3N4IA

Crystal structure of the shv-1 d104e beta-lactamase/beta-lactamase inhibitor protein (blip) complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVEYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase SHV-1
publication title Specificity and Cooperativity at beta-lactamase Position 104 in TEM-1/BLIP and SHV-1/BLIP interactions
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 98
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3n4iA00
3GTCA 3W4QA 1ONGA 4E3NA 2ZC5B 2XGNA 3IH9A 4E3LA 4U0XA 1M6KA 4XXRA 3UPOA 5FATA 3V3RA 3NY4A 4GB7A 5FQQA 5JYPA 2JC7A 4KG2A 2HP9A 3WS1A 4KZAA 5FI7A 4UA6A 4OH0A 1G68A 2RL3A 4FH4A 3Q7VA 1K56D 3ITAA 1IYQA 5TFQA 3UPPA 1EWZA 5E2EA 1XA7A 5CHJA 3PBRA 4GN2A 5HW3A 1I2WA 2HDUA 1MY8A 4DDSA 3BRMA 1BTLA 2X71A 3HUMA 2WAEA 4XUZA 1FSYA 2XK1A 3GR2A 1ERMA 3MZDA 4LV0A 4QB8A 4OPYA 5CTNA 3UDFA 5FSRA 5EVLA 4DRTA 4E3OA 1ES5A 3BFEA 3NDEA 3UE3A 3ZVWA 3VP4A 2Z2MB 2WGWB 2ZQ8A 1KVMA 3MKFA 3S1YA 3VP2A 1JVJA 3N6IA 5DF9A 3O87A 1TEMA 4S2KA 4BD0A 5CXWA 2Y59A 4Y0TA 5CHUA 1N4OA 4R23A 3CG5A 1BUEA 3UPNA 4Y0OA 2Y2GA 1W8YA 1ESUA 2XR0A 1K38A 4WZ4A 4ZJ3A 3V39A 1DY6A 4MLLA 2V20A 1IELA 5GLCA 1YLYA 3OCNA 5D3OA 1BSGA 5FAQA 3WRZA 1CI9A 1K25A 4ZJ2A 1IKIA 3NBLA 2OLVA 5DTSA 1PWGA 2PU4A 2WKEA 4ZJ1A 2RCXA 3IF6B 4UA9A 4BQMA 3BYDA 1VQQA 1YLJA 5IHVA 1KDSA 4S2IA 4F94A 5CRFA 1PZPA 2H10A 2H5SA 4UA7A 5F1FA 3UY6A 1NY0A 5HAQA 2ZC6B 5KMWA 3OPLA 4N9LA 3PBQA 1K54A 2V1ZA 1MKIA 4O7DA 3W4PA 1QMEA 5M18A 1ZG6A 3OPHA 5E43A 4DE1A 4HBTA 2V2FF 4OQHA 3WWXA 4LENA 3GSGA 1I5QA 3Q7VB 4OLDA 1FQGA 3A3FA 1LL9A 4GDBA 4EWFA 3BFFA 3DW0A 3ITBA 1K6RA 4OQIA 5FAOA 4OOMA 2DCFA 2JBFA 5EVID 4S2NA 1SKFA 2ZD8A 1YLZA 3UN7A 4JXVA 5KSCA 2XF3A 4OP8A 5DVAA 1FR6A 4N1HA 2FFYA 5FQKA 1VM1A 3VOZA 4X6TA 1BULA 2WZZA 5L2FA 2Y2HA 2HDQA 3NC8A 3OCLA 4P0MA 1PIOA 3Q07A 3N4IA 2Y2NA 5EVIC 1IKGA 1K55C 4YFMA 1L0GA 1H5XA 2ZM0A 3B3XA 1GHIA 2H0YA 3MKEA 3IXDA 1K4FA 4P6BA 1CI8A 5AQ9A 3O88A 4N9KA 3VFHA 4DXCA 4JXWA 4Z9QA 3G35A 5FI2A 2C5WB 3PAGA 1NZUA 5CEDA 3M2KA 1E3UA 1FCOA 3G2YA 5FQIA 3S22A 3HUOA 1BLSA 1E25A 3PAEA 4GD8A 1PWDA 4Q8IA 1WYBA 4DF6A 1GCEA 2HP5A 5E2GA 2E8IA 2ZQCA 4OVDA 1K6SA 4JLFA 3VP0A 2ZC3B 3C7UA 4CPKA 4NETA 4PM7A 1Z6FA 5FQ9A 3FKWA 1XP4A 2ZC4B 4CJNA 3GV9A 4A5RA 3VSLA 4M3KA 5GHYA 4HESA 1BT5A 1NRFA 3BECA 2B5RA 2H0TA 3ISGA 4KZ9A 5GLAA 1BLCA 4EV4A 3FZCA 1ES2A 1MWTA 3O3VA 1K57A 1YMXA 3D4FA 3AGEA 4WMCA 2ZC7A 4WZ5C 4MBHA 4JF6A 3IXHA 1KGGA 4EUZA 3BEBA 4IBRA 2J9OA 5EECA 1O07A 3PBTA 4X53A 1LLBA 5DTTA 4EBNA 3UDXA 4U0TA 2WGIA 5M19A 4ZBEA 3IHAA 3HLDA 5FQMA 3SS5A 5HL1A 3SS3A 4OPQA 4C3QA 3EQUA 3PTEA 4FD8A 3AGFA 4JF4A 4FCFA 5HFOA 1E4DA 1Q2PA 2IWCA 4UHUA 5EE8A 4C75A 4DE3A 1DJBA 3WS0A 4DXBA 3NIAA 2XQZA 2OSUA 4S2JA 3LY3A 1IYSA 4IEDA 3C5AA 2WYXA 4PM6A 2IWDA 1FOFA 4FSFA 2A49A 5J8XA 4Y7PA 1GA9A 4H8RA 4JF5A 4L0LA 4WM9A 3A3IA 4JXGA 5CGSA 2WGVA 1Q2QA 1L0FA 3BLSA 1CEFA 1NJ4A 3CMZA 3HLBA 5HAPA 1CK3A 4EBLA 5E2HA 3FV7A 2Y4AA 5F82A 5A90A 2XD5A 3WS4A 2QPNA 3IT9A 4K91A 3P98A 4D2OA 4DE0A 1G6AA 3W8KA 3ZG7B 3EQVA 1W5DA 2ZLYA 4KZ8A 1MPLA 2EXAA 3FYZA 5GHXA 1YMSA 3UE1A 2ZQ9A 1LI0A 4R3JA 3A3EA 4OPRA 1MXOA 4GOGA 2XDMA 4XUXA 3IWOA 3VP3A 2X01A 3BFGA 1WE4A 3IXGA 2P74A 4GKUA 1OMEA 3HVFA 1H8ZA 3GRJA 2XFSA 1M40A 3I7JA 1TDLA 2Y2PA 1XXMA 2Y91A 2VGJA 2Z2LB 3DWKA 3HLWA 3IWQA 3P09A 5EPHA 5FAPA 4OLGA 4PPRA 3LY4A 5DTKA 1XKZA 1RCJA 4QHCA 3HREA 1YT4A 1KGEA 1L0EA 1RP5A 4KQQA 2WZXA 4R4RA 1YQSA 4KZBA 3N8RA 2PU2A 3HBRA 1W8QA 1K56A 4MBKA 1ZG4A 1PI4A 2ZQDA 4MEZA 1KDWA 2DRWA 4E3IA 1MWRA 5CECA 3IF6C 1L0DA 3G31A 4B88A 2OV5A 5A93A 4OP5A 5U47A 4EQIA 3ZHHA 4LV3A 2R9XA 1DJAA 1PI5A 3IQAA 5FA7A 1EI5A 3UO9A 1FSWA 1ES4A 4LCMA 1L2SA 3SH7A 1QMFA 4OOYA 4JBFA 1TVFA 1O7EA 3VMAA 3ZCZA 5JYOA 3VFFA 4UAAA 1ONHA 1KE0A 2DNSA 3G30A 5EUAA 1SCWA 2QMIA 4P87A 4OPZA 1YLTA 1JWVA 3DTMA 4P85A 4BL3A 4QU3A 1W7FA 4WBGA 2Y2KA 2XEPA 3UE0A 3RXWA 4X56A 4K0WA 5CGWA 1TDGA 3TG9A 1XX2A 5M1AA 1ZC2A 5CERA 5EOEA 3ZVTA 3OC2A 4MNRA 5FDHA 4IVKA 4S2PA 5G18A 3ZNTA 4X68A 4LV2A 5FI6A 4GD6A 3GVBA 1HD8A 4QJGA 3OPPA 4RVAA 2Y2LA 3DWZA 2Q9MA 3MZEA 1NYYA 3O86A 4Y0UA 3NDGA 3A3DA 4JKTA 1PZOA 1KE3A 4DKIA 1RGYA 1SDNA 1ALQA 5CGXA 1CEGA 3HLGA 4KZ5A 5AQ7A 4BL2A 4EBPA 2EX8A 2Y2OA 2ZQ7A 4RX2A 3ZGAB 1BLPA 3Q82A 4JXSA 5HARA 1EROA 1HTZA 1RGZA 2OLUA 4QY5A 3SOIA 3M2JA 3V50A 4DDYA 3PBOA 3C4PA 4BJPA 4E6WA 2ZQAA 3HUNA 4LCLA 1KVLA 2HDSA 2BLSA 1FCNA 2ZM8A 3IWIA 4KZ4A 1LHYA 2P9VA 1W79A 2Y55A 4BENA 1BLHA 1SDEA 3C7VA 3OPRA 1I2SA 5KSHA 2FFFB 4LV1A 3RJUA 5EVIA 3LO7A 4E3JA 3HLFA 3N7WA 2HDRA 1K55A 4YINA 4PM8A 5AQAA 1IYPA 3GQZA 2Q9NA 3NCKA 4K0XA 1C3BA 2G2WA 1ZKJA 4C6YA 5GLBA 1S6RA 5AQBA 4ZAMA 2EX6A 3NI9A 3ZG8B 3Q81A 3BFDA 1XPBA 4DE2A 3JYIA 2XD1A 5EOOA 4NK3A 3GMWA 3MXRA 4OQ0A 2EX9A 4B4ZA 1K54C 5FQJA 2GDNA 3ZG5A 3IH8A 1LL5A 2QZ6A 4WYYA 2HPBA 3UNWA 5GL9A 3Q7ZA 2XH9A 1SHVA 4WELA 1NZOA 5KZHA 4RA7A 3E2LA 2ZMAA 4ZDXA 5TR7A 5CTMA 4ID4A 3WRTA 4KZ7A 1Y54A 4GDNA 1ES3A 2WAFA 3TSGA 1JWZA 4S2NC 3VP1A 5HAIA 3M6BA 2ZM2A 5A92A 2EFUA 4PM9A 3ZDJA 3QNCA 1JTDA 4U3TA 2WKIA 4S2OA 3MBZA 4WZ5A 4HBUA 5I94A 1YLWA 4E3MA 2EX2A 4S2MA 3G4PA 3PBSA 1E3UD 1MWUA 1FR1A 1J9MA 3S4XA 1ESIA 4KZ6A 3SS4A 1S0WA 4GNUA 3UDIA 1DJCA 4X69A 4BLMA 4X55A 3AGDA 3IXBA 2XLNA 3ZFZA 3BFCA 1AXBA 2WADA 4BD1A 3BLMA 4JPMA 4PM5A 1ERQA 4N92A 1HVBA 2J7VA 3LCEA 3E2KA 4OKPA 4R4SA 5E2FA 2G2UA 4RYEA 1XA1A 3QNBA 4IBXA 2ZJ9A 1GA0A 3CZDA 1PWCA 2P9VB 3N8SA 4KG5A 4R0QA 3HL9A 1FCMA 3ZG9B 1GHMA 2WK0A 3LEZA 5GLDA 3VSKA 2C6WB 4WMCD 3SH9A 4WEKA 3G32A 2CC1A 4MBFA 3HLEA 5EVIB 3W4OA 5FASA 5F83A 1MBLA 1YLPA 3G2ZA 3N8LA 2I72A 2Y2JA 4S2LA 1HZOA 4QD4A 3IF5A 1PYYA 3PBNA 3HLCA 3QHYA 5DF8A 4B4XA 3ZNYA 1K57C 4GZBA 3IHBA 2BG1A 3V3SA 3M6HA 2J9PA 1NYMA 2EFXA 5A91A 5F1GA 2UWXA 2X02A 2Y2MA 2IWBA 3RXXA 2PBYA 3TOIA 1KGFA 3V5MA 1H8YA 4R3BA 1GHPA 5TGFA 2J8YA 2WGWA 2A3UA 1JWPA 2Y2QA 3G34A 4KG6A 4QY6A 3ZG0A 5CEBA 5CHMA 1PW8A 5BOHA 4E3KA 5DF7A 4RX3A 3CJMA 4ZTKA 4OONA 2EXBA 5HX9A 2WKHA 1N9BA 2JE5A 4OQGA 4WEJA 1K4EA 4HEFA 3BM6A 3A3JA 1LI9A 3FKVA 4KQOA 2WUQA 1U60A 4PMAA 5GHZA 3SH8A 1XGJA 4KZ3A 2HP6A 3OZHA 4KQRA 3FWLA 4OOLA 1WYCA 1XGIA 2JCHA 3WS5A 3MXSA 3WS2A 1MWSA 4E6XA 2XFTA 1IEMA 1NXYA 3C4OA 2Y2IA 3MZFA 1JTGA 1BZAA 3MFDA 4N1XA 2R9WA 1IYOA 1KE4A 3IF6A 3Q1FA 1YM1A 2VGKA 4FH2A 4KENB 4R1GA 1PW1A 3VOYA 4IVIA
chains in the Genus database with same CATH superfamily
