4L9GA 4U3TA 2OAQ1 4DDSA 3LCEA 3CPTA 4ZJ1A 3PR6A 3BLSA 4YWZA 2C6WB 3KYEA 5CEDA 2DCFA 4JXSA 4OP8A 2FZ0A 3PBOA 1GCEA 5AVFA 1GA0A 1YLJA 5FDSA 3D72A 2Y2GA 3MFDA 1DJCA 3M6HA 1BULA 1TS7A 2WAEA 4JF5A 1CJFA 3FPWA 4X6TA 3ZVWA 1FOFA 2Y55A 2K31A 4X68A 5M19A 3OPPA 5AQ9A 1K57A 5FAOA 1KVMA 4WN5A 4DF6A 2O99A 3IXDA 4JF6A 5HD3A 4I5SA 2QYBA 5E2EA 4GNUA 4HQAA 2IA2A 3SS3A 1FCNA 4KQQA 3UDXA 2XD5A 3QP2A 4KZ4A 4MLLA 5HAPA 3OCLA 3ZFZA 4EV4A 4EEUA 1NZUA 4GCZA 4MNRA 4PM9A 4WELA 3DW0A 3CPTB 3ZCZA 2WGIA 2V2FF 1W8YA 3UE1A 5HWWA 3FYZA 3IQAA 4E04A 4LLOB 3BFEA 5FI6A 3UDIA 3MSHA 3K2NA 3DAVA 1X0OA 2Z2MB 4PAUA 2BG1A 3C5AA 5CGXA 1TDLA 2XFSA 2GDNA 1ESUA 1K55A 2Y2HA 3ZG7B 3PAGA 5EVIA 2EWVA 2W3FA 4ID4A 3F1PB 1K54A 2ZMVA 4GHIA 3UNWA 3OCNA 4ZDXA 1C3BA 4Q0HA 1HLUP 3K3DA 3SH7A 2JE5A 4LRZE 4EU0A 1OTEA 2V0UA 3S1YA 4LENA 2HZ5A 4NKPA 4LV3A 4N9KA 1G68A 1BT5A 3FPVA 5L2FA 4PPRA 1CEGA 3BQAA 3G32A 3FZCA 1JWPA 4M4XA 1VETB 3N8LA 3G2YA 2J3WA 1FIKA 3U2AA 2E8IA 4LPZA 3IX4A 2HV1A 1U60A 4DE1A 4E3KA 4RYEA 1K56A 3GR2A 3LYXA 2O9CA 3E4QA 1YSPA 3MMHA 2FFFB 3HJKA 5I5LA 1K6RA 3WS1A 1VQQA 4Y7PA 1MWSA 4BENA 2I9VA 2XRNA 2P7JA 4OOLA 4X1MA 3CUEC 3NC8A 4O01A 4PM5A 1L0FA 2P9VB 2X01A 3M6BA 1N9NA 3LIAA 5EVIB 3GMWA 2PBYA 4GHIB 4FTXA 3IF6A 3MXQA 1Y4OA 2Q0OA 4E3LA 3ZG5A 2PR6A 4GDNA 1MWTA 1LSWA 2EX9A 4LV0A 1XGIA 1XGJA 1D7EA 1OTBA 3UE0A 1MWUA 4PKYA 1O7EA 4PMAA 3A3FA 4X53A 4JXGA 1D06A 3VFFA 1DJAA 4H8RA 2B02A 3O87A 3UPOA 1FR1A 4R4SA 4UA9A 4B4XA 2A24A 3GQZA 3ITAA 5L07A 3QNCA 1TS6A 3IXBA 2OLVA 3SZTA 5GLCA 5EVID 5GHZA 2HP6A 1JNUA 4M3KA 4JGQA 2ACGA 2EFXA 4N1HA 3IBJA 1DJBA 2QZ6A 3QNBA 1IYSA 5GHXA 1M40A 1FSYA 3G4PA 4MCWA 3V3SA 3EQUA 4YOFA 1YMSA 1T1AA 3B3XA 1TD5A 3P09A 5M1AA 5IS1A 3BY9A 4I3AA 4LCLA 3LY4A 3CAXA 3UY6A 3C7UA 3F1NB 1W5DA 2V8CA 3NBLA 4P85A 3EWKA 1F9IA 1ONGA 1NXYA 3LR0A 5DTKA 3W4PA 5CHMA 3UDFA 3JVUA 3C30A 3F1OA 5CERA 3UE6A 1PWCA 1HZOA 3O3VA 3PYPA 4OOMA 2A24B 3T4JA 5GLDA 4N1XA 2J80A 1TVFA 2JKRM 3HLCA 2EFUA 4HH3A 1V9YA 5EOOA 1RGZA 4FUWA 2ZOHA 4UEYA 2RCXA 3QP1A 3LI9A 2Y8HA 3LR5A 5DKKA 5CRFA 2JKTI 5GHYA 2K7SA 3G2ZA 2WKHA 2HP9A 3MQ0A 2QKPA 4QB8A 2Y2QA 4KZ6A 4DJ3A 1UWNX 3T50A 2EX6A 4JXWA 3N8RA 2G7UA 2Y2NA 3E2KA 4HBUA 3UB5P 1JTDA 1BTLA 3PBNA 4BQMA 4CJNA 2GNXA 2WK0A 1TF1A 4Q0JA 3H7WB 1ES3A 3WWXA 4OPRA 3BEBA 1JVJA 4L0LA 3IXGA 2ZM2A 3E0YA 3DTKA 1LHYA 4EQ1A 1BUEA 1ZHHB 4WZ4A 2V1ZA 3N4IA 1YLPA 2ZM8A 4LCMA 4YINA 2PYRA 4N9LA 3LO7A 3Q1FA 3A3JA 3R4KA 4Y2FA 4X56A 4Y13A 4F3LA 3W4QA 2LB5A 4C75A 2ZL1B 1KDSA 4NEED 3RTYA 4KZ8A 3FWLA 5EECA 3T12B 2VLGA 5DKLA 1XJ3A 3LIFA 3BECA 4XT2A 1MPLA 1P9WA 2W1RA 1W79A 3IHAA 4KZ3A 3IWOA 3NCKA 1F98A 4EBPA 1AWIA 2HDRA 1P0ZA 2JKGA 2P08A 1L3LA 1SKOA 5AJGA 2ZC4B 3EQVA 2QPNA 4LRXC 3IT9A 5HAQA 3C8CA 3NDGA 4I38A 2P74A 1DP6A 2W1TA 4R0QA 3G35A 1ZC2A 3R7WB 3SH9A 3CUEA 4ETXA 4FCFA 3VV4A 3RH8B 5HL1A 1QMEA 1IYPA 4LRYC 3UE3A 1EI5A 1OJGA 4Y5FA 5FATA 1NYMA 4C3QA 1EROA 5L09A 4HP4A 2HDUA 5AQ7A 1L0DA 2VZWA 3MXRA 5FQMA 2XQZA 1MWRA 5HDCA 4X25A 4Y3IA 4F3LB 1I2WA 2UV0E 4II7A 2O9AA 3DBAA 3A3IA 1MBLA 4OH0A 2NUPC 3RJUA 1UGUA 3BWLA 3B47A 1PWGA 1OMEA 4XT2B 1XA1A 4X69A 2Y4AA 3JYIA 1SZVA 4RQ9A 3T4SA 1L2SA 1LSXA 4I3IA 5HPIA 1WE4A 5FSRA 5GLBA 3WS2A 4ZJ2A 4EESA 2IWDA 4RA7A 1SKOB 2R9XA 3H9WA 3QP8A 4IBRA 4R3AA 2IWCA 4E3OA 5BOHA 1FSWA 2ZQCA 4G3WA 4EETB 2OSUA 3LIBA 2ZQ8A 3AGDA 3VFHA 5GLAA 4S2NA 3BFFA 4B88A 3LIDA 3HLGA 5FI7A 3O5YA 3Q81A 2ZC3B 3WS5A 1MZUA 4MDZA 2DNSA 4QY5A 4NXGA 5FQJA 4MBFA 3UB8A 3MZDA 4E3JA 1BZAA 3GTCA 4KQRA 1IELA 1ES4A 1ES2A 2VGLM 4K91A 4MBKA 3ZGAB 5CXWA 3CI6A 4S2IA 2VGKA 4R3JA 2HF6A 2P04A 2PU2A 3VE4A 2CC1A 4S2OA 2KX6A 3BW6A 1FCMA 4UQIM 2A49A 4IVIA 3T1QB 2L0WA 1XPBA 1WYCA 5TBMA 3T4QA 1BYWA 1S4RA 1SCWA 3CJMA 3IXHA 5U47A 4B4ZA 4P6BA 3HLEA 1ERQA 3F1PA 3ZG0A 4K0WA 1WYBA 3TG9A 2PD8A 2PYPA 4WEJA 2B5RA 1MXOA 4Y0TA 3PAEA 1YMXA 4YFMA 2WKEA 1PZPA 2W27A 4JF4A 2ZD8A 3CG5A 2VGLS 4OPQA 1ONHA 2J8YA 4R3BA 1ERMA 3VOZA 1VETA 1F5MA 4F94A 4UQIS 1FR6A 4OLGA 3IH8A 4RVAA 3CWFA 3KSIA 5HSQA 4I39A 1S66L 3UPNA 1S0WA 4IVKA 2Q9NA 2DRWA 4GD6A 1OT6A 1A0KA 2HGVA 1MKIA 1FQGA 2OWJA 5TBMB 3Q7VA 2P9VA 3VOLA 5J4EA 4OPYA 5FL3A 2A3UA 4IUKA 1N9OA 3MQOA 4IEDA 2BASA 5FQQA 3OC2A 4MEZA 1BLPA 3HLDA 4UAAA 4ARZA 4MBHA 4PHTA 1PIOA 1ZG6A 2M1CA 5M18A 3NHQA 2G2WA 2DMWA 3VP4A 5EV0A 2ZBBA 1XKZA 2XDMA 4XXRA 3TOIA 5J8XA 1EW0A 4NXEA 1CI8A 2H28A 5HZHA 4EBNA 1TDGA 4OONA 3P98A 1PZOA 4DKIA 5DFYA 2BTFP 3EEAA 2D01A 5HARA 4HBTA 4B9OA 3T4LA 4JKTA 3KSGA 4NXFA 5CHJA 4ZRRA 4S2JA 2E8JA 2WKRA 3Q7VB 1LLBA 5HX9A 4KG5A 3LICA 4Q0IA 2ZMFA 2PDRA 3BFGA 5KSCA 1NRFA 3GDIA 5HDSA 1PYYA 3HUOA 2ZC6B 1XJ6A 4P0MA 3W4OA 3NI9A 2XROA 4S2PA 4ARZB 2VGJA 1J9MA 4QU3A 4CLCB 3F1NA 3OPLA 1GSVA 1PFLA 1XFNA 5A92A 1KVLA 2VV8A 3NECA 4C6YA 2W0NA 5DJUA 