4I3IA

Structures of it intermediate of photoactive yellow prtein e46q muntant from time-resolved laue crystallography collected at 14id aps
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
molecule tags Luminescent protein
source organism Halorhodospira halophila
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4i3iA00
1OTDA 5TBMB 3MR0A 3IS2A 3H7WA 1V9ZA 4JGRA 3MQQA 3IBRA 4M4XA 1OTBA 1UWPX 5KIZA 3UE6A 1F9IA 1OT6A 2PHYA 1DP9A 1XJ3A 4GHIA 4NXFA 1XJ4A 4HH3A 1NWZA 1LL8A 3NOTC 5EFWA 3UB6A 3F1PA 5G4YA 1TS8A 2D02A 2WKPA 4HP9A 4EEUA 5A8BA 5AVEA 5IS1A 5HDSA 1XFNA 4PKYA 5HDCA 2WKQA 1T1AA 2D01A 4JGPA 4LPZA 5HWVA 2P7JA 1P0ZA 3A0RA 1WA9A 1JNUA 3NJAA 3NHQA 2W0NA 4I39A 4B9OA 3LICA 2QWSA 3H82B 3UMDA 3EEHA 1S66L 3HJIA 5J7EA 3NOUC 1T19A 2QJ5A 3LUQA 4L9FA 5G4ZA 2A24A 3BY8A 2CMNA 3CLOA 3LYXA 1S4SA 2B02A 4H6JA 2INWA 4LRYC 1GSXA 2I9VA 3LI9A 2PR5A 5HD3A 2W27A 3T50A 2PD8A 1S4RA 1S67L 3IS2B 4JGOA 3RH8B 3LIBA 1XJ6A 3UB7A 1TS0A 4I38A 4PKYG 4H6JB 2PYPA 2V0UA 4HJ4A 4WF0A 4DJ3A 5F69A 2OOLA 1D7EA 2VV8A 2K7SA 4I3IA 4GW9A 5I5LA 2R78A 2L1MA 2OWJA 4DJ2A 4NXBA 2YKFA 3D72A 4BBUA 5DJUA 1DP8A 2PYRA 5F5YA 2KDKA 4I5SA 2J80A 2QJ7A 4WL9A 3ULFA 3FC7A 4LLOB 1TS6A 3H7WB 1N9NA 1S1ZA 2PD7A 1D06A 1P97A 2OWHA 4GCZA 2PR6A 2M1CA 3BY9A 1VB6A 4GS9A 3LIFA 4L9GA 4MN6A 2VV6A 4NXEA 3PHYA 3C8CA 4R70A 3F1NB 5HWWA 4HQAA 4I3AA 1KOUA 1T18A 1OJGA 1X0OA 4GHIB 2V1AA 1T1CA 2VV7A 4LRZE 4LRXC 4NXGA 4RQ9A 2WKRA 4HY8A 4GS9B 2HV1A 3GECA 4WUJA 4HH2A 3VOLA 4BBTA 5DKKA 5TBMA 3MXQA 4KQDA 5DKLA 3B33A 5IU1A 2V1BA 4MN5A 5HD5A 2H28A 1OTEA 3LIEA 3HJKA 4R6LA 4HJ3A 1DRMA 1LSXA 1ODVA 4HJ6A 3PYPA 3F1OA 3MQOA 3H9WA 2QKPA 2ZOIA 2V0WA 3BWLA 4HHDA 4KUOA 3UB9A 3MJQA 3NOPC 4XT2B 4F3LB 1N9OA 1OTAA 1GSVA 1GSWA 2ZBBA 1UGUA 4JGQA 4EERA 1Y28A 5J3WA 3ZQ5A 4EESA 1EW0A 2EA9A 1OTIA 4EEPA 3A0SA 1F98A 3SW1A 1MZUA 2V9AA 2L4RA 3LIAA 2VLGA 3EWKA 3OLOA 4K08A 4HIAA 1LSWA 5J4EA 1OT9A 4HP4A 3CWFA 4EXOA 2JN7A 5DJTA 2BASA 3RTYA 2L0WA 3E4QA 3KX0X 2KX6A 1LT0A 3P7NA 5F6AA 4WLAA 3VE3A 3VE4A 2VEAA 1OJ5A 1N9LA 3C2WA 1XFQA 3FG8A 3ICYA 4HNBA 4KUKA 4R38A 3F1PB 2PDRA 3UMEA 3K3DA 3A0VA 2GJ3A 4EETB 3F1OB 4WN5A 5HWTA 4HOIA 4E04A 1S1YA 5F68A 2Z6CA 5HZHA 2Z6DA 4EW7A 3UB8A 4HI4A 3LI8A 1V9YA 2YKHA 3G6OA 3GDIA 4EQ1A 4R3AA 1UWNX 3LIDA 4XT2A 5AVFA 4F3LA 4L9EA 1BYWA 5HDDA 2JHEA 1G28A 2A24B 3E4PA 3MFXA 1TS7A 4YWZA 3CAXA 1DP6A 4BBVA 1LSVA 4I3JA 2QHKA 5HSQA 3F1NA 2ZOHA 1XJ2A 3K3CA 3E4OA 3H82A 1T1BA
chains in the Genus database with same CATH superfamily
4RVAA 2VKSA 3QP2A 3D3OA 3IBJA 5HAQA 1F9IA 1XJ3A 3S7QA 5D3OA 1M40A 2LB9A 1RGYA 5DTTA 2WKIA 1XA1A 2WKQA 2WYXA 5HWVA 1KGGA 2WGVA 2XFSA 4PHTA 4IVKA 4G3KA 2B02A 2B95A 3T50A 4O0PA 4WZ4A 3LIBA 1JWPA 4PKYG 1KE4A 3N7WA 4HBTA 4OVDA 1S0WA 5CTNA 4KZ6A 3TE8A 5FI7A 4X55A 3RXWA 3ZG7B 2MJ6A 2OWHA 3SH8A 1J9MA 1X0OA 4LRZE 2V1AA 4JF4A 4GLQA 1H8YA 5AQ7A 4P6BA 5CGXA 1XPBA 1ONHA 2XA7M 3MXSA 4G3WA 1N9OA 4FH2A 4PM7A 4JF5A 4OH0A 3VOZA 2VLGA 3ZG0A 4U3TA 3PBOA 4EXOA 2HPBA 1BLCA 3E4QA 3MZDA 3IQAA 4Y0TA 5DFXA 3V5MA 3VE4A 1N9LA 4UA9A 2O9BA 4GD6A 4OP5A 3BFEA 2Z6DA 3UDXA 3G6OA 4JKTA 3GDIA 4ZBEA 4MBKA 2WADA 3VOYA 3A3EA 3MFDA 3W8KA 3UN7A 3K3CA 2EFUA 5F1GA 3UO9A 1AXBA 2PHYA 1DP9A 1QMEA 3VMAA 5DF7A 3HUMA 4PKYA 5HDCA 4LPZA 5GHXA 4PM9A 3FZCA 4OPYA 3PR6A 4Q0HA 3ISGA 1IOUA 3LCEA 4KENB 3C7UA 5GLAA 4FH4A 4GW9A 2R78A 1IFQA 5CTMA 5DJUA 4WM9A 2XK1A 4P6ZM 1N9NA 2PD7A 3LIFA 4R70A 1KDWA 5DF9A 2WKEA 5GL9A 3A3IA 3ZGAB 2VV7A 4YOFA 4DN0A 3VOLA 4EUZA 5TR7A 3IH8A 3HJKA 3M2JA 4IVIA 3QP1A 3FWLA 5KZHA 2ZD8A 4EQIA 4EERA 4KZ8A 1UGUA 5A90A 1YLPA 1SKOA 4X25A 1MZUA 4S2OA 4Q0JA 1XX2A 2Z2MB 4OP8A 1GA9A 3T1QB 3IXDA 3N8SA 2BASA 4DDSA 5EPHA 4R38A 4R4RA 2X01A 4S2JA 2GZAA 1Y4OA 4E04A 1S1YA 2C6WB 1K57A 2Z6CA 3UB8A 5HAPA 1V9YA 4S2NC 2HP5A 5HSQA 4FOFA 5F83A 3DWKA 4CLCB 2PAVP 3N6IA 3IS2A 3H7WA 3C30A 2ZMFA 3SH9A 4KQRA 1OTBA 1UWPX 1ZG6A 4GHIA 4IUHA 1IYQA 3B3XA 5FQIA 1NWZA 4B4ZA 1FR6A 1JWVA 4LV1A 5KSHA 2P7JA 5CXWA 4XXRA 3TG9A 1ZHHB 3IWOA 3T4QA 4WEKA 4X1LA 1BT5A 2PD8A 4E3JA 4AFIA 2OAQ1 2QYBA 3LEQA 1ESUA 5AQ9A 4NXBA 2I72A 3C5AA 1WYBA 2JC7A 2PBDP 2J80A 2QJ7A 3W4QA 1K6SA 3FC7A 2XLNA 1L0EA 3S22A 4FD8A 4RA7A 3TJZC 1K55A 3S7OA 2O0YA 3LGOA 5DKKA 2RL3A 3MXRA 2XD1A 2W1TA 3O88A 3KSIA 2E8JA 2M7VA 5DTSA 3T4JA 4F3LB 3BYDA 2H0YA 5EVIB 4ZDXA 3P01A 1P9WA 1OTIA 5AQAA 1LI9A 5FAPA 1PWGA 1PW8A 3LY3A 5IT5A 4Z1WA 1IKGA 3CWFA 1K57C 1BZAA 2XF3A 4ZRRA 4II7A 2KX6A 4JF6A 3B42A 1MC0A 2V20A 2ZL1A 4YINA 3T4TA 3KSFA 5AVFA 4F3LA 3MFXA 2OLUA 5FQ9A 1DP6A 4I3JA 2ZOHA 2KLIA 5FI2A 4WZ5A 1L0GA 1GHPA 3K2NA 3QHYA 1Y54A 4UA7A 3TOIA 3IWIA 1CQAA 2PU2A 1K0KA 1GHIA 2PRFA 5G4YA 4PM5A 1XFNA 4E3NA 2Y2LA 4Z9QA 4LENA 3LICA 3A3JA 4D60A 5M18A 3MKFA 1MKIA 4JLFA 2Y2OA 1S4SA 2H10A 3WWXA 4R23A 3EGDC 2P9VB 2ZC6B 4HJ4A 4WF0A 1ES5A 2WGWA 2OOLA 2ZC4B 3GVBA 3CMZA 2QMIA 4XUZA 5IS1A 1LI0A 1P97A 1WE4A 2Y2PA 3PHYA 3T4OA 4HQAA 1YSQA 3GECA 1PWDA 2Y79A 4BBTA 3Q7ZA 3IF6B 2BG1A 5IU1A 5EOOA 1BLPA 3G4PA 4OOMA 3ZNTA 1H8MA 2J7VA 3MQOA 4NEED 4GKUA 2Y55A 3MJQA 1EWZA 3KSGA 4MCWA 4MLLA 3A0SA 4CPKA 4E3LA 2J8YA 3EWKA 3Q07A 