3UB8A

Periplasmic portion of the helicobacter pylori chemoreceptor tlpb with formamide bound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
157
structure length
157
Chain Sequence
MEHLETGQYKKREKTLAYMTKILEQGIHEYYKSFDNDTARKMALDYFKRINDDKGMIYMVVVDKNGVVLFDPVNPKTVGQSGLDAQSVDGVYYVRGYLEAAKKGGGYTYYKMPKYDGGVPEKKFAYSHYDEVSQMVIAATSYYTDINTENKAIKEGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and proposed mechanism for the pH-sensing Helicobacter pylori chemoreceptor TlpB.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Membrane protein
molecule keywords chemoreceptor TlpB
total genus 54
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17200 sCache_2 Single Cache domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ub8A00
5G4YA 4I3JA 1OJ5A 2VV8A 4HOIA 1ODVA 1V9ZA 3H82A 4WUJA 1X0OA 3LI8A 3IS2B 1DP8A 4PKYA 5HD5A 1LSXA 4MN5A 1F9IA 2PR5A 3EWKA 3PYPA 4EESA 4MN6A 3VOLA 1G28A 1T19A 3E4PA 1T1AA 4HI4A 4JGOA 2P7JA 1S1ZA 4LRYC 4H6JB 4NXEA 1TS6A 1KOUA 3A0VA 3H7WA 3LYXA 4HJ6A 4YWZA 5HWTA 3NOUC 3F1OB 5I5LA 5HDDA 2I9VA 2PYPA 3FC7A 3CAXA 3RTYA 2V0UA 3NOPC 3UMDA 4HQAA 3ZQ5A 4WF0A 3IBRA 4I3IA 2QJ7A 5AVFA 4KUKA 2R78A 3H7WB 4GS9A 3C8CA 3HJKA 5IS1A 5HZHA 2Z6DA 4KQDA 4EQ1A 5F69A 3E4OA 1XJ4A 1TS7A 5DJTA 4RQ9A 1D06A 1XJ2A 1XFQA 1UGUA 3NHQA 4GS9B 1S4SA 4HH2A 3F1NB 3FG8A 4LRZE 4R6LA 3NJAA 2PR6A 3MQQA 4K08A 1N9OA 5EFWA 3BY9A 3E4QA 2QWSA 3UB9A 2L1MA 3G6OA 2OWJA 4EW7A 1P97A 3MQOA 3F1PA 2VV6A 4I39A 4R70A 4F3LA 5IU1A 5A8BA 4NXGA 2YKFA 3BY8A 1LT0A 2L0WA 1OTIA 3LIAA 5HDCA 5F68A 1D7EA 2QKPA 1OTEA 4EETB 4JGQA 3ICYA 4HP4A 4F3LB 3LIFA 4HJ3A 2V9AA 4GW9A 4HHDA 2QJ5A 4L9GA 5J3WA 1LSWA 2KDKA 1OJGA 1S67L 4JGPA 4DJ3A 5HWWA 2J80A 1DP6A 1S1YA 1TS0A 4I5SA 4WN5A 1JNUA 2OWHA 1N9NA 1EW0A 2WKQA 3F1OA 3GDIA 2HV1A 1NWZA 1XJ6A 1GSXA 1MZUA 1DRMA 2D02A 2V1AA 3PHYA 5F6AA 5F5YA 5AVEA 3ULFA 2V1BA 3EEHA 4BBUA 2ZOIA 4EEUA 1TS8A 1UWPX 2BASA 1OTBA 2EA9A 2JHEA 3KX0X 4L9EA 2VLGA 5DJUA 5DKKA 1T1CA 1WA9A 1LSVA 2QHKA 2WKRA 2YKHA 3LI9A 1N9LA 5TBMB 4NXBA 5HDSA 3VE3A 3MFXA 1BYWA 3LIEA 3F1NA 3K3CA 4DJ2A 3A0RA 2H28A 2B02A 4HJ4A 4EXOA 1GSVA 3CLOA 3D72A 3LUQA 3MXQA 3F1PB 4I38A 1XFNA 2A24B 2PHYA 4XT2B 5HWVA 1S4RA 1DP9A 2M1CA 1OT6A 3T50A 4BBTA 4EEPA 2VEAA 2PD8A 1S66L 4GCZA 3HJIA 4WLAA 2K7SA 4WL9A 4BBVA 3UB8A 3H9WA 4M4XA 4EERA 2A24A 4L9FA 1Y28A 5HD3A 2Z6CA 3MR0A 4LPZA 3IS2A 2INWA 4GHIA 2W0NA 4B9OA 2PD7A 2WKPA 4HY8A 1UWNX 3VE4A 2W27A 4KUOA 5J4EA 3GECA 2CMNA 1V9YA 4H6JA 4HIAA 4HH3A 1VB6A 4R3AA 1OT9A 2V0WA 3LIBA 3RH8B 2OOLA 5KIZA 3UB7A 3SW1A 3C2WA 3P7NA 4PKYG 1T1BA 1GSWA 3LIDA 4LLOB 1OTDA 2PDRA 5DKLA 5TBMA 2ZBBA 3K3DA 3MJQA 3A0SA 3B33A 3BWLA 4R38A 3CWFA 1F98A 5G4ZA 4E04A 3NOTC 4HNBA 3UB6A 4HP9A 5HSQA 4GHIB 1P0ZA 3UE6A 1XJ3A 2JN7A 2ZOHA 2D01A 2L4RA 4I3AA 4NXFA 4XT2A 3UMEA 3H82B 1T18A 1OTAA 2PYRA 3LICA 4JGRA 4LRXC 1LL8A 2KX6A 2VV7A 3OLOA 5J7EA 2GJ3A
chains in the Genus database with same CATH superfamily
4FD8A 3G4PA 1SKFA 4LCMA 3C7VA 4MN6A 3S7NA 2P7JA 5HAPA 2JKTI 3FC7A 5KSHA 4WF0A 5FQMA 3E98A 1KGFA 3DWZA 1H8ZA 3PBNA 4Q8IA 5CRFA 3ZDJA 5L09A 4G3KA 2FFYA 3N4IA 2W3EA 4I39A 1ZTUA 1CJFA 3BLSA 5DF8A 3LIAA 4O7DA 1FQGA 3R7WB 2R9WA 4EETB 1JWPA 4N92A 3LIFA 2QJ5A 3O3VA 1XJ6A 3ZVTA 5FL3A 2XQZA 3FYZA 4OLGA 5I94A 3V5MA 2EA9A 4L9EA 2VLGA 2JCHA 4CLCE 1NZOA 4NXBA 3QNBA 1K38A 2XA7M 1XX2A 1BUEA 3PBRA 4HEFA 2VGJA 3CITA 4PPRA 4R3JA 2G7UA 4C75A 1VETB 4GNUA 4BBVA 5HD3A 4B9OA 3MXSA 4JBFA 2HDSA 3RXWA 1NYMA 1ALQA 5D3OA 1FR1A 2M7UA 4LLOB 2IA2A 2HJEA 2WGWB 2WK0A 1ONHA 3JVVA 4YINA 3G31A 1SDEA 4G3WA 4K91A 3HCYA 3IX8A 2VGLS 1X0OA 4DN0A 4OPZA 3WS0A 3VOLA 1PW1A 2KOIA 3PBOA 2PYPA 5C5KA 3CAXA 5HAQA 3M6BA 4GS9A 2EXAA 1W8QA 1TS7A 1BSGA 4LRZE 5DF7A 2M7VA 1BLCA 4NK3A 1TDGA 4U0XA 2L0WA 1OTIA 3M6HA 5CEBA 3WRTA 4HP4A 2VZWA 2OWHA 4LV1A 3HL9A 2X01A 1NXYA 1YMXA 4ETZA 3NI9A 1YSPA 4CLCC 3Q82A 3GV9A 1GSVA 3A3EA 4OOYA 3CLOA 1C3BA 3D72A 3Q07A 1YSQA 2VEAA 4HESA 4JF6A 1CI8A 5CGXA 2V20A 4DE0A 1FILA 3UDFA 3NCKA 3HLGA 2JC7A 1IKIA 5FQIA 4HH3A 2BG1A 4P0MA 3ZG0A 1JVJA 1CQAA 3SH9A 3C2WA 3MZFA 2ZC3B 5FDSA 4MDZA 2VKSA 4MMNA 3K3DA 4JF4A 3B33A 5G4ZA 2X02A 4GHIB 2JKFA 1LHYA 3VSKA 3OCNA 5EPHA 2JKRM 1K54C 3ZFZA 2ZD8A 1FCOA 1PW8A 3ZHHA 2ZMFA 1OJ5A 2VX8A 4PKYA 1S1ZA 3LYXA 4S2OA 3RJUA 3NOPC 3WWXA 5AVFA 3GMWA 1PRQA 4JXVA 4KG2A 4BENA 3MZEA 3IBJA 3GRJA 3LEZA 3OBFA 2CC1A 1S4SA 2ZM2A 4F3LA 4FH4A 4YNRA 2HJ9C 1ZKJA 4QJGA 1KE3A 4JGQA 3B42A 4KENB 4HHDA 4L9GA 1OJGA 1S67L 1FOFA 1U60A 3CPTA 3PBTA 3F1OA 4WELA 1OMEA 1ESIA 2ZM0A 5FEGA 4WBGA 5CGWA 5GLAA 3NECA 1XGJA 1F5MA 1BULA 5GHZA 2HDRA 1RGZA 4JF5A 2Y2PA 3UNWA 5L07A 2P04A 3HJIA 2EXBA 3S4XA 4M4XA 2DNSA 3MR0A 3O88A 3OPPA 2INWA 1K57C 4PM6A 4L0LA 3VE4A 5J4EA 2OAQ1 2H5SA 4IUHA 3QP6A 1IYOA 1KGEA 3S7QA 4D2OA 2E8IA 3NOTC 3UB6A 1M6KA 5HSQA 1IFQA 1XJ3A 2B5RA 1AWIA 5EVIC 3IF6B 1LL8A 2RL3A 2VV7A 4MLLA 1ES5A 4QWOA 3T12B 4ARZA 3IWQA 4KZ6A 3IS2B 3M2KA 2ZQCA 1KE0A 3NULA 4ARZB 4NXEA 3PTEA 1W79A 3CPTB 2ZQ9A 4Q0IA 2LB9A 4X55A 4BLMA 1FCMA 3V3SA 4DXCA 5KSCA 4DF6A 3QP5A 3Q81A 5DJTA 3CG5A 3KYEA 1WYBA 4BD1A 4R6LA 2NUTC 1J3WA 2OWJA 4OQHA 5EVLA 2VJWA 4MBHA 4WMCD 1KDWA 4DDYA 