3UB8A

Periplasmic portion of the helicobacter pylori chemoreceptor tlpb with formamide bound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
157
structure length
157
Chain Sequence
MEHLETGQYKKREKTLAYMTKILEQGIHEYYKSFDNDTARKMALDYFKRINDDKGMIYMVVVDKNGVVLFDPVNPKTVGQSGLDAQSVDGVYYVRGYLEAAKKGGGYTYYKMPKYDGGVPEKKFAYSHYDEVSQMVIAATSYYTDINTENKAIKEGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and proposed mechanism for the pH-sensing Helicobacter pylori chemoreceptor TlpB.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Membrane protein
molecule keywords chemoreceptor TlpB
total genus 54
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17200 sCache_2 Single Cache domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ub8A00
4K08A 3H9WA 3KX0X 4DJ3A 2I9VA 2GJ3A 4I3IA 1V9YA 2WKPA 4PKYG 4LRYC 3UB7A 5HWVA 4DJ2A 5EFWA 2OWJA 3UMDA 3MQQA 3MFXA 4GCZA 2KX6A 3UE6A 1OTAA 4EXOA 4H6JA 4BBVA 3F1PB 3C8CA 4HQAA 3LYXA 1KOUA 4EETB 3H82A 3NJAA 1NWZA 1F98A 2J80A 3MXQA 4GS9B 5J7EA 1V9ZA 5HDDA 3P7NA 3FC7A 3LI9A 4NXFA 3ZQ5A 1GSVA 3NOTC 1DP6A 3H7WB 2B02A 2D02A 4HOIA 4WN5A 4GS9A 3K3DA 5HSQA 5HZHA 3EWKA 2EA9A 2PYRA 4I39A 4KUKA 4RQ9A 1UGUA 2KDKA 1VB6A 1XJ3A 1GSWA 5HWWA 2ZBBA 1P97A 3VE3A 2PD8A 1UWNX 2JHEA 1WA9A 1BYWA 5F5YA 5TBMB 1OJGA 3F1OA 1Y28A 4EESA 5KIZA 4HH3A 4EERA 2W27A 5DKLA 1MZUA 1XFQA 4PKYA 4JGPA 5AVEA 4F3LB 3T50A 2WKRA 3A0VA 3LI8A 4NXGA 2VLGA 4HJ4A 3E4PA 1X0OA 5I5LA 2YKFA 3NOPC 5IS1A 4M4XA 3F1NB 2PHYA 3LIDA 3UMEA 2QJ5A 2V1AA 3F1PA 3PHYA 4XT2A 1OTBA 3LIBA 4L9GA 3RTYA 4L9FA 5DJTA 5J4EA 4JGQA 1LT0A 5A8BA 4HJ6A 3H82B 4WLAA 1OT9A 2PYPA 2QWSA 4LRZE 4I5SA 5IU1A 3BY9A 3HJIA 3PYPA 1LL8A 4NXBA 1S66L 4GHIA 3E4OA 4HP4A 1G28A 5G4ZA 5HD3A 2JN7A 2P7JA 2Z6DA 4I38A 4R38A 2V0UA 5HWTA 2PD7A 4H6JB 3UB9A 4EQ1A 4KUOA 2PR6A 2VV7A 2ZOIA 2PR5A 2H28A 2L0WA 3A0SA 3LIFA 1T19A 4GW9A 4EEUA 1TS0A 3LIEA 3ULFA 4R3AA 2V0WA 3IBRA 4JGRA 1XFNA 3RH8B 4EEPA 3H7WA 3NOUC 3HJKA 1D7EA 2L1MA 1OTDA 3IS2A 4BBTA 1P0ZA 2L4RA 3MJQA 4HHDA 5AVFA 1S4SA 2Z6CA 3A0RA 4HIAA 1OT6A 3CLOA 2OWHA 1T1AA 1TS7A 4WF0A 1S4RA 1N9NA 1XJ2A 1S67L 1XJ6A 5DKKA 5J3WA 4GHIB 3F1NA 1T1BA 2R78A 3BWLA 2ZOHA 3UB6A 3VE4A 3GDIA 4I3JA 3SW1A 5F6AA 1GSXA 1N9OA 1S1ZA 2VV8A 1EW0A 2INWA 5HDCA 3LUQA 5HDSA 5F68A 1LSXA 3BY8A 2VV6A 2CMNA 3MR0A 4KQDA 1LSWA 4XT2B 1T18A 5HD5A 4WL9A 1JNUA 4B9OA 1T1CA 1UWPX 4JGOA 4E04A 3B33A 1LSVA 2QKPA 2VEAA 4LRXC 3NHQA 1DP8A 4L9EA 2BASA 1N9LA 1S1YA 2QHKA 3E4QA 2V1BA 3F1OB 3IS2B 3OLOA 1OTEA 4HP9A 4NXEA 2V9AA 3CAXA 4HH2A 4R6LA 2W0NA 3CWFA 4BBUA 5G4YA 4LPZA 1OJ5A 2PDRA 3MQOA 4EW7A 5TBMA 4I3AA 2YKHA 1F9IA 2A24A 3GECA 4HJ3A 3ICYA 4LLOB 4YWZA 1DP9A 3EEHA 2K7SA 3LIAA 4F3LA 3UB8A 3VOLA 5DJUA 1DRMA 2A24B 1XJ4A 4MN5A 1D06A 2HV1A 3K3CA 3LICA 1TS8A 4R70A 4WUJA 3G6OA 1ODVA 4HI4A 1OTIA 3C2WA 4HY8A 5F69A 2M1CA 3D72A 2QJ7A 4HNBA 4MN6A 2OOLA 1TS6A 2D01A 2WKQA 3FG8A