1YLJA 5J4EA 1L0DA 1NZUA 5DJTA 2EWWA 3O5YA 3BFCA 1SZVA 3HREA 2GDNA 4HOIA 3A3FA 3HL9A 1HD8A 2GNXA 2YKHA 4K91A 4ARZB 3VSKA 1UWNX 1BYWA 5FQQA 1Q2PA 5HDDA 2A24B 3NDEA 4LV2A 1DJAA 2Y2KA 1W63Q 3N4IA 3UY6A 3MQQA 1LL5A 5HPFA 5KIZA 2Y2MA 1DJCA 2HF6A 4OQGA 2JKFA 2A2LA 3HLCA 3SH7A 2ZM2A 2DRWA 2A24A 3BY8A 4KZ3A 3BFGA 3LI9A 1BUEA 4GN2A 3BRMA 5E2FA 1L3LA 1CEFA 1CK3A 1FOFA 3CPTA 1KVMA 4DJ2A 4DE1A 4KG5A 1PZOA 3NECA 4GCZA 1VB6A 3C8CA 2HP9A 5L2FA 4C6YA 3ZYTA 5FA7A 5L10A 1NY0A 5CECA 3B33A 5TJJA 3UB9A 3U4LP 4X53A 1K56D 4JGQA 3QP4A 3BM6A 4S2NA 5F82A 2XEPA 2L4RA 5GHZA 1VETB 3MF0A 3NC8A 3CZDA 1PWCA 4E6WA 3KYEA 3LR3A 2XQZA 4S2PA 1H5XA 3VE3A 5G18A 3PBSA 5L09A 2BTFP 1OJ5A 2PDRA 2GJ3A 1I2WA 4BD0A 1ES4A 3KO6A 2EX2A 5E43A 4WEJA 2EXAA 3G2YA 1BLHA 1Z09A 2W1RA 4YWZA 4BBVA 1IELA 1W5DA 1IYPA 3FV7A 3H82A 4RX2A 4FCFA 3DAVA 5TBMB 1PFLA 4M4XA 2VGLS 3CG5A 1YSPA 5FL3A 5FQJA 4HP9A 1I2SA 3ITAA 5M1AA 1IKIA 3IXGA 2JCHA 3UMDA 4GDNA 2INWA 1HTZA 3OC2A 4QWOA 2EXBA 5CERA 4QHCA 4CJNA 2VGKA 2PYRA 4N1XA 4DE3A 4DMZA 4WL9A 2ZMAA 5FEFA 5BOHA 1FSWA 2EX8A 3V39A 1A0KA 1VHMA 2OLVA 5FQKA 1K25A 4IBRA 4O01A 1HVBA 5DKLA 4QY5A 3PXPA 4HJ6A 2QKPA 2ZOIA 1MWUA 1GSWA 1KGFA 3GMWA 1Y28A 4Y7PA 4KZ5A 1OT9A 5A93A 5CEDA 1YLZA 4EU0A 5F6AA 2HDUA 3C2WA 2ZC5B 4BL2A 4UA6A 1FIKA 3JPUA 3K3DA 2ZQ7A 1NYYA 4CLCD 4ME4A 5HAIA 1E3UD 4HI4A 4OQIA 4NETA 4R3AA 2EFXA 1G28A 1MXOA 3F1NA 3ZVWA 4HESA 1SHVA 1V9ZA 3UE3A 3AGEA 3SS4A 3EEAA 4PAUA 1NLZA 2PU4A 2Y2HA 4NXFA 3T1RA 3PBTA 1W8YA 4GDBA 3VV4A 1XGIA 4WYYA 4O8GA 3CJMA 2WKPA 4P0MA 5HW3A 3FPWA 3O86A 4B9OA 3MKEA 2BLSA 2EX9A 1NXYA 3C7VA 3T4LA 2W3EA 1CI9A 2ZMVA 2WGIA 1S4RA 3CITA 4LFUA 3IX3A 4FSFA 4KG6A 3V3RA 2P08A 3OCLA 5F69A 4UAAA 1SKFA 4BBUA 1DP8A 4K0WA 4DDYA 4UQIS 3DW0A 3BY9A 5E2HA 1VEUA 4RQ9A 5EVLA 3QP6A 1K38A 4IUKA 5CGSA 4GS9B 1TD5A 3VP1A 4KQOA 3UPPA 3MXQA 3UPOA 1ERQA 3D4FA 3LIEA 1LSXA 4ZJ3A 4NK3A 1PYYA 5AJGA 4S2IA 4ARZA 1BSGA 1ALQA 5J8XA 4OONA 3O3VA 1H3QA 2V1ZA 3PBNA 3E0YA 4R3JA 1LHYA 3PBRA 1XKZA 4WLAA 1PI4A 4R3BA 2M7UA 1KDSA 1E25A 4JXGA 4EETB 3DTEA 5HWTA 1YPRA 4L0LA 1U60A 1IEMA 1JWZA 3HCYA 5EM1A 4GOGA 3SZTA 1E3UA 1ES3A 3O87A 5FDHA 4OQHA 3ZCZA 5FAQA 3W2ZA 3LFVA 1OT6A 3Q7VB 3QP8A 2NUTC 3DTKA 1K55C 3UB6A 3NDGA 2D02A 3GTCA 5TFQA 4BLMA 2JKRI 3KYZA 3JYIA 2ZC3B 1NRJA 4OLDA 5DF8A 3NOUC 1T19A 4UHUA 1O7EA 3LEZA 1BTLA 4B88A 4DE2A 4JGOA 4ZJ2A 4E3MA 3UB7A 3KSHA 4DJ3A 4I3IA 3TW8A 2WGWB 3CUEC 4Y5FA 5FASA 3JVUA 2KDKA 3ULFA 4LLOB 1MWTA 3IT9A 4IHQA 5CEBA 2JKTM 2PR6A 2FZ0A 2Z2LB 3HVFA 4MN6A 5HWWA 4I3AA 1T18A 5KMWA 4OOYA 4HH2A 4R0QA 3E98A 4LGWA 1RP5A 2IWCA 4HEFA 5E2GA 5HD5A 1OTEA 2OV5A 2Q9MA 3MMHA 3CI6A 1XP4A 4KZAA 2V0WA 3FKWA 1GSVA 3NCKA 5J3WA 3IX4A 3LIAA 4MBFA 4QPRA 1JTDA 3CHWP 4GZBA 1EI5A 1NYMA 1BULA 4EWFA 3F1PB 1FQGA 1H0MA 5DFYA 3WRZA 5HZHA 2J3TD 3Q1FA 4WMCA 5FAOA 3BLMA 2R9XA 4NKPA 2IA2A 2ZM8A 1JTGA 1Z6FA 3DTMA 3SS5A 5AQBA 2Y4AA 3F1PA 1K4EA 4M3KA 4RYEA 2WUQA 3Q82A 5LBRA 1NZOA 3GSGA 4MEZA 1FSYA 2QWSA 3VFFA 4IBXA 4OLGA 5L07A 2CC1A 3LYXA 4H6JA 4ETZA 2ZLYA 2W27A 2W3FA 3C4OA 3RH8B 5A91A 3HLGA 1D7EA 2ACGA 2OWJA 3LO7A 2VA0A 3OPRA 4XUXA 1TDGA 1KOUA 3T12B 4E3KA 2QPNA 2V8CA 4OOLA 1MBLA 1LLBA 3HLWA 1SDEA 1MWSA 3UPNA 2Q9NA 4HJ3A 3DBAA 1DY6A 1MPLA 4LV3A 3BWLA 5EE8A 4RX3A 2DCFA 1D1JA 1F98A 1IYOA 3TSGA 5U47A 1SKOB 3I7JA 3RTYA 5CRFA 1TDLA 3P7NA 2HGVA 3UMEA 3PAGA 2VZWA 1KGEA 4Y2FA 4LV0A 3LI8A 3QNCA 1SDNA 3CPTB 3M6BA 4ZJ1A 4EBNA 3E4OA 4YFMA 5FSRA 1XXMA 1CF0A 4F94A 2WZXA 2IWDA 3HUNA 3MZFA 1K6RA 2D01A 4WMCD 2W0NA 5HL1A 4PPRA 3CUEA 1S66L 5G4ZA 1PRQA 2V8FA 1MWRA 1STZA 4X1MA 4I38A 3L7HA 4X68A 4E3OA 2PBYA 3BEBA 5CHMA 1IYSA 1H8ZA 3G31A 2J3WA 1D06A 2Y8HA 2VV6A 3HLDA 3ZG8B 2WAEA 1K54A 2GX5A 2UWXA 4OPZA 5C5KA 2G2UA 3GR2A 3IXHA 4Y0OA 1ESIA 4GJ4A 2W3HA 4EUVA 1FILA 1NRFA 5F1FA 2HDSA 5K5BA 5MC7A 3WS2A 1LSWA 4JPMA 2JN7A 1LT0A 4EBLA 3FYZA 5DTKA 3IF5A 3F1OB 5E2EA 2W3GA 3UDIA 4EW7A 4IEDA 4EV4A 4CLCE 3AGDA 2X02A 4YNRA 2E8IA 2A49A 2ZM0A 4QD4A 1CI8A 4E6XA 3BW6A 3WS5A 3D9YA 4OPRA 3IF6A 3IBRA 2XH9A 4X6TA 5EFWA 5A8BA 1TS8A 3VP2A 1ZG4A 1XGJA 3RJUA 1P0ZA 3MZEA 1WA9A 4I39A 3H82B 3HUOA 4X69A 1KE3A 2PT7A 2EX6A 1ERMA 2QJ5A 1YMSA 5FEGA 4JXWA 5JYOA 2XGNA 1GHMA 3VP0A 5HFOA 3OZHA 4Y17A 5CX7A 1SCWA 4Q8IA 1G5UA 2P9VA 2UV0E 5GLDA 4I5SA 2ZQCA 4L9GA 2V2FF 4EEUA 3UDFA 2R9WA 4IJGA 1YLYA 3PTEA 2B5RA 5EM0A 2V1BA 4JBFA 4R6LA 2HJEA 4GB7A 4HHDA 2DNSA 4H8RA 4OKPA 2EA9A 1PNEA 2ZQ8A 3OLOA 2X71A 5I94A 1ONGA 4WZ5C 1J3WA 1KVLA 2XSSA 1YMXA 2HZ5A 4QU3A 1YKDA 3M6HA 3WS4A 3A0VA 5HARA 3ZHHA 1OPXA 4MBHA 3UB5P 2FFYA 4EQ1A 1YLWA 1TF1A 1N4OA 5EVEA 2OSUA 2H0TA 4K0XA 2LB5A 4WELA 4X56A 4P85A 1OTDA 2FFFB 2JKTI 4JGRA 3U2AA 1VEUB 4BWIA 3G35A 3MBZA 1XJ4A 3Q7VA 5TGFA 1PW1A 3C4PA 5A92A 3T4KA 3S4XA 5HL6A 3BFDA 3KYQA 3EEHA 3HJIA 2J9PA 3LUQA 3PBQA 3OPLA 4BD1A 3AGFA 2ZC7A 3P98A 1XJ6A 4BJPA 4WBGA 2HJ9C 1WYCA 3NULA 2PYPA 3A3DA 2L1MA 4QB8A 2YKFA 3D72A 4O7DA 4MN7A 3SS3A 3NIAA 5FATA 3IXBA 1TS6A 1S1ZA 1FCNA 3OOVA 3HBRA 4FTXA 4LRXC 3JVVA 4HY8A 2EWVA 3MS6A 4U0TA 1E4DA 4ETXA 2K31A 3EQVA 4Y3IA 3BLSA 1G68A 1DRMA 3R4KA 3PYPA 4G3VA 2VJWA 4S2KA 4Y0UA 1YM1A 1OTAA 