3UB8A

Periplasmic portion of the helicobacter pylori chemoreceptor tlpb with formamide bound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
157
structure length
157
Chain Sequence
b'MEHLETGQYKKREKTLAYMTKILEQGIHEYYKSFDNDTARKMALDYFKRINDDKGMIYMVVVDKNGVVLFDPVNPKTVGQSGLDAQSVDGVYYVRGYLEAAKKGGGYTYYKMPKYDGGVPEKKFAYSHYDEVSQMVIAATSYYTDINTENKAIKEGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chemoreceptor TlpB
molecule tags Membrane protein
source organism Helicobacter pylori
publication title Structure and proposed mechanism for the pH-sensing Helicobacter pylori chemoreceptor TlpB.
pubmed doi rcsb
total genus 54
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17200 sCache_2 Single Cache domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ub8A00
1GSVA 3EWKA 3A0VA 1UWPX 2PD8A 3H7WA 3E4PA 3KX0X 3LICA 2ZOHA 3MQQA 2W27A 5HSQA 2I9VA 1EW0A 2VV7A 4HQAA 1T1AA 1XJ2A 2VEAA 3OLOA 4HIAA 1OT9A 1S4RA 3H82B 4JGOA 4PKYA 5AVFA 5AVEA 2EA9A 5HD5A 2ZOIA 4L9FA 2R78A 3BY8A 3C8CA 4LRZE 1S1ZA 3K3CA 2PYRA 1D7EA 2K7SA 2B02A 2PR5A 1XJ6A 2QKPA 3MXQA 1OJ5A 5HDSA 2V1BA 3UB6A 4BBUA 3K3DA 4I39A 3H82A 5F69A 3FG8A 3MQOA 4JGRA 4LRXC 4DJ3A 5HDDA 1F9IA 3LIDA 5IU1A 1S1YA 2QHKA 2D02A 4BBTA 3F1OB 4WUJA 5DKKA 1N9OA 3MFXA 3VE3A 2PD7A 4EETB 3P7NA 1T1BA 4EW7A 5TBMB 5DJTA 1KOUA 2A24A 3ZQ5A 1XFQA 2VLGA 4JGQA 4GS9A 1G28A 1XJ4A 4F3LA 1VB6A 2QWSA 4R70A 2D01A 2M1CA 1TS0A 5F5YA 4WN5A 1LT0A 5HZHA 2CMNA 1OTIA 4PKYG 2HV1A 2JHEA 3C2WA 4LRYC 4WLAA 4HNBA 2Z6CA 5EFWA 2JN7A 3NOUC 2PYPA 1WA9A 3UMEA 1GSWA 3RTYA 4HP4A 4XT2B 3LIAA 4GHIB 2L1MA 3A0SA 3LIEA 4LLOB 5HD3A 4WL9A 3UB9A 5HDCA 5HWWA 1P0ZA 1OJGA 2L4RA 3IS2A 4M4XA 4EERA 4EEPA 4GCZA 3H7WB 4EQ1A 2WKQA 4EEUA 1TS7A 4I38A 4KUOA 1N9NA 1F98A 4HH3A 1X0OA 1XJ3A 4RQ9A 4NXFA 5F6AA 1P97A 2V0UA 1V9YA 5F68A 2H28A 4EXOA 3ULFA 3BY9A 2ZBBA 2GJ3A 4E04A 5HWVA 3MR0A 1N9LA 3PYPA 2V1AA 3G6OA 1S67L 1NWZA 4I5SA 4MN5A 4NXGA 5G4YA 3UMDA 5I5LA 2BASA 3NOPC 2J80A 4GW9A 4K08A 3UE6A 1UGUA 3A0RA 5IS1A 2P7JA 3HJKA 4KQDA 3GECA 3E4OA 1OT6A 1T18A 2PHYA 1DP8A 2YKHA 3CAXA 4HY8A 4NXEA 2YKFA 4HI4A 2A24B 4I3IA 1JNUA 4R38A 2WKRA 4I3AA 2V9AA 3BWLA 5J3WA 4EESA 5J7EA 2VV6A 2Z6DA 5DKLA 4B9OA 5TBMA 2VV8A 3LI9A 3MJQA 4HOIA 5A8BA 3H9WA 5KIZA 3UB8A 2INWA 4L9EA 3LYXA 4H6JB 1LSXA 3LIBA 2OWHA 2V0WA 4LPZA 1OTBA 3FC7A 1DP6A 1S66L 1OTAA 2QJ5A 3NJAA 4HJ6A 3B33A 4XT2A 2PDRA 4DJ2A 3SW1A 4WF0A 1BYWA 2PR6A 4H6JA 4NXBA 3HJIA 3VOLA 1GSXA 4HJ4A 3PHYA 2QJ7A 1S4SA 1LL8A 3EEHA 1D06A 1DP9A 3IBRA 4YWZA 1MZUA 1Y28A 3T50A 1ODVA 5J4EA 1T1CA 4L9GA 1DRMA 2L0WA 3CLOA 3LI8A 2KDKA 4KUKA 5DJUA 3GDIA 1TS6A 4HJ3A 4BBVA 4GS9B 4F3LB 3E4QA 4I3JA 5HWTA 3NOTC 2OOLA 1OTEA 3D72A 1UWNX 1T19A 3LUQA 3ICYA 3F1NB 3F1NA 4R6LA 3RH8B 4MN6A 3LIFA 3NHQA 3UB7A 1V9ZA 3IS2B 4JGPA 1OTDA 2OWJA 2WKPA 2KX6A 3VE4A 4HHDA 4HH2A 1LSWA 1XFNA 4GHIA 3CWFA 5G4ZA 2W0NA 4HP9A 3F1PA 3F1PB 1TS8A 1LSVA 3F1OA 4R3AA
chains in the Genus database with same CATH superfamily
2GX5A 4KZ9A 4R3BA 3N8LA 5EV0A 1NXYA 1Z6FA 4GLQA 1F2KA 4Z1WA 3HLBA 4GB7A 3LY4A 2V1BA 2ZM2A 1K57A 2IA2A 2HDRA 4JPMA 3P01A 1K4EA 1KOUA 5FASA 2ACGA 3BYDA 1LT0A 1OTIA 4PM9A 1L0EA 4UQIS 5L8MA 4EBPA 2EXAA 4S2NA 4NKPA 2XD1A 4PM8A 2M7VA 1Q2PA 3UB9A 3BFEA 1DJCA 2XSSA 1P0ZA 2IWCA 3IXGA 3VP0A 4ZJ2A 1F98A 1PWGA 2Y2MA 3BLSA 3PTEA 1VEUA 3S7NA 4BMWA 1VETA 1S0WA 2J9PA 3A3IA 3GVBA 2XR0A 1LL9A 3UPNA 1JWVA 2Q0OA 3OCLA 3VSLA 2RL3A 4KZ4A 5E2HA 4DF6A 2V9AA 1CJFA 4ARZB 1PI5A 2Y8HA 4FH4A 2A3UA 1VETB 3QP5A 3BM6A 3H9WA 3N4IA 2W3DA 2OWHA 1JWZA 2Y59A 4F94A 2G7UA 3LCEA 1FSWA 3IH8A 3VOLA 5HPFA 3W8KA 3UDXA 4NEED 1U60A 3LEZA 4UHUA 5HPIA 1XA1A 4GZBA 5TJJA 3CG5A 3GSGA 3IX4A 1E4DA 2HJEA 3NCKA 5CHJA 3PBSA 3Q82A 2PBDP 5FAOA 2LB9A 2EX2A 4WYYA 3MZEA 1CI8A 1GSVA 3MQQA 4IBXA 4EBLA 1K57C 1PW1A 4HQAA 4DXCA 4X1MA 3SS4A 2ZOIA 1ZKJA 3HCYA 3K2NA 3G32A 5GHZA 5HDDA 4Q0HA 3G2ZA 4N9KA 4CLCA 5EECA 2OV5A 4JGQA 1VB6A 3ZG0A 5FAQA 1BULA 4KZ6A 2Y2OA 3DTKA 4OLDA 4P85A 3VSKA 1DJAA 3EOIA 2Y2NA 3G35A 3RXXA 4RX3A 5HFOA 3EEAA 4GNUA 4N9LA 1IOUA 5F68A 4HBUA 3GV9A 5HX9A 1S67L 1IYSA 1WYCA 2B18A 3SZTA 4C3QA 2Z6DA 4KZ3A 3MJQA 2ZL1B 2JKRI 3GR2A 4OH0A 2EWWA 4HJ6A 1BYWA 3R7WA 3BW6A 3MF0A 1S4SA 4G3VA 2XFTA 4IVKA 1OTEA 2PRFA 4X53A 1IKIA 3FKVA 1V9ZA 4FCFA 2OWJA 4L0LA 2A49A 3HBRA 1LSWA 4GHIA 2W0NA 5MC7A 1GA9A 4E3NA 1ZG4A 1W63Q 4OVDA 1KGEA 3IXBA 3OLOA 3G34A 4JF4A 3H82B 5IHVA 3C8CA 5CGSA 4KZ7A 5HDSA 5HAPA 4KQQA 1FOFA 2P04A 5EM0A 3T4SA 1ESUA 3SS3A 5EOEA 3C7UA 3CPTA 5DJTA 5FDHA 4GS9A 3V50A 1YQSA 1ERMA 3FPWA 1BSGA 1SZVA 3C5AA 2WGWB 4P6BA 4LV3A 3JVUA 1GSWA 3NBLA 4OQIA 2KOIA 5DFYA 2WKQA 3O3VA 3CUEA 3TE8A 2XLNA 1GHIA 4BLMA 3PYPA 1NWZA 4QD4A 2J80A 4AFIA 3DWKA 2VJWA 3PBQA 2PT7A 1GHMA 1PIOA 2NUPC 5KIZA 3MSHA 1LSXA 5KSHA 1PW8A 1S66L 1FCMA 2UWXA 2PR6A 3DTMA 3ZG8B 3BFFA 1DRMA 2L0WA 2O99A 2ZM0A 1TF1A 4S2JA 5HWTA 4HEFA 1SCWA 3D72A 4BD0A 4Q0IA 4HH2A 4NETA 5F1GA 4GD6A 3S7PA 2R9XA 4X69A 5J8XA 1OT9A 3M6HA 4MBFA 1ES5A 3UB6A 3WS5A 3H82A 5F69A 1SDNA 3VOYA 3FPVA 1K38A 4ID4A 2KLIA 2D02A 1K56D 2OAQ1 2PD7A 3VE3A 3ISGA 5CTNA 4S2LA 5GHXA 1HZOA 2OLUA 2Y2KA 4B93A 3HUMA 5FQKA 1YLPA 1AXBA 2QZ6A 4EERA 