3IX8A 2W3EA 3HUNA 2V0WA 2PRFA 1E25A 1YLTA 3SS4A 2VX8A 5A91A 1H8MA 3WRZA 2PT7A 3P01A 4DMZA 5E43A 4ZTKA 3BY8A 4KZ5A 4D60A 4K0XA 3OOVA 5DF7A 1G28A 4P6ZM 1SDEA 5E2HA 2XH9A 2LB9A 3MZEA 3BRMA 5EFWA 3RFBA 5TFQA 2X71A 3MF0A 2R9WA 5J7EA 4CLCD 3NY4A 1JTGA 5HAIA 2V1AA 5F1GA 3OLOA 4JGRA 4EUVA 1N9LA 3H7WA 2KLIA 2ZJ9A 4A5RA 2JN7A 2PU4A 4E3MA 1KE4A 5F82A 1CQAA 3PBSA 4N92A 5EVLA 4NETA 3ITBA 1DY6A 3B42A 1SDNA 1TS8A 4E6WA 1XXMA 4GW9A 1PI4A 1GHPA 2HP5A 2C5WB 1T19A 3GVBA 2XFTA 4GDBA 3IBRA 3UB9A 3M2KA 2Y2PA 2ZL1A 2Z6DA 3DTMA 3RXWA 4P6ZS 5FQ9A 5CGWA 4KZ9A 5K5BA 5G4YA 1YAXA 2Y91A 3VP1A 2PAVP 4FH2A 5FAPA 3V50A 2AVXA 2VA0A 4I3JA 4O8GA 5CGSA 1H5XA 3T4TA 4G3VA 3LR4A 2XGNA 3HREA 1CK3A 3IWIA 5F68A 4KQDA 1LL9A 5G4ZA 3VSKA 4OOYA 4S2LA 4KG6A 5EVEA 3VP3A 4ZJ3A 2VV7A 1PWDA 3HLFA 3LY3A 4MN6A 2INWA 5A90A 1L0EA 2JKTM 3A3DA 4WBGA 2Z6CA 4HHDA 3A3EA 2B18A 3HBRA 3T4KA 3WS0A 3ZG8B 3R7WA 5HD5A 1DP9A 5EM0A 2ZQ9A 2ZQDA 5FASA 2FFYA 1LT0A 4QWOA 1BLSA 1JWVA 3V5MA 2QHKA 1Z09A 3IH9A 5DFXA 3WRTA 1WA9A 5DF8A 3HUMA 3LEZA 3KSHA 1Z6FA 1NYYA 2WUQA 4GJ4A 3K3CA 4BL3A 3PBQA 2YKHA 2WZXA 3PHYA 3QHYA 3V67A 1YLYA 2HPBA 3FC7A 4Z1WA 1S1YA 3VP0A 5KIZA 2QWSA 3ISGA 4GKUA 5A93A 3S7PA 4LFUA 1YT4A 4CLCC 1LL8A 1P97A 3DWKA 3S22A 1V9ZA 5EOEA 3G34A 2CMNA 1S6RA 4L9FA 3M2JA 1BSGA 1N9BA 5FA7A 1PNEA 1YLZA 2V1BA 4BBUA 2H10A 1ES5A 3GECA 2V8FA 1L0GA 1CEFA 4HJ3A 3H82B 3V39A 1VEUB 1GHIA 3CLOA 4PKYG 1M6KA 3DTEA 1STZA 4GD8A 3HL9A 1XP4A 1MY8A 4O7DA 4OVDA 2XA7M 2WADA 5JYPA 4HOIA 2XF3A 5L8MA 2Y2KA 4ETZA 3UO9A 1K38A 1RCJA 5HW3A 1HVBA 3KO6A 1TS0A 4R4RA 2OWHA 3BYDA 5HFOA 3VSLA 5C5KA 2YKFA 1Y54A 5E2GA 3NIAA 4CPKA 4HEFA 3BLMA 5F1FA 1DRMA 3JVVA 3ZG9B 4EXOA 3C7VA 5CHUA 2OLUA 3ZDJA 1H8YA 2WGVA 2ZQ7A 5CECA 1T18A 4R38A 2VV6A 3QP4A 4UA6A 4U0TA 4HI4A 3HLBA 4KUKA 5E2FA 2J9PA 4WEKA 3TRCA 5HPFA 3MFXA 4LV1A 3MKEA 2XA7S 5D3OA 1NJ4A 4E6XA 1XJ2A 1JWZA 3ICYA 2JBFA 4Y15A 3ZVTA 2EXAA 5I94A 2PD7A 3GV9A 2O9BA 4JXVA 4OQGA 2HDQA 1KE3A 3S7OA 4GN2A 4CLCE 1E3UA 1IYQA 1NLZA 3GSGA 3IHBA 1HTZA 2M7VA 4H6JB 4JBFA 2QJ7A 3V3RA 2WZZA 4JPMA 1IEMA 4Q8IA 1NLYA 3QP6A 5MC7A 2OOLA 3N7WA 3Q7ZA 3G6OA 3W8KA 4GS9B 3LIEA 4MMNA 1O07A 3IS2B 2VJWA 2R78A 1ODVA 1GSWA 4R70A 3OPRA 4QJGA 2GX5A 4O0PA 4OP5A 4KG2A 4Y0UA 3VOYA 1T1BA 5F69A 2FH5A 2J3TC 1W8QA 3WS4A 1KOUA 3ZQ5A 3NOPC 4NK3A 1CF0A 3PBRA 3UMDA 3SH8A 4JGPA 4R6LA 1W63Q 2WYXA 5CX7A 1G6AA 3OZHA 3NULA 4HJ4A 4HNBA 2JCHA 4WMCD 4FSFA 2Z2LB 4QPRA 1H8ZA 3FG8A 2GZAA 1S1ZA 3E98A 2NUTC 3Q07A 1IKGA 3S7NA 1T1CA 4WUJA 3CMZA 2GJ3A 3BFDA 1YSQA 1IKIA 3IWQA 1IFQA 4EQIA 4MN7A 1I2SA 2H0YA 2L1MA 2W3DA 4JLFA 5DF9A 4GZBA 4BWIA 1G5UA 5DVAA 5IT5A 3AGFA 4WF0A 4DXBA 2OV5A 2JC7A 3ULFA 4E3IA 1OTDA 3O86A 2XEPA 3CITA 4WZ5C 4CLCA 1EWZA 4WL9A 1E3UD 3NDEA 3PXPA 1OTAA 1XFQA 5F83A 3BQ8A 2VK3A 5FAQA 1HD8A 3CHWP 1TEMA 3MS6A 1N4OA 3G30A 1DP8A 2Y2OA 3B33A 2UWXA 3C4PA 4QY6A 4DE0A 3MJQA 4KENB 5CTMA 5TR7A 1VB6A 1Y28A 3KYZA 3P7NA 2VEAA 3T4OA 4K08A 3GRJA 2JKFA 3I7JA 3W2ZA 4DE3A 3LEQA 1RGYA 5AVEA 5EUAA 2WGWA 1MC0A 4KUOA 2ZMAA 4EBLA 1GSXA 4RX2A 4XUXA 2ZQAA 2EXBA 4L9EA 1NRJA 2QJ5A 1NY0A 5FQKA 3LUQA 1LL5A 2Y2IA 3D9YA 3KSFA 2VKSA 4HIAA 2J9OA 3BJNA 1ZKJA 4BL2A 1J3WA 4LV2A 1Q2PA 2XLNA 5FDHA 4IUHA 4R1GA 4ZBEA 1D1JA 4OQ0A 1XA7A 2QMIA 5F5YA 2PBDP 3E2LA 4QHCA 4NG2A 3TW8A 3S4XA 3MKFA 4FOFA 3MZFA 1YM1A 1E4DA 5EM1A 5JYOA 2ZOIA 3JPUA 1FCOA 2HJ9C 3RXXA 3OPHA 3MBZA 3NJAA 1LI9A 4PM8A 2Y2LA 3C2WA 5DTSA 2XK1A 1LI0A 2V20A 4BBTA 4XUZA 1ZTUA 2H0TA 1K4EA 1CI9A 2WGWB 4ESPA 4LGWA 1PRQA 4Y17A 4BD1A 2ZLYA 1FILA 2D02A 2Y2JA 2WKPA 3HVFA 2L4RA 2KDKA 3FKVA 5AQBA 1ALQA 4EWFA 4IHQA 2WKQA 1YLWA 2A2LA 4Y0OA 1GHMA 2WKIA 5KZHA 1GA9A 4S2NC 4DRTA 3IX3A 1P9RA 3S7QA 2G2UA 4AFIA 4WLAA 2RL3A 3IF6B 3LI8A 5IU1A 2I72A 5F6AA 4BLMA 1SHVA 2JKRI 4NXBA 3EGXC 3L9KA 5DTTA 4BMWA 4DN0A 4S2MA 4CQHA 5HWVA 5HWTA 3ZYTA 4RX3A 3IF5A 1K56D 1W7FA 4OQIA 5FI2A 4FH4A 5EE8A 1RP5A 4DDYA 1ESIA 5CTNA 3O88A 3A0SA 4OKPA 2EX8A 1K6SA 2EA9A 4BJPA 2HJEA 5A8BA 3EGDC 3BM6A 4S2KA 3NOUC 1K57C 2EWWA 5EPHA 3N6IA 3LR3A 3DTIA 2IWBA 3CZDA 5LBRA 4R23A 3QP5A 3PTEA 4OQHA 4YNRA 4P87A 5G18A 2MJ6A 4EEPA 1K4FA 2BLSA 4PM7A 3H82A 1VEUA 5AQAA 4KQOA 3ZHHA 3VMAA 3BFCA 1VM1A 2HDSA 3A0RA 3TSGA 1Q2QA 3UN7A 3ZNYA 1S4SA 1BLCA 3LFVA 4KZBA 5TJJA 5FEFA 4EERA 2Q9MA 3D3OA 1IOUA 3FKWA 4WZ5A 3C4OA 3PBTA 4U0XA 5FQIA 2W3HA 4E3NA 5KMWA 1H0MA 1OT9A 4KZ7A 3F1OB 1PI5A 2XR0A 1SKFA 1AXBA 1PW8A 3D4FA 4FD8A 4DJ2A 2ZM0A 5GL9A 3HCYA 3AGEA 1K55C 4UHUA 5KSHA 4HY8A 4ZAMA 4EW7A 3OBFA 2K2NA 1G6OA 1ZG4A 3L7HA 5L10A 5EVIC 3FV7A 2V9AA 5TGFA 2XD1A 2PHYA 2Y59A 5HL6A 1K54C 2H5SA 2JHEA 3UMEA 3LGOA 3MXSA 1UWPX 1XJ4A 3NOTC 3VP2A 3KYQA 1KGFA 3TE8A 4BBVA 1IYOA 3HLWA 1NWZA 4D2OA 1F2KA 3SW1A 4Z9QA 1OJ5A 4GOGA 2J7VA 4DXCA 3TJZC 1VHMA 3T1SA 2J3TD 1S67L 4X55A 1NZOA 4OPZA 3UB6A 4IBXA 2XSSA 1W63M 2M7UA 4MN5A 1OTIA 4HP9A 1YQSA 3SOIA 5J3WA 1KDWA 3EOIA 1H3QA 3C38A 3VE3A 2PR5A 3MR0A 2B95A 1KGGA 4UA7A 1KE0A 4EUZA 3UPPA 4B93A 3KX0X 4JGOA 3UB7A 3G31A 2ZC5B 2ZC7A 3MQQA 1MKMA 5HDDA 3ZNTA 2OAP1 3T1RA 4H6JA 1YPRA 1I5QA 3HJIA 4IJGA 1ACFA 4G3KA 2EX2A 1KGEA 4OLDA 2O0YA 1K0KA 4WM9A 4WMCA
