3N4IA

Crystal structure of the shv-1 d104e beta-lactamase/beta-lactamase inhibitor protein (blip) complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVEYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Specificity and Cooperativity at beta-lactamase Position 104 in TEM-1/BLIP and SHV-1/BLIP interactions
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
total genus 98
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3n4iA00
4JXWA 1TDGA 2FFYA 5F83A 2WZXA 2C5WB 4L0LA 4E6WA 2ZQDA 2WAEA 3VP0A 4PM7A 4DXCA 3V39A 5FA7A 1YLYA 4XXRA 3G35A 3CJMA 1NYYA 1YLWA 3GQZA 3DW0A 4GDBA 2IWDA 4DF6A 3S22A 4U3TA 2EFXA 2WZZA 2R9XA 3C7VA 3G31A 3N4IA 5CGWA 3D4FA 4QJGA 1WE4A 4KG2A 1SKFA 3ZG5A 5A91A 2G2UA 1E3UD 4C6YA 2J7VA 4GZBA 5EVIA 2EX8A 2JCHA 2ZQ7A 1IKIA 2XLNA 2IWCA 3DTMA 2Y59A 1XX2A 1JTDA 3SS3A 3QNBA 4X68A 5D3OA 4JF6A 4OPZA 1EWZA 4X55A 5TFQA 4OPYA 1FCMA 1KE4A 1CEGA 5GHYA 4IVIA 4E6XA 3HBRA 4N1XA 4OH0A 3OPLA 1WYBA 5FQMA 3HLFA 4GD8A 3RXWA 2Y55A 4UAAA 1SDEA 1L0GA 1BULA 4U0TA 4JF4A 2RCXA 5CHJA 3CZDA 3NIAA 4PM5A 4P87A 2DCFA 4MNRA 4EV4A 4KENB 1E4DA 4K0WA 1Q2PA 2Z2LB 1WYCA 4LCLA 4EBNA 2Y2GA 4BLMA 3IH9A 3QNCA 4KG6A 4KZ6A 3C4OA 4X69A 1GCEA 3BFDA 4S2KA 5EVIB 5I94A 2QZ6A 3TSGA 1XA1A 2EXAA 5CTNA 1M6KA 1YMSA 1O7EA 4B4XA 1JWVA 3VMAA 1IYOA 1N4OA 4MEZA 2V20A 4S2PA 1KDSA 4GB7A 1HZOA 1GHMA 4JBFA 1HVBA 2XFSA 2H5SA 3PBRA 3PAGA 5M18A 3N8RA 5GLCA 1SCWA 4OQHA 4WZ4A 3N6IA 4KZ9A 3UPPA 3I7JA 2J9OA 4A5RA 4EWFA 3WRTA 2Y2OA 4KQRA 3WWXA 3EQVA 3BLMA 4Q8IA 1FR6A 2WKHA 3BLSA 3RJUA 1XGJA 3UPOA 1JTGA 1YLZA 3M6HA 3N8SA 5FQKA 1KGGA 1L2SA 3G2ZA 4E3MA 1KGEA 1RCJA 1MY8A 1S0WA 4E3JA 4Y0TA 5DTKA 1QMEA 4IBXA 1ZKJA 3NY4A 1FR1A 3OCLA 1JWZA 1PI5A 1FSWA 4BQMA 3ZG9B 1PZPA 3NDGA 5GHZA 1IYQA 3TOIA 1FCNA 2ZD8A 4ZJ1A 2PU4A 1Z6FA 3MZEA 4ID4A 1FOFA 3S4XA 2OSUA 3IWOA 5FDHA 3BFCA 4Y0UA 5E43A 3Q7ZA 1E25A 1TEMA 1EI5A 3NDEA 3DWZA 2Z2MB 2VGJA 3ZGAB 1ERQA 1ZG4A 3JYIA 3S1YA 3HLDA 1FSYA 1BLSA 5DTSA 3PBSA 5FI7A 4K0XA 1H8ZA 4LENA 4PPRA 1YT4A 3SH8A 1ONHA 3A3EA 4KZ4A 1VQQA 3SS5A 3RXXA 1K6RA 2ZM0A 1YQSA 3G30A 1XXMA 1K25A 4NK3A 1K54A 3O88A 1DJCA 2HDQA 2WKEA 4QB8A 2XEPA 3M2KA 1NXYA 1K54C 3HREA 2G2WA 3UO9A 5EOEA 1K56A 5F1GA 3SOIA 1W8QA 1YLJA 3ZG8B 3PAEA 3ZNYA 4GNUA 4MLLA 4E3IA 4X53A 2V1ZA 3OZHA 4BD0A 1LHYA 4XUZA 4Y0OA 5FAQA 4KZ3A 5AQBA 5KSHA 4F94A 4E3NA 3V5MA 4S2NA 3PBQA 3MFDA 4OOYA 2H0TA 4EUZA 4WEKA 4HESA 1DJAA 5GLBA 1I2SA 1PIOA 4OPQA 4S2NC 4X6TA 1BLPA 1XP4A 3FYZA 3ZFZA 3GSGA 2XH9A 3MZDA 3TG9A 1MWTA 2DNSA 2OLVA 2EXBA 4HBUA 1W5DA 2WUQA 1MWSA 1IYSA 4JXGA 3IQAA 4UA9A 5EVIC 3EQUA 5JYPA 1AXBA 4IEDA 5FQIA 4GKUA 4LCMA 1ES3A 1LL9A 3PBTA 3MXSA 2XGNA 3LCEA 4XUXA 4OVDA 4QD4A 3VP2A 3G34A 5DF8A 1H8YA 3UNWA 4DDSA 4JF5A 4RVAA 4BD1A 4OPRA 4Y7PA 2CC1A 3B3XA 3HLGA 2OV5A 3QHYA 1LI9A 1ESUA 3NI9A 1XA7A 4S2MA 4Z9QA 1BLHA 1S6RA 3C4PA 3OCNA 4ZJ2A 2VGKA 2V2FF 2PU2A 5FAOA 5EECA 4BL3A 4OOMA 5CEBA 2XDMA 4WMCD 4C75A 4FD8A 1RGYA 4OP8A 4JPMA 5CGXA 5CECA 4B88A 3VP3A 3GMWA 5HAQA 3BEBA 4M3KA 1K4FA 3FV7A 4P85A 3OPRA 5HW3A 3E2LA 4HBTA 1GHPA 3O86A 4ZAMA 5J8XA 3M2JA 5TR7A 1PI4A 4KG5A 4EBPA 5GHXA 3ZCZA 3N8LA 4R3BA 4WYYA 5FI2A 4DE2A 2QMIA 3ZNTA 3SH9A 4E3LA 1MBLA 1GA0A 1IYPA 2EFUA 1HTZA 4WM9A 4S2LA 2I72A 5HAIA 2A49A 1GA9A 5CHMA 5IHVA 3VOYA 5CRFA 3SS4A 3ZDJA 3UDIA 1NJ4A 3WS4A 2ZC7A 2X71A 1I2WA 2ZQ9A 3BFFA 4LV2A 5E2HA 2JE5A 4ZTKA 3PBNA 3FKVA 2UWXA 4E3KA 3GVBA 5EUAA 3E2KA 3ZG7B 4RX3A 2ZMAA 3FKWA 1MKIA 2ZQ8A 4OQ0A 4UA6A 4KZ5A 2HDRA 5AQAA 5G18A 2Y2HA 3GRJA 3HUMA 2ZC4B 5FASA 1PWDA 1PWGA 5TGFA 4N92A 1QMFA 1Y54A 4WZ5A 4MBKA 3A3JA 3N7WA 2IWBA 4YFMA 3UE3A 3A3DA 1KE3A 1G68A 4WZ5C 1LLBA 1PWCA 1FCOA 5CERA 4CPKA 5KSCA 1J9MA 3IHAA 4DE3A 3A3IA 3BYDA 2WGVA 4QU3A 4RA7A 3UDXA 1C3BA 1MWRA 4KZ8A 2Q9NA 3Q7VA 4EQIA 4LV0A 3ZVWA 1BLCA 4N1HA 2BG1A 5JYOA 2ZC6B 1K57A 4FH2A 5CEDA 5FQQA 3IXHA 4DXBA 4ZDXA 3O87A 5EVLA 2WGWB 1K57C 4DKIA 3G4PA 1NRFA 2EX2A 1MWUA 3IXBA 5M19A 2Y2PA 1HD8A 4PM8A 3AGDA 4BJPA 2E8IA 4KQOA 5BOHA 1O07A 3IHBA 3FZCA 1W79A 2XFTA 1K55A 3WRZA 1K4EA 4OLDA 2ZC3B 4OONA 2Y2MA 1K55C 4FSFA 4E3OA 1RP5A 3HLEA 3DWKA 3OPPA 1BZAA 3LY3A 1IEMA 4UHUA 4DDYA 3IXDA 5E2FA 1ZG6A 3MKEA 3NCKA 2XR0A 4JLFA 3ZVTA 1K38A 2EX9A 2HDSA 3BRMA 4FH4A 2XF3A 3HVFA 1DY6A 3Q7VB 2ZQCA 2FFFB 4B4ZA 1ESIA 4MBFA 4KZBA 4U0XA 2P74A 1NZOA 3ISGA 2R9WA 1ES4A 1VM1A 4LV1A 1L0FA 2P9VB 3LO7A 3Q1FA 3O3VA 1BTLA 5FI6A 2H10A 4ZJ3A 3UY6A 5A90A 1SHVA 5HX9A 2XD5A 2GDNA 2J9PA 2WAFA 3IH8A 4QY6A 2Y2KA 1YLTA 1PW1A 5A93A 4GDNA 2Y91A 3AGEA 1ERMA 1IKGA 3ITBA 4H8RA 5EVID 3VSLA 1E3UA 3Q81A 5CHUA 4OKPA 4R23A 4UA7A 5A92A 4LV3A 2ZC5B 4C3QA 5CTMA 1ES2A 1KDWA 4R3JA 1ZC2A 5AQ7A 4N9LA 1YMXA 5FAPA 3WS1A 4P6BA 4OOLA 2H0YA 1EROA 3SH7A 1CI9A 4O7DA 3Q07A 5KMWA 5DF9A 2HP5A 3V50A 2WADA 3V3SA 4BENA 1M40A 2Y4AA 3NC8A 2HDUA 1L0EA 1LI0A 1NYMA 2Y2LA 5L2FA 1OMEA 4WEJA 5E2GA 3MZFA 4BL2A 4CJNA 4PM9A 3UPNA 3HLWA 3IF6A 3ZG0A 4D2OA 4DE0A 3BFEA 5KZHA 5M1AA 3FWLA 4QY5A 5FSRA 4R4RA 3WS0A 1RGZA 3AGFA 4IVKA 1PZOA 2Y2IA 3IF6C 4S2JA 4WMCA 5E2EA 2ZM8A 3W4QA 5DTTA 5FATA 2HPBA 3GTCA 4GD6A 4JKTA 4OQGA 5EE8A 2HP6A 3HLCA 4WBGA 1W8YA 3GR2A 3MXRA 3W4OA 3VP4A 2Y2NA 3VSKA 3A3FA 5HARA 4GN2A 4X56A 5GLDA 3VFFA 3V3RA 3IT9A 2JC7A 1U60A 4WELA 3MKFA 3VFHA 1KGFA 3VOZA 1MXOA 1LL5A 3G2YA 2RL3A 1N9BA 2X02A 3UN7A 2XK1A 3IWIA 1XKZA 2WGWA 4K91A 5DVAA 4DRTA 1SDNA 1ONGA 4R1GA 1H5XA 2J8YA 2ZM2A 4MBHA 4P0MA 2X01A 1BSGA 1BUEA 4NETA 2BLSA 3HL9A 4DE1A 1K6SA 3CG5A 4RX2A 3OC2A 4JXSA 2Y2JA 5HFOA 3IF5A 5U47A 4YINA 2WKIA 3UDFA 3IF6B 3G32A 2JBFA 4OLGA 4PM6A 2C6WB 4FCFA 3MBZA 3VP1A 2DRWA 3UE1A 2ZQAA 4GOGA 1GHIA 5F82A 2XQZA 5FQJA 4S2OA 4RYEA 1BT5A 5AQ9A 1PW8A 1CI8A 2QPNA 4OQIA 2WYXA 3WS2A 2ZLYA 1MPLA 5FQ9A 1ES5A 5CGSA 3HUOA 3OPHA 2A3UA 4KZAA 4OP5A 3P98A 4EBLA 2EX6A 5CXWA 2P9VA 3ZHHA 2HP9A 4PMAA 4KZ7A 1CK3A 4R0QA 5GL9A 3UE0A 3BM6A 1I5QA 1XPBA 1Q2QA 1L0DA 2Y2QA 3NBLA 2WGIA 1KVLA 1W7FA 4ZBEA 3WS5A 2Q9MA 2WK0A 3GV9A 1G6AA 1KE0A 2XD1A 3BECA 4KQQA 4N9KA 5F1FA 1YM1A 2PBYA 4QHCA 1TDLA 3W8KA 1NZUA 3IXGA 1JVJA 3ITAA 1PYYA 3PBOA 1ALQA 3HUNA 5EOOA 5EPHA 3LY4A 1IELA 3W4PA 5HL1A 1XGIA 1K56D 1KVMA 5GLAA 3M6BA 3Q82A 3CMZA 1FQGA 4R4SA 4HEFA 1YLPA 2ZJ9A 4IBRA 1DJBA 3BFGA 5HAPA 3LEZA 1NY0A 3IWQA 3PTEA 3C7UA 2OLUA 4S2IA 3P09A 5DF7A 1JWPA 3C5AA 1CEFA 2B5RA 4JXVA 3HLBA 1TVFA
chains in the Genus database with same CATH superfamily
