4I3IA

Structures of it intermediate of photoactive yellow prtein e46q muntant from time-resolved laue crystallography collected at 14id aps
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Luminescent protein
molecule keywords Photoactive yellow protein
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4i3iA00
3A0VA 1P97A 3PHYA 3D72A 4M4XA 1WA9A 1TS0A 3A0SA 4HOIA 1V9YA 1S66L 4EEUA 5AVFA 2OOLA 2V1BA 1P0ZA 3F1PA 4LRZE 5F69A 3UMEA 4GW9A 1OTAA 3IBRA 5IU1A 1GSXA 3H7WB 4GS9A 3G6OA 4H6JB 1LT0A 3FC7A 4WN5A 3MJQA 1T1BA 4H6JA 1XFQA 3ZQ5A 3UMDA 2VEAA 1UWNX 4I3IA 2Z6CA 2L4RA 4JGOA 1OT9A 3BY9A 4KUKA 3E4PA 2JHEA 3LIDA 4HNBA 4EXOA 1S1ZA 2JN7A 2VV8A 1TS6A 3GECA 3PYPA 4HIAA 4I38A 4EESA 5TBMB 5HWWA 4HH3A 2CMNA 2VV7A 3IS2B 2QJ5A 1N9OA 3CLOA 3MR0A 3LI9A 1GSVA 4MN5A 5HDCA 1OTIA 3UB7A 2PD8A 3LIBA 2QHKA 3H9WA 3UB9A 1LSWA 3P7NA 3HJKA 3ULFA 2V9AA 1TS8A 1ODVA 3F1OA 3H82A 3B33A 4L9FA 4KUOA 4HQAA 3NOTC 1EW0A 3LIFA 5DKKA 4KQDA 4MN6A 5G4YA 3UB6A 2B02A 3EEHA 3LIEA 3NOUC 1OJ5A 3VOLA 2YKFA 4BBTA 3SW1A 4I5SA 4R70A 1XJ2A 3UB8A 1X0OA 1Y28A 4WL9A 3LUQA 2P7JA 4LRXC 3K3DA 1TS7A 4WUJA 3NHQA 4NXGA 4EETB 3LI8A 3HJIA 1N9LA 1S4RA 2W27A 1T1CA 5DJUA 3UE6A 3KX0X 2INWA 3RH8B 4R6LA 5J7EA 4HJ6A 1VB6A 2PYRA 4EEPA 5HD3A 1JNUA 4WF0A 1DP8A 1S4SA 1XJ4A 2D02A 4R3AA 2EA9A 2GJ3A 1T18A 2PDRA 2L1MA 3RTYA 5A8BA 3NJAA 4L9GA 4PKYG 4XT2A 2VLGA 4YWZA 4DJ2A 1S1YA 3F1NB 3F1OB 3H82B 3MQQA 2YKHA 4NXEA 5HWTA 5HSQA 1OTBA 2QWSA 2V1AA 4HP4A 2KX6A 5G4ZA 2HV1A 1XFNA 4GHIA 4NXFA 3F1NA 3OLOA 4F3LB 5IS1A 4I39A 5TBMA 4I3JA 1OTDA 1V9ZA 2J80A 2WKPA 4NXBA 5HD5A 4F3LA 3MXQA 4WLAA 3VE4A 2M1CA 2W0NA 4DJ3A 3CWFA 1D7EA 2V0UA 3GDIA 1G28A 3FG8A 3T50A 1OJGA 5F68A 3ICYA 2K7SA 4JGQA 4LRYC 4GCZA 3E4OA 4GS9B 3MFXA 5J3WA 1LSVA 2ZOHA 4PKYA 4XT2B 1D06A 3A0RA 4HJ3A 1UGUA 3F1PB 2A24A 5I5LA 3VE3A 1MZUA 1OT6A 2PR5A 5HZHA 1NWZA 2KDKA 2OWHA 1OTEA 5EFWA 4HH2A 2QJ7A 3E4QA 2QKPA 1S67L 2R78A 1DP9A 4JGPA 3NOPC 5AVEA 4E04A 1N9NA 3BWLA 2H28A 4L9EA 2L0WA 4RQ9A 1T19A 3H7WA 4HHDA 4I3AA 3EWKA 4BBVA 3BY8A 5HWVA 5DKLA 1LL8A 2PYPA 1LSXA 2Z6DA 2PHYA 4BBUA 1F98A 5KIZA 3LICA 4EW7A 1UWPX 2ZBBA 2PD7A 2I9VA 4B9OA 2ZOIA 2D01A 4HP9A 5J4EA 2WKQA 4K08A 4EERA 2WKRA 4EQ1A 1XJ3A 5F6AA 4GHIB 4HI4A 4HJ4A 2V0WA 1BYWA 3MQOA 3LYXA 5F5YA 1GSWA 1XJ6A 5DJTA 1DP6A 2PR6A 1T1AA 2OWJA 2VV6A 3C2WA 3CAXA 4JGRA 2BASA 3K3CA 4LPZA 3LIAA 5HDSA 4LLOB 1DRMA 3C8CA 5HDDA 3IS2A 1KOUA 2A24B 1F9IA 4R38A 4HY8A
chains in the Genus database with same CATH superfamily
3A0VA 3O3VA 1K55C 1RCJA 1JWVA 1G6OA 3WS0A 3MJQA 2QZ6A 3W8KA 3D9YA 4I38A 1K55A 4CPKA 2EX8A 2V8FA 4K0WA 3KSGA 4Y0TA 4FUWA 2LB5A 3LIBA 3M6BA 3KYEA 1W8YA 3LY4A 1K54A 3CUEA 4Z1WA 3PBQA 4ZDXA 1SDNA 4UA9A 4KUOA 4P6ZS 2B95A 2Y79A 2YKFA 4LFUA 5F1GA 2WKEA 1LHYA 2P7JA 4ZJ2A 5IHVA 4C3QA 4EETB 4FTXA 3BECA 3UE6A 1T1CA 1K6SA 5CRFA 1S4SA 3HLGA 4NXEA 4HP4A 2J80A 4F3LA 1PIOA 4N92A 1IOUA 3ZNYA 3GDIA 1QMEA 1PWDA 3MFXA 1K4EA 1YLZA 4JF6A 1Z6FA 3F1PB 3UN7A 3G32A 3EGXC 1HTZA 2C5WB 4O0PA 4QY6A 4E3OA 4FOFA 3BFGA 2Y4AA 2KLIA 3LFVA 2MJ6A 4R0QA 2EWVA 1YKDA 2P08A 3V3RA 4DMZA 2G7UA 3NIAA 3R7WA 5CGWA 3QP5A 4LGWA 4GHIB 1LI9A 1YMXA 1PI5A 3C2WA 4JGRA 4QJGA 1K56D 4JXVA 3TG9A 4NETA 5D3OA 5KSHA 3NC8A 5FQKA 5IU1A 4IJGA 4OKPA 2Y2KA 2XH9A 4Y0OA 1BSGA 4DE3A 1ZG4A 2BTFP 2J9PA 3CMZA 2VV8A 4O01A 4OOMA 4U3TA 4OPZA 3P7NA 5FL3A 3T1XA 4GN2A 4UAAA 1M40A 1G6AA 5HARA 1E4DA 4WUJA 1TS7A 2O0YA 4NXGA 1L0DA 4DDSA 3ZVTA 2PYRA 3MZDA 3JVUA 2HDRA 1NLYA 1Y54A 4UA6A 4Y17A 3NJAA 4DXCA 1W63M 4FSFA 1CK3A 1YSPA 4OPQA 3UDIA 5EOEA 1V9ZA 4WLAA 1YSQA 2J8YA 3LO7A 4C6YA 3T50A 2DRWA 4DF6A 2ZQ7A 3ZDJA 4QU3A 5HZHA 1GA9A 3Q07A 2OWHA 4YOFA 1E25A 3A3DA 4JGPA 1N4OA 5A93A 1LL5A 3H7WA 4I3AA 2W3GA 3WS1A 3PBOA 1F98A 5CTNA 1UWPX 5FDHA 4N9LA 1SKOB 4EQ1A 3V50A 1GSWA 1DP6A 2WAEA 2XA7S 3DAVA 5DF8A 2Y59A 2JCHA 5EVEA 5KZHA 2ZM0A 5M1AA 5DF9A 3IQAA 5E43A 1S6RA 1V9YA 4HOIA 1DJCA 1P9WA 3MQ0A 4EBPA 3VP3A 4GS9A 2HGVA 2XR0A 2GZAA 4FH4A 4DXBA 4JGOA 3G2YA 1EWZA 1K38A 5DTKA 4EESA 2ZC6B 3IX4A 2HJ9C 1BLSA 3CLOA 3OPHA 2ZMVA 5FQIA 4L9FA 3OOVA 5DKKA 3QNCA 4BWIA 1OJ5A 2M7VA 1NZOA 1XPBA 1MWUA 1KE4A 3T12B 1KDSA 2W27A 4N9KA 3N8RA 5FQMA 1JNUA 1Q2PA 5BOHA 4MBHA 4PAUA 5GL9A 3H82B 4MN7A 1MY8A 5G4ZA 2VGLS 1ONGA 4GJ4A 3UE3A 4ZJ1A 1ESUA 4LCLA 2WUQA 4JGQA 2WAFA 3Q7VB 1DY6A 1VEUB 2XFSA 3PBNA 3P01A 1NWZA 3ZG0A 5EFWA 3E4QA 1S67L 3DWKA 2PYPA 4R1GA 5IT5A 4EW7A 4E3LA 3KO6A 1XJ3A 5EM1A 2OAP1 4S2IA 2FFFB 2W1TA 1XJ6A 3C7VA 3P09A 3S7NA 1GA0A 4M4XA 3D72A 3E2LA 5E2HA 2ZQCA 3UE1A 3LR5A 3EEAA 2FH5A 4OPRA 1IKGA 1M6KA 3IWQA 4KQOA 3SH9A 1FILA 2XSSA 4KUKA 2AVXA 2W3HA 3LI9A 1WYBA 2HP5A 3S22A 3ZHHA 3HJKA 4CLCE 3MFDA 3V3SA 2H0TA 3FZCA 3H82A 3NOTC 4Y3IA 1LL9A 1XJ2A 3TE8A 4LV0A 5GHZA 1ES4A 1VETA 3L9KA 1N9LA 5GHXA 4OP5A 1JTGA 3BFDA 4UQIM 1MWSA 5E2GA 4PKYG 3ZG9B 3PBTA 4YWZA 4MNRA 3S1YA 2KX6A 4GHIA 5HW3A 4I39A 4ETZA 3VE4A 3L7HA 5EOOA 2V0UA 2WADA 1G28A 5E2EA 1W79A 1MZUA 1KE3A 2RCXA 1TVFA 1PZPA 1K56A 3VV4A 1K54C 3CUEC 4FD8A 4HESA 3BWLA 4QHCA 3IXBA 2E8IA 2VJWA 4HEFA 3OPLA 1K0KA 3VP2A 1O7EA 2BG1A 3MXSA 1WYCA 4IBRA 1BZAA 2WKRA 