chains in the Genus database with same CATH superfamily
2A49A 5EV0A 1V9YA 5EFWA 5FI2A 2VGLM 2WKIA 4KZ8A 3NULA 3W4OA 4OOYA 3LI9A 1ACFA 4GS9A 3KSGA 3EOIA 3PR6A 3ITAA 1GCEA 1BLCA 1Y28A 1I2WA 2XF3A 4OQHA 4ZJ3A 3BEBA 3BFDA 3Q07A 3T4OA 2WKRA 1PWCA 3NIAA 3IWQA 3F1NB 5A90A 2V1AA 1KDSA 5IU1A 3PAGA 3OBFA 1CEFA 4WYYA 5AQAA 2PU2A 4N1HA 2PD7A 3LY3A 1ERMA 4F94A 3LIFA 3S1YA 1L0DA 4JXGA 1YMSA 3BLMA 5CHMA 3IS2A 3IF6C 1N9NA 1I2SA 1Z6FA 2Y79A 5EVIA 3N8LA 1RP5A 1XA1A 3R7WB 4KG2A 1HD8A 5F68A 4EQIA 5EOEA 1IYOA 1DP8A 1N9LA 2W3HA 3LR3A 4OOMA 4EBNA 1OTEA 3TRCA 3UPOA 1TEMA 2YKHA 4B93A 4R4RA 2W3EA 2XQZA 4YWZA 4EW7A 2P04A 1DP9A 3TG9A 3LIAA 2K31A 2E8JA 3KSHA 2HP9A 1A0KA 1ERQA 2JCHA 4FCFA 3M2JA 3ZCZA 3C30A 3ZG5A 3MFXA 4BBVA 3F1PB 1Z09A 1ES3A 2B95A 4JF4A 5J7EA 3FC7A 1IYQA 4WN5A 4HOIA 2EA9A 4I39A 3Q7ZA 4PAUA 2KDKA 5FAPA 2ZBBA 1WA9A 1BYWA 4QY5A 2W27A 4IBXA 3D4FA 3A3JA 3PBRA 5CGSA 4MBFA 1ALQA 1P9WA 2VX8A 1E4DA 4M4XA 1M6KA 2XEPA 5FI6A 1BLHA 4M3KA 4DXCA 3OPHA 3ZVWA 3S7PA 1G28A 1MKIA 4R38A 2X01A 2Q9MA 2WUQA 1DJBA 4IVIA 1K54A 4JGRA 3HREA 2GZAA 4DDSA 1XKZA 1P0ZA 5AVFA 3ZNYA 4EBLA 4C75A 2M7UA 3T12B 4RVAA 2VV8A 4S2NC 1EW0A 4B88A 4K0XA 1T1CA 3E98A 1ZC2A 4O01A 3QP8A 5CTMA 4ARZA 1MY8A 3IF6B 5FQJA 1XPBA 2HDUA 3QP5A 3DBAA 3B47A 4LCLA 4MDZA 1KVMA 3GV9A 2H5SA 1PZPA 1YT4A 4QB8A 5KZHA 3UB7A 4X69A 4Y3IA 1RCJA 5DVAA 1ES4A 5GHZA 4DMZA 3C8CA 3Q1FA 4OP8A 4RX3A 4OP5A 3O86A 3KYQA 1RGYA 5HAIA 2EWWA 3WRTA 1L0FA 4Y13A 2I72A 1P97A 3SS5A 1FILA 1ES2A 1VQQA 5FEFA 3BYDA 3N8SA 1PWGA 1IOUA 1BULA 3MBZA 5I5LA 2JE5A 1LI9A 5FASA 5GLAA 4PM7A 2VA0A 4HJ6A 3ZFZA 4G3KA 1PZOA 2W1RA 1L0GA 1QMEA 1NRJA 2WAEA 3LIEA 1XFNA 2XROA 3CHWP 2Z6CA 3N4IA 4PHTA 5DKKA 4OQGA 3G30A 2FFYA 1L2SA 1MC0A 2EX9A 3DAVA 4KG5A 5CGWA 2BLSA 3SH7A 4KQDA 2JKRM 2ZM8A 1T18A 3FWLA 5E2GA 4JGOA 3SH9A 3UDFA 1YLYA 4WZ5C 4HP9A 1NJ4A 3MZDA 4JLFA 3WRZA 2A24A 1H5XA 2EX2A 4QWOA 1CK3A 2DNSA 1MPLA 3IHBA 4MN5A 2Y2NA 1PRQA 4HI4A 4HNBA 1TVFA 3SS4A 2D01A 2ZLYA 2XK1A 4PM5A 2Y91A 2WKEA 2UWXA 3CG5A 5DTKA 4P6BA 2B5RA 3W4QA 4CPKA 2ZJ9A 3BFEA 2V8CA 1NWZA 4JXWA 3GMWA 4CLCC 5HDDA 5DTTA 3PBTA 3JVUA 2XDMA 5JYPA 3ZVTA 3DTIA 4GD6A 1NYMA 4JGPA 1SKOA 3FYZA 2BG1A 3EGXC 4KZAA 5GHXA 3CJMA 4N92A 1BLSA 2JKFA 3TE8A 1YLWA 1IYPA 1VETB 1AWIA 3G35A 2WADA 4C6YA 4WLAA 2HF6A 4GHIA 5F1GA 3BECA 2P7JA 1JTGA 3UDIA 2VV7A 3V50A 3C4OA 4BMWA 2WGVA 4OPYA 