1EW0A 3FPVA 5HX9A 4N1HA 4GNUA 1JVJA 3OBFA 1YAXA 2ZL1B 1XFQA 3FG8A 4Y13A 3GQZA 4WN5A 2O9CA 3OPHA 3WS0A 1ZTUA 3LIDA 5FQMA 4CLCC 2JHEA 3E4PA 1LSVA 2XFTA 3N8RA 4DXBA 1PZPA 2K2NA 3BQAA 1W7FA 4BENA 4KZBA 1ZC2A 2WK0A 4JXVA 3NOTC 1LL8A 5EV0A 5AVEA 4BMWA 3ZVTA 5EVIA 3NHQA 1JNUA 2ZJ9A 3IF6C 2VGLM 4L9FA 3LY4A 3CLOA 3NBLA 2WKHA 2J9OA 1CJFA 5HD3A 1K54C 1GSXA 2ZQDA 2WZZA 4ESPA 2V0UA 3EGXC 5EVID 5HPIA 2VK3A 2OAP1 4GD8A 2ZQ9A 4NXEA 2O9AA 1NLYA 3F1NB 1W8QA 4P87A 1K56A 1ODVA 4R4SA 1K4FA 5M19A 3F1OA 1N9BA 3LR4A 3NI9A 3FKVA 2Q0OA 3BECA 3UNWA 2G7UA 1HZOA 4NG2A 1I5QA 3GV9A 4EEPA 2Y2IA 2VX8A 4DF6A 2A3UA 1FCMA 2L0WA 2NUPC 4S2LA 1G6OA 4CLCA 3S7PA 3RFBA 4PM6A 1ES2A 3N8LA 3VP3A 4MDZA 2JBFA 3CAXA 5IHVA 2XRNA 3ITBA 2P04A 4C75A 4ID4A 4UQIM 2W3DA 1W79A 2AVXA 1GCEA 4QY6A 2QZ6A 4MMNA 1PIOA 3NJAA 3A0RA 1S6RA 2Y2QA 2WAFA 4N92A 5J7EA 3ZDJA 4A5RA 2VGJA 4LRYC 3E2LA 5JYPA 3VP4A 1QMFA 3B47A 4D2OA 1F5MA 2K7SA 3HLBA 3LR5A 1L0FA 3UE1A 2KOIA 3T1SA 1LL9A 1YT4A 3V67A 1F2KA 3WS1A 3T1XA 3S7NA 3H7WB 3SOIA 3G34A 4GHIB 4NXGA 1CEGA 4ZTKA 3TRCA 1VM1A 4U0XA 4KG2A 2Y91A 4KQDA 2J3TC 1VQQA 4MN5A 2H28A 3E2KA 4KUOA 3NOPC 2ZBBA 3Q81A 3ZQ5A 5GLBA 4EESA 2FH5A 4HIAA 5KSCA 4S2MA 4BL3A 4KZ7A 3OPPA 1XA7A 1FR1A 4KUKA 2Y2JA 2DMWA 2HP6A 3ZFZA 1MY8A 3W4OA 4KZ4A 1TS7A 1C3BA 2Y2NA 2W1TB 1XJ2A 2XD5A 5EVIC 4KQQA 3MR0A 2G2WA 2HDRA 1P9RA 3OCNA 3EQUA 3UE6A 5CGWA 3MQ0A 3HLEA 5HDSA 1PI5A 4KZ9A 1T1AA 4UEYA 3HLFA 4JGPA 1ACFA 3QNBA 2P74A 4Y15A 4ZAMA 1VETA 4B4XA 2PR5A 1S67L 3P09A 1YLTA 2RCXA 4DKIA 1W63M 2XDMA 5FDSA 5GLCA 1Q2QA 4MNRA 3IWQA 3DWZA 2M1CA 2Y2GA 1BLSA 2JKRM 1OJGA 2H5SA 3EOIA 4WUJA 4DRTA 5TBMA 4N9KA 5EECA 1M6KA 4XT2B 3V3SA 3W4PA 4BQMA 3SW1A 1DJBA 3IHBA 2V9AA 3R7WA 3UE0A 3WRTA 5GHYA 4HP4A 1OMEA 4N9LA 3VSLA 3M2KA 3T4SA 1KE0A 1TEMA 4HNBA 3ICYA 1MKMA 5EOEA 4DE0A 2ZQAA 1HLUP 3RXXA 1NJ4A 4XT2A 4L9EA 3DTIA 5CHUA 5EUAA 2QHKA 2O99A 3R7WB 3S1YA 3C38A 3IH9A 4LCLA 1G6AA 1RGZA 4HH3A 4JXSA 2JE5A 3V50A 3PAEA 3ZG5A 3LR0A 3NY4A 2CMNA 2I9VA 2JKGA 3IS2B 4E3IA 1TS0A 1YQSA 4H6JB 4Q0IA 3IHAA 1FCOA 2VV8A 1ZKJA 4B93A 5I5LA 4OPQA 5F5YA 1O07A 5L8MA 2IWBA 4OQ0A 4GS9A 2B18A 1T1CA 2HDQA 2WKRA 1TVFA 4DXCA 2HV1A 4CQHA 3G2ZA 2XROA 1L2SA 3H9WA 4PM8A 3ZNYA 1RCJA 3VFHA 3L9KA 3IX8A 4K08A 4C3QA 1AWIA 4PMAA 4R1GA 3BJNA 2XR0A 1EROA 5DVAA 3ZG9B 3KX0X 2VEAA 3BQ8A 2XA7S 4LCMA 3GRJA 4EBPA 3QP5A 5F68A 4P6ZS 4HBUA 5CHJA 1GA0A 4FUWA 3MSHA 3BFFA 2C5WB 4QJGA 2Y59A 3G32A 5FI6A 3G30A 1T1BA
chains in the Genus database with same CATH topology
2K2NA 4NKPA 2IA2A 2VKSA 3BQAA 3MQQA 5HPFA 3D3OA 5KIZA 3IBJA 1F9IA 1XJ3A 2HF6A 3S7QA 2A2LA 2LB9A 3NOTC 1LL8A 3F1PA 5AVEA 4BMWA 2WKQA 5LBRA 5HWVA 3NHQA 1JNUA 2QWSA 2VGLM 4L9FA 2A24A 3BY8A 3CLOA 4PHTA 3LYXA 4G3KA 2B02A 4H6JA 5HD3A 4ETZA 1GSXA 3LI9A 3T50A 2W27A 4O0PA 2W3FA 3RH8B 3LIBA 4PKYG 2V0UA 3EGXC 1D7EA 2OWJA 4DJ2A 5HPIA 2VA0A 3TE8A 2OAP1 4GCZA 2MJ6A 2OWHA 1VB6A 4NXEA 2O9AA 3C8CA 1NLYA 3F1NB 1KOUA 1X0OA 4LRZE 2V1AA 4GLQA 3ZYTA 4OOLA 3B33A 5TJJA 4HJ3A 1ODVA 3DBAA 3F1OA 3LR4A 3BWLA 3UB9A 2XA7M 4G3WA 1N9OA 2G7UA 4JGQA 4EEPA 1F98A 2L4RA 2VLGA 2VX8A 3MF0A 3PBOA 4EXOA 3LR3A 3RTYA 2L0WA 3E4QA 2NUPC 3P7NA 3VE3A 5DFXA 3PBSA 3VE4A 2HGVA 1OJ5A 1G6OA 1N9LA 4CLCA 3UMEA 2PDRA 2GJ3A 2O9BA 2VZWA 4Y2FA 3S7PA 3KO6A 3RFBA 2Z6DA 4WEJA 3LI8A 4MDZA 3G6OA 3GDIA 2W1RA 4YWZA 3CAXA 4BBVA 2XRNA 3K3CA 3E4OA 3H82A 2P04A 5TBMB 4M4XA 4UQIM 2W3DA 2PHYA 1DP9A 2VGLS 1YSPA 5FL3A 4MMNA 4HP9A 4PKYA 5HDCA 2D01A 4LPZA 3NJAA 3A0RA 2W0NA 3UMDA 3CUEA 1S66L 5J7EA 5G4ZA 4LRYC 2INWA 3PR6A 4Q0HA 1STZA 3B47A 1IOUA 4I38A 3OC2A 1F5MA 2K7SA 3LR5A 4GW9A 2R78A 1IFQA 2KOIA 5DJUA 2PYRA 3V67A 4DMZA 3S7NA 4WL9A 3H7WB 4P6ZM 1N9NA 2J3WA 2PD7A 1D06A 2Y8HA 3LIFA 4R70A 2VV6A 5DF9A 4GHIB 4NXGA 1VHMA 2VV7A 4YOFA 3TRCA 4DN0A 3VOLA 2GX5A 5C5KA 4KQDA 2J3TC 4O01A 5DKLA 4MN5A 2H28A 3PXPA 3HJKA 4HJ6A 2QKPA 2ZOIA 4KUOA 3NOPC 2ZBBA 4EERA 1GSWA 1UGUA 1Y28A 3ZQ5A 4EESA 4GJ4A 2FH5A 2W3HA 4EUVA 1MZUA 5K5BA 4Q0JA 5MC7A 4HIAA 1LSWA 1OT9A 2JN7A 2BASA 4EU0A 1LT0A 5F6AA 3C2WA 4R38A 4KUKA 2GZAA 3K3DA 2DMWA 3F1OB 4E04A 1S1YA 2W3GA 2Z6CA 4CLCD 4EW7A 4ME4A 3UB8A 4HI4A 4CLCE 1V9YA 4YNRA 4R3AA 1G28A 1TS7A 5HSQA 3BW6A 2W1TB 3F1NA 4FOFA 1XJ2A 4CLCB 3MR0A 3IS2A 3H7WA 3C30A 1V9ZA 2ZMFA 1P9RA 3IBRA 3OCNA 3EEAA 3UE3A 4PAUA 3EQUA 1OTBA 1UWPX 1NLZA 3UE6A 4GHIA 4IUHA 3PBTA 4NXFA 3VV4A 1NWZA 5EFWA 3MQ0A 4O8GA 5A8BA 1TS8A 2WKPA 5HDSA 1T1AA 3FPWA 4JGPA 4UEYA 5KSHA 2P7JA 1P0ZA 4B9OA 1WA9A 4I39A 1ZHHB 3T4QA 3H82B 4WEKA 2PT7A 2QJ5A 3T4LA 2W3EA 2ZMVA 2PR5A 2PD8A 1S4RA 1S67L 3CITA 4FSFA 4AFIA 2OAQ1 2P08A 3OCLA 1W63M 5F69A 2QYBA 5CX7A 4NXBA 4BBUA 1DP8A 4I5SA 2J80A 2QJ7A 3FC7A 4UQIS 2M1CA 3BY9A 4L9GA 2JKRM 4EEUA 1OJGA 4RQ9A 3EOIA 4IJGA 4IUKA 3S7OA 4GS9B 2O0YA 1TD5A 4WUJA 4KQOA 5DKKA 3MXQA 5TBMA 2V1BA 3LIEA 4R6LA 1LSXA 2HJEA 2W1TA 3KSIA 2M7VA 4HHDA 5AJGA 4XT2B 3T4JA 4F3LB 4ARZA 3P01A 2EA9A 1P9WA 1OTIA 3SW1A 2V9AA 3R7WA 1H3QA 3OLOA 5IT5A 3PBNA 3E0YA 4Z1WA 4HP4A 3CWFA 3PBRA 3T4SA 4ZRRA 4II7A 2KX6A 4WLAA 2XSSA 1YKDA 3B42A 1MC0A 3ICYA 4HNBA 2M7UA 1MKMA 3A0VA 4EETB 5HWTA 1OPXA 4L0LA 