1DJAA 2Y2KA 1SKOA 3VMAA 3TE8A 1DP6A 3FKVA 3P01A 4N1HA 1FSYA 2V8CA 3R4KA 5EUAA 2EWVA 2QZ6A 4M3KA 4MBKA 4FH2A 3QP8A 3NDGA 3LI9A 3ITAA 1H5XA 4YOFA 4E3MA 2C6WB 4RX2A 1TEMA 1YAXA 3ZYTA 3F1PB 1NRJA 1OT6A 4N9KA 1Z6FA 3PAGA 5HPFA 3G2YA 4EERA 4P6BA 5CTMA 3P98A 1W7FA 3VP1A 2W0NA 3KO6A 2XFTA 3QP2A 1K56A 2HDUA 3W4QA 2OOLA 3SH7A 5TR7A 5IHVA 1W8YA 5FAPA 3MJQA 3IX4A 3N8SA 4Y2FA 1HVBA 2QMIA 2HZ5A 4CQHA 1ZG6A 1N4OA 3ZGAB 4LRXC 2KX6A 2XR0A 2A2LA 2XK1A 1TVFA 4QHCA 4WUJA 1MWRA 3E4PA 1LI0A 4H6JB 2Y2MA 3H7WA 3BYDA 2Y2QA 1ES4A 5EOEA 3UMDA 4KZ8A 1K6RA 1GHMA 2PU2A 2UWXA 5JYOA 1E4DA 4MEZA 3QNCA 3UO9A 4KQRA 1VEUB 5L2FA 1YLPA 3MQQA 3ZG7B 1PNEA 3F1PA 1VEUA 5A8BA 4B4ZA 4IVIA 2FH5A 5F68A 4E3NA 1K54A 3U4LP 2EX2A 3O87A 1XKZA 3A3IA 4I5SA 5GL9A 2W3DA 1GHPA 1UWPX 1L0EA 3AGFA 2QHKA 1WA9A 1LSVA 3F1NA 1ACFA 3MBZA 4NKPA 1K6SA 2Q0OA 3HBRA 3N6IA 2A24B 2ZQAA 1DP9A 3N8RA 4K0XA 5HARA 3IXGA 3SOIA 3OC2A 2HPBA 5JYPA 4HY8A 4H6JA 5TFQA 3IT9A 4R23A 2V0WA 4UA9A 5LBRA 3LEQA 5GLBA 2WGWA 1A0KA 3KYZA 3HUMA 2Y79A 4FTXA 1SZVA 3ITBA 4XT2A 2EX6A 1FR6A 5J7EA 1L3LA 2O9BA 1RCJA 3A3DA 2PR5A 1EROA 5HD5A 4LRYC 5E2FA 3MXRA 4EESA 3A0VA 3NOUC 4DE3A 3W8KA 3ZQ5A 4WEKA 5A90A 4WZ5C 5CHUA 5HZHA 4IJGA 4Y0OA 4FUWA 1H3QA 2DRWA 1XJ4A 2Y55A 1XJ2A 4Z9QA 4GS9B 4Q0HA 2A3UA 1WYCA 3NJAA 2EFUA 3U2AA 5EFWA 2W3FA 3L9KA 2B95A 2Z2MB 2L1MA 3S22A 4OONA 4E3JA 3G34A 3BY8A 1CEGA 5KMWA 5M1AA 2C5WB 4JLFA 3DTKA 4IBRA 5J3WA 4DXBA 1ERQA 4OQIA 1PIOA 1S1YA 5FI2A 4S2LA 1EW0A 2WKQA 4R0QA 5HW3A 1YM1A 1T1CA 1CEFA 2V2FF 3TRCA 3MFXA 1BYWA 4OP8A 4QY5A 3A3JA 3IH8A 2XSSA 1YLYA 3SS5A 3AGEA 3FPWA 2ZMAA 3BFGA 4FSFA 1K55A 2Y2LA 1AXBA 1JTGA 5FATA 1UWNX 4Y0UA 1OT9A 5TJJA 1Q2PA 4PKYG 4ZRRA 3KSGA 2G2UA 4IHQA 4P6ZS 1CF0A 2V8FA 2GNXA 4KZ4A 2ZL1A 3BFEA 3H82B 2GDNA 2PYRA 2A49A 2ZQ7A 2Y2HA 2XLNA 5CGSA 4IEDA 1V9ZA 1I2SA 5EVIB 2H10A 1T19A 2O9AA 4XUZA 4K0WA 4U0TA 4YWZA 1EWZA 3LY4A 4OQGA 4ESPA 3UDXA 3B47A 4S2NA 1LL5A 4S2PA 4RQ9A 1KGGA 4OLDA 4PAUA 1S0WA 4CLCA 4QPRA 2R9XA 1IOUA 3HLFA 3OCLA 3BY9A 3MQOA 2J9PA 4MN7A 4FCFA 3LY3A 1LT0A 2PBDP 3GSGA 3ICYA 4F3LB 2ZC4B 2V9AA 3JVUA 4UHUA 3C4PA 3V3RA 4LFUA 2GX5A 3UB5P 3EEHA 1GHIA 1OTBA 5DKKA 1L0GA 1I2WA 3DWKA 3K3CA 1E25A 4EXOA 2WAFA 4OPYA 4B4XA 4S2KA 3ZG9B 2EWWA 3IHAA 3DTIA 1XFNA 1K55C 3MQ0A 3UY6A 1Y54A 3HLEA 4GCZA 4DE1A 1MBLA 1DJCA 5KZHA 1XA1A 2Z6CA 2VK3A 4PMAA 2FZ0A 3S7PA 1L0FA 4DE2A 4UEYA 4JXSA 3C30A 5KIZA 2GZAA 4Y7PA 1YLWA 4X53A 3A0SA 4E3OA 3GTCA 3WS4A 2ACGA 2WKEA 2J8YA 5AQ9A 1J9MA 3NIAA 1HZOA 3UMEA 1T18A 3L7HA 4PM9A 1BLHA 4ID4A 3O5YA 4GDNA 4UA6A 1XPBA 3QP4A 1K4EA 3VSLA 1MY8A 5IS1A 3AGDA 3KSHA 2HGVA 2V0UA 5DFXA 4B93A 4ZJ2A 3VOZA 3E4OA 3T4SA 2P9VA 5FQKA 4E6XA 3V39A 4K08A 1NLYA 5F1FA 1IYSA 4NXGA 2XFSA 1OTEA 4U3TA 3TW8A 2XROA 3CMZA 2UV0E 1LSWA 1TS0A 5EOOA 1SKOB 3ULFA 5CHMA 4BBUA 5DTKA 4GKUA 2WKRA 4BJPA 1N9LA 4N9LA 4RYEA 3LIEA 2Y2IA 2X71A 4LENA 3LUQA 2B18A 3FPVA 4S2NC 4UA7A 5FSRA 4JXGA 2KLIA 1MPLA 5FEFA 2XD5A 3W2ZA 3NDEA 3I7JA 2J3TD 3GECA 2ZQDA 1VB6A 3LIBA 1QMEA 4BMWA 2JBFA 3NBLA 1DY6A 2ZC5B 3V50A 1ES3A 1G6AA 1D1JA 3ZNTA 4E6WA 3SS3A 3ISGA 4EV4A 1S6RA 4JGRA 3P09A 3N7WA 5A92A 3W4OA 3MF0A 1O07A 4KQQA 2WZZA 4HI4A 3UB8A 4GZBA 4R4RA 5HWTA 2I9VA 2XF3A 4I3IA 3LCEA 3LO7A 5L8MA 2Y2GA 3C4OA 3H7WB 2XGNA 3ZVWA 1YLZA 2W1TA 3PXPA 2BTFP 4LV0A 1P97A 1IELA 4MNRA 5F82A 4LCLA 1KVLA 4UQIS 2G2WA 3EGDC 1GSXA 1ZHHB 3PHYA 3DTMA 3BEBA 2XDMA 5DJUA 1H0MA 5TBMB 1ERMA 4IVKA 1GA0A 3M2JA 2J9OA 4HJ4A 5FAOA 3T50A 4L9FA 3GQZA 1BLPA 3OPLA 1VETA 2WKPA 4JPMA 3V67A 2CMNA 3E2KA 3G30A 4X1LA 3UDIA 1G5UA 4E3IA 3BM6A 2IWCA 2JKTM 4EU0A 4QD4A 3PBSA 3G2ZA 1PWDA 4BQMA 1OPXA 1ZG4A 4S2JA 1XGIA 4GD8A 3TSGA 5BOHA 5TGFA 3MKFA 2DMWA 5EV0A 4O01A 2XA7S 4EWFA 1BLSA 2GJ3A 3N8LA 5HX9A 2OV5A 4AFIA 2BLSA 3DAVA 3OOVA 4Q0JA 4PM7A 4ZJ1A 5CECA 5DF9A 4XXRA 1G28A 1LI9A 4PM5A 4PM8A 4HQAA 4Y17A 2H0YA 4KUKA 2ZQ8A 3WRZA 4RA7A 5L10A 1XFQA 1GA9A 3F1NB 1YT4A 2WKIA 3T1SA 1W5DA 3T4KA 4II7A 1D7EA 1FIKA 3LR5A 5HFOA 5EVIA 5FQJA 3HUNA 5HWWA 3OLOA 4DJ3A 2RCXA 2K31A 1EI5A 1MZUA 1STZA 2V1AA 4BL2A 2JHEA 2YKHA 3UE3A 1MWTA 2V1ZA 4KZ5A 3MXQA 2VGKA 3VP4A 4XT2B 3CUEA 4WLAA 2K7SA 4D60A 2PD7A 3EGXC 4Y3IA 2HP9A 3IH9A 1YKDA 2Q9NA 3KSFA 3MFDA 3B3XA 4X68A 3G32A 1P0ZA 4LGWA 4X56A 3LICA 4GHIA 5G4YA 4CPKA 1ODVA 1CK3A 4OQ0A 1F9IA 4QU3A 3TJZC 4CLCD 1T1AA 2PAVP 4KZAA 1TS6A 4HJ6A 3CJMA 3WS5A 2I72A 3CZDA 1ZC2A 3JYIA 2R78A 5E2HA 3HJKA 3O86A 3S7OA 4CLCB 3T1RA 1RP5A 1HD8A 4IBXA 3VOYA 3IF6A 3UB9A 1MXOA 3E4QA 4EW7A 1F2KA 2YKFA 4P6ZM 2NUPC 3SS4A 5HDCA 4LV2A 4C3QA 3KSIA 5AJGA 3PAEA 4OH0A 4WZ5A 2IWDA 3FWLA 1PYYA 1O7EA 3T4QA 3GDIA 5GHYA 5F6AA 3VE3A 3LR0A 3CHWP 5M18A 2MJ6A 2P9VB 3QP1A 3EEAA 3OZHA 5DTTA 5FQQA 4ZDXA 3E2LA 2P08A 2W3GA 5CTNA 2PD8A 1BT5A 1MWSA 1PWGA 3T1XA 2JKRI 3GR2A 2J3TC 3LFVA 2ZM8A 3HLWA 5HL1A 4A5RA 1K57A 3IWOA 3Q7VB 4KZBA 3UB7A 1SDNA 1GSWA 4OOMA 3BQAA 2WUQA 3BWLA 3MZDA 3CWFA 1F98A 1QMFA 4KZ3A 4NXFA 5IT5A 2HF6A 1NRFA 1DP8A 2WAEA 2EX8A 4MN5A 3C7UA 4Y5FA 5IU1A 1Y4OA 3F1OB 5HDDA 3ZG5A 1XP4A 3UN7A 4X69A 2ZMVA 3KYQA 4OPRA 3ZG8B 1YQSA 2PBYA 5CHJA 4RX3A 1UGUA 3T4JA 4PHTA 4R70A 2OLUA 2QKPA 5GHXA 3HLCA 4GLQA 4Y15A 4YFMA 2W3HA 2E8JA 3D3OA 