3WS2A 3T4JA 2PT7A 1Y4OA 4HHDA 4BLMA 2EWVA 1G5UA 5HL1A 3VP2A 4WF0A 3LCEA 4HBTA 2Y2PA 2ZOHA 1YSPA 1W5DA 4WEKA 2JKGA 2QMIA 1LHYA 3HLDA 1F5MA 4GDBA 1PW8A 4ZBEA 2PU4A 4GZBA 3CWFA 3UE3A 3GECA 1BTLA 4HJ3A 1VM1A 3Q81A 3NDEA 3GRJA 3IHAA 4EBPA 3RXXA 4R70A 4RA7A 5L2FA 4X25A 2QJ7A 2X02A 1ZTUA 5EUAA 5DF7A 1K57A 3A3IA 1CJFA 3UE0A 5CX7A 5FL3A 3UMDA 3LYXA 3UE1A 3ZQ5A 4Q0HA 3P01A 2FFFB 3K3DA 3EWKA 4KUKA 4GOGA 2V2FF 2QZ6A 5TBMB 4HH3A 2WGIA 4IJGA 2XD5A 2Y2IA 5IHVA 1JTDA 3D3OA 4XUXA 3IXGA 2WGWA 5J8XA 4ZAMA 3FKVA 2JKTM 2B18A 2YKFA 3WS4A 5DF8A 3UMEA 3S4XA 2P9VA 1KE4A 3ZG8B 4DXBA 5F1FA 1LI0A 5TBMA 1N4OA 1OT9A 2JKTI 4YOFA 3O88A 3LFVA 3MKFA 1D7EA 4Z9QA 2L4RA 5CXWA 4HIAA 3HLGA 4X6TA 4N1XA 2O99A 1T1BA 4CLCB 5GLCA 3W8KA 2ZMAA 5EVIC 3ZHHA 4D2OA 4ZRRA 3EQVA 2QKPA 3AGFA 4JF6A 2O9BA 3KO6A 1D1JA 3UB5P 2H0YA 2ZQ9A 2ZD8A 1K0KA 2OSUA 2Y2JA 4F3LA 1YPRA 2VGJA 4Y15A 3FPVA 3C4PA 2M1CA 4LV0A 4HBUA 3T4KA 2GJ3A 2ZQDA 5HL6A 1PI4A 5TGFA 1W63Q 3IF5A 1F98A 1O7EA 4E3OA 5BOHA 2V8FA 4BWIA 4G3WA 4OPQA 1BLPA 1CEGA 2ZMVA 3BM6A 4YINA 3EEAA 3V5MA 3VOZA 4WM9A 3A3DA 4F3LB 4LV2A 2HPBA 3E4PA 2V1ZA 2MJ6A 4B4ZA 3CMZA 4IUKA 3RTYA 3E0YA 5CECA 3BY9A 3TW8A 3N8RA 1S66L 4HP4A 2JN7A 2HDRA 4FSFA 2ZC4B 3U4LP 3ULFA 2L1MA 3SS3A 3G32A 1TS7A 1GHPA 3T1RA 3IX3A 4Y17A 4GB7A 1LSXA 3IWIA 3HLBA 2XFTA 4UA9A 3NCKA 5AQ9A 2BASA 3F1OB 2V9AA 3IWOA 5CHUA 3IQAA 5E43A 1BSGA 3LEZA 2WGWB 2GX5A 5HARA 3VOLA 4Y0OA 3HUMA 4GN2A 2ZM0A 5C5KA 4OPZA 1NRFA 2X71A 5I94A 3N6IA 3ZG0A 4ZDXA 4UA6A 1YQSA 4GCZA 5FQKA 3NY4A 4S2LA 4S2IA 1NLZA 2A2LA 1H0MA 1CI8A 5M18A 1GSVA 1DP6A 3AGEA 5HSQA 4LENA 4LV3A 3V3RA 3BJNA 5GLDA 5F82A 5HPIA 4EESA 3PBOA 1SCWA 1YLJA 1MZUA 2H0TA 4X55A 3CITA 2NUPC 1PWDA 5TJJA 3HCYA 4P87A 4X1LA 2QJ5A 3KSFA 3ZNTA 3R7WA 4IVKA 4OQIA 1OTBA 4KZ9A 2GDNA 5EVIB 3PYPA 3S7OA 1YM1A 3H7WA 4S2JA 4DN0A 3ZG7B 1XJ6A 2KLIA 4B4XA 3TOIA 3BWLA 1GSXA 2INWA 4EV4A 1O07A 1Q2PA 4XUZA 2XA7S 4IBRA 1LSVA 2Y2HA 4KQOA 4UEYA 2VEAA 3A3FA 3NHQA 1K56D 5FQMA 3ZGAB 2LB5A 2O0YA 2PAVP 4BBUA 4Z1WA 4WZ5A 3UNWA 2EXAA 1MWUA 4PPRA 4K0WA 3K3CA 4WUJA 2ZQ7A 3OOVA 4X68A 4DJ3A 2WKPA 4NG2A 4Q0JA 4WELA 4CLCA 3N7WA 4BL2A 4II7A 1FSYA 1H8YA 5M19A 4DRTA 3RJUA 1DJCA 3W4PA 2XLNA 1SKFA 2ZQAA 2Y2QA 4CLCE 3MZEA 1SDEA 1KVLA 2DRWA 4PKYA 5HX9A 4KZ5A 4JF5A 1S6RA 2EX6A 3IXBA 4MBKA 3PBSA 2G7UA 4UHUA 4O0PA 1LT0A 2P74A 4R3BA 4YNRA 5FSRA 5HWTA 4E3NA 5FA7A 4OQ0A 2H28A 1K56A 4R3AA 3HJKA 2HZ5A 4BBTA 1KGFA 3G4PA 5L09A 4QJGA 4GHIB 5FAQA 3F1NA 2R78A 5F6AA 1LL5A 3KSIA 1M40A 3O3VA 2PBYA 1G6AA 1HLUP 3RXWA 5EVLA 1UWPX 3T4LA 3NC8A 1I5QA 3GR2A 3IS2B 4FUWA 1L0EA 4NK3A 3V67A 4EWFA 5G4YA 1GHIA 2ZMFA 2W3DA 