3P98A 2XDMA 4HJ4A 2ZD8A 4LRXC 4Q0IA 2Y8HA 4LLOB 3C4PA 4I3JA 3LGOA 2VX8A 1FQGA 3EGDC 1CJFA 4GKUA 4ME4A 1KDWA 3LR0A 2HDSA 4OP8A 1W8QA 2V2FF 4MDZA 3ZQ5A 3HUMA 3ULFA 1OMEA 4YNRA 2JN7A 2PAVP 5TBMB 2CMNA 4MN5A 2VA0A 3OBFA 3PBRA 4JXSA 2RL3A 2JKTM 2XD1A 1TS8A 5AQBA 3UB6A 5CEBA 1IYQA 3ITAA 3FYZA 5DJUA 4JF4A 3W4QA 4E6XA 5A91A 1H8ZA 1G68A 3VFHA 3KSFA 2W3FA 1VM1A 3WWXA 3QP4A 3SS5A 4H8RA 4LV3A 3ICYA 4LRYC 3R7WB 1UGUA 2A24A 1AWIA 2QPNA 3IX3A 4WBGA 2R78A 5TFQA 3LEQA 5GLCA 4RQ9A 3HLWA 4P6BA 3BFCA 3GRJA 3HL9A 5J4EA 4EERA 4OONA 1W5DA 3BYDA 4R4SA 3MS6A 4JKTA 2VV6A 3JPUA 2J3TD 4XUXA 4LENA 4BD1A 1NYYA 4GD6A 3VP4A 4K91A 3NCKA 4GDNA 4QY5A 4CQHA 2O9BA 3F1PA 2XF3A 3A3IA 3RJUA 3ZCZA 2Y2MA 2EXAA 1OPXA 2V8CA 1ONHA 2ACGA 3IHBA 4OQGA 1OTIA 3ZNTA 2J3WA 3H9WA 4MEZA 3VP0A 2OSUA 2FFYA 2J9OA 5HAQA 3IHAA 5CTMA 3DW0A 2V1ZA 4UHUA 4YFMA 3LUQA 3WRTA 1FCMA 5FI7A 4ZJ3A 1K4FA 4U0XA 3S7OA 3RH8B 4KZ6A 1YMSA 1XJ4A 4WYYA 2EA9A 1T18A 4ZAMA 2L1MA 4EUVA 1PRQA 2Q9NA 3E2KA 2K2NA 3F1OB 3MQQA 2ZQDA 5HWTA 5HAIA 3TJZC 3FPVA 3AGFA 4U0TA 3OLOA 2VGLM 4BL3A 4P87A 4E3JA 5EM0A 2LB9A 4F94A 5FQQA 2JKGA 2XRNA 2PU2A 4OOYA 3EOIA 4XT2B 4WEJA 3ZG5A 4Y2FA 2H0YA 2QJ7A 4ARZA 3O86A 2R9WA 4L9EA 2L0WA 3U4LP 5KSCA 3EWKA 3RXWA 1CI8A 2PHYA 2FZ0A 3T1QB 4K08A 1VHMA 4EV4A 2M7UA 4C75A 2JKFA 4E3NA 1ERMA 1E3UA 1Q2QA 2Y2PA 3SZTA 2VGJA 4R3JA 5HDDA 3ZFZA 4PM8A 1PYYA 3C4OA 3A0SA 1FR6A 1BLPA 1OTAA 1L0GA 3DTMA 1T1BA 3N4IA 3OC2A 3LIDA 4XUZA 3MBZA 5CEDA 4JPMA 4RX3A 1GCEA 4X68A 4KQQA 3Q1FA 1HD8A 3IF6C 3DTIA 4NK3A 5G18A 3QP1A 1S4RA 2Q0OA 5HD3A 2GJ3A 3TW8A 3BFFA 1MWTA 2HDQA 2NUTC 4RX2A 4DJ2A 1S1YA 3S4XA 1VQQA 2YKHA 1NRJA 2C6WB 2J3TC 4BD0A 1WE4A 4A5RA 3M2KA 4DN0A 3N8LA 1OJGA 1ALQA 5L8MA 5GHYA 2OLVA 1D06A 3A0RA 3MKEA 5F83A 1N9NA 3NBLA 3Q82A 4S2NC 4OH0A 4KZ8A 2Z6DA 4UEYA 3E0YA 5KIZA 3BJNA 4R4RA 2PBYA 3T4LA 3VSLA 5HDSA 3T1SA 2P9VB 3NULA 1TS0A 3LEZA 5AVFA 2V1BA 2X02A 1GHMA 4JF5A 4WN5A 1VETB 1SZVA 2Y91A 4N1XA 2JHEA 4HNBA 3C38A 1TEMA 1E3UD 1XXMA 3IXHA 4WZ5C 3UB9A 4E3KA 3DTKA 1CI9A 5DF7A 3T1RA 3SH7A 1RP5A 2B02A 1P9RA 2OLUA 4G3VA 2B18A 4WL9A 3NHQA 1J3WA 3HJIA 3IF6A 4BLMA 2EX9A 5F82A 2WZXA 3PXPA 3IXGA 3ZG8B 5EVIB 4L9GA 1L0EA 3N8SA 4KZ3A 1YLJA 1OTBA 3PR6A 2HV1A 1RGYA 3CITA 5TBMA 4G3WA 3GVBA 4EU0A 1JVJA 3CWFA 4Y15A 2GNXA 4JXGA 5J3WA 3E4OA 4HJ3A 3O5YA 3UPNA 4PPRA 3GQZA 3OZHA 3SH8A 4GD8A 3O87A 5DKLA 2ZJ9A 3CJMA 4ZBEA 4QB8A 2W3DA 2O99A 2ZQAA 2WYXA 4HI4A 3LCEA 3BEBA 2ZC5B 3LYXA 2Y2GA 5AQ7A 4Q0JA 2V20A 5AJGA 3NDGA 2HP9A 2PRFA 1TDLA 1H8MA 5HL6A 1NY0A 3WS5A 3ZGAB 1ES2A 3BRMA 3HREA 1YLWA 4S2OA 3T4OA 4WMCD 5CHUA 1NXYA 1K25A 4GNUA 2R9XA 1KVMA 3C5AA 4ZRRA 2XROA 3OCLA 4HQAA 1EW0A 5G4YA 5HL1A 5EVIA 4RA7A 1NZUA 5JYPA 4ARZB 1H8YA 5JYOA 4GZBA 1W7FA 4G3KA 3B3XA 3T4KA 1CQAA 3DBAA 5TR7A 3RFBA 2VLGA 3MKFA 1BLCA 3F1NB 1CEFA 1IKIA 2JKRM 2P9VA 2Z2LB 2HPBA 2ZL1B 5U47A 2XQZA 4N1HA 4MLLA 5I5LA 1XKZA 5FSRA 3OPRA 3EQVA 1BUEA 1SKFA 4KZAA 3A3FA 4E6WA 3VOZA 4Z9QA 4OQIA 1PWGA 3LICA 5CGSA 4DE0A 5CHJA 2XD5A 4HBUA 3HLCA 2DCFA 4PMAA 4DRTA 5F5YA 4BJPA 1T1AA 1U60A 3K3CA 1L3LA 3HLEA 3IS2A 4QD4A 1F9IA 4R38A 3BFEA 5FDSA 4IUKA 4R23A 5EVIC 2EWWA 3KSIA 3H7WB 3G6OA 1LT0A 3UE0A 2X01A 2WGIA 3A3JA 2Z6CA 1HLUP 5EVLA 5DTSA 1K57C 2WZZA 4IEDA 2EX6A 3GTCA 4X6TA 3IH8A 4HH3A 2XEPA 3IS2B 3MR0A 5HDCA 3T4SA 2GX5A 3NI9A 3ZVWA 3HVFA 1SDEA 1VEUA 2ZC4B 3IWOA 3SW1A 3LR4A 5HX9A 2H5SA 2XGNA 3IH9A 4WMCA 1YLYA 3IT9A 1VB6A 4HJ6A 2EXBA 4DKIA 3SS4A 2PDRA 3IX8A 3RTYA 5A8BA 2KOIA 4GOGA 3V39A 4RYEA 5HSQA 2WKHA 1MXOA 5EECA 1YAXA 2QWSA 3GSGA 4X55A 2WKPA 2JC7A 2P04A 5FATA 3AGEA 4GCZA 4GS9B 2ZOHA 4D2OA 4K0XA 2OV5A 2WGVA 2QKPA 2ZQ8A 3NOPC 3DTEA 2QYBA 5TGFA 1GHPA 2X71A 2PD7A 3UB5P 4HP9A 3HCYA 4EBLA 5F69A 5HD5A 4OOLA 2XA7M 3M6HA 1F5MA 2ZMFA 1P97A 2OAQ1 2JBFA 4Y13A 3MZFA 3GR2A 3NY4A 4GW9A 2Y2NA 1SKOA 3IBJA 3BQAA 3V67A 1D1JA 3GV9A 3GECA 4HIAA 4OQHA 1TS6A 3G35A 4GB7A 3UB7A 4ESPA 1RGZA 4PM7A 3F1OA 3BM6A 2A2LA 5AQAA 1LI0A 4BBTA 3E98A 4PM6A 4B4ZA 1HVBA 4P0MA 1FCOA 5E2FA 3FWLA 3A3EA 3VOYA 1DP8A 4ZTKA 3FPWA 3MZEA 2WK0A 5EUAA 5FAPA 2VK3A 4S2NA 5F1FA 4B93A 2ZL1A 5IS1A 1O07A 1YPRA 2EX2A 2UWXA 2M1CA 1LLBA 3VP1A 4Q8IA 3Q81A 3D3OA 5CX7A 1ZC2A 2Q9MA 3UDXA 4WZ4A 2KDKA 4MBKA 1YQSA 4B4XA 2K31A 1JWPA 4Y7PA 2H28A 4HHDA 1ZKJA 1LL8A 1N9BA 3GMWA 2HDUA 4UQIS 4PM9A 5CHMA 5F6AA 3UY6A 4LPZA 2OWJA 1CEGA 2E8JA 1FIKA 3LIAA 3MMHA 2JKRI 3ISGA 1FSYA 3PHYA 5K5BA 4EEUA 2BLSA 3SOIA 4P6ZM 2B5RA 4GLQA 5HPFA 1GSXA 1Z09A 3UMDA 2G2UA 4I3IA 3HUOA 2L4RA 3BY9A 1IELA 3G2ZA 3T4TA 1S1ZA 5FAQA 3PYPA 5HWWA 3PBSA 1NJ4A 2IA2A 4HBTA 3TRCA 1MC0A 1NLZA 2V9AA 4KENB 1ODVA 4Y0UA 3FKWA 4KZ9A 3EEHA 3NOUC 1K6RA 1X0OA 4JBFA 2WKIA 3G31A 3QNBA 4BMWA 3QHYA 4OLGA 3FV7A 2INWA 2HP6A 3PTEA 5M19A 2NUPC 4D60A 4LCMA 4R3AA 5L10A 1QMFA 1STZA 2Y2HA 5L2FA 3KSHA 2ZC3B 5EPHA 3MF0A 4F3LB 2PU4A 3CZDA 1OTDA 4DDYA 1XP4A 2GDNA 1BT5A 1L2SA 1D7EA 3JYIA 1LSVA 5DFYA 2Z2MB 4S2LA 4NG2A 5AQ9A 4KQRA 3UDFA 2Y2IA 3R4KA 3VFFA 1PFLA 5FAOA 2Y2JA 1BULA 1H3QA 1ERQA 4RVAA 4WEKA 3TSGA 2ZBBA 4S2JA 1IYOA 1KE0A 3HBRA 3UPOA 1BLHA 3NECA 2V0WA 1J9MA 4KG2A 5DJTA 3FKVA 4KZ7A 3CAXA 