1ONGA 2EA9A 2ZC5B 5HD5A 4U0XA 3UPOA 3NY4A 4EETB 3C30A 2ZL1A 2HP9A 3WS1A 4OH0A 4CLCB 2A24A 4FH4A 1K56D 3C2WA 5E2EA 2HV1A 4GN2A 5HW3A 2ZOIA 1FSYA 3CLOA 4E3OA 1ES5A 1XJ4A 4H6JA 1JVJA 3N6IA 3LR0A 4S2KA 2O0YA 1LL8A 1X0OA 1OTAA 5CHUA 1N4OA 3UPNA 4O8GA 1K38A 4ZJ3A 4ARZA 2V20A 1GSVA 5D3OA 2L4RA 1K25A 2OAP1 5DFXA 3ZQ5A 4BQMA 4HP4A 2O9CA 2J3WA 3H7WB 1T1AA 4IUKA 1LSVA 1KDSA 1YKDA 4EXOA 5CRFA 3HCYA 5DJTA 4HQAA 5DJUA 5HAQA 4L9GA 5KMWA 4JGQA 3PBQA 1MKIA 4CLCA 1ACFA 4O7DA 3W4PA 2WKPA 4LENA 1LL9A 4EWFA 4QPRA 2W3EA 3DW0A 2B95A 5DFYA 1MZUA 2HGVA 5KSCA 2XF3A 2FFYA 1VM1A 3NC8A 4YFMA 5AQ9A 3IXDA 1K4FA 5FEGA 3PXPA 4JXWA 3K3DA 3PAGA 3M2KA 1E3UA 1FCOA 3G2YA 3BQAA 4DN0A 3LIBA 1BLSA 3PAEA 4GD8A 1PWDA 3EOIA 1WYBA 5G4ZA 1K6SA 1XJ3A 4CPKA 4JGPA 3A0VA 4CJNA 3VSLA 3KSHA 5GHYA 1BT5A 3BECA 2B5RA 1BLCA 1F98A 3D4FA 4D60A 2ZC7A 2XROA 4IBRA 3S7OA 3PBTA 4I38A 2WGIA 4HH2A 3MR0A 3HLDA 3JVVA 2NUPC 5EM0A 1DJBA 2OWJA 3NIAA 2OSUA 5LBRA 3UB9A 4MN6A 2WYXA 2IWDA 3KYZA 5J8XA 4H8RA 4L0LA 4WM9A 4PKYG 2QJ7A 3LEQA 4IJGA 4JXGA 4KUOA 1CK3A 3IX8A 3FV7A 4DJ3A 5F82A 5A90A 3WS4A 5J4EA 4DE0A 1G6AA 3DTKA 3EQVA 4NKPA 1W5DA 2ZLYA 4LRYC 4NXFA 1MXOA 4GOGA 2XDMA 3E4OA 1OMEA 2VX8A 3GRJA 3V39A 3P09A 3HLWA 3IWQA 4HHDA 4OLGA 2JHEA 4QHCA 3HREA 4KQQA 3VV4A 1RP5A 3N8RA 1K56A 4MBKA 4MEZA 1TS0A 4E3IA 1MWRA 3IF6C 1YAXA 2MJ6A 5FA7A 3OOVA 3T50A 3SH7A 3ZCZA 2A2LA 4HJ6A 1T1BA 1KE0A 3G30A 2QJ5A 1YLTA 4Y17A 3UE0A 4QWOA 4Y13A 2XEPA 4CQHA 3VE3A 5L07A 5CGWA 3T4LA 4R38A 5HL6A 4UQIS 4JGRA 3ZVTA 3IBRA 4S2PA 5G18A 4X68A 4LV2A 2LB9A 3GVBA 3B33A 4QJGA 1PFLA 2Y2LA 2W27A 4Y0UA 5F5YA 4KQDA 4JKTA 4ETZA 4F3LA 4DKIA 1RGYA 1SDNA 4KZ5A 2ZMVA 2Y2OA 4Y3IA 4I3JA 1EROA 1RGZA 3V50A 4DDYA 5CX7A 3PBOA 1NRJA 2P9VA 4BENA 1W63Q 3C7VA 3OPRA 5KSHA 3UB8A 4I5SA 4PM8A 5AQAA 1C3BA 4ZAMA 2EX6A 3ZG8B 3BFDA 1XPBA 3JYIA 4X1MA 3GMWA 4OQ0A 4B4ZA 1K54C 3LICA 4LFUA 3Q7ZA 4X1LA 4WELA 5KZHA 4RA7A 3K2NA 4ZDXA 1P0ZA 5AJGA 4KZ7A 4GDNA 2HF6A 2J3TC 3PR6A 3T1XA 3QNCA 1JTDA 4B9OA 1FR1A 4KZ6A 3SS4A 3OBFA 3CI6A 1OT9A 3ZFZA 2JKFA 4BD1A 1IOUA 2J7VA 1FILA 3E2KA 5E2FA 5IS1A 2ZJ9A 2PT7A 4KG5A 1GHMA 3VSKA 3W4OA 3HLEA 3MXQA 2VV6A 2Y2JA 4QD4A 1PYYA 5DF8A 4GZBA 3IHBA 1S1YA 3M6HA 5HPFA 3MQOA 2X02A 2Y2MA 1H0MA 4PAUA 2J8YA 2Y2QA 3ZG0A 1JWPA 3G34A 5CHMA 4E3KA 1VEUB 3DAVA 4ZTKA 4OONA 2Z6CA 1N9BA 1S67L 4HEFA 1K0KA 4IUHA 3FKVA 4KQOA 1XJ6A 4PMAA 3SH8A 3OZHA 3FWLA 1XJ2A 4E6XA 5EVEA 3PYPA 3MZFA 1JTGA 2R9WA 3IF6A 4PHTA 1YM1A 1PW1A 3VOYA 1D7EA 3G6OA 3T1QB 3V3RA 5HDSA 4Q0HA 5FI7A 4GW9A 1SZVA 5HWVA 4I39A 1IYQA 1XA7A 1YSPA 3PBRA 3RFBA 1OTEA 1BTLA 1BYWA 1VETA 4XUZA 3GR2A 4BBUA 1ERMA 4LV0A 5AVEA 4DRTA 4OPYA 1T1CA 5CTNA 3EWKA 4L9EA 3BFEA 1OTDA 3NDEA 3VP4A 2Z2MB 3BW6A 3S1YA 5DF9A 4BWIA 3QP1A 4Y0TA 3CG5A 1BUEA 2V0UA 4Y0OA 2OAQ1 2Y2GA 1W8YA 2K31A 1ESUA 2Z6DA 5GLCA 1CI9A 3A0RA 1IKIA 3NBLA 2OLVA 2PU4A 3LIEA 4ZJ1A 1VQQA 3OLOA 1YLJA 4F94A 2M7UA 3TJZC 2H5SA 4LRXC 1OTIA 4NXBA 4N9LA 2UV0E 1K54A 2V0WA 2R78A 3OPHA 5E43A 2V2FF 2A24B 3WWXA 4OLDA 1FQGA 3A3FA 2JKTI 4GDBA 3ITBA 4OOMA 2DCFA 1SKFA 2ZD8A 4LRZE 3UN7A 3DTEA 5DVAA 4N1HA 4X6TA 5L2FA 3OCLA 3NOTC 1PIOA 1L0GA 1H5XA 3B3XA 2H0YA 3MKEA 4P6BA 4DXCA 4Z9QA 1NZUA 5L8MA 3S22A 3HUOA 4ARZB 1E25A 2PD7A 3S7PA 5E2GA 3E0YA 2E8IA 2ZQCA 4OVDA 4JLFA 3KYQA 1Z6FA 3H82B 2V8FA 1Y28A 2H0TA 3ISGA 4EV4A 1MWTA 3O3VA 1YMXA 3AGEA 2O99A 4WZ5C 4MBHA 3IXHA 4HP9A 4WN5A 4YWZA 4EUZA 5EECA 1LLBA 1G28A 4HI4A 1ODVA 5HL1A 3SS3A 4OPQA 4C3QA 1TS8A 4FD8A 3CPTA 3H9WA 4UHUA 3U2AA 2JKRI 3LY3A 1IYSA 3MJQA 1AWIA 1S4SA 4PM6A 4X25A 1F9IA 1FOFA 2A49A 4FSFA 3A3IA 4M4XA 5HAPA 3HLBA 4EBLA 2I9VA 1PRQA 2XD5A 3IT9A 3ZG7B 5AVFA 3S7NA 2XA7S 3FYZA 3H82A 2ZQ9A 1LI0A 1S4RA 2PBDP 4OPRA 4EEPA 3VP3A 1WE4A 3BY9A 3IXGA 2P74A 1NWZA 2D02A 4YNRA 1HLUP 1JNUA 2VGJA 3CITA 5FAPA 4Q0IA 4PPRA 1YT4A 1KGEA 1L0EA 4R4RA 2WZXA 4KZBA 3VE4A 2PU2A 3HBRA 4WL9A 1ZG4A 1PI4A 5HWWA 5CECA 1STZA 3UB7A 4OP5A 5U47A 1DJAA 5HSQA 1EI5A 4GCZA 3F1OA 3UO9A 1Z09A 2VLGA 3RH8B 1L2SA 4OOYA 3VFFA 4UAAA 2DNSA 4HH3A 3PHYA 1W7FA 4X56A 1TDGA 4II7A 1Y4OA 4ZRRA 5CERA 5DKKA 5EOEA 3OC2A 4MNRA 3OPPA 3LGOA 4PKYA 3TE8A 3O86A 3T12B 3NDGA 1KE3A 5CGXA 3HLGA 1OJGA 4I3IA 4LLOB 1BLPA 3QP5A 2XRNA 1XFNA 3SOIA 2OLUA 3M2JA 2PYPA 3C4PA 4LCLA 1CF0A 1CJFA 3C38A 3F1PB 4KZ4A 1BLHA 1SDEA 1I2SA 2GX5A 3QP6A 4WLAA 3GECA 3HLFA 1IYPA 1P9WA 2Q9NA 2VGLS 2L0WA 4HY8A 2XA7M 4NK3A 1LSXA 2W0NA 2W3HA 2GDNA 3IH8A 5GL9A 2XH9A 1SHVA 3LYXA 2ZMAA 5CTMA 1ES3A 2VA0A 1JWZA 2ZM2A 4WUJA 3ZDJA 3S7QA 2QWSA 4F3LB 4S2OA 5FDSA 2EWWA 3FC7A 4HBUA 4WZ5A 4EERA 5I94A 3PBSA 1ESIA 3BJNA 3T4OA 1V9ZA 1NLZA 3SW1A 3KSFA 1ZTUA 4BLMA 4X55A 1FIKA 2V8CA 4JPMA 3ZYTA 3F1PA 4N92A 3FG8A 1S1ZA 3LCEA 1DP8A 2G2UA 3IX4A 3QNBA 2P9VB 3N8SA 3LEZA 4WEKA 4MBFA 3N8LA 1LSWA 5L10A 2PDRA 2W1TA 3IF5A 3HLCA 3KSIA 4B4XA 3ZNYA 2J9PA 1NYMA 3KO6A 2UWXA 3IX3A 2PBYA 3TOIA 1KGFA 5TGFA 2PHYA 1DRMA 2WGWA 4KG6A 4QY6A 2Y8HA 5DF7A 1GSXA 4RX3A 3CJMA 2EXBA 2WKHA 4OQGA 3VOLA 4G3KA 2VKSA 5GHZA 1U60A 4YOFA 1LT0A 4FTXA 1J3WA 3WS5A 3JVUA 4NEED 3P01A 2XFTA 1N9NA 2VGLM 2Y79A 4N1XA 1OTBA 4FH2A 4R1GA 4IVIA 3GTCA 4E3NA 2XGNA 3IH9A 4E3LA 4DJ2A 4Y2FA 4I3AA 5FATA 3UMEA 4KG2A 4KZAA 4UA6A 1DP6A 3EGXC 1D06A 2RL3A 4DMZA 3Q7VA 3ITAA 4GS9A 5TFQA 1EWZA 5CHJA 3NOUC 4O0PA 1MY8A 4DDSA 3BRMA 2X71A 2WAEA 1A0KA 2QKPA 4KUKA 4QB8A 3UDFA 5FSRA 1OJ5A 4CLCE 1TS7A 3UE3A 3ZVWA 2ZQ8A 3L9KA 1KVMA 3MKFA 3VP2A 3KYEA 4R70A 5HD3A 1G5UA 2XR0A 2JN7A 1DY6A 1IELA 2E8JA 3OCNA 1BSGA 3WRZA 4ZJ2A 5DTSA 1PWGA 4GLQA 2WKEA 2RCXA 3IF6B 4UA9A 3BYDA 1F2KA 3L7HA 1PZPA 2JKTM 2H10A 2O9BA 3MSHA 4UQIM 3V67A 5F1FA 2ZC6B 3RTYA 3E4PA 3OPLA 2V1ZA 3MQQA 5M18A 1ZG6A 4DE1A 4OQHA 3GSGA 1I5QA 1G6OA 3D72A 1K6RA 5EVID 2JBFA 1VETB 4JXVA 4OP8A 3K3CA 2GJ3A 1BULA 2WZZA 2Y2HA 1KOUA 4P0MA 3EGDC 5EVIC 3N4IA 2Y2NA 1K55C 1D1JA 2VEAA 3VFHA 1F5MA 3O88A 4N9KA 2GZAA 3P7NA 3G35A 5EV0A 2C5WB 4G3VA 4NXGA 5FQIA 2W3GA 4ME4A 4DF6A 2HP5A 2ZC3B 3C7UA 4PM7A 3MFXA 2K2NA 2OOLA 3GV9A 2YKHA 4A5RA 3C8CA 4HESA 1N9LA 1NRFA 4NXEA 3FZCA 1KGGA 3BEBA 3ICYA 2J9OA 2JKRM 1O07A 4X53A 5DTTA 1DP9A 4ETXA 4ZBEA 5FQMA 2P08A 3E4QA 3AGFA 4JF4A 5HFOA 2IWCA 5HPIA 4GHIB 4L9FA 4C75A 4DE3A 3IS2A 4DXBA 4CLCD 4ESPA 2W3FA 4IEDA 3C5AA 4Y7PA 1GA9A 2KX6A 2O9AA 4MN5A 5CGSA 1L0FA 1CEFA 3CMZA 3T4TA 2Y4AA 4K91A 2HJEA 4KZ8A 5GHXA 2VK3A 4XUXA 3IWOA 2X01A 4HJ4A 5FL3A 2XFSA 3DWKA 2ZOHA 3F1NA 1YPRA 3LY4A 2IA2A 2VJWA 3FPWA 2H28A 2PRFA 4FUWA 4HJ3A 4Z1WA 2ZQDA 5MC7A 2DRWA 1L0DA 5TBMA 5A93A 5J7EA 4GHIA 2CMNA 4LV3A 5J3WA 2R9XA 3CPTB 1PI5A 1MKMA 3LI9A 1FSWA 1ES4A 2BTFP 4JBFA 2VV8A 1ONHA 1SCWA 1T18A 3DTMA 4BL3A 2KOIA 2Y2KA 4K0WA 4Y5FA 2V1AA 3ZNTA 1NLYA 2OWHA 3R7WA 3QP2A 2Q9MA 3MZEA 1NYYA 3A3DA 1PZOA 4BL2A 4EBPA 5L09A 3LIFA 5FEFA 5IU1A 2D01A 5DKLA 5HARA 4QY5A 3JPUA 1WA9A 2PYRA 3LI8A 5KIZA 1OPXA 4BJPA 4E6WA 2ZQAA 3HUNA 2ZM8A 3IWIA 1LHYA 2Y55A 3LUQA 2FFFB 5EVIA 3LO7A 4YINA 3N7WA 2HDRA 1K55A 3GQZA 2G2WA 1ZKJA 3KX0X 5GLBA 5AQBA 3F1OB 4DE2A 2XD1A 5EOOA 2EX9A 1S66L 5G4YA 5FQJA 4IHQA 3ZG5A 1LL5A 4WYYA 1T19A 3E2LA 5TR7A 4ID4A 3TSGA 4S2NC 3VP1A 2PD8A 5HAIA 3M6BA 2EFUA 4PM9A 3R4KA 1ZHHB 3MBZA 1YLWA 2EX2A 1MWUA 3S4XA 1J9MA 3UDIA 3CUEC 4FOFA 3AGDA 5HWTA 3BFCA 1AXBA 3TW8A 4PM5A 1ERQA 5F6AA 3BQ8A 1HVBA 1GSWA 4OKPA 4R4SA 4RYEA 1XA1A 4IBXA 5F68A 3CZDA 1PWCA 4R0QA 1FCMA 3ZG9B 2WK0A 5GLDA 3HJKA 4WMCD 3G32A 2CC1A 2ZBBA 1MBLA 4MDZA 3G2ZA 2I72A 1HZOA 3PBNA 3UMDA 1K57C 2BG1A 2YKFA 5A91A 5F1GA 1VHMA 5HDCA 5C5KA 1UWNX 4R3BA 5BOHA 