4HBTA 2GDNA 4RQ9A 3G31A 4OQGA 3QP2A 5BOHA 3IXDA 4R4RA 1MWRA 5FI6A 4I5SA 3DBAA 4X25A 5G4YA 3UMDA 4OKPA 2RCXA 2VK3A 1TDLA 1W7FA 3JYIA 4HI4A 1E25A 4E3OA 4EESA 4M3KA 1CQAA 5F1FA 2CC1A 4KG6A 3LIBA 3MXSA 3FC7A 3NJAA 1W8YA 3M2KA 4DJ2A 3HVFA 3VFFA 4Y0TA 4HJ4A 2QJ7A 3T4TA 2PU4A 5FAPA 3IBRA 1DP9A 4D60A 2A2LA 2KDKA 2ZQ8A 4Y15A 1K6RA 4WEKA 3NOTC 4S2NC 3C4OA 3RXWA 1G6OA 4Q0JA 2WKPA 2W3EA 5DTSA 5EVIB 1EROA 3ZHHA 3A0VA 1YLYA 2WYXA 2ZOHA 2WZZA 4G3WA 3V67A 2Y4AA 2R78A 4L9FA 1D7EA 3IWIA 1F5MA 1OJ5A 1PWCA 1IYPA 4DJ3A 3PAEA 4Y2FA 4X55A 4OPRA 1G68A 3IBJA 1G5UA 3QP8A 3MMHA 4OQHA 3P09A 1ES3A 4WZ4A 1IEMA 3RFBA 1K54C 1XKZA 4GJ4A 3ZG9B 4R23A 1LHYA 4S2KA 4DE2A 3VMAA 1X0OA 3HREA 4U0XA 2VGJA 1RP5A 4EQIA 1L0FA 3HLCA 3D9YA 3MZFA 3MR0A 1YLTA 1ERQA 1H8MA 1H8ZA 2P7JA 3E4OA 1T18A 4KZ8A 3OC2A 3UE3A 2VV6A 5A8BA 3BFCA 3B33A 1PI4A 5FATA 4NXBA 3AGDA 2WGWA 5M19A 3T4KA 3HLGA 1T1CA 4P6ZS 5FEGA 1H0MA 1BLPA 2OLVA 5DTTA 4KUKA 2HZ5A 1SDEA 2ZQAA 2W1RA 4E3JA 3MZDA 1BT5A 3DAVA 2ZMVA 5TGFA 4MNRA 2ZC4B 4LV0A 3TG9A 3F1PA 1CK3A 2OSUA 5HAQA 4PKYA 4HIAA 2EWVA 4OP8A 3G4PA 3O86A 1AWIA 2K7SA 2QKPA 1LL5A 4DMZA 3MXQA 2XROA 1G6AA 3MQOA 5C5KA 2C6WB 1E3UD 3KYZA 5CECA 2Y2IA 3TW8A 3EGXC 4E6WA 4OLGA 2EFUA 2M1CA 3OPRA 3W4QA 4PKYG 4EUVA 5GLBA 1JTGA 3R7WB 3ZVTA 5EFWA 1LLBA 3ITBA 1H5XA 5KSCA 1BUEA 2W1TB 3IS2A 4K91A 4QPRA 4I38A 1NYYA 1TVFA 2FFYA 1V9YA 2IWDA 4KQRA 3CITA 4PM6A 2H0TA 1BLHA 2O9BA 3T1QB 4GW9A 3ZNYA 3B42A 2Q9MA 3IT9A 3GECA 3PBRA 2WKRA 2W3GA 3BWLA 4GKUA 4DE0A 1CF0A 1PRQA 4OPYA 3KSGA 4X6TA 5E2GA 5M18A 3EQUA 1NY0A 1ALQA 1L0GA 2JKTI 3EGDC 3OCNA 4Y3IA 5DJUA 4C75A 4F3LB 2EFXA 4I3JA 5EE8A 2J3WA 3ICYA 4Z9QA 2KX6A 1MY8A 1K25A 4CLCD 5G4ZA 1MBLA 4RYEA 1XGJA 3EWKA 5EVID 2I9VA 1XJ2A 3HLDA 3WS1A 2PYRA 1LI0A 5DF8A 2QYBA 2DMWA 4I39A 3UO9A 2QPNA 2XFSA 5IU1A 3LY3A 2QHKA 3BFDA 4UA7A 4C6YA 3LEQA 1IKGA 3AGFA 3OBFA 5CHUA 3SH9A 2HPBA 3ZG5A 2ZLYA 3MQ0A 4B4ZA 4LRYC 3O5YA 3GQZA 3LIEA 5HWWA 3T4QA 1K4FA 4QWOA 5A90A 3WWXA 3HUOA 4KUOA 3E2LA 3FV7A 4CJNA 5CGWA 4D2OA 4EXOA 4MBHA 1KVLA 1TDGA 4XXRA 1YLZA 3WS0A 1UGUA 4UQIM 3A3DA 4HY8A 5TR7A 2YKFA 1S6RA 5EVIA 3LR4A 4ZJ1A 3UB5P 3UY6A 3PBTA 3MXRA 4DE3A 3D3OA 2VGLM 1L2SA 2WGVA 3PHYA 1YMSA 4YINA 1LL8A 3KO6A 3WS2A 1BLCA 1MPLA 1YM1A 3NECA 2GNXA 5K5BA 4MN7A 4ZBEA 1LI9A 2DNSA 4GS9B 4BBVA 3LFVA 5HD5A 5EVEA 1T19A 2Y79A 3W4PA 1JTDA 4WBGA 2ZMFA 2FH5A 5FEFA 1Q2QA 4HP9A 4XUZA 4EWFA 2PD8A 3KX0X 4ZTKA 2ZQ9A 2W27A 3NI9A 4IVIA 2VEAA 3UDIA 5AVEA 4IUHA 2P08A 4Y17A 2Y2LA 1YSPA 1IFQA 5FDSA 1KE4A 1JWPA 2VKSA 1N4OA 1N9OA 5HL1A 4GDNA 3DTEA 1IYQA 2ZC6B 4F3LA 4PAUA 3ZCZA 2P9VB 4JF6A 4BJPA 1XX2A 4X56A 3UMEA 2VX8A 1KGFA 1XP4A 2HP6A 4GCZA 4KZ5A 1XJ3A 3IF6B 2Y2QA 5F6AA 5FSRA 1FSYA 3QP1A 2ZQDA 3BY9A 1EWZA 3ZQ5A 2V1AA 2BASA 3VOZA 5AJGA 2PHYA 4NXEA 1E3UA 2V8CA 3SS5A 4ZRRA 3IQAA 3LYXA 5AQ7A 1ONGA 1YAXA 2PDRA 4BENA 1BLSA 1K6SA 2JKFA 3L9KA 3RJUA 4E3MA 5L2FA 1YMXA 3QNBA 5AQBA 4ETXA 3LR0A 2X01A 3OPHA 4OP5A 4BBUA 2E8JA 2EXBA 4OOYA 4JBFA 4E3IA 3DWZA 3LR3A 3O87A 1PYYA 2J3TD 4WZ5A 5CX7A 3F1OA 5JYOA 1NLYA 3JVVA 1EW0A 1MKMA 2VV7A 5U47A 1K55C 2MJ6A 2Z2LB 5F83A 4R0QA 3LR5A 4LRXC 2B95A 1FR1A 3F1OB 5L09A 1ZC2A 3T4JA 1VHMA 4CLCB 2DRWA 4EBNA 1HTZA 2HF6A 5HL6A 3SH7A 1P9RA 5HW3A 4EEUA 1O07A 4BD1A 2V0UA 3Q7VA 4IHQA 3ZG7B 2ZC3B 3CZDA 5CTMA 3T1XA 4Y13A 3DTIA 4P6ZM 5DFXA 4S2PA 2ZQ7A 2V8FA 4DKIA 3PAGA 4S2OA 4L9EA 4MBKA 4LPZA 4ETZA 3VFHA 2V20A 1QMEA 1YT4A 5J4EA 4KZAA 4UA9A 3V3RA 2XD5A 4JKTA 4KG2A 3ITAA 3KYEA 4LGWA 4DE1A 3IWOA 2OOLA 3RH8B 4CLCE 1NZUA 3IS2B 4HHDA 3BQAA 4LCLA 3LICA 3E4PA 4H8RA 2C5WB 1S4RA 5AVFA 2AVXA 4LRZE 4OPQA 5CRFA 2Y2JA 4ZDXA 3LIDA 1KVMA 3KSFA 4EETB 4UA6A 5FA7A 4RX2A 1FILA 2Z2MB 1L3LA 1NRJA 3V5MA 4IEDA 2HGVA 1XGIA 2Z6CA 3BQ8A 1C3BA 3C4PA 3ZYTA 5DTKA 2XH9A 1KDSA 3W2ZA 1WE4A 4HH3A 3M6BA 2E8IA 5L10A 5A93A 2H28A 3UE0A 3G6OA 5A92A 3NOPC 2K31A 1Z09A 3HJKA 3CAXA 2Y2PA 4PMAA 1O7EA 3TRCA 2HDSA 4B9OA 3PBNA 4G3KA 3KSIA 4YNRA 1KGGA 4Y0UA 3BFGA 1ZG6A 3MKFA 3BLMA 1L0DA 1YSQA 1RGZA 2EX8A 2O9AA 1TS6A 5IT5A 2NUTC 1STZA 4LFUA 4K0XA 2M7UA 4MN6A 2P9VA 3BJNA 4IUKA 3VE4A 2O9CA 3A3FA 4ZJ3A 4R3AA 4B4XA 4OONA 3BY8A 4JLFA 2ZD8A 1YLWA 1TEMA 2XK1A 3TJZC 2PBYA 1XFQA 4R3JA 5HZHA 3C38A 5EUAA 3PXPA 4HNBA 3N6IA 5EVLA 1MKIA 1FIKA 4LLOB 3A0SA 4S2MA 1ES4A 3N7WA 3S4XA 4M4XA 1GHPA 4R4SA 1ES2A 4QB8A 3ULFA 2ZBBA 4WEJA 5FQJA 2XA7M 3T1RA 2EX6A 1HD8A 1IYOA 3NULA 3UPPA 5HARA 1XXMA 5AQAA 2J9OA 3UB8A 4UEYA 3G30A 1OTAA 3UPOA 2QMIA 3NDEA 1P9WA 1FCOA 3CUEC 3MKEA 2V1ZA 4YWZA 1CEFA 1Y28A 1SKOA 3FZCA 3BEBA 3IF6C 4L9GA 4DDSA 3N8RA 4JF5A 5GLDA 3OPLA 1YKDA 5KMWA 2O0YA 2P74A 3LIFA 3UB7A 1NYMA 4U3TA 3T1SA 3IF6A 1VM1A 3F1PB 2FFFB 4JGOA 1K56A 4EV4A 2B02A 1XJ6A 4PPRA 2ZM8A 5FQIA 2J8YA 1PNEA 1S1YA 3ZNTA 5CEBA 5JYPA 2JKGA 4A5RA 4MCWA 4O8GA 5GHYA 2H5SA 2VLGA 1G28A 4YOFA 1VEUB 4R70A 2D01A 3NDGA 1DY6A 3V3SA 1KE0A 3C2WA 3IH9A 1Y4OA 2W3FA 2GZAA 3LIAA 1NJ4A 3SH8A 1TS7A 1N9NA 2HP9A 2Y55A 1GCEA 3IX8A 4KENB 4MDZA 2GJ3A 5TFQA 4RVAA 3Q7ZA 1K55A 2WAFA 1OT6A 2WADA 2YKHA 4KQOA 5J7EA 4X68A 4FSFA 4HOIA 4BL2A 3IXHA 4X1LA 2B5RA 2QJ5A 3N8SA 4XT2A 4EU0A 4WF0A 3OOVA 3C7VA 3LGOA 4GD8A 3T50A 3TOIA 2VZWA 3LI8A 2ZC5B 4MLLA 