3UB8A

Periplasmic portion of the helicobacter pylori chemoreceptor tlpb with formamide bound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
157
structure length
157
Chain Sequence
MEHLETGQYKKREKTLAYMTKILEQGIHEYYKSFDNDTARKMALDYFKRINDDKGMIYMVVVDKNGVVLFDPVNPKTVGQSGLDAQSVDGVYYVRGYLEAAKKGGGYTYYKMPKYDGGVPEKKFAYSHYDEVSQMVIAATSYYTDINTENKAIKEGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords chemoreceptor TlpB
publication title Structure and proposed mechanism for the pH-sensing Helicobacter pylori chemoreceptor TlpB.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 54
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17200 sCache_2 Single Cache domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ub8A00
1OTEA 1GSXA 1S4RA 2OWHA 3UE6A 3E4PA 4BBUA 3P7NA 1T18A 2J80A 5F69A 2PR6A 3H82B 4LRZE 4R6LA 2QWSA 4HJ4A 3BWLA 4LRYC 3CAXA 1OTAA 3EWKA 4L9GA 2PHYA 4GS9B 1S1YA 1LSXA 5AVFA 4I3IA 3NHQA 3A0RA 2VV7A 4GCZA 2D02A 3UMDA 3UB9A 4NXBA 5J3WA 4I38A 1UGUA 2QJ5A 4BBTA 3GDIA 4WL9A 2VV6A 3E4OA 1G28A 4MN5A 4KUKA 4F3LA 4JGRA 4HH2A 4HI4A 4JGPA 4HP9A 2V9AA 3BY9A 1TS8A 1P0ZA 1XJ6A 5KIZA 3F1OA 4GHIB 1GSWA 4JGOA 2W0NA 4XT2B 4B9OA 5HDCA 2D01A 3VOLA 2L1MA 3A0VA 2INWA 4I5SA 1UWNX 2WKPA 2OOLA 3VE4A 3D72A 1N9LA 1NWZA 2V0WA 3UB8A 5HZHA 2YKHA 1XFNA 4EQ1A 1T1CA 1S66L 2PD7A 1OT6A 3ZQ5A 3EEHA 4I3AA 3H7WA 2M1CA 5HD3A 3H9WA 3NJAA 4EETB 3F1PA 5I5LA 1N9OA 3LYXA 3B33A 1DP8A 4PKYG 2B02A 2GJ3A 4R3AA 4E04A 1TS6A 1VB6A 4YWZA 5DKLA 2KX6A 1KOUA 1OJGA 3F1NA 4RQ9A 4R70A 4EEPA 3E4QA 1TS7A 2EA9A 3UMEA 1T1BA 1XJ3A 3OLOA 3T50A 5HD5A 4L9FA 3MFXA 5HWTA 5G4ZA 1P97A 2W27A 3HJKA 4LPZA 2CMNA 2PR5A 1BYWA 2ZBBA 3MJQA 5HSQA 3F1OB 3NOPC 5IU1A 4EEUA 3LI8A 3BY8A 4HJ6A 5IS1A 2WKRA 2Z6DA 1XJ4A 4WN5A 4JGQA 4NXEA 3RTYA 4WF0A 5AVEA 2K7SA 4KQDA 1LT0A 2QJ7A 3LIEA 1V9YA 3H7WB 3LICA 2HV1A 1LL8A 5DJUA 5F6AA 3F1PB 4WUJA 4H6JB 2OWJA 1XJ2A 5TBMA 3CLOA 2JHEA 2P7JA 3LIBA 4HNBA 3MQOA 4EESA 2ZOIA 4XT2A 1JNUA 1UWPX 1OJ5A 4R38A 3FG8A 3NOTC 1F98A 3PHYA 1T19A 4HQAA 1F9IA 1T1AA 4GW9A 1DP6A 1N9NA 3F1NB 5F68A 3LIDA 5HWWA 1LSVA 1MZUA 2A24A 4EXOA 4LRXC 1OT9A 1OTBA 2R78A 4L9EA 4HIAA 4PKYA 4WLAA 3FC7A 2PD8A 5G4YA 5DJTA 3LIFA 4HY8A 2PYRA 3NOUC 1V9ZA 4HHDA 1WA9A 3ULFA 4DJ2A 3HJIA 4F3LB 3IS2A 4HJ3A 4I39A 5HDDA 5J7EA 2VV8A 3H82A 5F5YA 1EW0A 1S1ZA 1S4SA 3A0SA 4NXGA 3UB6A 4I3JA 2V0UA 3KX0X 1DRMA 3K3CA 4HH3A 4GS9A 4MN6A 3PYPA 3GECA 3MR0A 2PDRA 3LUQA 4BBVA 1ODVA 3MXQA 1D7EA 3LI9A 2BASA 2WKQA 2KDKA 5J4EA 1D06A 1XFQA 2Z6CA 4KUOA 1GSVA 5TBMB 1Y28A 5A8BA 4EERA 2H28A 3G6OA 2QKPA 2L4RA 3C2WA 5HWVA 2YKFA 3CWFA 1X0OA 2V1AA 3VE3A 4GHIA 3C8CA 4LLOB 5EFWA 2I9VA 2QHKA 2PYPA 3IBRA 1DP9A 2JN7A 2V1BA 1S67L 2L0WA 2A24B 2VEAA 4HP4A 3LIAA 4NXFA 4DJ3A 4M4XA 5DKKA 1OTIA 3K3DA 3MQQA 1TS0A 3RH8B 2ZOHA 1OTDA 3UB7A 4EW7A 2VLGA 3SW1A 5HDSA 4HOIA 1LSWA 4H6JA 4K08A 3ICYA 3IS2B
chains in the Genus database with same CATH superfamily
1K0KA 4IEDA 4NEED 3E4PA 4BBUA 3PAEA 3Q7VA 1XXMA 3IT9A 2QMIA 4FH4A 4LRZE 4PM7A 3IF5A 2EFXA 3HVFA 4QB8A 3DTEA 1RCJA 1HD8A 3BWLA 4ZJ1A 1H5XA 4DXBA 3CPTB 3IWIA 2OAQ1 3OPHA 3QP1A 3HLGA 2ZL1A 3G32A 4EUZA 1G5UA 1CEGA 4DKIA 2EX6A 3VP2A 1O7EA 2O9CA 1BLPA 1K6RA 3HLEA 4K91A 1UGUA 3MZEA 4Y0UA 3NY4A 3E4OA 5CHJA 4QPRA 5CXWA 2IA2A 5HAQA 1CJFA 4H8RA 4F3LA 5AJGA 2PU4A 4MLLA 1EWZA 3QHYA 4JLFA 2V9AA 1BUEA 4R23A 4LV0A 3F1OA 4GHIB 4JGOA 2Y2NA 4EWFA 4XT2B 3DW0A 3OCLA 1LI0A 3IQAA 3S7PA 4B9OA 3OOVA 2D01A 2L1MA 3RFBA 2ZC4B 2HJEA 3FYZA 3W8KA 2G2UA 1J3WA 4CLCA 3LR3A 2O99A 2WKHA 3M2KA 4DF6A 3MXRA 1N9LA 3K2NA 4B93A 2YKHA 3UDXA 5KSCA 4OQIA 3EEHA 2M1CA 3P01A 1KDWA 2I72A 4MEZA 4BJPA 1N9OA 4S2KA 5EVLA 1BZAA 3EGDC 4S2NA 4KZBA 2B02A 1N4OA 5M18A 3OPRA 4R3AA 2JKGA 1NZOA 3O88A 3N8LA 1VB6A 5DKLA 2ZM0A 4RYEA 2KX6A 1OJGA 2J9PA 2W3HA 2Y2OA 3EOIA 2ZQAA 1ZKJA 3E4QA 4E3KA 3BFDA 2WYXA 3ZG7B 4UAAA 5EVIA 3IHBA 4L9FA 2ZQ9A 3MSHA 4WMCA 4YFMA 1P97A 3HJKA 3LY3A 3BQAA 3MJQA 1RGZA 4WELA 3IHAA 4WEKA 3MZFA 1E4DA 4OP8A 4Q0JA 1SCWA 5IU1A 3G4PA 3BM6A 4ESPA 1VETA 2Z6DA 4FCFA 2HF6A 1XJ4A 5IT5A 3D3OA 2HP5A 3ITAA 1MY8A 3O87A 2XSSA 3MKEA 5AVEA 2K7SA 1LT0A 3EGXC 4KG2A 2W3EA 3SH9A 2ZJ9A 5BOHA 3UNWA 4R1GA 5FI6A 2BG1A 3A3IA 1LLBA 3MZDA 3H7WB 3LICA 2ZC7A 4GNUA 1Y54A 1ONGA 3F1PB 5JYOA 1GHIA 3BJNA 4GKUA 4QU3A 5TBMA 3CLOA 4PPRA 4N9KA 4HNBA 4WZ4A 2ZOIA 2WGVA 3JPUA 1L0GA 1JTDA 3VSKA 4M3KA 3SS4A 1CF0A 3P09A 4R0QA 4GW9A 1G68A 2FZ0A 3F1NB 4OLDA 5F68A 1ZTUA 5CTMA 1FCMA 2IWDA 2Y8HA 3T4KA 5HWWA 4EXOA 4N1HA 1PYYA 4LRXC 1YSPA 3FKVA 2GX5A 2OSUA 5A91A 3IF6B 3A3JA 3G30A 3JVUA 3ZG5A 1WE4A 3C5AA 2Z2MB 4UQIM 3V67A 1XA1A 1IOUA 3OPLA 4KG5A 1PRQA 2Y91A 4F94A 4DJ2A 5EE8A 5GLDA 2P9VB 3FZCA 1H0MA 2XD5A 4MBKA 2JE5A 4Y2FA 5EECA 5J7EA 3W2ZA 4X56A 1YQSA 4HESA 2H10A 3HCYA 4O0PA 2OLUA 1S4SA 1KGFA 4KZ8A 2H5SA 2QPNA 2V0UA 3KX0X 3SS5A 3KSHA 1CI8A 4JXVA 3PYPA 4ID4A 4KENB 3LUQA 2G2WA 3M6HA 1FSYA 3MXQA 4GOGA 2BASA 4OQHA 4B4XA 2KDKA 3SOIA 1F5MA 1XFQA 3Q81A 4LV3A 2ZLYA 3A3FA 4FUWA 5A8BA 4IHQA 3WS1A 3LR0A 4OPZA 1YLYA 2H28A 1BTLA 2HDSA 3PBTA 1DY6A 1HLUP 3PBQA 4DXCA 3T1SA 4EBNA 3DBAA 4BENA 5DVAA 3V5MA 3G34A 3BFEA 3VE3A 2J3TC 1TDGA 3S7NA 