1PW8A 3UE6A 2DMWA 5K5BA 1LI9A 3EEHA 1XGJA 2HP6A 4KQRA 1WYCA 2JCHA 5HDDA 1XFQA 3MXSA 3WS2A 1MWSA 4AFIA 3UB5P 1IEMA 1BZAA 3MFDA 1IFQA 3Q1FA 1KE4A 4KENB 2VGKA 3UB6A 3H7WA 5EFWA 3W4QA 2ACGA 3T4KA 3MF0A 4EQ1A 4LPZA 1M6KA 4XXRA 4R6LA 2L1MA 2HZ5A 3CHWP 4GB7A 3ULFA 3QP8A 5FQQA 5JYPA 2JC7A 2EWVA 4P6ZS 1G68A 2W1TB 3UPPA 2PR6A 1I2WA 4G3WA 2HDUA 4EU0A 5HZHA 3HUMA 1V9YA 2XK1A 3MZDA 1EW0A 3NECA 5EVLA 2FH5A 2WGWB 4K08A 3O87A 4HNBA 1TEMA 4BD0A 5CXWA 2Y59A 4R23A 3MQ0A 4WZ4A 4MLLA 1YLYA 5FAQA 2AVXA 2B02A 2V9AA 2WKRA 4BBVA 5IHVA 4S2IA 4Q0JA 4UA7A 3UY6A 1NY0A 4MMNA 3D3OA 1QMEA 1VB6A 4HBTA 2V1BA 3Q7VB 3LR5A 4GS9B 3NJAA 3BFFA 4OQIA 5FAOA 4S2NA 1YLZA 2VV7A 3T4SA 5TJJA 1FR6A 5FQKA 3VOZA 1SKOB 2HDQA 3Q07A 1IKGA 3T1SA 2ZM0A 3DTIA 1GHIA 4XT2B 1CI8A 5FI2A 3T4QA 5CEDA 3CUEA 4Q8IA 1P9RA 3LIDA 3NOPC 1GCEA 4P6ZM 3CWFA 3TRCA 3VP0A 4NETA 5FQ9A 3FKWA 4MN7A 1XP4A 2ZC4B 4M3KA 4KZ9A 5GLAA 1ES2A 1K57A 4WMCA 4EEUA 3D9YA 4JF6A 3E98A 2HJ9C 3LR3A 4EBNA 3UDXA 4U0TA 5M19A 3IHAA 3MS6A 4EW7A 4LGWA 4HIAA 3SS5A 3EQUA 4BMWA 3PTEA 3HJIA 4FCFA 2XSSA 1E4DA 1Q2PA 5EE8A 1SKOA 1W63M 3WS0A 2XQZA 3SZTA 4S2JA 4GJ4A 2KLIA 4XT2A 4JF5A 2LB5A 5I5LA 1CQAA 2WGVA 1Q2QA 3BLSA 2W3DA 1NJ4A 1YSQA 2J3TD 5E2HA 3BWLA 2QPNA 4D2OA 3P98A 3W8KA 2B18A 1MPLA 2EXAA 1UWPX 1YMSA 3UE1A 4R3JA 3A3EA 3BFGA 3BY8A 4GKUA 3QP4A 3HVFA 1H8ZA 1M40A 3I7JA 1TDLA 2Y2PA 1XXMA 2Y91A 2Z2LB 5EPHA 5DTKA 1XKZA 1RCJA 4RQ9A 1H3QA 1PNEA 1YQSA 1W8QA 1KDWA 4EUVA 3CAXA 3G31A 4B88A 2OV5A 4EQIA 3ZHHA 2JKGA 5EM1A 3IQAA 5F69A 3IS2B 3VMAA 4LCMA 1QMFA 1TVFA 1O7EA 5JYOA 5EUAA 2QMIA 4P87A 4OPZA 1JWVA 4P85A 4QU3A 4WBGA 3RXWA 3TG9A 1XX2A 5M1AA 1ZC2A 2M7VA 5FDHA 4IVKA 3EEAA 5FI6A 4GD6A 3GDIA 1HD8A 4B93A 4RVAA 3DWZA 3KSGA 2QYBA 1ALQA 2VZWA 1CEGA 5AQ7A 2EX8A 2ZQ7A 4RX2A 3ZGAB 3Q82A 3U4LP 1H8MA 4JXSA 3F1NB 1HTZA 1KVLA 2HDSA 2BLSA 3IBJA 1FCNA 1W79A 2ZMFA 4LV1A 5TBMB 3LIAA 3RJUA 4E3JA 1TF1A 3FPVA 3NCKA 4K0XA 4C6YA 4NG2A 1S6RA 2K7SA 3NI9A 3Q81A 3LR4A 3MXRA 4CLCC 4E04A 3W2ZA 2QZ6A 2P7JA 3MMHA 4UEYA 2HPBA 2NUTC 2INWA 3UNWA 1NZOA 3O5YA 4JGOA 1VEUA 3WRTA 1Y54A 2WAFA 3R7WB 3DBAA 2KDKA 5A92A 4U3TA 2BASA 3T4JA 2WKIA 1P97A 4E3MA 4S2MA 3G4PA 5A8BA 1E3UD 2M1CA 3A0SA 2P04A 1S0WA 4GNUA 1DJCA 1UGUA 4X69A 3IXBA 4HOIA 2XLNA 2WADA 3BLMA 1MC0A 2W1RA 3T1RA 3B42A 1OT6A 2GNXA 3NULA 3HL9A 2FZ0A 4Y15A 2C6WB 4O01A 3SH9A 5EVIB 5FASA 4MCWA 2PAVP 5F83A 2J80A 1YLPA 2ZL1B 3NHQA 4S2LA 2WKQA 3QHYA 4EESA 2G7UA 3V3SA 2EFXA 1L3LA 2QHKA 2Q0OA 3B47A 1TS6A 2IWBA 3RXXA 5IT5A 1TD5A 3V5MA 1H8YA 1GHPA 5CEBA 2A3UA 4WF0A 4R3AA 5HX9A 2JE5A 4H6JB 4WEJA 1K4EA 3BM6A 3A3JA 4BBTA 2PR5A 2WUQA 1N9OA 4KZ3A 4OOLA 1XGIA 3LFVA 1NXYA 3C4OA 2Y2IA 1IYOA 1GA0A
chains in the Genus database with same CATH topology
3GTCA 3W4QA 1ONGA 4E3NA 2ZC5B 2XGNA 3IH9A 4E3LA 4U0XA 1M6KA 4XXRA 3UPOA 5FATA 3V3RA 3NY4A 4GB7A 5FQQA 5JYPA 2JC7A 4KG2A 2HP9A 3WS1A 4KZAA 5FI7A 4UA6A 4OH0A 1G68A 2RL3A 4FH4A 3Q7VA 1K56D 3ITAA 1IYQA 5TFQA 3UPPA 1EWZA 5E2EA 1XA7A 5CHJA 3PBRA 4GN2A 5HW3A 1I2WA 2HDUA 1MY8A 4DDSA 3BRMA 1BTLA 2X71A 3HUMA 2WAEA 4XUZA 1FSYA 2XK1A 3GR2A 1ERMA 3MZDA 4LV0A 4QB8A 4OPYA 5CTNA 3UDFA 5FSRA 5EVLA 4DRTA 4E3OA 1ES5A 3BFEA 3NDEA 3UE3A 3ZVWA 3VP4A 2Z2MB 2WGWB 2ZQ8A 1KVMA 3MKFA 3S1YA 3VP2A 1JVJA 3N6IA 5DF9A 3O87A 1TEMA 4S2KA 4BD0A 5CXWA 2Y59A 4Y0TA 5CHUA 1N4OA 4R23A 3CG5A 1BUEA 3UPNA 4Y0OA 2Y2GA 1W8YA 1ESUA 2XR0A 1K38A 4WZ4A 4ZJ3A 3V39A 1DY6A 4MLLA 2V20A 1IELA 5GLCA 1YLYA 3OCNA 5D3OA 1BSGA 5FAQA 3WRZA 1CI9A 1K25A 4ZJ2A 1IKIA 3NBLA 2OLVA 5DTSA 1PWGA 2PU4A 2WKEA 4ZJ1A 2RCXA 3IF6B 4UA9A 4BQMA 3BYDA 1VQQA 1YLJA 5IHVA 1KDSA 4S2IA 4F94A 5CRFA 1PZPA 2H10A 2H5SA 4UA7A 5F1FA 3UY6A 1NY0A 5HAQA 2ZC6B 5KMWA 3OPLA 4N9LA 3PBQA 1K54A 2V1ZA 1MKIA 4O7DA 3W4PA 1QMEA 5M18A 1ZG6A 3OPHA 5E43A 4DE1A 4HBTA 2V2FF 4OQHA 3WWXA 4LENA 3GSGA 1I5QA 3Q7VB 4OLDA 1FQGA 3A3FA 1LL9A 4GDBA 4EWFA 3BFFA 3DW0A 3ITBA 1K6RA 4OQIA 5FAOA 4OOMA 2DCFA 2JBFA 5EVID 4S2NA 1SKFA 2ZD8A 1YLZA 3UN7A 4JXVA 5KSCA 2XF3A 4OP8A 5DVAA 1FR6A 4N1HA 2FFYA 5FQKA 1VM1A 3VOZA 4X6TA 1BULA 2WZZA 5L2FA 2Y2HA 2HDQA 3NC8A 3OCLA 4P0MA 1PIOA 3Q07A 3N4IA 2Y2NA 5EVIC 1IKGA 1K55C 4YFMA 1L0GA 1H5XA 2ZM0A 3B3XA 1GHIA 2H0YA 3MKEA 3IXDA 1K4FA 4P6BA 1CI8A 5AQ9A 3O88A 4N9KA 3VFHA 4DXCA 4JXWA 4Z9QA 3G35A 5FI2A 2C5WB 3PAGA 1NZUA 5CEDA 3M2KA 1E3UA 1FCOA 3G2YA 5FQIA 3S22A 3HUOA 1BLSA 1E25A 3PAEA 4GD8A 1PWDA 4Q8IA 1WYBA 4DF6A 1GCEA 2HP5A 5E2GA 2E8IA 2ZQCA 4OVDA 1K6SA 4JLFA 3VP0A 2ZC3B 3C7UA 4CPKA 4NETA 4PM7A 1Z6FA 5FQ9A 3FKWA 1XP4A 2ZC4B 4CJNA 3GV9A 4A5RA 3VSLA 4M3KA 5GHYA 4HESA 1BT5A 1NRFA 3BECA 2B5RA 2H0TA 3ISGA 4KZ9A 5GLAA 1BLCA 4EV4A 3FZCA 1ES2A 1MWTA 3O3VA 1K57A 1YMXA 3D4FA 3AGEA 4WMCA 2ZC7A 4WZ5C 4MBHA 4JF6A 3IXHA 1KGGA 4EUZA 3BEBA 4IBRA 2J9OA 5EECA 1O07A 3PBTA 4X53A 1LLBA 5DTTA 4EBNA 3UDXA 4U0TA 2WGIA 5M19A 4ZBEA 3IHAA 3HLDA 5FQMA 3SS5A 5HL1A 3SS3A 4OPQA 4C3QA 3EQUA 3PTEA 4FD8A 3AGFA 4JF4A 4FCFA 5HFOA 1E4DA 1Q2PA 2IWCA 4UHUA 5EE8A 4C75A 4DE3A 1DJBA 3WS0A 4DXBA 3NIAA 2XQZA 2OSUA 4S2JA 3LY3A 1IYSA 4IEDA 3C5AA 2WYXA 4PM6A 2IWDA 1FOFA 4FSFA 2A49A 5J8XA 4Y7PA 1GA9A 4H8RA 4JF5A 4L0LA 4WM9A 3A3IA 4JXGA 5CGSA 2WGVA 1Q2QA 1L0FA 3BLSA 1CEFA 1NJ4A 3CMZA 3HLBA 5HAPA 1CK3A 4EBLA 5E2HA 3FV7A 2Y4AA 5F82A 5A90A 2XD5A 3WS4A 2QPNA 3IT9A 4K91A 3P98A 4D2OA 4DE0A 1G6AA 3W8KA 3ZG7B 3EQVA 1W5DA 2ZLYA 4KZ8A 1MPLA 2EXAA 3FYZA 5GHXA 1YMSA 3UE1A 2ZQ9A 1LI0A 4R3JA 3A3EA 4OPRA 1MXOA 4GOGA 2XDMA 4XUXA 3IWOA 3VP3A 2X01A 3BFGA 1WE4A 3IXGA 2P74A 4GKUA 1OMEA 3HVFA 1H8ZA 3GRJA 2XFSA 1M40A 3I7JA 1TDLA 2Y2PA 1XXMA 2Y91A 2VGJA 2Z2LB 3DWKA 3HLWA 3IWQA 3P09A 5EPHA 5FAPA 4OLGA 4PPRA 3LY4A 5DTKA 1XKZA 1RCJA 4QHCA 3HREA 1YT4A 1KGEA 1L0EA 1RP5A 4KQQA 2WZXA 4R4RA 1YQSA 4KZBA 3N8RA 2PU2A 3HBRA 1W8QA 1K56A 4MBKA 1ZG4A 1PI4A 2ZQDA 4MEZA 1KDWA 2DRWA 4E3IA 1MWRA 5CECA 3IF6C 1L0DA 3G31A 4B88A 2OV5A 5A93A 4OP5A 5U47A 4EQIA 3ZHHA 4LV3A 2R9XA 1DJAA 1PI5A 3IQAA 5FA7A 1EI5A 3UO9A 1FSWA 1ES4A 4LCMA 1L2SA 3SH7A 1QMFA 4OOYA 4JBFA 1TVFA 1O7EA 3VMAA 3ZCZA 5JYOA 3VFFA 4UAAA 1ONHA 1KE0A 2DNSA 3G30A 5EUAA 1SCWA 2QMIA 4P87A 4OPZA 1YLTA 1JWVA 3DTMA 4P85A 4BL3A 4QU3A 1W7FA 4WBGA 2Y2KA 2XEPA 3UE0A 3RXWA 4X56A 4K0WA 5CGWA 1TDGA 3TG9A 1XX2A 5M1AA 1ZC2A 5CERA 5EOEA 3ZVTA 3OC2A 4MNRA 5FDHA 4IVKA 4S2PA 5G18A 3ZNTA 4X68A 4LV2A 5FI6A 4GD6A 3GVBA 1HD8A 4QJGA 3OPPA 4RVAA 2Y2LA 3DWZA 2Q9MA 3MZEA 1NYYA 3O86A 4Y0UA 3NDGA 3A3DA 4JKTA 1PZOA 1KE3A 4DKIA 1RGYA 1SDNA 1ALQA 5CGXA 1CEGA 3HLGA 4KZ5A 5AQ7A 4BL2A 4EBPA 2EX8A 2Y2OA 2ZQ7A 4RX2A 3ZGAB 1BLPA 3Q82A 4JXSA 5HARA 1EROA 1HTZA 1RGZA 2OLUA 4QY5A 3SOIA 3M2JA 3V50A 4DDYA 3PBOA 3C4PA 4BJPA 4E6WA 2ZQAA 3HUNA 4LCLA 1KVLA 2HDSA 2BLSA 1FCNA 2ZM8A 3IWIA 4KZ4A 1LHYA 2P9VA 1W79A 2Y55A 4BENA 1BLHA 1SDEA 3C7VA 3OPRA 1I2SA 5KSHA 2FFFB 4LV1A 3RJUA 5EVIA 3LO7A 4E3JA 3HLFA 3N7WA 2HDRA 1K55A 4YINA 4PM8A 5AQAA 1IYPA 3GQZA 2Q9NA 3NCKA 4K0XA 1C3BA 2G2WA 1ZKJA 4C6YA 5GLBA 1S6RA 