4JXWA 4O0PA 4I39A 2XRNA 4L0LA 4E6WA 1VETB 3UB9A 2PD7A 4K08A 1YLWA 3DTKA 4GDBA 1AWIA 2EFXA 2WZZA 3G31A 4I3IA 4KG2A 3ZG5A 2G2UA 1E3UD 2ZQ7A 3BY9A 1XX2A 4HIAA 4JF6A 3VE3A 3F1NA 4X55A 3CUEC 5EFWA 1YSPA 5GHYA 4E6XA 3HBRA 2JKRM 3ZQ5A 2Y55A 1NLYA 3C8CA 2RCXA 4GLQA 2KOIA 3A0SA 4P87A 2DCFA 4MNRA 3H7WA 1Q2PA 2Z2LB 2J3TC 3QNCA 4KG6A 4X69A 5EVIB 4S2KA 3BFDA 5I94A 3TSGA 1Z09A 2EXAA 5CTNA 2PYPA 3VMAA 4BWIA 3UB8A 4P6ZS 1KDSA 2PDRA 4WF0A 1HVBA 2H5SA 3PBRA 5MC7A 2O9CA 3N8RA 4Y15A 3UPPA 2J9OA 3KSGA 1FR6A 3BLSA 3LIFA 1XGJA 3UPOA 1YLZA 4LGWA 5IU1A 1L2SA 2NUPC 4HHDA 3MQ0A 4E3JA 3CWFA 5DTKA 1QMEA 4IBXA 1G6OA 1FR1A 3UE6A 2I9VA 5HDCA 3F1PB 4BQMA 2W1TB 1IYQA 1FCNA 1LT0A 1VETA 3MZEA 3T50A 1OPXA 4ID4A 3MSHA 3VE4A 3QP2A 1TEMA 1EI5A 1K0KA 3DWZA 2VGJA 3JYIA 3BQAA 4X25A 2QKPA 3SH8A 1ONHA 4KZ4A 1D1JA 3RXXA 1ODVA 3T4LA 1XXMA 4NK3A 1SKOB 4QB8A 4EERA 2XEPA 3M2KA 3G6OA 3SOIA 1W8QA 3R4KA 2V1ZA 2GNXA 5KSHA 4XT2A 3PR6A 1TS0A 3MFDA 4EUZA 3SW1A 5GLBA 1OT9A 4S2NC 4X6TA 3ZFZA 4LRXC 2XH9A 2Z6CA 2DNSA 2EXBA 1W5DA 4UA9A 1BYWA 3EQUA 5JYPA 1AXBA 4IEDA 1Y28A 3DTEA 4I38A 3VP2A 5G4YA 4RVAA 4OPRA 4HQAA 3HLGA 2OV5A 3QHYA 2HV1A 1XA7A 4Z9QA 1S6RA 3OCNA 1W63M 5DJUA 3V67A 2PU2A 2V0WA 2P7JA 2FH5A 5DKLA 4WMCD 1UGUA 5DFXA 4HBTA 1GHPA 3RH8B 2OAP1 3M2JA 1PI4A 3ZCZA 3UMEA 4I5SA 4B9OA 1MBLA 1IYPA 1TS8A 5HAIA 2A49A 5IHVA 2YKHA 5CRFA 2UV0E 1NJ4A 4HNBA 2ZQ9A 4Z1WA 2UWXA 1OT6A 2V8FA 4RX3A 4UA6A 1SKOA 2M7VA 1MC0A 2ZMVA 3DAVA 5FASA 5TGFA 4MBKA 3A3JA 3TW8A 4UQIM 5KSCA 4CPKA 4WZ5C 1LLBA 1FCOA 5CERA 4QPRA 4I3JA 4RA7A 1C3BA 1MWRA 3EEAA 4MDZA 4EQIA 2ZC6B 5CEDA 4ZDXA 1K57C 3IXBA 4QWOA 2Y2PA 5J7EA 1HD8A 3AGDA 3FG8A 3IHBA 3E4QA 3WRZA 4OLDA 2ZC3B 4OONA 1K55C 4FSFA 3OPPA 3ZYTA 3DWKA 3KYQA 1BZAA 3P7NA 3NCKA 2HDSA 1GSVA 2XF3A 3IBRA 3D3OA 4WL9A 4HJ3A 4KZBA 1NZOA 2PYRA 4LV1A 1LSXA 2H10A 5A90A 1SHVA 3IH8A 1YLTA 1PW1A 2Y91A 4MN5A 4YWZA 4UA7A 4LV3A 2VK3A 1KDWA 3B33A 2KLIA 2KDKA 4M4XA 5KMWA 1OTDA 2HP5A 1M40A 2HDUA 1LI0A 3P01A 3MZFA 1T1CA 3MQOA 3UPNA 5KZHA 3BFEA 5FSRA 4WMCA 3CLOA 4NXEA 4P6ZM 4WBGA 3HLCA 3R7WA 5HARA 4GN2A 1TF1A 3JVUA 4ETZA 4BBVA 4EXOA 1XKZA 4DRTA 3NHQA 4GHIB 4P0MA 3CG5A 4FOFA 4HY8A 2Y2JA 4JXSA 5HFOA 5U47A 3IF6B 5FL3A 5EM1A 4PM6A 1S1ZA 4GOGA 5F82A 2JN7A 2XSSA 4S2OA 1CI8A 5K5BA 2VGLS 2O99A 4JGPA 5CGSA 3OPHA 4H6JA 4KZAA 4OP5A 3P98A 4R0QA 4Y2FA 1XPBA 1X0OA 2Q9MA 4BBTA 2WK0A 2XD1A 3W8KA 3OBFA 5EOOA 5HL1A 3W4PA 4NEED 5GLAA 3CMZA 3LYXA 3K3DA 4DMZA 1NY0A 4S2IA 4HH2A 3HCYA 1JWPA 3HLBA 5F83A 1V9ZA 2K2NA 2WAEA 4DXCA 3CJMA 5DKKA 4U3TA 3DBAA 1WE4A 1SKFA 4Y5FA 2EX8A 2JKRI 2XLNA 3DTMA 1P97A 2W3DA 2KX6A 1EWZA 4D60A 1FCMA 1KE4A 3KX0X 4N1XA 3OPLA 1WYBA 4G3WA 3CI6A 4UAAA 1L0GA 1BULA 3NIAA 5HWWA 3LFVA 3RTYA 2INWA 2VEAA 4KZ6A 4EQ1A 5HZHA 1GCEA 4B4XA 1IYOA 3F1NB 1F5MA 5KIZA 2AVXA 1N4OA 2V20A 4EESA 5M18A 1SCWA 4KZ9A 3WWXA 2L1MA 4KQRA 1JTGA 3M6HA 1KGGA 3H7WB 1LSVA 3L7HA 4MN7A 3NY4A 2B02A 3OCLA 3T1RA 3ULFA 1JWZA 1PI5A 5GHZA 4ZJ1A 2PU4A 1Z6FA 1MZUA 3BFCA 4UQIS 4Y0UA 5F68A 1LL8A 4GW9A 1ZG4A 5FI7A 4K0XA 4LENA 2Z6DA 3A3EA 3KYEA 1F2KA 1DP9A 3FPWA 1YSQA 2HDQA 2P08A 2WKEA 1TS7A 1K54C 3HREA 1PFLA 4IUKA 4X53A 3OZHA 4XUZA 4CLCE 4KZ3A 4F94A 1YKDA 4S2NA 3PBQA 4OOYA 2H0TA 5HWVA 1XP4A 2HGVA 2WUQA 4JXGA 1OTEA 2Q0OA 4GKUA 1ES3A 1T1BA 5EV0A 1LL9A 3SZTA 3LCEA 4OVDA 3UNWA 4O01A 3B3XA 3NI9A 4S2MA 1BLHA 2V2FF 3MXQA 4IHQA 4NXBA 4XT2B 5EECA 4OOMA 3T1SA 2XDMA 4FD8A 1DP8A 2PR5A 5CGXA 5CECA 4B88A 3VP3A 5HAQA 4P85A 3E2LA 1MKMA 3O86A 4L9FA 1ACFA 4EBPA 5GHXA 4R3BA 4WYYA 1HLUP 4CLCD 2VX8A 4ZRRA 3ZNTA 4E3LA 2W27A 4WM9A 3QP8A 1GA9A 5CHMA 3IX3A 3BJNA 3SS4A 4O8GA 3BFFA 2E8JA 3PBNA 2VGLM 4E3KA 2V1AA 3ZG7B 2R78A 1CF0A 3EEHA 4OQ0A 1MKIA 5G18A 5AQAA 5F69A 5FEGA 2V8CA 2JKTM 3LIBA 3HUMA 1PWDA 3NULA 4WZ5A 4R38A 3N7WA 3UE3A 3KO6A 3A3DA 1G68A 3IHAA 4DE3A 3BYDA 4YOFA 4ETXA 3UDXA 4KZ8A 2D02A 1J3WA 1K57A 4FH2A 5FQQA 4DKIA 3G4PA 3LUQA 4G3VA 4PAUA 4BJPA 3FZCA 1W79A 1K55A 2Y2MA 1PNEA 1S66L 4UHUA 4DDYA 3MKEA 3IS2A 3ZVTA 3D9YA 1DY6A 4B4ZA 2Y8HA 1ESIA 3ISGA 1XJ3A 2R9WA 2VLGA 1ES4A 1VM1A 2P9VB 1BTLA 4ZJ3A 5TBMA 2VJWA 2GDNA 2J9PA 5A93A 3ITBA 3VSLA 1E3UA 5CHUA 4R23A 3UMDA 2VKSA 5CTMA 3BW6A 1ES2A 4R3JA 1ZC2A 4EEPA 3BWLA 4N9LA 3E4OA 5AJGA 1GSWA 2A24A 3Q07A 5DF9A 3V3SA 4BENA 2Y2LA 2OWHA 2W3EA 3HLWA 4D2OA 4R4RA 3WS0A 3AGFA 4S2JA 5E2EA 2ZM8A 5DTTA 3GTCA 4OQGA 2HP6A 3D72A 4LLOB 1XFQA 3VOZA 4HJ6A 2RL3A 1N9BA 3UN7A 2M7UA 4CLCA 5DVAA 1Y4OA 1ZHHB 2J8YA 4NETA 3IF5A 1XJ4A 2VA0A 1LSWA 4FCFA 3GECA 3C30A 3UE1A 1GHIA 3K3CA 3R7WB 1BT5A 5AQ9A 3WS2A 1MPLA 1ES5A 2EWVA 4LFUA 4EBLA 2EX6A 4KUKA 3T4JA 2P9VA 4E04A 4PMAA 1CK3A 3UE0A 3MQQA 4WN5A 1I5QA 2O9AA 5AVFA 1G6AA 3BECA 5F1FA 1W63Q 2PBYA 4QHCA 1NZUA 1UWPX 3T4SA 1PYYA 4EU0A 1ALQA 1IELA 1K56D 2PAVP 1FQGA 4R4SA 2ZJ9A 2K31A 1DJBA 3IWQA 3C7UA 3NJAA 4H6JB 5DF7A 3CITA 2B5RA 5GLCA 4OQHA 3MMHA 1YAXA 1TVFA 2FFYA 4Y13A 2WZXA 2C5WB 4PM7A 5FA7A 1YLYA 4XXRA 3G35A 1NYYA 1N9NA 2IA2A 3DW0A 4MN6A 2IWDA 4DF6A 2XROA 4PHTA 3C7VA 2R9XA 3F1OA 3MJQA 1CJFA 3N4IA 5CGWA 2ZMFA 2ZOHA 4C6YA 3PXPA 2JCHA 2HJEA 1IKIA 1L3LA 2IWCA 4KQDA 5D3OA 3LI8A 1CEGA 1G5UA 4IVIA 3T1XA 5FQMA 4HJ4A 3HLFA 4GD8A 4EW7A 3S7PA 2HZ5A 3IX8A 5CHJA 1T1AA 3CZDA 5DJTA 4EV4A 1KOUA 1E4DA 4K0WA 1WYCA 4CLCC 3L9KA 1S4RA 4RQ9A 4MEZA 4S2PA 2H28A 3KYZA 1HZOA 4JBFA 2WKRA 3GDIA 3O5YA 3PAGA 3N6IA 3IX4A 4ME4A 3I7JA 4EWFA 4JGRA 4KUOA 2J3WA 4ESPA 1STZA 3G2ZA 4E3MA 1KGEA 1G28A 1MY8A 5F6AA 3H9WA 1YPRA 3LR0A 2W0NA 3QP4A 2M1CA 2ZD8A 3TJZC 3IWOA 5FDHA 5E43A 1E25A 3ZGAB 1FILA 3JPUA 1BLSA 2MJ6A 1S1YA 3DTIA 1K6RA 2ZM0A 2VV8A 3G30A 3T4KA 1K54A 1NXYA 2DMWA 1K56A 4ARZA 5F1GA 1OTAA 1YLJA 3ZNYA 4GNUA 4MLLA 2NUTC 4BD0A 1LHYA 5FAQA 5AQBA 4E3NA 4DN0A 1TS6A 3V5MA 4WEKA 4R6LA 1PIOA 4OPQA 3NECA 1BLPA 3FYZA 3GSGA 1MWTA 2OLVA 4HBUA 4R3AA 1MWSA 3U2AA 1IYSA 3IQAA 5IT5A 4II7A 1FIKA 5L10A 3PBTA 2QYBA 3KSFA 3LR5A 5DF8A 1H8YA 4DDSA 4Y7PA 2CC1A 1VEUA 1LI9A 1ESUA 3C4PA 4ZJ2A 2VGKA 2D01A 5FAOA 4BL3A 3OOVA 4C75A 5HDDA 1XJ2A 2P04A 4M3KA 1K4FA 1D7EA 2VZWA 3OPRA 5HW3A 2BTFP 4ZAMA 5J8XA 4KG5A 2W3GA 3N8LA 4DE2A 4WLAA 5FI2A 1P0ZA 2QMIA 3LI9A 1ZTUA 3MFXA 3SH9A 2EFUA 4S2LA 3VOYA 5HD5A 3WS4A 2ZC7A 2X71A 1I2WA 1XFNA 5E2HA 5LBRA 2JE5A 3FKVA 3A0VA 4BMWA 4KZ5A 2Y2HA 3GRJA 2ZC4B 3EWKA 1PWGA 2HJ9C 4N92A 2IWBA 1JNUA 4YFMA 5L07A 1PWCA 3TE8A 3NOUC 5G4ZA 1DRMA 3A3IA 2WGVA 4EUVA 4LRYC 2Q9NA 3Q7VA 2EWWA 1BLCA 2BG1A 5JYOA 1D06A 4DXBA 3VOLA 1OJ5A 3O87A 5EVLA 2WGWB 4X1LA 4IUHA 2QJ5A 2E8IA 4KQOA 2XFTA 1P9RA 2WKQA 5DFYA 1K4EA 3MF0A 1RP5A 3HLEA 4HH3A 3LY3A 1IEMA 5E2FA 1ZG6A 1K38A 2EX9A 4FH4A 3W2ZA 3HVFA 2W1RA 2ZQCA 4MBFA 3T4QA 2P74A 3HJKA 4Q0HA 3CPTA 4GCZA 1IFQA 5HL6A 4GDNA 4H8RA 3AGEA 5EVID 3Q81A 2L0WA 5A92A 2ZC5B 4HI4A 2B18A 2VV7A 1YMXA 5FAPA 3WS1A 4P6BA 2H0YA 3SH7A 3IS2B 3EGDC 1L0EA 2QWSA 1NYMA 5L2FA 3CAXA 2ZL1A 5E2GA 4CJNA 3LIDA 3QP5A 5HDSA 2L4RA 1RGZA 4IVKA 1PZOA 3IF6C 5FATA 1N9LA 4JKTA 5TBMB 1S4SA 3MXRA 2Y2NA 3VSKA 5GLDA 4X56A 3V3RA 3VFHA 2JC7A 1U60A 2G7UA 3MKFA 1KGFA 2GJ3A 1MXOA 3G2YA 2X02A 2WGWA 4K91A 3PYPA 2A24B 1H5XA 3E98A 4MBHA 1BSGA 4DE1A 4RX2A 1T19A 3OC2A 4YINA 3T12B 5EVEA 3G32A 2JBFA 4OLGA 2C6WB 2OOLA 1GSXA 2DRWA 1F98A 5EM0A 3VV4A 1P9WA 2GX5A 2W3HA 1PW8A 2QPNA 2WYXA 2V1BA 4CLCB 2A2LA 2HP9A 4KZ7A 5GL9A 3BM6A 1Q2QA 2Y2QA 3NBLA 2OAQ1 2WGIA 1W7FA 4ZBEA 4NG2A 3WS5A 1YM1A 5A8BA 2PRFA 3ITAA 3LY4A 4B93A 1XGIA 3M6BA 2FZ0A 4HEFA 4IBRA 3LEZA 2PBDP 4PKYG 5F5YA 3IBJA 3S7OA 4EETB 1TDGA 5L8MA 5HSQA 2ZQDA 3VP0A 2XA7M 