4Z1WA 5AVEA 1TS8A 4GN2A 4GOGA 1IEMA 5GLCA 1IYQA 3HUOA 3IHBA 5MC7A 4GB7A 4CJNA 2PHYA 4F94A 4N1XA 5EECA 3IQAA 4WMCA 4FOFA 3TOIA 3IS2A 4HBUA 1V9YA 3SZTA 4UAAA 3RH8B 4MBFA 3P7NA 1KE4A 2XEPA 1E3UA 1OTDA 5TBMA 1YLTA 5DKLA 4ZTKA 4R38A 5FQ9A 4HNBA 3Q1FA 3BJNA 1PI4A 3DBAA 1ONGA 2VV8A 3VV4A 4BL3A 4DRTA 4OVDA 1LSXA 3VP3A 3UPOA 2XH9A 5EVEA 3IF5A 4KG5A 3MS6A 1Z09A 2QJ7A 3T4LA 5F83A 2WKHA 4LV3A 1M40A 2W1RA 4GJ4A 3NHQA 3IX3A 4EBPA 4GD6A 5HPIA 4XUXA 3DW0A 2OAP1 2KDKA 4WN5A 3T4OA 5HAIA 2D02A 3OPHA 5AQAA 5M19A 3A3FA 3QHYA 1K4FA 4X1MA 2B02A 5GLDA 3EQUA 4KQOA 3LGOA 5DTSA 4EEPA 1YPRA 3BQ8A 4DKIA 5DVAA 3NC8A 4WL9A 3H9WA 2A24A 3MSHA 4LPZA 2O9CA 2WGIA 4P87A 1PFLA 1XXMA 4QY6A 3FKWA 4NG2A 3IF6C 3RFBA 1YLJA 4UQIM 2OSUA 2HP6A 2PT7A 3DTEA 3IXHA 3UPNA 3UE6A 2PRFA 5FI7A 1MC0A 3MMHA 2H0TA 2Y4AA 5E2EA 3VP2A 5EE8A 4HOIA 1NZUA 3LI8A 1BTLA 1VQQA 3EWKA 3PYPA 4EUVA 3SH8A 4JGOA 1Q2QA 3W4PA 4EUZA 2DCFA 2O0YA 4E3KA 3BW6A 2QYBA 2ZJ9A 4EQ1A 1P9WA 2Z2LB 1HLUP 4OP5A 2LB5A 2VA0A 2PR6A 4IUKA 4NETA 4QB8A 3JPUA 1NYYA 3G6OA 4BWIA 1G68A 5E2GA 5CERA 5F1GA 1PZPA 3T1QB 4GW9A 3C38A 4WEJA 1JWVA 2J3WA 2J7VA 2J80A 4KZ7A 4ZJ3A 1N9NA 5J8XA 2WYXA 5F5YA 3D4FA 5AQBA 2V1BA 1RGYA 4ZBEA 1L0DA 4DMZA 2H28A 3Q7ZA 4B88A 2WGVA 3VFFA 4I38A 1GCEA 1S4RA 5U47A 4BD0A 4WYYA 2WZXA 3HVFA 1E3UD 3IXBA 1TD5A 3HLBA 3ZCZA 1NJ4A 4KUOA 2HDQA 3SW1A 2AVXA 2WADA 1T1BA 2O99A 1DJBA 1PI5A 3LIDA 2PDRA 1NY0A 2Y2NA 3HREA 3NY4A 3BECA 4HP9A 3VFHA 5HL6A 2L4RA 1OTAA 4I3JA 2ZL1B 1HTZA 2Q9MA 4EBNA 3H82A 2JE5A 2Y2OA 1WE4A 1KDSA 1KVMA 3C5AA 3HLDA 3RTYA 3Q7VA 4X6TA 3IBRA 4O8GA 3LR3A 3WS1A 3C8CA 2ZLYA 2Z6DA 2P74A 4WZ4A 4KQDA 1YMSA 4JXWA 3UE1A 3FG8A 2QWSA 4OOLA 2XRNA 2VV6A 5CXWA 4ETXA 1G6OA 1I5QA 2XD1A 4HBTA 2ZC7A 4NEED 4HJ3A 4C6YA 4JGPA 5A93A 4O0PA 4R1GA 3G35A 1MWUA 2VGLM 5A91A 4OPQA 2HV1A 1NWZA 5FDHA 1DRMA 3UE0A 2BASA 3FZCA 1JWZA 3KX0X 1SHVA 4X25A 3RXXA 3PR6A 1FCNA 1L2SA 1PZOA 1BZAA 1MKIA 1TDLA 3TG9A 4P85A 4S2IA 2EX9A 5HWVA 2FFFB 2PU4A 4Y13A 1S66L 1P9RA 1H8YA 1K0KA 4RVAA 4H8RA 5DFYA 5EM0A 3IWIA 5CEDA 4OKPA 3CI6A 1LL9A 5EM1A 4R4SA 3BLMA 3IXDA 1FSWA 1XA7A 3E0YA 3UPPA 3BFFA 2HP5A 1IYPA 1JTDA 5CX7A 1SCWA 5G18A 2QPNA 1MKMA 2ZOHA 5FASA 4GDBA 5E43A 3K2NA 1N9BA 2JKGA 1K56D 4MCWA 4R3BA 3LR4A 3EOIA 1KOUA 5FAQA 2OLVA 4ZAMA 5I5LA 2Y2JA 4EQIA 4ME4A 3GVBA 5FI6A 5F69A 1TF1A 1D06A 4Y0TA 1PWCA 3EQVA 4HH2A 3T4TA 3D9YA 1N9OA 1W63Q 3MKEA 1ESUA 2Y8HA 2IWBA 3ZNYA 3BFDA 4DDSA 3S1YA 3CUEC 3VP0A 1JNUA 4G3VA 1CI9A 1ES2A 3OPRA 2ZOIA 4EEUA 1K25A 3FV7A 2W1TB 5HDSA 4DJ2A 3BFCA 3A0RA 4KG6A 3PBQA 2K2NA 1NLZA 1LLBA 2M1CA 4BBTA 3R7WA 2EFXA 5K5BA 1Y28A 1W63M 4JKTA 3WS2A 2ZC6B 4E3LA 1H8MA 2W27A 4EBLA 4HIAA 4R3AA 1VHMA 3BRMA 4S2MA 4WM9A 2Y91A 2ZBBA 5AQ7A 4E04A 1IKGA 4KZ9A 2Y59A 1VM1A 2JN7A 2D01A 4I3AA 5EVID 5FA7A
chains in the Genus database with same CATH topology
2VV8A 3MF0A 3VV4A 4WUJA 1LSXA 4MN6A 3E4PA 4HI4A 3S7NA 2P7JA 3UB8A 4H6JB 3H7WA 5HWTA 2JKTI 2I9VA 3FC7A 3UMDA 5KSHA 4WF0A 4I3IA 3E98A 2QJ7A 5L8MA 3H7WB 3T4LA 3PBNA 2W1RA 2W1TA 3PXPA 4GJ4A 3NHQA 3MQQA 4G3KA 1P97A 2W3EA 3F1PA 4I39A 5A8BA 1ZTUA 3LIAA 5F68A 2FH5A 5HPIA 3R7WB 4EETB 3LIFA 2QJ5A 2OAP1 2KDKA 4UQIS 4I5SA 4WN5A 3T4OA 3EGDC 2D02A 1XJ6A 1GSXA 1ZHHB 5FL3A 2W3DA 3PHYA 1UWPX 2EA9A 4L9EA 2VLGA 5DJUA 2QHKA 1WA9A 1LSVA 4CLCE 5TBMB 4NXBA 3F1NA 2B02A 4HJ4A 2XA7M 3EQUA 4NKPA 4KQOA 3PBRA 3CITA 2A24B 1DP9A 2G7UA 3T50A 4EEPA 3BQ8A 4WL9A 4BBVA 3H9WA 2A24A 4L9FA 5HD3A 4LPZA 2O9CA 3OC2A 4B9OA 2WKPA 4HY8A 3V67A 2CMNA 4H6JA 3RFBA 2V0WA 5LBRA 4UQIM 3KYZA 2M7UA 4LLOB 2JKTM 2IA2A 4EU0A 2PT7A 2Y79A 2HJEA 3PBSA 1OPXA 3JVVA 3UE6A 1MC0A 3MMHA 4XT2A 2DMWA 4G3WA 4O01A 5J7EA 2XA7S 2GJ3A 4AFIA 3HCYA 4HOIA 2O9BA 3OOVA 4Q0JA 2VGLS 1X0OA 3LI8A 4DN0A 2PR5A 5DF9A 3EWKA 3PYPA 4EUVA 3VOLA 1G28A 5HD5A 4JGOA 4LRYC 4EESA 2KOIA 3PBOA 3A0VA 3NOUC 2PYPA 5C5KA 3CAXA 4HQAA 4WEKA 3ZQ5A 4KUKA 4GS9A 2O0YA 5HZHA 4IJGA 1H3QA 3BW6A 2QYBA 4EQ1A 1XJ4A 1P9WA 1TS7A 1XJ2A 1XFQA 4GS9B 3F1NB 4LRZE 4Q0HA 2LB5A 2VA0A 2PR6A 3NJAA 4IUKA 3U2AA 5EFWA 2M7VA 2W3FA 2L1MA 3G6OA 4BWIA 3BY8A 2L0WA 1OTIA 3T4KA 4II7A 1D7EA 3LR5A 4HP4A 4GW9A 5J3WA 3C38A 4WEJA 2VZWA 5HWWA 2J3WA 2J80A 1S1YA 4DJ3A 2OWHA 1N9NA 1EW0A 2K31A 2WKQA 1MZUA 1STZA 2V1AA 5F5YA 2V1BA 4ETZA 2JHEA 1T1CA 2YKHA 1YSPA 3UE3A 3TRCA 3MFXA 1BYWA 4CLCC 4DMZA 2H28A 1GSVA 3CLOA 3D72A 3MXQA 2XSSA 4I38A 4XT2B 1YSQA 1S4RA 3CUEA 2VEAA 3FPWA 4WLAA 2K7SA 4FSFA 1TD5A 2PD7A 3EGXC 4Y3IA 1UWNX 4KUOA 4HH3A 1OT9A 1YKDA 5TJJA 3SW1A 3KSFA 3C2WA 4PKYG 1T1BA 2O99A 3LIDA 4MDZA 2PDRA 2VKSA 4MMNA 4ZRRA 3K3DA 3B33A 5G4ZA 3KSGA 4IHQA 4HP9A 4P6ZS 4GHIB 1P0ZA 2GNXA 3OCNA 5HL6A 2L4RA 2JKRM 3H82B 1OTAA 2PYRA 3LICA 4GHIA 2ZMFA 4I3JA 5G4YA 1OJ5A 2VX8A 1ODVA 1V9ZA 3H82A 4PKYA 1F9IA 3TJZC 1T19A 4CLCD 1T1AA 2O9AA 1S1ZA 1TS6A 3LYXA 4HJ6A 4YWZA 3RTYA 3NOPC 3IBRA 4O8GA 3LR3A 5AVFA 2R78A 3C8CA 3HJKA 3S7OA 2Z6DA 4CLCB 3B47A 4KQDA 3IBJA 4RQ9A 3OBFA 1S4SA 3FG8A 4PAUA 4CLCA 4QPRA 1IOUA 3OCLA 3UB9A 3BY9A 3E4QA 2QWSA 4OOLA 4EW7A 2XRNA 3MQOA 2VV6A 4MN7A 4F3LA 2YKFA 4P6ZM 1LT0A 2NUPC 4ETXA 1G6OA 4YNRA 5HDCA 2HJ9C 3KSIA 4NEED 5AJGA 4JGQA 3ICYA 4F3LB 4HJ3A 3B42A 2V9AA 4HHDA 