5AQBA 4ZAMA 2EX6A 3NI9A 3ZG8B 3Q81A 3BFDA 1XPBA 4DE2A 3JYIA 2XD1A 5EOOA 4NK3A 3GMWA 3MXRA 4OQ0A 2EX9A 4B4ZA 1K54C 5FQJA 2GDNA 3ZG5A 3IH8A 1LL5A 2QZ6A 4WYYA 2HPBA 3UNWA 5GL9A 3Q7ZA 2XH9A 1SHVA 4WELA 1NZOA 5KZHA 4RA7A 3E2LA 2ZMAA 4ZDXA 5TR7A 5CTMA 4ID4A 3WRTA 4KZ7A 1Y54A 4GDNA 1ES3A 2WAFA 3TSGA 1JWZA 4S2NC 3VP1A 5HAIA 3M6BA 2ZM2A 5A92A 2EFUA 4PM9A 3ZDJA 3QNCA 1JTDA 4U3TA 2WKIA 4S2OA 3MBZA 4WZ5A 4HBUA 5I94A 1YLWA 4E3MA 2EX2A 4S2MA 3G4PA 3PBSA 1E3UD 1MWUA 1FR1A 1J9MA 3S4XA 1ESIA 4KZ6A 3SS4A 1S0WA 4GNUA 3UDIA 1DJCA 4X69A 4BLMA 4X55A 3AGDA 3IXBA 2XLNA 3ZFZA 3BFCA 1AXBA 2WADA 4BD1A 3BLMA 4JPMA 4PM5A 1ERQA 4N92A 1HVBA 2J7VA 3LCEA 3E2KA 4OKPA 4R4SA 5E2FA 2G2UA 4RYEA 1XA1A 3QNBA 4IBXA 2ZJ9A 1GA0A 3CZDA 1PWCA 2P9VB 3N8SA 4KG5A 4R0QA 3HL9A 1FCMA 3ZG9B 1GHMA 2WK0A 3LEZA 5GLDA 3VSKA 2C6WB 4WMCD 3SH9A 4WEKA 3G32A 2CC1A 4MBFA 3HLEA 5EVIB 3W4OA 5FASA 5F83A 1MBLA 1YLPA 3G2ZA 3N8LA 2I72A 2Y2JA 4S2LA 1HZOA 4QD4A 3IF5A 1PYYA 3PBNA 3HLCA 3QHYA 5DF8A 4B4XA 3ZNYA 1K57C 4GZBA 3IHBA 2BG1A 3V3SA 3M6HA 2J9PA 1NYMA 2EFXA 5A91A 5F1GA 2UWXA 2X02A 2Y2MA 2IWBA 3RXXA 2PBYA 3TOIA 1KGFA 3V5MA 1H8YA 4R3BA 1GHPA 5TGFA 2J8YA 2WGWA 2A3UA 1JWPA 2Y2QA 3G34A 4KG6A 4QY6A 3ZG0A 5CEBA 5CHMA 1PW8A 5BOHA 4E3KA 5DF7A 4RX3A 3CJMA 4ZTKA 4OONA 2EXBA 5HX9A 2WKHA 1N9BA 2JE5A 4OQGA 4WEJA 1K4EA 4HEFA 3BM6A 3A3JA 1LI9A 3FKVA 4KQOA 2WUQA 1U60A 4PMAA 5GHZA 3SH8A 1XGJA 4KZ3A 2HP6A 3OZHA 4KQRA 3FWLA 4OOLA 1WYCA 1XGIA 2JCHA 3WS5A 3MXSA 3WS2A 1MWSA 4E6XA 2XFTA 1IEMA 1NXYA 3C4OA 2Y2IA 3MZFA 1JTGA 1BZAA 3MFDA 4N1XA 2R9WA 1IYOA 1KE4A 3IF6A 3Q1FA 1YM1A 2VGKA 4FH2A 4KENB 4R1GA 1PW1A 3VOYA 4IVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTC A;  3W4Q A;  1ONG A;  4E3N A;  2ZC5 B;  2XGN A;  3IH9 A;  4E3L A;  4U0X A;  1M6K A;  4XXR A;  3UPO A;  5FAT A;  3V3R A;  3NY4 A;  4GB7 A;  5FQQ A;  5JYP A;  2JC7 A;  4KG2 A;  2HP9 A;  3WS1 A;  4KZA A;  5FI7 A;  4UA6 A;  4OH0 A;  1G68 A;  2RL3 A;  4FH4 A;  3Q7V A;  1K56 D;  3ITA A;  1IYQ A;  5TFQ A;  3UPP A;  1EWZ A;  5E2E A;  1XA7 A;  5CHJ A;  3PBR A;  4GN2 A;  5HW3 A;  1I2W A;  2HDU A;  1MY8 A;  4DDS A;  3BRM A;  1BTL A;  2X71 A;  3HUM A;  2WAE A;  4XUZ A;  1FSY A;  2XK1 A;  3GR2 A;  1ERM A;  3MZD A;  4LV0 A;  4QB8 A;  4OPY A;  5CTN A;  3UDF A;  5FSR A;  5EVL A;  4DRT A;  4E3O A;  1ES5 A;  3BFE A;  3NDE A;  3UE3 A;  3ZVW A;  3VP4 A;  2Z2M B;  2WGW B;  2ZQ8 A;  1KVM A;  3MKF A;  3S1Y A;  3VP2 A;  1JVJ A;  3N6I A;  5DF9 A;  3O87 A;  1TEM A;  4S2K A;  4BD0 A;  5CXW A;  2Y59 A;  4Y0T A;  5CHU A;  1N4O A;  4R23 A;  3CG5 A;  1BUE A;  3UPN A;  4Y0O A;  2Y2G A;  1W8Y A;  1ESU A;  2XR0 A;  1K38 A;  4WZ4 A;  4ZJ3 A;  3V39 A;  1DY6 A;  4MLL A;  2V20 A;  1IEL A;  5GLC A;  1YLY A;  3OCN A;  5D3O A;  1BSG A;  5FAQ A;  3WRZ A;  1CI9 A;  1K25 A;  4ZJ2 A;  1IKI A;  3NBL A;  2OLV A;  5DTS A;  1PWG A;  2PU4 A;  2WKE A;  4ZJ1 A;  2RCX A;  3IF6 B;  4UA9 A;  4BQM A;  3BYD A;  1VQQ A;  1YLJ A;  5IHV A;  1KDS A;  4S2I A;  4F94 A;  5CRF A;  1PZP A;  2H10 A;  2H5S A;  4UA7 A;  5F1F A;  3UY6 A;  1NY0 A;  5HAQ A;  2ZC6 B;  5KMW A;  3OPL A;  4N9L A;  3PBQ A;  1K54 A;  2V1Z A;  1MKI A;  4O7D A;  3W4P A;  1QME A;  5M18 A;  1ZG6 A;  3OPH A;  5E43 A;  4DE1 A;  4HBT A;  2V2F F;  4OQH A;  3WWX A;  4LEN A;  3GSG A;  1I5Q A;  3Q7V B;  4OLD A;  1FQG A;  3A3F A;  1LL9 A;  4GDB A;  4EWF A;  3BFF A;  3DW0 A;  3ITB A;  1K6R A;  4OQI A;  5FAO A;  4OOM A;  2DCF A;  2JBF A;  5EVI D;  4S2N A;  1SKF A;  2ZD8 A;  1YLZ A;  3UN7 A;  4JXV A;  5KSC A;  2XF3 A;  4OP8 A;  5DVA A;  1FR6 A;  4N1H A;  2FFY A;  5FQK A;  1VM1 A;  3VOZ A;  4X6T A;  1BUL A;  2WZZ A;  5L2F A;  2Y2H A;  2HDQ A;  3NC8 A;  3OCL A;  4P0M A;  1PIO A;  3Q07 A;  3N4I A;  2Y2N A;  5EVI C;  1IKG A;  1K55 C;  4YFM A;  1L0G A;  1H5X A;  2ZM0 A;  3B3X A;  1GHI A;  2H0Y A;  3MKE A;  3IXD A;  1K4F A;  4P6B A;  1CI8 A;  5AQ9 A;  3O88 A;  4N9K A;  3VFH A;  4DXC A;  4JXW A;  4Z9Q A;  3G35 A;  5FI2 A;  2C5W B;  3PAG A;  1NZU A;  5CED A;  3M2K A;  1E3U A;  1FCO A;  3G2Y A;  5FQI A;  3S22 A;  3HUO A;  1BLS A;  1E25 A;  3PAE A;  4GD8 A;  1PWD A;  4Q8I A;  1WYB A;  4DF6 A;  1GCE A;  2HP5 A;  5E2G A;  2E8I A;  2ZQC A;  4OVD A;  1K6S A;  4JLF A;  3VP0 A;  2ZC3 B;  3C7U A;  4CPK A;  4NET A;  4PM7 A;  1Z6F A;  5FQ9 A;  3FKW A;  1XP4 A;  2ZC4 B;  4CJN A;  3GV9 A;  4A5R A;  3VSL A;  4M3K A;  5GHY A;  4HES A;  1BT5 A;  1NRF A;  3BEC A;  2B5R A;  2H0T A;  3ISG A;  4KZ9 A;  5GLA A;  1BLC A;  4EV4 A;  3FZC A;  1ES2 A;  1MWT A;  3O3V A;  1K57 A;  1YMX A;  3D4F A;  3AGE A;  4WMC A;  2ZC7 A;  4WZ5 C;  4MBH A;  4JF6 A;  3IXH A;  1KGG A;  4EUZ A;  3BEB A;  4IBR A;  2J9O A;  5EEC A;  1O07 A;  3PBT A;  4X53 A;  1LLB A;  5DTT A;  4EBN A;  3UDX A;  4U0T A;  2WGI A;  5M19 A;  4ZBE A;  3IHA A;  3HLD A;  5FQM A;  3SS5 A;  5HL1 A;  3SS3 A;  4OPQ A;  4C3Q A;  3EQU A;  3PTE A;  4FD8 A;  3AGF A;  4JF4 A;  4FCF A;  5HFO A;  1E4D A;  1Q2P A;  2IWC A;  4UHU A;  5EE8 A;  4C75 A;  4DE3 A;  1DJB A;  3WS0 A;  4DXB A;  3NIA A;  2XQZ A;  2OSU A;  4S2J A;  3LY3 A;  1IYS A;  4IED A;  3C5A A;  2WYX A;  4PM6 A;  2IWD A;  1FOF A;  4FSF A;  2A49 A;  5J8X A;  4Y7P A;  1GA9 A;  4H8R A;  4JF5 A;  4L0L A;  4WM9 A;  3A3I A;  4JXG A;  5CGS A;  2WGV A;  1Q2Q A;  1L0F A;  3BLS A;  1CEF A;  1NJ4 A;  3CMZ A;  3HLB A;  5HAP A;  1CK3 A;  4EBL A;  5E2H A;  3FV7 A;  2Y4A A;  5F82 A;  5A90 A;  2XD5 A;  3WS4 A;  2QPN A;  3IT9 A;  4K91 A;  3P98 A;  4D2O A;  4DE0 A;  1G6A A;  3W8K A;  3ZG7 B;  3EQV A;  1W5D A;  2ZLY A;  4KZ8 A;  1MPL A;  2EXA A;  3FYZ A;  5GHX A;  1YMS A;  3UE1 A;  2ZQ9 A;  1LI0 A;  4R3J A;  3A3E A;  4OPR A;  1MXO A;  4GOG A;  2XDM A;  4XUX A;  3IWO A;  3VP3 A;  2X01 A;  3BFG A;  1WE4 A;  3IXG A;  2P74 A;  4GKU A;  1OME A;  3HVF A;  1H8Z A;  3GRJ A;  2XFS A;  1M40 A;  3I7J A;  1TDL A;  2Y2P A;  1XXM A;  2Y91 A;  2VGJ A;  2Z2L B;  3DWK A;  3HLW A;  3IWQ A;  3P09 A;  5EPH A;  5FAP A;  4OLG A;  4PPR A;  3LY4 A;  5DTK A;  1XKZ A;  1RCJ A;  4QHC A;  3HRE A;  1YT4 A;  1KGE A;  1L0E A;  1RP5 A;  4KQQ A;  2WZX A;  4R4R A;  1YQS A;  4KZB A;  3N8R A;  2PU2 A;  3HBR A;  1W8Q A;  1K56 A;  4MBK A;  1ZG4 A;  1PI4 A;  2ZQD A;  4MEZ A;  1KDW A;  2DRW A;  4E3I A;  1MWR A;  5CEC A;  3IF6 C;  1L0D A;  3G31 A;  4B88 A;  2OV5 A;  5A93 A;  4OP5 A;  5U47 A;  4EQI A;  3ZHH A;  4LV3 A;  2R9X A;  1DJA A;  1PI5 A;  3IQA A;  5FA7 A;  1EI5 A;  3UO9 A;  1FSW A;  1ES4 A;  4LCM A;  1L2S A;  3SH7 A;  1QMF A;  4OOY A;  4JBF A;  1TVF A;  1O7E A;  3VMA A;  3ZCZ A;  5JYO A;  3VFF A;  4UAA A;  1ONH A;  1KE0 A;  2DNS A;  3G30 A;  5EUA A;  1SCW A;  2QMI A;  4P87 A;  4OPZ A;  1YLT A;  1JWV A;  3DTM A;  4P85 A;  4BL3 A;  4QU3 A;  1W7F A;  4WBG A;  2Y2K A;  2XEP A;  3UE0 A;  3RXW A;  4X56 A;  4K0W A;  5CGW A;  1TDG A;  3TG9 A;  1XX2 A;  5M1A A;  1ZC2 A;  5CER