2J7VA 4JLFA 1KGGA 1P0ZA 2IWDA 4H6JB 1UWNX 1OT9A 1EROA 4S2MA 4NKPA 2VV7A 1MKIA 2Y55A 4O8GA 5CXWA 3BQ8A 1YM1A 4E3IA 4E3MA 3D4FA 3M2JA 3B33A 4WELA 1FOFA 5HFOA 3UNWA 3VSKA 4I5SA 4IVKA 4CLCC 2G2WA 3K3DA 1GHIA 1PWCA 5FQ9A 3IXDA 2Y2OA 1FR1A 1H0MA 3KX0X 4X25A 3Q7ZA 4WF0A 3WRZA 4EUZA 3V5MA 3PAGA 3CI6A 3CHWP 3W4PA 3T4JA 2IWCA 3RXXA 1W63Q 4DE2A 2Y2QA 3C30A 3EQUA 4NXFA 4CLCA 4NXBA 4KG6A 2W0NA 4DJ3A 5EV0A 1CF0A 5F68A 4OQ0A 5DVAA 3HLDA 3Q7VA 1PZOA 1ZG6A 4B88A 4HH2A 4E04A 1ZTUA 4WZ5A 3OCNA 3MSHA 3VMAA 1ESIA 1G5UA 4O7DA 4X53A 4EQIA 3HLFA 3QP2A 4B9OA 2ZOIA 3CG5A 5EE8A 2ZMAA 3MQOA 1KVLA 3C8CA 3G30A 4X1MA 4KZ4A 1S66L 5DTTA 5C5KA 5HAPA 3IBRA 1FSWA 2P74A 4H6JA 2VEAA 3KYZA 4CJNA 1HZOA 2UV0E 4EBNA 4EXOA 3JVVA 4OPYA 1GSVA 3N7WA 2PD8A 2QHKA 1LSWA 1EI5A 1XA1A 2DMWA 3LY3A 1ACFA 2Y2LA 4FCFA 3W4OA 2HZ5A 4IUHA 2XLNA 3ITBA 4KQDA 1MBLA 4DE1A 1JTDA 3LIEA 5I94A 5FI2A 3UB8A 5TJJA 1ZHHB 4IHQA 4EWFA 3DWZA 4GDBA 4X1LA 4PHTA 2D02A 5KMWA 2ZM2A 4XT2A 3G34A 2VGKA 2V1AA 1YT4A 1XFNA 2PT7A 2HJEA 2EFXA 5FQJA 2HF6A 3HLBA 1TDGA 2K7SA 2DNSA 3PAEA 4PKYA 1OT6A 2W1TB 5M18A 2A3UA 3NDEA 1YLPA 3T4QA 3HUNA 3S7PA 4BBVA 5CECA 4BBUA 4NEED 5L07A 1Y4OA 1S0WA 5MC7A 3BLMA 1DJAA 1WA9A 1NRFA 2OOLA 3IF5A 4LRZE 2I72A 2O9AA 1ES5A 3FC7A 4XXRA 5GLAA 3ZG7B 5HPIA 3OPPA 4BENA 3E4PA 3N6IA 4PM5A 3C7UA 5CERA 5FEFA 1H5XA 4JXWA 5CGXA 4M3KA 1F2KA 1I2WA 1TD5A 4Y5FA 3VOLA 4QWOA 3TOIA 4R70A 1IYSA 4QPRA 1MKMA 5GLDA 4R6LA 4R3BA 4UA7A 4EEPA 1FCNA 5L09A 5DFXA 2XFTA 3UPPA 3I7JA 5FA7A 3SS3A 3ZYTA 4ETXA 1K57A 1PI4A 3W2ZA 5EVID 3BW6A 2XK1A 5FI6A 3IF6B 1I2SA 3MXQA 4L0LA 4IVIA 3K2NA 4OVDA 3FG8A 1SHVA 1NYMA 4LV1A 3VE3A 5LBRA 2PR5A 1A0KA 1OTEA 5GLBA 5AVEA 1IEMA 1I5QA 2PBDP 2ZM8A 5A90A 3BY8A 2IWBA 4KG5A 2JKTI 4II7A 4MCWA 3AGDA 2I9VA 2D01A 3S7QA 2WKQA 4X56A 3QP8A 3KYQA 1AXBA 2PR6A 3LR3A 4KZBA 4S2PA 1KOUA 2H10A 4LV2A 1IYPA 3CPTB 2CC1A 3UMEA 3WS2A 1XFQA 2VZWA 2JE5A 3G4PA 2ZC7A 3O88A 1SCWA 3UO9A 3B42A 4WM9A 2QJ5A 1N9OA 4P85A 4S2KA 1L0FA 3CPTA 5J8XA 5FEGA 2QMIA 4KZ5A 3LIFA 4MN6A 1PW8A 5FASA 4X69A 1Y28A 3QP6A 1DJBA 3LI8A 2W1RA 5J7EA 1KGEA 1BTLA 4Q0HA 4IBXA 4BL2A 1XGJA 1KGFA 4YINA 2O9CA 3WS4A 4CLCB 1MPLA 2W3EA 3F1NA 1JWZA 3B47A 2EFUA 1ES3A 1YLTA 4ID4A 5A92A 3U2AA 2ZLYA 1XA7A 2VKSA 3MXRA 4MMNA 2ZQ9A 1PNEA 1DP9A 2WGWA 1XX2A 2WGWB 1T19A 3IWIA 5HWVA 1IFQA 1LSXA 3BLSA 1C3BA 1TF1A 2A49A 4FH2A 1MWRA 1XGIA 4MBFA 1BYWA 4OLDA 4BQMA 2BASA 4AFIA 1DRMA 4CLCD 1PW1A 2A24B 4HY8A
chains in the Genus database with same CATH topology
3A0VA 2VX8A 1H8MA 3EGDC 5HL6A 4ME4A 1P0ZA 3LR0A 1G6OA 4H6JB 3MJQA 4MDZA 3ZQ5A 1UWNX 3ULFA 3T4OA 1OT9A 4YNRA 2JN7A 4I38A 4NKPA 5TBMB 2CMNA 2VV7A 2VA0A 3OBFA 3KSGA 3PBRA 4MN5A 4O8GA 2LB5A 3LIBA 3BQ8A 2JKTM 3CUEA 4ZRRA 4Z1WA 1TS8A 3PBQA 2XROA 3OCLA 3B33A 4WELA 4KUOA 4P6ZS 4HQAA 1EW0A 5G4YA 3UB6A 2Y79A 2YKFA 4CLCC 4I5SA 4ARZB 2P7JA 3K3DA 4EETB 4G3KA 3T4KA 5DJUA 1T1CA 3UE6A 3KX0X 4WF0A 1S4SA 3DBAA 3CI6A 3RFBA 2VLGA 3T4JA 3KSFA 3F1NB 4NXEA 1W63Q 2W3FA 4HP4A 3C30A 3EQUA 4NXFA 2JKRM 2J80A 4CLCA 4NXBA 4F3LA 1IOUA 2W0NA 4DJ3A 3GDIA 5F68A 3ICYA 4LRYC 3MFXA 3R7WB 5I5LA 1UGUA 3F1PB 2A24A 3EQVA 3EGXC 4HH2A 4O0PA 2R78A 4E04A 1ZTUA 4FOFA 4RQ9A 3OCNA 2KLIA 3LFVA 2MJ6A 3LICA 2EWVA 1YKDA 2P08A 4DMZA 4B9OA 2G7UA 2ZOIA 3R7WA 5J4EA 4EERA 4GHIB 3MQOA 5F5YA 4BJPA 1T1AA 2VV6A 3C2WA 4JGRA 3K3CA 3C8CA 3IS2A 2J3TD 1F9IA 4R38A 4IUKA 1S66L 4CQHA 2EWWA 2O9BA 3F1PA 5KSHA 5C5KA 3KSIA 3IBRA 5IU1A 4IJGA 3H7WB 3G6OA 1LT0A 4H6JA 2VEAA 3KYZA 2Z6CA 1OPXA 4EXOA 2VV8A 4O01A 3JVVA 4HH3A 3IS2B 4OOMA 3MR0A 1GSVA 5HDCA 1OTIA 3T4SA 2PD8A 2J3WA 2QHKA 3H9WA 1LSWA 3P7NA 2GX5A 2DMWA 5FL3A 4IUHA 4KQDA 3LIEA 3SW1A 3LR4A 3UB8A 5TJJA 1ZHHB 3LUQA 4IHQA 4WUJA 1TS7A 2O0YA 4NXGA 3S7OA 3RH8B 4HJ6A 1VB6A 2PYRA 1XJ4A 3JVUA 4PHTA 2D02A 2EA9A 1NLYA 1T18A 2PDRA 2L1MA 3RTYA 4EUVA 3NJAA 5A8BA 2KOIA 4XT2A 1W63M 4FSFA 2K2NA 3F1OB 3MQQA 5HSQA 5HWTA 1YSPA 3TJZC 1YAXA 2QWSA 3FPVA 2V1AA 1XFNA 3OLOA 2VGLM 1V9ZA 2WKPA 2PT7A 2HJEA 4WLAA 1YSQA 2LB9A 2P04A 2HF6A 3T50A 2XRNA 2K7SA 4GCZA 4GS9B 2ZOHA 3EOIA 4PKYA 4XT2B 4WEJA 4Y2FA 1OT6A 2W1TB 5HZHA 2OWHA 4YOFA 2QJ7A 2QKPA 4ARZA 4JGPA 3NOPC 3T4QA 4L9EA 2L0WA 3S7PA 3H7WA 2QYBA 4I3AA 2W3GA 3EWKA 4BBVA 2PHYA 3PBOA 4BBUA 1F98A 4NEED 1UWPX 2PD7A 4HP9A 2FZ0A 4K08A 1VHMA 4EQ1A 2M7UA 3HCYA 1GSWA 1DP6A 2XA7S 5F69A 5MC7A 5HD5A 4OOLA 5HDDA 2XA7M 1F5MA 2ZMFA 5DF9A 1P97A 2OAQ1 1WA9A 3A0SA 4HOIA 1V9YA 2OOLA 1P9WA 4LRZE 3MQ0A 4GW9A 1OTAA 2O9AA 4GS9A 2HGVA 3FC7A 2GZAA 1T1BA 3IBJA 3BQAA 3V67A 5HPIA 4JGOA 3OC2A 3E4PA 3LIDA 3GECA 4HIAA 1TS6A 4EESA 2HJ9C 3CLOA 3UB7A 2ZMVA 3F1OA 4L9FA 2A2LA 3OOVA 5DKKA 1TD5A 4Y5FA 3VOLA 4BWIA 1OJ5A 4BBTA 4R70A 3E98A 4QPRA 2M7VA 1MKMA 1S4RA 2W27A 4R6LA 4EEPA 5HD3A 1JNUA 5DFXA 1DP8A 2GJ3A 3TW8A 3ZYTA 4ETXA 3FPWA 3W2ZA 4PAUA 2NUTC 3BW6A 4DJ2A 1S1YA 3H82B 2YKHA 4MN7A 1NRJA 5G4ZA 2VGLS 4B93A 2J3TC 4GJ4A 3UE3A 5IS1A 3MXQA 4L0LA 2M1CA 4DN0A 3K2NA 3FG8A 1OJGA 4JGQA 3D3OA 5CX7A 5L8MA 3VE3A 1D06A 3A0RA 3PBNA 3P01A 5LBRA 2PR5A 1NWZA 2KDKA 1OTEA 5EFWA 3E4QA 1S67L 2K31A 5AVEA 1N9NA 2H28A 4HHDA 3BY8A 1LL8A 2PYPA 