chains in the Genus database with same CATH topology
4FSFA 3PBNA 2Y79A 4QPRA 2GNXA 1GSVA 1XFNA 5DJTA 1TF1A 3FG8A 2GZAA 1S1ZA 4Q0JA 3E98A 3H7WB 2NUTC 3S7NA 1T1CA 2VV8A 4WUJA 2GJ3A 4GS9A 4L0LA 2W0NA 4HH2A 1YSQA 3IS2A 1IFQA 3EEHA 5DJUA 2W3EA 4MN7A 2V0WA 3E0YA 4EQ1A 4ME4A 1ZHHB 1LSVA 2VX8A 2W3GA 1H8MA 2L1MA 2W3DA 2PT7A 3P01A 4DMZA 1YKDA 2PYRA 5DF9A 3BY8A 3R4KA 3E4PA 4BWIA 3OOVA 4Y2FA 2W1TB 1G28A 4P6ZM 4F3LA 5IT5A 2LB9A 4GLQA 4WF0A 2LB5A 5EFWA 3ULFA 3RFBA 4NEED 1OTDA 3RTYA 3A0VA 3MF0A 3CITA 4HJ6A 5J7EA 4CLCD 4CLCA 3E4OA 4WL9A 2KOIA 3PXPA 1OPXA 2V1AA 1OTAA 1XFQA 2VLGA 3BQ8A 3OLOA 4JGRA 4EUVA 1N9LA 3H7WA 4L9GA 5DKLA 2KLIA 1XJ3A 2OAQ1 2JN7A 3LIFA 4XT2A 1DP8A 1P9WA 3B33A 2W1RA 3PBSA 1F98A 3PR6A 3MJQA 4YWZA 1P0ZA 3B42A 1VB6A 2P08A 5AJGA 1TS8A 1Y28A 3KYZA 3EQVA 2FZ0A 4GW9A 3P7NA 3PBOA 4LRXC 5AVFA 2VEAA 3T4OA 3C8CA 4K08A 1T19A 4I38A 3D72A 3W2ZA 1DP6A 3IBRA 3UB9A 5AVEA 2W1TA 1TS7A 3R7WB 3CUEA 4ETXA 1MC0A 4KUOA 3FPWA 2Z6DA 3VV4A 3RH8B 1GSXA 4P6ZS 4LRYC 2K31A 3UE3A 5K5BA 5G4YA 1OJGA 1YAXA 4Y5FA 4WN5A 4L9EA 1NRJA 2QJ5A 2VA0A 3LUQA 4I3JA 2O99A 4O8GA 4HP4A 2VZWA 3T4TA 4G3VA 3LR4A 3KSFA 2VKSA 5HD3A 4I5SA 2QYBA 4HIAA 5HDCA 4HQAA 4Y3IA 4F3LB 3BJNA 2IA2A 4II7A 5F68A 2O9AA 4KQDA 5G4ZA 3DBAA 4IUHA 2VV7A 3OCLA 5F5YA 4MN6A 2INWA 3TW8A 2NUPC 1UGUA 2JKTM 3BWLA 2Z6CA 3B47A 4EEUA 4HHDA 4FOFA 4XT2B 4GCZA 2B18A 4RQ9A 3T4KA 4WELA 3T4SA 3R7WA 2ZOIA 5HD5A 1LSXA 4I3IA 5HPIA 2HJ9C 1DP9A 1LT0A 4EESA 5HWWA 3NJAA 3H9WA 4E04A 2QHKA 4LLOB 3K2NA 5DFXA 3C2WA 4R3AA 1X0OA 4PAUA 1WA9A 4BBTA 1ZTUA 4G3WA 4EETB 3KSHA 3LIBA 4GJ4A 3K3CA 2EWVA 3PBQA 2W3FA 3LIDA 2D02A 3F1PB 2WKPA 2YKHA 2ZMVA 3PHYA 4GHIA 3OCNA 2L4RA 4Q0HA 3V67A 3O5YA 2KDKA 3K3DA 3FC7A 1MZUA 4Z1WA 4LRZE 4MDZA 4EU0A 1S1YA 4NXGA 5KIZA 1OTEA 3UB8A 2QWSA 4IHQA 2WKQA 2A2LA 2V0UA 2VGLM 3S7PA 4NKPA 4CLCC 3CI6A 1LL8A 1P97A 1P9RA 3S7QA 4AFIA 3FPVA 4WLAA 3LI8A 5IU1A 1V9ZA 5F6AA 2HF6A 2P04A 3VE4A 3BQAA 2CMNA 4M4XA 2KX6A 2JKRI 3BW6A 4NXBA 3EGXC 4L9FA 4UQIM 2J3WA 4BMWA 3U2AA 4DN0A 2L0WA 4LPZA 5TBMA 3T4QA 2HV1A 2V1BA 4BBUA 4CQHA 5HWVA 3GECA 5HWTA 3ZYTA 1BYWA 1S4RA 3LYXA 2O9CA 4HJ3A 3H82B 3E4QA 1YSPA 3MMHA 3HJKA 5I5LA 3F1PA 3CLOA 4PKYG 1STZA 2PD8A 2PYPA 4WEJA 2I9VA 2XRNA 2P7JA 3A0SA 4OOLA 2XA7M 2EA9A 4BJPA 3CUEC 2HJEA 2W27A 5A8BA 4O01A 4HOIA 5L8MA 1N9NA 3EGDC 3LIAA 3NOUC 4ETZA 2VGLS 4GHIB 3MXQA 3KO6A 2EWWA 1TS0A 2OWHA 3LR3A 2PR6A 5LBRA 5C5KA 2YKFA 1LSWA 1F5MA 4YNRA 4CLCB 1D7EA 1DRMA 3JVVA 4UQIS 1OTBA 4EXOA 4PKYA 2MJ6A 4EEPA 1D06A 3CWFA 3KSIA 5HSQA 3H82A 4I39A 1S66L 2B02A 1T18A 4R38A 2VV6A 4KQOA 1OT6A 4HI4A 3A0RA 2A24A 2HGVA 4KUKA 1S4SA 3LFVA 1TS6A 2OWJA 5TJJA 4WEKA 5TBMB 3TRCA 5HPFA 3MFXA 4EERA 3D3OA 1IOUA 2XA7S 1XJ2A 3VOLA 5J4EA 3PBTA 2W3HA 1JNUA 3ICYA 1OT9A 5FL3A 3F1OB 4IUKA 1N9OA 3MQOA 4JGQA 2PD7A 4DJ2A 2O9BA 2BASA 3IBJA 3OC2A 3HCYA 5KSHA 4HY8A 4EW7A 3S7OA 3OBFA 4ARZA 4PHTA 2K2NA 2M1CA 3NHQA 4CLCE 1G6OA 1NLZA 4MCWA 2V9AA 3EQUA 4YOFA 2PHYA 5HL6A 1T1AA 2DMWA 2JHEA 1TD5A 3UMEA 2ZBBA 1UWPX 1XJ4A 3NOTC 3KYQA 2M7VA 4H6JB 5IS1A 3TE8A 4BBVA 3BY9A 4I3AA 1NWZA 2QJ7A 3SW1A 1EW0A 4NXEA 1OJ5A 3CAXA 2H28A 3TJZC 5HZHA 3F1NB 1VHMA 2J3TD 1NLYA 1S67L 5MC7A 3EWKA 1F9IA 2OOLA 5DFYA 3UB6A 2XSSA 1W63M 3EEAA 3G6OA 3LR0A 2M7UA 4MN5A 2D01A 1OTIA 3JVUA 3C30A 3F1OA 4HP9A 4GS9B 3UE6A 4B9OA 3T4LA 5J3WA 3LIEA 4MMNA 3KSGA 3IS2B 3PYPA 2VJWA 4NXFA 4OOMA 2A24B 3EOIA 3T4JA 2R78A 2J80A 1ODVA 4ZRRA 1H3QA 2JKRM 3C38A 1GSWA 4HH3A 2PR5A 1V9YA 4R70A 3VE3A 3MR0A 2GX5A 2WKRA 2ZOHA 4O0PA 1T1BA 5F69A 4UEYA 2FH5A 2J3TC 4B93A 3KX0X 3LICA 4JGOA 3LI9A 4Q0IA 2Y8HA 2ZMFA 3LR5A 5DKKA 2JKTI 3UB7A 2K7SA 1KOUA 3ZQ5A 2PDRA 3GDIA 3MQQA 5HDSA 3NOPC 3MQ0A 1MKMA 2QKPA 5HDDA 2OAP1 1XJ6A 3PBRA 3UMDA 4H6JA 4JGPA 4DJ3A 1UWNX 4R6LA 3T50A 1W63Q 2XROA 5CX7A 2G7UA 3HJIA 4IJGA 4G3KA 4ARZB 2O0YA 4HJ4A 4HNBA 3F1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSV A;  1XFN A;  5DJT A;  3FG8 A;  1S1Z A;  3H7W B;  1T1C A;  2VV8 A;  4WUJ A;  2GJ3 A;  4GS9 A;  2W0N A;  4HH2 A;  3IS2 A;  3EEH A;  5DJU A;  2V0W A;  4EQ1 A;  1LSV A;  2L1M A;  2PYR A;  3BY8 A;  3E4P A;  1G28 A;  4F3L A;  4WF0 A;  5EFW A;  3ULF A;  1OTD A;  3RTY A;  3A0V A;  4HJ6 A;  5J7E A;  3E4O A;  4WL9 A;  2V1A A;  1OTA A;  1XFQ A;  2VLG A;  3OLO A;  4JGR A;  1N9L A;  3H7W A;  4L9G A;  5DKL A;  1XJ3 A;  2JN7 A;  3LIF A;  4XT2 A;  1DP8 A;  3B33 A;  1F98 