4L9GA 4JGPA 1OJGA 1S67L 3JVUA 4O0PA 3PBTA 3T4QA 2VGLM 3F1OA 3GDIA 3VE3A 2HV1A 1NWZA 4WELA 5F6AA 3LR0A 1DRMA 2GX5A 3EEHA 2BASA 1OTBA 3KX0X 2MJ6A 5DKKA 1F5MA 3EEAA 3PR6A 3K3CA 4EXOA 2P08A 2W3GA 2EWWA 1XFNA 3MQ0A 5HWVA 2P04A 2PD8A 1S66L 1P9RA 4GCZA 3HJIA 4M4XA 2JKRI 5DFYA 2J3TC 2Z6CA 3MR0A 2INWA 3LFVA 2FZ0A 3S7PA 4L0LA 3VE4A 3CI6A 4UEYA 5J4EA 2OAQ1 3C30A 4IUHA 2GZAA 3UB7A 5KIZA 3E0YA 1GSWA 3S7QA 4OOMA 3BQAA 3A0SA 3BWLA 3CWFA 1F98A 3NOTC 5CX7A 3UB6A 5HSQA 1MKMA 1IFQA 1XJ3A 2ZOHA 4NXFA 3UMEA 5IT5A 2HF6A 1T18A 3K2NA 1LL8A 2VV7A 3O5YA 4ARZA 4MCWA 3IS2B 1DP8A 3LR4A 4MN5A 4Y5FA 3EOIA 4ARZB 4NXEA 5IS1A 5IU1A 1KOUA 5I5LA 3F1OB 3KSHA 5HDDA 2HGVA 2V0UA 4Q0IA 2LB9A 5DFXA 4B93A 2ZMVA 4ME4A 3KYQA 5F69A 3E4OA 3T4SA 5DJTA 1TF1A 1D06A 1UGUA 3EQVA 4HH2A 3T4TA 4R6LA 3T4JA 4PHTA 2NUTC 1N9OA 4K08A 1NLYA 1W63Q 2OWJA 4R70A 2VJWA 4NXGA 2Y8HA 2QKPA 1OTEA 3TW8A 4GLQA 2XROA 2W3HA 3D3OA 3TE8A 1LSWA 3CUEC 1DP6A 1TS0A 3P01A 1JNUA 4Z1WA 4G3VA 3R4KA 2EWVA 5AVEA 3ULFA 4BBUA 2ZOIA 4EEUA 1TS8A 3LI9A 2WKRA 4BJPA 1N9LA 2W1TB 5HDSA 3LIEA 4DJ2A 3A0RA 4YOFA 3PBQA 1YAXA 3LUQA 2B18A 3FPVA 3ZYTA 3F1PB 2K2NA 1NLZA 5MC7A 2PHYA 2M1CA 1NRJA 1OT6A 4BBTA 2KLIA 5HPFA 3R7WA 3W2ZA 4FOFA 4EERA 5K5BA 1Y28A 1W63M 3IS2A 2J3TD 2W0NA 1H8MA 3KO6A 2W27A 3GECA 1V9YA 4HIAA 1VB6A 4R3AA 1VHMA 3LIBA 3RH8B 2OOLA 3P7NA 4BMWA 1OTDA 5DKLA 5TBMA 2ZBBA 3MJQA 4R38A 4E04A 4HNBA 4Y2FA 2JN7A 2D01A 4I3AA 3BJNA 4CQHA 4LRXC 3DBAA 4JGRA 2KX6A 3OLOA 2A2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G4Y A;  4I3J A;  1OJ5 A;  2VV8 A;  4HOI A;  1ODV A;  1V9Z A;  3H82 A;  4WUJ A;  1X0O A;  3LI8 A;  3IS2 B;  1DP8 A;  4PKY A;  5HD5 A;  1LSX A;  4MN5 A;  1F9I A;  2PR5 A;  3EWK A;  3PYP A;  4EES A;  4MN6 A;  3VOL A;  1G28 A;  1T19 A;  3E4P A;  1T1A A;  4HI4 A;  4JGO A;  2P7J A;  1S1Z A;  4LRY C;  4H6J B;  4NXE A;  1TS6 A;  1KOU A;  3A0V A;  3H7W A;  3LYX A;  4HJ6 A;  4YWZ A;  5HWT A;  3NOU C;  3F1O B;  5I5L A;  5HDD A;  2I9V A;  2PYP A;  3FC7 A;  3CAX A;  3RTY A;  2V0U A;  3NOP C;  3UMD A;  4HQA A;  3ZQ5 A;  4WF0 A;  3IBR A;  4I3I A;  2QJ7 A;  5AVF A;  4KUK A;  2R78 A;  3H7W B;  4GS9 A;  3C8C A;  3HJK A;  5IS1 A;  5HZH A;  2Z6D A;  4KQD A;  4EQ1 A;  5F69 A;  3E4O A;  1XJ4 A;  1TS7 A;  5DJT A;  4RQ9 A;  1D06 A;  1XJ2 A;  1XFQ A;  1UGU A;  3NHQ A;  4GS9 B;  1S4S A;  4HH2 A;  3F1N B;  3FG8 A;  4LRZ E;  4R6L A;  3NJA A;  2PR6 A;  3MQQ A;  4K08 A;  1N9O A;  5EFW A;  3BY9 A;  3E4Q A;  2QWS A;  3UB9 A;  2L1M A;  3G6O A;  2OWJ A;  4EW7 A;  1P97 A;  3MQO A;  3F1P A;  2VV6 A;  4I39 A;  4R70 A;  4F3L A;  5IU1 A;  5A8B A;  4NXG A;  2YKF A;  3BY8 A;  1LT0 A;  2L0W A;  1OTI A;  3LIA A;  5HDC A;  5F68 A;  1D7E A;  2QKP A;  1OTE A;  4EET B;  4JGQ A;  3ICY A;  4HP4 A;  4F3L B;  3LIF A;  4HJ3 A;  2V9A A;  4GW9 A;  4HHD A;  2QJ5 A;  4L9G A;  5J3W A;  1LSW A;  2KDK A;  1OJG A;  1S67 L;  4JGP A;  4DJ3 A;  5HWW A;  2J80 A;  1DP6 A;  1S1Y A;  1TS0 A;  4I5S A;  4WN5 A;  1JNU A;  2OWH A;  1N9N A;  1EW0 A;  2WKQ A;  3F1O A;  3GDI A;  2HV1 A;  1NWZ A;  1XJ6 A;  1GSX A;  1MZU A;  1DRM A;  2D02 A;  2V1A A;  3PHY A;  5F6A A;  5F5Y A;  5AVE A;  3ULF A;  2V1B A;  3EEH A;  4BBU A;  2ZOI A;  4EEU A;  1TS8 A;  1UWP X;  2BAS A;  1OTB A;  2EA9 A;  2JHE A;  3KX0 X;  4L9E A;  2VLG A;  5DJU A;  5DKK A;  1T1C A;  1WA9 A;  1LSV A;  2QHK A;  2WKR A;  2YKH A;  3LI9 A;  1N9L A;  5TBM B;  4NXB A;  5HDS A;  3VE3 A;  3MFX A;  1BYW A;  3LIE A;  3F1N A;  3K3C A;  4DJ2 A;  3A0R A;  2H28 A;  2B02 A;  4HJ4 A;  4EXO A;  1GSV A;  3CLO A;  3D72 A;  3LUQ A;  3MXQ A;  3F1P B;  4I38 A;  1XFN A;  2A24 B;  2PHY A;  4XT2 B;  5HWV A;  1S4R A;  1DP9 A;  2M1C A;  1OT6 A;  3T50 A;  4BBT A;  4EEP A;  2VEA A;  2PD8 A;  1S66 L;  4GCZ A;  3HJI A;  4WLA A;  2K7S A;  4WL9 A;  4BBV A;  3UB8 A;  3H9W A;  4M4X A;  4EER A;  2A24 A;  4L9F A;  1Y28 A;  5HD3 A;  2Z6C A;  3MR0 A;  4LPZ A;  3IS2 A;  2INW A;  4GHI A;  2W0N A;  4B9O A;  2PD7 A;  2WKP A;  4HY8 A;  1UWN X;  3VE4 A;  2W27 A;  4KUO A;  5J4E A;  3GEC A;  2CMN A;  1V9Y A;  4H6J A;  4HIA A;  4HH3 A;  1VB6 A;  4R3A A;  1OT9 A;  2V0W A;  3LIB A;  3RH8 B;  2OOL A;  5KIZ A;  3UB7 A;  3SW1 A;  3C2W A;  3P7N A;  4PKY G;  1T1B A;  1GSW A;  3LID A;  4LLO B;  1OTD A;  2PDR A;  5DKL A;  5TBM A;  2ZBB A;  3K3D A;  3MJQ A;  3A0S A;  3B33 A;  3BWL A;  4R38 A;  3CWF A;  1F98 A;  5G4Z A;  4E04 A;  3NOT C;  4HNB A;  3UB6 A;  4HP9 A;  5HSQ A;  4GHI B;  1P0Z A;  3UE6 A;  1XJ3 A;  2JN7 A;  2ZOH A;  2D01 A;  2L4R A;  4I3A A;  4NXF A;  4XT2 A;  3UME A;  3H82 B;  1T18 A;  1OTA A;  2PYR A;  3LIC A;  4JGR A;  4LRX C;  1LL8 A;  2KX6 A;  2VV7 A;  3OLO A;  5J7E A;  2GJ3 A; 
#chains in the Genus database with same CATH topology