3V39A 3QP6A 3GQZA 4MMNA 1F9IA 3S22A 1IOUA 3D4FA 4QJGA 5A91A 1SZVA 2J7VA 1TD5A 4GZBA 5EVIA 2O0YA 2Y59A 5HPFA 1JTDA 3SS3A 3QNBA 4X68A 2J80A 2QJ7A 2B95A 4OPZA 1DP6A 3UB5P 5TFQA 4OPYA 4Y17A 4OH0A 3RXWA 4NKPA 4DJ3A 1SDEA 4U0TA 2JKGA 4JF4A 2CMNA 3EOIA 2BASA 2EA9A 1XJ6A 4PM5A 4KENB 3F1OB 4LCLA 3C2WA 4EBNA 2Y2GA 4BLMA 3IH9A 1H3QA 3C4OA 3LGOA 3F1PA 5L09A 2QZ6A 1XA1A 2W1TA 3S7NA 4FUWA 1M6KA 1YMSA 3K2NA 1O7EA 1JWVA 3BY8A 4GB7A 1GHMA 2XFSA 1S67L 3TRCA 4WZ4A 4WUJA 4A5RA 3WRTA 2Y2OA 4Q8IA 3EQVA 3BLMA 2WKHA 3MS6A 3RJUA 3N8SA 1UWNX 5FQKA 1RCJA 1S0WA 1VHMA 4Y0TA 5J3WA 1ZKJA 1OTIA 3A0RA 3LEQA 1FSWA 3ZG9B 1PZPA 3NDGA 3TOIA 1EW0A 1FOFA 3S4XA 2OSUA 4EEUA 5HPIA 2HF6A 3Q7ZA 3NDEA 2Z2MB 1ERQA 3S1YA 3HLDA 4LPZA 1FSYA 5DTSA 3PBSA 5FDSA 1H8ZA 4PPRA 1YT4A 1VQQA 3SS5A 2LB9A 1YQSA 1K25A 3O88A 1DJCA 4Q0IA 3UO9A 1VB6A 2G2WA 3B47A 5EOEA 1T18A 3ZG8B 3PAEA 2V0UA 5C5KA 4E3IA 2Y79A 4Y0OA 3UB7A 3E0YA 3T4OA 3B42A 5IS1A 4HESA 1DJAA 1I2SA 4JGOA 1OJGA 3MZDA 3TG9A 5J4EA 5EVIC 5FQIA 4LCMA 2VV6A 3MXSA 2XGNA 4AFIA 4XUXA 4QD4A 3G34A 4JF5A 4LRZE 4ARZB 4BD1A 3LIAA 2ZOIA 2JKFA 3LIEA 5CEBA 1NRJA 1RGYA 1N9OA 4OP8A 2WKPA 4JPMA 3GMWA 3BEBA 2ACGA 1V9YA 3FV7A 4UEYA 2J3TD 5TR7A 1A0KA 2GZAA 1H0MA 4PKYA 1GA0A 1HTZA 1CQAA 2I72A 1VEUB 3ZDJA 3C38A 3UDIA 3NOPC 4LV2A 3T4TA 3U4LP 4R70A 4ZTKA 4Y3IA 3GVBA 5EUAA 3E2KA 2ZMAA 3FKWA 2ZQ8A 3RFBA 2HDRA 4NXGA 1QMFA 3CHWP 2K7SA 1Y54A 1KE3A 4CQHA 1J9MA 2QHKA 4QU3A 4LV0A 3S7QA 3ZVWA 4N1HA 4GS9B 3OLOA 3IXHA 3ICYA 4I3AA 5TJJA 1NRFA 2EX2A 1MWUA 2V9AA 5M19A 4Q0JA 4PM8A 5BOHA 1O07A 2PD8A 4L9EA 4E3OA 4HP4A 3IXDA 3HJIA 2XR0A 1WA9A 4JLFA 4IJGA 3BRMA 3LICA 3Q7VB 2FFFB 5AVEA 4U0XA 3FC7A 1L0FA 3BQ8A 3LO7A 4YNRA 3Q1FA 3O3VA 5FI6A 3MR0A 3UY6A 5HX9A 2XD5A 2WAFA 4QY6A 2Y2KA 1ERMA 1IKGA 2YKFA 4OKPA 2XA7S 4C3QA 4F3LB 4HOIA 5FEFA 2O9BA 5AQ7A 3NOTC 5HWTA 2JHEA 4OOLA 1EROA 1CI9A 4O7DA 4GHIA 3V50A 2WADA 3CUEA 2Y4AA 3NC8A 1OMEA 4WEJA 4BL2A 4PM9A 3IF6A 3ZG0A 4DE0A 4JGQA 5M1AA 3FWLA 4QY5A 3H82B 2Y2IA 3W4QA 3CPTB 2OWJA 2HPBA 4GD6A 5EE8A 3UB6A 1W8YA 3GR2A 3W4OA 3VP4A 3A3FA 4GJ4A 3T1QB 3VFFA 4DJ2A 3IT9A 4WELA 1NWZA 4GS9A 3FPVA 1LL5A 5I5LA 3KSIA 2XK1A 3IWIA 2PR6A 2JKTI 1SDNA 1ONGA 4R1GA 3LR4A 2ZM2A 2X01A 1BUEA 3PHYA 2BLSA 3HL9A 1K6SA 3E4PA 2ZL1B 2WKIA 3UDFA 2LB5A 2PHYA 4FTXA 5HD3A 3MBZA 3VP1A 4G3KA 2ZQAA 2XQZA 1OTBA 5FQJA 4RYEA 2ZBBA 4OQIA 2ZLYA 5FQ9A 3HUOA 2A3UA 5CXWA 3ZHHA 1NLZA 4X1MA 1L0DA 1KVLA 4NXFA 3JVVA 3GV9A 4KQQA 4N9KA 1KE0A 1H8MA 4BBUA 1TDLA 4F3LA 3IXGA 1JVJA 3PBOA 3HUNA 5EPHA 3EGXC 2PT7A 1KVMA 1PRQA 3KSHA 3Q82A 4MCWA 4L9GA 1YLPA 3BFGA 5HAPA 3LR3A 2W3FA 3PTEA 2OLUA 3P09A 3C5AA 1CEFA 5CX7A 3H82A 4JXVA 3QP1A 4HP9A
chains in the Genus database with same CATH topology
4JXWA 1TDGA 2FFYA 5F83A 2WZXA 2C5WB 4L0LA 4E6WA 2ZQDA 2WAEA 3VP0A 4PM7A 4DXCA 3V39A 5FA7A 1YLYA 4XXRA 3G35A 3CJMA 1NYYA 1YLWA 3GQZA 3DW0A 4GDBA 2IWDA 4DF6A 3S22A 4U3TA 2EFXA 2WZZA 2R9XA 3C7VA 3G31A 3N4IA 5CGWA 3D4FA 4QJGA 1WE4A 4KG2A 1SKFA 3ZG5A 5A91A 2G2UA 1E3UD 4C6YA 2J7VA 4GZBA 5EVIA 2EX8A 2JCHA 2ZQ7A 1IKIA 2XLNA 2IWCA 3DTMA 2Y59A 1XX2A 1JTDA 3SS3A 3QNBA 4X68A 5D3OA 4JF6A 4OPZA 1EWZA 4X55A 5TFQA 4OPYA 1FCMA 1KE4A 1CEGA 5GHYA 4IVIA 4E6XA 3HBRA 4N1XA 4OH0A 3OPLA 1WYBA 5FQMA 3HLFA 4GD8A 3RXWA 2Y55A 4UAAA 1SDEA 1L0GA 1BULA 4U0TA 4JF4A 2RCXA 5CHJA 3CZDA 3NIAA 4PM5A 4P87A 2DCFA 4MNRA 4EV4A 4KENB 1E4DA 4K0WA 1Q2PA 2Z2LB 1WYCA 4LCLA 4EBNA 2Y2GA 4BLMA 3IH9A 3QNCA 4KG6A 4KZ6A 3C4OA 4X69A 1GCEA 3BFDA 4S2KA 5EVIB 5I94A 2QZ6A 3TSGA 1XA1A 2EXAA 5CTNA 1M6KA 1YMSA 1O7EA 4B4XA 1JWVA 3VMAA 1IYOA 1N4OA 4MEZA 2V20A 4S2PA 1KDSA 4GB7A 1HZOA 1GHMA 4JBFA 1HVBA 2XFSA 2H5SA 3PBRA 3PAGA 5M18A 3N8RA 5GLCA 1SCWA 4OQHA 4WZ4A 3N6IA 4KZ9A 3UPPA 3I7JA 2J9OA 4A5RA 4EWFA 3WRTA 2Y2OA 4KQRA 3WWXA 3EQVA 3BLMA 4Q8IA 1FR6A 2WKHA 3BLSA 3RJUA 1XGJA 3UPOA 1JTGA 1YLZA 3M6HA 3N8SA 5FQKA 1KGGA 1L2SA 3G2ZA 4E3MA 1KGEA 1RCJA 1MY8A 1S0WA 4E3JA 4Y0TA 5DTKA 1QMEA 4IBXA 1ZKJA 3NY4A 1FR1A 3OCLA 1JWZA 1PI5A 1FSWA 4BQMA 3ZG9B 1PZPA 3NDGA 5GHZA 1IYQA 3TOIA 1FCNA 2ZD8A 4ZJ1A 2PU4A 1Z6FA 3MZEA 4ID4A 1FOFA 3S4XA 2OSUA 3IWOA 5FDHA 3BFCA 4Y0UA 5E43A 3Q7ZA 1E25A 1TEMA 1EI5A 3NDEA 3DWZA 2Z2MB 2VGJA 3ZGAB 1ERQA 1ZG4A 3JYIA 3S1YA 3HLDA 1FSYA 1BLSA 5DTSA 3PBSA 5FI7A 4K0XA 1H8ZA 4LENA 4PPRA 1YT4A 3SH8A 1ONHA 3A3EA 4KZ4A 1VQQA 3SS5A 3RXXA 1K6RA 2ZM0A 1YQSA 3G30A 1XXMA 1K25A 4NK3A 1K54A 3O88A 1DJCA 2HDQA 2WKEA 4QB8A 2XEPA 3M2KA 1NXYA 1K54C 3HREA 2G2WA 3UO9A 5EOEA 1K56A 5F1GA 3SOIA 1W8QA 1YLJA 3ZG8B 3PAEA 3ZNYA 4GNUA 4MLLA 4E3IA 4X53A 2V1ZA 3OZHA 4BD0A 1LHYA 4XUZA 4Y0OA 5FAQA 4KZ3A 5AQBA 5KSHA 4F94A 4E3NA 3V5MA 4S2NA 3PBQA 3MFDA 4OOYA 2H0TA 4EUZA 4WEKA 4HESA 1DJAA 5GLBA 1I2SA 1PIOA 4OPQA 4S2NC 4X6TA 1BLPA 1XP4A 3FYZA 3ZFZA 3GSGA 2XH9A 3MZDA 3TG9A 1MWTA 2DNSA 2OLVA 2EXBA 4HBUA 1W5DA 2WUQA 1MWSA 1IYSA 4JXGA 3IQAA 4UA9A 5EVIC 3EQUA 5JYPA 1AXBA 4IEDA 5FQIA 4GKUA 4LCMA 1ES3A 1LL9A 3PBTA 3MXSA 2XGNA 3LCEA 4XUXA 4OVDA 4QD4A 3VP2A 3G34A 5DF8A 1H8YA 3UNWA 4DDSA 4JF5A 4RVAA 4BD1A 4OPRA 4Y7PA 2CC1A 3B3XA 3HLGA 2OV5A 3QHYA 1LI9A 1ESUA 3NI9A 1XA7A 4S2MA 4Z9QA 1BLHA 1S6RA 3C4PA 3OCNA 4ZJ2A 2VGKA 2V2FF 2PU2A 5FAOA 5EECA 4BL3A 4OOMA 5CEBA 2XDMA 4WMCD 4C75A 4FD8A 1RGYA 4OP8A 4JPMA 5CGXA 5CECA 4B88A 3VP3A 3GMWA 5HAQA 3BEBA 4M3KA 1K4FA 3FV7A 4P85A 3OPRA 5HW3A 3E2LA 4HBTA 1GHPA 3O86A 4ZAMA 5J8XA 3M2JA 5TR7A 1PI4A 4KG5A 4EBPA 5GHXA 3ZCZA 3N8LA 4R3BA 4WYYA 5FI2A 4DE2A 2QMIA 3ZNTA 3SH9A 4E3LA 1MBLA 1GA0A 1IYPA 2EFUA 1HTZA 4WM9A 4S2LA 2I72A 5HAIA 2A49A 1GA9A 5CHMA 5IHVA 3VOYA 5CRFA 3SS4A 3ZDJA 3UDIA 1NJ4A 3WS4A 2ZC7A 2X71A 1I2WA 2ZQ9A 3BFFA 4LV2A 5E2HA 2JE5A 4ZTKA 3PBNA 3FKVA 2UWXA 4E3KA 3GVBA 5EUAA 3E2KA 3ZG7B 4RX3A 2ZMAA 3FKWA 1MKIA 2ZQ8A 4OQ0A 4UA6A 4KZ5A 2HDRA 5AQAA 5G18A 2Y2HA 3GRJA 3HUMA 2ZC4B 5FASA 1PWDA 1PWGA 5TGFA 4N92A 1QMFA 1Y54A 4WZ5A 4MBKA 3A3JA 3N7WA 2IWBA 4YFMA 3UE3A 3A3DA 1KE3A 1G68A 4WZ5C 1LLBA 1PWCA 1FCOA 5CERA 4CPKA 5KSCA 1J9MA 3IHAA 4DE3A 3A3IA 3BYDA 2WGVA 4QU3A 4RA7A 3UDXA 1C3BA 1MWRA 4KZ8A 2Q9NA 3Q7VA 4EQIA 4LV0A 3ZVWA 1BLCA 4N1HA 2BG1A 5JYOA 2ZC6B 1K57A 4FH2A 5CEDA 5FQQA 3IXHA 4DXBA 4ZDXA 3O87A 5EVLA 2WGWB 1K57C 4DKIA 3G4PA 1NRFA 2EX2A 1MWUA 3IXBA 5M19A 2Y2PA 1HD8A 4PM8A 3AGDA 4BJPA 2E8IA 4KQOA 5BOHA 1O07A 3IHBA 3FZCA 1W79A 2XFTA 1K55A 3WRZA 1K4EA 4OLDA 2ZC3B 4OONA 2Y2MA 1K55C 4FSFA 4E3OA 1RP5A 3HLEA 3DWKA 3OPPA 1BZAA 3LY3A 1IEMA 4UHUA 4DDYA 3IXDA 5E2FA 1ZG6A 3MKEA 3NCKA 2XR0A 4JLFA 3ZVTA 1K38A 2EX9A 2HDSA 3BRMA 4FH4A 2XF3A 3HVFA 1DY6A 3Q7VB 2ZQCA 2FFFB 4B4ZA 1ESIA 4MBFA 4KZBA 4U0XA 2P74A 1NZOA 3ISGA 2R9WA 1ES4A 1VM1A 4LV1A 1L0FA 2P9VB 3LO7A 3Q1FA 3O3VA 1BTLA 5FI6A 2H10A 4ZJ3A 3UY6A 5A90A 1SHVA 5HX9A 2XD5A 2GDNA 2J9PA 2WAFA 3IH8A 4QY6A 2Y2KA 1YLTA 1PW1A 5A93A 4GDNA 2Y91A 3AGEA 1ERMA 1IKGA 3ITBA 4H8RA 5EVID 3VSLA 1E3UA 3Q81A 5CHUA 4OKPA 4R23A 4UA7A 5A92A 4LV3A 2ZC5B 4C3QA 5CTMA 1ES2A 1KDWA 4R3JA 1ZC2A 5AQ7A 