1J9MA 4C3QA 3G2YA 2J3TC 3FPWA 4GDNA 1PNEA 3MQ0A 1TD5A 1MWTA 1ODVA 3C2WA 3D72A 1SDNA 3HLFA 2ZM2A 1CI9A 2ZL1B 3H9WA 3CUEA 1AXBA 1XX2A 4PKYG 3MQQA 2KX6A 4E3LA 4HQAA 2ZQCA 3NJAA 3MKEA 3CPTB 4DDYA 2Q9NA 3VFFA 4NXFA 2HJEA 3LGOA 4BJPA 1JWPA 3MMHA 3ZYTA 3WS1A 1UWNX 2JHEA 5FQ9A 4FOFA 3HBRA 2V20A 3MZFA 2Y2KA 3A0VA 3VSLA 3PAEA 4U3TA 4JPMA 3BRMA 1IKIA 3LIBA 3HUOA 5EM1A 4CJNA 2PYPA 5HWVA 3D9YA 3BLSA 4CQHA 4N9KA 3MS6A 3ITBA 4G3VA 3A0RA 2J8YA 1E25A 5M1AA 3UB6A 2VJWA 1IYSA 4KZBA 3TJZC 4IHQA 5L8MA 2GNXA 4ZJ2A 3MR0A 1Y54A 2HP5A 1K4FA 1HTZA 2VGKA 2XRNA 1EWZA 2M7VA 3OLOA 5GL9A 5E2HA 2W0NA 4LPZA 1KE0A 1OJ5A 2PDRA 3QHYA 2J9OA 3MXRA 1F9IA 3RFBA 4ID4A 1PIOA 5FQQA 4PM9A 3UB8A 2ZC7A 3P09A 2A24B 3G2ZA 2VK3A 4S2KA 5MC7A 4QHCA 2P08A 3P98A 3C7UA 4MN6A 3V3SA 1TS6A 2Q0OA 4K08A 4P6ZS 2WAFA 3C7VA 4U0XA 1K38A 1BT5A 3IF6A 4DE0A 4PM8A 2HDSA 2Y55A 5FQIA 4X53A 2J80A 4RX2A 1DJAA 2JKRI 1U60A 3P7NA 3H7WB 2D02A 4DE2A 1KDWA 1UGUA 4PMAA 4R0QA 4KZ4A 3VE3A 3UDXA 3GSGA 4FD8A 5DF9A 3NDGA 3VOYA 1SZVA 5A92A 2XR0A 2R9WA 5U47A 4EU0A 4LCMA 3F1PA 5TFQA 3S7NA 3CPTA 1MKMA 5D3OA 4P6ZM 4A5RA 3E4OA 4I38A 3T4SA 2EX8A 3C38A 4EUVA 1W79A 1NXYA 3CUEC 1OTDA 2WZXA 1S4RA 1TF1A 2Z2LB 5DFXA 1IFQA 1ZG6A 3T4TA 4MEZA 1K6SA 4RYEA 3NI9A 1XGIA 4B9OA 1G68A 5FEGA 4GLQA 2VKSA 1PW1A 4BQMA 4HH2A 4MMNA 3MQOA 4LLOB 3ICYA 2CC1A 2JC7A 4Y5FA 1XP4A 4R23A 3HLEA 5DJUA 4GKUA 3NBLA 1QMFA 4NKPA 1MWRA 4LFUA 3UPNA 4R4SA 5HFOA 2OWJA 2XH9A 1DY6A 3QNCA 2EFXA 3H82A 1WE4A 1YLPA 4OPRA 1E3UD 3GQZA 4WMCD 1FR6A 1XGJA 4PM6A 5HWWA 2XA7M 3FKWA 5F5YA 3WS0A 3F1OA 4IEDA 1GA0A 2ZC3B 3FZCA 5LBRA 2C5WB 3DTEA 3MXSA 4NXGA 3T1XA 2OLVA 4KZ6A 5DJTA 4MBHA 5EM0A 2XSSA 5J4EA 2Y2MA 4I5SA 5CEBA 1LL8A 4U0TA 2QPNA 4H6JB 3JYIA 3MFDA 3A0SA 3IBJA 4GW9A 3PXPA 3LEQA 3VP1A 3NOUC 3MJQA 2NUTC 3CLOA 1T1AA 4NEED 2C6WB 2J9PA 5TR7A 3OPPA 5HDSA 2VV6A 3IXDA 2E8IA 4ETZA 1K6RA 5EPHA 4OLGA 5FI7A 4NXEA 1RGZA 3S7QA 4GNUA 3R4KA 1W8QA 3EEHA 3HVFA 1D06A 1NZOA 3IXHA 4O7DA 5GLBA 4E3JA 5F69A 2XFSA 3U2AA 5IT5A 1S1YA 2QHKA 5FDSA 4S2PA 5AQ7A 4LRYC 1W8YA 2J3TD 1OTAA 4H6JA 5FAOA 1L3LA 3PBQA 1C3BA 3LR0A 4ETXA 3M2KA 1K55C 3HL9A 3IX8A 4E3MA 4DKIA 2B02A 3I7JA 2LB9A 2PYRA 3GTCA 4RQ9A 3QP4A 5KIZA 1XA7A 1XFQA 4S2NA 2J3WA 1ES5A 5E2EA 3VFHA 2HJ9C 3QP2A 4WEJA 1P9RA 2ACGA 3CI6A 4KG6A 1FCMA 4BD0A 2PHYA 4OONA 3LIDA 3VP3A 4BD1A 3PHYA 1KGGA 1GA9A 1H8MA 4KQRA 5A8BA 3VMAA 2Y2LA 4LRZE 4MNRA 5HPFA 3OZHA 5G4ZA 4ARZB 2V0UA 4EQ1A 2JBFA 2L0WA 3VV4A 4ZTKA 4WMCA 3EGDC 2V0WA 3ISGA 3G34A 4EEPA 4UQIM 1ONHA 1XJ2A 4FTXA 4NETA 4E6XA 2IA2A 4E6WA 1FQGA 3C5AA 1N9OA 4BL3A 3LUQA 3M6BA 3BY8A 1WYCA 3BFGA 3SH8A 4LRXC 1SHVA 3L9KA 