4UQIS 2WADA 2VJWA 1DP9A 1XA7A 1MWUA 4NK3A 2L0WA 2VEAA 2PRFA 4Y0TA 3LIAA 4NXFA 3BLMA 5A92A 4DJ3A 3L9KA 3S1YA 4M4XA 3HLCA 3K3DA 2EWWA 2HDQA 3PBOA 3P98A 2HDRA 4DRTA 1OTDA 5CX7A 2VLGA 1JVJA 5HDSA 5EM1A 5K5BA 5G18A 3HLBA 4H6JA 5HX9A 3C4OA 5DFYA 5FQIA 2OWHA 5HPFA 2HP6A 1L0DA 2J80A 3WRTA 4R6LA 2VX8A 3PAGA 1FCNA 4HJ4A 5FASA 4LRYC 4Q0HA 1OTAA 4U0TA 1JWVA 3EWKA 2PHYA 1KVLA 4GS9B 1M6KA 4Q8IA 4I3IA 2R9XA 5FDHA 2O9AA 2ACGA 1OMEA 3NHQA 1NYYA 1CEFA 1Z09A 2JCHA 1W7FA 2HGVA 1S6RA 5HAIA 4XUZA 1WYCA 4ZBEA 1PWCA 4NXBA 5TFQA 1SHVA 2E8IA 1ES5A 3GDIA 4E6XA 3T4SA 4ZDXA 3VSLA 2Q9MA 3IBJA 3DTMA 3IH8A 4OONA 4QWOA 1G28A 4HEFA 1N9BA 2ZMVA 2ZC5B 4HH2A 3NIAA 3QNCA 3T12B 5C5KA 5L2FA 4HP9A 1HZOA 3ZDJA 1NLZA 2ZQ8A 3E2KA 1TS8A 1P0ZA 2M7UA 3GVBA 3TJZC 1NRJA 1K55C 3S22A 3UPNA 4K0WA 4AFIA 3KSGA 3KYQA 4N1XA 4I5SA 2PBYA 1I2WA 3C30A 5IHVA 3N4IA 5EM0A 1D1JA 2WKPA 2OOLA 3CITA 2FH5A 3O5YA 4BMWA 5MC7A 3HUMA 5EUAA 1K38A 3LY4A 3UO9A 1T1CA 3NDEA 2W1TA 1OT6A 1GCEA 4IJGA 5HD3A 2LB9A 3TG9A 3HLWA 4IUHA 2W3FA 4EETB 1MBLA 2XDMA 5AQBA 2J9OA 2A49A 3MKFA 3LYXA 4PKYG 4X68A 2GJ3A 3NC8A 4OOLA 5GLCA 2Y4AA 1PZOA 1GHPA 5L10A 5CRFA 5KZHA 1TS6A 1YMSA 3M6BA 4FSFA 4FTXA 5GL9A 2HP9A 5TGFA 2EWVA 4MDZA 3W4OA 3OZHA 4R4RA 1ES2A 3CI6A 3OC2A 2V20A 3VMAA 1SKFA 1YM1A 5CHUA 3ZG8B 3IX8A 2KOIA 3PBRA 4DMZA 4Z9QA 2DMWA 1T1BA 5HD5A 1TDLA 1ERMA 1SKOA 3LCEA 4WBGA 1IYQA 2ZBBA 2A2LA 1LL9A 1RGYA 4UA7A 3NULA 3F1OB 3HLFA 2P74A 1HTZA 4LFUA 5DF8A 2EFUA 2LB5A 3MF0A 4EEUA 4PM9A 3VFHA 2CC1A 2ZMAA 3VOYA 2R9WA 1K56D 4X1LA 2WAFA 1ESUA 3BECA 1XP4A 2O0YA 2EX8A 2MJ6A 4U3TA 4KQDA 3IF6C 2GDNA 1W8YA 3UDFA 2ZMFA 3LO7A 1YKDA 1BLSA 2XROA 2WAEA 2HV1A 3RXXA 4QHCA 2PAVP 5DJUA 4RA7A 4O8GA 2J8YA 3JVVA 1KVMA 3Q1FA 2OWJA 4II7A 3MMHA 4MBFA 2P7JA 3MQOA 4OKPA 4XT2A 1CK3A 4MN7A 1PZPA 5GHYA 1KGEA 3UE0A 3FG8A 3NOTC 1DJCA 2WZZA 1T19A 4HQAA 4KQQA 1F9IA 2W3GA 1C3BA 1T1AA 1MXOA 4S2MA 1FR1A 1A0KA 2JC7A 4RVAA 1W63M 2A24A 3EEAA 3FWLA 5EVIB 1MWTA 1OT9A 1OTBA 4OVDA 5CEDA 2PD8A 5DJTA 1Q2QA 3LIFA 3T4QA 1NYMA 3BFGA 1IKIA 4QY6A 3N8RA 1NLYA 3NOUC 3O86A 1E3UD 1V9ZA 3W4QA 3PBSA 1IELA 3HJIA 3G2YA 4ME4A 3IS2A 5M1AA 4HJ3A 4EV4A 1VETB 2VZWA 4CPKA 5HDDA 3IWOA 2VV8A 2H0TA 2WZXA 3G35A 2P04A 3H82A 3U2AA 3VV4A 1S1ZA 4O7DA 3A0SA 1K55A 2XGNA 3S4XA 3IXDA 5E2EA 5EPHA 4K0XA 4KQOA 1YSQA 2RCXA 3MS6A 4FOFA 1JWZA 2Y2QA 1ODVA 3OCNA 1D7EA 4LCLA 1YLPA 2HDUA 5CGXA 3WS5A 1D06A 5FQJA 2WGWA 1TF1A 4KUOA 1LL5A 2M7VA 4BL3A 5F1GA 1FOFA 1GSVA 5TBMB 3LGOA 1ES3A 5M19A 4X6TA 5JYPA 3G31A 1YMXA 4YOFA 5HFOA 4MNRA 1VQQA 3C2WA 2ZM2A 3CWFA 3GSGA 1ZHHB 2V1AA 4BD1A 2X02A 1PW8A 1FCOA 1YLJA 3CZDA 4LLOB 1KE0A 4JBFA 4S2PA 3TSGA 5FEGA 2PYPA 2DRWA 3DWKA 2V1BA 3HUOA 3HL9A 4CLCD 1L0EA 2HZ5A 3RH8B 4E3MA 1G6AA 3E0YA 4JXGA 4KZAA 1W63Q 3D9YA 1IYPA 1EROA 1LSWA 3VP1A 2XH9A 4K08A 1SDNA 4P85A 1MKIA 4UA9A 2Y79A 4LV1A 1S4RA 1STZA 3UE6A 4BWIA 3P7NA 1OPXA 4E3NA 1PNEA 2PR6A 2KLIA 2B18A 3SH8A 3N7WA 1YLWA 3NDGA 1PW1A 2DNSA 3CAXA 3BLSA 5CGWA 2GNXA 1P9WA 4DN0A 4L9GA 3BFCA 5AVFA 1S1YA 1LSXA 1K6SA 3W4PA 3IXHA 4Y13A 4N9LA 3A0RA 4R3BA 2K2NA 4RX2A 4GCZA 2D02A 1FQGA 3UMDA 1NRFA 4Z1WA 3UPOA 3IF6A 5E2GA 3UB9A 5J3WA 2B95A 4I38A 3T1XA 1ALQA 2EXAA 4WL9A 2VV6A 4D60A 5GHZA 4CLCE 5HL6A 3BQ8A 5EVID 4KUKA 2XLNA 4KZ7A 4HI4A 1PI5A 2P9VA 4WMCD 4JGPA 1JWPA 2QYBA 2XA7M 2V8FA 4JKTA 4LGWA 3C7VA 1XJ6A 5KIZA 5KSHA 1IKGA 3WS2A 5CEBA 4HBUA 5HDCA 3ZCZA 1K57C 3A0VA 3KYEA 2PT7A 3OPPA 1UWNX 3D4FA 3D72A 5HAPA 1IYOA 5E43A 1NWZA 2V8CA 2V0WA 4IVKA 3UB8A 3VFFA 3Q82A 1XFNA 4EQ1A 1PFLA 1W5DA 1NXYA 4GD8A 3BYDA 3ZQ5A 5DTSA 3ZVWA 2V2FF 3M2JA 2VGJA 4EUVA 5I5LA 1DP8A 3V3RA 2ZC6B 1LI9A 1VEUA 2Y2JA 4QY5A 3GQZA 3T4LA 4OOYA 4Y5FA 2XK1A 4BL2A 3WS0A 4RQ9A 2XA7S 4Y0OA 2XFTA 4EEPA 3BEBA 1TS7A 2EA9A 2OV5A 3UMEA 3R7WA 1XJ3A 2XEPA 4WEJA 4EBPA 5FI7A 5A93A 4D2OA 1VM1A 5G4ZA 5L09A 1RP5A 5EVEA 5HPIA 1BYWA 4P0MA 1KDSA 1BLCA 1BSGA 3BY8A 2JKTI 4HJ6A 3RJUA 4E3IA 5IS1A 2BTFP 4NETA 4LCMA 2XR0A 4JGQA 4NXEA 2JBFA 4XXRA 2Y2LA 4PM6A 2ZC3B 4R3JA 4C6YA 2WKIA 1ZG6A 2ZQDA 5FSRA 4ARZA 1TD5A 2W1TB 2VKSA 4IVIA 2XQZA 1H3QA 4JF4A 3PXPA 5DTTA 1ESIA 1LL8A 5F6AA 4EQIA 4WUJA 4MBHA 4Y17A 4PAUA 3LEZA 1XJ2A 1Q2PA 1YPRA 5E2FA 1ZC2A 3LIBA 1TEMA 5AQ7A 4DE3A 2EX9A 4N92A 3Q7VB 1UWPX 1OJ5A 2VGLS 3FKWA 3PHYA 3ZNTA 1QMFA 4UEYA 1DP6A 5A90A 1AXBA 1N9NA 4WZ5C 4X1MA 3FPVA 3ZNYA 4QD4A 1LSVA 1BLHA 1MZUA 2ZL1B 1ACFA 4R4SA 5FA7A 4PKYA 2WKEA 1BULA 4JPMA 3MBZA 1H8YA 1MWRA 3Q7ZA 4GN2A 1SKOB 3LEQA 4B4ZA 4ZJ3A 5DF7A 3G2ZA 4HY8A 1WYBA 5GHXA 3GRJA 4HHDA 1WA9A 1NJ4A 3IXGA 4DE0A 3NCKA 3HLDA 3SH7A 2HPBA 3C7UA 2QZ6A 4F3LB 3VP4A 2Y59A 4ETZA 2K31A 1YLTA 4I39A 3V50A 1FSWA 4PM5A 1K25A 4Q0IA 3QP5A 4E3LA 4C75A 3QNBA 3MXSA 4RX3A 4OP5A 1EW0A 3DAVA 3BW6A 3GV9A 3IH9A 3UB6A 1DRMA 3CPTA 5F83A 1EI5A 2ZQCA 1I2SA 1K57A 4HBTA 4OH0A 4MN6A 3MR0A 4CLCB 1I5QA 2PDRA 1VHMA 2H0YA 1H8MA 1W79A 3SS3A 3I7JA 2Q9NA 3LI9A 1DJAA 1K54C 4JF5A 4KQRA 3DWZA 3VOZA 5DTKA 3JYIA 4NKPA 4MMNA 4EERA 4G3WA 3HREA 2Y55A 3G6OA 1KE4A 2QKPA 3LR5A 3CUEC 2OAP1 2L4RA 4GDBA 5HWVA 1DJBA 4ZJ2A 2C6WB 5FATA 4UHUA 5FQMA 1Y4OA 5HW3A 4GHIA 4S2OA 5FL3A 3EQUA 3IBRA 1QMEA 2JN7A 1S67L 5F82A 4EBLA 2A24B 2Y2GA 4JF6A 