4N9LA 1YMXA 5FAPA 3WS1A 4P6BA 4OOLA 2H0YA 1EROA 3SH7A 1CI9A 4O7DA 3Q07A 5KMWA 5DF9A 2HP5A 3V50A 2WADA 3V3SA 4BENA 1M40A 2Y4AA 3NC8A 2HDUA 1L0EA 1LI0A 1NYMA 2Y2LA 5L2FA 1OMEA 4WEJA 5E2GA 3MZFA 4BL2A 4CJNA 4PM9A 3UPNA 3HLWA 3IF6A 3ZG0A 4D2OA 4DE0A 3BFEA 5KZHA 5M1AA 3FWLA 4QY5A 5FSRA 4R4RA 3WS0A 1RGZA 3AGFA 4IVKA 1PZOA 2Y2IA 3IF6C 4S2JA 4WMCA 5E2EA 2ZM8A 3W4QA 5DTTA 5FATA 2HPBA 3GTCA 4GD6A 4JKTA 4OQGA 5EE8A 2HP6A 3HLCA 4WBGA 1W8YA 3GR2A 3MXRA 3W4OA 3VP4A 2Y2NA 3VSKA 3A3FA 5HARA 4GN2A 4X56A 5GLDA 3VFFA 3V3RA 3IT9A 2JC7A 1U60A 4WELA 3MKFA 3VFHA 1KGFA 3VOZA 1MXOA 1LL5A 3G2YA 2RL3A 1N9BA 2X02A 3UN7A 2XK1A 3IWIA 1XKZA 2WGWA 4K91A 5DVAA 4DRTA 1SDNA 1ONGA 4R1GA 1H5XA 2J8YA 2ZM2A 4MBHA 4P0MA 2X01A 1BSGA 1BUEA 4NETA 2BLSA 3HL9A 4DE1A 1K6SA 3CG5A 4RX2A 3OC2A 4JXSA 2Y2JA 5HFOA 3IF5A 5U47A 4YINA 2WKIA 3UDFA 3IF6B 3G32A 2JBFA 4OLGA 4PM6A 2C6WB 4FCFA 3MBZA 3VP1A 2DRWA 3UE1A 2ZQAA 4GOGA 1GHIA 5F82A 2XQZA 5FQJA 4S2OA 4RYEA 1BT5A 5AQ9A 1PW8A 1CI8A 2QPNA 4OQIA 2WYXA 3WS2A 2ZLYA 1MPLA 5FQ9A 1ES5A 5CGSA 3HUOA 3OPHA 2A3UA 4KZAA 4OP5A 3P98A 4EBLA 2EX6A 5CXWA 2P9VA 3ZHHA 2HP9A 4PMAA 4KZ7A 1CK3A 4R0QA 5GL9A 3UE0A 3BM6A 1I5QA 1XPBA 1Q2QA 1L0DA 2Y2QA 3NBLA 2WGIA 1KVLA 1W7FA 4ZBEA 3WS5A 2Q9MA 2WK0A 3GV9A 1G6AA 1KE0A 2XD1A 3BECA 4KQQA 4N9KA 5F1FA 1YM1A 2PBYA 4QHCA 1TDLA 3W8KA 1NZUA 3IXGA 1JVJA 3ITAA 1PYYA 3PBOA 1ALQA 3HUNA 5EOOA 5EPHA 3LY4A 1IELA 3W4PA 5HL1A 1XGIA 1K56D 1KVMA 5GLAA 3M6BA 3Q82A 3CMZA 1FQGA 4R4SA 4HEFA 1YLPA 2ZJ9A 4IBRA 1DJBA 3BFGA 5HAPA 3LEZA 1NY0A 3IWQA 3PTEA 3C7UA 2OLUA 4S2IA 3P09A 5DF7A 1JWPA 3C5AA 1CEFA 2B5RA 4JXVA 3HLBA 1TVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JXW A;  1TDG A;  2FFY A;  5F83 A;  2WZX A;  2C5W B;  4L0L A;  4E6W A;  2ZQD A;  2WAE A;  3VP0 A;  4PM7 A;  4DXC A;  3V39 A;  5FA7 A;  1YLY A;  4XXR A;  3G35 A;  3CJM A;  1NYY A;  1YLW A;  3GQZ A;  3DW0 A;  4GDB A;  2IWD A;  4DF6 A;  3S22 A;  4U3T A;  2EFX A;  2WZZ A;  2R9X A;  3C7V A;  3G31 A;  3N4I A;  5CGW A;  3D4F A;  4QJG A;  1WE4 A;  4KG2 A;  1SKF A;  3ZG5 A;  5A91 A;  2G2U A;  1E3U D;  4C6Y A;  2J7V A;  4GZB A;  5EVI A;  2EX8 A;  2JCH A;  2ZQ7 A;  1IKI A;  2XLN A;  2IWC A;  3DTM A;  2Y59 A;  1XX2 A;  1JTD A;  3SS3 A;  3QNB A;  4X68 A;  5D3O A;  4JF6 A;  4OPZ A;  1EWZ A;  4X55 A;  5TFQ A;  4OPY A;  1FCM A;  1KE4 A;  1CEG A;  5GHY A;  4IVI A;  4E6X A;  3HBR A;  4N1X A;  4OH0 A;  3OPL A;  1WYB A;  5FQM A;  3HLF A;  4GD8 A;  3RXW A;  2Y55 A;  4UAA A;  1SDE A;  1L0G A;  1BUL A;  4U0T A;  4JF4 A;  2RCX A;  5CHJ A;  3CZD A;  3NIA A;  4PM5 A;  4P87 A;  2DCF A;  4MNR A;  4EV4 A;  4KEN B;  1E4D A;  4K0W A;  1Q2P A;  2Z2L B;  1WYC A;  4LCL A;  4EBN A;  2Y2G A;  4BLM A;  3IH9 A;  3QNC A;  4KG6 A;  4KZ6 A;  3C4O A;  4X69 A;  1GCE A;  3BFD A;  4S2K A;  5EVI B;  5I94 A;  2QZ6 A;  3TSG A;  1XA1 A;  2EXA A;  5CTN A;  1M6K A;  1YMS A;  1O7E A;  4B4X A;  1JWV A;  3VMA A;  1IYO A;  1N4O A;  4MEZ A;  2V20 A;  4S2P A;  1KDS A;  4GB7 A;  1HZO A;  1GHM A;  4JBF A;  1HVB A;  2XFS A;  2H5S A;  3PBR A;  3PAG A;  5M18 A;  3N8R A;  5GLC A;  1SCW A;  4OQH A;  4WZ4 A;  3N6I A;  4KZ9 A;  3UPP A;  3I7J A;  2J9O A;  4A5R A;  4EWF A;  3WRT A;  2Y2O A;  4KQR A;  3WWX A;  3EQV A;  3BLM A;  4Q8I A;  1FR6 A;  2WKH A;  3BLS A;  3RJU A;  1XGJ A;  3UPO A;  1JTG A;  1YLZ A;  3M6H A;  3N8S A;  5FQK A;  1KGG A;  1L2S A;  3G2Z A;  4E3M A;  1KGE A;  1RCJ A;  1MY8 A;  1S0W A;  4E3J A;  4Y0T A;  5DTK A;  1QME A;  4IBX A;  1ZKJ A;  3NY4 A;  1FR1 A;  3OCL A;  1JWZ A;  1PI5 A;  1FSW A;  4BQM A;  3ZG9 B;  1PZP A;  3NDG A;  5GHZ A;  1IYQ A;  3TOI A;  1FCN A;  2ZD8 A;  4ZJ1 A;  2PU4 A;  1Z6F A;  3MZE A;  4ID4 A;  1FOF A;  3S4X A;  2OSU A;  3IWO A;  5FDH A;  3BFC A;  4Y0U A;  5E43 A;  3Q7Z A;  1E25 A;  1TEM A;  1EI5 A;  3NDE A;  3DWZ A;  2Z2M B;  2VGJ A;  3ZGA B;  1ERQ A;  1ZG4 A;  3JYI A;  3S1Y A;  3HLD A;  1FSY A;  1BLS A;  5DTS A;  3PBS A;  5FI7 A;  4K0X A;  1H8Z A;  4LEN A;  4PPR A;  1YT4 A;  3SH8 A;  1ONH A;  3A3E A;  4KZ4 A;  1VQQ A;  3SS5 A;  3RXX A;  1K6R A;  2ZM0 A;  1YQS A;  3G30 A;  1XXM A;  1K25 A;  4NK3 A;  1K54 A;  3O88 A;  1DJC A;  2HDQ A;  2WKE A;  4QB8 A;  2XEP A;  3M2K A;  1NXY A;  1K54 C;  3HRE A;  2G2W A;  3UO9 A;  5EOE A;  1K56 A;  5F1G A;  3SOI A;  1W8Q A;  1YLJ A;  3ZG8 B;  3PAE A;  3ZNY A;  4GNU A;  4MLL A;  4E3I A;  4X53 A;  2V1Z A;  3OZH A;  4BD0 A;  1LHY A;  4XUZ A;  4Y0O A;  5FAQ A;  4KZ3 A;  5AQB A;  5KSH A;  4F94 A;  4E3N A;  3V5M A;  4S2N A;  3PBQ A;  3MFD A;  4OOY A;  2H0T A;  4EUZ A;  4WEK A;  4HES A;  1DJA A;  5GLB A;  1I2S A;  1PIO A;  4OPQ A;  4S2N C;  4X6T A;  1BLP A;  1XP4 A;  3FYZ A;  3ZFZ A;  3GSG A;  2XH9 A;  3MZD A;  3TG9 A;  1MWT A;  2DNS A;  2OLV A;  2EXB A;  4HBU A;  1W5D A;  2WUQ A;  1MWS A;  1IYS A;  4JXG A;  3IQA A;  4UA9 A;  5EVI C;  3EQU A;  5JYP A;  1AXB A;  4IED A;  5FQI A;  4GKU A;  4LCM A;  1ES3 A;  1LL9 A;  3PBT A;  3MXS A;  2XGN A;  3LCE A;  4XUX A;  4OVD A;  4QD4 A;  3VP2 A;  3G34 A;  5DF8 A;  1H8Y A;  3UNW A;  4DDS A;  4JF5 A;  4RVA A;  4BD1 A;  4OPR A;  4Y7P A;  2CC1 A;  3B3X A;  3HLG A;  2OV5 A;  3QHY A;  1LI9 A;  1ESU A;  3NI9 A;  1XA7 A;  4S2M A;  4Z9Q A;  1BLH A;  1S6R A;  3C4P A;  3OCN A;  4ZJ2 A;  2VGK A;  2V2F F;  2PU2 A;  5FAO A;  5EEC A;  4BL3 A;  4OOM A;  5CEB A;  2XDM A;  4WMC D;  4C75 A;  4FD8 A;  1RGY A;  4OP8 A;  4JPM A;  5CGX A;  5CEC A;  4B88 A;  3VP3 A;  3GMW A;  5HAQ A;  3BEB A;  4M3K A;  1K4F A;  3FV7 A;  4P85 A;  3OPR A;  5HW3 A;  3E2L A;  4HBT A;  1GHP A;  3O86 A;  4ZAM A;  5J8X A;  3M2J A;  5TR7 A;  1PI4 A;  4KG5 A;  4EBP A;  5GHX A;  3ZCZ A;  3N8L A;  4R3B A;  4WYY A;  5FI2 A;  4DE2 A;  2QMI A;  3ZNT A;  3SH9 A;  4E3L A;  1MBL A;  1GA0 A;  1IYP A;  2EFU A;  1HTZ A;  4WM9 A;  4S2L A;  2I72 A;  5HAI A;  2A49 A;  1GA9 A;  5CHM A;  5IHV A;  3VOY A;  5CRF A;  3SS4 A;  3ZDJ A;  3UDI A;  1NJ4 A;  3WS4 A;  2ZC7 A;  2X71 A;  1I2W A;  2ZQ9 A;  3BFF A;  4LV2 A;  5E2H A;  2JE5 A;  4ZTK A;  3PBN A;  3FKV A;  2UWX A;  4E3K A;  3GVB A;  5EUA A;  3E2K A;  3ZG7 B;  4RX3 A;  2ZMA A;  3FKW A;  1MKI A;  2ZQ8 A;  4OQ0 A;  4UA6 A;  4KZ5 A;  2HDR A;  5AQA A;  5G18 A;  2Y2H A;  3GRJ A;  3HUM A;  2ZC4 B;  5FAS A;  1PWD A;  1PWG A;  5TGF A;  4N92 A;  1QMF A;  1Y54 A;  4WZ5 A;  4MBK A;  3A3J A;  3N7W A;  2IWB A;  4YFM A;  3UE3 A;  3A3D A;  1KE3 A;  1G68 A;  4WZ5 C;  1LLB A;  1PWC A;  1FCO A;  5CER A;  4CPK A;  5KSC A;  1J9M A;  3IHA A;  4DE3 A;  3A3I A;  3BYD A;  2WGV A;  4QU3 A;  4RA7 A;  3UDX A;  1C3B A;  1MWR A;  4KZ8 A;  2Q9N A;  3Q7V A;  4EQI A;  4LV0 A;  3ZVW A;  1BLC A;  4N1H A;  2BG1 A;  5JYO A;  2ZC6 B;  1K57 A;  4FH2 A;  5CED A;  5FQQ A;  3IXH A;  4DXB A;  4ZDX A;  3O87 A;  5EVL A;  2WGW B;  1K57 C;  4DKI A;  3G4P A;  1NRF A;  2EX2 A;  1MWU A;  3IXB A;  5M19 A;  2Y2P A;  1HD8 