4JXGA 3V39A 1H8YA 1SHVA 3E4QA 4PM5A 2X71A 5EOOA 2HP5A 3FYZA 3JPUA 2HDQA 1D1JA 3TSGA 4CLCC 1ACFA 3H7WA 1OMEA 1JVJA 1W8QA 4DN0A 5CHMA 1K0KA 2VA0A 3ZDJA 1OPXA 3K3CA 2XEPA 2JE5A 4JGRA 5G18A 3VP2A 2X02A 1SKOB 3MFXA 4LENA 4GN2A 3P7NA 1T1BA 2I72A 2XRNA 3IX3A 2WUQA 4WZ5C 4RA7A 3O88A 1TS0A 3B47A 2W3HA 2CMNA 5F82A 1MWUA 4GDBA 2PYPA 1WA9A 1CEGA 4HP4A 1M40A 5GL9A 3E98A 4WL9A 1MXOA 4U0TA 4EQ1A 5I94A 2Y91A 1YLJA 4CQHA 3T4OA 5FQQA 4WM9A 4FH2A 4MN5A 1N9LA 2ZMAA 1MC0A 2WAEA 5KZHA 1ONHA 3UE6A 1W5DA 2A24B 3GMWA 3ZFZA 1JNUA 4FOFA 2JKRM 5DKLA 2VV8A 1XPBA 4NK3A 3HLEA 2INWA 5HAIA 2JCHA 1XA7A 1MWSA 4JXSA 3UNWA 2VGLS 2EX9A 3WRTA 1I2SA 3SOIA 5DVAA 5EPHA 1TD5A 1D06A 2LB5A 3CLOA 5FI2A 4CPKA 4OOMA 1BZAA 2IWBA 4OQ0A 1KE3A 2ZJ9A 5F5YA 3CMZA 3G2YA 3IHBA 4JGPA 4KG5A 4WMCD 2G2UA 1PWDA 4KZBA 5E2FA 5EVIC 3VP3A 5E43A 5D3OA 2ZL1A 4R1GA 3UN7A 1T1AA 2V2FF 4WELA 1HLUP 3T12B 1S1ZA 1GA0A 4FD8A 2H0YA 3K3DA 2WKIA 4E3KA 1PFLA 4WUJA 4P0MA 3A3EA 1I2WA 4O7DA 4QU3A 3Q7VB 5GLAA 2H10A 1KDWA 3E0YA 4WN5A 3GTCA 4ZAMA 3S1YA 3UE1A 3NOUC 2ZC7A 3PBOA 5A91A 4QY5A 4GHIB 2WKEA 2L1MA 5HD3A 2JC7A 5HDCA 3VP4A 2BG1A 1OJGA 4EEPA 3H7WB 5L07A 1SKFA 3AGEA 4FTXA 3ZVWA 4Y5FA 5HWVA 2JKTM 4ME4A 3A3JA 5IS1A 2OAP1 2BLSA 5FQ9A 5TBMB 1WYBA 3EQVA 5J3WA 2XF3A 3S7QA 5FL3A 3LI9A 2G2WA 1NRFA 3QP4A 2XGNA 1NZOA 1DP6A 4OOLA 3VP1A 1ZTUA 3GRJA 4NG2A 4LV2A 3NC8A 2J7VA 4HESA 3EEHA 3FKWA 3P98A 3GDIA 2PU2A 4DDYA 4PHTA 3L7HA 3CJMA 1UWNX 3W4OA 4XUXA 4BL3A 1XFNA 3S7OA 3CWFA 4ARZA 4QJGA 2XQZA 1UWPX 5HSQA 3MFDA 3D4FA 4K0WA 2EA9A 3Q1FA 4S2IA 2JBFA 3Q81A 3BECA 3FG8A 2FZ0A 5DF7A 3E2KA 4BBTA 4Y0OA 5DKKA 1MWTA 2R9WA 5FI7A 4LV1A 4YFMA 3UDFA 3ZGAB 4XT2B 3LO7A 1EI5A 1A0KA 5GLCA 2L4RA 1J3WA 3HLFA 1PZOA 5E2EA 4NXFA 1P97A 4N1HA 4E6XA 2WGIA 1IELA 4E04A 4II7A 3S22A 3PR6A 4NXGA 1QMFA 4OPZA 1N9BA 1FR6A 1Y54A 1DP8A 1RGYA 5FQMA 4R38A 4I3AA 4MEZA 1ZHHB 3I7JA 5CXWA 5TBMA 1BTLA 3CI6A 4PM7A 3BRMA 2Q9NA 4JXWA 4H6JB 5M1AA 3QHYA 1OTBA 2VGKA 3SW1A 3M2JA 5DF9A 1FQGA 3MBZA 2K2NA 3IHAA 1GSXA 4EUZA 4DXBA 1MZUA 4WMCA 3Q07A 3KSHA 4ESPA 2WK0A 4BWIA 1ESIA 4QHCA 3HLWA 3LUQA 3F1NB 3F1NA 3NHQA 3WS4A 4Q8IA 2DCFA 1W79A 1LSVA 5CEDA 3NIAA 4EW7A 4FUWA 2PR5A 3CHWP 3FWLA 1F9IA 2W1TA 4IBRA 4GOGA 2A24A 3HL9A 1XJ4A 2QWSA 4O0PA 5CGXA 4E3LA 2HV1A 2JHEA 3IF5A 4WLAA 1FCNA 2PAVP 3OZHA 2UV0E 2JN7A 3HUNA 3RTYA 4DRTA 2HDUA 4BQMA 1J9MA 4N1XA 3KYQA 1RCJA 3DW0A 4LCMA 4IJGA 1VQQA 5EM1A 4QY6A 4JXVA 4B88A 2J3TC 4MMNA 2XDMA 1NLZA 5I5LA 4K08A 2Y2GA 3A0RA 5AQ9A 3C30A 3IWQA 3U2AA 4KQDA 3CPTB 1PZPA 5LBRA 4I3IA 1M6KA 3T4LA 3B3XA 1DJBA 3VV4A 1H3QA 2Y2HA 2WKHA 2V0WA 4P87A 3MS6A 3OPPA 4H6JA 3HJIA 5CERA 3R4KA 2WZXA 4Y7PA 1ODVA 3WRZA 4O01A 4N92A 4UAAA 2BTFP 4HJ3A 1CI9A 1HVBA 1K54A 4R6LA 3QNCA 1I5QA 3QP6A 2ZQCA 1OTDA 2HJ9C 3U4LP 3NY4A 1W63M 1YPRA 1TS8A 2XA7S
chains in the Genus database with same CATH topology
3A0VA 3H7WA 1NLYA 2GX5A 2ZOHA 3JVVA 4DN0A 1EW0A 4G3WA 1MKMA 2VV7A 2VA0A 3V67A 2MJ6A 4L9FA 2R78A 1OPXA 4GLQA 3K3CA 1D7EA 4Z1WA 1F5MA 1OJ5A 2V1BA 3LR5A 4JGRA 4LRXC 2IA2A 4DJ3A 4Y2FA 3F1OB 3MFXA 3P01A 3P7NA 1T1BA 1KOUA 2XRNA 3T4JA 1VHMA 4CLCB 3IBJA 1TS0A 3B47A 2W3HA 3MMHA 1LT0A 2CMNA 1OTIA 2HF6A 3RFBA 4UQIS 5L8MA 2PYPA 1WA9A 4NKPA 4HP4A 2M7VA 4GJ4A 5HL6A 3UB9A 3E98A 4WL9A 2XSSA 1P9RA 1P0ZA 4EQ1A 4EEUA 1F98A 1X0OA 4CQHA 3T4OA 2V0UA 3S7NA 4BMWA 4IHQA 3MR0A 1N9LA 4MN5A 1MC0A 3UE6A 1H8MA 3OCLA 4P6ZM 2P7JA 3E4OA 1T18A 5DFXA 3OC2A 2A24B 3UE3A 1JNUA 4FOFA 2V9AA 4ARZB 2JKRM 2VV6A 5DKLA 2Y8HA 2VV8A 5A8BA 3H9WA 2INWA 4L9EA 2W3DA 2OWHA 4LPZA 2VGLS 3B33A 2G7UA 4ETZA 4NXBA 3VOLA 5HPFA 1TD5A 4NEED 1D06A 2LB5A 3T4KA 5HPIA 5J4EA 1T1CA 4P6ZS 3CLOA 5TJJA 4KUKA 4OOMA 2W1RA 2HJEA 5F5YA 2OOLA 3RH8B 2ZMVA 3PBSA 4CLCE 3IS2B 4JGPA 2LB9A 4HHDA 3F1PA 1GSVA 3BQAA 3MQQA 3LICA 3E4PA 4HQAA 1T1AA 4PKYA 4HIAA 1S4RA 2EWVA 5AVFA 4WELA 2ZOIA 4LRZE 1S1ZA 2K7SA 2QKPA 4DMZA 3MXQA 3K3DA 2XROA 3HCYA 3K2NA 3MQOA 5C5KA 5HDDA 3LIDA 4Q0HA 3KSFA 4CLCA 3KYZA 4WUJA 4EETB 3TW8A 3EGXC 4JGQA 1VB6A 1NRJA 2M1CA 3E0YA 4WN5A 4PKYG 4EUVA 2HGVA 3R7WB 2Z6CA 5EFWA 3BQ8A 3NOUC 3ZYTA 3PBOA 4GHIB 2L1MA 3EOIA 5HD3A 5HDCA 2W1TB 3IS2A 1OJGA 4EEPA 3H7WB 3W2ZA 3EEAA 4QPRA 4I38A 4HH3A 1IOUA 1V9YA 5F68A 2H28A 4Y5FA 5HWVA 3CITA 2JKTM 3G6OA 1S67L 4ME4A 2O9BA 3NOPC 4GW9A 3B42A 5IS1A 2K31A 3HJKA 2B18A 3GECA 2OAP1 3CAXA 5TBMB 3EQVA 3PBRA 2WKRA 2W3GA 3BWLA 5J3WA 2Z6DA 3S7QA 5FL3A 3TRCA 4B9OA 3LI9A 3MJQA 2JKRI 3PBNA 3KSGA 2EWWA 4G3KA 3KSIA 4YNRA 4HJ6A 1DP6A 4OOLA 1ZTUA 1BYWA 3EQUA 3R7WA 3BW6A 3MF0A 1S4SA 1YSQA 3EEHA 4G3VA 2JKTI 3EGDC 3OCNA 4Y3IA 2O9AA 3GDIA 5DJUA 1TS6A 5IT5A 2NUTC 4F3LB 4PHTA 1STZA 4I3JA 2J3WA 2M7UA 1OTEA 1UWNX 3ICYA 4MN6A 3BJNA 1V9ZA 4IUKA 2OWJA 4L0LA 2KX6A 3VE4A 2O9CA 4CLCD 1LSWA 1XFNA 4GHIA 3CWFA 5G4ZA 3S7OA 4ARZA 2W0NA 5MC7A 4R3AA 3EWKA 1UWPX 5HSQA 2I9VA 1W63Q 1XJ2A 3OLOA 3H82B 2EA9A 3C8CA 3BY8A 2PYRA 5HDSA 2QYBA 2DMWA 4I39A 3FG8A 2FZ0A 5IU1A 2P04A 3TJZC 3T4SA 2QHKA 4BBTA 5DKKA 5DJTA 3OBFA 1XFQA 4GS9A 3FPWA 5HZHA 3MQ0A 4LRYC 3C38A 3O5YA 3PXPA 4HNBA 3JVUA 1GSWA 4XT2B 4LLOB 3A0SA 3LIEA 5HWWA 3T4QA 2L4RA 4M4XA 2KOIA 5DFYA 2WKQA 4KUOA 3CUEA 3TE8A 4NXFA 1P97A 4EXOA 3ULFA 