3T4TA 3KSFA 4EQ1A 5AVFA 4XT2A 4F3LA 1TF1A 4L9EA 3HCYA 3MFXA 1DP6A 4I3JA 2LB5A 2QHKA 4WELA 2O99A 2ZOHA 3R7WB 2KLIA 3C38A 1OTDA 2JKTI 4JGRA 3K2NA 3W2ZA 3LFVA 3U2AA 1OT6A 4BWIA 2NUTC 1XJ4A 4HH3A 3UB6A 5G4YA 2D02A 1XFNA 2JKRI 3KYZA 1NRJA 3T4KA 3LICA 5HL6A 3KYQA 3EEHA 3HJIA 3NOUC 1T19A 3LUQA 3PBQA 3LR0A 2CMNA 1S4SA 2I9VA 3IS2B 4JGOA 3EGDC 1XJ6A 3UB7A 4BJPA 1TS0A 3KSHA 2HJ9C 2PYPA 4H6JB 4HJ4A 4Q0IA 4WF0A 4DJ3A 2OOLA 4I3IA 2VV8A 4B93A 5I5LA 3TW8A 2L1MA 2YKFA 3D72A 3CUEC 4Y5FA 4MN7A 5F5YA 3JVUA 2KDKA 3ULFA 5IS1A 4LLOB 1TS6A 1S1ZA 4IHQA 5L8MA 1P97A 3OOVA 2JKTM 2PR6A 2FZ0A 4GS9A 4MN6A 5HWWA 3PHYA 3T4OA 4HQAA 4I3AA 1T18A 4LRXC 2B18A 1T1CA 1YSQA 3JVVA 2WKRA 4HY8A 2EWVA 2HV1A 3GECA 4CQHA 4HH2A 2Y79A 4BBTA 3E98A 2XROA 4ETXA 5IU1A 2K31A 3EQVA 5HD5A 1OTEA 4Y3IA 1DRMA 3R4KA 3MMHA 4OOMA 3CI6A 1H8MA 3PYPA 3MQOA 4G3VA 3H9WA 2V0WA 4NEED 2VJWA 3MJQA 1OTAA 3KSGA 1GSVA 4MCWA 5J3WA 1EW0A 3FPVA 3A0SA 3LIAA 3EWKA 4K08A 4QPRA 5J4EA 3BJNA 5DJTA 2EWWA 3KX0X 3O5YA 3OBFA 2VEAA 1YAXA 3BQ8A 3FG8A 1XFQA 3F1PB 2XA7S 5DFYA 4WN5A 4HOIA 2O9CA 5F68A 4P6ZS 5HZHA 2J3TD 2GNXA 1ZTUA 2YKHA 4ARZB 1UWNX 3LIDA 4CLCC 1BYWA 5HDDA 2JHEA 2A24B 3E4PA 1LSVA 1W63Q 3TJZC 1T1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTD A;  5TBM B;  3MR0 A;  3IS2 A;  3H7W A;  1V9Z A;  4JGR A;  3MQQ A;  3IBR A;  4M4X A;  1OTB A;  1UWP X;  5KIZ A;  3UE6 A;  1F9I A;  1OT6 A;  2PHY A;  1DP9 A;  1XJ3 A;  4GHI A;  4NXF A;  1XJ4 A;  4HH3 A;  1NWZ A;  1LL8 A;  3NOT C;  5EFW A;  3UB6 A;  3F1P A;  5G4Y A;  1TS8 A;  2D02 A;  2WKP A;  4HP9 A;  4EEU A;  5A8B A;  5AVE A;  5IS1 A;  5HDS A;  1XFN A;  4PKY A;  5HDC A;  2WKQ A;  1T1A A;  2D01 A;  4JGP A;  4LPZ A;  5HWV A;  2P7J A;  1P0Z A;  3A0R A;  1WA9 A;  1JNU A;  3NJA A;  3NHQ A;  2W0N A;  4I39 A;  4B9O A;  3LIC A;  2QWS A;  3H82 B;  3UMD A;  3EEH A;  1S66 L;  3HJI A;  5J7E A;  3NOU C;  1T19 A;  2QJ5 A;  3LUQ A;  4L9F A;  5G4Z A;  2A24 A;  3BY8 A;  2CMN A;  3CLO A;  3LYX A;  1S4S A;  2B02 A;  4H6J A;  2INW A;  4LRY C;  1GSX A;  2I9V A;  3LI9 A;  2PR5 A;  5HD3 A;  2W27 A;  3T50 A;  2PD8 A;  1S4R A;  1S67 L;  3IS2 B;  4JGO A;  3RH8 B;  3LIB A;  1XJ6 A;  3UB7 A;  1TS0 A;  4I38 A;  4PKY G;  4H6J B;  2PYP A;  2V0U A;  4HJ4 A;  4WF0 A;  4DJ3 A;  5F69 A;  2OOL A;  1D7E A;  2VV8 A;  2K7S A;  4I3I A;  4GW9 A;  5I5L A;  2R78 A;  2L1M A;  2OWJ A;  4DJ2 A;  4NXB A;  2YKF A;  3D72 A;  4BBU A;  5DJU A;  1DP8 A;  2PYR A;  5F5Y A;  2KDK A;  4I5S A;  2J80 A;  2QJ7 A;  4WL9 A;  3ULF A;  3FC7 A;  4LLO B;  1TS6 A;  3H7W B;  1N9N A;  1S1Z A;  2PD7 A;  1D06 A;  1P97 A;  2OWH A;  4GCZ A;  2PR6 A;  2M1C A;  3BY9 A;  1VB6 A;  4GS9 A;  3LIF A;  4L9G A;  4MN6 A;  2VV6 A;  4NXE A;  3PHY A;  3C8C A;  4R70 A;  3F1N B;  5HWW A;  4HQA A;  4I3A A;  1KOU A;  1T18 A;  1OJG A;  1X0O A;  4GHI B;  2V1A A;  1T1C A;  2VV7 A;  4LRZ E;  4LRX C;  4NXG A;  4RQ9 A;  2WKR A;  4HY8 A;  4GS9 B;  2HV1 A;  3GEC A;  4WUJ A;  4HH2 A;  3VOL A;  4BBT A;  5DKK A;  5TBM A;  3MXQ A;  4KQD A;  5DKL A;  3B33 A;  5IU1 A;  2V1B A;  4MN5 A;  5HD5 A;  2H28 A;  1OTE A;  3LIE A;  3HJK A;  4R6L A;  4HJ3 A;  1DRM A;  1LSX A;  1ODV A;  4HJ6 A;  3PYP A;  3F1O A;  3MQO A;  3H9W A;  2QKP A;  2ZOI A;  2V0W A;  3BWL A;  4HHD A;  4KUO A;  3UB9 A;  3MJQ A;  3NOP C;  4XT2 B;  4F3L B;  1N9O A;  1OTA A;  1GSV A;  1GSW A;  2ZBB A;  1UGU A;  4JGQ A;  4EER A;  1Y28 A;  5J3W A;  3ZQ5 A;  4EES A;  1EW0 A;  2EA9 A;  1OTI A;  4EEP A;  3A0S A;  1F98 A;  3SW1 A;  1MZU A;  2V9A A;  2L4R A;  3LIA A;  2VLG A;  3EWK A;  3OLO A;  4K08 A;  4HIA A;  1LSW A;  5J4E A;  1OT9 A;  4HP4 A;  3CWF A;  4EXO A;  2JN7 A;  5DJT A;  2BAS A;  3RTY A;  2L0W A;  3E4Q A;  3KX0 X;  2KX6 A;  1LT0 A;  3P7N A;  5F6A A;  4WLA A;  3VE3 A;  3VE4 A;  2VEA A;  1OJ5 A;  1N9L A;  3C2W A;  1XFQ A;  3FG8 A;  3ICY A;  4HNB A;  4KUK A;  4R38 A;  3F1P B;  2PDR A;  3UME A;  3K3D A;  3A0V A;  2GJ3 A;  4EET B;  3F1O B;  4WN5 A;  5HWT A;  4HOI A;  4E04 A;  1S1Y A;  5F68 A;  2Z6C A;  5HZH A;  2Z6D A;  4EW7 A;  3UB8 A;  4HI4 A;  3LI8 A;  1V9Y A;  2YKH A;  3G6O A;  3GDI A;  4EQ1 A;  4R3A A;  1UWN X;  3LID A;  4XT2 A;  5AVF A;  4F3L A;  4L9E A;  1BYW A;  5HDD A;  2JHE A;  1G28 A;  2A24 B;  3E4P A;  3MFX A;  1TS7 A;  4YWZ A;  3CAX A;  1DP6 A;  4BBV A;  1LSV A;  4I3J A;  2QHK A;  5HSQ A;  3F1N A;  2ZOH A;  1XJ2 A;  3K3C A;  3E4O A;  3H82 A;  1T1B A; 
#chains in the Genus database with same CATH topology