 4FD8 A;  3G4P A;  1SKF A;  4LCM A;  3C7V A;  4MN6 A;  3S7N A;  2P7J A;  5HAP A;  2JKT I;  3FC7 A;  5KSH A;  4WF0 A;  5FQM A;  3E98 A;  1KGF A;  3DWZ A;  1H8Z A;  3PBN A;  4Q8I A;  5CRF A;  3ZDJ A;  5L09 A;  4G3K A;  2FFY A;  3N4I A;  2W3E A;  4I39 A;  1ZTU A;  1CJF A;  3BLS A;  5DF8 A;  3LIA A;  4O7D A;  1FQG A;  3R7W B;  2R9W A;  4EET B;  1JWP A;  4N92 A;  3LIF A;  2QJ5 A;  3O3V A;  1XJ6 A;  3ZVT A;  5FL3 A;  2XQZ A;  3FYZ A;  4OLG A;  5I94 A;  3V5M A;  2EA9 A;  4L9E A;  2VLG A;  2JCH A;  4CLC E;  1NZO A;  4NXB A;  3QNB A;  1K38 A;  2XA7 M;  1XX2 A;  1BUE A;  3PBR A;  4HEF A;  2VGJ A;  3CIT A;  4PPR A;  4R3J A;  2G7U A;  4C75 A;  1VET B;  4GNU A;  4BBV A;  5HD3 A;  4B9O A;  3MXS A;  4JBF A;  2HDS A;  3RXW A;  1NYM A;  1ALQ A;  5D3O A;  1FR1 A;  2M7U A;  4LLO B;  2IA2 A;  2HJE A;  2WGW B;  2WK0 A;  1ONH A;  3JVV A;  4YIN A;  3G31 A;  1SDE A;  4G3W A;  4K91 A;  3HCY A;  3IX8 A;  2VGL S;  1X0O A;  4DN0 A;  4OPZ A;  3WS0 A;  3VOL A;  1PW1 A;  2KOI A;  3PBO A;  2PYP A;  5C5K A;  3CAX A;  5HAQ A;  3M6B A;  4GS9 A;  2EXA A;  1W8Q A;  1TS7 A;  1BSG A;  4LRZ E;  5DF7 A;  2M7V A;  1BLC A;  4NK3 A;  1TDG A;  4U0X A;  2L0W A;  1OTI A;  3M6H A;  5CEB A;  3WRT A;  4HP4 A;  2VZW A;  2OWH A;  4LV1 A;  3HL9 A;  2X01 A;  1NXY A;  1YMX A;  4ETZ A;  3NI9 A;  1YSP A;  4CLC C;  3Q82 A;  3GV9 A;  1GSV A;  3A3E A;  4OOY A;  3CLO A;  1C3B A;  3D72 A;  3Q07 A;  1YSQ A;  2VEA A;  4HES A;  4JF6 A;  1CI8 A;  5CGX A;  2V20 A;  4DE0 A;  1FIL A;  3UDF A;  3NCK A;  3HLG A;  2JC7 A;  1IKI A;  5FQI A;  4HH3 A;  2BG1 A;  4P0M A;  3ZG0 A;  1JVJ A;  1CQA A;  3SH9 A;  3C2W A;  3MZF A;  2ZC3 B;  5FDS A;  4MDZ A;  2VKS A;  4MMN A;  3K3D A;  4JF4 A;  3B33 A;  5G4Z A;  2X02 A;  4GHI B;  2JKF A;  1LHY A;  3VSK A;  3OCN A;  5EPH A;  2JKR M;  1K54 C;  3ZFZ A;  2ZD8 A;  1FCO A;  1PW8 A;  3ZHH A;  2ZMF A;  1OJ5 A;  2VX8 A;  4PKY A;  1S1Z A;  3LYX A;  4S2O A;  3RJU A;  3NOP C;  3WWX A;  5AVF A;  3GMW A;  1PRQ A;  4JXV A;  4KG2 A;  4BEN A;  3MZE A;  3IBJ A;  3GRJ A;  3LEZ A;  3OBF A;  2CC1 A;  1S4S A;  2ZM2 A;  4F3L A;  4FH4 A;  4YNR A;  2HJ9 C;  1ZKJ A;  4QJG A;  1KE3 A;  4JGQ A;  3B42 A;  4KEN B;  4HHD A;  4L9G A;  1OJG A;  1S67 L;  1FOF A;  1U60 A;  3CPT A;  3PBT A;  3F1O A;  4WEL A;  1OME A;  1ESI A;  2ZM0 A;  5FEG A;  4WBG A;  5CGW A;  5GLA A;  3NEC A;  1XGJ A;  1F5M A;  1BUL A;  5GHZ A;  2HDR A;  1RGZ A;  4JF5 A;  2Y2P A;  3UNW A;  5L07 A;  2P04 A;  3HJI A;  2EXB A;  3S4X A;  4M4X A;  2DNS A;  3MR0 A;  3O88 A;  3OPP A;  2INW A;  1K57 C;  4PM6 A;  4L0L A;  3VE4 A;  5J4E A;  2OAQ 1;  2H5S A;  4IUH A;  3QP6 A;  1IYO A;  1KGE A;  3S7Q A;  4D2O A;  2E8I A;  3NOT C;  3UB6 A;  1M6K A;  5HSQ A;  1IFQ A;  1XJ3 A;  2B5R A;  1AWI A;  5EVI C;  3IF6 B;  1LL8 A;  2RL3 A;  2VV7 A;  4MLL A;  1ES5 A;  4QWO A;  3T12 B;  4ARZ A;  3IWQ A;  4KZ6 A;  3IS2 B;  3M2K A;  2ZQC A;  1KE0 A;  3NUL A;  4ARZ B;  4NXE A;  3PTE A;  1W79 A;  3CPT B;  2ZQ9 A;  4Q0I A;  2LB9 A;  4X55 A;  4BLM A;  1FCM A;  3V3S A;  4DXC A;  5KSC A;  4DF6 A;  3QP5 A;  3Q81 A;  5DJT A;  3CG5 A;  3KYE A;  1WYB A;  4BD1 A;  4R6L A;  2NUT C;  1J3W A;  2OWJ A;  4OQH A;  5EVL A;  2VJW A;  4MBH A;  4WMC D;  1KDW A;  4DDY A;  1DJA A;  2Y2K A;  1SKO A;  3VMA A;  3TE8 A;  1DP6 A;  3FKV A;  3P01 A;  4N1H A;  1FSY A;  2V8C A;  3R4K A;  5EUA A;  2EWV A;  2QZ6 A;  4M3K A;  4MBK A;  4FH2 A;  3QP8 A;  3NDG A;  3LI9 A;  3ITA A;  1H5X A;  4YOF A;  4E3M A;  2C6W B;  4RX2 A;  1TEM A;  1YAX A;  3ZYT A;  3F1P B;  1NRJ A;  1OT6 A;  4N9K A;  1Z6F A;  3PAG A;  5HPF A;  3G2Y A;  4EER A;  4P6B A;  5CTM A;  3P98 A;  1W7F A;  3VP1 A;  2W0N A;  3KO6 A;  2XFT A;  3QP2 A;  1K56 A;  2HDU A;  3W4Q A;  2OOL A;  3SH7 A;  5TR7 A;  5IHV A;  1W8Y A;  5FAP A;  3MJQ A;  3IX4 A;  3N8S A;  4Y2F A;  1HVB A;  2QMI A;  2HZ5 A;  4CQH A;  1ZG6 A;  1N4O A;  3ZGA B;  4LRX C;  2KX6 A;  2XR0 A;  2A2L A;  2XK1 A;  1TVF A;  4QHC A;  4WUJ A;  1MWR A;  3E4P A;  1LI0 A;  4H6J B;  2Y2M A;  3H7W A;  3BYD A;  2Y2Q A;  1ES4 A;  5EOE A;  3UMD A;  4KZ8 A;  1K6R A;  1GHM A;  2PU2 A;  2UWX A;  5JYO A;  1E4D A;  4MEZ A;  3QNC A;  3UO9 A;  4KQR A;  1VEU B;  5L2F A;  1YLP A;  3MQQ A;  3ZG7 B;  1PNE A;  3F1P A;  1VEU A;  5A8B A;  4B4Z A;  4IVI A;  2FH5 A;  5F68 A;  4E3N A;  1K54 A;  3U4L P;  2EX2 A;  3O87 A;  1XKZ A;  3A3I A;  4I5S A;  5GL9 A;  2W3D A;  1GHP A;  1UWP X;  1L0E A;  3AGF A;  2QHK A;  1WA9 A;  1LSV A;  3F1N A;  1ACF A;  3MBZ A;  4NKP A;  1K6S A;  2Q0O A;  3HBR A;  3N6I A;  2A24 B;  2ZQA A;  1DP9 A;  3N8R A;  4K0X A;  5HAR A;  3IXG A;  3SOI A;  3OC2 A;  2HPB A;  5JYP A;  4HY8 A;  4H6J A;  5TFQ A;  3IT9 A;  4R23 A;  2V0W A;  4UA9 A;  5LBR A;  3LEQ A;  5GLB A;  2WGW A;  1A0K A;  3KYZ A;  3HUM A;  2Y79 A;  4FTX A;  1SZV A;  3ITB A;  4XT2 A;  2EX6 A;  1FR6 A;  5J7E A;  1L3L A;  2O9B A;  1RCJ A;  3A3D A;  2PR5 A;  1ERO A;  5HD5 A;  4LRY C;  5E2F A;  3MXR A;  4EES A;  3A0V A;  3NOU C;  4DE3 A;  3W8K A;  3ZQ5 A;  4WEK A;  5A90 A;  4WZ5 C;  5CHU A;  5HZH A;  4IJG A;  4Y0O A;  4FUW A;  1H3Q A;  2DRW A;  1XJ4 A;  2Y55 A;  1XJ2 A;  4Z9Q A;  4GS9 B;  4Q0H A;  2A3U A;  1WYC A;  3NJA A;  2EFU A;  3U2A A;  5EFW A;  2W3F A;  3L9K A;  2B95 A;  2Z2M B;  2L1M A;  3S22 A;  4OON A;  4E3J A;  3G34 A;  3BY8 A;  1CEG A;  5KMW A;  5M1A A;  2C5W B;  4JLF A;  3DTK A;  4IBR A;  5J3W A;  4DXB A;  1ERQ A;  4OQI A;  1PIO A;  1S1Y A;  5FI2 A;  4S2L A;  1EW0 A;  2WKQ A;  4R0Q A;  5HW3 