A;  3MJQ A;  4YWZ A;  1P0Z A;  1VB6 A;  1TS8 A;  1Y28 A;  4GW9 A;  3P7N A;  4LRX C;  5AVF A;  2VEA A;  3C8C A;  4K08 A;  1T19 A;  4I38 A;  3D72 A;  1DP6 A;  3IBR A;  3UB9 A;  5AVE A;  1TS7 A;  4KUO A;  2Z6D A;  3RH8 B;  1GSX A;  4LRY C;  5G4Y A;  1OJG A;  4WN5 A;  4L9E A;  2QJ5 A;  3LUQ A;  4I3J A;  4HP4 A;  5HD3 A;  4I5S A;  4HIA A;  5HDC A;  4HQA A;  4F3L B;  5F68 A;  4KQD A;  5G4Z A;  2VV7 A;  5F5Y A;  4MN6 A;  2INW A;  1UGU A;  3BWL A;  2Z6C A;  4EEU A;  4HHD A;  4XT2 B;  4GCZ A;  4RQ9 A;  2ZOI A;  5HD5 A;  1LSX A;  4I3I A;  1DP9 A;  1LT0 A;  4EES A;  5HWW A;  3NJA A;  3H9W A;  4E04 A;  2QHK A;  4LLO B;  3C2W A;  4R3A A;  1X0O A;  1WA9 A;  4BBT A;  4EET B;  3LIB A;  3K3C A;  3LID A;  2D02 A;  3F1P B;  2WKP A;  2YKH A;  3PHY A;  4GHI A;  2L4R A;  2KDK A;  3K3D A;  3FC7 A;  1MZU A;  4LRZ E;  1S1Y A;  4NXG A;  5KIZ A;  1OTE A;  3UB8 A;  2QWS A;  2WKQ A;  2V0U A;  1LL8 A;  1P97 A;  4WLA A;  3LI8 A;  5IU1 A;  1V9Z A;  5F6A A;  3VE4 A;  2CMN A;  4M4X A;  2KX6 A;  4NXB A;  4L9F A;  2L0W A;  4LPZ A;  5TBM A;  2HV1 A;  2V1B A;  4BBU A;  5HWV A;  3GEC A;  5HWT A;  1BYW A;  1S4R A;  3LYX A;  4HJ3 A;  3H82 B;  3E4Q A;  3HJK A;  5I5L A;  3F1P A;  3CLO A;  4PKY G;  2PD8 A;  2PYP A;  2I9V A;  2P7J A;  3A0S A;  2EA9 A;  2W27 A;  5A8B A;  4HOI A;  1N9N A;  3LIA A;  3NOU C;  4GHI B;  3MXQ A;  1TS0 A;  2OWH A;  2PR6 A;  2YKF A;  1LSW A;  1D7E A;  1DRM A;  4EXO A;  1OTB A;  4PKY A;  4EEP A;  1D06 A;  3CWF A;  5HSQ A;  4I39 A;  3H82 A;  1S66 L;  2B02 A;  1T18 A;  4R38 A;  2VV6 A;  1OT6 A;  4HI4 A;  3A0R A;  2A24 A;  4KUK A;  1S4S A;  1TS6 A;  2OWJ A;  5TBM B;  3MFX A;  4EER A;  1XJ2 A;  3VOL A;  5J4E A;  3ICY A;  1JNU A;  1OT9 A;  3F1O B;  1N9O A;  3MQO A;  4JGQ A;  2PD7 A;  4DJ2 A;  2BAS A;  4HY8 A;  4EW7 A;  2M1C A;  3NHQ A;  2V9A A;  2PHY A;  1T1A A;  2JHE A;  3UME A;  2ZBB A;  1UWP X;  1XJ4 A;  3NOT C;  4H6J B;  5IS1 A;  4BBV A;  3BY9 A;  4I3A A;  1NWZ A;  2QJ7 A;  3SW1 A;  1EW0 A;  4NXE A;  1OJ5 A;  3CAX A;  2H28 A;  5HZH A;  3F1N B;  1S67 L;  3EWK A;  1F9I A;  2OOL A;  3UB6 A;  3G6O A;  4MN5 A;  2D01 A;  1OTI A;  3F1O A;  4HP9 A;  4GS9 B;  3UE6 A;  4B9O A;  5J3W A;  3LIE A;  3PYP A;  3IS2 B;  4NXF A;  2A24 B;  2R78 A;  2J80 A;  1ODV A;  1GSW A;  4HH3 A;  2PR5 A;  1V9Y A;  4R70 A;  3VE3 A;  3MR0 A;  2WKR A;  2ZOH A;  1T1B A;  5F69 A;  3KX0 X;  3LIC A;  4JGO A;  3LI9 A;  5DKK A;  3UB7 A;  2K7S A;  1KOU A;  3ZQ5 A;  2PDR A;  3GDI A;  3MQQ A;  5HDS A;  3NOP C;  2QKP A;  5HDD A;  1XJ6 A;  3UMD A;  4H6J A;  4JGP A;  4DJ3 A;  1UWN X;  4R6L A;  3T50 A;  3HJI A;  4HJ4 A;  4HNB A;  3F1N A; 
#chains in the Genus database with same CATH topology
 2Y79 A;  5DJT A;  5IHV A;  1QMF A;  1K25 A;  1PW1 A;  3IF6 C;  4QD4 A;  4GS9 A;  3SS5 A;  4HH2 A;  3IS2 A;  3EEH A;  4ME4 A;  1LSV A;  2W3G A;  4X1L A;  4DE2 A;  2WAF A;  1YKD A;  3E4P A;  3DWZ A;  2X02 A;  1XX2 A;  2W1T B;  1BLH A;  4GB7 A;  3N8S A;  4GLQ A;  2Y2M A;  4BD0 A;  3T1X A;  3A0V A;  5FEG A;  4HJ6 A;  4WYY A;  5CEB A;  3Q82 A;  3E4O A;  2KOI A;  1OPX A;  4KZA A;  4PM6 A;  3U4L P;  4HES A;  4L9G A;  4U3T A;  2OAQ 1;  4DDS A;  3LCE A;  3CPT A;  4ZJ1 A;  3PR6 A;  3BLS A;  4YWZ A;  2C6W B;  3KYE A;  5CED A;  2DCF A;  4JXS A;  4OP8 A;  2FZ0 A;  3PBO A;  1GCE A;  5AVF A;  1GA0 A;  1YLJ A;  5FDS A;  3D72 A;  2Y2G A;  3MFD A;  1DJC A;  3M6H A;  1BUL A;  1TS7 A;  2WAE A;  4JF5 A;  1CJF A;  3FPW A;  4X6T A;  3ZVW A;  1FOF A;  2Y55 A;  2K31 A;  4X68 A;  5M19 A;  3OPP A;  5AQ9 A;  1K57 A;  5FAO A;  1KVM A;  4WN5 A;  4DF6 A;  2O99 A;  3IXD A;  4JF6 A;  5HD3 A;  4I5S A;  2QYB A;  5E2E A;  4GNU A;  4HQA A;  2IA2 A;  3SS3 A;  1FCN A;  4KQQ A;  3UDX A;  2XD5 A;  3QP2 A;  4KZ4 A;  4MLL A;  5HAP A;  3OCL A;  3ZFZ A;  4EV4 A;  4EEU A;  1NZU A;  4GCZ A;  4MNR A;  4PM9 A;  4WEL A;  3DW0 A;  3CPT B;  3ZCZ A;  2WGI A;  2V2F F;  1W8Y A;  3UE1 A;  5HWW A;  3FYZ A;  3IQA A;  4E04 A;  4LLO B;  3BFE A;  5FI6 A;  3UDI A;  3MSH A;  3K2N A;  3DAV A;  1X0O A;  2Z2M B;  4PAU A;  2BG1 A;  3C5A A;  5CGX A;  1TDL A;  2XFS A;  2GDN A;  1ESU A;  1K55 A;  2Y2H A;  3ZG7 B;  3PAG A;  5EVI A;  2EWV A;  2W3F A;  4ID4 A;  3F1P B;  1K54 A;  2ZMV A;  4GHI A;  3UNW A;  3OCN A;  4ZDX A;  1C3B A;  4Q0H A;  1HLU P;  3K3D A;  3SH7 A;  2JE5 A;  4LRZ E;  4EU0 A;  1OTE A;  2V0U A;  3S1Y A;  4LEN A;  2HZ5 A;  4NKP A;  4LV3 A;  4N9K A;  1G68 A;  1BT5 A;  3FPV A;  5L2F A;  4PPR A;  1CEG A;  3BQA A;  3G32 A;  3FZC A;  1JWP A;  4M4X A;  1VET B;  3N8L A;  3G2Y A;  2J3W A;  1FIK A;  3U2A A;  2E8I A;  4LPZ A;  3IX4 A;  2HV1 A;  1U60 A;  4DE1 A;  4E3K A;  4RYE A;  1K56 A;  3GR2 A;  3LYX A;  2O9C A;  3E4Q A;  1YSP A;  3MMH A;  2FFF B;  3HJK A;  5I5L A;  1K6R A;  3WS1 A;  1VQQ A;  4Y7P A;  1MWS A;  4BEN A;  2I9V A;  2XRN A;  2P7J A;  4OOL A;  4X1M A;  3CUE C;  3NC8 A;  4O01 A;  4PM5 A;  1L0F A;  2P9V B;  2X01 A;  3M6B A;  1N9N A;  3LIA A;  5EVI B;  3GMW A;  2PBY A;  4GHI B;  4FTX A;  3IF6 A;  3MXQ A;  1Y4O A;  2Q0O A;  4E3L A;  3ZG5 A;  2PR6 A;  4GDN A;  1MWT A;  1LSW A;  2EX9 A;  4LV0 A;  1XGI A;  1XGJ A;  1D7E A;  1OTB A;  3UE0 A;  1MWU A;  4PKY A;  1O7E A;  4PMA A;  3A3F A;  4X53 A;  4JXG A;  1D06 A;  3VFF A;  1DJA A;  4H8R A;  2B02 A;  3O87 A;  3UPO A;  1FR1 A;  4R4S A;  4UA9 A;  4B4X A;  2A24 A;  3GQZ A;  3ITA A;  5L07 A;  3QNC A;  1TS6 A;  3IXB A;  2OLV A;  3SZT A;  5GLC A;  5EVI D;  5GHZ A;  2HP6 A;  1JNU A;  4M3K A;  4JGQ A;  2ACG A;  2EFX A;  4N1H A;  3IBJ A;  1DJB A;  2QZ6 A;  3QNB A;  1IYS A;  5GHX A;  1M40 A;  1FSY A;  3G4P A;  4MCW A;  3V3S A;  3EQU A;  4YOF A;  1YMS A;  1T1A A;  3B3X A;  1TD5 A;  3P09 A;  5M1A A;  5IS1 A;  3BY9 A;  4I3A A;  4LCL A;  3LY4 A;  3CAX A;  3UY6 A;  3C7U A;  3F1N B;  1W5D A;  2V8C A;  3NBL A;  4P85 A;  3EWK A;  1F9I A;  1ONG A;  1NXY A;  3LR0 A;  5DTK A;  3W4P A;  5CHM A;  3UDF A;  3JVU A;  3C30 A;  3F1O A;  5CER A;  3UE6 A;  1PWC A;  1HZO A;  3O3V A;  3PYP A;  4OOM A;  2A24 B;  3T4J A;  5GLD A;  4N1X A;  2J80 A;  1TVF A;  2JKR M;  3HLC A;  2EFU A;  4HH3 A;  1V9Y A;  5EOO A;  1RGZ A;  4FUW A;  2ZOH A;  4UEY A;  2RCX A;  3QP1 A;  3LI9 A;  2Y8H A;  3LR5 A;  5DKK A;  5CRF A;  2JKT I;  5GHY A;  2K7S A;  3G2Z A;  2WKH A;  2HP9 A;  3MQ0 A;  2QKP A;  4QB8 A;  2Y2Q A;  4KZ6 A;  4DJ3 A;  1UWN X;  3T50 A;  2EX6 A;  4JXW A;  3N8R A;  2G7U A;  2Y2N A;  3E2K A;  4HBU A;  3UB5 P;  1JTD A;  1BTL A;  3PBN A;  4BQM A;  4CJN A;  2GNX A;  2WK0 A;  1TF1 A;  4Q0J A;  3H7W B;  1ES3 A;  3WWX A;  4OPR A;  3BEB A;  1JVJ A;  4L0L A;  3IXG A;  2ZM2 A;  3E0Y A;  3DTK A;  1LHY A;  4EQ1 A;  1BUE A;  1ZHH B;  4WZ4 A;  2V1Z A;  3N4I A;  1YLP A;  2ZM8 A;  4LCM A;  4YIN A;  2PYR A;  4N9L A;  3LO7 A;  3Q1F A;  3A3J A;  3R4K A;  4Y2F A;  4X56 A;  4Y13 A;  4F3L A;  3W4Q A;  2LB5 A;  4C75 A;  2ZL1 B;  1KDS A;  4NEE D;  3RTY A;  4KZ8 A;  3FWL A;  5EEC A;  3T12 B;  2VLG A;  5DKL A;  1XJ3 A;  3LIF A;  3BEC A;  4XT2 A;  1MPL A;  1P9W A;  2W1R A;  1W79 A;  3IHA A;  4KZ3 A;  3IWO A;  3NCK A;  1F98 A;  4EBP A;  1AWI A;  2HDR A;  1P0Z A;  2JKG A;  2P08 A;  1L3L A;  1SKO A;  5AJG A;  2ZC4 B;  3EQV A;  2QPN A;  4LRX C;  3IT9 A;  5HAQ A;  3C8C A;  3NDG A;  4I38 A;  2P74 A;  1DP6 A;  2W1T A;  4R0Q A;  3G35 A;  1ZC2 A;  3R7W B;  3SH9 A;  3CUE A;  4ETX A;  4FCF A;  3VV4 A;  3RH8 B;  5HL1 A;  1QME A;  1IYP A;  4LRY C;  3UE3 A;  1EI5 A;  1OJG A;  4Y5F A;  5FAT A;  1NYM A;  4C3Q A;  1ERO A;  5L09 A;  4HP4 A;  2HDU A;  5AQ7 A;  1L0D A;  2VZW A;  3MXR A;  5FQM A;  2XQZ A;  1MWR A;  5HDC A;  4X25 A;  4Y3I A;  4F3L B;  1I2W A;  2UV0 E;  4II7 A;  2O9A A;  3DBA A;  3A3I A;  1MBL A;  4OH0 A;  2NUP C;  3RJU A;  1UGU A;  3BWL A;  3B47 A;  1PWG A;  1OME A;  4XT2 B;  1XA1 A;  4X69 A;  2Y4A A;  3JYI A;  1SZV A;  4RQ9 A;  3T4S A;  1L2S A;  1LSX A;  4I3I A;  5HPI A;  1WE4 A;  5FSR A;  5GLB A;  3WS2 A;  4ZJ2 A;  4EES A;  2IWD A;  4RA7 A;  1SKO B;  2R9X A;  3H9W A;  3QP8 A;  4IBR A;  4R3A A;  2IWC A;  4E3O A;  5BOH A;  1FSW A;  2ZQC A;  4G3W A;  4EET B;  2OSU A;  3LIB A;  2ZQ8 A;  3AGD A;  3VFH A;  5GLA A;  4S2N A;  3BFF A;  4B88 A;  3LID A;  3HLG A;  5FI7 A;  3O5Y A;  3Q81 A;  2ZC3 B;  3WS5 A;  1MZU A;  4MDZ A;  2DNS A;  4QY5 A;  4NXG A;  5FQJ A;  4MBF A;  3UB8 A;  3MZD A;  4E3J A;  1BZA A;  3GTC A;  4KQR A;  1IEL A;  1ES4 A;  1ES2 A;  2VGL M;  4K91 A;  4MBK A;  3ZGA B;  5CXW A;  3CI6 A;  4S2I A;  2VGK A;  4R3J A;  2HF6 A;  2P04 A;  2PU2 A;  3VE4 A;  2CC1 A;  4S2O A;  2KX6 A;  3BW6 A;  1FCM A;  4UQI M;  2A49 A;  4IVI A;  3T1Q B;  2L0W A;  1XPB A;  1WYC A;  5TBM A;  3T4Q A;  1BYW A;  1S4R A;  1SCW A;  3CJM A;  3IXH A;  5U47 A;  4B4Z A;  4P6B A;  3HLE A;  1ERQ A;  3F1P A;  3ZG0 A;  4K0W A;  1WYB A;  3TG9 A;  2PD8 A;  2PYP A;  4WEJ A;  2B5R A;  1MXO A;  4Y0T A;  3PAE A;  1YMX A;  4YFM A;  2WKE A;  1PZP A;  2W27 A;  4JF4 A;  2ZD8 A;  3CG5 A;  2VGL S;  4OPQ A;  1ONH A;  2J8Y A;  4R3B A;  1ERM A;  3VOZ A;  1VET A;  1F5M A;  4F94 A;  4UQI S;  1FR6 A;  4OLG A;  3IH8 A;  4RVA A;  3CWF A;  3KSI A;  5HSQ A;  4I39 A;  1S66 L;  3UPN A;  1S0W A;  4IVK A;  2Q9N A;  2DRW A;  4GD6 A;  1OT6 A;  1A0K A;  2HGV A;  1MKI A;  1FQG A;  2OWJ A;  5TBM B;  3Q7V A;  2P9V A;  3VOL A;  5J4E A;  4OPY A;  5FL3 A;  2A3U A;  4IUK A;  1N9O A;  3MQO A;  4IED A;  2BAS A;  5FQQ A;  3OC2 A;  4MEZ A;  1BLP A;  3HLD A;  4UAA A;  4ARZ A;  4MBH