2ZBBA 4WEJA 4E04A 2XA7M 4II7A 3PYPA 3PR6A 1NWZA 4NXGA 2J80A 1UGUA 4AFIA 4UQIM 1DP8A 2VJWA 4HY8A 2YKFA 3PBQA 2PT7A 4R38A 4I3AA 1ZHHB 3LR4A 5TBMA 3CI6A 2NUPC 5KIZA 3UB8A 4H6JB 1LSXA 4UEYA 3PBTA 5KSHA 1OTBA 1S66L 1OTAA 3D3OA 3SW1A 2VGLM 5DF9A 1P9WA 2K2NA 2PR6A 3CUEC 1GSXA 3PHYA 1LL8A 3KO6A 4YWZA 1MZUA 1Y28A 4L9GA 1DRMA 2L0WA 2O99A 3KSHA 1TF1A 2GNXA 5K5BA 4MN7A 4BBVA 4GS9B 4BWIA 3LFVA 5HWTA 5HD5A 3LUQA 1YKDA 3D72A 1T19A 2Y79A 3F1NB 3F1NA 2O0YA 3LIFA 3NHQA 4Q0IA 3UB7A 2ZMFA 2FH5A 4HH2A 2XA7S 3S7PA 4HP9A 3F1PB 1LSVA 2PD8A 3KX0X 2W27A 4JGOA 2VEAA 4EW7A 1OT9A 5AVEA 4IUHA 2PR5A 2B02A 1XJ6A 2P08A 3UB6A 3H82A 5F69A 1YSPA 1IFQA 3FPVA 1F9IA 2VKSA 1S1YA 2KLIA 2D02A 2W1TA 1N9OA 2OAQ1 2PD7A 3VE3A 4MCWA 4O8GA 2A24A 2VLGA 4F3LA 1G28A 1XJ4A 4YOFA 4R70A 2QWSA 2D01A 4O0PA 4PAUA 4B93A 2HV1A 2JHEA 3C2WA 4BJPA 4WLAA 2W3FA 3UMEA 2JN7A 2VX8A 3RTYA 2GZAA 3LIAA 3KYQA 4EERA 4GCZA 4IJGA 1TS7A 4RQ9A 1N9NA 1XJ3A 5F6AA 4MDZA 3BY9A 2GJ3A 2J3TC 4MMNA 4I5SA 2V1AA 3DBAA 1NLZA 5G4YA 3ZQ5A 3UMDA 5I5LA 2BASA 4K08A 3A0RA 3C30A 3U2AA 4KQDA 5AJGA 1OT6A 2PHYA 2YKHA 4NXEA 5LBRA 4HI4A 4I3IA 4KQOA 5J7EA 4EESA 4ZRRA 4FSFA 3T4LA 4HOIA 3VV4A 1H3QA 3LYXA 3LIBA 2V0WA 3FC7A 1YAXA 2QJ5A 3NJAA 4XT2A 2PDRA 4DJ2A 4EU0A 4WF0A 3OOVA 4H6JA 3HJIA 4HJ4A 2QJ7A 3T4TA 3R4KA 3IBRA 1DP9A 3T50A 2VZWA 1ODVA 3LI8A 2A2LA 2KDKA 4O01A 4HJ3A 4ETXA 3LR0A 3E4QA 4WEKA 3NOTC 4BBUA 4R6LA 1G6OA 3LR3A 1OTDA 4Q0JA 2WKPA 2HJ9C 2W3EA 2J3TD 5CX7A 1W63M 4CLCC 1TS8A 3F1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSV A;  3EWK A;  3A0V A;  1UWP X;  2PD8 A;  3H7W A;  3E4P A;  3KX0 X;  3LIC A;  2ZOH A;  3MQQ A;  2W27 A;  5HSQ A;  2I9V A;  1EW0 A;  2VV7 A;  4HQA A;  1T1A A;  1XJ2 A;  2VEA A;  3OLO A;  4HIA A;  1OT9 A;  1S4R A;  3H82 B;  4JGO A;  4PKY A;  5AVF A;  5AVE A;  2EA9 A;  5HD5 A;  2ZOI A;  4L9F A;  2R78 A;  3BY8 A;  3C8C A;  4LRZ E;  1S1Z A;  3K3C A;  2PYR A;  1D7E A;  2K7S A;  2B02 A;  2PR5 A;  1XJ6 A;  2QKP A;  3MXQ A;  1OJ5 A;  5HDS A;  2V1B A;  3UB6 A;  4BBU A;  3K3D A;  4I39 A;  3H82 A;  5F69 A;  3FG8 A;  3MQO A;  4JGR A;  4LRX C;  4DJ3 A;  5HDD A;  1F9I A;  3LID A;  5IU1 A;  1S1Y A;  2QHK A;  2D02 A;  4BBT A;  3F1O B;  4WUJ A;  5DKK A;  1N9O A;  3MFX A;  3VE3 A;  2PD7 A;  4EET B;  3P7N A;  1T1B A;  4EW7 A;  5TBM B;  5DJT A;  1KOU A;  2A24 A;  3ZQ5 A;  1XFQ A;  2VLG A;  4JGQ A;  4GS9 A;  1G28 A;  1XJ4 A;  4F3L A;  1VB6 A;  2QWS A;  4R70 A;  2D01 A;  2M1C A;  1TS0 A;  5F5Y A;  4WN5 A;  1LT0 A;  5HZH A;  2CMN A;  1OTI A;  4PKY G;  2HV1 A;  2JHE A;  3C2W A;  4LRY C;  4WLA A;  4HNB A;  2Z6C A;  5EFW A;  2JN7 A;  3NOU C;  2PYP A;  1WA9 A;  3UME A;  1GSW A;  3RTY A;  4HP4 A;  4XT2 B;  3LIA A;  4GHI B;  2L1M A;  3A0S A;  3LIE A;  4LLO B;  5HD3 A;  4WL9 A;  3UB9 A;  5HDC A;  5HWW A;  1P0Z A;  1OJG A;  2L4R A;  3IS2 A;  4M4X A;  4EER A;  4EEP A;  4GCZ A;  3H7W B;  4EQ1 A;  2WKQ A;  4EEU A;  1TS7 A;  4I38 A;  4KUO A;  1N9N A;  1F98 A;  4HH3 A;  1X0O A;  1XJ3 A;  4RQ9 A;  4NXF A;  5F6A A;  1P97 A;  2V0U A;  1V9Y A;  5F68 A;  2H28 A;  4EXO A;  3ULF A;  3BY9 A;  2ZBB A;  2GJ3 A;  4E04 A;  5HWV A;  3MR0 A;  1N9L A;  3PYP A;  2V1A A;  3G6O A;  1S67 L;  1NWZ A;  4I5S A;  4MN5 A;  4NXG A;  5G4Y A;  3UMD A;  5I5L A;  2BAS A;  3NOP C;  2J80 A;  4GW9 A;  4K08 A;  3UE6 A;  1UGU A;  3A0R A;  5IS1 A;  2P7J A;  3HJK A;  4KQD A;  3GEC A;  3E4O A;  1OT6 A;  1T18 A;  2PHY A;  1DP8 A;  2YKH A;  3CAX A;  4HY8 A;  4NXE A;  2YKF A;  4HI4 A;  2A24 B;  4I3I A;  1JNU A;  4R38 A;  2WKR A;  4I3A A;  2V9A A;  3BWL A;  5J3W A;  4EES A;  5J7E A;  2VV6 A;  2Z6D A;  5DKL A;  4B9O A;  5TBM A;  2VV8 A;  3LI9 A;  3MJQ A;  4HOI A;  5A8B A;  3H9W A;  5KIZ A;  3UB8 A;  2INW A;  4L9E A;  3LYX A;  4H6J B;  1LSX A;  3LIB A;  2OWH A;  2V0W A;  4LPZ A;  1OTB A;  3FC7 A;  1DP6 A;  1S66 L;  1OTA A;  2QJ5 A;  3NJA A;  4HJ6 A;  3B33 A;  4XT2 A;  2PDR A;  4DJ2 A;  3SW1 A;  4WF0 A;  1BYW A;  2PR6 A;  4H6J A;  4NXB A;  3HJI A;  3VOL A;  1GSX A;  4HJ4 A;  3PHY A;  2QJ7 A;  1S4S A;  1LL8 A;  3EEH A;  1D06 A;  1DP9 A;  3IBR A;  4YWZ A;  1MZU A;  1Y28 A;  3T50 A;  1ODV A;  5J4E A;  1T1C A;  4L9G A;  1DRM A;  2L0W A;  3CLO A;  3LI8 A;  2KDK A;  4KUK A;  5DJU A;  3GDI A;  1TS6 A;  4HJ3 A;  4BBV A;  4GS9 B;  4F3L B;  3E4Q A;  4I3J A;  5HWT A;  3NOT C;  2OOL A;  1OTE A;  3D72 A;  1UWN X;  1T19 A;  3LUQ A;  3ICY A;  3F1N B;  3F1N A;  4R6L A;  3RH8 B;  4MN6 A;  3LIF A;  3NHQ A;  3UB7 A;  1V9Z A;  3IS2 B;  4JGP A;  1OTD A;  2OWJ A;  2WKP A;  2KX6 A;  3VE4 A;  4HHD A;  4HH2 A;  1LSW A;  1XFN A;  4GHI A;  3CWF A;  5G4Z A;  2W0N A;  4HP9 A;  3F1P A;  3F1P B;  1TS8 A;  1LSV A;  3F1O A;  4R3A A; 
#chains in the Genus database with same CATH topology