 4RVA A;  2VKS A;  3QP2 A;  3D3O A;  3IBJ A;  5HAQ A;  1F9I A;  1XJ3 A;  3S7Q A;  5D3O A;  1M40 A;  2LB9 A;  1RGY A;  5DTT A;  2WKI A;  1XA1 A;  2WKQ A;  2WYX A;  5HWV A;  1KGG A;  2WGV A;  2XFS A;  4PHT A;  4IVK A;  4G3K A;  2B02 A;  2B95 A;  3T50 A;  4O0P A;  4WZ4 A;  3LIB A;  1JWP A;  4PKY G;  1KE4 A;  3N7W A;  4HBT A;  4OVD A;  1S0W A;  5CTN A;  4KZ6 A;  3TE8 A;  5FI7 A;  4X55 A;  3RXW A;  3ZG7 B;  2MJ6 A;  2OWH A;  3SH8 A;  1J9M A;  1X0O A;  4LRZ E;  2V1A A;  4JF4 A;  4GLQ A;  1H8Y A;  5AQ7 A;  4P6B A;  5CGX A;  1XPB A;  1ONH A;  2XA7 M;  3MXS A;  4G3W A;  1N9O A;  4FH2 A;  4PM7 A;  4JF5 A;  4OH0 A;  3VOZ A;  2VLG A;  3ZG0 A;  4U3T A;  3PBO A;  4EXO A;  2HPB A;  1BLC A;  3E4Q A;  3MZD A;  3IQA A;  4Y0T A;  5DFX A;  3V5M A;  3VE4 A;  1N9L A;  4UA9 A;  2O9B A;  4GD6 A;  4OP5 A;  3BFE A;  2Z6D A;  3UDX A;  3G6O A;  4JKT A;  3GDI A;  4ZBE A;  4MBK A;  2WAD A;  3VOY A;  3A3E A;  3MFD A;  3W8K A;  3UN7 A;  3K3C A;  2EFU A;  5F1G A;  3UO9 A;  1AXB A;  2PHY A;  1DP9 A;  1QME A;  3VMA A;  5DF7 A;  3HUM A;  4PKY A;  5HDC A;  4LPZ A;  5GHX A;  4PM9 A;  3FZC A;  4OPY A;  3PR6 A;  4Q0H A;  3ISG A;  1IOU A;  3LCE A;  4KEN B;  3C7U A;  5GLA A;  4FH4 A;  4GW9 A;  2R78 A;  1IFQ A;  5CTM A;  5DJU A;  4WM9 A;  2XK1 A;  4P6Z M;  1N9N A;  2PD7 A;  3LIF A;  4R70 A;  1KDW A;  5DF9 A;  2WKE A;  5GL9 A;  3A3I A;  3ZGA B;  2VV7 A;  4YOF A;  4DN0 A;  3VOL A;  4EUZ A;  5TR7 A;  3IH8 A;  3HJK A;  3M2J A;  4IVI A;  3QP1 A;  3FWL A;  5KZH A;  2ZD8 A;  4EQI A;  4EER A;  4KZ8 A;  1UGU A;  5A90 A;  1YLP A;  1SKO A;  4X25 A;  1MZU A;  4S2O A;  4Q0J A;  1XX2 A;  2Z2M B;  4OP8 A;  1GA9 A;  3T1Q B;  3IXD A;  3N8S A;  2BAS A;  4DDS A;  5EPH A;  4R38 A;  4R4R A;  2X01 A;  4S2J A;  2GZA A;  1Y4O A;  4E04 A;  1S1Y A;  2C6W B;  1K57 A;  2Z6C A;  3UB8 A;  5HAP A;  1V9Y A;  4S2N C;  2HP5 A;  5HSQ A;  4FOF A;  5F83 A;  3DWK A;  4CLC B;  2PAV P;  3N6I A;  3IS2 A;  3H7W A;  3C30 A;  2ZMF A;  3SH9 A;  4KQR A;  1OTB A;  1UWP X;  1ZG6 A;  4GHI A;  4IUH A;  1IYQ A;  3B3X A;  5FQI A;  1NWZ A;  4B4Z A;  1FR6 A;  1JWV A;  4LV1 A;  5KSH A;  2P7J A;  5CXW A;  4XXR A;  3TG9 A;  1ZHH B;  3IWO A;  3T4Q A;  4WEK A;  4X1L A;  1BT5 A;  2PD8 A;  4E3J A;  4AFI A;  2OAQ 1;  2QYB A;  3LEQ A;  1ESU A;  5AQ9 A;  4NXB A;  2I72 A;  3C5A A;  1WYB A;  2JC7 A;  2PBD P;  2J80 A;  2QJ7 A;  3W4Q A;  1K6S A;  3FC7 A;  2XLN A;  1L0E A;  3S22 A;  4FD8 A;  4RA7 A;  3TJZ C;  1K55 A;  3S7O A;  2O0Y A;  3LGO A;  5DKK A;  2RL3 A;  3MXR A;  2XD1 A;  2W1T A;  3O88 A;  3KSI A;  2E8J A;  2M7V A;  5DTS A;  3T4J A;  4F3L B;  3BYD A;  2H0Y A;  5EVI B;  4ZDX A;  3P01 A;  1P9W A;  1OTI A;  5AQA A;  1LI9 A;  5FAP A;  1PWG A;  1PW8 A;  3LY3 A;  5IT5 A;  4Z1W A;  1IKG A;  3CWF A;  1K57 C;  1BZA A;  2XF3 A;  4ZRR A;  4II7 A;  2KX6 A;  4JF6 A;  3B42 A;  1MC0 A;  2V20 A;  2ZL1 A;  4YIN A;  3T4T A;  3KSF A;  5AVF A;  4F3L A;  3MFX A;  2OLU A;  5FQ9 A;  1DP6 A;  4I3J A;  2ZOH A;  2KLI A;  5FI2 A;  4WZ5 A;  1L0G A;  1GHP A;  3K2N A;  3QHY A;  1Y54 A;  4UA7 A;  3TOI A;  3IWI A;  1CQA A;  2PU2 A;  1K0K A;  1GHI A;  2PRF A;  5G4Y A;  4PM5 A;  1XFN A;  4E3N A;  2Y2L A;  4Z9Q A;  4LEN A;  3LIC A;  3A3J A;  4D60 A;  5M18 A;  3MKF A;  1MKI A;  4JLF A;  2Y2O A;  1S4S A;  2H10 A;  3WWX A;  4R23 A;  3EGD C;  2P9V B;  2ZC6 B;  4HJ4 A;  4WF0 A;  1ES5 A;  2WGW A;  2OOL A;  2ZC4 B;  3GVB A;  3CMZ A;  2QMI A;  4XUZ A;  5IS1 A;  1LI0 A;  1P97 A;  1WE4 A;  2Y2P A;  3PHY A;  3T4O A;  4HQA A;  1YSQ A;  3GEC A;  1PWD A;  2Y79 A;  4BBT A;  3Q7Z A;  3IF6 B;  2BG1 A;  5IU1 A;  5EOO A;  1BLP A;  3G4P A;  4OOM A;  3ZNT A;  1H8M A;  2J7V A;  3MQO A;  4NEE D;  4GKU A;  2Y55 A;  3MJQ A;  1EWZ A;  3KSG A;  4MCW A;  4MLL A;  3A0S A;  4CPK A;  4E3L A;  2J8Y A;  3EWK A;  3Q07 A;  1YLJ A;  5J4E A;  1L0D A;  1NZU A;  5DJT A;  2EWW A;  3O5Y A;  3BFC A;  1SZV A;  3HRE A;  2GDN A;  4HOI A;  3A3F A;  3HL9 A;  1HD8 A;  2GNX A;  2YKH A;  4K91 A;  4ARZ B;  3VSK A;  1UWN X;  1BYW A;  5FQQ A;  1Q2P A;  5HDD A;  2A24 B;  3NDE A;  4LV2 A;  1DJA A;  2Y2K A;  1W63 Q;  3N4I A;  3UY6 A;  3MQQ A;  1LL5 A;  5HPF A;  5KIZ A;  2Y2M A;  1DJC A;  2HF6 A;  4OQG A;  2JKF A;  2A2L A;  3HLC A;  3SH7 A;  2ZM2 A;  2DRW A;  2A24 A;  3BY8 A;  4KZ3 A;  3BFG A;  3LI9 A;  1BUE A;  4GN2 A;  3BRM A;  5E2F A;  1L3L A;  1CEF A;  1CK3 A;  1FOF A;  3CPT A;  1KVM A;  4DJ2 A;  4DE1 A;  4KG5 A;  1PZO A;  3NEC A;  4GCZ A;  1VB6 A;  3C8C A;  2HP9 A;  5L2F A;  4C6Y A;  3ZYT A;  5FA7 A;  5L10 A;  1NY0 A;  5CEC A;  3B33 A;  5TJJ A;  3UB9 A;  3U4L P;  4X53 A;  1K56 D;  4JGQ A;  3QP4 A;  3BM6 A;  4S2N A;  5F82 A;  2XEP A;  2L4R A;  5GHZ A;  1VET B;  3MF0 A;  3NC8 A;  3CZD A;  1PWC A;  4E6W A;  3KYE A;  3LR3 A;  2XQZ A;  4S2P A;  1H5X A;  3VE3 A;  5G18 A;  3PBS A;  5L09 A;  2BTF P;  1OJ5 A;  2PDR A;  2GJ3 A;  1I2W A;  4BD0 A;  1ES4 A;  3KO6 A;  2EX2 A;  5E43 A;  4WEJ A;  2EXA A;  3G2Y A;  1BLH A;  1Z09 A;  2W1R A;  4YWZ A;  4BBV A;  1IEL A;  1W5D A;  1IYP A;  3FV7 A;  3H82 A;  4RX2 A;  4FCF A;  3DAV A;  5TBM B;  1PFL A;  4M4X A;  2VGL S;  3CG5 A;  1YSP A;  5FL3 A;  5FQJ A;  4HP9 A;  1I2S A;  3ITA A;  5M1A A;  1IKI A;  3IXG A;  2JCH A;  3UMD A;  4GDN A;  2INW A;  1HTZ A;  3OC2 A;  4QWO A;  2EXB A;  5CER A;  4QHC A;  4CJN A;  2VGK A;  2PYR A;  4N1X A;  4DE3 A;  4DMZ A;  4WL9 A;  2ZMA A;  5FEF A;  5BOH A;  1FSW A;  2EX8 A;  3V39 A;  1A0K A;  1VHM A;  2OLV A;  5FQK A;  1K25 A;  4IBR A;  4O01 A;  1HVB A;  5DKL A;  4QY5 A;  3PXP A;  4HJ6 A;  2QKP A;  2ZOI A;  1MWU A;  1GSW A;  1KGF A;  3GMW A;  1Y28 A;  4Y7P A;  4KZ5 A;  1OT9 A;  5A93 