1NZUA 2V1BA 3OC2A 3CAXA 1JVJA 1TDGA 3WWXA 2K7SA 3KYZA 3O87A 1EROA 4P85A 4OLDA 4KZ3A 3B3XA 1YSQA 3MF0A 5CRFA 2DCFA 2OOLA 2WZZA 5KSCA 1YMXA 2HP6A 1OMEA 4DE1A 2O9AA 4EETB 3O5YA 2RL3A 3BFCA 1EI5A 3QP6A 2W3FA 1KE3A 5HZHA 1FIKA 2HGVA 1PFLA 4Q0IA 2WK0A 5EE8A 3EQUA 4JXVA 1XJ3A 5K5BA 3LO7A 5CHJA 1BZAA 5DKLA 4E3KA 2Y59A 1K25A 2Y8HA 1X0OA 4H8RA 2R9XA 4XT2A 4EUZA 3K2NA 4OKPA 4JGQA 1YKDA 1CQAA 4KENB 4L0LA 5A93A 3HJIA 3IH9A 3UB9A 4KUOA 2ZQ8A 5L10A 2ZOIA 1Q2QA 1JWVA 5DTSA 1YLZA 3AGDA 3VSKA 2OWHA 4GJ4A 4O8GA 3S22A 1YLTA 2OAP1 3UY6A 2ZL1A 3W2ZA 3GDIA 4LV1A 5DFYA 5HDCA 5CERA 4S2MA 1SKOB 2Y2GA 2VGLS 4FH2A 1PI5A 1E3UA 2Z2MB 1MBLA 3WS5A 5KMWA 3ZG9B 4Q8IA 4X1MA 4HEFA 3B42A 1FCNA 4GD8A 4BENA 1VETA 4HJ4A 4X56A 2QYBA 3FG8A 4IUHA 3KX0X 3IX4A 1H8ZA 3Q7VB 4DJ2A 5EOOA 1H3QA 5JYOA 3UE6A 4Y0TA 5GHYA 1NY0A 5AJGA 2FH5A 1KOUA 4GS9B 1TDLA 2ZC5B 4MLLA 4AFIA 4ESPA 4ZJ1A 5HAPA 1ZHHB 3OPRA 3BW6A 2W3GA 2W1TA 3LI8A 3DWZA 5CEDA 1FCOA 4QY6A 5CGXA 1LLBA 2PBDP 4KQQA 4ME4A 4NXBA 5HD3A 3UO9A 1N9BA 4UAAA 1IKGA 2Z6DA 5L07A 2PR6A 1K54C 2W1TB 4JBFA 3RH8B 5HAQA 1OT6A 3FV7A 1S67L 2VZWA 1ONGA 3KYEA 5EVID 1F2KA 2IWCA 2CMNA 3E2KA 1LSWA 3OCLA 3ZDJA 4D60A 5FATA 5CTNA 3T1QB 3SOIA 3PTEA 4R6LA 4DE3A 4HESA 2HV1A 1ESIA 1STZA 2Y2OA 5EECA 4QD4A 2IWDA 1HVBA 3OPLA 1K57C 4I3IA 2RCXA 1VEUB 3OCNA 3G31A 3TSGA 2EXBA 3Q7VA 4YFMA 3QP1A 1V9ZA 4JKTA 3BQAA 4K91A 1GSWA 4JXSA 1OJGA 4WBGA 1IELA 4N9LA 3BFFA 5E2FA 2K2NA 3LR4A 5AVEA 3DTKA 5AQBA 2VLGA 2J7VA 3NOPC 3LY4A 2Y4AA 2OV5A 4UA7A 4L9FA 4EERA 3QNBA 4OH0A 4QU3A 5EVEA 2PR5A 1W7FA 2XGNA 2OAQ1 3IBRA 4OVDA 2G2WA 2WYXA 4E3IA 1S4SA 1VEUA 4CLCD 3CZDA 1K4EA 2BTFP 2IWBA 2ZC6B 1S1ZA 1HZOA 1WYBA 2P9VB 4Y0UA 3E2LA 4XT2B 4WL9A 1JNUA 1S0WA 4MCWA 3B33A 4R1GA 3JPUA 4L9EA 2KOIA 4UQIS 5KSHA 3E4QA 3M6HA 3HUNA 4LGWA 3NECA 3Q82A 1ZG4A 2FZ0A 2DMWA 3A3EA 1XJ4A 4R3JA 1TS8A 3G6OA 1ESUA 3UN7A 4OOLA 2WKQA 4XXRA 1IEMA 2I9VA 1OPXA 4QPRA 1XXMA 4EXOA 3JVVA 1NYYA 2AVXA 3GVBA 4Y7PA 3MXQA 3IT9A 4P0MA 1KGEA 3NOTC 1K55A 3V39A 1BUEA 1J3WA 3BQ8A 2UV0E 1VB6A 2PD8A 2G2UA 1FOFA 3VP0A 3PBNA 1GHMA 1CF0A 3T50A 1MXOA 4FH4A 1W63M 2HDQA 5IS1A 1MWSA 3DTMA 3L7HA 1FR1A 1NLYA 4L9GA 4MN7A 3DW0A 3H82B 1VHMA 4Y2FA 3UPPA 3T4QA 1ZKJA 2EFUA 1JWZA 1T19A 4EEUA 1TS0A 3LR5A 2O9CA 1FSWA 3HLWA 3DWKA 2WKHA 5J3WA 3VE4A 4I3JA 3SW1A 3SZTA 1LL9A 3HLCA 2H10A 3MSHA 2A3UA 5HD5A 4E04A 5HW3A 4KZ7A 2PRFA 5F83A 4WZ4A 1YAXA 3IH8A 3VP4A 1PYYA 4S2OA 3T1SA 4I3AA 5FDHA 4DF6A 5A91A 1G6OA 1DRMA 5G18A 3LICA 2XD1A 4HY8A 1OTIA 2OLUA 2QWSA
chains in the Genus database with same CATH topology