 2GX5 A;  4KZ9 A;  4R3B A;  3N8L A;  5EV0 A;  1NXY A;  1Z6F A;  4GLQ A;  1F2K A;  4Z1W A;  3HLB A;  4GB7 A;  3LY4 A;  2V1B A;  2ZM2 A;  1K57 A;  2IA2 A;  2HDR A;  4JPM A;  3P01 A;  1K4E A;  1KOU A;  5FAS A;  2ACG A;  3BYD A;  1LT0 A;  1OTI A;  4PM9 A;  1L0E A;  4UQI S;  5L8M A;  4EBP A;  2EXA A;  4S2N A;  4NKP A;  2XD1 A;  4PM8 A;  2M7V A;  1Q2P A;  3UB9 A;  3BFE A;  1DJC A;  2XSS A;  1P0Z A;  2IWC A;  3IXG A;  3VP0 A;  4ZJ2 A;  1F98 A;  1PWG A;  2Y2M A;  3BLS A;  3PTE A;  1VEU A;  3S7N A;  4BMW A;  1VET A;  1S0W A;  2J9P A;  3A3I A;  3GVB A;  2XR0 A;  1LL9 A;  3UPN A;  1JWV A;  2Q0O A;  3OCL A;  3VSL A;  2RL3 A;  4KZ4 A;  5E2H A;  4DF6 A;  2V9A A;  1CJF A;  4ARZ B;  1PI5 A;  2Y8H A;  4FH4 A;  2A3U A;  1VET B;  3QP5 A;  3BM6 A;  3H9W A;  3N4I A;  2W3D A;  2OWH A;  1JWZ A;  2Y59 A;  4F94 A;  2G7U A;  3LCE A;  1FSW A;  3IH8 A;  3VOL A;  5HPF A;  3W8K A;  3UDX A;  4NEE D;  1U60 A;  3LEZ A;  4UHU A;  5HPI A;  1XA1 A;  4GZB A;  5TJJ A;  3CG5 A;  3GSG A;  3IX4 A;  1E4D A;  2HJE A;  3NCK A;  5CHJ A;  3PBS A;  3Q82 A;  2PBD P;  5FAO A;  2LB9 A;  2EX2 A;  4WYY A;  3MZE A;  1CI8 A;  1GSV A;  3MQQ A;  4IBX A;  4EBL A;  1K57 C;  1PW1 A;  4HQA A;  4DXC A;  4X1M A;  3SS4 A;  2ZOI A;  1ZKJ A;  3HCY A;  3K2N A;  3G32 A;  5GHZ A;  5HDD A;  4Q0H A;  3G2Z A;  4N9K A;  4CLC A;  5EEC A;  2OV5 A;  4JGQ A;  1VB6 A;  3ZG0 A;  5FAQ A;  1BUL A;  4KZ6 A;  2Y2O A;  3DTK A;  4OLD A;  4P85 A;  3VSK A;  1DJA A;  3EOI A;  2Y2N A;  3G35 A;  3RXX A;  4RX3 A;  5HFO A;  3EEA A;  4GNU A;  4N9L A;  1IOU A;  5F68 A;  4HBU A;  3GV9 A;  5HX9 A;  1S67 L;  1IYS A;  1WYC A;  2B18 A;  3SZT A;  4C3Q A;  2Z6D A;  4KZ3 A;  3MJQ A;  2ZL1 B;  2JKR I;  3GR2 A;  4OH0 A;  2EWW A;  4HJ6 A;  1BYW A;  3R7W A;  3BW6 A;  3MF0 A;  1S4S A;  4G3V A;  2XFT A;  4IVK A;  1OTE A;  2PRF A;  4X53 A;  1IKI A;  3FKV A;  1V9Z A;  4FCF A;  2OWJ A;  4L0L A;  2A49 A;  3HBR A;  1LSW A;  4GHI A;  2W0N A;  5MC7 A;  1GA9 A;  4E3N A;  1ZG4 A;  1W63 Q;  4OVD A;  1KGE A;  3IXB A;  3OLO A;  3G34 A;  4JF4 A;  3H82 B;  5IHV A;  3C8C A;  5CGS A;  4KZ7 A;  5HDS A;  5HAP A;  4KQQ A;  1FOF A;  2P04 A;  5EM0 A;  3T4S A;  1ESU A;  3SS3 A;  5EOE A;  3C7U A;  3CPT A;  5DJT A;  5FDH A;  4GS9 A;  3V50 A;  1YQS A;  1ERM A;  3FPW A;  1BSG A;  1SZV A;  3C5A A;  2WGW B;  4P6B A;  4LV3 A;  3JVU A;  1GSW A;  3NBL A;  4OQI A;  2KOI A;  5DFY A;  2WKQ A;  3O3V A;  3CUE A;  3TE8 A;  2XLN A;  1GHI A;  4BLM A;  3PYP A;  1NWZ A;  4QD4 A;  2J80 A;  4AFI A;  3DWK A;  2VJW A;  3PBQ A;  2PT7 A;  1GHM A;  1PIO A;  2NUP C;  5KIZ A;  3MSH A;  1LSX A;  5KSH A;  1PW8 A;  1S66 L;  1FCM A;  2UWX A;  2PR6 A;  3DTM A;  3ZG8 B;  3BFF A;  1DRM A;  2L0W A;  2O99 A;  2ZM0 A;  1TF1 A;  4S2J A;  5HWT A;  4HEF A;  1SCW A;  3D72 A;  4BD0 A;  4Q0I A;  4HH2 A;  4NET A;  5F1G A;  4GD6 A;  3S7P A;  2R9X A;  4X69 A;  5J8X A;  1OT9 A;  3M6H A;  4MBF A;  1ES5 A;  3UB6 A;  3WS5 A;  3H82 A;  5F69 A;  1SDN A;  3VOY A;  3FPV A;  1K38 A;  4ID4 A;  2KLI A;  2D02 A;  1K56 D;  2OAQ 1;  2PD7 A;  3VE3 A;  3ISG A;  5CTN A;  4S2L A;  5GHX A;  1HZO A;  2OLU A;  2Y2K A;  4B93 A;  3HUM A;  5FQK A;  1YLP A;  1AXB A;  2QZ6 A;  4EER A;  4HBT A;  2GDN A;  4RQ9 A;  3G31 A;  4OQG A;  3QP2 A;  5BOH A;  3IXD A;  4R4R A;  1MWR A;  5FI6 A;  4I5S A;  3DBA A;  4X25 A;  5G4Y A;  3UMD A;  4OKP A;  2RCX A;  2VK3 A;  1TDL A;  1W7F A;  3JYI A;  4HI4 A;  1E25 A;  4E3O A;  4EES A;  4M3K A;  1CQA A;  5F1F A;  2CC1 A;  4KG6 A;  3LIB A;  3MXS A;  3FC7 A;  3NJA A;  1W8Y A;  3M2K A;  4DJ2 A;  3HVF A;  3VFF A;  4Y0T A;  4HJ4 A;  2QJ7 A;  3T4T A;  2PU4 A;  5FAP A;  3IBR A;  1DP9 A;  4D60 A;  2A2L A;  2KDK A;  2ZQ8 A;  4Y15 A;  1K6R A;  4WEK A;  3NOT C;  4S2N C;  3C4O A;  3RXW A;  1G6O A;  4Q0J A;  2WKP A;  2W3E A;  5DTS A;  5EVI B;  1ERO A;  3ZHH A;  3A0V A;  1YLY A;  2WYX A;  2ZOH A;  2WZZ A;  4G3W A;  3V67 A;  2Y4A A;  2R78 A;  4L9F A;  1D7E A;  3IWI A;  1F5M A;  1OJ5 A;  1PWC A;  1IYP A;  4DJ3 A;  3PAE A;  4Y2F A;  4X55 A;  4OPR A;  1G68 A;  3IBJ A;  1G5U A;  3QP8 A;  3MMH A;  4OQH A;  3P09 A;  1ES3 A;  4WZ4 A;  1IEM A;  3RFB A;  1K54 C;  1XKZ A;  4GJ4 A;  3ZG9 B;  4R23 A;  1LHY A;  4S2K A;  4DE2 A;  3VMA A;  1X0O A;  3HRE A;  4U0X A;  2VGJ A;  1RP5 A;  4EQI A;  1L0F A;  3HLC A;  3D9Y A;  3MZF A;  3MR0 A;  1YLT A;  1ERQ A;  1H8M A;  1H8Z A;  2P7J A;  3E4O A;  1T18 A;  4KZ8 A;  3OC2 A;  3UE3 A;  2VV6 A;  5A8B A;  3BFC A;  3B33 A;  1PI4 A;  5FAT A;  4NXB A;  3AGD A;  2WGW A;  5M19 A;  3T4K A;  3HLG A;  1T1C A;  4P6Z S;  5FEG A;  1H0M A;  1BLP A;  2OLV A;  5DTT A;  4KUK A;  2HZ5 A;  1SDE A;  2ZQA A;  2W1R A;  4E3J A;  3MZD A;  1BT5 A;  3DAV A;  2ZMV A;  5TGF A;  4MNR A;  2ZC4 B;  4LV0 A;  3TG9 A;  3F1P A;  1CK3 A;  2OSU A;  5HAQ A;  4PKY A;  4HIA A;  2EWV A;  4OP8 A;  3G4P A;  3O86 A;  1AWI A;  2K7S A;  2QKP A;  1LL5 A;  4DMZ A;  3MXQ A;  2XRO A;  1G6A A;  3MQO A;  5C5K A;  2C6W B;  1E3U D;  3KYZ A;  5CEC A;  2Y2I A;  3TW8 A;  3EGX C;  4E6W A;  4OLG A;  2EFU A;  2M1C A;  3OPR A;  3W4Q A;  4PKY G;  4EUV A;  5GLB A;  1JTG A;  3R7W B;  3ZVT A;  5EFW A;  1LLB A;  3ITB A;  1H5X A;  5KSC A;  1BUE A;  2W1T B;  3IS2 A;  4K91 A;  4QPR A;  4I38 A;  1NYY A;  1TVF A;  2FFY A;  1V9Y A;  2IWD A;  4KQR A;  3CIT A;  4PM6 A;  2H0T A;  1BLH A;  2O9B A;  3T1Q B;  4GW9 A;  3ZNY A;  3B42 A;  2Q9M A;  3IT9 A;  3GEC A;  3PBR A;  2WKR A;  2W3G A;  3BWL A;  4GKU A;  4DE0 A;  1CF0 A;  1PRQ A;  4OPY A;  3KSG A;  4X6T A;  5E2G A;  5M18 A;  3EQU A;  1NY0 A;  1ALQ A;  1L0G A;  2JKT I;  3EGD C;  3OCN A;  4Y3I A;  5DJU A;  4C75 A;  4F3L B;  2EFX A;  4I3J A;  5EE8 A;  2J3W A;  3ICY A;  4Z9Q A;  2KX6 A;  1MY8 A;  1K25 A;  4CLC D;  5G4Z A;  1MBL A;  4RYE A;  1XGJ A;  3EWK A;  5EVI D;  2I9V A;  1XJ2 A;  3HLD A;  3WS1 A;  2PYR A;  1LI0 A;  5DF8 A;  2QYB A;  2DMW A;  4I39 A;  3UO9 A;  2QPN A;  2XFS A;  5IU1 A;  3LY3 A;  2QHK A;  3BFD A;  4UA7 A;  4C6Y A;  3LEQ A;  1IKG A;  3AGF A;  3OBF A;  5CHU A;  3SH9 A;  2HPB A;  3ZG5 A;  2ZLY A;  3MQ0 A;  4B4Z A;  4LRY C;  3O5Y A;  3GQZ A;  3LIE A;  5HWW A;  3T4Q A;  1K4F A;  4QWO A;  5A90 A;  3WWX A;  3HUO A;  4KUO A;  3E2L A;  3FV7 A;  4CJN A;  5CGW A;  4D2O A;  4EXO A;  4MBH A;  1KVL A;  1TDG A;  4XXR A;  1YLZ A;  3WS0 A;  1UGU A;  4UQI M;  3A3D A;  4HY8 A;  5TR7 A;  2YKF A;  1S6R A;  5EVI A;  3LR4 A;  4ZJ1 A;  3UB5 P;  3UY6 A;  3PBT A;  3MXR A;  4DE3 A;  3D3O A;  2VGL M;  1L2S A;  2WGV A;  3PHY A;  1YMS A;  4YIN A;  1LL8 A;  3KO6 A;  3WS2 A;  1BLC A;  1MPL A;  1YM1 A;  3NEC A;  2GNX A;  5K5B A;  4MN7 A;  4ZBE A;  1LI9 A;  2DNS A;  4GS9 B;  4BBV A;  3LFV A;  5HD5 A;  5EVE A;  1T19 A;  2Y79 A;  3W4P A;  1JTD A;  4WBG A;  2ZMF A;  2FH5 A;  5FEF A;  1Q2Q A;  4HP9 A;  4XUZ A;  4EWF A;  2PD8 A;  3KX0 X;  4ZTK A;  2ZQ9 A;  2W27 A;  3NI9 A;  4IVI A;  2VEA A;  3UDI A;  5AVE A;  4IUH A;  2P08 A;  4Y17 A;  2Y2L A;  1YSP A;  1IFQ A;  5FDS A;  1KE4 A;  1JWP A;  2VKS A;  1N4O A;  1N9O A;  5HL1 A;  4GDN A;  3DTE A;  1IYQ A;  2ZC6 B;  4F3L A;  4PAU A;  3ZCZ A;  2P9V B;  4JF6 A;  4BJP A;  1XX2 A;  4X56 A;  3UME A;  2VX8 A;  1KGF A;  1XP4 A;  2HP6 A;  4GCZ A;  4KZ5 A;  1XJ3 A;  3IF6 B;  2Y2Q A;  5F6A A;  5FSR A;  1FSY A;  3QP1 A;  2ZQD A;  3BY9 A;  1EWZ A;  3ZQ5 A;  2V1A A;  2BAS A;  3VOZ A;  5AJG A;  2PHY A;  4NXE A;  1E3U A;  2V8C A;  3SS5 A;  4ZRR A;  3IQA A;  3LYX A;  5AQ7 A;  1ONG A;  1YAX A;  2PDR A;  4BEN A;  1BLS A;  1K6S A;  2JKF A;  3L9K A;  3RJU A;  4E3M A;  5L2F A;  1YMX A;  3QNB A;  5AQB A;  4ETX A;  3LR0 A;  2X01 A;  3OPH A;  4OP5 A;  4BBU A;  2E8J A;  2EXB A;  4OOY A;  4JBF A;  4E3I A;  3DWZ A;  3LR3 A;  3O87 A;  1PYY A;  2J3T D;  4WZ5 A;  5CX7 A;  3F1O A;  5JYO A;  1NLY A;  3JVV A;  1EW0 A;  1MKM A;  2VV7 A;  5U47 A;  1K55 C;  2MJ6 A;  2Z2L B;  5F83 A;  4R0Q A;  3LR5 A;  4LRX C;  2B95 A;  1FR1 A;  3F1O B;  5L09 A;  1ZC2 A;  3T4J A;  1VHM A;  4CLC B;  2DRW A;  4EBN A;  1HTZ A;  2HF6 A;  5HL6 A;  3SH7 A;  1P9R A;  5HW3 A;  4EEU A;  1O07 A;  4BD1 A;  2V0U A;  3Q7V A;  4IHQ A;  3ZG7 B;  2ZC3 B;  3CZD A;  5CTM A;  3T1X A;  4Y13 A;  3DTI A;  4P6Z M;  5DFX A;  4S2P A;  2ZQ7 A;  2V8F A;  4DKI A;  3PAG A;  4S2O A;  4L9E A;  4MBK A;  4LPZ A;  4ETZ A;  3VFH A;  2V20 A;  1QME A;  1YT4 A;  5J4E A;  4KZA A;  4UA9 A;  3V3R A;  2XD5 A;  4JKT A;  4KG2 A;  3ITA A;  3KYE A;  4LGW A;  4DE1 A;  3IWO A;  2OOL A;  3RH8 B;  4CLC E;  1NZU A;  3IS2 B;  4HHD A;  3BQA A;  4LCL A;  3LIC A;  3E4P A;  4H8R A;  2C5W B;  1S4R A;  5AVF A;  2AVX A;  4LRZ E;  4OPQ A;  5CRF A;  2Y2J A;  4ZDX A;  3LID A;  1KVM A;  3KSF A;  4EET B;  4UA6 A;  5FA7 A;  4RX2 A;  1FIL A;  2Z2M B;  1L3L A;  1NRJ A;  3V5M A;  4IED A;  2HGV A;  1XGI A;  2Z6C A;  3BQ8 A;  1C3B A;  3C4P A;  3ZYT A;  5DTK A;  2XH9 A;  1KDS A;  3W2Z A;  1WE4 A;  4HH3 A;  3M6B A;  2E8I A;  5L10 A;  5A93 A;  2H28 A;  3UE0 A;  3G6O A;  5A92 A;  3NOP C;  2K31 A;  1Z09 A;  3HJK A;  3CAX A;  2Y2P A;  4PMA A;  1O7E A;  3TRC A;  2HDS A;  4B9O A;  3PBN A;  4G3K A;  3KSI A;  4YNR A;  1KGG A;  4Y0U A;  3BFG A;  1ZG6 A;  3MKF A;  3BLM A;  1L0D A;  1YSQ A;  1RGZ A;  2EX8 A;  2O9A A;  1TS6 A;  5IT5 A;  2NUT C;  1STZ A;  4LFU A;  4K0X A;  2M7U A;  4MN6 A;  2P9V A;  3BJN A;  4IUK A;  3VE4 A;  2O9C A;  3A3F A;  4ZJ3 A;  4R3A A;  4B4X A;  4OON A;  3BY8 A;  4JLF A;  2ZD8 A;  1YLW A;  1TEM A;  2XK1 A;  3TJZ C;  2PBY A;  1XFQ A;  4R3J A;  5HZH A;  3C38 A;  5EUA A;  3PXP A;  4HNB A;  3N6I A;  5EVL A;  1MKI A;  1FIK A;  4LLO B;  3A0S A;  4S2M A;  1ES4 A;  3N7W A;  3S4X A;  4M4X A;  1GHP A;  4R4S A;  1ES2 A;  4QB8 A;  3ULF A;  2ZBB A;  4WEJ A;  5FQJ A;  2XA7 M;  3T1R A;  2EX6 A;  1HD8 A;  1IYO A;  3NUL A;  3UPP A;  5HAR A;  1XXM A;  5AQA A;  2J9O A;  3UB8 A;  4UEY A;  3G30 A;  1OTA A;  3UPO A;  2QMI A;  3NDE A;  1P9W A;  1FCO A;  3CUE C;  3MKE A;  2V1Z A;  4YWZ A;  1CEF A;  1Y28 A;  1SKO A;  3FZC A;  3BEB A;  3IF6 C;  4L9G A;  4DDS A;  3N8R A;  4JF5 A;  5GLD A;  3OPL A;  1YKD A;  5KMW A;  2O0Y A;  2P74 A;  3LIF A;  3UB7 A;  1NYM A;  4U3T A;  3T1S A;  3IF6 A;  1VM1 A;  3F1P B;  2FFF B;  4JGO A;  1K56 A;  4EV4 A;  2B02 A;  1XJ6 A;  4PPR A;  2ZM8 A;  5FQI A;  2J8Y A;  1PNE A;  1S1Y A;  3ZNT A;  5CEB A;  5JYP A;  2JKG A;  4A5R A;  4MCW A;  4O8G A;  5GHY A;  2H5S A;  2VLG A;  1G28 A;  4YOF A;  1VEU B;  4R70 A;  2D01 A;  3NDG A;  1DY6 A;  3V3S A;  1KE0 A;  3C2W A;  3IH9 A;  1Y4O A;  2W3F A;  2GZA A;  3LIA A;  1NJ4 A;  3SH8 A;  1TS7 A;  1N9N A;  2HP9 A;  2Y55 A;  1GCE A;  3IX8 A;  4KEN B;  4MDZ A;  2GJ3 A;  5TFQ A;  