A;  4PM8 A;  3AGD A;  4BJP A;  2E8I A;  4KQO A;  5BOH A;  1O07 A;  3IHB A;  3FZC A;  1W79 A;  2XFT A;  1K55 A;  3WRZ A;  1K4E A;  4OLD A;  2ZC3 B;  4OON A;  2Y2M A;  1K55 C;  4FSF A;  4E3O A;  1RP5 A;  3HLE A;  3DWK A;  3OPP A;  1BZA A;  3LY3 A;  1IEM A;  4UHU A;  4DDY A;  3IXD A;  5E2F A;  1ZG6 A;  3MKE A;  3NCK A;  2XR0 A;  4JLF A;  3ZVT A;  1K38 A;  2EX9 A;  2HDS A;  3BRM A;  4FH4 A;  2XF3 A;  3HVF A;  1DY6 A;  3Q7V B;  2ZQC A;  2FFF B;  4B4Z A;  1ESI A;  4MBF A;  4KZB A;  4U0X A;  2P74 A;  1NZO A;  3ISG A;  2R9W A;  1ES4 A;  1VM1 A;  4LV1 A;  1L0F A;  2P9V B;  3LO7 A;  3Q1F A;  3O3V A;  1BTL A;  5FI6 A;  2H10 A;  4ZJ3 A;  3UY6 A;  5A90 A;  1SHV A;  5HX9 A;  2XD5 A;  2GDN A;  2J9P A;  2WAF A;  3IH8 A;  4QY6 A;  2Y2K A;  1YLT A;  1PW1 A;  5A93 A;  4GDN A;  2Y91 A;  3AGE A;  1ERM A;  1IKG A;  3ITB A;  4H8R A;  5EVI D;  3VSL A;  1E3U A;  3Q81 A;  5CHU A;  4OKP A;  4R23 A;  4UA7 A;  5A92 A;  4LV3 A;  2ZC5 B;  4C3Q A;  5CTM A;  1ES2 A;  1KDW A;  4R3J A;  1ZC2 A;  5AQ7 A;  4N9L A;  1YMX A;  5FAP A;  3WS1 A;  4P6B A;  4OOL A;  2H0Y A;  1ERO A;  3SH7 A;  1CI9 A;  4O7D A;  3Q07 A;  5KMW A;  5DF9 A;  2HP5 A;  3V50 A;  2WAD A;  3V3S A;  4BEN A;  1M40 A;  2Y4A A;  3NC8 A;  2HDU A;  1L0E A;  1LI0 A;  1NYM A;  2Y2L A;  5L2F A;  1OME A;  4WEJ A;  5E2G A;  3MZF A;  4BL2 A;  4CJN A;  4PM9 A;  3UPN A;  3HLW A;  3IF6 A;  3ZG0 A;  4D2O A;  4DE0 A;  3BFE A;  5KZH A;  5M1A A;  3FWL A;  4QY5 A;  5FSR A;  4R4R A;  3WS0 A;  1RGZ A;  3AGF A;  4IVK A;  1PZO A;  2Y2I A;  3IF6 C;  4S2J A;  4WMC A;  5E2E A;  2ZM8 A;  3W4Q A;  5DTT A;  5FAT A;  2HPB A;  3GTC A;  4GD6 A;  4JKT A;  4OQG A;  5EE8 A;  2HP6 A;  3HLC A;  4WBG A;  1W8Y A;  3GR2 A;  3MXR A;  3W4O A;  3VP4 A;  2Y2N A;  3VSK A;  3A3F A;  5HAR A;  4GN2 A;  4X56 A;  5GLD A;  3VFF A;  3V3R A;  3IT9 A;  2JC7 A;  1U60 A;  4WEL A;  3MKF A;  3VFH A;  1KGF A;  3VOZ A;  1MXO A;  1LL5 A;  3G2Y A;  2RL3 A;  1N9B A;  2X02 A;  3UN7 A;  2XK1 A;  3IWI A;  1XKZ A;  2WGW A;  4K91 A;  5DVA A;  4DRT A;  1SDN A;  1ONG A;  4R1G A;  1H5X A;  2J8Y A;  2ZM2 A;  4MBH A;  4P0M A;  2X01 A;  1BSG A;  1BUE A;  4NET A;  2BLS A;  3HL9 A;  4DE1 A;  1K6S A;  3CG5 A;  4RX2 A;  3OC2 A;  4JXS A;  2Y2J A;  5HFO A;  3IF5 A;  5U47 A;  4YIN A;  2WKI A;  3UDF A;  3IF6 B;  3G32 A;  2JBF A;  4OLG A;  4PM6 A;  2C6W B;  4FCF A;  3MBZ A;  3VP1 A;  2DRW A;  3UE1 A;  2ZQA A;  4GOG A;  1GHI A;  5F82 A;  2XQZ A;  5FQJ A;  4S2O A;  4RYE A;  1BT5 A;  5AQ9 A;  1PW8 A;  1CI8 A;  2QPN A;  4OQI A;  2WYX A;  3WS2 A;  2ZLY A;  1MPL A;  5FQ9 A;  1ES5 A;  5CGS A;  3HUO A;  3OPH A;  2A3U A;  4KZA A;  4OP5 A;  3P98 A;  4EBL A;  2EX6 A;  5CXW A;  2P9V A;  3ZHH A;  2HP9 A;  4PMA A;  4KZ7 A;  1CK3 A;  4R0Q A;  5GL9 A;  3UE0 A;  3BM6 A;  1I5Q A;  1XPB A;  1Q2Q A;  1L0D A;  2Y2Q A;  3NBL A;  2WGI A;  1KVL A;  1W7F A;  4ZBE A;  3WS5 A;  2Q9M A;  2WK0 A;  3GV9 A;  1G6A A;  1KE0 A;  2XD1 A;  3BEC A;  4KQQ A;  4N9K A;  5F1F A;  1YM1 A;  2PBY A;  4QHC A;  1TDL A;  3W8K A;  1NZU A;  3IXG A;  1JVJ A;  3ITA A;  1PYY A;  3PBO A;  1ALQ A;  3HUN A;  5EOO A;  5EPH A;  3LY4 A;  1IEL A;  3W4P A;  5HL1 A;  1XGI A;  1K56 D;  1KVM A;  5GLA A;  3M6B A;  3Q82 A;  3CMZ A;  1FQG A;  4R4S A;  4HEF A;  1YLP A;  2ZJ9 A;  4IBR A;  1DJB A;  3BFG A;  5HAP A;  3LEZ A;  1NY0 A;  3IWQ A;  3PTE A;  3C7U A;  2OLU A;  4S2I A;  3P09 A;  5DF7 A;  1JWP A;  3C5A A;  1CEF A;  2B5R A;  4JXV A;  3HLB A;  1TVF A; 
#chains in the Genus database with same CATH topology
 4JXW A;  4O0P A;  4I39 A;  2XRN A;  4L0L A;  4E6W A;  1VET B;  3UB9 A;  2PD7 A;  4K08 A;  1YLW A;  3DTK A;  4GDB A;  1AWI A;  2EFX A;  2WZZ A;  3G31 A;  4I3I A;  4KG2 A;  3ZG5 A;  2G2U A;  1E3U D;  2ZQ7 A;  3BY9 A;  1XX2 A;  4HIA A;  4JF6 A;  3VE3 A;  3F1N A;  4X55 A;  3CUE C;  5EFW A;  1YSP A;  5GHY A;  4E6X A;  3HBR A;  2JKR M;  3ZQ5 A;  2Y55 A;  1NLY A;  3C8C A;  2RCX A;  4GLQ A;  2KOI A;  3A0S A;  4P87 A;  2DCF A;  4MNR A;  3H7W A;  1Q2P A;  2Z2L B;  2J3T C;  3QNC A;  4KG6 A;  4X69 A;  5EVI B;  4S2K A;  3BFD A;  5I94 A;  3TSG A;  1Z09 A;  2EXA A;  5CTN A;  2PYP A;  3VMA A;  4BWI A;  3UB8 A;  4P6Z S;  1KDS A;  2PDR A;  4WF0 A;  1HVB A;  2H5S A;  3PBR A;  5MC7 A;  2O9C A;  3N8R A;  4Y15 A;  3UPP A;  2J9O A;  3KSG A;  1FR6 A;  3BLS A;  3LIF A;  1XGJ A;  3UPO A;  1YLZ A;  4LGW A;  5IU1 A;  1L2S A;  2NUP C;  4HHD A;  3MQ0 A;  4E3J A;  3CWF A;  5DTK A;  1QME A;  4IBX A;  1G6O A;  1FR1 A;  3UE6 A;  2I9V A;  5HDC A;  3F1P B;  4BQM A;  2W1T B;  1IYQ A;  1FCN A;  1LT0 A;  1VET A;  3MZE A;  3T50 A;  1OPX A;  4ID4 A;  3MSH A;  3VE4 A;  3QP2 A;  1TEM A;  1EI5 A;  1K0K A;  3DWZ A;  2VGJ A;  3JYI A;  3BQA A;  4X25 A;  2QKP A;  3SH8 A;  1ONH A;  4KZ4 A;  1D1J A;  3RXX A;  1ODV A;  3T4L A;  1XXM A;  4NK3 A;  1SKO B;  4QB8 A;  4EER A;  2XEP A;  3M2K A;  3G6O A;  3SOI A;  1W8Q A;  3R4K A;  2V1Z A;  2GNX A;  5KSH A;  4XT2 A;  3PR6 A;  1TS0 A;  3MFD A;  4EUZ A;  3SW1 A;  5GLB A;  1OT9 A;  4S2N C;  4X6T A;  3ZFZ A;  4LRX C;  2XH9 A;  2Z6C A;  2DNS A;  2EXB A;  1W5D A;  4UA9 A;  1BYW A;  3EQU A;  5JYP A;  1AXB A;  4IED A;  1Y28 A;  3DTE A;  4I38 A;  3VP2 A;  5G4Y A;  4RVA A;  4OPR A;  4HQA A;  3HLG A;  2OV5 A;  3QHY A;  2HV1 A;  1XA7 A;  4Z9Q A;  1S6R A;  3OCN A;  1W63 M;  5DJU A;  3V67 A;  2PU2 A;  2V0W A;  2P7J A;  2FH5 A;  5DKL A;  4WMC D;  1UGU A;  5DFX A;  4HBT A;  1GHP A;  3RH8 B;  2OAP 1;  3M2J A;  1PI4 A;  3ZCZ A;  3UME A;  4I5S A;  4B9O A;  1MBL A;  1IYP A;  1TS8 A;  5HAI A;  2A49 A;  5IHV A;  2YKH A;  5CRF A;  2UV0 E;  1NJ4 A;  4HNB A;  2ZQ9 A;  4Z1W A;  2UWX A;  1OT6 A;  2V8F A;  4RX3 A;  4UA6 A;  1SKO A;  2M7V A;  1MC0 A;  2ZMV A;  3DAV A;  5FAS A;  5TGF A;  4MBK A;  3A3J A;  3TW8 A;  4UQI M;  5KSC A;  4CPK A;  4WZ5 C;  1LLB A;  1FCO A;  5CER A;  4QPR A;  4I3J A;  4RA7 A;  1C3B A;  1MWR A;  3EEA A;  4MDZ A;  4EQI A;  2ZC6 B;  5CED A;  4ZDX A;  1K57 C;  3IXB A;  4QWO A;  2Y2P A;  5J7E A;  1HD8 A;  3AGD A;  3FG8 A;  3IHB A;  3E4Q A;  3WRZ A;  4OLD A;  2ZC3 B;  4OON A;  1K55 C;  4FSF A;  3OPP A;  3ZYT A;  3DWK A;  3KYQ A;  1BZA A;  3P7N A;  3NCK A;  2HDS A;  1GSV A;  2XF3 A;  3IBR A;  3D3O A;  4WL9 A;  4HJ3 A;  4KZB A;  1NZO A;  2PYR A;  4LV1 A;  1LSX A;  2H10 A;  5A90 A;  1SHV A;  3IH8 A;  1YLT A;  1PW1 A;  2Y91 A;  4MN5 A;  4YWZ A;  4UA7 A;  4LV3 A;  2VK3 A;  1KDW A;  3B33 A;  2KLI A;  2KDK A;  4M4X A;  5KMW A;  1OTD A;  2HP5 A;  1M40 A;  2HDU A;  1LI0 A;  3P01 A;  3MZF A;  1T1C A;  3MQO A;  3UPN A;  5KZH A;  3BFE A;  5FSR A;  4WMC A;  3CLO A;  4NXE A;  4P6Z M;  4WBG A;  3HLC A;  3R7W A;  5HAR A;  4GN2 A;  1TF1 A;  3JVU A;  4ETZ A;  4BBV A;  4EXO A;  1XKZ A;  4DRT A;  3NHQ A;  4GHI B;  4P0M A;  3CG5 A;  4FOF A;  4HY8 A;  2Y2J A;  4JXS A;  5HFO A;  5U47 A;  3IF6 B;  5FL3 A;  