3H9WA 3CUEA 1V9YA 4PKYG 5CX7A 5EFWA 5FL3A 3UMDA 3MQQA 2KX6A 2VGLM 4HQAA 2O9AA 3LYXA 4EETB 3NJAA 3O5YA 3ZQ5A 3LI9A 4NXFA 2W3FA 4Q0HA 5HZHA 3P01A 2HGVA 3K3DA 4GS9A 2HJEA 3EWKA 4Q0IA 4KUKA 3KSGA 4BJPA 3MMHA 3EOIA 3EQUA 1XJ3A 3PR6A 3ZYTA 1UWNX 2JHEA 5K5BA 4FOFA 5TBMB 1Y28A 4HH3A 4IJGA 5DKLA 3D3OA 2Y8HA 3T4OA 2WKRA 3A0VA 1X0OA 2JKTM 2B18A 2YKFA 3F1NB 3UMEA 2V1AA 4XT2A 3LIBA 3K2NA 4JGQA 1YKDA 5IU1A 5TBMA 1OT9A 2PYPA 4L0LA 5HWVA 3HJIA 4CQHA 3OBFA 2JKTI 2PD7A 3UB9A 4YOFA 4KUOA 2ZOIA 3LIFA 3LFVA 4G3VA 1D7EA 3IS2A 2L4RA 4HIAA 3A0RA 2OWHA 4GJ4A 4O8GA 1N9NA 2O99A 2Y79A 2OAP1 3W2ZA 1T1BA 4CLCB 3UB6A 2VJWA 3GDIA 5DFYA 5HDCA 3TJZC 3R7WB 4IHQA 5L8MA 5F68A 2GNXA 3MR0A 4ZRRA 3EQVA 2QKPA 2VGLS 2XRNA 2M7VA 1DP8A 3OLOA 1N9LA 3LR3A 2O9BA 2W3HA 3KO6A 4OOMA 1OTEA 3TRCA 2W0NA 4LPZA 1OJ5A 2PDRA 2YKHA 1F9IA 4B93A 2W3EA 4YWZA 3RFBA 4EW7A 2P04A 1DP9A 3LIAA 4F3LA 2K31A 3UB8A 3KSHA 2A24B 5MC7A 2P08A 3FPVA 3B42A 2M1CA 4MN6A 1TS6A 4HJ4A 2QYBA 3FG8A 4K08A 4IUHA 4P6ZS 3KX0X 3T4KA 2GJ3A 5HL6A 4DJ2A 1H3QA 3C30A 3MFXA 3UE6A 4BBVA 5AJGA 3F1PB 1W63Q 2FH5A 1KOUA 2J80A 1F98A 4GS9B 5J7EA 2JKRI 3P7NA 3FC7A 4WN5A 3H7WB 2D02A 4HOIA 4AFIA 2EA9A 4I39A 4PAUA 1UGUA 2KDKA 1ZHHB 2ZBBA 3VE3A 1WA9A 1BYWA 4BWIA 4G3WA 3BW6A 2W27A 2ZMVA 2W3GA 5DF9A 3EEAA 3PBRA 4F3LB 2W1TA 3LI8A 1P9WA 3E4PA 2VX8A 4M4XA 2MJ6A 4EU0A 3F1PA 4IUKA 3RTYA 3E0YA 4ME4A 3S7NA 1MKMA 3BY9A 3TW8A 4NXBA 1S66L 4P6ZM 3E4OA 4HP4A 1G28A 5HD3A 3S7PA 2JN7A 2Z6DA 4I38A 4R38A 3T4SA 2PR6A 3C38A 2W1TB 4FSFA 4EUVA 3ULFA 4JGRA 3RH8B 2GZAA 2L1MA 1OTDA 3CUEC 1P0ZA 5AVFA 1OT6A 1TS7A 1S4RA 1S67L 1TF1A 2M7UA 5DFXA 1IFQA 2VZWA 3T4TA 2VV8A 1EW0A 1LSXA 2CMNA 4B9OA 1LSWA 3OCLA 1T1CA 3E98A 4GLQA 4O01A 2VKSA 2BASA 3F1OB 4ARZA 2V9AA 4HH2A 4R6LA 4MMNA 3MQOA 4LLOB 3ICYA 4Y5FA 2GX5A 3DBAA 3VOLA 3B47A 5DJUA 4MDZA 2HV1A 5C5KA 1STZA 4NKPA 3UB7A 4Y3IA 4I3IA 3OCNA 2OWJA 4GCZA 4DMZA 1NLZA 3C8CA 2A2LA 3H82A 1V9ZA 1GSVA 1DP6A 5HSQA 3KYQA 2EWWA 3BQAA 5HWWA 1GSWA 2XA7M 3BJNA 1P97A 5F5YA 1OJGA 3F1OA 5HPIA 4EESA 3PBOA 1MZUA 2K2NA 5LBRA 3LR4A 5AVEA 1IOUA 4NXGA 2VLGA 3CITA 5I5LA 2NUPC 3NOPC 5TJJA 3HCYA 2QJ5A 3KSFA 3R7WA 1OTBA 4L9FA 5DJTA 5J4EA 2XSSA 2VA0A 4HJ6A 4I5SA 3PYPA 4EERA 1LL8A 3S7OA 4H6JB 4G3KA 2PR5A 2W1RA 3A0SA 3IBJA 4GW9A 2OAQ1 1NRJA 3LIEA 3IBRA 1XFNA 3PXPA 2XROA 3H7WA 3NOUC 3MJQA 2NUTC 4DN0A 1S4SA 2Z6CA 4PHTA 3CLOA 1T1AA 4CLCD 4NEED 1XJ6A 5DKKA 2KLIA 3BWLA 1MC0A 1GSXA 1S1ZA 2INWA 5HDSA 2VV6A 4KQDA 2JKRM 4XT2B 1T18A 4WL9A 1JNUA 2XA7S 4JGOA 3B33A 1LSVA 4MCWA 4KQOA 4UEYA 2VEAA 4ETZA 3NHQA 4L9EA 2KOIA 4UQIS 5KSHA 3E4QA 4HP9A 2LB5A 2O0YA 4NXEA 4BBUA 4Z1WA 3S7QA 2A24A 2FZ0A 3R4KA 3EEHA 2DMWA 1XJ4A 4MN5A 1D06A 3K3CA 