4RVA A;  3Q7Z A;  1K55 A;  2WAF A;  1OT6 A;  2WAD A;  2YKH A;  4KQO A;  5J7E A;  4X68 A;  4FSF A;  4HOI A;  4BL2 A;  3IXH A;  4X1L A;  2B5R A;  2QJ5 A;  3N8S A;  4XT2 A;  4EU0 A;  4WF0 A;  3OOV A;  3C7V A;  3LGO A;  4GD8 A;  3T50 A;  3TOI A;  2VZW A;  3LI8 A;  2ZC5 B;  4MLL A;  4JXG A;  3V39 A;  1H8Y A;  1SHV A;  3E4Q A;  4PM5 A;  2X71 A;  5EOO A;  2HP5 A;  3FYZ A;  3JPU A;  2HDQ A;  1D1J A;  3TSG A;  4CLC C;  1ACF A;  3H7W A;  1OME A;  1JVJ A;  1W8Q A;  4DN0 A;  5CHM A;  1K0K A;  2VA0 A;  3ZDJ A;  1OPX A;  3K3C A;  2XEP A;  2JE5 A;  4JGR A;  5G18 A;  3VP2 A;  2X02 A;  1SKO B;  3MFX A;  4LEN A;  4GN2 A;  3P7N A;  1T1B A;  2I72 A;  2XRN A;  3IX3 A;  2WUQ A;  4WZ5 C;  4RA7 A;  3O88 A;  1TS0 A;  3B47 A;  2W3H A;  2CMN A;  5F82 A;  1MWU A;  4GDB A;  2PYP A;  1WA9 A;  1CEG A;  4HP4 A;  1M40 A;  5GL9 A;  3E98 A;  4WL9 A;  1MXO A;  4U0T A;  4EQ1 A;  5I94 A;  2Y91 A;  1YLJ A;  4CQH A;  3T4O A;  5FQQ A;  4WM9 A;  4FH2 A;  4MN5 A;  1N9L A;  2ZMA A;  1MC0 A;  2WAE A;  5KZH A;  1ONH A;  3UE6 A;  1W5D A;  2A24 B;  3GMW A;  3ZFZ A;  1JNU A;  4FOF A;  2JKR M;  5DKL A;  2VV8 A;  1XPB A;  4NK3 A;  3HLE A;  2INW A;  5HAI A;  2JCH A;  1XA7 A;  1MWS A;  4JXS A;  3UNW A;  2VGL S;  2EX9 A;  3WRT A;  1I2S A;  3SOI A;  5DVA A;  5EPH A;  1TD5 A;  1D06 A;  2LB5 A;  3CLO A;  5FI2 A;  4CPK A;  4OOM A;  1BZA A;  2IWB A;  4OQ0 A;  1KE3 A;  2ZJ9 A;  5F5Y A;  3CMZ A;  3G2Y A;  3IHB A;  4JGP A;  4KG5 A;  4WMC D;  2G2U A;  1PWD A;  4KZB A;  5E2F A;  5EVI C;  3VP3 A;  5E43 A;  5D3O A;  2ZL1 A;  4R1G A;  3UN7 A;  1T1A A;  2V2F F;  4WEL A;  1HLU P;  3T12 B;  1S1Z A;  1GA0 A;  4FD8 A;  2H0Y A;  3K3D A;  2WKI A;  4E3K A;  1PFL A;  4WUJ A;  4P0M A;  3A3E A;  1I2W A;  4O7D A;  4QU3 A;  3Q7V B;  5GLA A;  2H10 A;  1KDW A;  3E0Y A;  4WN5 A;  3GTC A;  4ZAM A;  3S1Y A;  3UE1 A;  3NOU C;  2ZC7 A;  3PBO A;  5A91 A;  4QY5 A;  4GHI B;  2WKE A;  2L1M A;  5HD3 A;  2JC7 A;  5HDC A;  3VP4 A;  2BG1 A;  1OJG A;  4EEP A;  3H7W B;  5L07 A;  1SKF A;  3AGE A;  4FTX A;  3ZVW A;  4Y5F A;  5HWV A;  2JKT M;  4ME4 A;  3A3J A;  5IS1 A;  2OAP 1;  2BLS A;  5FQ9 A;  5TBM B;  1WYB A;  3EQV A;  5J3W A;  2XF3 A;  3S7Q A;  5FL3 A;  3LI9 A;  2G2W A;  1NRF A;  3QP4 A;  2XGN A;  1NZO A;  1DP6 A;  4OOL A;  3VP1 A;  1ZTU A;  3GRJ A;  4NG2 A;  4LV2 A;  3NC8 A;  2J7V A;  4HES A;  3EEH A;  3FKW A;  3P98 A;  3GDI A;  2PU2 A;  4DDY A;  4PHT A;  3L7H A;  3CJM A;  1UWN X;  3W4O A;  4XUX A;  4BL3 A;  1XFN A;  3S7O A;  3CWF A;  4ARZ A;  4QJG A;  2XQZ A;  1UWP X;  5HSQ A;  3MFD A;  3D4F A;  4K0W A;  2EA9 A;  3Q1F A;  4S2I A;  2JBF A;  3Q81 A;  3BEC A;  3FG8 A;  2FZ0 A;  5DF7 A;  3E2K A;  4BBT A;  4Y0O A;  5DKK A;  1MWT A;  2R9W A;  5FI7 A;  4LV1 A;  4YFM A;  3UDF A;  3ZGA B;  4XT2 B;  3LO7 A;  1EI5 A;  1A0K A;  5GLC A;  2L4R A;  1J3W A;  3HLF A;  1PZO A;  5E2E A;  4NXF A;  1P97 A;  4N1H A;  4E6X A;  2WGI A;  1IEL A;  4E04 A;  4II7 A;  3S22 A;  3PR6 A;  4NXG A;  1QMF A;  4OPZ A;  1N9B A;  1FR6 A;  1Y54 A;  1DP8 A;  1RGY A;  5FQM A;  4R38 A;  4I3A A;  4MEZ A;  1ZHH B;  3I7J A;  5CXW A;  5TBM A;  1BTL A;  3CI6 A;  4PM7 A;  3BRM A;  2Q9N A;  4JXW A;  4H6J B;  5M1A A;  3QHY A;  1OTB A;  2VGK A;  3SW1 A;  3M2J A;  5DF9 A;  1FQG A;  3MBZ A;  2K2N A;  3IHA A;  1GSX A;  4EUZ A;  4DXB A;  1MZU A;  4WMC A;  3Q07 A;  3KSH A;  4ESP A;  2WK0 A;  4BWI A;  1ESI A;  4QHC A;  3HLW A;  3LUQ A;  3F1N B;  3F1N A;  3NHQ A;  3WS4 A;  4Q8I A;  2DCF A;  1W79 A;  1LSV A;  5CED A;  3NIA A;  4EW7 A;  4FUW A;  2PR5 A;  3CHW P;  3FWL A;  1F9I A;  2W1T A;  4IBR A;  4GOG A;  2A24 A;  3HL9 A;  1XJ4 A;  2QWS A;  4O0P A;  5CGX A;  4E3L A;  2HV1 A;  2JHE A;  3IF5 A;  4WLA A;  1FCN A;  2PAV P;  3OZH A;  2UV0 E;  2JN7 A;  3HUN A;  3RTY A;  4DRT A;  2HDU A;  4BQM A;  1J9M A;  4N1X A;  3KYQ A;  1RCJ A;  3DW0 A;  4LCM A;  4IJG A;  1VQQ A;  5EM1 A;  4QY6 A;  4JXV A;  4B88 A;  2J3T C;  4MMN A;  2XDM A;  1NLZ A;  5I5L A;  4K08 A;  2Y2G A;  3A0R A;  5AQ9 A;  3C30 A;  3IWQ A;  3U2A A;  4KQD A;  3CPT B;  1PZP A;  5LBR A;  4I3I A;  1M6K A;  3T4L A;  3B3X A;  1DJB A;  3VV4 A;  1H3Q A;  2Y2H A;  2WKH A;  2V0W A;  4P87 A;  3MS6 A;  3OPP A;  4H6J A;  3HJI A;  5CER A;  3R4K A;  2WZX A;  4Y7P A;  1ODV A;  3WRZ A;  4O01 A;  4N92 A;  4UAA A;  2BTF P;  4HJ3 A;  1CI9 A;  1HVB A;  1K54 A;  4R6L A;  3QNC A;  1I5Q A;  3QP6 A;  2ZQC A;  1OTD A;  2HJ9 C;  3U4L P;  3NY4 A;  1W63 M;  1YPR A;  1TS8 A;  2XA7 S; 
#chains in the Genus database with same CATH homology