A;  4PHT A;  1PIO A;  1ZG6 A;  2M1C A;  5M18 A;  3NHQ A;  2G2W A;  2DMW A;  3VP4 A;  5EV0 A;  2ZBB A;  1XKZ A;  2XDM A;  4XXR A;  3TOI A;  5J8X A;  1EW0 A;  4NXE A;  1CI8 A;  2H28 A;  5HZH A;  4EBN A;  1TDG A;  4OON A;  3P98 A;  1PZO A;  4DKI A;  5DFY A;  2BTF P;  3EEA A;  2D01 A;  5HAR A;  4HBT A;  4B9O A;  3T4L A;  4JKT A;  3KSG A;  4NXF A;  5CHJ A;  4ZRR A;  4S2J A;  2E8J A;  2WKR A;  3Q7V B;  1LLB A;  5HX9 A;  4KG5 A;  3LIC A;  4Q0I A;  2ZMF A;  2PDR A;  3BFG A;  5KSC A;  1NRF A;  3GDI A;  5HDS A;  1PYY A;  3HUO A;  2ZC6 B;  1XJ6 A;  4P0M A;  3W4O A;  3NI9 A;  2XRO A;  4S2P A;  4ARZ B;  2VGJ A;  1J9M A;  4QU3 A;  4CLC B;  3F1N A;  3OPL A;  1GSV A;  1PFL A;  1XFN A;  5A92 A;  1KVL A;  2VV8 A;  3NEC A;  4C6Y A;  2W0N A;  5DJU A;  3IX8 A;  2W3E A;  3HUN A;  2V0W A;  2PRF A;  1E25 A;  1YLT A;  3SS4 A;  2VX8 A;  5A91 A;  1H8M A;  3WRZ A;  2PT7 A;  3P01 A;  4DMZ A;  5E43 A;  4ZTK A;  3BY8 A;  4KZ5 A;  4D60 A;  4K0X A;  3OOV A;  5DF7 A;  1G28 A;  4P6Z M;  1SDE A;  5E2H A;  2XH9 A;  2LB9 A;  3MZE A;  3BRM A;  5EFW A;  3RFB A;  5TFQ A;  2X71 A;  3MF0 A;  2R9W A;  5J7E A;  4CLC D;  3NY4 A;  1JTG A;  5HAI A;  2V1A A;  5F1G A;  3OLO A;  4JGR A;  4EUV A;  1N9L A;  3H7W A;  2KLI A;  2ZJ9 A;  4A5R A;  2JN7 A;  2PU4 A;  4E3M A;  1KE4 A;  5F82 A;  1CQA A;  3PBS A;  4N92 A;  5EVL A;  4NET A;  3ITB A;  1DY6 A;  3B42 A;  1SDN A;  1TS8 A;  4E6W A;  1XXM A;  4GW9 A;  1PI4 A;  1GHP A;  2HP5 A;  2C5W B;  1T19 A;  3GVB A;  2XFT A;  4GDB A;  3IBR A;  3UB9 A;  3M2K A;  2Y2P A;  2ZL1 A;  2Z6D A;  3DTM A;  3RXW A;  4P6Z S;  5FQ9 A;  5CGW A;  4KZ9 A;  5K5B A;  5G4Y A;  1YAX A;  2Y91 A;  3VP1 A;  2PAV P;  4FH2 A;  5FAP A;  3V50 A;  2AVX A;  2VA0 A;  4I3J A;  4O8G A;  5CGS A;  1H5X A;  3T4T A;  4G3V A;  3LR4 A;  2XGN A;  3HRE A;  1CK3 A;  3IWI A;  5F68 A;  4KQD A;  1LL9 A;  5G4Z A;  3VSK A;  4OOY A;  4S2L A;  4KG6 A;  5EVE A;  3VP3 A;  4ZJ3 A;  2VV7 A;  1PWD A;  3HLF A;  3LY3 A;  4MN6 A;  2INW A;  5A90 A;  1L0E A;  2JKT M;  3A3D A;  4WBG A;  2Z6C A;  4HHD A;  3A3E A;  2B18 A;  3HBR A;  3T4K A;  3WS0 A;  3ZG8 B;  3R7W A;  5HD5 A;  1DP9 A;  5EM0 A;  2ZQ9 A;  2ZQD A;  5FAS A;  2FFY A;  1LT0 A;  4QWO A;  1BLS A;  1JWV A;  3V5M A;  2QHK A;  1Z09 A;  3IH9 A;  5DFX A;  3WRT A;  1WA9 A;  5DF8 A;  3HUM A;  3LEZ A;  3KSH A;  1Z6F A;  1NYY A;  2WUQ A;  4GJ4 A;  3K3C A;  4BL3 A;  3PBQ A;  2YKH A;  2WZX A;  3PHY A;  3QHY A;  3V67 A;  1YLY A;  2HPB A;  3FC7 A;  4Z1W A;  1S1Y A;  3VP0 A;  5KIZ A;  2QWS A;  3ISG A;  4GKU A;  5A93 A;  3S7P A;  4LFU A;  1YT4 A;  4CLC C;  1LL8 A;  1P97 A;  3DWK A;  3S22 A;  1V9Z A;  5EOE A;  3G34 A;  2CMN A;  1S6R A;  4L9F A;  3M2J A;  1BSG A;  1N9B A;  5FA7 A;  1PNE A;  1YLZ A;  2V1B A;  4BBU A;  2H10 A;  1ES5 A;  3GEC A;  2V8F A;  1L0G A;  1CEF A;  4HJ3 A;  3H82 B;  3V39 A;  1VEU B;  1GHI A;  3CLO A;  4PKY G;  1M6K A;  3DTE A;  1STZ A;  4GD8 A;  3HL9 A;  1XP4 A;  1MY8 A;  4O7D A;  4OVD A;  2XA7 M;  2WAD A;  5JYP A;  4HOI A;  2XF3 A;  5L8M A;  2Y2K A;  4ETZ A;  3UO9 A;  1K38 A;  1RCJ A;  5HW3 A;  1HVB A;  3KO6 A;  1TS0 A;  4R4R A;  2OWH A;  3BYD A;  5HFO A;  3VSL A;  5C5K A;  2YKF A;  1Y54 A;  5E2G A;  3NIA A;  4CPK A;  4HEF A;  3BLM A;  5F1F A;  1DRM A;  3JVV A;  3ZG9 B;  4EXO A;  3C7V A;  5CHU A;  2OLU A;  3ZDJ A;  1H8Y A;  2WGV A;  2ZQ7 A;  5CEC A;  1T18 A;  4R38 A;  2VV6 A;  3QP4 A;  4UA6 A;  4U0T A;  4HI4 A;  3HLB A;  4KUK A;  5E2F A;  2J9P A;  4WEK A;  3TRC A;  5HPF A;  3MFX A;  4LV1 A;  3MKE A;  2XA7 S;  5D3O A;  1NJ4 A;  4E6X A;  1XJ2 A;  1JWZ A;  3ICY A;  2JBF A;  4Y15 A;  3ZVT A;  2EXA A;  5I94 A;  2PD7 A;  3GV9 A;  2O9B A;  4JXV A;  4OQG A;  2HDQ A;  1KE3 A;  3S7O A;  4GN2 A;  4CLC E;  1E3U A;  1IYQ A;  1NLZ A;  3GSG A;  3IHB A;  1HTZ A;  2M7V A;  4H6J B;  4JBF A;  2QJ7 A;  3V3R A;  2WZZ A;  4JPM A;  1IEM A;  4Q8I A;  1NLY A;  3QP6 A;  5MC7 A;  2OOL A;  3N7W A;  3Q7Z A;  3G6O A;  3W8K A;  4GS9 B;  3LIE A;  4MMN A;  1O07 A;  3IS2 B;  2VJW A;  2R78 A;  1ODV A;  1GSW A;  4R70 A;  3OPR A;  4QJG A;  2GX5 A;  4O0P A;  4OP5 A;  4KG2 A;  4Y0U A;  3VOY A;  1T1B A;  5F69 A;  2FH5 A;  2J3T C;  1W8Q A;  3WS4 A;  1KOU A;  3ZQ5 A;  3NOP C;  4NK3 A;  1CF0 A;  3PBR A;  3UMD A;  3SH8 A;  4JGP A;  4R6L A;  1W63 Q;  2WYX A;  5CX7 A;  1G6A A;  3OZH A;  3NUL A;  4HJ4 A;  4HNB A;  2JCH A;  4WMC D;  4FSF A;  2Z2L B;  4QPR A;  1H8Z A;  3FG8 A;  2GZA A;  1S1Z A;  3E98 A;  2NUT C;  3Q07 A;  1IKG A;  3S7N A;  1T1C A;  4WUJ A;  3CMZ A;  2GJ3 A;  3BFD A;  1YSQ A;  1IKI A;  3IWQ A;  1IFQ A;  4EQI A;  4MN7 A;  1I2S A;  2H0Y A;  2L1M A;  2W3D A;  4JLF A;  5DF9 A;  4GZB A;  4BWI A;  1G5U A;  5DVA A;  5IT5 