2Z6DA 4UEYA 2JKTI 3E0YA 5IT5A 5KIZA 4II7A 4EW7A 4UQIS 4MCWA 3KO6A 2I9VA 3BJNA 2D01A 3S7QA 2WKQA 1XJ3A 5F6AA 2OAP1 3KYQA 2W1TA 1XJ6A 3T4LA 2PR6A 4LPZA 2OWJA 3LR3A 3LIAA 5HDSA 3MMHA 2JKRI 1KOUA 3S7NA 4M4XA 3PHYA 3D72A 1TS0A 5K5BA 4EEUA 5AVFA 2V1BA 3EEAA 3LR5A 4P6ZM 2FH5A 3UMEA 4GLQA 5HPFA 1GSXA 4WN5A 4KQOA 1XFQA 3UMDA 2VZWA 4I3IA 2L4RA 2XSSA 3BY9A 4KUKA 2JHEA 4HNBA 3T4TA 1S1ZA 3PYPA 5HWWA 3C38A 3B42A 3PBSA 2W3HA 2QJ5A 1N9OA 3LI9A 2IA2A 3TRCA 1MC0A 3UB9A 1NLZA 4CLCE 3HJKA 2V9AA 1ODVA 3H82A 3NOTC 3LIFA 4MN6A 4Y3IA 2B02A 3EEHA 3NOUC 1P9RA 4G3VA 1XJ2A 1X0OA 1Y28A 2B18A 4WL9A 3TE8A 3NHQA 3LI8A 3HJIA 4BMWA 1N9LA 2W1RA 2INWA 5J7EA 3PXPA 2NUPC 4Q0HA 4R3AA 4UQIM 4L9GA 4PKYG 1STZA 3PBTA 4YWZA 3KSHA 2O9CA 1OTBA 3PR6A 2KX6A 3MF0A 2HV1A 4GHIA 4CLCB 2W3EA 3CITA 3F1NA 4F3LB 4I39A 5TBMA 3B47A 4I3JA 1OTDA 4G3WA 4EU0A 4ETZA 3VE4A 3CWFA 1D7EA 2V0UA 1G28A 2GNXA 3U2AA 5J3WA 3E4OA 1LSVA 5DFYA 2VKSA 4HJ3A 1MZUA 3O5YA 4MMNA 3VV4A 1DP9A 3CUEC 3BWLA 3R4KA 1T19A 2VJWA 5HWVA 5DKLA 1IFQA 1LSXA 1H3QA 1TF1A 4WEKA 2ZBBA 2W3DA 2WKRA 2O99A 4HI4A 4HJ4A 2V0WA 1BYWA 3LYXA 5DJTA 4LRXC 4Q0IA 3CAXA 4Q0JA 2BASA 2Y8HA 4LLOB 1DRMA 4AFIA 4CLCD 2A24B 5AJGA 4HY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0V A;  1P97 A;  3PHY A;  3D72 A;  4M4X A;  1WA9 A;  1TS0 A;  3A0S A;  4HOI A;  1V9Y A;  1S66 L;  4EEU A;  5AVF A;  2OOL A;  2V1B A;  1P0Z A;  3F1P A;  4LRZ E;  5F69 A;  3UME A;  4GW9 A;  1OTA A;  3IBR A;  5IU1 A;  1GSX A;  3H7W B;  4GS9 A;  3G6O A;  4H6J B;  1LT0 A;  3FC7 A;  4WN5 A;  3MJQ A;  1T1B A;  4H6J A;  1XFQ A;  3ZQ5 A;  3UMD A;  2VEA A;  1UWN X;  4I3I A;  2Z6C A;  2L4R A;  4JGO A;  1OT9 A;  3BY9 A;  4KUK A;  3E4P A;  2JHE A;  3LID A;  4HNB A;  4EXO A;  1S1Z A;  2JN7 A;  2VV8 A;  1TS6 A;  3GEC A;  3PYP A;  4HIA A;  4I38 A;  4EES A;  5TBM B;  5HWW A;  4HH3 A;  2CMN A;  2VV7 A;  3IS2 B;  2QJ5 A;  1N9O A;  3CLO A;  3MR0 A;  3LI9 A;  1GSV A;  4MN5 A;  5HDC A;  1OTI A;  3UB7 A;  2PD8 A;  3LIB A;  2QHK A;  3H9W A;  3UB9 A;  1LSW A;  3P7N A;  3HJK A;  3ULF A;  2V9A A;  1TS8 A;  1ODV A;  3F1O A;  3H82 A;  3B33 A;  4L9F A;  4KUO A;  4HQA A;  3NOT C;  1EW0 A;  3LIF A;  5DKK A;  4KQD A;  4MN6 A;  5G4Y A;  3UB6 A;  2B02 A;  3EEH A;  3LIE A;  3NOU C;  1OJ5 A;  3VOL A;  2YKF A;  4BBT A;  3SW1 A;  4I5S A;  4R70 A;  1XJ2 A;  3UB8 A;  1X0O A;  1Y28 A;  4WL9 A;  3LUQ A;  2P7J A;  4LRX C;  3K3D A;  1TS7 A;  4WUJ A;  3NHQ A;  4NXG A;  4EET B;  3LI8 A;  3HJI A;  1N9L A;  1S4R A;  2W27 A;  1T1C A;  5DJU A;  3UE6 A;  3KX0 X;  2INW A;  3RH8 B;  4R6L A;  5J7E A;  4HJ6 A;  1VB6 A;  2PYR A;  4EEP A;  5HD3 A;  1JNU A;  4WF0 A;  1DP8 A;  1S4S A;  1XJ4 A;  2D02 A;  4R3A A;  2EA9 A;  2GJ3 A;  1T18 A;  2PDR A;  2L1M A;  3RTY A;  5A8B A;  3NJA A;  4L9G A;  4PKY G;  4XT2 A;  2VLG A;  4YWZ A;  4DJ2 A;  1S1Y A;  3F1N B;  3F1O B;  3H82 B;  3MQQ A;  2YKH A;  4NXE A;  5HWT A;  5HSQ A;  1OTB A;  2QWS A;  2V1A A;  4HP4 A;  2KX6 A;  5G4Z A;  2HV1 A;  1XFN A;  4GHI A;  4NXF A;  3F1N A;  3OLO A;  4F3L B;  5IS1 A;  4I39 A;  5TBM A;  4I3J A;  1OTD A;  1V9Z A;  2J80 A;  2WKP A;  4NXB A;  5HD5 A;  4F3L A;  3MXQ A;  4WLA A;  3VE4 A;  2M1C A;  2W0N A;  4DJ3 A;  3CWF A;  1D7E A;  2V0U A;  3GDI A;  1G28 A;  3FG8 A;  3T50 A;  1OJG A;  5F68 A;  3ICY A;  2K7S A;  4JGQ A;  4LRY C;  4GCZ A;  3E4O A;  4GS9 B;  3MFX A;  5J3W A;  1LSV A;  2ZOH A;  4PKY A;  4XT2 B;  1D06 A;  3A0R A;  4HJ3 A;  1UGU A;  3F1P B;  2A24 A;  5I5L A;  3VE3 A;  1MZU A;  1OT6 A;  2PR5 A;  5HZH A;  1NWZ A;  2KDK A;  2OWH A;  1OTE A;  5EFW A;  4HH2 A;  2QJ7 A;  3E4Q A;  2QKP A;  1S67 L;  2R78 A;  1DP9 A;  4JGP A;  3NOP C;  5AVE A;  4E04 A;  1N9N A;  3BWL A;  2H28 A;  4L9E A;  2L0W A;  4RQ9 A;  1T19 A;  3H7W A;  4HHD A;  4I3A A;  3EWK A;  4BBV A;  3BY8 A;  5HWV A;  5DKL A;  1LL8 A;  2PYP A;  1LSX A;  2Z6D A;  2PHY A;  4BBU A;  1F98 A;  5KIZ A;  3LIC A;  4EW7 A;  1UWP X;  2ZBB A;  2PD7 A;  2I9V A;  4B9O A;  2ZOI A;  2D01 A;  4HP9 A;  5J4E A;  2WKQ A;  4K08 A;  4EER A;  2WKR A;  4EQ1 A;  1XJ3 A;  5F6A A;  4GHI B;  4HI4 A;  4HJ4 A;  2V0W A;  1BYW A;  3MQO A;  3LYX A;  5F5Y A;  1GSW A;  1XJ6 A;  5DJT A;  1DP6 A;  2PR6 A;  1T1A A;  2OWJ A;  2VV6 A;  3C2W A;  3CAX A;  4JGR A;  2BAS A;  3K3C A;  4LPZ A;  3LIA A;  5HDS A;  4LLO B;  1DRM A;  3C8C A;  5HDD A;  3IS2 A;  1KOU A;  2A24 B;  1F9I A;  4R38 A;  4HY8 A; 
#chains in the Genus database with same CATH topology