5EM1 A;  4PM6 A;  1S1Z A;  4GOG A;  5F82 A;  2JN7 A;  2XSS A;  4S2O A;  1CI8 A;  5K5B A;  2VGL S;  2O99 A;  4JGP A;  5CGS A;  3OPH A;  4H6J A;  4KZA A;  4OP5 A;  3P98 A;  4R0Q A;  4Y2F A;  1XPB A;  1X0O A;  2Q9M A;  4BBT A;  2WK0 A;  2XD1 A;  3W8K A;  3OBF A;  5EOO A;  5HL1 A;  3W4P A;  4NEE D;  5GLA A;  3CMZ A;  3LYX A;  3K3D A;  4DMZ A;  1NY0 A;  4S2I A;  4HH2 A;  3HCY A;  1JWP A;  3HLB A;  5F83 A;  1V9Z A;  2K2N A;  2WAE A;  4DXC A;  3CJM A;  5DKK A;  4U3T A;  3DBA A;  1WE4 A;  1SKF A;  4Y5F A;  2EX8 A;  2JKR I;  2XLN A;  3DTM A;  1P97 A;  2W3D A;  2KX6 A;  1EWZ A;  4D60 A;  1FCM A;  1KE4 A;  3KX0 X;  4N1X A;  3OPL A;  1WYB A;  4G3W A;  3CI6 A;  4UAA A;  1L0G A;  1BUL A;  3NIA A;  5HWW A;  3LFV A;  3RTY A;  2INW A;  2VEA A;  4KZ6 A;  4EQ1 A;  5HZH A;  1GCE A;  4B4X A;  1IYO A;  3F1N B;  1F5M A;  5KIZ A;  2AVX A;  1N4O A;  2V20 A;  4EES A;  5M18 A;  1SCW A;  4KZ9 A;  3WWX A;  2L1M A;  4KQR A;  1JTG A;  3M6H A;  1KGG A;  3H7W B;  1LSV A;  3L7H A;  4MN7 A;  3NY4 A;  2B02 A;  3OCL A;  3T1R A;  3ULF A;  1JWZ A;  1PI5 A;  5GHZ A;  4ZJ1 A;  2PU4 A;  1Z6F A;  1MZU A;  3BFC A;  4UQI S;  4Y0U A;  5F68 A;  1LL8 A;  4GW9 A;  1ZG4 A;  5FI7 A;  4K0X A;  4LEN A;  2Z6D A;  3A3E A;  3KYE A;  1F2K A;  1DP9 A;  3FPW A;  1YSQ A;  2HDQ A;  2P08 A;  2WKE A;  1TS7 A;  1K54 C;  3HRE A;  1PFL A;  4IUK A;  4X53 A;  3OZH A;  4XUZ A;  4CLC E;  4KZ3 A;  4F94 A;  1YKD A;  4S2N A;  3PBQ A;  4OOY A;  2H0T A;  5HWV A;  1XP4 A;  2HGV A;  2WUQ A;  4JXG A;  1OTE A;  2Q0O A;  4GKU A;  1ES3 A;  1T1B A;  5EV0 A;  1LL9 A;  3SZT A;  3LCE A;  4OVD A;  3UNW A;  4O01 A;  3B3X A;  3NI9 A;  4S2M A;  1BLH A;  2V2F F;  3MXQ A;  4IHQ A;  4NXB A;  4XT2 B;  5EEC A;  4OOM A;  3T1S A;  2XDM A;  4FD8 A;  1DP8 A;  2PR5 A;  5CGX A;  5CEC A;  4B88 A;  3VP3 A;  5HAQ A;  4P85 A;  3E2L A;  1MKM A;  3O86 A;  4L9F A;  1ACF A;  4EBP A;  5GHX A;  4R3B A;  4WYY A;  1HLU P;  4CLC D;  2VX8 A;  4ZRR A;  3ZNT A;  4E3L A;  2W27 A;  4WM9 A;  3QP8 A;  1GA9 A;  5CHM A;  3IX3 A;  3BJN A;  3SS4 A;  4O8G A;  3BFF A;  2E8J A;  3PBN A;  2VGL M;  4E3K A;  2V1A A;  3ZG7 B;  2R78 A;  1CF0 A;  3EEH A;  4OQ0 A;  1MKI A;  5G18 A;  5AQA A;  5F69 A;  5FEG A;  2V8C A;  2JKT M;  3LIB A;  3HUM A;  1PWD A;  3NUL A;  4WZ5 A;  4R38 A;  3N7W A;  3UE3 A;  3KO6 A;  3A3D A;  1G68 A;  3IHA A;  4DE3 A;  3BYD A;  4YOF A;  4ETX A;  3UDX A;  4KZ8 A;  2D02 A;  1J3W A;  1K57 A;  4FH2 A;  5FQQ A;  4DKI A;  3G4P A;  3LUQ A;  4G3V A;  4PAU A;  4BJP A;  3FZC A;  1W79 A;  1K55 A;  2Y2M A;  1PNE A;  1S66 L;  4UHU A;  4DDY A;  3MKE A;  3IS2 A;  3ZVT A;  3D9Y A;  1DY6 A;  4B4Z A;  2Y8H A;  1ESI A;  3ISG A;  1XJ3 A;  2R9W A;  2VLG A;  1ES4 A;  1VM1 A;  2P9V B;  1BTL A;  4ZJ3 A;  5TBM A;  2VJW A;  2GDN A;  2J9P A;  5A93 A;  3ITB A;  3VSL A;  1E3U A;  5CHU A;  4R23 A;  3UMD A;  2VKS A;  5CTM A;  3BW6 A;  1ES2 A;  4R3J A;  1ZC2 A;  4EEP A;  3BWL A;  4N9L A;  3E4O A;  5AJG A;  1GSW A;  2A24 A;  3Q07 A;  5DF9 A;  3V3S A;  4BEN A;  2Y2L A;  2OWH A;  2W3E A;  3HLW A;  4D2O A;  4R4R A;  3WS0 A;  3AGF A;  4S2J A;  5E2E A;  2ZM8 A;  5DTT A;  3GTC A;  4OQG A;  2HP6 A;  3D72 A;  4LLO B;  1XFQ A;  3VOZ A;  4HJ6 A;  2RL3 A;  1N9B A;  3UN7 A;  2M7U A;  4CLC A;  5DVA A;  1Y4O A;  1ZHH B;  2J8Y A;  4NET A;  3IF5 A;  1XJ4 A;  2VA0 A;  1LSW A;  4FCF A;  3GEC A;  3C30 A;  3UE1 A;  1GHI A;  3K3C A;  3R7W B;  1BT5 A;  5AQ9 A;  3WS2 A;  1MPL A;  1ES5 A;  2EWV A;  4LFU A;  4EBL A;  2EX6 A;  4KUK A;  3T4J A;  2P9V A;  4E04 A;  4PMA A;  1CK3 A;  3UE0 A;  3MQQ A;  4WN5 A;  1I5Q A;  2O9A A;  5AVF A;  1G6A A;  3BEC A;  5F1F A;  1W63 Q;  2PBY A;  4QHC A;  1NZU A;  1UWP X;  3T4S A;  1PYY A;  4EU0 A;  1ALQ A;  1IEL A;  1K56 D;  2PAV P;  1FQG A;  4R4S A;  2ZJ9 A;  2K31 A;  1DJB A;  3IWQ A;  3C7U A;  3NJA A;  4H6J B;  5DF7 A;  3CIT A;  2B5R A;  5GLC A;  4OQH A;  3MMH A;  1YAX A;  1TVF A;  2FFY A;  4Y13 A;  2WZX A;  2C5W B;  4PM7 A;  5FA7 A;  1YLY A;  4XXR A;  3G35 A;  1NYY A;  1N9N A;  2IA2 A;  3DW0 A;  4MN6 A;  2IWD A;  4DF6 A;  2XRO A;  4PHT A;  3C7V A;  2R9X A;  3F1O A;  3MJQ A;  1CJF A;  3N4I A;  5CGW A;  2ZMF A;  2ZOH A;  4C6Y A;  3PXP A;  2JCH A;  2HJE A;  1IKI A;  1L3L A;  2IWC A;  4KQD A;  5D3O A;  3LI8 A;  1CEG A;  1G5U A;  4IVI A;  3T1X A;  5FQM A;  4HJ4 A;  3HLF A;  4GD8 A;  4EW7 A;  3S7P A;  2HZ5 A;  3IX8 A;  5CHJ A;  1T1A A;  3CZD A;  5DJT A;  4EV4 A;  1KOU A;  1E4D A;  4K0W A;  1WYC A;  4CLC C;  3L9K A;  1S4R A;  4RQ9 A;  4MEZ A;  4S2P A;  2H28 A;  3KYZ A;  1HZO A;  4JBF A;  2WKR A;  3GDI A;  3O5Y A;  3PAG A;  3N6I A;  3IX4 A;  4ME4 A;  3I7J A;  4EWF A;  4JGR A;  4KUO A;  2J3W A;  4ESP A;  1STZ A;  3G2Z A;  4E3M A;  1KGE A;  1G28 A;  1MY8 A;  5F6A A;  3H9W A;  1YPR A;  3LR0 A;  2W0N A;  3QP4 A;  2M1C A;  2ZD8 A;  3TJZ C;  3IWO A;  5FDH A;  5E43 A;  1E25 A;  3ZGA B;  1FIL A;  3JPU A;  1BLS A;  2MJ6 A;  1S1Y A;  3DTI A;  1K6R A;  2ZM0 A;  2VV8 A;  3G30 A;  3T4K A;  1K54 A;  1NXY A;  2DMW A;  1K56 A;  4ARZ A;  5F1G A;  1OTA A;  1YLJ A;  3ZNY A;  4GNU A;  4MLL A;  2NUT C;  4BD0 A;  1LHY A;  5FAQ A;  5AQB A;  4E3N A;  4DN0 A;  1TS6 A;  3V5M A;  4WEK A;  4R6L A;  1PIO A;  4OPQ A;  3NEC A;  1BLP A;  3FYZ A;  3GSG A;  1MWT A;  2OLV A;  4HBU A;  4R3A A;  1MWS A;  3U2A A;  1IYS A;  3IQA A;  5IT5 A;  4II7 A;  1FIK A;  5L10 A;  3PBT A;  2QYB A;  3KSF A;  3LR5 A;  5DF8 A;  1H8Y A;  4DDS A;  4Y7P A;  2CC1 A;  1VEU A;  1LI9 A;  1ESU A;  3C4P A;  4ZJ2 A;  2VGK A;  2D01 A;  5FAO A;  4BL3 A;  3OOV A;  4C75 A;  5HDD A;  1XJ2 A;  2P04 A;  4M3K A;  1K4F A;  1D7E A;  2VZW A;  3OPR A;  5HW3 A;  2BTF P;  4ZAM A;  5J8X A;  4KG5 A;  2W3G A;  3N8L A;  4DE2 A;  4WLA A;  5FI2 A;  1P0Z A;  2QMI A;  3LI9 A;  1ZTU A;  3MFX A;  3SH9 A;  2EFU A;  4S2L A;  3VOY A;  5HD5 A;  3WS4 A;  2ZC7 A;  2X71 A;  1I2W A;  1XFN A;  5E2H A;  5LBR A;  2JE5 A;  3FKV A;  3A0V A;  4BMW A;  4KZ5 A;  2Y2H A;  3GRJ A;  2ZC4 B;  3EWK A;  1PWG A;  2HJ9 C;  4N92 A;  2IWB A;  1JNU A;  4YFM A;  5L07 A;  1PWC A;  3TE8 A;  3NOU C;  5G4Z A;  1DRM A;  3A3I A;  2WGV A;  4EUV A;  4LRY C;  2Q9N A;  3Q7V A;  2EWW A;  1BLC A;  2BG1 A;  5JYO A;  1D06 A;  4DXB A;  3VOL A;  1OJ5 A;  3O87 A;  5EVL A;  2WGW B;  4X1L A;  4IUH A;  2QJ5 A;  2E8I A;  4KQO A;  2XFT A;  1P9R A;  2WKQ A;  5DFY A;  1K4E A;  3MF0 A;  1RP5 A;  3HLE A;  4HH3 A;  3LY3 A;  1IEM A;  5E2F A;  1ZG6 A;  1K38 A;  2EX9 A;  4FH4 A;  3W2Z A;  3HVF A;  2W1R A;  2ZQC A;  4MBF A;  3T4Q A;  2P74 A;  3HJK A;  4Q0H A;  3CPT A;  4GCZ A;  1IFQ A;  5HL6 A;  4GDN A;  4H8R A;  3AGE A;  5EVI D;  3Q81 A;  2L0W A;  5A92 A;  2ZC5 B;  4HI4 A;  2B18 A;  2VV7 A;  1YMX A;  5FAP A;  3WS1 A;  4P6B A;  2H0Y A;  3SH7 A;  3IS2 B;  3EGD C;  1L0E A;  2QWS A;  1NYM A;  5L2F A;  3CAX A;  2ZL1 A;  5E2G A;  4CJN A;  3LID