A;  3AGF A;  4WF0 A;  4DXB A;  2OV5 A;  2JC7 A;  3ULF A;  4E3I A;  1OTD A;  3O86 A;  2XEP A;  3CIT A;  4WZ5 C;  4CLC A;  1EWZ A;  4WL9 A;  1E3U D;  3NDE A;  3PXP A;  1OTA A;  1XFQ A;  5F83 A;  3BQ8 A;  2VK3 A;  5FAQ A;  1HD8 A;  3CHW P;  1TEM A;  3MS6 A;  1N4O A;  3G30 A;  1DP8 A;  2Y2O A;  3B33 A;  2UWX A;  3C4P A;  4QY6 A;  4DE0 A;  3MJQ A;  4KEN B;  5CTM A;  5TR7 A;  1VB6 A;  1Y28 A;  3KYZ A;  3P7N A;  2VEA A;  3T4O A;  4K08 A;  3GRJ A;  2JKF A;  3I7J A;  3W2Z A;  4DE3 A;  3LEQ A;  1RGY A;  5AVE A;  5EUA A;  2WGW A;  1MC0 A;  4KUO A;  2ZMA A;  4EBL A;  1GSX A;  4RX2 A;  4XUX A;  2ZQA A;  2EXB A;  4L9E A;  1NRJ A;  2QJ5 A;  1NY0 A;  5FQK A;  3LUQ A;  1LL5 A;  2Y2I A;  3D9Y A;  3KSF A;  2VKS A;  4HIA A;  2J9O A;  3BJN A;  1ZKJ A;  4BL2 A;  1J3W A;  4LV2 A;  1Q2P A;  2XLN A;  5FDH A;  4IUH A;  4R1G A;  4ZBE A;  1D1J A;  4OQ0 A;  1XA7 A;  2QMI A;  5F5Y A;  2PBD P;  3E2L A;  4QHC A;  4NG2 A;  3TW8 A;  3S4X A;  3MKF A;  4FOF A;  3MZF A;  1YM1 A;  1E4D A;  5EM1 A;  5JYO A;  2ZOI A;  3JPU A;  1FCO A;  2HJ9 C;  3RXX A;  3OPH A;  3MBZ A;  3NJA A;  1LI9 A;  4PM8 A;  2Y2L A;  3C2W A;  5DTS A;  2XK1 A;  1LI0 A;  2V20 A;  4BBT A;  4XUZ A;  1ZTU A;  2H0T A;  1K4E A;  1CI9 A;  2WGW B;  4ESP A;  4LGW A;  1PRQ A;  4Y17 A;  4BD1 A;  2ZLY A;  1FIL A;  2D02 A;  2Y2J A;  2WKP A;  3HVF A;  2L4R A;  2KDK A;  3FKV A;  5AQB A;  1ALQ A;  4EWF A;  4IHQ A;  2WKQ A;  1YLW A;  2A2L A;  4Y0O A;  1GHM A;  2WKI A;  5KZH A;  1GA9 A;  4S2N C;  4DRT A;  3IX3 A;  1P9R A;  3S7Q A;  2G2U A;  4AFI A;  4WLA A;  2RL3 A;  3IF6 B;  3LI8 A;  5IU1 A;  2I72 A;  5F6A A;  4BLM A;  1SHV A;  2JKR I;  4NXB A;  3EGX C;  3L9K A;  5DTT A;  4BMW A;  4DN0 A;  4S2M A;  4CQH A;  5HWV A;  5HWT A;  3ZYT A;  4RX3 A;  3IF5 A;  1K56 D;  1W7F A;  4OQI A;  5FI2 A;  4FH4 A;  5EE8 A;  1RP5 A;  4DDY A;  1ESI A;  5CTN A;  3O88 A;  3A0S A;  4OKP A;  2EX8 A;  1K6S A;  2EA9 A;  4BJP A;  2HJE A;  5A8B A;  3EGD C;  3BM6 A;  4S2K A;  3NOU C;  1K57 C;  2EWW A;  5EPH A;  3N6I A;  3LR3 A;  3DTI A;  2IWB A;  3CZD A;  5LBR A;  4R23 A;  3QP5 A;  3PTE A;  4OQH A;  4YNR A;  4P87 A;  5G18 A;  2MJ6 A;  4EEP A;  1K4F A;  2BLS A;  4PM7 A;  3H82 A;  1VEU A;  5AQA A;  4KQO A;  3ZHH A;  3VMA A;  3BFC A;  1VM1 A;  2HDS A;  3A0R A;  3TSG A;  1Q2Q A;  3UN7 A;  3ZNY A;  1S4S A;  1BLC A;  3LFV A;  4KZB A;  5TJJ A;  5FEF A;  4EER A;  2Q9M A;  3D3O A;  1IOU A;  3FKW A;  4WZ5 A;  3C4O A;  3PBT A;  4U0X A;  5FQI A;  2W3H A;  4E3N A;  5KMW A;  1H0M A;  1OT9 A;  4KZ7 A;  3F1O B;  1PI5 A;  2XR0 A;  1SKF A;  1AXB A;  1PW8 A;  3D4F A;  4FD8 A;  4DJ2 A;  2ZM0 A;  5GL9 A;  3HCY A;  3AGE A;  1K55 C;  4UHU A;  5KSH A;  4HY8 A;  4ZAM A;  4EW7 A;  3OBF A;  2K2N A;  1G6O A;  1ZG4 A;  3L7H A;  5L10 A;  5EVI C;  3FV7 A;  2V9A A;  5TGF A;  2XD1 A;  2PHY A;  2Y59 A;  5HL6 A;  1K54 C;  2H5S A;  2JHE A;  3UME A;  3LGO A;  3MXS A;  1UWP X;  1XJ4 A;  3NOT C;  3VP2 A;  3KYQ A;  1KGF A;  3TE8 A;  4BBV A;  1IYO A;  3HLW A;  1NWZ A;  4D2O A;  1F2K A;  3SW1 A;  4Z9Q A;  1OJ5 A;  4GOG A;  2J7V A;  4DXC A;  3TJZ C;  1VHM A;  3T1S A;  2J3T D;  1S67 L;  4X55 A;  1NZO A;  4OPZ A;  3UB6 A;  4IBX A;  2XSS A;  1W63 M;  2M7U A;  4MN5 A;  1OTI A;  4HP9 A;  1YQS A;  3SOI A;  5J3W A;  1KDW A;  3EOI A;  1H3Q A;  3C38 A;  3VE3 A;  2PR5 A;  3MR0 A;  2B95 A;  1KGG A;  4UA7 A;  1KE0 A;  4EUZ A;  3UPP A;  4B93 A;  3KX0 X;  4JGO A;  3UB7 A;  3G31 A;  2ZC5 B;  2ZC7 A;  3MQQ A;  1MKM A;  5HDD A;  3ZNT A;  2OAP 1;  3T1R A;  4H6J A;  1YPR A;  1I5Q A;  3HJI A;  4IJG A;  1ACF A;  4G3K A;  2EX2 A;  1KGE A;  4OLD A;  2O0Y A;  1K0K A;  4WM9 A;  4WMC A; 
#chains in the Genus database with same CATH homology
 4FSF A;  3PBN A;  2Y79 A;  4QPR A;  2GNX A;  1GSV A;  1XFN A;  5DJT A;  1TF1 A;  3FG8 A;  2GZA A;  1S1Z A;  4Q0J A;  3E98 A;  3H7W B;  2NUT C;  3S7N A;  1T1C A;  2VV8 A;  4WUJ A;  2GJ3 A;  4GS9 A;  4L0L A;  2W0N A;  4HH2 A;  1YSQ A;  3IS2 A;  1IFQ A;  3EEH A;  5DJU A;  2W3E A;  4MN7 A;  2V0W A;  3E0Y A;  4EQ1 A;  4ME4 A;  1ZHH B;  1LSV A;  2VX8 A;  2W3G A;  1H8M A;  2L1M A;  2W3D A;  2PT7 A;  3P01 A;  4DMZ A;  1YKD A;  2PYR A;  5DF9 A;  3BY8 A;  3R4K A;  3E4P A;  4BWI A;  3OOV A;  4Y2F A;  2W1T B;  1G28 A;  4P6Z M;  4F3L A;  5IT5 A;  2LB9 A;  4GLQ A;  4WF0 A;  2LB5 A;  5EFW A;  3ULF A;  3RFB A;  4NEE D;  1OTD A;  3RTY A;  3A0V A;  3MF0 A;  3CIT A;  4HJ6 A;  5J7E A;  4CLC D;  4CLC A;  3E4O A;  4WL9 A;  2KOI A;  3PXP A;  1OPX A;  2V1A A;  1OTA A;  1XFQ A;  2VLG A;  3BQ8 A;  3OLO A;  4JGR A;  4EUV A;  1N9L A;  3H7W A;  4L9G A;  5DKL A;  2KLI A;  1XJ3 A;  2OAQ 1;  2JN7 A;  3LIF A;  4XT2 A;  1DP8 A;  1P9W A;  3B33 A;  2W1R