 3A0V A;  3O3V A;  1K55 C;  1RCJ A;  1JWV A;  1G6O A;  3WS0 A;  3MJQ A;  2QZ6 A;  3W8K A;  3D9Y A;  4I38 A;  1K55 A;  4CPK A;  2EX8 A;  2V8F A;  4K0W A;  3KSG A;  4Y0T A;  4FUW A;  2LB5 A;  3LIB A;  3M6B A;  3KYE A;  1W8Y A;  3LY4 A;  1K54 A;  3CUE A;  4Z1W A;  3PBQ A;  4ZDX A;  1SDN A;  4UA9 A;  4KUO A;  4P6Z S;  2B95 A;  2Y79 A;  2YKF A;  4LFU A;  5F1G A;  2WKE A;  1LHY A;  2P7J A;  4ZJ2 A;  5IHV A;  4C3Q A;  4EET B;  4FTX A;  3BEC A;  3UE6 A;  1T1C A;  1K6S A;  5CRF A;  1S4S A;  3HLG A;  4NXE A;  4HP4 A;  2J80 A;  4F3L A;  1PIO A;  4N92 A;  1IOU A;  3ZNY A;  3GDI A;  1QME A;  1PWD A;  3MFX A;  1K4E A;  1YLZ A;  4JF6 A;  1Z6F A;  3F1P B;  3UN7 A;  3G32 A;  3EGX C;  1HTZ A;  2C5W B;  4O0P A;  4QY6 A;  4E3O A;  4FOF A;  3BFG A;  2Y4A A;  2KLI A;  3LFV A;  2MJ6 A;  4R0Q A;  2EWV A;  1YKD A;  2P08 A;  3V3R A;  4DMZ A;  2G7U A;  3NIA A;  3R7W A;  5CGW A;  3QP5 A;  4LGW A;  4GHI B;  1LI9 A;  1YMX A;  1PI5 A;  3C2W A;  4JGR A;  4QJG A;  1K56 D;  4JXV A;  3TG9 A;  4NET A;  5D3O A;  5KSH A;  3NC8 A;  5FQK A;  5IU1 A;  4IJG A;  4OKP A;  2Y2K A;  2XH9 A;  4Y0O A;  1BSG A;  4DE3 A;  1ZG4 A;  2BTF P;  2J9P A;  3CMZ A;  2VV8 A;  4O01 A;  4OOM A;  4U3T A;  4OPZ A;  3P7N A;  5FL3 A;  3T1X A;  4GN2 A;  4UAA A;  1M40 A;  1G6A A;  5HAR A;  1E4D A;  4WUJ A;  1TS7 A;  2O0Y A;  4NXG A;  1L0D A;  4DDS A;  3ZVT A;  2PYR A;  3MZD A;  3JVU A;  2HDR A;  1NLY A;  1Y54 A;  4UA6 A;  4Y17 A;  3NJA A;  4DXC A;  1W63 M;  4FSF A;  1CK3 A;  1YSP A;  4OPQ A;  3UDI A;  5EOE A;  1V9Z A;  4WLA A;  1YSQ A;  2J8Y A;  3LO7 A;  4C6Y A;  3T50 A;  2DRW A;  4DF6 A;  2ZQ7 A;  3ZDJ A;  4QU3 A;  5HZH A;  1GA9 A;  3Q07 A;  2OWH A;  4YOF A;  1E25 A;  3A3D A;  4JGP A;  1N4O A;  5A93 A;  1LL5 A;  3H7W A;  4I3A A;  2W3G A;  3WS1 A;  3PBO A;  1F98 A;  5CTN A;  1UWP X;  5FDH A;  4N9L A;  1SKO B;  4EQ1 A;  3V50 A;  1GSW A;  1DP6 A;  2WAE A;  2XA7 S;  3DAV A;  5DF8 A;  2Y59 A;  2JCH A;  5EVE A;  5KZH A;  2ZM0 A;  5M1A A;  5DF9 A;  3IQA A;  5E43 A;  1S6R A;  1V9Y A;  4HOI A;  1DJC A;  1P9W A;  3MQ0 A;  4EBP A;  3VP3 A;  4GS9 A;  2HGV A;  2XR0 A;  2GZA A;  4FH4 A;  4DXB A;  4JGO A;  3G2Y A;  1EWZ A;  1K38 A;  5DTK A;  4EES A;  2ZC6 B;  3IX4 A;  2HJ9 C;  1BLS A;  3CLO A;  3OPH A;  2ZMV A;  5FQI A;  4L9F A;  3OOV A;  5DKK A;  3QNC A;  4BWI A;  1OJ5 A;  2M7V A;  1NZO A;  1XPB A;  1MWU A;  1KE4 A;  3T12 B;  1KDS A;  2W27 A;  4N9K A;  3N8R A;  5FQM A;  1JNU A;  1Q2P A;  5BOH A;  4MBH A;  4PAU A;  5GL9 A;  3H82 B;  4MN7 A;  1MY8 A;  5G4Z A;  2VGL S;  1ONG A;  4GJ4 A;  3UE3 A;  4ZJ1 A;  1ESU A;  4LCL A;  2WUQ A;  4JGQ A;  2WAF A;  3Q7V B;  1DY6 A;  1VEU B;  2XFS A;  3PBN A;  3P01 A;  1NWZ A;  3ZG0 A;  5EFW A;  3E4Q A;  1S67 L;  3DWK A;  2PYP A;  4R1G A;  5IT5 A;  4EW7 A;  4E3L A;  3KO6 A;  1XJ3 A;  5EM1 A;  2OAP 1;  4S2I A;  2FFF B;  2W1T A;  1XJ6 A;  3C7V A;  3P09 A;  3S7N A;  1GA0 A;  4M4X A;  3D72 A;  3E2L A;  5E2H A;  2ZQC A;  3UE1 A;  3LR5 A;  3EEA A;  2FH5 A;  4OPR A;  1IKG A;  1M6K A;  3IWQ A;  4KQO A;  3SH9 A;  1FIL A;  2XSS A;  4KUK A;  2AVX A;  2W3H A;  3LI9 A;  1WYB A;  2HP5 A;  3S22 A;  3ZHH A;  3HJK A;  4CLC E;  3MFD A;  3V3S A;  2H0T A;  3FZC A;  3H82 A;  3NOT C;  4Y3I A;  1LL9 A;  1XJ2 A;  3TE8 A;  4LV0 A;  5GHZ A;  1ES4 A;  1VET A;  3L9K A;  1N9L A;  5GHX A;  4OP5 A;  1JTG A;  3BFD A;  4UQI M;  1MWS A;  5E2G A;  4PKY G;  3ZG9 B;  3PBT A;  4YWZ A;  4MNR A;  3S1Y A;  2KX6 A;  4GHI A;  5HW3 A;  4I39 A;  4ETZ A;  3VE4 A;  3L7H A;  5EOO A;  2V0U A;  2WAD A;  1G28 A;  5E2E A;  1W79 A;  1MZU A;  1KE3 A;  2RCX A;  1TVF A;  1PZP A;  1K56 A;  3VV4 A;  1K54 C;  3CUE C;  4FD8 A;  4HES A;  3BWL A;  4QHC A;  3IXB A;  2E8I A;  2VJW A;  4HEF A;  3OPL A;  1K0K A;  3VP2 A;  1O7E A;  2BG1 A;  3MXS A;  1WYC A;  4IBR A;  1BZA A;  2WKR A;  3P98 A;  2XDM A;  4HJ4 A;  2ZD8 A;  4LRX C;  4Q0I A;  2Y8H A;  4LLO B;  3C4P A;  4I3J A;  3LGO A;  2VX8 A;  1FQG A;  3EGD C;  1CJF A;  4GKU A;  4ME4 A;  1KDW A;  3LR0 A;  2HDS A;  4OP8 A;  1W8Q A;  2V2F F;  4MDZ A;  3ZQ5 A;  3HUM A;  3ULF A;  1OME A;  4YNR A;  2JN7 A;  2PAV P;  5TBM B;  2CMN A;  4MN5 A;  2VA0 A;  3OBF A;  3PBR A;  4JXS A;  2RL3 A;  2JKT M;  2XD1 A;  1TS8 A;  5AQB A;  3UB6 A;  5CEB A;  1IYQ A;  3ITA A;  3FYZ A;  5DJU A;  4JF4 A;  3W4Q A;  4E6X A;  5A91 A;  1H8Z A;  1G68 A;  3VFH A;  3KSF A;  2W3F A;  1VM1 A;  3WWX A;  3QP4 A;  3SS5 A;  4H8R A;  4LV3 A;  3ICY A;  4LRY C;  3R7W B;  1UGU A;  2A24 A;  1AWI A;  2QPN A;  3IX3 A;  4WBG A;  2R78 A;  5TFQ A;  3LEQ A;  5GLC A;  4RQ9 A;  3HLW A;  4P6B A;  3BFC A;  3GRJ A;  3HL9 A;  5J4E A;  4EER A;  4OON A;  1W5D A;  3BYD A;  4R4S A;  3MS6 A;  4JKT A;  2VV6 A;  3JPU A;  2J3T D;  4XUX A;  4LEN A;  4BD1 A;  1NYY A;  4GD6 A;  3VP4 A;  4K91 A;  3NCK A;  4GDN A;  4QY5 A;  4CQH A;  2O9B A;  3F1P A;  2XF3 A;  3A3I A;  3RJU A;  3ZCZ A;  2Y2M A;  2EXA A;  1OPX A;  2V8C A;  1ONH A;  2ACG A;  3IHB A;  4OQG A;  1OTI A;  3ZNT A;  2J3W A;  3H9W A;  4MEZ A;  3VP0 A;  2OSU A;  2FFY A;  2J9O A;  5HAQ A;  3IHA A;  5CTM A;  3DW0 A;  2V1Z A;  4UHU A;  4YFM A;  3LUQ A;  3WRT A;  1FCM A;  5FI7 A;  4ZJ3 A;  1K4F A;  4U0X A;  3S7O A;  3RH8 B;  4KZ6 A;  1YMS A;  1XJ4 A;  4WYY A;  2EA9 A;  1T18 A;  4ZAM A;  2L1M A;  4EUV A;  1PRQ A;  2Q9N A;  3E2K A;  2K2N A;  3F1O B;  3MQQ A;  2ZQD A;  5HWT A;  5HAI A;  3TJZ C;  3FPV A;  3AGF A;  4U0T A;  3OLO A;  2VGL M;  4BL3 A;  4P87 A;  4E3J A;  5EM0 A;  2LB9 A;  4F94 A;  5FQQ A;  2JKG A;  2XRN A;  2PU2 A;  4OOY A;  3EOI A;  4XT2 B;  4WEJ A;  3ZG5 A;  4Y2F A;  2H0Y A;  2QJ7 A;  4ARZ A;  3O86 A;  2R9W A;  4L9E A;  2L0W A;  