1YAXA 1OTIA 3MQQA 3HBRA 2WGIA 3ZVTA 3U4LP 4CQHA 3B42A 3UB7A 2JKRI 3SW1A 4BQMA 4S2JA 2EX2A 4HOIA 3TOIA 4S2IA 4A5RA 4PM8A 4GZBA 1ZG4A 3IS2B 3A3DA 1OTEA 3B3XA 1GSXA 2X71A 3SZTA 4DDYA 1GA0A 1T18A 3E2LA 4BD0A 5F69A 3H82B 3ISGA 3KSIA 3ZYTA 5EV0A 3UDIA 4LV2A 5U47A 2QWSA 1TVFA 4ETXA 2JKTM 2Q0OA 4OQGA 5L8MA 3CG5A 3R4KA 4G3VA 2NUPC 4QJGA 1O07A 1ES4A 2VV7A 3NECA 1U60A 1L2SA 3IXBA 5E2HA 1HVBA 3TE8A 2WGWB 2QJ5A 3CHWP 1MC0A 1Z6FA 2RL3A 4BBTA 2WK0A 2EXBA 2XRNA 4MN5A 2W1RA 5LBRA 4JGRA 4PMAA 4OQ0A 4X69A 3ZG9B 2J3WA 3BY9A 2XF3A 4CJNA 3QP4A 5FAPA 1MWSA 3V3SA 1GSWA 3GTCA 2W0NA 5CGSA 2O9BA 1XGIA 4P6ZM 4ZAMA 4X53A 1LHYA 3VOLA 4GDNA 2INWA 4DE2A 2FFFB 2Y2HA 2UWXA 4ZRRA 1K4EA 3T1RA 5KMWA 4WZ5A 1MKMA 3T4TA 3VE4A 5J8XA 4Y3IA 2DCFA 2J3TD 3BRMA 2E8JA 3RXWA 5HZHA 3V39A 1PIOA 1S66L 4UA6A 2PD7A 3HUNA 4I3AA 3H7WA 3WWXA 1BT5A 3H9WA 1K4FA 3NJAA 3F1PA 4OPYA 3B33A 1F2KA 1XX2A 3UN7A 1H8ZA 4PHTA 5CHMA 3T4OA 1G6OA 2AVXA 3DTIA 4E04A 2XD1A 4GB7A 2G7UA 3ZGAB 4YWZA 3WRZA 4JXSA 1S0WA 3FPWA 1KOUA 1CQAA 3F1NA 4R70A 3S7OA 3T1QB 4FH2A 3AGEA 3IWQA 4U0XA 3NBLA 3LR4A 4EU0A 2PBDP 3B47A 3OLOA 3WS4A 4E6WA 3T50A 5FQQA 1PWDA 5TJJA 4P6ZS 4IBRA 3MFXA 5HWTA 3A3EA 1K54A 3AGDA 5TR7A 5D3OA 2W27A 2X01A 1IYSA 2CMNA 4LPZA 2PR5A 1W8QA 2OLVA 5HSQA 5FEFA 1FIKA 2ZM8A 4P87A 4KZ6A 3N8SA 3NOPC 3QP6A 3LI8A 2P08A 5CERA 4KZ5A 2Y2PA 2WKRA 3CUEA 3BFFA 5DF9A 4WN5A 2ZD8A 4FD8A 5I94A 3RTYA 4WF0A 4WYYA 4KG6A 2QJ7A 5EOOA 2IWCA 1XKZA 2GZAA 3CJMA 4MCWA 3LIEA 3QP8A 4DDSA 4KZ3A 1PWGA 1V9YA 3VP0A 4X25A 4OPRA 4GD6A 3UB5P 4XUXA 3MFDA 2JKRM 2C5WB 3IX4A 4H6JB 4LENA 2Y2MA 4OPQA 2VGKA 5FAOA 1VEUB 3PBNA 2JHEA 1IFQA 1IEMA 3NI9A 1MPLA 3ZHHA 4KZ4A 3KYZA 4EESA 5FDSA 4X55A 1JNUA 2VK3A 3UY6A 4YNRA 4R38A 1FR6A 3AGFA 3MQ0A 1F98A 4CLCC 3VP3A 3EQVA 4GJ4A 1ERQA 4IBXA 4O01A 1J9MA 3LIDA 4E3OA 4DE1A 3TRCA 2IWBA 4ZTKA 5FQKA 4E3JA 1NY0A 2FFYA 3UE3A 3R7WB 1YLZA 5EOEA 5HARA 3UE1A 5L07A 2R78A 4L9EA 4HIAA 4WLAA 3FC7A 5F1FA 5G4YA 4WM9A 2PU2A 4G3KA 1PI4A 3S7QA 2PYRA 3GR2A 1JTGA 5AQAA 1XPBA 3ULFA 4S2NC 5DFXA 2VGLM 2ZQ7A 4L0LA 1FILA 3PTEA 3LFVA 4Y7PA 3PR6A 1K56A 3CMZA 3QP2A 4KZ9A 4YINA 5CTNA 1L3LA 4Y15A 5F5YA 2B5RA 1KGGA 5FQ9A 4NXGA 4JXWA 1GA9A 5FI2A 4I3JA 3ZFZA 3K3CA 4GLQA 3C4PA 4HH3A 1CI9A 4GS9A 4ARZB 4OLGA 3GECA 3ITBA 3ZG0A 1AWIA 3E98A 2Z2LB 1L0FA 4BBVA 4BLMA 5EVIC 5HL1A 5CECA 4C3QA 3DTKA 2HJ9C 2WKQA 2A3UA 5J4EA 2Z6CA 2WUQA 2JKFA 1ONHA 1Y28A 1SZVA 2W3DA 3IX3A 1P9RA 1NZUA 4OOMA 2Y2KA 2V1ZA 2VA0A 2YKFA 1SDEA 3N6IA 3C38A 3KSFA 1X0OA 1M40A 2NUTC 2XFSA 5AQ9A 2BLSA 2Y2IA 3GMWA 3C8CA 3FV7A 4IUKA 5EFWA 3T4JA 2I9VA 5FAQA 2QHKA 3Q07A 3TW8A 3O3VA 4S2LA 1GHMA 2J7VA 1E25A 4HP4A 5DKKA 5GLBA 4NG2A 1XGJA 1TS0A 2ZOHA 3L7HA 4B88A 4P6BA 1KE3A 4EW7A 1E3UA 3UPPA 3OBFA 3KO6A 5GLAA 3ICYA 1YT4A 2UV0E
chains in the Genus database with same CATH topology
1OTEA 1GSXA 1S4RA 1STZA 2OWHA 4NEED 3UE6A 5HPFA 3E4PA 4BWIA 4BBUA 3P7NA 1OPXA 1T18A 2J80A 5F69A 2PR6A 3H82B 2KLIA 3KSIA 4LRZE 3ZYTA 4R6LA 2B18A 2QWSA 2VX8A 4HJ4A 3BWLA 4LRYC 3CAXA 4Q0HA 4ETXA 2JKTM 1OTAA 2GNXA 1P9WA 3EWKA 4DN0A 4L9GA 5L8MA 2PHYA 4GS9B 1S1YA 1LSXA 5AVFA 2OAQ1 4I3IA 3R4KA 4G3VA 2NUPC 2O9AA 3NHQA 3A0RA 2K2NA 2VV7A 4GCZA 2D02A 3UMDA 2HGVA 2O9CA 4Z1WA 3TE8A 3UB9A 4NXBA 5J3WA 4I38A 1UGUA 2QJ5A 1MC0A 4BBTA 3GDIA 4WL9A 3T4SA 2VV6A 3E4OA 2XRNA 3IBJA 4QPRA 4CLCE 5HL6A 3BQ8A 2IA2A 1G28A 4MN5A 4KUKA 4F3LA 2W1RA 5AJGA 2ZMVA 5LBRA 4JGRA 4HH2A 4HI4A 4JGPA 5C5KA 4HP9A 2QYBA 1NLZA 2V9AA 2XA7M 2J3WA 3BY9A 1TS8A 1P0ZA 2M7UA 1XJ6A 5KIZA 5KSHA 3TJZC 3F1OA 4GHIB 1GSWA 4JGOA 1NRJA 2W0NA 4XT2B 2O9BA 3OCLA 3S7PA 4B9OA 3OOVA 5HDCA 4P6ZM 2D01A 3VOLA 2L1MA 4AFIA 3KSGA 3KYQA 3A0VA 2INWA 3RFBA 4I5SA 2HJEA 4ZRRA 4CLCA 2PT7A 3C30A 3LR3A 2O99A 1UWNX 1MKMA 2WKPA 2OOLA 3T4TA 3VE4A 3D72A 4Y3IA 1N9LA 2J3TD 3CITA 2FH5A 1NWZA 3O5YA 2V0WA 3UB8A 4BMWA 3K2NA 4B93A 5MC7A 5HZHA 2YKHA 1XFNA 4EQ1A 1T1CA 1S66L 2PD7A 2W1TA 1OT6A 3ZQ5A 3EEHA 4I3AA 3H7WA 2M1CA 4IJGA 3P01A 5HD3A 2LB9A 3H9WA 4IUHA 2W3FA 3NJAA 4EETB 3F1PA 4EUVA 5I5LA 4BJPA 1N9OA 3LYXA 3B33A 1DP8A 3EGDC 4PKYG 2B02A 2GJ3A 4OOLA 4PHTA 3T4LA 3T4OA 1G6OA 4R3AA 4Y5FA 4E04A 1TS6A 2G7UA 1VB6A 4YWZA 5DKLA 3FPWA 4FSFA 2KX6A 1KOUA 1OJGA 2EWVA 4MDZA 2W3HA 3F1NA 3EOIA 4R70A 4RQ9A 3S7OA 3CI6A 3OC2A 2XA7S 4EEPA 3E4QA 3LR4A 1TS7A 2EA9A 4EU0A 2KOIA 3PBRA 4DMZA 3UMEA 2DMWA 3R7WA 1T1BA 1XJ3A 3B47A 3OLOA 3T50A 4WEJA 5HD5A 4L9FA 5TJJA 4P6ZS 3MFXA 5HWTA 5G4ZA 1P97A 2W27A 3HJKA 5HPIA 2CMNA 4LPZA 2PR5A 1BYWA 2ZBBA 3BQAA 3MJQA 2A2LA 5HSQA 4WELA 3F1OB 4WEKA 4Q0JA 3NOPC 2LB5A 5IU1A 3MF0A 4EEUA 3LI8A 2P08A 3BY8A 2JKTI 4HJ6A 5IS1A 2WKRA 2Z6DA 3CUEA 2HF6A 1XJ4A 5IT5A 3D3OA 5DF9A 4WN5A 2O0YA 4JGQA 4NXEA 2XSSA 3RTYA 4WF0A 2MJ6A 5AVEA 2K7SA 4KQDA 1LT0A 3EGXC 2QJ7A 2W3EA 2GZAA 4MCWA 4ARZA 3LIEA 1TD5A 2ZMFA 2W1TB 1V9YA 1YKDA 2VKSA 3H7WB 3LICA 2XROA 1H3QA 2HV1A 3PXPA 1LL8A 5DJUA 5F6AA 2JKRM 3F1PB 4O8GA 4WUJA 3JVVA 4H6JB 3BJNA 4PAUA 2OWJA 4II7A 1XJ2A 3MMHA 5TBMA 3CLOA 3PBNA 2JHEA 1IFQA 2P7JA 3LIBA 4HNBA 3MQOA 3KYZA 4EESA 2ZOIA 4MN7A 4XT2A 1JNUA 1UWPX 1OJ5A 4YNRA 2VGLS 4R38A 3FG8A 3MQ0A 3NOTC 1F98A 3PHYA 4CLCC 1T19A 4HQAA 4UEYA 3EQVA 1F9IA 