A;  5EOE A;  3ZVT A;  3OC2 A;  4MNR A;  5FDH A;  4IVK A;  4S2P A;  5G18 A;  3ZNT A;  4X68 A;  4LV2 A;  5FI6 A;  4GD6 A;  3GVB A;  1HD8 A;  4QJG A;  3OPP A;  4RVA A;  2Y2L A;  3DWZ A;  2Q9M A;  3MZE A;  1NYY A;  3O86 A;  4Y0U A;  3NDG A;  3A3D A;  4JKT A;  1PZO A;  1KE3 A;  4DKI A;  1RGY A;  1SDN A;  1ALQ A;  5CGX A;  1CEG A;  3HLG A;  4KZ5 A;  5AQ7 A;  4BL2 A;  4EBP A;  2EX8 A;  2Y2O A;  2ZQ7 A;  4RX2 A;  3ZGA B;  1BLP A;  3Q82 A;  4JXS A;  5HAR A;  1ERO A;  1HTZ A;  1RGZ A;  2OLU A;  4QY5 A;  3SOI A;  3M2J A;  3V50 A;  4DDY A;  3PBO A;  3C4P A;  4BJP A;  4E6W A;  2ZQA A;  3HUN A;  4LCL A;  1KVL A;  2HDS A;  2BLS A;  1FCN A;  2ZM8 A;  3IWI A;  4KZ4 A;  1LHY A;  2P9V A;  1W79 A;  2Y55 A;  4BEN A;  1BLH A;  1SDE A;  3C7V A;  3OPR A;  1I2S A;  5KSH A;  2FFF B;  4LV1 A;  3RJU A;  5EVI A;  3LO7 A;  4E3J A;  3HLF A;  3N7W A;  2HDR A;  1K55 A;  4YIN A;  4PM8 A;  5AQA A;  1IYP A;  3GQZ A;  2Q9N A;  3NCK A;  4K0X A;  1C3B A;  2G2W A;  1ZKJ A;  4C6Y A;  5GLB A;  1S6R A;  5AQB A;  4ZAM A;  2EX6 A;  3NI9 A;  3ZG8 B;  3Q81 A;  3BFD A;  1XPB A;  4DE2 A;  3JYI A;  2XD1 A;  5EOO A;  4NK3 A;  3GMW A;  3MXR A;  4OQ0 A;  2EX9 A;  4B4Z A;  1K54 C;  5FQJ A;  2GDN A;  3ZG5 A;  3IH8 A;  1LL5 A;  2QZ6 A;  4WYY A;  2HPB A;  3UNW A;  5GL9 A;  3Q7Z A;  2XH9 A;  1SHV A;  4WEL A;  1NZO A;  5KZH A;  4RA7 A;  3E2L A;  2ZMA A;  4ZDX A;  5TR7 A;  5CTM A;  4ID4 A;  3WRT A;  4KZ7 A;  1Y54 A;  4GDN A;  1ES3 A;  2WAF A;  3TSG A;  1JWZ A;  4S2N C;  3VP1 A;  5HAI A;  3M6B A;  2ZM2 A;  5A92 A;  2EFU A;  4PM9 A;  3ZDJ A;  3QNC A;  1JTD A;  4U3T A;  2WKI A;  4S2O A;  3MBZ A;  4WZ5 A;  4HBU A;  5I94 A;  1YLW A;  4E3M A;  2EX2 A;  4S2M A;  3G4P A;  3PBS A;  1E3U D;  1MWU A;  1FR1 A;  1J9M A;  3S4X A;  1ESI A;  4KZ6 A;  3SS4 A;  1S0W A;  4GNU A;  3UDI A;  1DJC A;  4X69 A;  4BLM A;  4X55 A;  3AGD A;  3IXB A;  2XLN A;  3ZFZ A;  3BFC A;  1AXB A;  2WAD A;  4BD1 A;  3BLM A;  4JPM A;  4PM5 A;  1ERQ A;  4N92 A;  1HVB A;  2J7V A;  3LCE A;  3E2K A;  4OKP A;  4R4S A;  5E2F A;  2G2U A;  4RYE A;  1XA1 A;  3QNB A;  4IBX A;  2ZJ9 A;  1GA0 A;  3CZD A;  1PWC A;  2P9V B;  3N8S A;  4KG5 A;  4R0Q A;  3HL9 A;  1FCM A;  3ZG9 B;  1GHM A;  2WK0 A;  3LEZ A;  5GLD A;  3VSK A;  2C6W B;  4WMC D;  3SH9 A;  4WEK A;  3G32 A;  2CC1 A;  4MBF A;  3HLE A;  5EVI B;  3W4O A;  5FAS A;  5F83 A;  1MBL A;  1YLP A;  3G2Z A;  3N8L A;  2I72 A;  2Y2J A;  4S2L A;  1HZO A;  4QD4 A;  3IF5 A;  1PYY A;  3PBN A;  3HLC A;  3QHY A;  5DF8 A;  4B4X A;  3ZNY A;  1K57 C;  4GZB A;  3IHB A;  2BG1 A;  3V3S A;  3M6H A;  2J9P A;  1NYM A;  2EFX A;  5A91 A;  5F1G A;  2UWX A;  2X02 A;  2Y2M A;  2IWB A;  3RXX A;  2PBY A;  3TOI A;  1KGF A;  3V5M A;  1H8Y A;  4R3B A;  1GHP A;  5TGF A;  2J8Y A;  2WGW A;  2A3U A;  1JWP A;  2Y2Q A;  3G34 A;  4KG6 A;  4QY6 A;  3ZG0 A;  5CEB A;  5CHM A;  1PW8 A;  5BOH A;  4E3K A;  5DF7 A;  4RX3 A;  3CJM A;  4ZTK A;  4OON A;  2EXB A;  5HX9 A;  2WKH A;  1N9B A;  2JE5 A;  4OQG A;  4WEJ A;  1K4E A;  4HEF A;  3BM6 A;  3A3J A;  1LI9 A;  3FKV A;  4KQO A;  2WUQ A;  1U60 A;  4PMA A;  5GHZ A;  3SH8 A;  1XGJ A;  4KZ3 A;  2HP6 A;  3OZH A;  4KQR A;  3FWL A;  4OOL A;  1WYC A;  1XGI A;  2JCH A;  3WS5 A;  3MXS A;  3WS2 A;  1MWS A;  4E6X A;  2XFT A;  1IEM A;  1NXY A;  3C4O A;  2Y2I A;  3MZF A;  1JTG A;  1BZA A;  3MFD A;  4N1X A;  2R9W A;  1IYO A;  1KE4 A;  3IF6 A;  3Q1F A;  1YM1 A;  2VGK A;  4FH2 A;  4KEN B;  4R1G A;  1PW1 A;  3VOY A;  4IVI A; 
#chains in the Genus database with same CATH topology
 1ONG A;  2EA9 A;  2ZC5 B;  5HD5 A;  4U0X A;  3UPO A;  3NY4 A;  4EET B;  3C30 A;  2ZL1 A;  2HP9 A;  3WS1 A;  4OH0 A;  4CLC B;  2A24 A;  4FH4 A;  1K56 D;  3C2W A;  5E2E A;  2HV1 A;  4GN2 A;  5HW3 A;  2ZOI A;  1FSY A;  3CLO A;  4E3O A;  1ES5 A;  1XJ4 A;  4H6J A;  1JVJ A;  3N6I A;  3LR0 A;  4S2K A;  2O0Y A;  1LL8 A;  1X0O A;  1OTA A;  5CHU A;  1N4O A;  3UPN A;  4O8G A;  1K38 A;  4ZJ3 A;  4ARZ A;  2V20 A;  1GSV A;  5D3O A;  2L4R A;  1K25 A;  2OAP 1;  5DFX A;  3ZQ5 A;  4BQM A;  4HP4 A;  2O9C A;  2J3W A;  3H7W B;  1T1A A;  4IUK A;  1LSV A;  1KDS A;  1YKD A;  4EXO A;  5CRF A;  3HCY A;  5DJT A;  4HQA A;  5DJU A;  5HAQ A;  4L9G A;  5KMW A;  4JGQ A;  3PBQ A;  1MKI A;  4CLC A;  1ACF A;  4O7D A;  3W4P A;  2WKP A;  4LEN A;  1LL9 A;  4EWF A;  4QPR A;  2W3E A;  3DW0 A;  2B95 A;  5DFY A;  1MZU A;  2HGV A;  5KSC A;  2XF3 A;  2FFY A;  1VM1 A;  3NC8 A;  4YFM A;  5AQ9 A;  3IXD A;  1K4F A;  5FEG A;  3PXP A;  4JXW A;  3K3D A;  3PAG A;  3M2K A;  1E3U A;  1FCO A;  3G2Y A;  3BQA A;  4DN0 A;  3LIB A;  1BLS A;  3PAE A;  4GD8 A;  1PWD A;  3EOI A;  1WYB A;  5G4Z A;  1K6S A;  1XJ3 A;  4CPK A;  4JGP A;  3A0V A;  4CJN A;  3VSL A;  3KSH A;  5GHY A;  1BT5 A;  3BEC A;  2B5R A;  1BLC A;  1F98 A;  3D4F A;  4D60 A;  2ZC7 A;  2XRO A;  4IBR A;  3S7O A;  3PBT A;  4I38 A;  2WGI A;  4HH2 A;  3MR0 A;  3HLD A;  3JVV A;  2NUP C;  5EM0 A;  1DJB A;  2OWJ A;  3NIA A;  2OSU A;  5LBR A;  3UB9 A;  4MN6 A;  2WYX A;  2IWD A;  3KYZ A;  5J8X A;  4H8R A;  4L0L A;  4WM9 A;  4PKY G;  2QJ7 A;  3LEQ A;  4IJG A;  4JXG A;  4KUO A;  1CK3 A;  3IX8 A;  3FV7 A;  4DJ3 A;  5F82 A;  5A90 A;  3WS4 A;  5J4E A;  4DE0 A;  1G6A A;  3DTK A;  3EQV A;  4NKP A;  1W5D A;  2ZLY A;  4LRY C;  4NXF A;  1MXO A;  4GOG A;  2XDM A;  3E4O A;  1OME A;  2VX8 A;  3GRJ A;  3V39 A;  3P09 A;  3HLW A;  3IWQ A;  4HHD A;  4OLG A;  2JHE A;  4QHC A;  3HRE A;  4KQQ A;  3VV4 A;  1RP5 A;  3N8R A;  1K56 A;  4MBK A;  4MEZ A;  1TS0 A;  4E3I A;  1MWR A;  3IF6 C;  1YAX A;  2MJ6 A;  5FA7 A;  3OOV A;  3T50 A;  3SH7 A;  3ZCZ A;  2A2L A;  4HJ6 A;  1T1B A;  1KE0 A;  3G30 A;  2QJ5 A;  1YLT A;  4Y17 A;  3UE0 A;  4QWO A;  4Y13 A;  2XEP A;  4CQH A;  3VE3 A;  5L07 A;  5CGW A;  3T4L A;  4R38 A;  5HL6 A;  4UQI S;  4JGR A;  3ZVT A;  3IBR A;  4S2P A;  5G18 A;  4X68 A;  4LV2 A;  2LB9 A;  3GVB A;  3B33 A;  4QJG A;  1PFL A;  2Y2L A;  2W27 A;  4Y0U A;  5F5Y A;  4KQD A;  4JKT A;  4ETZ A;  4F3L A;  4DKI A;  1RGY A;  1SDN A;  4KZ5 A;  2ZMV A;  2Y2O A;  4Y3I A;  4I3J A;  1ERO A;  1RGZ A;  3V50 A;  4DDY A;  5CX7 A;  3PBO A;  1NRJ A;  2P9V A;  4BEN A;  1W63 Q;  3C7V A;  3OPR A;  5KSH A;  3UB8 A;  4I5S A;  4PM8 A;  5AQA A;  1C3B A;  4ZAM A;  2EX6 A;  3ZG8 B;  3BFD A;  1XPB A;  3JYI A;  4X1M A;  3GMW A;  4OQ0 A;  4B4Z A;  1K54 C;  3LIC A;  4LFU A;  3Q7Z A;  4X1L A;  4WEL A;  5KZH A;  4RA7 A;  3K2N A;  4ZDX A;  1P0Z A;  5AJG A;  4KZ7 A;  4GDN A;  2HF6 A;  2J3T C;  3PR6 A;  3T1X A;  3QNC A;  1JTD A;  4B9O A;  1FR1 A;  4KZ6 A;  3SS4 A;  3OBF A;  3CI6 A;  1OT9 A;  3ZFZ A;  2JKF A;  4BD1 A;  1IOU A;  2J7V A;  1FIL A;  3E2K A;  5E2F A;  5IS1 A;  2ZJ9 A;  2PT7 A;  4KG5 A;  1GHM A;  3VSK A;  3W4O A;  3HLE A;  3MXQ A;  2VV6 A;  2Y2J A;  4QD4 A;  1PYY A;  5DF8 A;  4GZB A;  3IHB A;  1S1Y A;  3M6H A;  5HPF