3U4L P;  5KSC A;  3EWK A;  3RXW A;  1CI8 A;  2PHY A;  2FZ0 A;  3T1Q B;  4K08 A;  1VHM A;  4EV4 A;  2M7U A;  4C75 A;  2JKF A;  4E3N A;  1ERM A;  1E3U A;  1Q2Q A;  2Y2P A;  3SZT A;  2VGJ A;  4R3J A;  5HDD A;  3ZFZ A;  4PM8 A;  1PYY A;  3C4O A;  3A0S A;  1FR6 A;  1BLP A;  1OTA A;  1L0G A;  3DTM A;  1T1B A;  3N4I A;  3OC2 A;  3LID A;  4XUZ A;  3MBZ A;  5CED A;  4JPM A;  4RX3 A;  1GCE A;  4X68 A;  4KQQ A;  3Q1F A;  1HD8 A;  3IF6 C;  3DTI A;  4NK3 A;  5G18 A;  3QP1 A;  1S4R A;  2Q0O A;  5HD3 A;  2GJ3 A;  3TW8 A;  3BFF A;  1MWT A;  2HDQ A;  2NUT C;  4RX2 A;  4DJ2 A;  1S1Y A;  3S4X A;  1VQQ A;  2YKH A;  1NRJ A;  2C6W B;  2J3T C;  4BD0 A;  1WE4 A;  4A5R A;  3M2K A;  4DN0 A;  3N8L A;  1OJG A;  1ALQ A;  5L8M A;  5GHY A;  2OLV A;  1D06 A;  3A0R A;  3MKE A;  5F83 A;  1N9N A;  3NBL A;  3Q82 A;  4S2N C;  4OH0 A;  4KZ8 A;  2Z6D A;  4UEY A;  3E0Y A;  5KIZ A;  3BJN A;  4R4R A;  2PBY A;  3T4L A;  3VSL A;  5HDS A;  3T1S A;  2P9V B;  3NUL A;  1TS0 A;  3LEZ A;  5AVF A;  2V1B A;  2X02 A;  1GHM A;  4JF5 A;  4WN5 A;  1VET B;  1SZV A;  2Y91 A;  4N1X A;  2JHE A;  4HNB A;  3C38 A;  1TEM A;  1E3U D;  1XXM A;  3IXH A;  4WZ5 C;  3UB9 A;  4E3K A;  3DTK A;  1CI9 A;  5DF7 A;  3T1R A;  3SH7 A;  1RP5 A;  2B02 A;  1P9R A;  2OLU A;  4G3V A;  2B18 A;  4WL9 A;  3NHQ A;  1J3W A;  3HJI A;  3IF6 A;  4BLM A;  2EX9 A;  5F82 A;  2WZX A;  3PXP A;  3IXG A;  3ZG8 B;  5EVI B;  4L9G A;  1L0E A;  3N8S A;  4KZ3 A;  1YLJ A;  1OTB A;  3PR6 A;  2HV1 A;  1RGY A;  3CIT A;  5TBM A;  4G3W A;  3GVB A;  4EU0 A;  1JVJ A;  3CWF A;  4Y15 A;  2GNX A;  4JXG A;  5J3W A;  3E4O A;  4HJ3 A;  3O5Y A;  3UPN A;  4PPR A;  3GQZ A;  3OZH A;  3SH8 A;  4GD8 A;  3O87 A;  5DKL A;  2ZJ9 A;  3CJM A;  4ZBE A;  4QB8 A;  2W3D A;  2O99 A;  2ZQA A;  2WYX A;  4HI4 A;  3LCE A;  3BEB A;  2ZC5 B;  3LYX A;  2Y2G A;  5AQ7 A;  4Q0J A;  2V20 A;  5AJG A;  3NDG A;  2HP9 A;  2PRF A;  1TDL A;  1H8M A;  5HL6 A;  1NY0 A;  3WS5 A;  3ZGA B;  1ES2 A;  3BRM A;  3HRE A;  1YLW A;  4S2O A;  3T4O A;  4WMC D;  5CHU A;  1NXY A;  1K25 A;  4GNU A;  2R9X A;  1KVM A;  3C5A A;  4ZRR A;  2XRO A;  3OCL A;  4HQA A;  1EW0 A;  5G4Y A;  5HL1 A;  5EVI A;  4RA7 A;  1NZU A;  5JYP A;  4ARZ B;  1H8Y A;  5JYO A;  4GZB A;  1W7F A;  4G3K A;  3B3X A;  3T4K A;  1CQA A;  3DBA A;  5TR7 A;  3RFB A;  2VLG A;  3MKF A;  1BLC A;  3F1N B;  1CEF A;  1IKI A;  2JKR M;  2P9V A;  2Z2L B;  2HPB A;  2ZL1 B;  5U47 A;  2XQZ A;  4N1H A;  4MLL A;  5I5L A;  1XKZ A;  5FSR A;  3OPR A;  3EQV A;  1BUE A;  1SKF A;  4KZA A;  3A3F A;  4E6W A;  3VOZ A;  4Z9Q A;  4OQI A;  1PWG A;  3LIC A;  5CGS A;  4DE0 A;  5CHJ A;  2XD5 A;  4HBU A;  3HLC A;  2DCF A;  4PMA A;  4DRT A;  5F5Y A;  4BJP A;  1T1A A;  1U60 A;  3K3C A;  1L3L A;  3HLE A;  3IS2 A;  4QD4 A;  1F9I A;  4R38 A;  3BFE A;  5FDS A;  4IUK A;  4R23 A;  5EVI C;  2EWW A;  3KSI A;  3H7W B;  3G6O A;  1LT0 A;  3UE0 A;  2X01 A;  2WGI A;  3A3J A;  2Z6C A;  1HLU P;  5EVL A;  5DTS A;  1K57 C;  2WZZ A;  4IED A;  2EX6 A;  3GTC A;  4X6T A;  3IH8 A;  4HH3 A;  2XEP A;  3IS2 B;  3MR0 A;  5HDC A;  3T4S A;  2GX5 A;  3NI9 A;  3ZVW A;  3HVF A;  1SDE A;  1VEU A;  2ZC4 B;  3IWO A;  3SW1 A;  3LR4 A;  5HX9 A;  2H5S A;  2XGN A;  3IH9 A;  4WMC A;  1YLY A;  3IT9 A;  1VB6 A;  4HJ6 A;  2EXB A;  4DKI A;  3SS4 A;  2PDR A;  3IX8 A;  3RTY A;  5A8B A;  2KOI A;  4GOG A;  3V39 A;  4RYE A;  5HSQ A;  2WKH A;  1MXO A;  5EEC A;  1YAX A;  2QWS A;  3GSG A;  4X55 A;  2WKP A;  2JC7 A;  2P04 A;  5FAT A;  3AGE A;  4GCZ A;  4GS9 B;  2ZOH A;  4D2O A;  4K0X A;  2OV5 A;  2WGV A;  2QKP A;  2ZQ8 A;  3NOP C;  3DTE A;  2QYB A;  5TGF A;  1GHP A;  2X71 A;  2PD7 A;  3UB5 P;  4HP9 A;  3HCY A;  4EBL A;  5F69 A;  5HD5 A;  4OOL A;  2XA7 M;  3M6H A;  1F5M A;  2ZMF A;  1P97 A;  2OAQ 1;  2JBF A;  4Y13 A;  3MZF A;  3GR2 A;  3NY4 A;  4GW9 A;  2Y2N A;  1SKO A;  3IBJ A;  3BQA A;  3V67 A;  1D1J A;  3GV9 A;  3GEC A;  4HIA A;  4OQH A;  1TS6 A;  3G35 A;  4GB7 A;  3UB7 A;  4ESP A;  1RGZ A;  4PM7 A;  3F1O A;  3BM6 A;  2A2L A;  5AQA A;  1LI0 A;  4BBT A;  3E98 A;  4PM6 A;  4B4Z A;  1HVB A;  4P0M A;  1FCO A;  5E2F A;  3FWL A;  3A3E A;  3VOY A;  1DP8 A;  4ZTK A;  3FPW A;  3MZE A;  2WK0 A;  5EUA A;  5FAP A;  2VK3 A;  4S2N A;  5F1F A;  4B93 A;  2ZL1 A;  5IS1 A;  1O07 A;  1YPR A;  2EX2 A;  2UWX A;  2M1C A;  1LLB A;  3VP1 A;  4Q8I A;  3Q81 A;  3D3O A;  5CX7 A;  1ZC2 A;  2Q9M A;  3UDX A;  4WZ4 A;  2KDK A;  4MBK A;  1YQS A;  4B4X A;  2K31 A;  1JWP A;  4Y7P A;  2H28 A;  4HHD A;  1ZKJ A;  1LL8 A;  1N9B A;  3GMW A;  2HDU A;  4UQI S;  4PM9 A;  5CHM A;  5F6A A;  3UY6 A;  4LPZ A;  2OWJ A;  1CEG A;  2E8J A;  1FIK A;  3LIA A;  3MMH A;  2JKR I;  3ISG A;  1FSY A;  3PHY A;  5K5B A;  4EEU A;  2BLS A;  3SOI A;  4P6Z M;  2B5R A;  4GLQ A;  5HPF A;  1GSX A;  1Z09 A;  3UMD A;  2G2U A;  4I3I A;  3HUO A;  2L4R A;  3BY9 A;  1IEL A;  3G2Z A;  3T4T A;  1S1Z A;  5FAQ A;  3PYP A;  5HWW A;  3PBS A;  1NJ4 A;  2IA2 A;  4HBT A;  3TRC A;  1MC0 A;  1NLZ A;  2V9A A;  4KEN B;  1ODV A;  4Y0U A;  3FKW A;  4KZ9 A;  3EEH