A;  3PBS A;  1F98 A;  3PR6 A;  3MJQ A;  4YWZ A;  1P0Z A;  3B42 A;  1VB6 A;  2P08 A;  5AJG A;  1TS8 A;  1Y28 A;  3KYZ A;  3EQV A;  2FZ0 A;  4GW9 A;  3P7N A;  3PBO A;  4LRX C;  5AVF A;  2VEA A;  3T4O A;  3C8C A;  4K08 A;  1T19 A;  4I38 A;  3D72 A;  3W2Z A;  1DP6 A;  3IBR A;  3UB9 A;  5AVE A;  2W1T A;  1TS7 A;  3R7W B;  3CUE A;  4ETX A;  1MC0 A;  4KUO A;  3FPW A;  2Z6D A;  3VV4 A;  3RH8 B;  1GSX A;  4P6Z S;  4LRY C;  2K31 A;  3UE3 A;  5K5B A;  5G4Y A;  1OJG A;  1YAX A;  4Y5F A;  4WN5 A;  4L9E A;  1NRJ A;  2QJ5 A;  2VA0 A;  3LUQ A;  4I3J A;  2O99 A;  4O8G A;  4HP4 A;  2VZW A;  3T4T A;  4G3V A;  3LR4 A;  3KSF A;  2VKS A;  5HD3 A;  4I5S A;  2QYB A;  4HIA A;  5HDC A;  4HQA A;  4Y3I A;  4F3L B;  3BJN A;  2IA2 A;  4II7 A;  5F68 A;  2O9A A;  4KQD A;  5G4Z A;  3DBA A;  4IUH A;  2VV7 A;  3OCL A;  5F5Y A;  4MN6 A;  2INW A;  3TW8 A;  2NUP C;  1UGU A;  2JKT M;  3BWL A;  2Z6C A;  3B47 A;  4EEU A;  4HHD A;  4FOF A;  4XT2 B;  4GCZ A;  2B18 A;  4RQ9 A;  3T4K A;  4WEL A;  3T4S A;  3R7W A;  2ZOI A;  5HD5 A;  1LSX A;  4I3I A;  5HPI A;  2HJ9 C;  1DP9 A;  1LT0 A;  4EES A;  5HWW A;  3NJA A;  3H9W A;  4E04 A;  2QHK A;  4LLO B;  3K2N A;  5DFX A;  3C2W A;  4R3A A;  1X0O A;  4PAU A;  1WA9 A;  4BBT A;  1ZTU A;  4G3W A;  4EET B;  3KSH A;  3LIB A;  4GJ4 A;  3K3C A;  2EWV A;  3PBQ A;  2W3F A;  3LID A;  2D02 A;  3F1P B;  2WKP A;  2YKH A;  2ZMV A;  3PHY A;  4GHI A;  3OCN A;  2L4R A;  4Q0H A;  3V67 A;  3O5Y A;  2KDK A;  3K3D A;  3FC7 A;  1MZU A;  4Z1W A;  4LRZ E;  4MDZ A;  4EU0 A;  1S1Y A;  4NXG A;  5KIZ A;  1OTE A;  3UB8 A;  2QWS A;  4IHQ A;  2WKQ A;  2A2L A;  2V0U A;  2VGL M;  3S7P A;  4NKP A;  4CLC C;  3CI6 A;  1LL8 A;  1P97 A;  1P9R A;  3S7Q A;  4AFI A;  3FPV A;  4WLA A;  3LI8 A;  5IU1 A;  1V9Z A;  5F6A A;  2HF6 A;  2P04 A;  3VE4 A;  3BQA A;  2CMN A;  4M4X A;  2KX6 A;  2JKR I;  3BW6 A;  4NXB A;  3EGX C;  4L9F A;  4UQI M;  2J3W A;  4BMW A;  3U2A A;  4DN0 A;  2L0W A;  4LPZ A;  5TBM A;  3T4Q A;  2HV1 A;  2V1B A;  4BBU A;  4CQH A;  5HWV A;  3GEC A;  5HWT A;  3ZYT A;  1BYW A;  1S4R A;  3LYX A;  2O9C A;  4HJ3 A;  3H82 B;  3E4Q A;  1YSP A;  3MMH A;  3HJK A;  5I5L A;  3F1P A;  3CLO A;  4PKY G;  1STZ A;  2PD8 A;  2PYP A;  4WEJ A;  2I9V A;  2XRN A;  2P7J A;  3A0S A;  4OOL A;  2XA7 M;  2EA9 A;  4BJP A;  3CUE C;  2HJE A;  2W27 A;  5A8B A;  4O01 A;  4HOI A;  5L8M A;  1N9N A;  3EGD C;  3LIA A;  3NOU C;  4ETZ A;  2VGL S;  4GHI B;  3MXQ A;  3KO6 A;  2EWW A;  1TS0 A;  2OWH A;  3LR3 A;  2PR6 A;  5LBR A;  5C5K A;  2YKF A;  1LSW A;  1F5M A;  4YNR A;  4CLC B;  1D7E A;  1DRM A;  3JVV A;  4UQI S;  1OTB A;  4EXO A;  4PKY A;  2MJ6 A;  4EEP A;  1D06 A;  3CWF A;  3KSI A;  5HSQ A;  3H82 A;  4I39 A;  1S66 L;  2B02 A;  1T18 A;  4R38 A;  2VV6 A;  4KQO A;  1OT6 A;  4HI4 A;  3A0R A;  2A24 A;  2HGV A;  4KUK A;  1S4S A;  3LFV A;  1TS6 A;  2OWJ A;  5TJJ A;  4WEK A;  5TBM B;  3TRC A;  5HPF A;  3MFX A;  4EER A;  3D3O A;  1IOU A;  2XA7 S;  1XJ2 A;  3VOL A;  5J4E A;  3PBT A;  2W3H A;  1JNU A;  3ICY A;  1OT9 A;  5FL3 A;  3F1O B;  4IUK A;  1N9O A;  3MQO A;  4JGQ A;  2PD7 A;  4DJ2 A;  2O9B A;  2BAS A;  3IBJ A;  3OC2 A;  3HCY A;  5KSH A;  4HY8 A;  4EW7 A;  3S7O A;  3OBF A;  4ARZ A;  4PHT A;  2K2N A;  2M1C A;  3NHQ A;  4CLC E;  1G6O A;  1NLZ A;  4MCW A;  2V9A A;  3EQU A;  4YOF A;  2PHY A;  5HL6 A;  1T1A A;  2DMW A;  2JHE A;  1TD5 A;  3UME A;  2ZBB A;  1UWP X;  1XJ4 A;  3NOT C;  3KYQ A;  2M7V A;  4H6J B;  5IS1 A;  3TE8 A;  4BBV A;  3BY9 A;  4I3A A;  1NWZ A;  2QJ7 A;  3SW1 A;  1EW0 A;  4NXE A;  1OJ5 A;  3CAX A;  2H28 A;  3TJZ C;  5HZH A;  3F1N B;  1VHM A;  2J3T D;  1NLY A;  1S67 L;  5MC7 A;  3EWK A;  1F9I A;  2OOL A;  5DFY A;  3UB6 A;  2XSS A;  1W63 M;  3EEA A;  3G6O A;  3LR0 A;  2M7U A;  4MN5 A;  2D01 A;  1OTI A;  3JVU A;  3C30 A;  3F1O A;  4HP9 A;  4GS9 B;  3UE6 A;  4B9O A;  3T4L A;  5J3W A;  3LIE A;  4MMN A;  3KSG A;  3IS2 B;  3PYP A;  2VJW A;  4NXF A;  4OOM A;  2A24 B;  3EOI A;  3T4J A;  2R78 A;  2J80 A;  1ODV A;  4ZRR A;  1H3Q A;  2JKR M;  3C38 A;  1GSW A;  4HH3 A;  2PR5 A;  1V9Y A;  4R70 A;  3VE3 A;  3MR0 A;  2GX5 A;  2WKR A;  2ZOH A;  4O0P A;  1T1B A;  5F69 A;  4UEY A;  2FH5 A;  2J3T C;  4B93 A;  3KX0 X;  3LIC A;  4JGO A;  3LI9 A;  4Q0I A;  2Y8H A;  2ZMF A;  3LR5 A;  5DKK A;  2JKT I;  3UB7 A;  2K7S A;  1KOU A;  3ZQ5 A;  2PDR A;  3GDI A;  3MQQ A;  5HDS A;  3NOP C;  3MQ0 A;  1MKM A;  2QKP A;  5HDD A;  2OAP 1;  1XJ6 A;  3PBR A;  3UMD A;  4H6J A;  4JGP A;  4DJ3 A;  1UWN X;  4R6L A;  3T50 A;  1W63 Q;  2XRO A;  5CX7 A;  2G7U A;  3HJI A;  4IJG A;  4G3K A;  4ARZ B;  2O0Y A;  4HJ4 A;  4HNB A;  3F1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...