A;  5CED A;  1YLZ A;  4EU0 A;  5F6A A;  2HDU A;  3C2W A;  2ZC5 B;  4BL2 A;  4UA6 A;  1FIK A;  3JPU A;  3K3D A;  2ZQ7 A;  1NYY A;  4CLC D;  4ME4 A;  5HAI A;  1E3U D;  4HI4 A;  4OQI A;  4NET A;  4R3A A;  2EFX A;  1G28 A;  1MXO A;  3F1N A;  3ZVW A;  4HES A;  1SHV A;  1V9Z A;  3UE3 A;  3AGE A;  3SS4 A;  3EEA A;  4PAU A;  1NLZ A;  2PU4 A;  2Y2H A;  4NXF A;  3T1R A;  3PBT A;  1W8Y A;  4GDB A;  3VV4 A;  1XGI A;  4WYY A;  4O8G A;  3CJM A;  2WKP A;  4P0M A;  5HW3 A;  3FPW A;  3O86 A;  4B9O A;  3MKE A;  2BLS A;  2EX9 A;  1NXY A;  3C7V A;  3T4L A;  2W3E A;  1CI9 A;  2ZMV A;  2WGI A;  1S4R A;  3CIT A;  4LFU A;  3IX3 A;  4FSF A;  4KG6 A;  3V3R A;  2P08 A;  3OCL A;  5F69 A;  4UAA A;  1SKF A;  4BBU A;  1DP8 A;  4K0W A;  4DDY A;  4UQI S;  3DW0 A;  3BY9 A;  5E2H A;  1VEU A;  4RQ9 A;  5EVL A;  3QP6 A;  1K38 A;  4IUK A;  5CGS A;  4GS9 B;  1TD5 A;  3VP1 A;  4KQO A;  3UPP A;  3MXQ A;  3UPO A;  1ERQ A;  3D4F A;  3LIE A;  1LSX A;  4ZJ3 A;  4NK3 A;  1PYY A;  5AJG A;  4S2I A;  4ARZ A;  1BSG A;  1ALQ A;  5J8X A;  4OON A;  3O3V A;  1H3Q A;  2V1Z A;  3PBN A;  3E0Y A;  4R3J A;  1LHY A;  3PBR A;  1XKZ A;  4WLA A;  1PI4 A;  4R3B A;  2M7U A;  1KDS A;  1E25 A;  4JXG A;  4EET B;  3DTE A;  5HWT A;  1YPR A;  4L0L A;  1U60 A;  1IEM A;  1JWZ A;  3HCY A;  5EM1 A;  4GOG A;  3SZT A;  1E3U A;  1ES3 A;  3O87 A;  5FDH A;  4OQH A;  3ZCZ A;  5FAQ A;  3W2Z A;  3LFV A;  1OT6 A;  3Q7V B;  3QP8 A;  2NUT C;  3DTK A;  1K55 C;  3UB6 A;  3NDG A;  2D02 A;  3GTC A;  5TFQ A;  4BLM A;  2JKR I;  3KYZ A;  3JYI A;  2ZC3 B;  1NRJ A;  4OLD A;  5DF8 A;  3NOU C;  1T19 A;  4UHU A;  1O7E A;  3LEZ A;  1BTL A;  4B88 A;  4DE2 A;  4JGO A;  4ZJ2 A;  4E3M A;  3UB7 A;  3KSH A;  4DJ3 A;  4I3I A;  3TW8 A;  2WGW B;  3CUE C;  4Y5F A;  5FAS A;  3JVU A;  2KDK A;  3ULF A;  4LLO B;  1MWT A;  3IT9 A;  4IHQ A;  5CEB A;  2JKT M;  2PR6 A;  2FZ0 A;  2Z2L B;  3HVF A;  4MN6 A;  5HWW A;  4I3A A;  1T18 A;  5KMW A;  4OOY A;  4HH2 A;  4R0Q A;  3E98 A;  4LGW A;  1RP5 A;  2IWC A;  4HEF A;  5E2G A;  5HD5 A;  1OTE A;  2OV5 A;  2Q9M A;  3MMH A;  3CI6 A;  1XP4 A;  4KZA A;  2V0W A;  3FKW A;  1GSV A;  3NCK A;  5J3W A;  3IX4 A;  3LIA A;  4MBF A;  4QPR A;  1JTD A;  3CHW P;  4GZB A;  1EI5 A;  1NYM A;  1BUL A;  4EWF A;  3F1P B;  1FQG A;  1H0M A;  5DFY A;  3WRZ A;  5HZH A;  2J3T D;  3Q1F A;  4WMC A;  5FAO A;  3BLM A;  2R9X A;  4NKP A;  2IA2 A;  2ZM8 A;  1JTG A;  1Z6F A;  3DTM A;  3SS5 A;  5AQB A;  2Y4A A;  3F1P A;  1K4E A;  4M3K A;  4RYE A;  2WUQ A;  3Q82 A;  5LBR A;  1NZO A;  3GSG A;  4MEZ A;  1FSY A;  2QWS A;  3VFF A;  4IBX A;  4OLG A;  5L07 A;  2CC1 A;  3LYX A;  4H6J A;  4ETZ A;  2ZLY A;  2W27 A;  2W3F A;  3C4O A;  3RH8 B;  5A91 A;  3HLG A;  1D7E A;  2ACG A;  2OWJ A;  3LO7 A;  2VA0 A;  3OPR A;  4XUX A;  1TDG A;  1KOU A;  3T12 B;  4E3K A;  2QPN A;  2V8C A;  4OOL A;  1MBL A;  1LLB A;  3HLW A;  1SDE A;  1MWS A;  3UPN A;  2Q9N A;  4HJ3 A;  3DBA A;  1DY6 A;  1MPL A;  4LV3 A;  3BWL A;  5EE8 A;  4RX3 A;  2DCF A;  1D1J A;  1F98 A;  1IYO A;  3TSG A;  5U47 A;  1SKO B;  3I7J A;  3RTY A;  5CRF A;  1TDL A;  3P7N A;  2HGV A;  3UME A;  3PAG A;  2VZW A;  1KGE A;  4Y2F A;  4LV0 A;  3LI8 A;  3QNC A;  1SDN A;  3CPT B;  3M6B A;  4ZJ1 A;  4EBN A;  3E4O A;  4YFM A;  5FSR A;  1XXM A;  1CF0 A;  4F94 A;  2WZX A;  2IWD A;  3HUN A;  3MZF A;  1K6R A;  2D01 A;  4WMC D;  2W0N A;  5HL1 A;  4PPR A;  3CUE A;  1S66 L;  5G4Z A;  1PRQ A;  2V8F A;  1MWR A;  1STZ A;  4X1M A;  4I38 A;  3L7H A;  4X68 A;  4E3O A;  2PBY A;  3BEB A;  5CHM A;  1IYS A;  1H8Z A;  3G31 A;  2J3W A;  1D06 A;  2Y8H A;  2VV6 A;  3HLD A;  3ZG8 B;  2WAE A;  1K54 A;  2GX5 A;  2UWX A;  4OPZ A;  5C5K A;  2G2U A;  3GR2 A;  3IXH A;  4Y0O A;  1ESI A;  4GJ4 A;  2W3H A;  4EUV A;  1FIL A;  1NRF A;  5F1F A;  2HDS A;  5K5B A;  5MC7 A;  3WS2 A;  1LSW A;  4JPM A;  2JN7 A;  1LT0 A;  4EBL A;  3FYZ A;  5DTK A;  3IF5 A;  3F1O B;  5E2E A;  2W3G A;  3UDI A;  4EW7 A;  4IED A;  4EV4 A;  4CLC E;  3AGD A;  2X02 A;  4YNR A;  2E8I A;  2A49 A;  2ZM0 A;  4QD4 A;  1CI8 A;  4E6X A;  3BW6 A;  3WS5 A;  3D9Y A;  4OPR A;  3IF6 A;  3IBR A;  2XH9 A;  4X6T A;  5EFW A;  5A8B A;  1TS8 A;  3VP2 A;  1ZG4 A;  1XGJ A;  3RJU A;  1P0Z A;  3MZE A;  1WA9 A;  4I39 A;  3H82 B;  3HUO A;  4X69 A;  1KE3 A;  2PT7 A;  2EX6 A;  1ERM A;  2QJ5 A;  1YMS A;  5FEG A;  4JXW A;  5JYO A;  2XGN A;  1GHM A;  3VP0 A;  5HFO A;  3OZH A;  4Y17 A;  5CX7 A;  1SCW A;  4Q8I A;  1G5U A;  2P9V A;  2UV0 E;  5GLD A;  4I5S A;  2ZQC A;  4L9G A;  2V2F F;  4EEU A;  3UDF A;  2R9W A;  4IJG A;  1YLY A;  3PTE A;  2B5R A;  5EM0 A;  2V1B A;  4JBF A;  4R6L A;  2HJE A;  4GB7 A;  4HHD A;  2DNS A;  4H8R A;  4OKP A;  2EA9 A;  1PNE A;  2ZQ8 A;  3OLO A;  2X71 A;  5I94 A;  1ONG A;  4WZ5 C;  1J3W A;  1KVL A;  2XSS A;  1YMX A;  2HZ5 A;  4QU3 A;  1YKD A;  3M6H A;  3WS4 A;  3A0V A;  5HAR A;  3ZHH A;  1OPX A;  4MBH A;  3UB5 P;  2FFY A;  4EQ1 A;  1YLW A;  1TF1 A;  1N4O A;  5EVE A;  2OSU A;  2H0T A;  4K0X A;  2LB5 A;  4WEL A;  4X56 A;  4P85 A;  1OTD A;  2FFF B;  