2W3GA 4GJ4A 1T1AA 4GW9A 1DP6A 2FZ0A 1N9NA 3F1NB 5F68A 1ZTUA 4O01A 3FPVA 2Y8HA 3LIDA 3T4KA 5HWWA 1LSVA 3TRCA 1MZUA 1W63M 2A24A 4EXOA 3UE3A 3R7WB 3EEAA 4LRXC 1OT9A 1OTBA 2R78A 1YSPA 4HIAA 4L9EA 4PKYA 4WLAA 3FC7A 2GX5A 2PD8A 5G4YA 5DJTA 3LIFA 3T4QA 3JVUA 4G3KA 4UQIM 3V67A 3S7QA 1IOUA 4HY8A 2PYRA 1NLYA 3NOUC 1V9ZA 4HHDA 1WA9A 3ULFA 4DJ2A 5DFXA 2VGLM 3PBSA 3HJIA 4ME4A 4F3LB 3IS2A 4L0LA 3LFVA 4ETZA 2K31A 4HJ3A 3PR6A 4I39A 2VZWA 5HDDA 4Q0IA 4Y2FA 5J7EA 2VV8A 3W2ZA 3H82A 2P04A 3U2AA 3VV4A 5F5YA 1EW0A 3HCYA 4O0PA 1S1ZA 1S4SA 3A0SA 3BW6A 4NXGA 3UB6A 4I3JA 2V0UA 3KX0X 1DRMA 3K3CA 4GLQA 3KSHA 4HH3A 4KQOA 4GS9A 1YSQA 4ARZB 4MN6A 3PYPA 3GECA 3MR0A 4CLCB 4FOFA 3E98A 2PDRA 3LUQA 1VHMA 4BBVA 1ODVA 1H8MA 3MXQA 3OCNA 1D7EA 3LI9A 2BASA 2HJ9C 2WKQA 2KDKA 1F5MA 5J4EA 1D06A 1XFQA 2Z6CA 4KUOA 1TF1A 2M7VA 4NKPA 4MMNA 1GSVA 5TBMB 1Y28A 2W3DA 5A8BA 4EERA 4IHQA 4G3WA 1P9RA 3LR0A 2H28A 3G6OA 4OOMA 3PBTA 2QKPA 3LR5A 4YOFA 3PBQA 2VA0A 3CUEC 2OAP1 2L4RA 3DBAA 3C2WA 5HWVA 2YKFA 3CWFA 3C38A 3KSFA 1X0OA 2NUTC 1ZHHB 2V1AA 3VE3A 4GHIA 2J3TC 3C8CA 4LLOB 3S7NA 4IUKA 3T4JA 4UQIS 5EFWA 2I9VA 5FL3A 3EQUA 2QHKA 2PYPA 2VJWA 3IBRA 1DP9A 3TW8A 2JN7A 2V1BA 1S67L 2L0WA 2A24B 2VEAA 4HP4A 3LIAA 4NXFA 4DJ3A 1YAXA 4M4XA 5DKKA 4CLCD 1OTIA 3K3DA 2EWWA 3MQQA 1TS0A 3RH8B 2ZOHA 3E0YA 3PBOA 1W63Q 4CQHA 1OTDA 3B42A 3UB7A 4EW7A 5CX7A 2VLGA 2JKRI 3SW1A 3OBFA 5HDSA 5K5BA 3KO6A 4HOIA 1LSWA 4H6JA 4K08A 3ICYA 3IS2B 5DFYA 2Y79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTE A;  1GSX A;  1S4R A;  2OWH A;  3UE6 A;  3E4P A;  4BBU A;  3P7N A;  1T18 A;  2J80 A;  5F69 A;  2PR6 A;  3H82 B;  4LRZ E;  4R6L A;  2QWS A;  4HJ4 A;  3BWL A;  4LRY C;  3CAX A;  1OTA A;  3EWK A;  4L9G A;  2PHY A;  4GS9 B;  1S1Y A;  1LSX A;  5AVF A;  4I3I A;  3NHQ A;  3A0R A;  2VV7 A;  4GCZ A;  2D02 A;  3UMD A;  3UB9 A;  4NXB A;  5J3W A;  4I38 A;  1UGU A;  2QJ5 A;  4BBT A;  3GDI A;  4WL9 A;  2VV6 A;  3E4O A;  1G28 A;  4MN5 A;  4KUK A;  4F3L A;  4JGR A;  4HH2 A;  4HI4 A;  4JGP A;  4HP9 A;  2V9A A;  3BY9 A;  1TS8 A;  1P0Z A;  1XJ6 A;  5KIZ A;  3F1O A;  4GHI B;  1GSW A;  4JGO A;  2W0N A;  4XT2 B;  4B9O A;  5HDC A;  2D01 A;  3VOL A;  2L1M A;  3A0V A;  2INW A;  4I5S A;  1UWN X;  2WKP A;  2OOL A;  3VE4 A;  3D72 A;  1N9L A;  1NWZ A;  2V0W A;  3UB8 A;  5HZH A;  2YKH A;  1XFN A;  4EQ1 A;  1T1C A;  1S66 L;  2PD7 A;  1OT6 A;  3ZQ5 A;  3EEH A;  4I3A A;  3H7W A;  2M1C A;  5HD3 A;  3H9W A;  3NJA A;  4EET B;  3F1P A;  5I5L A;  1N9O A;  3LYX A;  3B33 A;  1DP8 A;  4PKY G;  2B02 A;  2GJ3 A;  4R3A A;  4E04 A;  1TS6 A;  1VB6 A;  4YWZ A;  5DKL A;  2KX6 A;  1KOU A;  1OJG A;  3F1N A;  4RQ9 A;  4R70 A;  4EEP A;  3E4Q A;  1TS7 A;  2EA9 A;  3UME A;  1T1B A;  1XJ3 A;  3OLO A;  3T50 A;  5HD5 A;  4L9F A;  3MFX A;  5HWT A;  5G4Z A;  1P97 A;  2W27 A;  3HJK A;  4LPZ A;  2CMN A;  2PR5 A;  1BYW A;  2ZBB A;  3MJQ A;  5HSQ A;  3F1O B;  3NOP C;  5IU1 A;  4EEU A;  3LI8 A;  3BY8 A;  4HJ6 A;  5IS1 A;  2WKR A;  2Z6D A;  1XJ4 A;  4WN5 A;  4JGQ A;  4NXE A;  3RTY A;  4WF0 A;  5AVE A;  2K7S A;  4KQD A;  1LT0 A;  2QJ7 A;  3LIE A;  1V9Y A;  3H7W B;  3LIC A;  2HV1 A;  1LL8 A;  5DJU A;  5F6A A;  3F1P B;  4WUJ A;  4H6J B;  2OWJ A;  1XJ2 A;  5TBM A;  3CLO A;  2JHE A;  2P7J A;  3LIB A;  4HNB A;  3MQO A;  4EES A;  2ZOI A;  4XT2 A;  1JNU A;  1UWP X;  1OJ5 A;  4R38 A;  3FG8 A;  3NOT C;  1F98 A;  3PHY A;  1T19 A;  4HQA A;  1F9I A;  1T1A A;  4GW9 A;  1DP6 A;  1N9N A;  3F1N B;  5F68 A;  3LID A;  5HWW A;  1LSV A;  1MZU A;  2A24 A;  4EXO A;  4LRX C;  1OT9 A;  1OTB A;  2R78 A;  4L9E A;  4HIA A;  4PKY A;  4WLA A;  3FC7 A;  2PD8 A;  5G4Y A;  5DJT A;  3LIF A;  4HY8 A;  2PYR A;  3NOU C;  1V9Z A;  4HHD A;  1WA9 A;  3ULF A;  4DJ2 A;  3HJI A;  4F3L B;  3IS2 A;  4HJ3 A;  4I39 A;  5HDD A;  5J7E A;  2VV8 A;  3H82 A;  5F5Y A;  1EW0 A;  1S1Z A;  1S4S A;  3A0S A;  4NXG A;  3UB6 A;  4I3J A;  2V0U A;  3KX0 X;  1DRM A;  3K3C A;  4HH3 A;  4GS9 A;  4MN6 A;  3PYP A;  3GEC A;  3MR0 A;  2PDR A;  3LUQ A;  4BBV A;  1ODV A;  3MXQ A;  1D7E A;  3LI9 A;  2BAS A;  2WKQ A;  2KDK A;  5J4E A;  1D06 A;  1XFQ A;  2Z6C A;  4KUO A;  1GSV A;  5TBM B;  1Y28 A;  5A8B A;  4EER A;  2H28 A;  3G6O A;  2QKP A;  2L4R A;  3C2W A;  5HWV A;  2YKF A;  3CWF A;  1X0O A;  2V1A A;  3VE3 A;  4GHI A;  3C8C A;  4LLO B;  5EFW A;  2I9V A;  2QHK A;  2PYP A;  3IBR A;  1DP9 A;  2JN7 A;  2V1B A;  1S67 L;  2L0W A;  2A24 B;  2VEA A;  4HP4 A;  3LIA A;  4NXF A;  4DJ3 A;  4M4X A;  5DKK A;  1OTI A;  3K3D A;  3MQQ A;  1TS0 A;  3RH8 B;  2ZOH A;  1OTD A;  3UB7 A;  4EW7 A;  2VLG A;  3SW1 A;  5HDS A;  4HOI A;  1LSW A;  4H6J A;  4K08 A;  3ICY A;  3IS2 B; 
#chains in the Genus database with same CATH topology