A;  3QP5 A;  5HDS A;  2L4R A;  1RGZ A;  4IVK A;  1PZO A;  3IF6 C;  5FAT A;  1N9L A;  4JKT A;  5TBM B;  1S4S A;  3MXR A;  2Y2N A;  3VSK A;  5GLD A;  4X56 A;  3V3R A;  3VFH A;  2JC7 A;  1U60 A;  2G7U A;  3MKF A;  1KGF A;  2GJ3 A;  1MXO A;  3G2Y A;  2X02 A;  2WGW A;  4K91 A;  3PYP A;  2A24 B;  1H5X A;  3E98 A;  4MBH A;  1BSG A;  4DE1 A;  4RX2 A;  1T19 A;  3OC2 A;  4YIN A;  3T12 B;  5EVE A;  3G32 A;  2JBF A;  4OLG A;  2C6W B;  2OOL A;  1GSX A;  2DRW A;  1F98 A;  5EM0 A;  3VV4 A;  1P9W A;  2GX5 A;  2W3H A;  1PW8 A;  2QPN A;  2WYX A;  2V1B A;  4CLC B;  2A2L A;  2HP9 A;  4KZ7 A;  5GL9 A;  3BM6 A;  1Q2Q A;  2Y2Q A;  3NBL A;  2OAQ 1;  2WGI A;  1W7F A;  4ZBE A;  4NG2 A;  3WS5 A;  1YM1 A;  5A8B A;  2PRF A;  3ITA A;  3LY4 A;  4B93 A;  1XGI A;  3M6B A;  2FZ0 A;  4HEF A;  4IBR A;  3LEZ A;  2PBD P;  4PKY G;  5F5Y A;  3IBJ A;  3S7O A;  4EET B;  1TDG A;  5L8M A;  5HSQ A;  2ZQD A;  3VP0 A;  2XA7 M;  3V39 A;  3QP6 A;  3GQZ A;  4MMN A;  1F9I A;  3S22 A;  1IOU A;  3D4F A;  4QJG A;  5A91 A;  1SZV A;  2J7V A;  1TD5 A;  4GZB A;  5EVI A;  2O0Y A;  2Y59 A;  5HPF A;  1JTD A;  3SS3 A;  3QNB A;  4X68 A;  2J80 A;  2QJ7 A;  2B95 A;  4OPZ A;  1DP6 A;  3UB5 P;  5TFQ A;  4OPY A;  4Y17 A;  4OH0 A;  3RXW A;  4NKP A;  4DJ3 A;  1SDE A;  4U0T A;  2JKG A;  4JF4 A;  2CMN A;  3EOI A;  2BAS A;  2EA9 A;  1XJ6 A;  4PM5 A;  4KEN B;  3F1O B;  4LCL A;  3C2W A;  4EBN A;  2Y2G A;  4BLM A;  3IH9 A;  1H3Q A;  3C4O A;  3LGO A;  3F1P A;  5L09 A;  2QZ6 A;  1XA1 A;  2W1T A;  3S7N A;  4FUW A;  1M6K A;  1YMS A;  3K2N A;  1O7E A;  1JWV A;  3BY8 A;  4GB7 A;  1GHM A;  2XFS A;  1S67 L;  3TRC A;  4WZ4 A;  4WUJ A;  4A5R A;  3WRT A;  2Y2O A;  4Q8I A;  3EQV A;  3BLM A;  2WKH A;  3MS6 A;  3RJU A;  3N8S A;  1UWN X;  5FQK A;  1RCJ A;  1S0W A;  1VHM A;  4Y0T A;  5J3W A;  1ZKJ A;  1OTI A;  3A0R A;  3LEQ A;  1FSW A;  3ZG9 B;  1PZP A;  3NDG A;  3TOI A;  1EW0 A;  1FOF A;  3S4X A;  2OSU A;  4EEU A;  5HPI A;  2HF6 A;  3Q7Z A;  3NDE A;  2Z2M B;  1ERQ A;  3S1Y A;  3HLD A;  4LPZ A;  1FSY A;  5DTS A;  3PBS A;  5FDS A;  1H8Z A;  4PPR A;  1YT4 A;  1VQQ A;  3SS5 A;  2LB9 A;  1YQS A;  1K25 A;  3O88 A;  1DJC A;  4Q0I A;  3UO9 A;  1VB6 A;  2G2W A;  3B47 A;  5EOE A;  1T18 A;  3ZG8 B;  3PAE A;  2V0U A;  5C5K A;  4E3I A;  2Y79 A;  4Y0O A;  3UB7 A;  3E0Y A;  3T4O A;  3B42 A;  5IS1 A;  4HES A;  1DJA A;  1I2S A;  4JGO A;  1OJG A;  3MZD A;  3TG9 A;  5J4E A;  5EVI C;  5FQI A;  4LCM A;  2VV6 A;  3MXS A;  2XGN A;  4AFI A;  4XUX A;  4QD4 A;  3G34 A;  4JF5 A;  4LRZ E;  4ARZ B;  4BD1 A;  3LIA A;  2ZOI A;  2JKF A;  3LIE A;  5CEB A;  1NRJ A;  1RGY A;  1N9O A;  4OP8 A;  2WKP A;  4JPM A;  3GMW A;  3BEB A;  2ACG A;  1V9Y A;  3FV7 A;  4UEY A;  2J3T D;  5TR7 A;  1A0K A;  2GZA A;  1H0M A;  4PKY A;  1GA0 A;  1HTZ A;  1CQA A;  2I72 A;  1VEU B;  3ZDJ A;  3C38 A;  3UDI A;  3NOP C;  4LV2 A;  3T4T A;  3U4L P;  4R70 A;  4ZTK A;  4Y3I A;  3GVB A;  5EUA A;  3E2K A;  2ZMA A;  3FKW A;  2ZQ8 A;  3RFB A;  2HDR A;  4NXG A;  1QMF A;  3CHW P;  2K7S A;  1Y54 A;  1KE3 A;  4CQH A;  1J9M A;  2QHK A;  4QU3 A;  4LV0 A;  3S7Q A;  3ZVW A;  4N1H A;  4GS9 B;  3OLO A;  3IXH A;  3ICY A;  4I3A A;  5TJJ A;  1NRF A;  2EX2 A;  1MWU A;  2V9A A;  5M19 A;  4Q0J A;  4PM8 A;  5BOH A;  1O07 A;  2PD8 A;  4L9E A;  4E3O A;  4HP4 A;  3IXD A;  3HJI A;  2XR0 A;  1WA9 A;  4JLF A;  4IJG A;  3BRM A;  3LIC A;  3Q7V B;  2FFF B;  5AVE A;  4U0X A;  3FC7 A;  1L0F A;  3BQ8 A;  3LO7 A;  4YNR A;  3Q1F A;  3O3V A;  5FI6 A;  3MR0 A;  3UY6 A;  5HX9 A;  2XD5 A;  2WAF A;  4QY6 A;  2Y2K A;  1ERM A;  1IKG A;  2YKF A;  4OKP A;  2XA7 S;  4C3Q A;  4F3L B;  4HOI A;  5FEF A;  2O9B A;  5AQ7 A;  3NOT C;  5HWT A;  2JHE A;  4OOL A;  1ERO A;  1CI9 A;  4O7D A;  4GHI A;  3V50 A;  2WAD A;  3CUE A;  2Y4A A;  3NC8 A;  1OME A;  4WEJ A;  4BL2 A;  4PM9 A;  3IF6 A;  3ZG0 A;  4DE0 A;  4JGQ A;  5M1A A;  3FWL A;  4QY5 A;  3H82 B;  2Y2I A;  3W4Q A;  3CPT B;  2OWJ A;  2HPB A;  4GD6 A;  5EE8 A;  3UB6 A;  1W8Y A;  3GR2 A;  3W4O A;  3VP4 A;  3A3F A;  4GJ4 A;  3T1Q B;  3VFF A;  4DJ2 A;  3IT9 A;  4WEL A;  1NWZ A;  4GS9 A;  3FPV A;  1LL5 A;  5I5L A;  3KSI A;  2XK1 A;  3IWI A;  2PR6 A;  2JKT I;  1SDN A;  1ONG A;  4R1G A;  3LR4 A;  2ZM2 A;  2X01 A;  1BUE A;  3PHY A;  2BLS A;  3HL9 A;  1K6S A;  3E4P A;  2ZL1 B;  2WKI A;  3UDF A;  2LB5 A;  2PHY A;  4FTX A;  5HD3 A;  3MBZ A;  3VP1 A;  4G3K A;  2ZQA A;  2XQZ A;  1OTB A;  5FQJ A;  4RYE A;  2ZBB A;  4OQI A;  2ZLY A;  5FQ9 A;  3HUO A;  2A3U A;  5CXW A;  3ZHH A;  1NLZ A;  4X1M A;  1L0D A;  1KVL A;  4NXF A;  3JVV A;  3GV9 A;  4KQQ A;  4N9K A;  1KE0 A;  1H8M A;  4BBU A;  1TDL A;  4F3L A;  3IXG A;  1JVJ A;  3PBO A;  3HUN A;  5EPH A;  3EGX C;  2PT7 A;  1KVM A;  1PRQ A;  3KSH A;  3Q82 A;  4MCW A;  4L9G A;  1YLP A;  3BFG A;  5HAP A;  3LR3 A;  2W3F A;  3PTE A;  2OLU A;  3P09 A;  3C5A A;  1CEF A;  5CX7 A;  3H82 A;  4JXV A;  3QP1 A;  4HP9 A; 
#chains in the Genus database with same CATH homology
 4JXW A;  1TDG A;  2FFY A;  5F83 A;  2WZX A;  2C5W B;  4L0L A;  4E6W A;  2ZQD A;  2WAE A;  3VP0 A;  4PM7 A;  4DXC A;  3V39 A;  5FA7 A;  1YLY A;  4XXR A;  3G35 A;  3CJM A;  1NYY A;  1YLW A;  3GQZ A;  3DW0 A;  4GDB A;  2IWD A;  4DF6 A;  3S22 A;  4U3T A;  2EFX A;  2WZZ A;  2R9X A;  3C7V A;  3G31 A;  3N4I A;  5CGW A;  3D4F A;  4QJG A;  1WE4 A;  4KG2 A;  1SKF A;  3ZG5 A;  5A91 A;  2G2U A;  1E3U D;  4C6Y A;  2J7V A;  4GZB A;  5EVI A;  2EX8 A;  2JCH A;  2ZQ7 A;  1IKI A;  2XLN A;  2IWC A;  3DTM A;  2Y59 A;  1XX2 A;  1JTD A;  3SS3 A;  3QNB A;  4X68 A;  5D3O A;  4JF6 A;  4OPZ A;  1EWZ A;  4X55 A;  5TFQ A;  4OPY A;  1FCM A;  1KE4 A;  1CEG A;  5GHY A;  4IVI A;  4E6X A;  3HBR A;  4N1X A;  4OH0 A;  3OPL A;  1WYB A;  5FQM A;  3HLF A;  4GD8 A;  3RXW A;  2Y55 A;  4UAA A;  1SDE A;  1L0G A;  1BUL A;  4U0T A;  4JF4 A;  2RCX A;  5CHJ A;  3CZD A;  3NIA A;  4PM5 A;  4P87 A;  2DCF A;  4MNR A;  4EV4 A;  4KEN B;  1E4D A;  4K0W A;  1Q2P A;  2Z2L B;  1WYC A;  4LCL A;  4EBN A;  2Y2G A;  4BLM A;  3IH9 A;  3QNC A;  4KG6 A;  4KZ6 A;  3C4O A;  4X69 A;  1GCE A;  3BFD A;  4S2K A;  5EVI B;  5I94 A;  2QZ6 A;  3TSG A;  1XA1 A;  2EXA A;  5CTN A;  1M6K A;  1YMS A;  1O7E A;  4B4X A;  1JWV A;  3VMA A;  1IYO A;  1N4O A;  4MEZ A;  2V20 A;  4S2P A;  1KDS A;  4GB7 A;  1HZO A;  1GHM A;  4JBF A;  1HVB A;  2XFS A;  2H5S A;  3PBR A;  3PAG A;  5M18 A;  3N8R A;  5GLC A;  1SCW A;  4OQH A;  4WZ4 A;  3N6I A;  4KZ9 A;  3UPP A;  3I7J A;  2J9O A;  4A5R A;  4EWF A;  3WRT A;  2Y2O A;  4KQR A;  3WWX A;  3EQV A;  3BLM A;  4Q8I A;  1FR6 A;  2WKH A;  3BLS A;  3RJU A;  1XGJ A;  3UPO A;  1JTG A;  1YLZ A;  3M6H A;  3N8S A;  5FQK A;  1KGG A;  1L2S A;  3G2Z A;  4E3M A;  1KGE A;  1RCJ A;  1MY8 A;  1S0W A;  4E3J A;  4Y0T A;  5DTK A;  1QME A;  4IBX A;  1ZKJ A;  3NY4 A;  1FR1 A;  3OCL A;  1JWZ A;  