A;  3MQO A;  2X02 A;  2Y2M A;  1H0M A;  4PAU A;  2J8Y A;  2Y2Q A;  3ZG0 A;  1JWP A;  3G34 A;  5CHM A;  4E3K A;  1VEU B;  3DAV A;  4ZTK A;  4OON A;  2Z6C A;  1N9B A;  1S67 L;  4HEF A;  1K0K A;  4IUH A;  3FKV A;  4KQO A;  1XJ6 A;  4PMA A;  3SH8 A;  3OZH A;  3FWL A;  1XJ2 A;  4E6X A;  5EVE A;  3PYP A;  3MZF A;  1JTG A;  2R9W A;  3IF6 A;  4PHT A;  1YM1 A;  1PW1 A;  3VOY A;  1D7E A;  3G6O A;  3T1Q B;  3V3R A;  5HDS A;  4Q0H A;  5FI7 A;  4GW9 A;  1SZV A;  5HWV A;  4I39 A;  1IYQ A;  1XA7 A;  1YSP A;  3PBR A;  3RFB A;  1OTE A;  1BTL A;  1BYW A;  1VET A;  4XUZ A;  3GR2 A;  4BBU A;  1ERM A;  4LV0 A;  5AVE A;  4DRT A;  4OPY A;  1T1C A;  5CTN A;  3EWK A;  4L9E A;  3BFE A;  1OTD A;  3NDE A;  3VP4 A;  2Z2M B;  3BW6 A;  3S1Y A;  5DF9 A;  4BWI A;  3QP1 A;  4Y0T A;  3CG5 A;  1BUE A;  2V0U A;  4Y0O A;  2OAQ 1;  2Y2G A;  1W8Y A;  2K31 A;  1ESU A;  2Z6D A;  5GLC A;  1CI9 A;  3A0R A;  1IKI A;  3NBL A;  2OLV A;  2PU4 A;  3LIE A;  4ZJ1 A;  1VQQ A;  3OLO A;  1YLJ A;  4F94 A;  2M7U A;  3TJZ C;  2H5S A;  4LRX C;  1OTI A;  4NXB A;  4N9L A;  2UV0 E;  1K54 A;  2V0W A;  2R78 A;  3OPH A;  5E43 A;  2V2F F;  2A24 B;  3WWX A;  4OLD A;  1FQG A;  3A3F A;  2JKT I;  4GDB A;  3ITB A;  4OOM A;  2DCF A;  1SKF A;  2ZD8 A;  4LRZ E;  3UN7 A;  3DTE A;  5DVA A;  4N1H A;  4X6T A;  5L2F A;  3OCL A;  3NOT C;  1PIO A;  1L0G A;  1H5X A;  3B3X A;  2H0Y A;  3MKE A;  4P6B A;  4DXC A;  4Z9Q A;  1NZU A;  5L8M A;  3S22 A;  3HUO A;  4ARZ B;  1E25 A;  2PD7 A;  3S7P A;  5E2G A;  3E0Y A;  2E8I A;  2ZQC A;  4OVD A;  4JLF A;  3KYQ A;  1Z6F A;  3H82 B;  2V8F A;  1Y28 A;  2H0T A;  3ISG A;  4EV4 A;  1MWT A;  3O3V A;  1YMX A;  3AGE A;  2O99 A;  4WZ5 C;  4MBH A;  3IXH A;  4HP9 A;  4WN5 A;  4YWZ A;  4EUZ A;  5EEC A;  1LLB A;  1G28 A;  4HI4 A;  1ODV A;  5HL1 A;  3SS3 A;  4OPQ A;  4C3Q A;  1TS8 A;  4FD8 A;  3CPT A;  3H9W A;  4UHU A;  3U2A A;  2JKR I;  3LY3 A;  1IYS A;  3MJQ A;  1AWI A;  1S4S A;  4PM6 A;  4X25 A;  1F9I A;  1FOF A;  2A49 A;  4FSF A;  3A3I A;  4M4X A;  5HAP A;  3HLB A;  4EBL A;  2I9V A;  1PRQ A;  2XD5 A;  3IT9 A;  3ZG7 B;  5AVF A;  3S7N A;  2XA7 S;  3FYZ A;  3H82 A;  2ZQ9 A;  1LI0 A;  1S4R A;  2PBD P;  4OPR A;  4EEP A;  3VP3 A;  1WE4 A;  3BY9 A;  3IXG A;  2P74 A;  1NWZ A;  2D02 A;  4YNR A;  1HLU P;  1JNU A;  2VGJ A;  3CIT A;  5FAP A;  4Q0I A;  4PPR A;  1YT4 A;  1KGE A;  1L0E A;  4R4R A;  2WZX A;  4KZB A;  3VE4 A;  2PU2 A;  3HBR A;  4WL9 A;  1ZG4 A;  1PI4 A;  5HWW A;  5CEC A;  1STZ A;  3UB7 A;  4OP5 A;  5U47 A;  1DJA A;  5HSQ A;  1EI5 A;  4GCZ A;  3F1O A;  3UO9 A;  1Z09 A;  2VLG A;  3RH8 B;  1L2S A;  4OOY A;  3VFF A;  4UAA A;  2DNS A;  4HH3 A;  3PHY A;  1W7F A;  4X56 A;  1TDG A;  4II7 A;  1Y4O A;  4ZRR A;  5CER A;  5DKK A;  5EOE A;  3OC2 A;  4MNR A;  3OPP A;  3LGO A;  4PKY A;  3TE8 A;  3O86 A;  3T12 B;  3NDG A;  1KE3 A;  5CGX A;  3HLG A;  1OJG A;  4I3I A;  4LLO B;  1BLP A;  3QP5 A;  2XRN A;  1XFN A;  3SOI A;  2OLU A;  3M2J A;  2PYP A;  3C4P A;  4LCL A;  1CF0 A;  1CJF A;  3C38 A;  3F1P B;  4KZ4 A;  1BLH A;  1SDE A;  1I2S A;  2GX5 A;  3QP6 A;  4WLA A;  3GEC A;  3HLF A;  1IYP A;  1P9W A;  2Q9N A;  2VGL S;  2L0W A;  4HY8 A;  2XA7 M;  4NK3 A;  1LSX A;  2W0N A;  2W3H A;  2GDN A;  3IH8 A;  5GL9 A;  2XH9 A;  1SHV A;  3LYX A;  2ZMA A;  5CTM A;  1ES3 A;  2VA0 A;  1JWZ A;  2ZM2 A;  4WUJ A;  3ZDJ A;  3S7Q A;  2QWS A;  4F3L B;  4S2O A;  5FDS A;  2EWW A;  3FC7 A;  4HBU A;  4WZ5 A;  4EER A;  5I94 A;  3PBS A;  1ESI A;  3BJN A;  3T4O A;  1V9Z A;  1NLZ A;  3SW1 A;  3KSF A;  1ZTU A;  4BLM A;  4X55 A;  1FIK A;  2V8C A;  4JPM A;  3ZYT A;  3F1P A;  4N92 A;  3FG8 A;  1S1Z A;  3LCE A;  1DP8 A;  2G2U A;  3IX4 A;  3QNB A;  2P9V B;  3N8S A;  3LEZ A;  4WEK A;  4MBF A;  3N8L A;  1LSW A;  5L10 A;  2PDR A;  2W1T A;  3IF5 A;  3HLC A;  3KSI A;  4B4X A;  3ZNY A;  2J9P A;  1NYM A;  3KO6 A;  2UWX A;  3IX3 A;  2PBY A;  3TOI A;  1KGF A;  5TGF A;  2PHY A;  1DRM A;  2WGW A;  4KG6 A;  4QY6 A;  2Y8H A;  5DF7 A;  1GSX A;  4RX3 A;  3CJM A;  2EXB A;  2WKH A;  4OQG A;  3VOL A;  4G3K A;  2VKS A;  5GHZ A;  1U60 A;  4YOF A;  1LT0 A;  4FTX A;  1J3W A;  3WS5 A;  3JVU A;  4NEE D;  3P01 A;  2XFT A;  1N9N A;  2VGL M;  2Y79 A;  4N1X A;  1OTB A;  4FH2 A;  4R1G A;  4IVI A;  3GTC A;  4E3N A;  2XGN A;  3IH9 A;  4E3L A;  4DJ2 A;  4Y2F A;  4I3A A;  5FAT A;  3UME A;  4KG2 A;  4KZA A;  4UA6 A;  1DP6 A;  3EGX C;  1D06 A;  2RL3 A;  4DMZ A;  3Q7V A;  3ITA A;  4GS9 A;  5TFQ A;  1EWZ A;  5CHJ A;  3NOU C;  4O0P A;  1MY8 A;  4DDS A;  3BRM A;  2X71 A;  2WAE A;  1A0K A;  2QKP A;  4KUK A;  4QB8 A;  3UDF A;  5FSR A;  1OJ5 A;  4CLC E;  1TS7 A;  3UE3 A;  3ZVW A;  2ZQ8 A;  3L9K A;  1KVM A;  3MKF A;  3VP2 A;  3KYE A;  4R70 A;  5HD3 A;  1G5U A;  2XR0 A;  2JN7 A;  1DY6 A;  1IEL A;  2E8J A;  3OCN A;  1BSG A;  3WRZ A;  4ZJ2 A;  5DTS A;  1PWG A;  4GLQ A;  2WKE A;  2RCX A;  3IF6 B;  4UA9 A;  3BYD A;  1F2K A;  3L7H A;  1PZP A;  2JKT M;  2H10 A;  2O9B A;  3MSH A;  4UQI M;  3V67 A;  5F1F A;  2ZC6 B;  3RTY A;  3E4P A;  3OPL A;  2V1Z A;  3MQQ A;  5M18 A;  1ZG6 A;  4DE1 A;  4OQH A;  3GSG A;  1I5Q A;  1G6O A;  3D72 A;  1K6R A;  5EVI D;  2JBF A;  1VET B;  4JXV A;  4OP8 A;  3K3C A;  2GJ3 A;  1BUL A;  2WZZ A;  2Y2H A;  1KOU A;  4P0M A;  3EGD C;  5EVI C;  3N4I A;  2Y2N A;  1K55 C;  1D1J A;  2VEA A;  3VFH A;  1F5M A;  3O88 A;  4N9K A;  2GZA A;  3P7N A;  3G35 A;  5EV0 A;  2C5W B;  4G3V A;  4NXG A;  5FQI A;  2W3G A;  4ME4 A;  4DF6 A;  2HP5 A;  2ZC3 B;  3C7U A;  4PM7 A;  3MFX A;  2K2N A;  2OOL A;  3GV9 A;  2YKH A;  4A5R A;  3C8C A;  4HES A;  1N9L A;  1NRF A;  4NXE A;  3FZC A;  1KGG A;  3BEB A;  3ICY A;  2J9O A;  2JKR M;  1O07 A;  4X53 A;  5DTT A;  1DP9 A;  4ETX A;  4ZBE A;  5FQM A;  2P08 A;  3E4Q A;  3AGF A;  4JF4 A;  5HFO A;  2IWC A;  5HPI A;  4GHI B;  4L9F A;  4C75 A;  4DE3 A;  3IS2 A;  4DXB A;  4CLC D;  4ESP A;  2W3F A;  4IED A;  3C5A A;  4Y7P A;  1GA9 A;  2KX6 A;  2O9A A;  4MN5 A;  5CGS A;  1L0F A;  1CEF A;  3CMZ A;  3T4T A;  2Y4A A;  4K91 A;  2HJE A;  4KZ8 A;  5GHX A;  2VK3 A;  4XUX A;  3IWO A;  2X01 A;  4HJ4 A;  5FL3 A;  2XFS A;  3DWK A;  2ZOH A;  3F1N A;  1YPR A;  3LY4 A;  2IA2 A;  2VJW A;  3FPW A;  2H28 A;  2PRF A;  4FUW A;  4HJ3 A;  4Z1W A;  2ZQD A;  5MC7 A;  2DRW A;  1L0D A;  5TBM A;  5A93 A;  5J7E A;  4GHI A;  2CMN A;  4LV3 A;  5J3W A;  2R9X A;  3CPT B;  1PI5 A;  1MKM A;  3LI9 A;  1FSW A;  1ES4 A;  2BTF P;  4JBF A;  2VV8 A;  1ONH A;  1SCW A;  1T18 A;  3DTM A;  4BL3 A;  2KOI A;  2Y2K A;  4K0W A;  4Y5F A;  2V1A A;  3ZNT A;  1NLY A;  2OWH A;  3R7W A;  3QP2 A;  2Q9M A;  3MZE A;  1NYY A;  3A3D A;  1PZO A;  4BL2 A;  4EBP A;  5L09 A;  3LIF A;  5FEF A;  5IU1 A;  2D01 A;  5DKL A;  5HAR A;  4QY5 A;  3JPU A;  1WA9 A;  2PYR A;  3LI8 A;  5KIZ A;  1OPX A;  4BJP A;  4E6W A;  2ZQA A;  3HUN A;  2ZM8 A;  3IWI A;  