1TS8A 4WUJA 3G6OA 4HI4A 5F69A 4HNBA 4OOLA 3U2AA 3OOVA 5IT5A 2D01A 2WKQA 2QHKA 1S1YA 4DJ3A 2I9VA 1OPXA 4QPRA 2WKPA 4LRYC 2J3TD 4Q0JA 4EXOA 1OTAA 4H6JA 4WELA 3PBQA 4CLCA 3JVVA 3LR0A 1NWZA 4II7A 3MXQA 4ETXA 4CLCC 5HDDA 3NOTC 2B02A 3PBTA 3JVUA 2LB9A 2PYRA 4RQ9A 3BQ8A 1VB6A 2PD8A 4CLCE 5KIZA 1XFQA 4PKYA 2J3WA 3PBNA 4JGPA 2HJ9C 1P9RA 4WEJA 3EGXC 3T50A 3CI6A 1W63M 3TE8A 5IS1A 2PHYA 3LIDA 1NLYA 3PHYA 3PBSA 2G7UA 4L9GA 4O0PA 1H8MA 4MN7A 1LT0A 5A8BA 4WLAA 3H82B 1VHMA 4Y2FA 2HF6A 4LRZE 4YNRA 3T4QA 4GHIA 5HPFA 5G4ZA 4ARZB 2P7JA 5HWTA 2V0UA 4EQ1A 2VV7A 2H28A 2L0WA 3VV4A 1T19A 4EEUA 1TS0A 3EGDC 3LR5A 2O9CA 4R3AA 2V0WA 4BMWA 4EEPA 3T4JA 2PT7A 3HJKA 4BBTA 4HHDA 2EWVA 4UQIM 4WF0A 1XJ2A 5J3WA 2IA2A 4GHIB 3F1NA 2R78A 2ZOHA 3VE4A 4I3JA 1YSPA 5F6AA 3KSIA 3SW1A 1N9OA 4WEKA 3LUQA 3BY8A 5HD5A 1F5MA 1UWPX 3T4LA 4E04A 4LRXC 1YAXA 3IS2B 3OC2A 2V1BA 3CAXA 3V67A 3CWFA 5G4YA 2ZMFA 3UE3A 2W3DA 4I3AA 3GECA 4HJ3A 2K7SA 2J3TC 3FPWA 3MQ0A 1G6OA 3KYZA 1TD5A 1DRMA 3LICA 4R70A 1ODVA 4HY8A 1OTIA 3C2WA 1YSQA 3MF0A 3D72A 2QJ7A 1ZTUA 2OOLA 2QWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K08 A;  3H9W A;  3KX0 X;  4DJ3 A;  2I9V A;  2GJ3 A;  4I3I A;  1V9Y A;  2WKP A;  4PKY G;  4LRY C;  3UB7 A;  5HWV A;  4DJ2 A;  5EFW A;  2OWJ A;  3UMD A;  3MQQ A;  3MFX A;  4GCZ A;  2KX6 A;  3UE6 A;  1OTA A;  4EXO A;  4H6J A;  4BBV A;  3F1P B;  3C8C A;  4HQA A;  3LYX A;  1KOU A;  4EET B;  3H82 A;  3NJA A;  1NWZ A;  1F98 A;  2J80 A;  3MXQ A;  4GS9 B;  5J7E A;  1V9Z A;  5HDD A;  3P7N A;  3FC7 A;  3LI9 A;  4NXF A;  3ZQ5 A;  1GSV A;  3NOT C;  1DP6 A;  3H7W B;  2B02 A;  2D02 A;  4HOI A;  4WN5 A;  4GS9 A;  3K3D A;  5HSQ A;  5HZH A;  3EWK A;  2EA9 A;  2PYR A;  4I39 A;  4KUK A;  4RQ9 A;  1UGU A;  2KDK A;  1VB6 A;  1XJ3 A;  1GSW A;  5HWW A;  2ZBB A;  1P97 A;  3VE3 A;  2PD8 A;  1UWN X;  2JHE A;  1WA9 A;  1BYW A;  5F5Y A;  5TBM B;  1OJG A;  3F1O A;  1Y28 A;  4EES A;  5KIZ A;  4HH3 A;  4EER A;  2W27 A;  5DKL A;  1MZU A;  1XFQ A;  4PKY A;  4JGP A;  5AVE A;  4F3L B;  3T50 A;  2WKR A;  3A0V A;  3LI8 A;  4NXG A;  2VLG A;  4HJ4 A;  3E4P A;  1X0O A;  5I5L A;  2YKF A;  3NOP C;  5IS1 A;  4M4X A;  3F1N B;  2PHY A;  3LID A;  3UME A;  2QJ5 A;  2V1A A;  3F1P A;  3PHY A;  4XT2 A;  1OTB A;  3LIB A;  4L9G A;  3RTY A;  4L9F A;  5DJT A;  5J4E A;  4JGQ A;  1LT0 A;  5A8B A;  4HJ6 A;  3H82 B;  4WLA A;  1OT9 A;  2PYP A;  2QWS A;  4LRZ E;  4I5S A;  5IU1 A;  3BY9 A;  3HJI A;  3PYP A;  1LL8 A;  4NXB A;  1S66 L;  4GHI A;  3E4O A;  4HP4 A;  1G28 A;  5G4Z A;  5HD3 A;  2JN7 A;  2P7J A;  2Z6D A;  4I38 A;  4R38 A;  2V0U A;  5HWT A;  