1PI5 A;  1FSW A;  4BQM A;  3ZG9 B;  1PZP A;  3NDG A;  5GHZ A;  1IYQ A;  3TOI A;  1FCN A;  2ZD8 A;  4ZJ1 A;  2PU4 A;  1Z6F A;  3MZE A;  4ID4 A;  1FOF A;  3S4X A;  2OSU A;  3IWO A;  5FDH A;  3BFC A;  4Y0U A;  5E43 A;  3Q7Z A;  1E25 A;  1TEM A;  1EI5 A;  3NDE A;  3DWZ A;  2Z2M B;  2VGJ A;  3ZGA B;  1ERQ A;  1ZG4 A;  3JYI A;  3S1Y A;  3HLD A;  1FSY A;  1BLS A;  5DTS A;  3PBS A;  5FI7 A;  4K0X A;  1H8Z A;  4LEN A;  4PPR A;  1YT4 A;  3SH8 A;  1ONH A;  3A3E A;  4KZ4 A;  1VQQ A;  3SS5 A;  3RXX A;  1K6R A;  2ZM0 A;  1YQS A;  3G30 A;  1XXM A;  1K25 A;  4NK3 A;  1K54 A;  3O88 A;  1DJC A;  2HDQ A;  2WKE A;  4QB8 A;  2XEP A;  3M2K A;  1NXY A;  1K54 C;  3HRE A;  2G2W A;  3UO9 A;  5EOE A;  1K56 A;  5F1G A;  3SOI A;  1W8Q A;  1YLJ A;  3ZG8 B;  3PAE A;  3ZNY A;  4GNU A;  4MLL A;  4E3I A;  4X53 A;  2V1Z A;  3OZH A;  4BD0 A;  1LHY A;  4XUZ A;  4Y0O A;  5FAQ A;  4KZ3 A;  5AQB A;  5KSH A;  4F94 A;  4E3N A;  3V5M A;  4S2N A;  3PBQ A;  3MFD A;  4OOY A;  2H0T A;  4EUZ A;  4WEK A;  4HES A;  1DJA A;  5GLB A;  1I2S A;  1PIO A;  4OPQ A;  4S2N C;  4X6T A;  1BLP A;  1XP4 A;  3FYZ A;  3ZFZ A;  3GSG A;  2XH9 A;  3MZD A;  3TG9 A;  1MWT A;  2DNS A;  2OLV A;  2EXB A;  4HBU A;  1W5D A;  2WUQ A;  1MWS A;  1IYS A;  4JXG A;  3IQA A;  4UA9 A;  5EVI C;  3EQU A;  5JYP A;  1AXB A;  4IED A;  5FQI A;  4GKU A;  4LCM A;  1ES3 A;  1LL9 A;  3PBT A;  3MXS A;  2XGN A;  3LCE A;  4XUX A;  4OVD A;  4QD4 A;  3VP2 A;  3G34 A;  5DF8 A;  1H8Y A;  3UNW A;  4DDS A;  4JF5 A;  4RVA A;  4BD1 A;  4OPR A;  4Y7P A;  2CC1 A;  3B3X A;  3HLG A;  2OV5 A;  3QHY A;  1LI9 A;  1ESU A;  3NI9 A;  1XA7 A;  4S2M A;  4Z9Q A;  1BLH A;  1S6R A;  3C4P A;  3OCN A;  4ZJ2 A;  2VGK A;  2V2F F;  2PU2 A;  5FAO A;  5EEC A;  4BL3 A;  4OOM A;  5CEB A;  2XDM A;  4WMC D;  4C75 A;  4FD8 A;  1RGY A;  4OP8 A;  4JPM A;  5CGX A;  5CEC A;  4B88 A;  3VP3 A;  3GMW A;  5HAQ A;  3BEB A;  4M3K A;  1K4F A;  3FV7 A;  4P85 A;  3OPR A;  5HW3 A;  3E2L A;  4HBT A;  1GHP A;  3O86 A;  4ZAM A;  5J8X A;  3M2J A;  5TR7 A;  1PI4 A;  4KG5 A;  4EBP A;  5GHX A;  3ZCZ A;  3N8L A;  4R3B A;  4WYY A;  5FI2 A;  4DE2 A;  2QMI A;  3ZNT A;  3SH9 A;  4E3L A;  1MBL A;  1GA0 A;  1IYP A;  2EFU A;  1HTZ A;  4WM9 A;  4S2L A;  2I72 A;  5HAI A;  2A49 A;  1GA9 A;  5CHM A;  5IHV A;  3VOY A;  5CRF A;  3SS4 A;  3ZDJ A;  3UDI A;  1NJ4 A;  3WS4 A;  2ZC7 A;  2X71 A;  1I2W A;  2ZQ9 A;  3BFF A;  4LV2 A;  5E2H A;  2JE5 A;  4ZTK A;  3PBN A;  3FKV A;  2UWX A;  4E3K A;  3GVB A;  5EUA A;  3E2K A;  3ZG7 B;  4RX3 A;  2ZMA A;  3FKW A;  1MKI A;  2ZQ8 A;  4OQ0 A;  4UA6 A;  4KZ5 A;  2HDR A;  5AQA A;  5G18 A;  2Y2H A;  3GRJ A;  3HUM A;  2ZC4 B;  5FAS A;  1PWD A;  1PWG A;  5TGF A;  4N92 A;  1QMF A;  1Y54 A;  4WZ5 A;  4MBK A;  3A3J A;  3N7W A;  2IWB A;  4YFM A;  3UE3 A;  3A3D A;  1KE3 A;  1G68 A;  4WZ5 C;  1LLB A;  1PWC A;  1FCO A;  5CER A;  4CPK A;  5KSC A;  1J9M A;  3IHA A;  4DE3 A;  3A3I A;  3BYD A;  2WGV A;  4QU3 A;  4RA7 A;  3UDX A;  1C3B A;  1MWR A;  4KZ8 A;  2Q9N A;  3Q7V A;  4EQI A;  4LV0 A;  3ZVW A;  1BLC A;  4N1H A;  2BG1 A;  5JYO A;  2ZC6 B;  1K57 A;  4FH2 A;  5CED A;  5FQQ A;  3IXH A;  4DXB A;  4ZDX A;  3O87 A;  5EVL A;  2WGW B;  1K57 C;  4DKI A;  3G4P A;  1NRF A;  2EX2 A;  1MWU A;  3IXB A;  5M19 A;  2Y2P A;  1HD8 A;  4PM8 A;  3AGD A;  4BJP A;  2E8I A;  4KQO A;  5BOH A;  1O07 A;  3IHB A;  3FZC A;  1W79 A;  2XFT A;  1K55 A;  3WRZ A;  1K4E A;  4OLD A;  2ZC3 B;  4OON A;  2Y2M A;  1K55 C;  4FSF A;  4E3O A;  1RP5 A;  3HLE A;  3DWK A;  3OPP A;  1BZA A;  3LY3 A;  1IEM A;  4UHU A;  4DDY A;  3IXD A;  5E2F A;  1ZG6 A;  3MKE A;  3NCK A;  2XR0 A;  4JLF A;  3ZVT A;  1K38 A;  2EX9 A;  2HDS A;  3BRM A;  4FH4 A;  2XF3 A;  3HVF A;  1DY6 A;  3Q7V B;  2ZQC A;  2FFF B;  4B4Z A;  1ESI A;  4MBF A;  4KZB A;  4U0X A;  2P74 A;  1NZO A;  3ISG A;  2R9W A;  1ES4 A;  1VM1 A;  4LV1 A;  1L0F A;  2P9V B;  3LO7 A;  3Q1F A;  3O3V A;  1BTL A;  5FI6 A;  2H10 A;  4ZJ3 A;  3UY6 A;  5A90 A;  1SHV A;  5HX9 A;  2XD5 A;  2GDN A;  2J9P A;  2WAF A;  3IH8 A;  4QY6 A;  2Y2K A;  1YLT A;  1PW1 A;  5A93 A;  4GDN A;  2Y91 A;  3AGE A;  1ERM A;  1IKG A;  3ITB A;  4H8R A;  5EVI D;  3VSL A;  1E3U A;  3Q81 A;  5CHU A;  4OKP A;  4R23 A;  4UA7 A;  5A92 A;  4LV3 A;  2ZC5 B;  4C3Q A;  5CTM A;  1ES2 A;  1KDW A;  4R3J A;  1ZC2 A;  5AQ7 A;  4N9L A;  1YMX A;  5FAP A;  3WS1 A;  4P6B A;  4OOL A;  2H0Y A;  1ERO A;  3SH7 A;  1CI9 A;  4O7D A;  3Q07 A;  5KMW A;  5DF9 A;  2HP5 A;  3V50 A;  2WAD A;  3V3S A;  4BEN A;  1M40 A;  2Y4A A;  3NC8 A;  2HDU A;  1L0E A;  1LI0 A;  1NYM A;  2Y2L A;  5L2F A;  1OME A;  4WEJ A;  5E2G A;  3MZF A;  4BL2 A;  4CJN A;  4PM9 A;  3UPN A;  3HLW A;  3IF6 A;  3ZG0 A;  4D2O A;  4DE0 A;  3BFE A;  5KZH A;  5M1A A;  3FWL A;  4QY5 A;  5FSR A;  4R4R A;  3WS0 A;  1RGZ A;  3AGF A;  4IVK A;  1PZO A;  2Y2I A;  3IF6 C;  4S2J A;  4WMC A;  5E2E A;  2ZM8 A;  3W4Q A;  5DTT A;  5FAT A;  2HPB A;  3GTC A;  4GD6 A;  4JKT A;  4OQG A;  5EE8 A;  2HP6 A;  3HLC A;  4WBG A;  1W8Y A;  3GR2 A;  3MXR A;  3W4O A;  3VP4 A;  2Y2N A;  3VSK A;  3A3F A;  5HAR A;  4GN2 A;  4X56 A;  5GLD A;  3VFF A;  3V3R A;  3IT9 A;  2JC7 A;  1U60 A;  4WEL A;  3MKF A;  3VFH A;  1KGF A;  3VOZ A;  1MXO A;  1LL5 A;  3G2Y A;  2RL3 A;  1N9B A;  2X02 A;  3UN7 A;  2XK1 A;  3IWI A;  1XKZ A;  2WGW A;  4K91 A;  5DVA A;  4DRT A;  1SDN A;  1ONG A;  4R1G A;  1H5X A;  2J8Y A;  2ZM2 A;  4MBH A;  4P0M A;  2X01 A;  1BSG A;  1BUE A;  4NET A;  2BLS A;  3HL9 A;  4DE1 A;  1K6S A;  3CG5 A;  4RX2 A;  3OC2 A;  4JXS A;  2Y2J A;  5HFO A;  3IF5 A;  5U47 A;  4YIN A;  2WKI A;  3UDF A;  3IF6 B;  3G32 A;  2JBF A;  4OLG A;  4PM6 A;  2C6W B;  4FCF A;  3MBZ A;  3VP1 A;  2DRW A;  3UE1 A;  2ZQA A;  4GOG A;  1GHI A;  5F82 A;  2XQZ A;  5FQJ A;  4S2O A;  4RYE A;  1BT5 A;  5AQ9 A;  1PW8 A;  1CI8 A;  2QPN A;  4OQI A;  2WYX A;  3WS2 A;  2ZLY A;  1MPL A;  5FQ9 A;  1ES5 A;  5CGS A;  3HUO A;  3OPH A;  2A3U A;  4KZA A;  4OP5 A;  3P98 A;  4EBL A;  2EX6 A;  5CXW A;  2P9V A;  3ZHH A;  2HP9 A;  4PMA A;  4KZ7 A;  1CK3 A;  4R0Q A;  5GL9 A;  3UE0 A;  3BM6 A;  1I5Q A;  1XPB A;  1Q2Q A;  1L0D A;  2Y2Q A;  3NBL A;  2WGI A;  1KVL A;  1W7F A;  4ZBE A;  3WS5 A;  2Q9M A;  2WK0 A;  3GV9 A;  1G6A A;  1KE0 A;  2XD1 A;  3BEC A;  4KQQ A;  4N9K A;  5F1F A;  1YM1 A;  2PBY A;  4QHC A;  1TDL A;  3W8K A;  1NZU A;  3IXG A;  1JVJ A;  3ITA A;  1PYY A;  3PBO A;  1ALQ A;  3HUN A;  5EOO A;  5EPH A;  3LY4 A;  1IEL A;  3W4P A;  5HL1 A;  1XGI A;  1K56 D;  1KVM A;  5GLA A;  3M6B A;  3Q82 A;  3CMZ A;  1FQG A;  4R4S A;  4HEF A;  1YLP A;  2ZJ9 A;  4IBR A;  1DJB A;  3BFG A;  5HAP A;  3LEZ A;  1NY0 A;  3IWQ A;  3PTE A;  3C7U A;  2OLU A;  4S2I A;  3P09 A;  5DF7 A;  1JWP A;  3C5A A;  1CEF A;  2B5R A;  4JXV A;  3HLB A;  1TVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...