1LHY A;  2Y55 A;  3LUQ A;  2FFF B;  5EVI A;  3LO7 A;  4YIN A;  3N7W A;  2HDR A;  1K55 A;  3GQZ A;  2G2W A;  1ZKJ A;  3KX0 X;  5GLB A;  5AQB A;  3F1O B;  4DE2 A;  2XD1 A;  5EOO A;  2EX9 A;  1S66 L;  5G4Y A;  5FQJ A;  4IHQ A;  3ZG5 A;  1LL5 A;  4WYY A;  1T19 A;  3E2L A;  5TR7 A;  4ID4 A;  3TSG A;  4S2N C;  3VP1 A;  2PD8 A;  5HAI A;  3M6B A;  2EFU A;  4PM9 A;  3R4K A;  1ZHH B;  3MBZ A;  1YLW A;  2EX2 A;  1MWU A;  3S4X A;  1J9M A;  3UDI A;  3CUE C;  4FOF A;  3AGD A;  5HWT A;  3BFC A;  1AXB A;  3TW8 A;  4PM5 A;  1ERQ A;  5F6A A;  3BQ8 A;  1HVB A;  1GSW A;  4OKP A;  4R4S A;  4RYE A;  1XA1 A;  4IBX A;  5F68 A;  3CZD A;  1PWC A;  4R0Q A;  1FCM A;  3ZG9 B;  2WK0 A;  5GLD A;  3HJK A;  4WMC D;  3G32 A;  2CC1 A;  2ZBB A;  1MBL A;  4MDZ A;  3G2Z A;  2I72 A;  1HZO A;  3PBN A;  3UMD A;  1K57 C;  2BG1 A;  2YKF A;  5A91 A;  5F1G A;  1VHM A;  5HDC A;  5C5K A;  1UWN X;  4R3B A;  5BOH A;  1PW8 A;  3UE6 A;  2DMW A;  5K5B A;  1LI9 A;  3EEH A;  1XGJ A;  2HP6 A;  4KQR A;  1WYC A;  2JCH A;  5HDD A;  1XFQ A;  3MXS A;  3WS2 A;  1MWS A;  4AFI A;  3UB5 P;  1IEM A;  1BZA A;  3MFD A;  1IFQ A;  3Q1F A;  1KE4 A;  4KEN B;  2VGK A;  3UB6 A;  3H7W A;  5EFW A;  3W4Q A;  2ACG A;  3T4K A;  3MF0 A;  4EQ1 A;  4LPZ A;  1M6K A;  4XXR A;  4R6L A;  2L1M A;  2HZ5 A;  3CHW P;  4GB7 A;  3ULF A;  3QP8 A;  5FQQ A;  5JYP A;  2JC7 A;  2EWV A;  4P6Z S;  1G68 A;  2W1T B;  3UPP A;  2PR6 A;  1I2W A;  4G3W A;  2HDU A;  4EU0 A;  5HZH A;  3HUM A;  1V9Y A;  2XK1 A;  3MZD A;  1EW0 A;  3NEC A;  5EVL A;  2FH5 A;  2WGW B;  4K08 A;  3O87 A;  4HNB A;  1TEM A;  4BD0 A;  5CXW A;  2Y59 A;  4R23 A;  3MQ0 A;  4WZ4 A;  4MLL A;  1YLY A;  5FAQ A;  2AVX A;  2B02 A;  2V9A A;  2WKR A;  4BBV A;  5IHV A;  4S2I A;  4Q0J A;  4UA7 A;  3UY6 A;  1NY0 A;  4MMN A;  3D3O A;  1QME A;  1VB6 A;  4HBT A;  2V1B A;  3Q7V B;  3LR5 A;  4GS9 B;  3NJA A;  3BFF A;  4OQI A;  5FAO A;  4S2N A;  1YLZ A;  2VV7 A;  3T4S A;  5TJJ A;  1FR6 A;  5FQK A;  3VOZ A;  1SKO B;  2HDQ A;  3Q07 A;  1IKG A;  3T1S A;  2ZM0 A;  3DTI A;  1GHI A;  4XT2 B;  1CI8 A;  5FI2 A;  3T4Q A;  5CED A;  3CUE A;  4Q8I A;  1P9R A;  3LID A;  3NOP C;  1GCE A;  4P6Z M;  3CWF A;  3TRC A;  3VP0 A;  4NET A;  5FQ9 A;  3FKW A;  4MN7 A;  1XP4 A;  2ZC4 B;  4M3K A;  4KZ9 A;  5GLA A;  1ES2 A;  1K57 A;  4WMC A;  4EEU A;  3D9Y A;  4JF6 A;  3E98 A;  2HJ9 C;  3LR3 A;  4EBN A;  3UDX A;  4U0T A;  5M19 A;  3IHA A;  3MS6 A;  4EW7 A;  4LGW A;  4HIA A;  3SS5 A;  3EQU A;  4BMW A;  3PTE A;  3HJI A;  4FCF A;  2XSS A;  1E4D A;  1Q2P A;  5EE8 A;  1SKO A;  1W63 M;  3WS0 A;  2XQZ A;  3SZT A;  4S2J A;  4GJ4 A;  2KLI A;  4XT2 A;  4JF5 A;  2LB5 A;  5I5L A;  1CQA A;  2WGV A;  1Q2Q A;  3BLS A;  2W3D A;  1NJ4 A;  1YSQ A;  2J3T D;  5E2H A;  3BWL A;  2QPN A;  4D2O A;  3P98 A;  3W8K A;  2B18 A;  1MPL A;  2EXA A;  1UWP X;  1YMS A;  3UE1 A;  4R3J A;  3A3E A;  3BFG A;  3BY8 A;  4GKU A;  3QP4 A;  3HVF A;  1H8Z A;  1M40 A;  3I7J A;  1TDL A;  2Y2P A;  1XXM A;  2Y91 A;  2Z2L B;  5EPH A;  5DTK A;  1XKZ A;  1RCJ A;  4RQ9 A;  1H3Q A;  1PNE A;  1YQS A;  1W8Q A;  1KDW A;  4EUV A;  3CAX A;  3G31 A;  4B88 A;  2OV5 A;  4EQI A;  3ZHH A;  2JKG A;  5EM1 A;  3IQA A;  5F69 A;  3IS2 B;  3VMA A;  4LCM A;  1QMF A;  1TVF A;  1O7E A;  5JYO A;  5EUA A;  2QMI A;  4P87 A;  4OPZ A;  1JWV A;  4P85 A;  4QU3 A;  4WBG A;  3RXW A;  3TG9 A;  1XX2 A;  5M1A A;  1ZC2 A;  2M7V A;  5FDH A;  4IVK A;  3EEA A;  5FI6 A;  4GD6 A;  3GDI A;  1HD8 A;  4B93 A;  4RVA A;  3DWZ A;  3KSG A;  2QYB A;  1ALQ A;  2VZW A;  1CEG A;  5AQ7 A;  2EX8 A;  2ZQ7 A;  4RX2 A;  3ZGA B;  3Q82 A;  3U4L P;  1H8M A;  4JXS A;  3F1N B;  1HTZ A;  1KVL A;  2HDS A;  2BLS A;  3IBJ A;  1FCN A;  1W79 A;  2ZMF A;  4LV1 A;  5TBM B;  3LIA A;  3RJU A;  4E3J A;  1TF1 A;  3FPV A;  3NCK A;  4K0X A;  4C6Y A;  4NG2 A;  1S6R A;  2K7S A;  3NI9 A;  3Q81 A;  3LR4 A;  3MXR A;  4CLC C;  4E04 A;  3W2Z A;  2QZ6 A;  2P7J A;  3MMH A;  4UEY A;  2HPB A;  2NUT C;  2INW A;  3UNW A;  1NZO A;  3O5Y A;  4JGO A;  1VEU A;  3WRT A;  1Y54 A;  2WAF A;  3R7W B;  3DBA A;  2KDK A;  5A92 A;  4U3T A;  2BAS A;  3T4J A;  2WKI A;  1P97 A;  4E3M A;  4S2M A;  3G4P A;  5A8B A;  1E3U D;  2M1C A;  3A0S A;  2P04 A;  1S0W A;  4GNU A;  1DJC A;  1UGU A;  4X69 A;  3IXB A;  4HOI A;  2XLN A;  2WAD A;  3BLM A;  1MC0 A;  2W1R A;  3T1R A;  3B42 A;  1OT6 A;  2GNX A;  3NUL A;  3HL9 A;  2FZ0 A;  4Y15 A;  2C6W B;  4O01 A;  3SH9 A;  5EVI B;  5FAS A;  4MCW A;  2PAV P;  5F83 A;  2J80 A;  1YLP A;  2ZL1 B;  3NHQ A;  4S2L A;  2WKQ A;  3QHY A;  4EES A;  2G7U A;  3V3S A;  2EFX A;  1L3L A;  2QHK A;  2Q0O A;  3B47 A;  1TS6 A;  2IWB A;  3RXX A;  5IT5 A;  1TD5 A;  3V5M A;  1H8Y A;  1GHP A;  5CEB A;  2A3U A;  4WF0 A;  4R3A A;  5HX9 A;  2JE5 A;  4H6J B;  4WEJ A;  1K4E A;  3BM6 A;  3A3J A;  4BBT A;  2PR5 A;  2WUQ A;  1N9O A;  4KZ3 A;  4OOL A;  1XGI A;  3LFV A;  1NXY A;  3C4O A;  2Y2I A;  1IYO A;  1GA0 A; 
#chains in the Genus database with same CATH homology
 3GTC A;  3W4Q A;  1ONG A;  4E3N A;  2ZC5 B;  2XGN A;  3IH9 A;  4E3L A;  4U0X A;  1M6K A;  4XXR A;  3UPO A;  5FAT A;  3V3R A;  3NY4 A;  4GB7 A;  5FQQ A;  5JYP A;  2JC7 A;  4KG2 A;  2HP9 A;  3WS1 A;  4KZA A;  5FI7 A;  4UA6 A;  4OH0 A;  1G68 A;  2RL3 A;  4FH4 A;  3Q7V A;  1K56 D;  3ITA A;  1IYQ A;  5TFQ A;  3UPP A;  1EWZ A;  5E2E A;  1XA7 A;  5CHJ A;  3PBR A;  4GN2 A;  5HW3 A;  1I2W A;  2HDU A;  1MY8 A;  4DDS A;  3BRM A;  1BTL A;  2X71 A;  3HUM A;  2WAE A;  4XUZ A;  1FSY A;  2XK1 A;  3GR2 A;  1ERM A;  3MZD A;  4LV0 A;  4QB8 A;  4OPY A;  5CTN A;  3UDF A;  5FSR A;  5EVL A;  4DRT A;  4E3O A;  1ES5 A;  3BFE A;  3NDE A;  3UE3 A;  3ZVW A;  3VP4 A;  2Z2M B;  2WGW B;  2ZQ8 A;  1KVM A;  3MKF A;  3S1Y A;  3VP2 A;  1JVJ A;  3N6I A;  5DF9 A;  3O87 A;  1TEM A;  4S2K A;  4BD0 A;  5CXW A;  2Y59 A;  4Y0T A;  5CHU A;  1N4O A;  4R23 A;  3CG5 A;  1BUE A;  3UPN A;  4Y0O A;  2Y2G A;  1W8Y A;  1ESU A;  2XR0 A;  1K38 A;  4WZ4 A;  4ZJ3 A;  3V39 A;  1DY6 A;  4MLL A;  2V20 A;  1IEL A;  5GLC A;  1YLY A;  3OCN A;  5D3O A;  1BSG A;  5FAQ A;  3WRZ A;  1CI9 A;  1K25 A;  4ZJ2 A;  1IKI A;  3NBL A;  2OLV A;  5DTS A;  1PWG A;  2PU4 A;  2WKE A;  4ZJ1 A;  2RCX A;  3IF6 B;  4UA9 A;  4BQM A;  3BYD A;  1VQQ A;  1YLJ A;  5IHV A;  1KDS A;  4S2I A;  4F94 A;  5CRF A;  1PZP A;  2H10 A;  2H5S A;  4UA7 A;  5F1F A;  3UY6 A;  1NY0 A;  5HAQ A;  2ZC6 B;  5KMW A;  3OPL A;  4N9L A;  3PBQ A;  1K54 A;  2V1Z A;  1MKI A;  4O7D A;  3W4P A;  1QME A;  5M18 A;  1ZG6 A;  3OPH A;  5E43 A;  4DE1 A;  4HBT A;  2V2F F;  4OQH A;  3WWX A;  4LEN A;  3GSG A;  1I5Q A;  3Q7V B;  4OLD A;  1FQG A;  3A3F A;  1LL9 A;  4GDB A;  4EWF A;  3BFF A;  3DW0 A;  3ITB A;  1K6R A;  4OQI A;  5FAO A;  4OOM A;  2DCF A;  2JBF A;  5EVI D;  4S2N A;  1SKF A;  2ZD8 A;  1YLZ A;  3UN7 A;  4JXV A;  5KSC A;  2XF3 A;  4OP8 