 1K0K A;  4IED A;  4NEE D;  3E4P A;  4BBU A;  3PAE A;  3Q7V A;  1XXM A;  3IT9 A;  2QMI A;  4FH4 A;  4LRZ E;  4PM7 A;  3IF5 A;  2EFX A;  3HVF A;  4QB8 A;  3DTE A;  1RCJ A;  1HD8 A;  3BWL A;  4ZJ1 A;  1H5X A;  4DXB A;  3CPT B;  3IWI A;  2OAQ 1;  3OPH A;  3QP1 A;  3HLG A;  2ZL1 A;  3G32 A;  4EUZ A;  1G5U A;  1CEG A;  4DKI A;  2EX6 A;  3VP2 A;  1O7E A;  2O9C A;  1BLP A;  1K6R A;  3HLE A;  4K91 A;  1UGU A;  3MZE A;  4Y0U A;  3NY4 A;  3E4O A;  5CHJ A;  4QPR A;  5CXW A;  2IA2 A;  5HAQ A;  1CJF A;  4H8R A;  4F3L A;  5AJG A;  2PU4 A;  4MLL A;  1EWZ A;  3QHY A;  4JLF A;  2V9A A;  1BUE A;  4R23 A;  4LV0 A;  3F1O A;  4GHI B;  4JGO A;  2Y2N A;  4EWF A;  4XT2 B;  3DW0 A;  3OCL A;  1LI0 A;  3IQA A;  3S7P A;  4B9O A;  3OOV A;  2D01 A;  2L1M A;  3RFB A;  2ZC4 B;  2HJE A;  3FYZ A;  3W8K A;  2G2U A;  1J3W A;  4CLC A;  3LR3 A;  2O99 A;  2WKH A;  3M2K A;  4DF6 A;  3MXR A;  1N9L A;  3K2N A;  4B93 A;  2YKH A;  3UDX A;  5KSC A;  4OQI A;  3EEH A;  2M1C A;  3P01 A;  1KDW A;  2I72 A;  4MEZ A;  4BJP A;  1N9O A;  4S2K A;  5EVL A;  1BZA A;  3EGD C;  4S2N A;  4KZB A;  2B02 A;  1N4O A;  5M18 A;  3OPR A;  4R3A A;  2JKG A;  1NZO A;  3O88 A;  3N8L A;  1VB6 A;  5DKL A;  2ZM0 A;  4RYE A;  2KX6 A;  1OJG A;  2J9P A;  2W3H A;  2Y2O A;  3EOI A;  2ZQA A;  1ZKJ A;  3E4Q A;  4E3K A;  3BFD A;  2WYX A;  3ZG7 B;  4UAA A;  5EVI A;  3IHB A;  4L9F A;  2ZQ9 A;  3MSH A;  4WMC A;  4YFM A;  1P97 A;  3HJK A;  3LY3 A;  3BQA A;  3MJQ A;  1RGZ A;  4WEL A;  3IHA A;  4WEK A;  3MZF A;  1E4D A;  4OP8 A;  4Q0J A;  1SCW A;  5IU1 A;  3G4P A;  3BM6 A;  4ESP A;  1VET A;  2Z6D A;  4FCF A;  2HF6 A;  1XJ4 A;  5IT5 A;  3D3O A;  2HP5 A;  3ITA A;  1MY8 A;  3O87 A;  2XSS A;  3MKE A;  5AVE A;  2K7S A;  1LT0 A;  3EGX C;  4KG2 A;  2W3E A;  3SH9 A;  2ZJ9 A;  5BOH A;  3UNW A;  4R1G A;  5FI6 A;  2BG1 A;  3A3I A;  1LLB A;  3MZD A;  3H7W B;  3LIC A;  2ZC7 A;  4GNU A;  1Y54 A;  1ONG A;  3F1P B;  5JYO A;  1GHI A;  3BJN A;  4GKU A;  4QU3 A;  5TBM A;  3CLO A;  4PPR A;  4N9K A;  4HNB A;  4WZ4 A;  2ZOI A;  2WGV A;  3JPU A;  1L0G A;  1JTD A;  3VSK A;  4M3K A;  3SS4 A;  1CF0 A;  3P09 A;  4R0Q A;  4GW9 A;  1G68 A;  2FZ0 A;  3F1N B;  4OLD A;  5F68 A;  1ZTU A;  5CTM A;  1FCM A;  2IWD A;  2Y8H A;  3T4K A;  5HWW A;  4EXO A;  4N1H A;  1PYY A;  4LRX C;  1YSP A;  3FKV A;  2GX5 A;  2OSU A;  5A91 A;  3IF6 B;  3A3J A;  3G30 A;  3JVU A;  3ZG5 A;  1WE4 A;  3C5A A;  2Z2M B;  4UQI M;  3V67 A;  1XA1 A;  1IOU A;  3OPL A;  4KG5 A;  1PRQ A;  2Y91 A;  4F94 A;  4DJ2 A;  5EE8 A;  5GLD A;  2P9V B;  3FZC A;  1H0M A;  2XD5 A;  4MBK A;  2JE5 A;  4Y2F A;  5EEC A;  5J7E A;  3W2Z A;  4X56 A;  1YQS A;  4HES A;  2H10 A;  3HCY A;  4O0P A;  2OLU A;  1S4S A;  1KGF A;  4KZ8 A;  2H5S A;  2QPN A;  2V0U A;  3KX0 X;  3SS5 A;  3KSH A;  1CI8 A;  4JXV A;  3PYP A;  4ID4 A;  4KEN B;  3LUQ A;  2G2W A;  3M6H A;  1FSY A;  3MXQ A;  4GOG A;  2BAS A;  4OQH A;  4B4X A;  2KDK A;  3SOI A;  1F5M A;  1XFQ A;  3Q81 A;  4LV3 A;  2ZLY A;  3A3F A;  4FUW A;  5A8B A;  4IHQ A;  3WS1 A;  3LR0 A;  4OPZ A;  1YLY A;  2H28 A;  1BTL A;  2HDS A;  3PBT A;  1DY6 A;  1HLU P;  3PBQ A;  4DXC A;  3T1S A;  4EBN A;  3DBA A;  4BEN A;  5DVA A;  3V5M A;  3G34 A;  3BFE A;  3VE3 A;  2J3T C;  1TDG A;  3S7N A;  4UQI S;  2WAD A;  2VJW A;  1DP9 A;  1XA7 A;  1MWU A;  4NK3 A;  2L0W A;  2VEA A;  2PRF A;  4Y0T A;  3LIA A;  4NXF A;  3BLM A;  5A92 A;  4DJ3 A;  3L9K A;  3S1Y A;  4M4X A;  3HLC A;  3K3D A;  2EWW A;  2HDQ A;  3PBO A;  3P98 A;  2HDR A;  4DRT A;  1OTD A;  5CX7 A;  2VLG A;  1JVJ A;  5HDS A;  5EM1 A;  5K5B A;  5G18 A;  3HLB A;  4H6J A;  5HX9 A;  3C4O A;  5DFY A;  5FQI A;  2OWH A;  5HPF A;  2HP6 A;  1L0D A;  2J80 A;  3WRT A;  4R6L A;  2VX8 A;  3PAG A;  1FCN A;  4HJ4 A;  5FAS A;  4LRY C;  4Q0H A;  1OTA A;  4U0T A;  1JWV A;  3EWK A;  2PHY A;  1KVL A;  4GS9 B;  1M6K A;  4Q8I A;  4I3I A;  2R9X A;  5FDH A;  2O9A A;  2ACG A;  1OME A;  3NHQ A;  1NYY A;  1CEF A;  1Z09 A;  2JCH A;  1W7F A;  2HGV A;  1S6R A;  5HAI A;  4XUZ A;  1WYC A;  4ZBE A;  1PWC A;  4NXB A;  5TFQ A;  1SHV A;  2E8I A;  1ES5 A;  3GDI A;  4E6X A;  3T4S A;  4ZDX A;  3VSL A;  2Q9M A;  3IBJ A;  3DTM A;  3IH8 A;  4OON A;  4QWO A;  1G28 A;  4HEF A;  1N9B A;  2ZMV A;  2ZC5 B;  4HH2 A;  3NIA A;  3QNC A;  3T12 B;  5C5K A;  5L2F A;  4HP9 A;  1HZO A;  3ZDJ A;  1NLZ A;  2ZQ8 A;  3E2K A;  1TS8 A;  1P0Z A;  2M7U A;  3GVB A;  3TJZ C;  1NRJ A;  1K55 C;  3S22 A;  3UPN A;  4K0W A;  4AFI A;  3KSG A;  3KYQ A;  4N1X A;  4I5S A;  2PBY A;  1I2W A;  3C30 A;  5IHV A;  3N4I A;  5EM0 A;  1D1J A;  2WKP A;  2OOL A;  3CIT A;  2FH5 A;  3O5Y A;  4BMW A;  5MC7 A;  3HUM A;  5EUA A;  1K38 A;  3LY4 A;  3UO9 A;  1T1C A;  3NDE A;  2W1T A;  1OT6 A;  1GCE A;  4IJG A;  5HD3 A;  2LB9 A;  3TG9 A;  3HLW A;  4IUH A;  2W3F A;  4EET B;  1MBL A;  2XDM A;  5AQB A;  2J9O A;  2A49 A;  3MKF A;  3LYX A;  4PKY G;  4X68 A;  2GJ3 A;  3NC8 A;  4OOL A;  5GLC A;  2Y4A A;  1PZO A;  1GHP A;  5L10 A;  5CRF A;  5KZH A;  1TS6 A;  1YMS A;  3M6B A;  4FSF A;  4FTX A;  5GL9 A;  2HP9 A;  5TGF A;  2EWV A;  4MDZ A;  3W4O A;  3OZH A;  4R4R A;  1ES2 A;  3CI6 A;  3OC2 A;  2V20 A;  3VMA A;  1SKF A;  1YM1 A;  5CHU A;  3ZG8 B;  3IX8 A;  2KOI A;  3PBR A;  4DMZ A;  4Z9Q A;  2DMW A;  1T1B A;  5HD5 A;  1TDL A;  1ERM A;  1SKO A;  3LCE A;  4WBG A;  1IYQ A;  2ZBB A;  2A2L A;  1LL9 A;  1RGY A;  4UA7 A;  3NUL A;  3F1O B;  3HLF A;  2P74 A;  1HTZ A;  4LFU A;  5DF8 A;  2EFU A;  2LB5 A;  3MF0 A;  4EEU A;  