A;  1YM1 A;  1T1C A;  1CEF A;  2V2F F;  3TRC A;  3MFX A;  1BYW A;  4OP8 A;  4QY5 A;  3A3J A;  3IH8 A;  2XSS A;  1YLY A;  3SS5 A;  3AGE A;  3FPW A;  2ZMA A;  3BFG A;  4FSF A;  1K55 A;  2Y2L A;  1AXB A;  1JTG A;  5FAT A;  1UWN X;  4Y0U A;  1OT9 A;  5TJJ A;  1Q2P A;  4PKY G;  4ZRR A;  3KSG A;  2G2U A;  4IHQ A;  4P6Z S;  1CF0 A;  2V8F A;  2GNX A;  4KZ4 A;  2ZL1 A;  3BFE A;  3H82 B;  2GDN A;  2PYR A;  2A49 A;  2ZQ7 A;  2Y2H A;  2XLN A;  5CGS A;  4IED A;  1V9Z A;  1I2S A;  5EVI B;  2H10 A;  1T19 A;  2O9A A;  4XUZ A;  4K0W A;  4U0T A;  4YWZ A;  1EWZ A;  3LY4 A;  4OQG A;  4ESP A;  3UDX A;  3B47 A;  4S2N A;  1LL5 A;  4S2P A;  4RQ9 A;  1KGG A;  4OLD A;  4PAU A;  1S0W A;  4CLC A;  4QPR A;  2R9X A;  1IOU A;  3HLF A;  3OCL A;  3BY9 A;  3MQO A;  2J9P A;  4MN7 A;  4FCF A;  3LY3 A;  1LT0 A;  2PBD P;  3GSG A;  3ICY A;  4F3L B;  2ZC4 B;  2V9A A;  3JVU A;  4UHU A;  3C4P A;  3V3R A;  4LFU A;  2GX5 A;  3UB5 P;  3EEH A;  1GHI A;  1OTB A;  5DKK A;  1L0G A;  1I2W A;  3DWK A;  3K3C A;  1E25 A;  4EXO A;  2WAF A;  4OPY A;  4B4X A;  4S2K A;  3ZG9 B;  2EWW A;  3IHA A;  3DTI A;  1XFN A;  1K55 C;  3MQ0 A;  3UY6 A;  1Y54 A;  3HLE A;  4GCZ A;  4DE1 A;  1MBL A;  1DJC A;  5KZH A;  1XA1 A;  2Z6C A;  2VK3 A;  4PMA A;  2FZ0 A;  3S7P A;  1L0F A;  4DE2 A;  4UEY A;  4JXS A;  3C30 A;  5KIZ A;  2GZA A;  4Y7P A;  1YLW A;  4X53 A;  3A0S A;  4E3O A;  3GTC A;  3WS4 A;  2ACG A;  2WKE A;  2J8Y A;  5AQ9 A;  1J9M A;  3NIA A;  1HZO A;  3UME A;  1T18 A;  3L7H A;  4PM9 A;  1BLH A;  4ID4 A;  3O5Y A;  4GDN A;  4UA6 A;  1XPB A;  3QP4 A;  1K4E A;  3VSL A;  1MY8 A;  5IS1 A;  3AGD A;  3KSH A;  2HGV A;  2V0U A;  5DFX A;  4B93 A;  4ZJ2 A;  3VOZ A;  3E4O A;  3T4S A;  2P9V A;  5FQK A;  4E6X A;  3V39 A;  4K08 A;  1NLY A;  5F1F A;  1IYS A;  4NXG A;  2XFS A;  1OTE A;  4U3T A;  3TW8 A;  2XRO A;  3CMZ A;  2UV0 E;  1LSW A;  1TS0 A;  5EOO A;  1SKO B;  3ULF A;  5CHM A;  4BBU A;  5DTK A;  4GKU A;  2WKR A;  4BJP A;  1N9L A;  4N9L A;  4RYE A;  3LIE A;  2Y2I A;  2X71 A;  4LEN A;  3LUQ A;  2B18 A;  3FPV A;  4S2N C;  4UA7 A;  5FSR A;  4JXG A;  2KLI A;  1MPL A;  5FEF A;  2XD5 A;  3W2Z A;  3NDE A;  3I7J A;  2J3T D;  3GEC A;  2ZQD A;  1VB6 A;  3LIB A;  1QME A;  4BMW A;  2JBF A;  3NBL A;  1DY6 A;  2ZC5 B;  3V50 A;  1ES3 A;  1G6A A;  1D1J A;  3ZNT A;  4E6W A;  3SS3 A;  3ISG A;  4EV4 A;  1S6R A;  4JGR A;  3P09 A;  3N7W A;  5A92 A;  3W4O A;  3MF0 A;  1O07 A;  4KQQ A;  2WZZ A;  4HI4 A;  3UB8 A;  4GZB A;  4R4R A;  5HWT A;  2I9V A;  2XF3 A;  4I3I A;  3LCE A;  3LO7 A;  5L8M A;  2Y2G A;  3C4O A;  3H7W B;  2XGN A;  3ZVW A;  1YLZ A;  2W1T A;  3PXP A;  2BTF P;  4LV0 A;  1P97 A;  1IEL A;  4MNR A;  5F82 A;  4LCL A;  1KVL A;  4UQI S;  2G2W A;  3EGD C;  1GSX A;  1ZHH B;  3PHY A;  3DTM A;  3BEB A;  2XDM A;  5DJU A;  1H0M A;  5TBM B;  1ERM A;  4IVK A;  1GA0 A;  3M2J A;  2J9O A;  4HJ4 A;  5FAO A;  3T50 A;  4L9F A;  3GQZ A;  1BLP A;  3OPL A;  1VET A;  2WKP A;  4JPM A;  3V67 A;  2CMN A;  3E2K A;  3G30 A;  4X1L A;  3UDI A;  1G5U A;  4E3I A;  3BM6 A;  2IWC A;  2JKT M;  4EU0 A;  4QD4 A;  3PBS A;  3G2Z A;  1PWD A;  4BQM A;  1OPX A;  1ZG4 A;  4S2J A;  1XGI A;  4GD8 A;  3TSG A;  5BOH A;  5TGF A;  3MKF A;  2DMW A;  5EV0 A;  4O01 A;  2XA7 S;  4EWF A;  1BLS A;  2GJ3 A;  3N8L A;  5HX9 A;  2OV5 A;  4AFI A;  2BLS A;  3DAV A;  3OOV A;  4Q0J A;  4PM7 A;  4ZJ1 A;  5CEC A;  5DF9 A;  4XXR A;  1G28 A;  1LI9 A;  4PM5 A;  4PM8 A;  4HQA A;  4Y17 A;  2H0Y A;  4KUK A;  2ZQ8 A;  3WRZ A;  4RA7 A;  5L10 A;  1XFQ A;  1GA9 A;  3F1N B;  1YT4 A;  2WKI A;  3T1S A;  1W5D A;  3T4K A;  4II7 A;  1D7E A;  1FIK A;  3LR5 A;  5HFO A;  5EVI A;  5FQJ A;  3HUN A;  5HWW A;  3OLO A;  4DJ3 A;  2RCX A;  2K31 A;  1EI5 A;  1MZU A;  1STZ A;  2V1A A;  4BL2 A;  2JHE A;  2YKH A;  3UE3 A;  1MWT A;  2V1Z A;  4KZ5 A;  3MXQ A;  2VGK A;  3VP4 A;  4XT2 B;  3CUE A;  4WLA A;  2K7S A;  4D60 A;  2PD7 A;  3EGX C;  4Y3I A;  2HP9 A;  3IH9 A;  1YKD A;  2Q9N A;  3KSF A;  3MFD A;  3B3X A;  4X68 A;  3G32 A;  1P0Z A;  4LGW A;  4X56 A;  3LIC A;  4GHI A;  5G4Y A;  4CPK A;  1ODV A;  1CK3 A;  4OQ0 A;  1F9I A;  4QU3 A;  3TJZ C;  4CLC D;  1T1A A;  2PAV P;  4KZA A;  1TS6 A;  4HJ6 A;  3CJM A;  3WS5 A;  2I72 A;  3CZD A;  1ZC2 A;  3JYI A;  2R78 A;  5E2H A;  3HJK A;  3O86 A;  3S7O A;  4CLC B;  3T1R A;  1RP5 A;  1HD8 A;  4IBX A;  3VOY A;  3IF6 A;  3UB9 A;  1MXO A;  3E4Q A;  4EW7 A;  1F2K A;  2YKF A;  4P6Z M;  2NUP C;  3SS4 A;  5HDC A;  4LV2 A;  4C3Q A;  3KSI A;  5AJG A;  3PAE A;  4OH0 A;  4WZ5 A;  2IWD A;  3FWL A;  1PYY A;  1O7E A;  3T4Q A;  3GDI A;  5GHY A;  5F6A A;  3VE3 A;  3LR0 A;  3CHW P;  5M18 A;  2MJ6 A;  2P9V B;  3QP1 A;  3EEA A;  3OZH A;  5DTT A;  5FQQ A;  4ZDX A;  3E2L A;  2P08 A;  2W3G A;  5CTN A;  2PD8 A;  1BT5 A;  1MWS A;  1PWG A;  3T1X A;  2JKR I;  3GR2 A;  2J3T C;  3LFV A;  2ZM8 A;  3HLW A;  5HL1 A;  4A5R A;  1K57 A;  3IWO A;  3Q7V B;  4KZB A;  3UB7 A;  1SDN A;  1GSW A;  4OOM A;  3BQA A;  2WUQ A;  3BWL A;  3MZD A;  3CWF A;  1F98 A;  1QMF A;  4KZ3 A;  4NXF A;  5IT5 A;  2HF6 A;  1NRF A;  1DP8 A;  2WAE A;  2EX8 