A;  5DVA A;  1FR6 A;  4N1H A;  2FFY A;  5FQK A;  1VM1 A;  3VOZ A;  4X6T A;  1BUL A;  2WZZ A;  5L2F A;  2Y2H A;  2HDQ A;  3NC8 A;  3OCL A;  4P0M A;  1PIO A;  3Q07 A;  3N4I A;  2Y2N A;  5EVI C;  1IKG A;  1K55 C;  4YFM A;  1L0G A;  1H5X A;  2ZM0 A;  3B3X A;  1GHI A;  2H0Y A;  3MKE A;  3IXD A;  1K4F A;  4P6B A;  1CI8 A;  5AQ9 A;  3O88 A;  4N9K A;  3VFH A;  4DXC A;  4JXW A;  4Z9Q A;  3G35 A;  5FI2 A;  2C5W B;  3PAG A;  1NZU A;  5CED A;  3M2K A;  1E3U A;  1FCO A;  3G2Y A;  5FQI A;  3S22 A;  3HUO A;  1BLS A;  1E25 A;  3PAE A;  4GD8 A;  1PWD A;  4Q8I A;  1WYB A;  4DF6 A;  1GCE A;  2HP5 A;  5E2G A;  2E8I A;  2ZQC A;  4OVD A;  1K6S A;  4JLF A;  3VP0 A;  2ZC3 B;  3C7U A;  4CPK A;  4NET A;  4PM7 A;  1Z6F A;  5FQ9 A;  3FKW A;  1XP4 A;  2ZC4 B;  4CJN A;  3GV9 A;  4A5R A;  3VSL A;  4M3K A;  5GHY A;  4HES A;  1BT5 A;  1NRF A;  3BEC A;  2B5R A;  2H0T A;  3ISG A;  4KZ9 A;  5GLA A;  1BLC A;  4EV4 A;  3FZC A;  1ES2 A;  1MWT A;  3O3V A;  1K57 A;  1YMX A;  3D4F A;  3AGE A;  4WMC A;  2ZC7 A;  4WZ5 C;  4MBH A;  4JF6 A;  3IXH A;  1KGG A;  4EUZ A;  3BEB A;  4IBR A;  2J9O A;  5EEC A;  1O07 A;  3PBT A;  4X53 A;  1LLB A;  5DTT A;  4EBN A;  3UDX A;  4U0T A;  2WGI A;  5M19 A;  4ZBE A;  3IHA A;  3HLD A;  5FQM A;  3SS5 A;  5HL1 A;  3SS3 A;  4OPQ A;  4C3Q A;  3EQU A;  3PTE A;  4FD8 A;  3AGF A;  4JF4 A;  4FCF A;  5HFO A;  1E4D A;  1Q2P A;  2IWC A;  4UHU A;  5EE8 A;  4C75 A;  4DE3 A;  1DJB A;  3WS0 A;  4DXB A;  3NIA A;  2XQZ A;  2OSU A;  4S2J A;  3LY3 A;  1IYS A;  4IED A;  3C5A A;  2WYX A;  4PM6 A;  2IWD A;  1FOF A;  4FSF A;  2A49 A;  5J8X A;  4Y7P A;  1GA9 A;  4H8R A;  4JF5 A;  4L0L A;  4WM9 A;  3A3I A;  4JXG A;  5CGS A;  2WGV A;  1Q2Q A;  1L0F A;  3BLS A;  1CEF A;  1NJ4 A;  3CMZ A;  3HLB A;  5HAP A;  1CK3 A;  4EBL A;  5E2H A;  3FV7 A;  2Y4A A;  5F82 A;  5A90 A;  2XD5 A;  3WS4 A;  2QPN A;  3IT9 A;  4K91 A;  3P98 A;  4D2O A;  4DE0 A;  1G6A A;  3W8K A;  3ZG7 B;  3EQV A;  1W5D A;  2ZLY A;  4KZ8 A;  1MPL A;  2EXA A;  3FYZ A;  5GHX A;  1YMS A;  3UE1 A;  2ZQ9 A;  1LI0 A;  4R3J A;  3A3E A;  4OPR A;  1MXO A;  4GOG A;  2XDM A;  4XUX A;  3IWO A;  3VP3 A;  2X01 A;  3BFG A;  1WE4 A;  3IXG A;  2P74 A;  4GKU A;  1OME A;  3HVF A;  1H8Z A;  3GRJ A;  2XFS A;  1M40 A;  3I7J A;  1TDL A;  2Y2P A;  1XXM A;  2Y91 A;  2VGJ A;  2Z2L B;  3DWK A;  3HLW A;  3IWQ A;  3P09 A;  5EPH A;  5FAP A;  4OLG A;  4PPR A;  3LY4 A;  5DTK A;  1XKZ A;  1RCJ A;  4QHC A;  3HRE A;  1YT4 A;  1KGE A;  1L0E A;  1RP5 A;  4KQQ A;  2WZX A;  4R4R A;  1YQS A;  4KZB A;  3N8R A;  2PU2 A;  3HBR A;  1W8Q A;  1K56 A;  4MBK A;  1ZG4 A;  1PI4 A;  2ZQD A;  4MEZ A;  1KDW A;  2DRW A;  4E3I A;  1MWR A;  5CEC A;  3IF6 C;  1L0D A;  3G31 A;  4B88 A;  2OV5 A;  5A93 A;  4OP5 A;  5U47 A;  4EQI A;  3ZHH A;  4LV3 A;  2R9X A;  1DJA A;  1PI5 A;  3IQA A;  5FA7 A;  1EI5 A;  3UO9 A;  1FSW A;  1ES4 A;  4LCM A;  1L2S A;  3SH7 A;  1QMF A;  4OOY A;  4JBF A;  1TVF A;  1O7E A;  3VMA A;  3ZCZ A;  5JYO A;  3VFF A;  4UAA A;  1ONH A;  1KE0 A;  2DNS A;  3G30 A;  5EUA A;  1SCW A;  2QMI A;  4P87 A;  4OPZ A;  1YLT A;  1JWV A;  3DTM A;  4P85 A;  4BL3 A;  4QU3 A;  1W7F A;  4WBG A;  2Y2K A;  2XEP A;  3UE0 A;  3RXW A;  4X56 A;  4K0W A;  5CGW A;  1TDG A;  3TG9 A;  1XX2 A;  5M1A A;  1ZC2 A;  5CER A;  5EOE A;  3ZVT A;  3OC2 A;  4MNR A;  5FDH A;  4IVK A;  4S2P A;  5G18 A;  3ZNT A;  4X68 A;  4LV2 A;  5FI6 A;  4GD6 A;  3GVB A;  1HD8 A;  4QJG A;  3OPP A;  4RVA A;  2Y2L A;  3DWZ A;  2Q9M A;  3MZE A;  1NYY A;  3O86 A;  4Y0U A;  3NDG A;  3A3D A;  4JKT A;  1PZO A;  1KE3 A;  4DKI A;  1RGY A;  1SDN A;  1ALQ A;  5CGX A;  1CEG A;  3HLG A;  4KZ5 A;  5AQ7 A;  4BL2 A;  4EBP A;  2EX8 A;  2Y2O A;  2ZQ7 A;  4RX2 A;  3ZGA B;  1BLP A;  3Q82 A;  4JXS A;  5HAR A;  1ERO A;  1HTZ A;  1RGZ A;  2OLU A;  4QY5 A;  3SOI A;  3M2J A;  3V50 A;  4DDY A;  3PBO A;  3C4P A;  4BJP A;  4E6W A;  2ZQA A;  3HUN A;  4LCL A;  1KVL A;  2HDS A;  2BLS A;  1FCN A;  2ZM8 A;  3IWI A;  4KZ4 A;  1LHY A;  2P9V A;  1W79 A;  2Y55 A;  4BEN A;  1BLH A;  1SDE A;  3C7V A;  3OPR A;  1I2S A;  5KSH A;  2FFF B;  4LV1 A;  3RJU A;  5EVI A;  3LO7 A;  4E3J A;  3HLF A;  3N7W A;  2HDR A;  1K55 A;  4YIN A;  4PM8 A;  5AQA A;  1IYP A;  3GQZ A;  2Q9N A;  3NCK A;  4K0X A;  1C3B A;  2G2W A;  1ZKJ A;  4C6Y A;  5GLB A;  1S6R A;  5AQB A;  4ZAM A;  2EX6 A;  3NI9 A;  3ZG8 B;  3Q81 A;  3BFD A;  1XPB A;  4DE2 A;  3JYI A;  2XD1 A;  5EOO A;  4NK3 A;  3GMW A;  3MXR A;  4OQ0 A;  2EX9 A;  4B4Z A;  1K54 C;  5FQJ A;  2GDN A;  3ZG5 A;  3IH8 A;  1LL5 A;  2QZ6 A;  4WYY A;  2HPB A;  3UNW A;  5GL9 A;  3Q7Z A;  2XH9 A;  1SHV A;  4WEL A;  1NZO A;  5KZH A;  4RA7 A;  3E2L A;  2ZMA A;  4ZDX A;  5TR7 A;  5CTM A;  4ID4 A;  3WRT A;  4KZ7 A;  1Y54 A;  4GDN A;  1ES3 A;  2WAF A;  3TSG A;  1JWZ A;  4S2N C;  3VP1 A;  5HAI A;  3M6B A;  2ZM2 A;  5A92 A;  2EFU A;  4PM9 A;  3ZDJ A;  3QNC A;  1JTD A;  4U3T A;  2WKI A;  4S2O A;  3MBZ A;  4WZ5 A;  4HBU A;  5I94 A;  1YLW A;  4E3M A;  2EX2 A;  4S2M A;  3G4P A;  3PBS A;  1E3U D;  1MWU A;  1FR1 A;  1J9M A;  3S4X A;  1ESI A;  4KZ6 A;  3SS4 A;  1S0W A;  4GNU A;  3UDI A;  1DJC A;  4X69 A;  4BLM A;  4X55 A;  3AGD A;  3IXB A;  2XLN A;  3ZFZ A;  3BFC A;  1AXB A;  2WAD A;  4BD1 A;  3BLM A;  4JPM A;  4PM5 A;  1ERQ A;  4N92 A;  1HVB A;  2J7V A;  3LCE A;  3E2K A;  4OKP A;  4R4S A;  5E2F A;  2G2U A;  4RYE A;  1XA1 A;  3QNB A;  4IBX A;  2ZJ9 A;  1GA0 A;  3CZD A;  1PWC A;  2P9V B;  3N8S A;  4KG5 A;  4R0Q A;  3HL9 A;  1FCM A;  3ZG9 B;  1GHM A;  2WK0 A;  3LEZ A;  5GLD A;  3VSK A;  2C6W B;  4WMC D;  3SH9 A;  4WEK A;  3G32 A;  2CC1 A;  4MBF A;  3HLE A;  5EVI B;  3W4O A;  5FAS A;  5F83 A;  1MBL A;  1YLP A;  3G2Z A;  3N8L A;  2I72 A;  2Y2J A;  4S2L A;  1HZO A;  4QD4 A;  3IF5 A;  1PYY A;  3PBN A;  3HLC A;  3QHY A;  5DF8 A;  4B4X A;  3ZNY A;  1K57 C;  4GZB A;  3IHB A;  2BG1 A;  3V3S A;  3M6H A;  2J9P A;  1NYM A;  2EFX A;  5A91 A;  5F1G A;  2UWX A;  2X02 A;  2Y2M A;  2IWB A;  3RXX A;  2PBY A;  3TOI A;  1KGF A;  3V5M A;  1H8Y A;  4R3B A;  1GHP A;  5TGF A;  2J8Y A;  2WGW A;  2A3U A;  1JWP A;  2Y2Q A;  3G34 A;  4KG6 A;  4QY6 A;  3ZG0 A;  5CEB A;  5CHM A;  1PW8 A;  5BOH A;  4E3K A;  5DF7 A;  4RX3 A;  3CJM A;  4ZTK A;  4OON A;  2EXB A;  5HX9 A;  2WKH A;  1N9B A;  2JE5 A;  4OQG A;  4WEJ A;  1K4E A;  4HEF A;  3BM6 A;  3A3J A;  1LI9 A;  3FKV A;  4KQO A;  2WUQ A;  1U60 A;  4PMA A;  5GHZ A;  3SH8 A;  1XGJ A;  4KZ3 A;  2HP6 A;  3OZH A;  4KQR A;  3FWL A;  4OOL A;  1WYC A;  1XGI A;  2JCH A;  3WS5 A;  3MXS A;  3WS2 A;  1MWS A;  4E6X A;  2XFT A;  1IEM A;  1NXY A;  3C4O A;  2Y2I A;  3MZF A;  1JTG A;  1BZA A;  3MFD A;  4N1X A;  2R9W A;  1IYO A;  1KE4 A;  3IF6 A;  3Q1F A;  1YM1 A;  2VGK A;  4FH2 A;  4KEN B;  4R1G A;  1PW1 A;  3VOY A;  4IVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...