 3A0V A;  3H7W A;  1NLY A;  2GX5 A;  2ZOH A;  3JVV A;  4DN0 A;  1EW0 A;  4G3W A;  1MKM A;  2VV7 A;  2VA0 A;  3V67 A;  2MJ6 A;  4L9F A;  2R78 A;  1OPX A;  4GLQ A;  3K3C A;  1D7E A;  4Z1W A;  1F5M A;  1OJ5 A;  2V1B A;  3LR5 A;  4JGR A;  4LRX C;  2IA2 A;  4DJ3 A;  4Y2F A;  3F1O B;  3MFX A;  3P01 A;  3P7N A;  1T1B A;  1KOU A;  2XRN A;  3T4J A;  1VHM A;  4CLC B;  3IBJ A;  1TS0 A;  3B47 A;  2W3H A;  3MMH A;  1LT0 A;  2CMN A;  1OTI A;  2HF6 A;  3RFB A;  4UQI S;  5L8M A;  2PYP A;  1WA9 A;  4NKP A;  4HP4 A;  2M7V A;  4GJ4 A;  5HL6 A;  3UB9 A;  3E98 A;  4WL9 A;  2XSS A;  1P9R A;  1P0Z A;  4EQ1 A;  4EEU A;  1F98 A;  1X0O A;  4CQH A;  3T4O A;  2V0U A;  3S7N A;  4BMW A;  4IHQ A;  3MR0 A;  1N9L A;  4MN5 A;  1MC0 A;  3UE6 A;  1H8M A;  3OCL A;  4P6Z M;  2P7J A;  3E4O A;  1T18 A;  5DFX A;  3OC2 A;  2A24 B;  3UE3 A;  1JNU A;  4FOF A;  2V9A A;  4ARZ B;  2JKR M;  2VV6 A;  5DKL A;  2Y8H A;  2VV8 A;  5A8B A;  3H9W A;  2INW A;  4L9E A;  2W3D A;  2OWH A;  4LPZ A;  2VGL S;  3B33 A;  2G7U A;  4ETZ A;  4NXB A;  3VOL A;  5HPF A;  1TD5 A;  4NEE D;  1D06 A;  2LB5 A;  3T4K A;  5HPI A;  5J4E A;  1T1C A;  4P6Z S;  3CLO A;  5TJJ A;  4KUK A;  4OOM A;  2W1R A;  2HJE A;  5F5Y A;  2OOL A;  3RH8 B;  2ZMV A;  3PBS A;  4CLC E;  3IS2 B;  4JGP A;  2LB9 A;  4HHD A;  3F1P A;  1GSV A;  3BQA A;  3MQQ A;  3LIC A;  3E4P A;  4HQA A;  1T1A A;  4PKY A;  4HIA A;  1S4R A;  2EWV A;  5AVF A;  4WEL A;  2ZOI A;  4LRZ E;  1S1Z A;  2K7S A;  2QKP A;  4DMZ A;  3MXQ A;  3K3D A;  2XRO A;  3HCY A;  3K2N A;  3MQO A;  5C5K A;  5HDD A;  3LID A;  4Q0H A;  3KSF A;  4CLC A;  3KYZ A;  4WUJ A;  4EET B;  3TW8 A;  3EGX C;  4JGQ A;  1VB6 A;  1NRJ A;  2M1C A;  3E0Y A;  4WN5 A;  4PKY G;  4EUV A;  2HGV A;  3R7W B;  2Z6C A;  5EFW A;  3BQ8 A;  3NOU C;  3ZYT A;  3PBO A;  4GHI B;  2L1M A;  3EOI A;  5HD3 A;  5HDC A;  2W1T B;  3IS2 A;  1OJG A;  4EEP A;  3H7W B;  3W2Z A;  3EEA A;  4QPR A;  4I38 A;  4HH3 A;  1IOU A;  1V9Y A;  5F68 A;  2H28 A;  4Y5F A;  5HWV A;  3CIT A;  2JKT M;  3G6O A;  1S67 L;  4ME4 A;  2O9B A;  3NOP C;  4GW9 A;  3B42 A;  5IS1 A;  2K31 A;  3HJK A;  2B18 A;  3GEC A;  2OAP 1;  3CAX A;  5TBM B;  3EQV A;  3PBR A;  2WKR A;  2W3G A;  3BWL A;  5J3W A;  2Z6D A;  3S7Q A;  5FL3 A;  3TRC A;  4B9O A;  3LI9 A;  3MJQ A;  2JKR I;  3PBN A;  3KSG A;  2EWW A;  4G3K A;  3KSI A;  4YNR A;  4HJ6 A;  1DP6 A;  4OOL A;  1ZTU A;  1BYW A;  3EQU A;  3R7W A;  3BW6 A;  3MF0 A;  1S4S A;  1YSQ A;  3EEH A;  4G3V A;  2JKT I;  3EGD C;  3OCN A;  4Y3I A;  2O9A A;  3GDI A;  5DJU A;  1TS6 A;  5IT5 A;  2NUT C;  4F3L B;  4PHT A;  1STZ A;  4I3J A;  2J3W A;  2M7U A;  1OTE A;  1UWN X;  3ICY A;  4MN6 A;  3BJN A;  1V9Z A;  4IUK A;  2OWJ A;  4L0L A;  2KX6 A;  3VE4 A;  2O9C A;  4CLC D;  1LSW A;  1XFN A;  4GHI A;  3CWF A;  5G4Z A;  3S7O A;  4ARZ A;  2W0N A;  5MC7 A;  4R3A A;  3EWK A;  1UWP X;  5HSQ A;  2I9V A;  1W63 Q;  1XJ2 A;  3OLO A;  3H82 B;  2EA9 A;  3C8C A;  3BY8 A;  2PYR A;  5HDS A;  2QYB A;  2DMW A;  4I39 A;  3FG8 A;  2FZ0 A;  5IU1 A;  2P04 A;  3TJZ C;  3T4S A;  2QHK A;  4BBT A;  5DKK A;  5DJT A;  3OBF A;  1XFQ A;  4GS9 A;  3FPW A;  5HZH A;  3MQ0 A;  4LRY C;  3C38 A;  3O5Y A;  3PXP A;  4HNB A;  3JVU A;  1GSW A;  4XT2 B;  4LLO B;  3A0S A;  3LIE A;  5HWW A;  3T4Q A;  2L4R A;  4M4X A;  2KOI A;  5DFY A;  2WKQ A;  4KUO A;  3CUE A;  3TE8 A;  4NXF A;  1P97 A;  4EXO A;  3ULF A;  2ZBB A;  4WEJ A;  4E04 A;  2XA7 M;  4II7 A;  3PYP A;  3PR6 A;  1NWZ A;  4NXG A;  2J80 A;  1UGU A;  4AFI A;  4UQI M;  1DP8 A;  2VJW A;  4HY8 A;  2YKF A;  3PBQ A;  2PT7 A;  4R38 A;  4I3A A;  1ZHH B;  3LR4 A;  5TBM A;  3CI6 A;  2NUP C;  5KIZ A;  3UB8 A;  4H6J B;  1LSX A;  4UEY A;  3PBT A;  5KSH A;  1OTB A;  1S66 L;  1OTA A;  3D3O A;  3SW1 A;  2VGL M;  5DF9 A;  1P9W A;  2K2N A;  2PR6 A;  3CUE C;  1GSX A;  3PHY A;  1LL8 A;  3KO6 A;  4YWZ A;  1MZU A;  1Y28 A;  4L9G A;  1DRM A;  2L0W A;  2O99 A;  3KSH A;  1TF1 A;  2GNX A;  5K5B A;  4MN7 A;  4BBV A;  4GS9 B;  4BWI A;  3LFV A;  5HWT A;  5HD5 A;  3LUQ A;  1YKD A;  3D72 A;  1T19 A;  2Y79 A;  3F1N B;  3F1N A;  2O0Y A;  3LIF A;  3NHQ A;  4Q0I A;  3UB7 A;  2ZMF A;  2FH5 A;  4HH2 A;  2XA7 S;  3S7P A;  4HP9 A;  3F1P B;  1LSV A;  2PD8 A;  3KX0 X;  2W27 A;  4JGO A;  2VEA A;  4EW7 A;  1OT9 A;  5AVE A;  4IUH A;  2PR5 A;  2B02 A;  1XJ6 A;  2P08 A;  3UB6 A;  3H82 A;  5F69 A;  1YSP A;  1IFQ A;  3FPV A;  1F9I A;  2VKS A;  1S1Y A;  2KLI A;  2D02 A;  2W1T A;  1N9O A;  2OAQ 1;  2PD7 A;  3VE3 A;  4MCW A;  4O8G A;  2A24 A;  2VLG A;  4F3L A;  1G28 A;  1XJ4 A;  4YOF A;  4R70 A;  2QWS A;  2D01 A;  4O0P A;  4PAU A;  4B93 A;  2HV1 A;  2JHE A;  3C2W A;  4BJP A;  4WLA A;  2W3F A;  3UME A;  2JN7 A;  2VX8 A;  3RTY A;  2GZA A;  3LIA A;  3KYQ A;  4EER A;  4GCZ A;  4IJG A;  1TS7 A;  4RQ9 A;  1N9N A;  1XJ3 A;  5F6A A;  4MDZ A;  3BY9 A;  2GJ3 A;  2J3T C;  4MMN A;  4I5S A;  2V1A A;  3DBA A;  1NLZ A;  5G4Y A;  3ZQ5 A;  3UMD A;  5I5L A;  2BAS A;  4K08 A;  3A0R A;  3C30 A;  3U2A A;  4KQD A;  5AJG A;  1OT6 A;  2PHY A;  2YKH A;  4NXE A;  5LBR A;  4HI4 A;  4I3I A;  4KQO A;  5J7E A;  4EES A;  4ZRR A;  4FSF A;  3T4L A;  4HOI A;  3VV4 A;  1H3Q A;  3LYX A;  3LIB A;  2V0W A;  3FC7 A;  1YAX A;  2QJ5 A;  3NJA A;  4XT2 A;  2PDR A;  4DJ2 A;  4EU0 A;  4WF0 A;  3OOV A;  4H6J A;  3HJI A;  4HJ4 A;  2QJ7 A;  3T4T A;  3R4K A;  3IBR A;  1DP9 A;  3T50 A;  2VZW A;  1ODV A;  3LI8 A;  2A2L A;  2KDK A;  4O01 A;  4HJ3 A;  4ETX A;  3LR0 A;  3E4Q A;  4WEK A;  3NOT C;  4BBU A;  4R6L A;  1G6O A;  3LR3 A;  1OTD A;  4Q0J A;  2WKP A;  2HJ9 C;  2W3E A;  2J3T D;  5CX7 A;  1W63 M;  4CLC C;  1TS8 A;  3F1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...