4PM9 A;  3VFH A;  2CC1 A;  2ZMA A;  3VOY A;  2R9W A;  1K56 D;  4X1L A;  2WAF A;  1ESU A;  3BEC A;  1XP4 A;  2O0Y A;  2EX8 A;  2MJ6 A;  4U3T A;  4KQD A;  3IF6 C;  2GDN A;  1W8Y A;  3UDF A;  2ZMF A;  3LO7 A;  1YKD A;  1BLS A;  2XRO A;  2WAE A;  2HV1 A;  3RXX A;  4QHC A;  2PAV P;  5DJU A;  4RA7 A;  4O8G A;  2J8Y A;  3JVV A;  1KVM A;  3Q1F A;  2OWJ A;  4II7 A;  3MMH A;  4MBF A;  2P7J A;  3MQO A;  4OKP A;  4XT2 A;  1CK3 A;  4MN7 A;  1PZP A;  5GHY A;  1KGE A;  3UE0 A;  3FG8 A;  3NOT C;  1DJC A;  2WZZ A;  1T19 A;  4HQA A;  4KQQ A;  1F9I A;  2W3G A;  1C3B A;  1T1A A;  1MXO A;  4S2M A;  1FR1 A;  1A0K A;  2JC7 A;  4RVA A;  1W63 M;  2A24 A;  3EEA A;  3FWL A;  5EVI B;  1MWT A;  1OT9 A;  1OTB A;  4OVD A;  5CED A;  2PD8 A;  5DJT A;  1Q2Q A;  3LIF A;  3T4Q A;  1NYM A;  3BFG A;  1IKI A;  4QY6 A;  3N8R A;  1NLY A;  3NOU C;  3O86 A;  1E3U D;  1V9Z A;  3W4Q A;  3PBS A;  1IEL A;  3HJI A;  3G2Y A;  4ME4 A;  3IS2 A;  5M1A A;  4HJ3 A;  4EV4 A;  1VET B;  2VZW A;  4CPK A;  5HDD A;  3IWO A;  2VV8 A;  2H0T A;  2WZX A;  3G35 A;  2P04 A;  3H82 A;  3U2A A;  3VV4 A;  1S1Z A;  4O7D A;  3A0S A;  1K55 A;  2XGN A;  3S4X A;  3IXD A;  5E2E A;  5EPH A;  4K0X A;  4KQO A;  1YSQ A;  2RCX A;  3MS6 A;  4FOF A;  1JWZ A;  2Y2Q A;  1ODV A;  3OCN A;  1D7E A;  4LCL A;  1YLP A;  2HDU A;  5CGX A;  3WS5 A;  1D06 A;  5FQJ A;  2WGW A;  1TF1 A;  4KUO A;  1LL5 A;  2M7V A;  4BL3 A;  5F1G A;  1FOF A;  1GSV A;  5TBM B;  3LGO A;  1ES3 A;  5M19 A;  4X6T A;  5JYP A;  3G31 A;  1YMX A;  4YOF A;  5HFO A;  4MNR A;  1VQQ A;  3C2W A;  2ZM2 A;  3CWF A;  3GSG A;  1ZHH B;  2V1A A;  4BD1 A;  2X02 A;  1PW8 A;  1FCO A;  1YLJ A;  3CZD A;  4LLO B;  1KE0 A;  4JBF A;  4S2P A;  3TSG A;  5FEG A;  2PYP A;  2DRW A;  3DWK A;  2V1B A;  3HUO A;  3HL9 A;  4CLC D;  1L0E A;  2HZ5 A;  3RH8 B;  4E3M A;  1G6A A;  3E0Y A;  4JXG A;  4KZA A;  1W63 Q;  3D9Y A;  1IYP A;  1ERO A;  1LSW A;  3VP1 A;  2XH9 A;  4K08 A;  1SDN A;  4P85 A;  1MKI A;  4UA9 A;  2Y79 A;  4LV1 A;  1S4R A;  1STZ A;  3UE6 A;  4BWI A;  3P7N A;  1OPX A;  4E3N A;  1PNE A;  2PR6 A;  2KLI A;  2B18 A;  3SH8 A;  3N7W A;  1YLW A;  3NDG A;  1PW1 A;  2DNS A;  3CAX A;  3BLS A;  5CGW A;  2GNX A;  1P9W A;  4DN0 A;  4L9G A;  3BFC A;  5AVF A;  1S1Y A;  1LSX A;  1K6S A;  3W4P A;  3IXH A;  4Y13 A;  4N9L A;  3A0R A;  4R3B A;  2K2N A;  4RX2 A;  4GCZ A;  2D02 A;  1FQG A;  3UMD A;  1NRF A;  4Z1W A;  3UPO A;  3IF6 A;  5E2G A;  3UB9 A;  5J3W A;  2B95 A;  4I38 A;  3T1X A;  1ALQ A;  2EXA A;  4WL9 A;  2VV6 A;  4D60 A;  5GHZ A;  4CLC E;  5HL6 A;  3BQ8 A;  5EVI D;  4KUK A;  2XLN A;  4KZ7 A;  4HI4 A;  1PI5 A;  2P9V A;  4WMC D;  4JGP A;  1JWP A;  2QYB A;  2XA7 M;  2V8F A;  4JKT A;  4LGW A;  3C7V A;  1XJ6 A;  5KIZ A;  5KSH A;  1IKG A;  3WS2 A;  5CEB A;  4HBU A;  5HDC A;  3ZCZ A;  1K57 C;  3A0V A;  3KYE A;  2PT7 A;  3OPP A;  1UWN X;  3D4F A;  3D72 A;  5HAP A;  1IYO A;  5E43 A;  1NWZ A;  2V8C A;  2V0W A;  4IVK A;  3UB8 A;  3VFF A;  3Q82 A;  1XFN A;  4EQ1 A;  1PFL A;  1W5D A;  1NXY A;  4GD8 A;  3BYD A;  3ZQ5 A;  5DTS A;  3ZVW A;  2V2F F;  3M2J A;  2VGJ A;  4EUV A;  5I5L A;  1DP8 A;  3V3R A;  2ZC6 B;  1LI9 A;  1VEU A;  2Y2J A;  4QY5 A;  3GQZ A;  3T4L A;  4OOY A;  4Y5F A;  2XK1 A;  4BL2 A;  3WS0 A;  4RQ9 A;  2XA7 S;  4Y0O A;  2XFT A;  4EEP A;  3BEB A;  1TS7 A;  2EA9 A;  2OV5 A;  3UME A;  3R7W A;  1XJ3 A;  2XEP A;  4WEJ A;  4EBP A;  5FI7 A;  5A93 A;  4D2O A;  1VM1 A;  5G4Z A;  5L09 A;  1RP5 A;  5EVE A;  5HPI A;  1BYW A;  4P0M A;  1KDS A;  1BLC A;  1BSG A;  3BY8 A;  2JKT I;  4HJ6 A;  3RJU A;  4E3I A;  5IS1 A;  2BTF P;  4NET A;  4LCM A;  2XR0 A;  4JGQ A;  4NXE A;  2JBF A;  4XXR A;  2Y2L A;  4PM6 A;  2ZC3 B;  4R3J A;  4C6Y A;  2WKI A;  1ZG6 A;  2ZQD A;  5FSR A;  4ARZ A;  1TD5 A;  2W1T B;  2VKS A;  4IVI A;  2XQZ A;  1H3Q A;  4JF4 A;  3PXP A;  5DTT A;  1ESI A;  1LL8 A;  5F6A A;  4EQI A;  4WUJ A;  4MBH A;  4Y17 A;  4PAU A;  3LEZ A;  1XJ2 A;  1Q2P A;  1YPR A;  5E2F A;  1ZC2 A;  3LIB A;  1TEM A;  5AQ7 A;  4DE3 A;  2EX9 A;  4N92 A;  3Q7V B;  1UWP X;  1OJ5 A;  2VGL S;  3FKW A;  3PHY A;  3ZNT A;  1QMF A;  4UEY A;  1DP6 A;  5A90 A;  1AXB A;  1N9N A;  4WZ5 C;  4X1M A;  3FPV A;  3ZNY A;  4QD4 A;  1LSV A;  1BLH A;  1MZU A;  2ZL1 B;  1ACF A;  4R4S A;  5FA7 A;  4PKY A;  2WKE A;  1BUL A;  4JPM A;  3MBZ A;  1H8Y A;  1MWR A;  3Q7Z A;  4GN2 A;  1SKO B;  3LEQ A;  4B4Z A;  4ZJ3 A;  5DF7 A;  3G2Z A;  4HY8 A;  1WYB A;  5GHX A;  3GRJ A;  4HHD A;  1WA9 A;  1NJ4 A;  3IXG A;  4DE0 A;  3NCK A;  3HLD A;  3SH7 A;  2HPB A;  3C7U A;  2QZ6 A;  4F3L B;  3VP4 A;  2Y59 A;  4ETZ A;  2K31 A;  1YLT A;  4I39 A;  3V50 A;  1FSW A;  4PM5 A;  1K25 A;  4Q0I A;  3QP5 A;  4E3L A;  4C75 A;  3QNB A;  3MXS A;  4RX3 A;  4OP5 A;  1EW0 A;  3DAV A;  3BW6 A;  3GV9 A;  3IH9 A;  3UB6 A;  1DRM A;  3CPT A;  5F83 A;  1EI5 A;  2ZQC A;  1I2S A;  1K57 A;  4HBT A;  4OH0 A;  4MN6 A;  3MR0 A;  4CLC B;  1I5Q A;  2PDR A;  1VHM A;  2H0Y A;  1H8M A;  1W79 A;  3SS3 A;  3I7J A;  2Q9N A;  3LI9 A;  1DJA A;  1K54 C;  4JF5 A;  4KQR A;  3DWZ A;  3VOZ A;  5DTK A;  3JYI A;  4NKP A;  