2JKT I;  4JGR A;  3U2A A;  1VEU B;  4BWI A;  3G35 A;  3MBZ A;  1XJ4 A;  3Q7V A;  5TGF A;  1PW1 A;  3C4P A;  5A92 A;  3T4K A;  3S4X A;  5HL6 A;  3BFD A;  3KYQ A;  3EEH A;  3HJI A;  2J9P A;  3LUQ A;  3PBQ A;  3OPL A;  4BD1 A;  3AGF A;  2ZC7 A;  3P98 A;  1XJ6 A;  4BJP A;  4WBG A;  2HJ9 C;  1WYC A;  3NUL A;  2PYP A;  3A3D A;  2L1M A;  4QB8 A;  2YKF A;  3D72 A;  4O7D A;  4MN7 A;  3SS3 A;  3NIA A;  5FAT A;  3IXB A;  1TS6 A;  1S1Z A;  1FCN A;  3OOV A;  3HBR A;  4FTX A;  4LRX C;  3JVV A;  4HY8 A;  2EWV A;  3MS6 A;  4U0T A;  1E4D A;  4ETX A;  2K31 A;  3EQV A;  4Y3I A;  3BLS A;  1G68 A;  1DRM A;  3R4K A;  3PYP A;  4G3V A;  2VJW A;  4S2K A;  4Y0U A;  1YM1 A;  1OTA A;  1EW0 A;  3FPV A;  5HX9 A;  4N1H A;  4GNU A;  1JVJ A;  3OBF A;  1YAX A;  2ZL1 B;  1XFQ A;  3FG8 A;  4Y13 A;  3GQZ A;  4WN5 A;  2O9C A;  3OPH A;  3WS0 A;  1ZTU A;  3LID A;  5FQM A;  4CLC C;  2JHE A;  3E4P A;  1LSV A;  2XFT A;  3N8R A;  4DXB A;  1PZP A;  2K2N A;  3BQA A;  1W7F A;  4BEN A;  4KZB A;  1ZC2 A;  2WK0 A;  4JXV A;  3NOT C;  1LL8 A;  5EV0 A;  5AVE A;  4BMW A;  3ZVT A;  5EVI A;  3NHQ A;  1JNU A;  2ZJ9 A;  3IF6 C;  2VGL M;  4L9F A;  3LY4 A;  3CLO A;  3NBL A;  2WKH A;  2J9O A;  1CJF A;  5HD3 A;  1K54 C;  1GSX A;  2ZQD A;  2WZZ A;  4ESP A;  2V0U A;  3EGX C;  5EVI D;  5HPI A;  2VK3 A;  2OAP 1;  4GD8 A;  2ZQ9 A;  4NXE A;  2O9A A;  1NLY A;  3F1N B;  1W8Q A;  4P87 A;  1K56 A;  1ODV A;  4R4S A;  1K4F A;  5M19 A;  3F1O A;  1N9B A;  3LR4 A;  3NI9 A;  3FKV A;  2Q0O A;  3BEC A;  3UNW A;  2G7U A;  1HZO A;  4NG2 A;  1I5Q A;  3GV9 A;  4EEP A;  2Y2I A;  2VX8 A;  4DF6 A;  2A3U A;  1FCM A;  2L0W A;  2NUP C;  4S2L A;  1G6O A;  4CLC A;  3S7P A;  3RFB A;  4PM6 A;  1ES2 A;  3N8L A;  3VP3 A;  4MDZ A;  2JBF A;  3CAX A;  5IHV A;  2XRN A;  3ITB A;  2P04 A;  4C75 A;  4ID4 A;  4UQI M;  2W3D A;  1W79 A;  2AVX A;  1GCE A;  4QY6 A;  2QZ6 A;  4MMN A;  1PIO A;  3NJA A;  3A0R A;  1S6R A;  2Y2Q A;  2WAF A;  4N92 A;  5J7E A;  3ZDJ A;  4A5R A;  2VGJ A;  4LRY C;  3E2L A;  5JYP A;  3VP4 A;  1QMF A;  3B47 A;  4D2O A;  1F5M A;  2K7S A;  3HLB A;  3LR5 A;  1L0F A;  3UE1 A;  2KOI A;  3T1S A;  1LL9 A;  1YT4 A;  3V67 A;  1F2K A;  3WS1 A;  3T1X A;  3S7N A;  3H7W B;  3SOI A;  3G34 A;  4GHI B;  4NXG A;  1CEG A;  4ZTK A;  3TRC A;  1VM1 A;  4U0X A;  4KG2 A;  2Y91 A;  4KQD A;  2J3T C;  1VQQ A;  4MN5 A;  2H28 A;  3E2K A;  4KUO A;  3NOP C;  2ZBB A;  3Q81 A;  3ZQ5 A;  5GLB A;  4EES A;  2FH5 A;  4HIA A;  5KSC A;  4S2M A;  4BL3 A;  4KZ7 A;  3OPP A;  1XA7 A;  1FR1 A;  4KUK A;  2Y2J A;  2DMW A;  2HP6 A;  3ZFZ A;  1MY8 A;  3W4O A;  4KZ4 A;  1TS7 A;  1C3B A;  2Y2N A;  2W1T B;  1XJ2 A;  2XD5 A;  5EVI C;  4KQQ A;  3MR0 A;  2G2W A;  2HDR A;  1P9R A;  3OCN A;  3EQU A;  3UE6 A;  5CGW A;  3MQ0 A;  3HLE A;  5HDS A;  1PI5 A;  4KZ9 A;  1T1A A;  4UEY A;  3HLF A;  4JGP A;  1ACF A;  3QNB A;  2P74 A;  4Y15 A;  4ZAM A;  1VET A;  4B4X A;  2PR5 A;  1S67 L;  3P09 A;  1YLT A;  2RCX A;  4DKI A;  1W63 M;  2XDM A;  5FDS A;  5GLC A;  1Q2Q A;  4MNR A;  3IWQ A;  3DWZ A;  2M1C A;  2Y2G A;  1BLS A;  2JKR M;  1OJG A;  2H5S A;  3EOI A;  4WUJ A;  4DRT A;  5TBM A;  4N9K A;  5EEC A;  1M6K A;  4XT2 B;  3V3S A;  3W4P A;  4BQM A;  3SW1 A;  1DJB A;  3IHB A;  2V9A A;  3R7W A;  3UE0 A;  3WRT A;  5GHY A;  4HP4 A;  1OME A;  4N9L A;  3VSL A;  3M2K A;  3T4S A;  1KE0 A;  1TEM A;  4HNB A;  3ICY A;  1MKM A;  5EOE A;  4DE0 A;  2ZQA A;  1HLU P;  3RXX A;  1NJ4 A;  4XT2 A;  4L9E A;  3DTI A;  5CHU A;  5EUA A;  2QHK A;  2O99 A;  3R7W B;  3S1Y A;  3C38 A;  3IH9 A;  4LCL A;  1G6A A;  1RGZ A;  4HH3 A;  4JXS A;  2JE5 A;  3V50 A;  3PAE A;  3ZG5 A;  3LR0 A;  3NY4 A;  2CMN A;  2I9V A;  2JKG A;  3IS2 B;  4E3I A;  1TS0 A;  1YQS A;  4H6J B;  4Q0I A;  3IHA A;  1FCO A;  2VV8 A;  1ZKJ A;  4B93 A;  5I5L A;  4OPQ A;  5F5Y A;  1O07 A;  5L8M A;  2IWB A;  4OQ0 A;  4GS9 A;  2B18 A;  1T1C A;  2HDQ A;  2WKR A;  1TVF A;  4DXC A;  2HV1 A;  4CQH A;  3G2Z A;  2XRO A;  1L2S A;  3H9W A;  4PM8 A;  3ZNY A;  1RCJ A;  3VFH A;  3L9K A;  3IX8 A;  4K08 A;  4C3Q A;  1AWI A;  4PMA A;  4R1G A;  3BJN A;  2XR0 A;  1ERO A;  5DVA A;  3ZG9 B;  3KX0 X;  2VEA A;  3BQ8 A;  2XA7 S;  4LCM A;  3GRJ A;  4EBP A;  3QP5 A;  5F68 A;  4P6Z S;  4HBU A;  5CHJ A;  1GA0 A;  4FUW A;  3MSH A;  3BFF A;  2C5W B;  4QJG A;  2Y59 A;  3G32 A;  5FI6 A;  3G30 A;  1T1B A; 
#chains in the Genus database with same CATH homology