A;  4MN5 A;  3C7U A;  4Y5F A;  5IU1 A;  1Y4O A;  3F1O B;  5HDD A;  3ZG5 A;  1XP4 A;  3UN7 A;  4X69 A;  2ZMV A;  3KYQ A;  4OPR A;  3ZG8 B;  1YQS A;  2PBY A;  5CHJ A;  4RX3 A;  1UGU A;  3T4J A;  4PHT A;  4R70 A;  2OLU A;  2QKP A;  5GHX A;  3HLC A;  4GLQ A;  4Y15 A;  4YFM A;  2W3H A;  2E8J A;  3D3O A;  4Z1W A;  5AVE A;  1TS8 A;  4GN2 A;  4GOG A;  1IEM A;  5GLC A;  1IYQ A;  3HUO A;  3IHB A;  5MC7 A;  4GB7 A;  4CJN A;  2PHY A;  4F94 A;  4N1X A;  5EEC A;  3IQA A;  4WMC A;  4FOF A;  3TOI A;  3IS2 A;  4HBU A;  1V9Y A;  3SZT A;  4UAA A;  3RH8 B;  4MBF A;  3P7N A;  1KE4 A;  2XEP A;  1E3U A;  1OTD A;  5TBM A;  1YLT A;  5DKL A;  4ZTK A;  4R38 A;  5FQ9 A;  4HNB A;  3Q1F A;  3BJN A;  1PI4 A;  3DBA A;  1ONG A;  2VV8 A;  3VV4 A;  4BL3 A;  4DRT A;  4OVD A;  1LSX A;  3VP3 A;  3UPO A;  2XH9 A;  5EVE A;  3IF5 A;  4KG5 A;  3MS6 A;  1Z09 A;  2QJ7 A;  3T4L A;  5F83 A;  2WKH A;  4LV3 A;  1M40 A;  2W1R A;  4GJ4 A;  3NHQ A;  3IX3 A;  4EBP A;  4GD6 A;  5HPI A;  4XUX A;  3DW0 A;  2OAP 1;  2KDK A;  4WN5 A;  3T4O A;  5HAI A;  2D02 A;  3OPH A;  5AQA A;  5M19 A;  3A3F A;  3QHY A;  1K4F A;  4X1M A;  2B02 A;  5GLD A;  3EQU A;  4KQO A;  3LGO A;  5DTS A;  4EEP A;  1YPR A;  3BQ8 A;  4DKI A;  5DVA A;  3NC8 A;  4WL9 A;  3H9W A;  2A24 A;  3MSH A;  4LPZ A;  2O9C A;  2WGI A;  4P87 A;  1PFL A;  1XXM A;  4QY6 A;  3FKW A;  4NG2 A;  3IF6 C;  3RFB A;  1YLJ A;  4UQI M;  2OSU A;  2HP6 A;  2PT7 A;  3DTE A;  3IXH A;  3UPN A;  3UE6 A;  2PRF A;  5FI7 A;  1MC0 A;  3MMH A;  2H0T A;  2Y4A A;  5E2E A;  3VP2 A;  5EE8 A;  4HOI A;  1NZU A;  3LI8 A;  1BTL A;  1VQQ A;  3EWK A;  3PYP A;  4EUV A;  3SH8 A;  4JGO A;  1Q2Q A;  3W4P A;  4EUZ A;  2DCF A;  2O0Y A;  4E3K A;  3BW6 A;  2QYB A;  2ZJ9 A;  4EQ1 A;  1P9W A;  2Z2L B;  1HLU P;  4OP5 A;  2LB5 A;  2VA0 A;  2PR6 A;  4IUK A;  4NET A;  4QB8 A;  3JPU A;  1NYY A;  3G6O A;  4BWI A;  1G68 A;  5E2G A;  5CER A;  5F1G A;  1PZP A;  3T1Q B;  4GW9 A;  3C38 A;  4WEJ A;  1JWV A;  2J3W A;  2J7V A;  2J80 A;  4KZ7 A;  4ZJ3 A;  1N9N A;  5J8X A;  2WYX A;  5F5Y A;  3D4F A;  5AQB A;  2V1B A;  1RGY A;  4ZBE A;  1L0D A;  4DMZ A;  2H28 A;  3Q7Z A;  4B88 A;  2WGV A;  3VFF A;  4I38 A;  1GCE A;  1S4R A;  5U47 A;  4BD0 A;  4WYY A;  2WZX A;  3HVF A;  1E3U D;  3IXB A;  1TD5 A;  3HLB A;  3ZCZ A;  1NJ4 A;  4KUO A;  2HDQ A;  3SW1 A;  2AVX A;  2WAD A;  1T1B A;  2O99 A;  1DJB A;  1PI5 A;  3LID A;  2PDR A;  1NY0 A;  2Y2N A;  3HRE A;  3NY4 A;  3BEC A;  4HP9 A;  3VFH A;  5HL6 A;  2L4R A;  1OTA A;  4I3J A;  2ZL1 B;  1HTZ A;  2Q9M A;  4EBN A;  3H82 A;  2JE5 A;  2Y2O A;  1WE4 A;  1KDS A;  1KVM A;  3C5A A;  3HLD A;  3RTY A;  3Q7V A;  4X6T A;  3IBR A;  4O8G A;  3LR3 A;  3WS1 A;  3C8C A;  2ZLY A;  2Z6D A;  2P74 A;  4WZ4 A;  4KQD A;  1YMS A;  4JXW A;  3UE1 A;  3FG8 A;  2QWS A;  4OOL A;  2XRN A;  2VV6 A;  5CXW A;  4ETX A;  1G6O A;  1I5Q A;  2XD1 A;  4HBT A;  2ZC7 A;  4NEE D;  4HJ3 A;  4C6Y A;  4JGP A;  5A93 A;  4O0P A;  4R1G A;  3G35 A;  1MWU A;  2VGL M;  5A91 A;  4OPQ A;  2HV1 A;  1NWZ A;  5FDH A;  1DRM A;  3UE0 A;  2BAS A;  3FZC A;  1JWZ A;  3KX0 X;  1SHV A;  4X25 A;  3RXX A;  3PR6 A;  1FCN A;  1L2S A;  1PZO A;  1BZA A;  1MKI A;  1TDL A;  3TG9 A;  4P85 A;  4S2I A;  2EX9 A;  5HWV A;  2FFF B;  2PU4 A;  4Y13 A;  1S66 L;  1P9R A;  1H8Y A;  1K0K A;  4RVA A;  4H8R A;  5DFY A;  5EM0 A;  3IWI A;  5CED A;  4OKP A;  3CI6 A;  1LL9 A;  5EM1 A;  4R4S A;  3BLM A;  3IXD A;  1FSW A;  1XA7 A;  3E0Y A;  3UPP A;  3BFF A;  2HP5 A;  1IYP A;  1JTD A;  5CX7 A;  1SCW A;  5G18 A;  2QPN A;  1MKM A;  2ZOH A;  5FAS A;  4GDB A;  5E43 A;  3K2N A;  1N9B A;  2JKG A;  1K56 D;  4MCW A;  4R3B A;  3LR4 A;  3EOI A;  1KOU A;  5FAQ A;  2OLV A;  4ZAM A;  5I5L A;  2Y2J A;  4EQI A;  4ME4 A;  3GVB A;  5FI6 A;  5F69 A;  1TF1 A;  1D06 A;  4Y0T A;  1PWC A;  3EQV A;  4HH2 A;  3T4T A;  3D9Y A;  1N9O A;  1W63 Q;  3MKE A;  1ESU A;  2Y8H A;  2IWB A;  3ZNY A;  3BFD A;  4DDS A;  3S1Y A;  3CUE C;  3VP0 A;  1JNU A;  4G3V A;  1CI9 A;  1ES2 A;  3OPR A;  2ZOI A;  4EEU A;  1K25 A;  3FV7 A;  2W1T B;  5HDS A;  4DJ2 A;  3BFC A;  3A0R A;  4KG6 A;  3PBQ A;  2K2N A;  1NLZ A;  1LLB A;  2M1C A;  4BBT A;  3R7W A;  2EFX A;  5K5B A;  1Y28 A;  1W63 M;  4JKT A;  3WS2 A;  2ZC6 B;  4E3L A;  1H8M A;  2W27 A;  4EBL A;  4HIA A;  4R3A A;  1VHM A;  3BRM A;  4S2M A;  4WM9 A;  2Y91 A;  2ZBB A;  5AQ7 A;  4E04 A;  1IKG A;  4KZ9 A;  2Y59 A;  1VM1 A;  2JN7 A;  2D01 A;  4I3A A;  5EVI D;  5FA7 A; 
#chains in the Genus database with same CATH homology