4MMN A;  4EER A;  4G3W A;  3HRE A;  2Y55 A;  3G6O A;  1KE4 A;  2QKP A;  3LR5 A;  3CUE C;  2OAP 1;  2L4R A;  4GDB A;  5HWV A;  1DJB A;  4ZJ2 A;  2C6W B;  5FAT A;  4UHU A;  5FQM A;  1Y4O A;  5HW3 A;  4GHI A;  4S2O A;  5FL3 A;  3EQU A;  3IBR A;  1QME A;  2JN7 A;  1S67 L;  5F82 A;  4EBL A;  2A24 B;  2Y2G A;  4JF6 A;  1YAX A;  1OTI A;  3MQQ A;  3HBR A;  2WGI A;  3ZVT A;  3U4L P;  4CQH A;  3B42 A;  3UB7 A;  2JKR I;  3SW1 A;  4BQM A;  4S2J A;  2EX2 A;  4HOI A;  3TOI A;  4S2I A;  4A5R A;  4PM8 A;  4GZB A;  1ZG4 A;  3IS2 B;  3A3D A;  1OTE A;  3B3X A;  1GSX A;  2X71 A;  3SZT A;  4DDY A;  1GA0 A;  1T18 A;  3E2L A;  4BD0 A;  5F69 A;  3H82 B;  3ISG A;  3KSI A;  3ZYT A;  5EV0 A;  3UDI A;  4LV2 A;  5U47 A;  2QWS A;  1TVF A;  4ETX A;  2JKT M;  2Q0O A;  4OQG A;  5L8M A;  3CG5 A;  3R4K A;  4G3V A;  2NUP C;  4QJG A;  1O07 A;  1ES4 A;  2VV7 A;  3NEC A;  1U60 A;  1L2S A;  3IXB A;  5E2H A;  1HVB A;  3TE8 A;  2WGW B;  2QJ5 A;  3CHW P;  1MC0 A;  1Z6F A;  2RL3 A;  4BBT A;  2WK0 A;  2EXB A;  2XRN A;  4MN5 A;  2W1R A;  5LBR A;  4JGR A;  4PMA A;  4OQ0 A;  4X69 A;  3ZG9 B;  2J3W A;  3BY9 A;  2XF3 A;  4CJN A;  3QP4 A;  5FAP A;  1MWS A;  3V3S A;  1GSW A;  3GTC A;  2W0N A;  5CGS A;  2O9B A;  1XGI A;  4P6Z M;  4ZAM A;  4X53 A;  1LHY A;  3VOL A;  4GDN A;  2INW A;  4DE2 A;  2FFF B;  2Y2H A;  2UWX A;  4ZRR A;  1K4E A;  3T1R A;  5KMW A;  4WZ5 A;  1MKM A;  3T4T A;  3VE4 A;  5J8X A;  4Y3I A;  2DCF A;  2J3T D;  3BRM A;  2E8J A;  3RXW A;  5HZH A;  3V39 A;  1PIO A;  1S66 L;  4UA6 A;  2PD7 A;  3HUN A;  4I3A A;  3H7W A;  3WWX A;  1BT5 A;  3H9W A;  1K4F A;  3NJA A;  3F1P A;  4OPY A;  3B33 A;  1F2K A;  1XX2 A;  3UN7 A;  1H8Z A;  4PHT A;  5CHM A;  3T4O A;  1G6O A;  2AVX A;  3DTI A;  4E04 A;  2XD1 A;  4GB7 A;  2G7U A;  3ZGA B;  4YWZ A;  3WRZ A;  4JXS A;  1S0W A;  3FPW A;  1KOU A;  1CQA A;  3F1N A;  4R70 A;  3S7O A;  3T1Q B;  4FH2 A;  3AGE A;  3IWQ A;  4U0X A;  3NBL A;  3LR4 A;  4EU0 A;  2PBD P;  3B47 A;  3OLO A;  3WS4 A;  4E6W A;  3T50 A;  5FQQ A;  1PWD A;  5TJJ A;  4P6Z S;  4IBR A;  3MFX A;  5HWT A;  3A3E A;  1K54 A;  3AGD A;  5TR7 A;  5D3O A;  2W27 A;  2X01 A;  1IYS A;  2CMN A;  4LPZ A;  2PR5 A;  1W8Q A;  2OLV A;  5HSQ A;  5FEF A;  1FIK A;  2ZM8 A;  4P87 A;  4KZ6 A;  3N8S A;  3NOP C;  3QP6 A;  3LI8 A;  2P08 A;  5CER A;  4KZ5 A;  2Y2P A;  2WKR A;  3CUE A;  3BFF A;  5DF9 A;  4WN5 A;  2ZD8 A;  4FD8 A;  5I94 A;  3RTY A;  4WF0 A;  4WYY A;  4KG6 A;  2QJ7 A;  5EOO A;  2IWC A;  1XKZ A;  2GZA A;  3CJM A;  4MCW A;  3LIE A;  3QP8 A;  4DDS A;  4KZ3 A;  1PWG A;  1V9Y A;  3VP0 A;  4X25 A;  4OPR A;  4GD6 A;  3UB5 P;  4XUX A;  3MFD A;  2JKR M;  2C5W B;  3IX4 A;  4H6J B;  4LEN A;  2Y2M A;  4OPQ A;  2VGK A;  5FAO A;  1VEU B;  3PBN A;  2JHE A;  1IFQ A;  1IEM A;  3NI9 A;  1MPL A;  3ZHH A;  4KZ4 A;  3KYZ A;  4EES A;  5FDS A;  4X55 A;  1JNU A;  2VK3 A;  3UY6 A;  4YNR A;  4R38 A;  1FR6 A;  3AGF A;  3MQ0 A;  1F98 A;  4CLC C;  3VP3 A;  3EQV A;  4GJ4 A;  1ERQ A;  4IBX A;  4O01 A;  1J9M A;  3LID A;  4E3O A;  4DE1 A;  3TRC A;  2IWB A;  4ZTK A;  5FQK A;  4E3J A;  1NY0 A;  2FFY A;  3UE3 A;  3R7W B;  1YLZ A;  5EOE A;  5HAR A;  3UE1 A;  5L07 A;  2R78 A;  4L9E A;  4HIA A;  4WLA A;  3FC7 A;  5F1F A;  5G4Y A;  4WM9 A;  2PU2 A;  4G3K A;  1PI4 A;  3S7Q A;  2PYR A;  3GR2 A;  1JTG A;  5AQA A;  1XPB A;  3ULF A;  4S2N C;  5DFX A;  2VGL M;  2ZQ7 A;  4L0L A;  1FIL A;  3PTE A;  3LFV A;  4Y7P A;  3PR6 A;  1K56 A;  3CMZ A;  3QP2 A;  4KZ9 A;  4YIN A;  5CTN A;  1L3L A;  4Y15 A;  5F5Y A;  2B5R A;  1KGG A;  5FQ9 A;  4NXG A;  4JXW A;  1GA9 A;  5FI2 A;  4I3J A;  3ZFZ A;  3K3C A;  4GLQ A;  3C4P A;  4HH3 A;  1CI9 A;  4GS9 A;  4ARZ B;  4OLG A;  3GEC A;  3ITB A;  3ZG0 A;  1AWI A;  3E98 A;  2Z2L B;  1L0F A;  4BBV A;  4BLM A;  5EVI C;  5HL1 A;  5CEC A;  4C3Q A;  3DTK A;  2HJ9 C;  2WKQ A;  2A3U A;  5J4E A;  2Z6C A;  2WUQ A;  2JKF A;  1ONH A;  1Y28 A;  1SZV A;  2W3D A;  3IX3 A;  1P9R A;  1NZU A;  4OOM A;  2Y2K A;  2V1Z A;  2VA0 A;  2YKF A;  1SDE A;  3N6I A;  3C38 A;  3KSF A;  1X0O A;  1M40 A;  2NUT C;  2XFS A;  5AQ9 A;  2BLS A;  2Y2I A;  3GMW A;  3C8C A;  3FV7 A;  4IUK A;  5EFW A;  3T4J A;  2I9V A;  5FAQ A;  2QHK A;  3Q07 A;  3TW8 A;  3O3V A;  4S2L A;  1GHM A;  2J7V A;  1E25 A;  4HP4 A;  5DKK A;  5GLB A;  4NG2 A;  1XGJ A;  1TS0 A;  2ZOH A;  3L7H A;  4B88 A;  4P6B A;  1KE3 A;  4EW7 A;  1E3U A;  3UPP A;  3OBF A;  3KO6 A;  5GLA A;  3ICY A;  1YT4 A;  2UV0 E; 
#chains in the Genus database with same CATH homology