 2K2N A;  4NKP A;  2IA2 A;  2VKS A;  3BQA A;  3MQQ A;  5HPF A;  3D3O A;  5KIZ A;  3IBJ A;  1F9I A;  1XJ3 A;  2HF6 A;  3S7Q A;  2A2L A;  2LB9 A;  3NOT C;  1LL8 A;  3F1P A;  5AVE A;  4BMW A;  2WKQ A;  5LBR A;  5HWV A;  3NHQ A;  1JNU A;  2QWS A;  2VGL M;  4L9F A;  2A24 A;  3BY8 A;  3CLO A;  4PHT A;  3LYX A;  4G3K A;  2B02 A;  4H6J A;  5HD3 A;  4ETZ A;  1GSX A;  3LI9 A;  3T50 A;  2W27 A;  4O0P A;  2W3F A;  3RH8 B;  3LIB A;  4PKY G;  2V0U A;  3EGX C;  1D7E A;  2OWJ A;  4DJ2 A;  5HPI A;  2VA0 A;  3TE8 A;  2OAP 1;  4GCZ A;  2MJ6 A;  2OWH A;  1VB6 A;  4NXE A;  2O9A A;  3C8C A;  1NLY A;  3F1N B;  1KOU A;  1X0O A;  4LRZ E;  2V1A A;  4GLQ A;  3ZYT A;  4OOL A;  3B33 A;  5TJJ A;  4HJ3 A;  1ODV A;  3DBA A;  3F1O A;  3LR4 A;  3BWL A;  3UB9 A;  2XA7 M;  4G3W A;  1N9O A;  2G7U A;  4JGQ A;  4EEP A;  1F98 A;  2L4R A;  2VLG A;  2VX8 A;  3MF0 A;  3PBO A;  4EXO A;  3LR3 A;  3RTY A;  2L0W A;  3E4Q A;  2NUP C;  3P7N A;  3VE3 A;  5DFX A;  3PBS A;  3VE4 A;  2HGV A;  1OJ5 A;  1G6O A;  1N9L A;  4CLC A;  3UME A;  2PDR A;  2GJ3 A;  2O9B A;  2VZW A;  4Y2F A;  3S7P A;  3KO6 A;  3RFB A;  2Z6D A;  4WEJ A;  3LI8 A;  4MDZ A;  3G6O A;  3GDI A;  2W1R A;  4YWZ A;  3CAX A;  4BBV A;  2XRN A;  3K3C A;  3E4O A;  3H82 A;  2P04 A;  5TBM B;  4M4X A;  4UQI M;  2W3D A;  2PHY A;  1DP9 A;  2VGL S;  1YSP A;  5FL3 A;  4MMN A;  4HP9 A;  4PKY A;  5HDC A;  2D01 A;  4LPZ A;  3NJA A;  3A0R A;  2W0N A;  3UMD A;  3CUE A;  1S66 L;  5J7E A;  5G4Z A;  4LRY C;  2INW A;  3PR6 A;  4Q0H A;  1STZ A;  3B47 A;  1IOU A;  4I38 A;  3OC2 A;  1F5M A;  2K7S A;  3LR5 A;  4GW9 A;  2R78 A;  1IFQ A;  2KOI A;  5DJU A;  2PYR A;  3V67 A;  4DMZ A;  3S7N A;  4WL9 A;  3H7W B;  4P6Z M;  1N9N A;  2J3W A;  2PD7 A;  1D06 A;  2Y8H A;  3LIF A;  4R70 A;  2VV6 A;  5DF9 A;  4GHI B;  4NXG A;  1VHM A;  2VV7 A;  4YOF A;  3TRC A;  4DN0 A;  3VOL A;  2GX5 A;  5C5K A;  4KQD A;  2J3T C;  4O01 A;  5DKL A;  4MN5 A;  2H28 A;  3PXP A;  3HJK A;  4HJ6 A;  2QKP A;  2ZOI A;  4KUO A;  3NOP C;  2ZBB A;  4EER A;  1GSW A;  1UGU A;  1Y28 A;  3ZQ5 A;  4EES A;  4GJ4 A;  2FH5 A;  2W3H A;  4EUV A;  1MZU A;  5K5B A;  4Q0J A;  5MC7 A;  4HIA A;  1LSW A;  1OT9 A;  2JN7 A;  2BAS A;  4EU0 A;  1LT0 A;  5F6A A;  3C2W A;  4R38 A;  4KUK A;  2GZA A;  3K3D A;  2DMW A;  3F1O B;  4E04 A;  1S1Y A;  2W3G A;  2Z6C A;  4CLC D;  4EW7 A;  4ME4 A;  3UB8 A;  4HI4 A;  4CLC E;  1V9Y A;  4YNR A;  4R3A A;  1G28 A;  1TS7 A;  5HSQ A;  3BW6 A;  2W1T B;  3F1N A;  4FOF A;  1XJ2 A;  4CLC B;  3MR0 A;  3IS2 A;  3H7W A;  3C30 A;  1V9Z A;  2ZMF A;  1P9R A;  3IBR A;  3OCN A;  3EEA A;  3UE3 A;  4PAU A;  3EQU A;  1OTB A;  1UWP X;  1NLZ A;  3UE6 A;  4GHI A;  4IUH A;  3PBT A;  4NXF A;  3VV4 A;  1NWZ A;  5EFW A;  3MQ0 A;  4O8G A;  5A8B A;  1TS8 A;  2WKP A;  5HDS A;  1T1A A;  3FPW A;  4JGP A;  4UEY A;  5KSH A;  2P7J A;  1P0Z A;  4B9O A;  1WA9 A;  4I39 A;  1ZHH B;  3T4Q A;  3H82 B;  4WEK A;  2PT7 A;  2QJ5 A;  3T4L A;  2W3E A;  2ZMV A;  2PR5 A;  2PD8 A;  1S4R A;  1S67 L;  3CIT A;  4FSF A;  4AFI A;  2OAQ 1;  2P08 A;  3OCL A;  1W63 M;  5F69 A;  2QYB A;  5CX7 A;  4NXB A;  4BBU A;  1DP8 A;  4I5S A;  2J80 A;  2QJ7 A;  3FC7 A;  4UQI S;  2M1C A;  3BY9 A;  4L9G A;  2JKR M;  4EEU A;  1OJG A;  4RQ9 A;  3EOI A;  4IJG A;  4IUK A;  3S7O A;  4GS9 B;  2O0Y A;  1TD5 A;  4WUJ A;  4KQO A;  5DKK A;  3MXQ A;  5TBM A;  2V1B A;  3LIE A;  4R6L A;  1LSX A;  2HJE A;  2W1T A;  3KSI A;  2M7V A;  4HHD A;  5AJG A;  4XT2 B;  3T4J A;  4F3L B;  4ARZ A;  3P01 A;  2EA9 A;  1P9W A;  1OTI A;  3SW1 A;  2V9A A;  3R7W A;  1H3Q A;  3OLO A;  5IT5 A;  3PBN A;  3E0Y A;  4Z1W A;  4HP4 A;  3CWF A;  3PBR A;  3T4S A;  4ZRR A;  4II7 A;  2KX6 A;  4WLA A;  2XSS A;  1YKD A;  3B42 A;  1MC0 A;  3ICY A;  4HNB A;  2M7U A;  1MKM A;  3A0V A;  4EET B;  5HWT A;  1OPX A;  4L0L A;  3T4T A;  3KSF A;  4EQ1 A;  5AVF A;  4XT2 A;  4F3L A;  1TF1 A;  4L9E A;  3HCY A;  3MFX A;  1DP6 A;  4I3J A;  2LB5 A;  2QHK A;  4WEL A;  2O99 A;  2ZOH A;  3R7W B;  2KLI A;  3C38 A;  1OTD A;  2JKT I;  4JGR A;  3K2N A;  3W2Z A;  3LFV A;  3U2A A;  1OT6 A;  4BWI A;  2NUT C;  1XJ4 A;  4HH3 A;  3UB6 A;  5G4Y A;  2D02 A;  1XFN A;  2JKR I;  3KYZ A;  1NRJ A;  3T4K A;  3LIC A;  5HL6 A;  3KYQ A;  3EEH A;  3HJI A;  3NOU C;  1T19 A;  3LUQ A;  3PBQ A;  3LR0 A;  2CMN A;  1S4S A;  2I9V A;  3IS2 B;  4JGO A;  3EGD C;  1XJ6 A;  3UB7 A;  4BJP A;  1TS0 A;  3KSH A;  2HJ9 C;  2PYP A;  4H6J B;  4HJ4 A;  4Q0I A;  4WF0 A;  4DJ3 A;  2OOL A;  4I3I A;  2VV8 A;  4B93 A;  5I5L A;  3TW8 A;  2L1M A;  2YKF A;  3D72 A;  3CUE C;  4Y5F A;  4MN7 A;  5F5Y A;  3JVU A;  2KDK A;  3ULF A;  5IS1 A;  4LLO B;  1TS6 A;  1S1Z A;  4IHQ A;  5L8M A;  1P97 A;  3OOV A;  2JKT M;  2PR6 A;  2FZ0 A;  4GS9 A;  4MN6 A;  5HWW A;  3PHY A;  3T4O A;  4HQA A;  4I3A A;  1T18 A;  4LRX C;  2B18 A;  1T1C A;  1YSQ A;  3JVV A;  2WKR A;  4HY8 A;  2EWV A;  2HV1 A;  3GEC A;  4CQH A;  4HH2 A;  2Y79 A;  4BBT A;  3E98 A;  2XRO A;  4ETX A;  5IU1 A;  2K31 A;  3EQV A;  5HD5 A;  1OTE A;  4Y3I A;  1DRM A;  3R4K A;  3MMH A;  4OOM A;  3CI6 A;  1H8M A;  3PYP A;  3MQO A;  4G3V A;  3H9W A;  2V0W A;  4NEE D;  2VJW A;  3MJQ A;  1OTA A;  3KSG A;  1GSV A;  4MCW A;  5J3W A;  1EW0 A;  3FPV A;  3A0S A;  3LIA A;  3EWK A;  4K08 A;  4QPR A;  5J4E A;  3BJN A;  5DJT A;  2EWW A;  3KX0 X;  3O5Y A;  3OBF A;  2VEA A;  1YAX A;  3BQ8 A;  3FG8 A;  1XFQ A;  3F1P B;  2XA7 S;  5DFY A;  4WN5 A;  4HOI A;  2O9C A;  5F68 A;  4P6Z S;  5HZH A;  2J3T D;  2GNX A;  1ZTU A;  2YKH A;  4ARZ B;  1UWN X;  3LID A;  4CLC C;  1BYW A;  5HDD A;  2JHE A;  2A24 B;  3E4P A;  1LSV A;  1W63 Q;  3TJZ C;  1T1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...