 2VV8 A;  3MF0 A;  3VV4 A;  4WUJ A;  1LSX A;  4MN6 A;  3E4P A;  4HI4 A;  3S7N A;  2P7J A;  3UB8 A;  4H6J B;  3H7W A;  5HWT A;  2JKT I;  2I9V A;  3FC7 A;  3UMD A;  5KSH A;  4WF0 A;  4I3I A;  3E98 A;  2QJ7 A;  5L8M A;  3H7W B;  3T4L A;  3PBN A;  2W1R A;  2W1T A;  3PXP A;  4GJ4 A;  3NHQ A;  3MQQ A;  4G3K A;  1P97 A;  2W3E A;  3F1P A;  4I39 A;  5A8B A;  1ZTU A;  3LIA A;  5F68 A;  2FH5 A;  5HPI A;  3R7W B;  4EET B;  3LIF A;  2QJ5 A;  2OAP 1;  2KDK A;  4UQI S;  4I5S A;  4WN5 A;  3T4O A;  3EGD C;  2D02 A;  1XJ6 A;  1GSX A;  1ZHH B;  5FL3 A;  2W3D A;  3PHY A;  1UWP X;  2EA9 A;  4L9E A;  2VLG A;  5DJU A;  2QHK A;  1WA9 A;  1LSV A;  4CLC E;  5TBM B;  4NXB A;  3F1N A;  2B02 A;  4HJ4 A;  2XA7 M;  3EQU A;  4NKP A;  4KQO A;  3PBR A;  3CIT A;  2A24 B;  1DP9 A;  2G7U A;  3T50 A;  4EEP A;  3BQ8 A;  4WL9 A;  4BBV A;  3H9W A;  2A24 A;  4L9F A;  5HD3 A;  4LPZ A;  2O9C A;  3OC2 A;  4B9O A;  2WKP A;  4HY8 A;  3V67 A;  2CMN A;  4H6J A;  3RFB A;  2V0W A;  5LBR A;  4UQI M;  3KYZ A;  2M7U A;  4LLO B;  2JKT M;  2IA2 A;  4EU0 A;  2PT7 A;  2Y79 A;  2HJE A;  3PBS A;  1OPX A;  3JVV A;  3UE6 A;  1MC0 A;  3MMH A;  4XT2 A;  2DMW A;  4G3W A;  4O01 A;  5J7E A;  2XA7 S;  2GJ3 A;  4AFI A;  3HCY A;  4HOI A;  2O9B A;  3OOV A;  4Q0J A;  2VGL S;  1X0O A;  3LI8 A;  4DN0 A;  2PR5 A;  5DF9 A;  3EWK A;  3PYP A;  4EUV A;  3VOL A;  1G28 A;  5HD5 A;  4JGO A;  4LRY C;  4EES A;  2KOI A;  3PBO A;  3A0V A;  3NOU C;  2PYP A;  5C5K A;  3CAX A;  4HQA A;  4WEK A;  3ZQ5 A;  4KUK A;  4GS9 A;  2O0Y A;  5HZH A;  4IJG A;  1H3Q A;  3BW6 A;  2QYB A;  4EQ1 A;  1XJ4 A;  1P9W A;  1TS7 A;  1XJ2 A;  1XFQ A;  4GS9 B;  3F1N B;  4LRZ E;  4Q0H A;  2LB5 A;  2VA0 A;  2PR6 A;  3NJA A;  4IUK A;  3U2A A;  5EFW A;  2M7V A;  2W3F A;  2L1M A;  3G6O A;  4BWI A;  3BY8 A;  2L0W A;  1OTI A;  3T4K A;  4II7 A;  1D7E A;  3LR5 A;  4HP4 A;  4GW9 A;  5J3W A;  3C38 A;  4WEJ A;  2VZW A;  5HWW A;  2J3W A;  2J80 A;  1S1Y A;  4DJ3 A;  2OWH A;  1N9N A;  1EW0 A;  2K31 A;  2WKQ A;  1MZU A;  1STZ A;  2V1A A;  5F5Y A;  2V1B A;  4ETZ A;  2JHE A;  1T1C A;  2YKH A;  1YSP A;  3UE3 A;  3TRC A;  3MFX A;  1BYW A;  4CLC C;  4DMZ A;  2H28 A;  1GSV A;  3CLO A;  3D72 A;  3MXQ A;  2XSS A;  4I38 A;  4XT2 B;  1YSQ A;  1S4R A;  3CUE A;  2VEA A;  3FPW A;  4WLA A;  2K7S A;  4FSF A;  1TD5 A;  2PD7 A;  3EGX C;  4Y3I A;  1UWN X;  4KUO A;  4HH3 A;  1OT9 A;  1YKD A;  5TJJ A;  3SW1 A;  3KSF A;  3C2W A;  4PKY G;  1T1B A;  2O99 A;  3LID A;  4MDZ A;  2PDR A;  2VKS A;  4MMN A;  4ZRR A;  3K3D A;  3B33 A;  5G4Z A;  3KSG A;  4IHQ A;  4HP9 A;  4P6Z S;  4GHI B;  1P0Z A;  2GNX A;  3OCN A;  5HL6 A;  2L4R A;  2JKR M;  3H82 B;  1OTA A;  2PYR A;  3LIC A;  4GHI A;  2ZMF A;  4I3J A;  5G4Y A;  1OJ5 A;  2VX8 A;  1ODV A;  1V9Z A;  3H82 A;  4PKY A;  1F9I A;  3TJZ C;  1T19 A;  4CLC D;  1T1A A;  2O9A A;  1S1Z A;  1TS6 A;  3LYX A;  4HJ6 A;  4YWZ A;  3RTY A;  3NOP C;  3IBR A;  4O8G A;  3LR3 A;  5AVF A;  2R78 A;  3C8C A;  3HJK A;  3S7O A;  2Z6D A;  4CLC B;  3B47 A;  4KQD A;  3IBJ A;  4RQ9 A;  3OBF A;  1S4S A;  3FG8 A;  4PAU A;  4CLC A;  4QPR A;  1IOU A;  3OCL A;  3UB9 A;  3BY9 A;  3E4Q A;  2QWS A;  4OOL A;  4EW7 A;  2XRN A;  3MQO A;  2VV6 A;  4MN7 A;  4F3L A;  2YKF A;  4P6Z M;  1LT0 A;  2NUP C;  4ETX A;  1G6O A;  4YNR A;  5HDC A;  2HJ9 C;  3KSI A;  4NEE D;  5AJG A;  4JGQ A;  3ICY A;  4F3L B;  4HJ3 A;  3B42 A;  2V9A A;  4HHD A;  4L9G A;  4JGP A;  1OJG A;  1S67 L;  3JVU A;  4O0P A;  3PBT A;  3T4Q A;  2VGL M;  3F1O A;  3GDI A;  3VE3 A;  2HV1 A;  1NWZ A;  4WEL A;  5F6A A;  3LR0 A;  1DRM A;  2GX5 A;  3EEH A;  2BAS A;  1OTB A;  3KX0 X;  2MJ6 A;  5DKK A;  1F5M A;  3EEA A;  3PR6 A;  3K3C A;  4EXO A;  2P08 A;  2W3G A;  2EWW A;  1XFN A;  3MQ0 A;  5HWV A;  2P04 A;  2PD8 A;  1S66 L;  1P9R A;  4GCZ A;  3HJI A;  4M4X A;  2JKR I;  5DFY A;  2J3T C;  2Z6C A;  3MR0 A;  2INW A;  3LFV A;  2FZ0 A;  3S7P A;  4L0L A;  3VE4 A;  3CI6 A;  4UEY A;  5J4E A;  2OAQ 1;  3C30 A;  4IUH A;  2GZA A;  3UB7 A;  5KIZ A;  3E0Y A;  1GSW A;  3S7Q A;  4OOM A;  3BQA A;  3A0S A;  3BWL A;  3CWF A;  1F98 A;  3NOT C;  5CX7 A;  3UB6 A;  5HSQ A;  1MKM A;  1IFQ A;  1XJ3 A;  2ZOH A;  4NXF A;  3UME A;  5IT5 A;  2HF6 A;  1T18 A;  3K2N A;  1LL8 A;  2VV7 A;  3O5Y A;  4ARZ A;  4MCW A;  3IS2 B;  1DP8 A;  3LR4 A;  4MN5 A;  4Y5F A;  3EOI A;  4ARZ B;  4NXE A;  5IS1 A;  5IU1 A;  1KOU A;  5I5L A;  3F1O B;  3KSH A;  5HDD A;  2HGV A;  2V0U A;  4Q0I A;  2LB9 A;  5DFX A;  4B93 A;  2ZMV A;  4ME4 A;  3KYQ A;  5F69 A;  3E4O A;  3T4S A;  5DJT A;  1TF1 A;  1D06 A;  1UGU A;  3EQV A;  4HH2 A;  3T4T A;  4R6L A;  3T4J A;  4PHT A;  2NUT C;  1N9O A;  4K08 A;  1NLY A;  1W63 Q;  2OWJ A;  4R70 A;  2VJW A;  4NXG A;  2Y8H A;  2QKP A;  1OTE A;  3TW8 A;  4GLQ A;  2XRO A;  2W3H A;  3D3O A;  3TE8 A;  1LSW A;  3CUE C;  1DP6 A;  1TS0 A;  3P01 A;  1JNU A;  4Z1W A;  4G3V A;  3R4K A;  2EWV A;  5AVE A;  3ULF A;  4BBU A;  2ZOI A;  4EEU A;  1TS8 A;  3LI9 A;  2WKR A;  4BJP A;  1N9L A;  2W1T B;  5HDS A;  3LIE A;  4DJ2 A;  3A0R A;  4YOF A;  3PBQ A;  1YAX A;  3LUQ A;  2B18 A;  3FPV A;  3ZYT A;  3F1P B;  2K2N A;  1NLZ A;  5MC7 A;  2PHY A;  2M1C A;  1NRJ A;  1OT6 A;  4BBT A;  2KLI A;  5HPF A;  3R7W A;  3W2Z A;  4FOF A;  4EER A;  5K5B A;  1Y28 A;  1W63 M;  3IS2 A;  2J3T D;  2W0N A;  1H8M A;  3KO6 A;  2W27 A;  3GEC A;  1V9Y A;  4HIA A;  1VB6 A;  4R3A A;  1VHM A;  3LIB A;  3RH8 B;  2OOL A;  3P7N A;  4BMW A;  1OTD A;  5DKL A;  5TBM A;  2ZBB A;  3MJQ A;  4R38 A;  4E04 A;  4HNB A;  4Y2F A;  2JN7 A;  2D01 A;  4I3A A;  3BJN A;  4CQH A;  4LRX C;  3DBA A;  4JGR A;  2KX6 A;  3OLO A;  2A2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...