 1OTE A;  1GSX A;  1S4R A;  1STZ A;  2OWH A;  4NEE D;  3UE6 A;  5HPF A;  3E4P A;  4BWI A;  4BBU A;  3P7N A;  1OPX A;  1T18 A;  2J80 A;  5F69 A;  2PR6 A;  3H82 B;  2KLI A;  3KSI A;  4LRZ E;  3ZYT A;  4R6L A;  2B18 A;  2QWS A;  2VX8 A;  4HJ4 A;  3BWL A;  4LRY C;  3CAX A;  4Q0H A;  4ETX A;  2JKT M;  1OTA A;  2GNX A;  1P9W A;  3EWK A;  4DN0 A;  4L9G A;  5L8M A;  2PHY A;  4GS9 B;  1S1Y A;  1LSX A;  5AVF A;  2OAQ 1;  4I3I A;  3R4K A;  4G3V A;  2NUP C;  2O9A A;  3NHQ A;  3A0R A;  2K2N A;  2VV7 A;  4GCZ A;  2D02 A;  3UMD A;  2HGV A;  2O9C A;  4Z1W A;  3TE8 A;  3UB9 A;  4NXB A;  5J3W A;  4I38 A;  1UGU A;  2QJ5 A;  1MC0 A;  4BBT A;  3GDI A;  4WL9 A;  3T4S A;  2VV6 A;  3E4O A;  2XRN A;  3IBJ A;  4QPR A;  4CLC E;  5HL6 A;  3BQ8 A;  2IA2 A;  1G28 A;  4MN5 A;  4KUK A;  4F3L A;  2W1R A;  5AJG A;  2ZMV A;  5LBR A;  4JGR A;  4HH2 A;  4HI4 A;  4JGP A;  5C5K A;  4HP9 A;  2QYB A;  1NLZ A;  2V9A A;  2XA7 M;  2J3W A;  3BY9 A;  1TS8 A;  1P0Z A;  2M7U A;  1XJ6 A;  5KIZ A;  5KSH A;  3TJZ C;  3F1O A;  4GHI B;  1GSW A;  4JGO A;  1NRJ A;  2W0N A;  4XT2 B;  2O9B A;  3OCL A;  3S7P A;  4B9O A;  3OOV A;  5HDC A;  4P6Z M;  2D01 A;  3VOL A;  2L1M A;  4AFI A;  3KSG A;  3KYQ A;  3A0V A;  2INW A;  3RFB A;  4I5S A;  2HJE A;  4ZRR A;  4CLC A;  2PT7 A;  3C30 A;  3LR3 A;  2O99 A;  1UWN X;  1MKM A;  2WKP A;  2OOL A;  3T4T A;  3VE4 A;  3D72 A;  4Y3I A;  1N9L A;  2J3T D;  3CIT A;  2FH5 A;  1NWZ A;  3O5Y A;  2V0W A;  3UB8 A;  4BMW A;  3K2N A;  4B93 A;  5MC7 A;  5HZH A;  2YKH A;  1XFN A;  4EQ1 A;  1T1C A;  1S66 L;  2PD7 A;  2W1T A;  1OT6 A;  3ZQ5 A;  3EEH A;  4I3A A;  3H7W A;  2M1C A;  4IJG A;  3P01 A;  5HD3 A;  2LB9 A;  3H9W A;  4IUH A;  2W3F A;  3NJA A;  4EET B;  3F1P A;  4EUV A;  5I5L A;  4BJP A;  1N9O A;  3LYX A;  3B33 A;  1DP8 A;  3EGD C;  4PKY G;  2B02 A;  2GJ3 A;  4OOL A;  4PHT A;  3T4L A;  3T4O A;  1G6O A;  4R3A A;  4Y5F A;  4E04 A;  1TS6 A;  2G7U A;  1VB6 A;  4YWZ A;  5DKL A;  3FPW A;  4FSF A;  2KX6 A;  1KOU A;  1OJG A;  2EWV A;  4MDZ A;  2W3H A;  3F1N A;  3EOI A;  4R70 A;  4RQ9 A;  3S7O A;  3CI6 A;  3OC2 A;  2XA7 S;  4EEP A;  3E4Q A;  3LR4 A;  1TS7 A;  2EA9 A;  4EU0 A;  2KOI A;  3PBR A;  4DMZ A;  3UME A;  2DMW A;  3R7W A;  1T1B A;  1XJ3 A;  3B47 A;  3OLO A;  3T50 A;  4WEJ A;  5HD5 A;  4L9F A;  5TJJ A;  4P6Z S;  3MFX A;  5HWT A;  5G4Z A;  1P97 A;  2W27 A;  3HJK A;  5HPI A;  2CMN A;  4LPZ A;  2PR5 A;  1BYW A;  2ZBB A;  3BQA A;  3MJQ A;  2A2L A;  5HSQ A;  4WEL A;  3F1O B;  4WEK A;  4Q0J A;  3NOP C;  2LB5 A;  5IU1 A;  3MF0 A;  4EEU A;  3LI8 A;  2P08 A;  3BY8 A;  2JKT I;  4HJ6 A;  5IS1 A;  2WKR A;  2Z6D A;  3CUE A;  2HF6 A;  1XJ4 A;  5IT5 A;  3D3O A;  5DF9 A;  4WN5 A;  2O0Y A;  4JGQ A;  4NXE A;  2XSS A;  3RTY A;  4WF0 A;  2MJ6 A;  5AVE A;  2K7S A;  4KQD A;  1LT0 A;  3EGX C;  2QJ7 A;  2W3E A;  2GZA A;  4MCW A;  4ARZ A;  3LIE A;  1TD5 A;  2ZMF A;  2W1T B;  1V9Y A;  1YKD A;  2VKS A;  3H7W B;  3LIC A;  2XRO A;  1H3Q A;  2HV1 A;  3PXP A;  1LL8 A;  5DJU A;  5F6A A;  2JKR M;  3F1P B;  4O8G A;  4WUJ A;  3JVV A;  4H6J B;  3BJN A;  4PAU A;  2OWJ A;  4II7 A;  1XJ2 A;  3MMH A;  5TBM A;  3CLO A;  3PBN A;  2JHE A;  1IFQ A;  2P7J A;  3LIB A;  4HNB A;  3MQO A;  3KYZ A;  4EES A;  2ZOI A;  4MN7 A;  4XT2 A;  1JNU A;  1UWP X;  1OJ5 A;  4YNR A;  2VGL S;  4R38 A;  3FG8 A;  3MQ0 A;  3NOT C;  1F98 A;  3PHY A;  4CLC C;  1T19 A;  4HQA A;  4UEY A;  3EQV A;  1F9I A;  2W3G A;  4GJ4 A;  1T1A A;  4GW9 A;  1DP6 A;  2FZ0 A;  1N9N A;  3F1N B;  5F68 A;  1ZTU A;  4O01 A;  3FPV A;  2Y8H A;  3LID A;  3T4K A;  5HWW A;  1LSV A;  3TRC A;  1MZU A;  1W63 M;  2A24 A;  4EXO A;  3UE3 A;  3R7W B;  3EEA A;  4LRX C;  1OT9 A;  1OTB A;  2R78 A;  1YSP A;  4HIA A;  4L9E A;  4PKY A;  4WLA A;  3FC7 A;  2GX5 A;  2PD8 A;  5G4Y A;  5DJT A;  3LIF A;  3T4Q A;  3JVU A;  4G3K A;  4UQI M;  3V67 A;  3S7Q A;  1IOU A;  4HY8 A;  2PYR A;  1NLY A;  3NOU C;  1V9Z A;  4HHD A;  1WA9 A;  3ULF A;  4DJ2 A;  5DFX A;  2VGL M;  3PBS A;  3HJI A;  4ME4 A;  4F3L B;  3IS2 A;  4L0L A;  3LFV A;  4ETZ A;  2K31 A;  4HJ3 A;  3PR6 A;  4I39 A;  2VZW A;  5HDD A;  4Q0I A;  4Y2F A;  5J7E A;  2VV8 A;  3W2Z A;  3H82 A;  2P04 A;  3U2A A;  3VV4 A;  5F5Y A;  1EW0 A;  3HCY A;  4O0P A;  1S1Z A;  1S4S A;  3A0S A;  3BW6 A;  4NXG A;  3UB6 A;  4I3J A;  2V0U A;  3KX0 X;  1DRM A;  3K3C A;  4GLQ A;  3KSH A;  4HH3 A;  4KQO A;  4GS9 A;  1YSQ A;  4ARZ B;  4MN6 A;  3PYP A;  3GEC A;  3MR0 A;  4CLC B;  4FOF A;  3E98 A;  2PDR A;  3LUQ A;  1VHM A;  4BBV A;  1ODV A;  1H8M A;  3MXQ A;  3OCN A;  1D7E A;  3LI9 A;  2BAS A;  2HJ9 C;  2WKQ A;  2KDK A;  1F5M A;  5J4E A;  1D06 A;  1XFQ A;  2Z6C A;  4KUO A;  1TF1 A;  2M7V A;  4NKP A;  4MMN A;  1GSV A;  5TBM B;  1Y28 A;  2W3D A;  5A8B A;  4EER A;  4IHQ A;  4G3W A;  1P9R A;  3LR0 A;  2H28 A;  3G6O A;  4OOM A;  3PBT A;  2QKP A;  3LR5 A;  4YOF A;  3PBQ A;  2VA0 A;  3CUE C;  2OAP 1;  2L4R A;  3DBA A;  3C2W A;  5HWV A;  2YKF A;  3CWF A;  3C38 A;  3KSF A;  1X0O A;  2NUT C;  1ZHH B;  2V1A A;  3VE3 A;  4GHI A;  2J3T C;  3C8C A;  4LLO B;  3S7N A;  4IUK A;  3T4J A;  4UQI S;  5EFW A;  2I9V A;  5FL3 A;  3EQU A;  2QHK A;  2PYP A;  2VJW A;  3IBR A;  1DP9 A;  3TW8 A;  2JN7 A;  2V1B A;  1S67 L;  2L0W A;  2A24 B;  2VEA A;  4HP4 A;  3LIA A;  4NXF A;  4DJ3 A;  1YAX A;  4M4X A;  5DKK A;  4CLC D;  1OTI A;  3K3D A;  2EWW A;  3MQQ A;  1TS0 A;  3RH8 B;  2ZOH A;  3E0Y A;  3PBO A;  1W63 Q;  4CQH A;  1OTD A;  3B42 A;  3UB7 A;  4EW7 A;  5CX7 A;  2VLG A;  2JKR I;  3SW1 A;  3OBF A;  5HDS A;  5K5B A;  3KO6 A;  4HOI A;  1LSW A;  4H6J A;  4K08 A;  3ICY A;  3IS2 B;  5DFY A;  2Y79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...