A;  3NOU C;  1K6R A;  1X0O A;  4JBF A;  2WKI A;  3G31 A;  3QNB A;  4BMW A;  3QHY A;  4OLG A;  3FV7 A;  2INW A;  2HP6 A;  3PTE A;  5M19 A;  2NUP C;  4D60 A;  4LCM A;  4R3A A;  5L10 A;  1QMF A;  1STZ A;  2Y2H A;  5L2F A;  3KSH A;  2ZC3 B;  5EPH A;  3MF0 A;  4F3L B;  2PU4 A;  3CZD A;  1OTD A;  4DDY A;  1XP4 A;  2GDN A;  1BT5 A;  1L2S A;  1D7E A;  3JYI A;  1LSV A;  5DFY A;  2Z2M B;  4S2L A;  4NG2 A;  5AQ9 A;  4KQR A;  3UDF A;  2Y2I A;  3R4K A;  3VFF A;  1PFL A;  5FAO A;  2Y2J A;  1BUL A;  1H3Q A;  1ERQ A;  4RVA A;  4WEK A;  3TSG A;  2ZBB A;  4S2J A;  1IYO A;  1KE0 A;  3HBR A;  3UPO A;  1BLH A;  3NEC A;  2V0W A;  1J9M A;  4KG2 A;  5DJT A;  3FKV A;  4KZ7 A;  3CAX A;  2J7V A;  4JLF A;  1KGG A;  1P0Z A;  2IWD A;  4H6J B;  1UWN X;  1OT9 A;  1ERO A;  4S2M A;  4NKP A;  2VV7 A;  1MKI A;  2Y55 A;  4O8G A;  5CXW A;  3BQ8 A;  1YM1 A;  4E3I A;  4E3M A;  3D4F A;  3M2J A;  3B33 A;  4WEL A;  1FOF A;  5HFO A;  3UNW A;  3VSK A;  4I5S A;  4IVK A;  4CLC C;  2G2W A;  3K3D A;  1GHI A;  1PWC A;  5FQ9 A;  3IXD A;  2Y2O A;  1FR1 A;  1H0M A;  3KX0 X;  4X25 A;  3Q7Z A;  4WF0 A;  3WRZ A;  4EUZ A;  3V5M A;  3PAG A;  3CI6 A;  3CHW P;  3W4P A;  3T4J A;  2IWC A;  3RXX A;  1W63 Q;  4DE2 A;  2Y2Q A;  3C30 A;  3EQU A;  4NXF A;  4CLC A;  4NXB A;  4KG6 A;  2W0N A;  4DJ3 A;  5EV0 A;  1CF0 A;  5F68 A;  4OQ0 A;  5DVA A;  3HLD A;  3Q7V A;  1PZO A;  1ZG6 A;  4B88 A;  4HH2 A;  4E04 A;  1ZTU A;  4WZ5 A;  3OCN A;  3MSH A;  3VMA A;  1ESI A;  1G5U A;  4O7D A;  4X53 A;  4EQI A;  3HLF A;  3QP2 A;  4B9O A;  2ZOI A;  3CG5 A;  5EE8 A;  2ZMA A;  3MQO A;  1KVL A;  3C8C A;  3G30 A;  4X1M A;  4KZ4 A;  1S66 L;  5DTT A;  5C5K A;  5HAP A;  3IBR A;  1FSW A;  2P74 A;  4H6J A;  2VEA A;  3KYZ A;  4CJN A;  1HZO A;  2UV0 E;  4EBN A;  4EXO A;  3JVV A;  4OPY A;  1GSV A;  3N7W A;  2PD8 A;  2QHK A;  1LSW A;  1EI5 A;  1XA1 A;  2DMW A;  3LY3 A;  1ACF A;  2Y2L A;  4FCF A;  3W4O A;  2HZ5 A;  4IUH A;  2XLN A;  3ITB A;  4KQD A;  1MBL A;  4DE1 A;  1JTD A;  3LIE A;  5I94 A;  5FI2 A;  3UB8 A;  5TJJ A;  1ZHH B;  4IHQ A;  4EWF A;  3DWZ A;  4GDB A;  4X1L A;  4PHT A;  2D02 A;  5KMW A;  2ZM2 A;  4XT2 A;  3G34 A;  2VGK A;  2V1A A;  1YT4 A;  1XFN A;  2PT7 A;  2HJE A;  2EFX A;  5FQJ A;  2HF6 A;  3HLB A;  1TDG A;  2K7S A;  2DNS A;  3PAE A;  4PKY A;  1OT6 A;  2W1T B;  5M18 A;  2A3U A;  3NDE A;  1YLP A;  3T4Q A;  3HUN A;  3S7P A;  4BBV A;  5CEC A;  4BBU A;  4NEE D;  5L07 A;  1Y4O A;  1S0W A;  5MC7 A;  3BLM A;  1DJA A;  1WA9 A;  1NRF A;  2OOL A;  3IF5 A;  4LRZ E;  2I72 A;  2O9A A;  1ES5 A;  3FC7 A;  4XXR A;  5GLA A;  3ZG7 B;  5HPI A;  3OPP A;  4BEN A;  3E4P A;  3N6I A;  4PM5 A;  3C7U A;  5CER A;  5FEF A;  1H5X A;  4JXW A;  5CGX A;  4M3K A;  1F2K A;  1I2W A;  1TD5 A;  4Y5F A;  3VOL A;  4QWO A;  3TOI A;  4R70 A;  1IYS A;  4QPR A;  1MKM A;  5GLD A;  4R6L A;  4R3B A;  4UA7 A;  4EEP A;  1FCN A;  5L09 A;  5DFX A;  2XFT A;  3UPP A;  3I7J A;  5FA7 A;  3SS3 A;  3ZYT A;  4ETX A;  1K57 A;  1PI4 A;  3W2Z A;  5EVI D;  3BW6 A;  2XK1 A;  5FI6 A;  3IF6 B;  1I2S A;  3MXQ A;  4L0L A;  4IVI A;  3K2N A;  4OVD A;  3FG8 A;  1SHV A;  1NYM A;  4LV1 A;  3VE3 A;  5LBR A;  2PR5 A;  1A0K A;  1OTE A;  5GLB A;  5AVE A;  1IEM A;  1I5Q A;  2PBD P;  2ZM8 A;  5A90 A;  3BY8 A;  2IWB A;  4KG5 A;  2JKT I;  4II7 A;  4MCW A;  3AGD A;  2I9V A;  2D01 A;  3S7Q A;  2WKQ A;  4X56 A;  3QP8 A;  3KYQ A;  1AXB A;  2PR6 A;  3LR3 A;  4KZB A;  4S2P A;  1KOU A;  2H10 A;  4LV2 A;  1IYP A;  3CPT B;  2CC1 A;  3UME A;  3WS2 A;  1XFQ A;  2VZW A;  2JE5 A;  3G4P A;  2ZC7 A;  3O88 A;  1SCW A;  3UO9 A;  3B42 A;  4WM9 A;  2QJ5 A;  1N9O A;  4P85 A;  4S2K A;  1L0F A;  3CPT A;  5J8X A;  5FEG A;  2QMI A;  4KZ5 A;  3LIF A;  4MN6 A;  1PW8 A;  5FAS A;  4X69 A;  1Y28 A;  3QP6 A;  1DJB A;  3LI8 A;  2W1R A;  5J7E A;  1KGE A;  1BTL A;  4Q0H A;  4IBX A;  4BL2 A;  1XGJ A;  1KGF A;  4YIN A;  2O9C A;  3WS4 A;  4CLC B;  1MPL A;  2W3E A;  3F1N A;  1JWZ A;  3B47 A;  2EFU A;  1ES3 A;  1YLT A;  4ID4 A;  5A92 A;  3U2A A;  2ZLY A;  1XA7 A;  2VKS A;  3MXR A;  4MMN A;  2ZQ9 A;  1PNE A;  1DP9 A;  2WGW A;  1XX2 A;  2WGW B;  1T19 A;  3IWI A;  5HWV A;  1IFQ A;  1LSX A;  3BLS A;  1C3B A;  1TF1 A;  2A49 A;  4FH2 A;  1MWR A;  1XGI A;  4MBF A;  1BYW A;  4OLD A;  4BQM A;  2BAS A;  4AFI A;  1DRM A;  4CLC D;  1PW1 A;  2A24 B;  4HY8 A; 
#chains in the Genus database with same CATH homology
 3A0V A;  2VX8 A;  1H8M A;  3EGD C;  5HL6 A;  4ME4 A;  1P0Z A;  3LR0 A;  1G6O A;  4H6J B;  3MJQ A;  4MDZ A;  3ZQ5 A;  1UWN X;  3ULF A;  3T4O A;  1OT9 A;  4YNR A;  2JN7 A;  4I38 A;  4NKP A;  5TBM B;  2CMN A;  2VV7 A;  2VA0 A;  3OBF A;  3KSG A;  3PBR A;  4MN5 A;  4O8G A;  2LB5 A;  3LIB A;  3BQ8 A;  2JKT M;  3CUE A;  4ZRR A;  4Z1W A;  1TS8 A;  3PBQ A;  2XRO A;  3OCL A;  3B33 A;  4WEL A;  4KUO A;  4P6Z S;  4HQA A;  1EW0 A;  5G4Y A;  3UB6 A;  2Y79 A;  2YKF A;  4CLC C;  4I5S A;  4ARZ B;  2P7J A;  3K3D A;  4EET B;  4G3K A;  3T4K A;  5DJU A;  1T1C A;  3UE6 A;  3KX0 X;  4WF0 A;  1S4S A;  3DBA A;  3CI6 A;  3RFB A;  2VLG A;  3T4J A;  3KSF A;  3F1N B;  4NXE A;  1W63 Q;  2W3F A;  4HP4 A;  3C30 A;  3EQU A;  4NXF A;  2JKR M;  2J80 A;  4CLC A;  4NXB A;  4F3L A;  1IOU A;  2W0N A;  4DJ3 A;  3GDI A;  5F68 A;  3ICY A;  4LRY C;  3MFX A;  3R7W B;  5I5L A;  1UGU A;  3F1P B;  2A24 A;  3EQV A;  3EGX C;  4HH2 A;  4O0P A;  2R78 A;  4E04 A;  1ZTU A;  4FOF A;  4RQ9 A;  3OCN A;  2KLI A;  3LFV A;  2MJ6 A;  3LIC A;  2EWV A;  1YKD A;  2P08 A;  4DMZ A;  4B9O A;  2G7U A;  2ZOI A;  3R7W A;  5J4E A;  4EER A;  4GHI B;  3MQO A;  5F5Y A;  4BJP A;  1T1A A;  2VV6 A;  3C2W A;  4JGR A;  3K3C A;  3C8C A;  3IS2 A;  2J3T D;  1F9I A;  4R38 A;  4IUK A;  1S66 L;  4CQH A;  2EWW A;  2O9B A;  3F1P A;  5KSH A;  5C5K A;  3KSI A;  3IBR A;  5IU1 A;  4IJG A;  3H7W B;  3G6O A;  1LT0 A;  4H6J A;  2VEA A;  3KYZ A;  2Z6C A;  1OPX A;  4EXO A;  2VV8 A;  4O01 A;  3JVV A;  4HH3 A;  3IS2 B;  4OOM A;  3MR0 A;  1GSV A;  5HDC A;  1OTI A;  3T4S A;  2PD8 A;  2J3W A;  2QHK A;  3H9W A;  1LSW A;  3P7N A;  2GX5 A;  2DMW A;  5FL3 A;  4IUH A;  4KQD A;  3LIE A;  3SW1 A;  3LR4 A;  3UB8 A;  5TJJ A;  1ZHH B;  3LUQ A;  4IHQ A;  4WUJ A;  1TS7 A;  2O0Y A;  4NXG A;  3S7O A;  3RH8 B;  4HJ6 A;  1VB6 A;  2PYR A;  1XJ4 A;  3JVU A;  4PHT A;  2D02 A;  2EA9 A;  1NLY A;  1T18 A;  2PDR A;  2L1M A;  3RTY A;  4EUV A;  3NJA A;  5A8B A;  2KOI A;  4XT2 A;  1W63 M;  4FSF A;  2K2N A;  3F1O B;  3MQQ A;  5HSQ A;  5HWT A;  1YSP A;  3TJZ C;  1YAX A;  2QWS A;  3FPV A;  2V1A A;  1XFN A;  3OLO A;  2VGL M;  1V9Z A;  2WKP A;  2PT7 A;  2HJE A;  4WLA A;  1YSQ A;  2LB9 A;  2P04 A;  2HF6 A;  3T50 A;  2XRN A;  2K7S A;  4GCZ A;  4GS9 B;  2ZOH A;  3EOI A;  4PKY A;  4XT2 B;  4WEJ A;  4Y2F A;  1OT6 A;  2W1T B;  5HZH A;  2OWH A;  4YOF A;  2QJ7 A;  2QKP A;  4ARZ A;  4JGP A;  3NOP C;  3T4Q A;  4L9E A;  2L0W A;  3S7P A;  3H7W A;  2QYB A;  4I3A A;  2W3G A;  3EWK A;  4BBV A;  2PHY A;  3PBO A;  4BBU A;  1F98 A;  4NEE D;  1UWP X;  2PD7 A;  4HP9 A;  2FZ0 A;  4K08 A;  1VHM A;  4EQ1 A;  2M7U A;  3HCY A;  1GSW A;  1DP6 A;  2XA7 S;  5F69 A;  5MC7 A;  5HD5 A;  4OOL A;  5HDD A;  2XA7 M;  1F5M A;  2ZMF A;  5DF9 A;  1P97 A;  2OAQ 1;  1WA9 A;  3A0S A;  4HOI A;  1V9Y A;  2OOL A;  1P9W A;  4LRZ E;  3MQ0 A;  4GW9 A;  1OTA A;  2O9A A;  4GS9 A;  2HGV A;  3FC7 A;  2GZA A;  1T1B A;  3IBJ A;  3BQA A;  3V67 A;  5HPI A;  4JGO A;  3OC2 A;  3E4P A;  3LID A;  3GEC A;  4HIA A;  1TS6 A;  4EES A;  2HJ9 C;  3CLO A;  3UB7 A;  2ZMV A;  3F1O A;  4L9F A;  2A2L A;  3OOV A;  5DKK A;  1TD5 A;  4Y5F A;  3VOL A;  4BWI A;  1OJ5 A;  4BBT A;  4R70 A;  3E98 A;  4QPR A;  2M7V A;  1MKM A;  1S4R A;  2W27 A;  4R6L A;  4EEP A;  5HD3 A;  1JNU A;  5DFX A;  1DP8 A;  2GJ3 A;  3TW8 A;  3ZYT A;  4ETX A;  3FPW A;  3W2Z A;  4PAU A;  2NUT C;  3BW6 A;  4DJ2 A;  1S1Y A;  3H82 B;  2YKH A;  4MN7 A;  1NRJ A;  5G4Z A;  2VGL S;  4B93 A;  2J3T C;  4GJ4 A;  3UE3 A;  5IS1 A;  3MXQ A;  4L0L A;  2M1C A;  4DN0 A;  3K2N A;  3FG8 A;  1OJG A;  4JGQ A;  3D3O A;  5CX7 A;  5L8M A;  3VE3 A;  1D06 A;  3A0R A;  3PBN A;  3P01 A;  5LBR A;  2PR5 A;  1NWZ A;  2KDK A;  1OTE A;  5EFW A;  3E4Q A;  1S67 L;  2K31 A;  5AVE A;  1N9N A;  2H28 A;  4HHD A;  3BY8 A;  1LL8 A;  2PYP A;  2Z6D A;  4UEY A;  2JKT I;  3E0Y A;  5IT5 A;  5KIZ A;  4II7 A;  4EW7 A;  4UQI S;  4MCW A;  3KO6 A;  2I9V A;  3BJN A;  2D01 A;  3S7Q A;  2WKQ A;  1XJ3 A;  5F6A A;  2OAP 1;  3KYQ A;  2W1T A;  1XJ6 A;  3T4L A;  2PR6 A;  4LPZ A;  2OWJ A;  3LR3 A;  3LIA A;  5HDS A;  3MMH A;  2JKR I;  1KOU A;  3S7N A;  4M4X A;  3PHY A;  3D72 A;  1TS0 A;  5K5B A;  4EEU A;  5AVF A;  2V1B A;  3EEA A;  3LR5 A;  4P6Z M;  2FH5 A;  3UME A;  4GLQ A;  5HPF A;  1GSX A;  4WN5 A;  4KQO A;  1XFQ A;  3UMD A;  2VZW A;  4I3I A;  2L4R A;  2XSS A;  3BY9 A;  4KUK A;  2JHE A;  4HNB A;  3T4T A;  1S1Z A;  3PYP A;  5HWW A;  3C38 A;  3B42 A;  3PBS A;  2W3H A;  2QJ5 A;  1N9O A;  3LI9 A;  2IA2 A;  3TRC A;  1MC0 A;  3UB9 A;  1NLZ A;  4CLC E;  3HJK A;  2V9A A;  1ODV A;  3H82 A;  3NOT C;  3LIF A;  4MN6 A;  4Y3I A;  2B02 A;  3EEH A;  3NOU C;  1P9R A;  4G3V A;  1XJ2 A;  1X0O A;  1Y28 A;  2B18 A;  4WL9 A;  3TE8 A;  3NHQ A;  3LI8 A;  3HJI A;  4BMW A;  1N9L A;  2W1R A;  2INW A;  5J7E A;  3PXP A;  2NUP C;  4Q0H A;  4R3A A;  4UQI M;  4L9G A;  4PKY G;  1STZ A;  3PBT A;  4YWZ A;  3KSH A;  2O9C A;  1OTB A;  3PR6 A;  2KX6 A;  3MF0 A;  2HV1 A;  4GHI A;  4CLC B;  2W3E A;  3CIT A;  3F1N A;  4F3L B;  4I39 A;  5TBM A;  3B47 A;  4I3J A;  1OTD A;  4G3W A;  4EU0 A;  4ETZ A;  3VE4 A;  3CWF A;  1D7E A;  2V0U A;  1G28 A;  2GNX A;  3U2A A;  5J3W A;  3E4O A;  1LSV A;  5DFY A;  2VKS A;  4HJ3 A;  1MZU A;  3O5Y A;  4MMN A;  3VV4 A;  1DP9 A;  3CUE C;  3BWL A;  3R4K A;  1T19 A;  2VJW A;  5HWV A;  5DKL A;  1IFQ A;  1LSX A;  1H3Q A;  1TF1 A;  4WEK A;  2ZBB A;  2W3D A;  2WKR A;  2O99 A;  4HI4 A;  4HJ4 A;  2V0W A;  1BYW A;  3LYX A;  5DJT A;  4LRX C;  4Q0I A;  3CAX A;  4Q0J A;  2BAS A;  2Y8H A;  4LLO B;  1DRM A;  4AFI A;  4CLC D;  2A24 B;  5AJG A;  4HY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...