2PD7 A;  4H6J B;  3UB9 A;  4EQ1 A;  4KUO A;  2PR6 A;  2VV7 A;  2ZOI A;  2PR5 A;  2H28 A;  2L0W A;  3A0S A;  3LIF A;  1T19 A;  4GW9 A;  4EEU A;  1TS0 A;  3LIE A;  3ULF A;  4R3A A;  2V0W A;  3IBR A;  4JGR A;  1XFN A;  3RH8 B;  4EEP A;  3H7W A;  3NOU C;  3HJK A;  1D7E A;  2L1M A;  1OTD A;  3IS2 A;  4BBT A;  1P0Z A;  2L4R A;  3MJQ A;  4HHD A;  5AVF A;  1S4S A;  2Z6C A;  3A0R A;  4HIA A;  1OT6 A;  3CLO A;  2OWH A;  1T1A A;  1TS7 A;  4WF0 A;  1S4R A;  1N9N A;  1XJ2 A;  1S67 L;  1XJ6 A;  5DKK A;  5J3W A;  4GHI B;  3F1N A;  1T1B A;  2R78 A;  3BWL A;  2ZOH A;  3UB6 A;  3VE4 A;  3GDI A;  4I3J A;  3SW1 A;  5F6A A;  1GSX A;  1N9O A;  1S1Z A;  2VV8 A;  1EW0 A;  2INW A;  5HDC A;  3LUQ A;  5HDS A;  5F68 A;  1LSX A;  3BY8 A;  2VV6 A;  2CMN A;  3MR0 A;  4KQD A;  1LSW A;  4XT2 B;  1T18 A;  5HD5 A;  4WL9 A;  1JNU A;  4B9O A;  1T1C A;  1UWP X;  4JGO A;  4E04 A;  3B33 A;  1LSV A;  2QKP A;  2VEA A;  4LRX C;  3NHQ A;  1DP8 A;  4L9E A;  2BAS A;  1N9L A;  1S1Y A;  2QHK A;  3E4Q A;  2V1B A;  3F1O B;  3IS2 B;  3OLO A;  1OTE A;  4HP9 A;  4NXE A;  2V9A A;  3CAX A;  4HH2 A;  4R6L A;  2W0N A;  3CWF A;  4BBU A;  5G4Y A;  4LPZ A;  1OJ5 A;  2PDR A;  3MQO A;  4EW7 A;  5TBM A;  4I3A A;  2YKH A;  1F9I A;  2A24 A;  3GEC A;  4HJ3 A;  3ICY A;  4LLO B;  4YWZ A;  1DP9 A;  3EEH A;  2K7S A;  3LIA A;  4F3L A;  3UB8 A;  3VOL A;  5DJU A;  1DRM A;  2A24 B;  1XJ4 A;  4MN5 A;  1D06 A;  2HV1 A;  3K3C A;  3LIC A;  1TS8 A;  4R70 A;  4WUJ A;  3G6O A;  1ODV A;  4HI4 A;  1OTI A;  3C2W A;  4HY8 A;  5F69 A;  2M1C A;  3D72 A;  2QJ7 A;  4HNB A;  4MN6 A;  2OOL A;  1TS6 A;  2D01 A;  2WKQ A;  3FG8 A; 
#chains in the Genus database with same CATH topology
 2A49 A;  5EV0 A;  1V9Y A;  5EFW A;  5FI2 A;  2VGL M;  2WKI A;  4KZ8 A;  3NUL A;  3W4O A;  4OOY A;  3LI9 A;  1ACF A;  4GS9 A;  3KSG A;  3EOI A;  3PR6 A;  3ITA A;  1GCE A;  1BLC A;  1Y28 A;  1I2W A;  2XF3 A;  4OQH A;  4ZJ3 A;  3BEB A;  3BFD A;  3Q07 A;  3T4O A;  2WKR A;  1PWC A;  3NIA A;  3IWQ A;  3F1N B;  5A90 A;  2V1A A;  1KDS A;  5IU1 A;  3PAG A;  3OBF A;  1CEF A;  4WYY A;  5AQA A;  2PU2 A;  4N1H A;  2PD7 A;  3LY3 A;  1ERM A;  4F94 A;  3LIF A;  3S1Y A;  1L0D A;  4JXG A;  1YMS A;  3BLM A;  5CHM A;  3IS2 A;  3IF6 C;  1N9N A;  1I2S A;  1Z6F A;  2Y79 A;  5EVI A;  3N8L A;  1RP5 A;  1XA1 A;  3R7W B;  4KG2 A;  1HD8 A;  5F68 A;  4EQI A;  5EOE A;  1IYO A;  1DP8 A;  1N9L A;  2W3H A;  3LR3 A;  4OOM A;  4EBN A;  1OTE A;  3TRC A;  3UPO A;  1TEM A;  2YKH A;  4B93 A;  4R4R A;  2W3E A;  2XQZ A;  4YWZ A;  4EW7 A;  2P04 A;  1DP9 A;  3TG9 A;  3LIA A;  2K31 A;  2E8J A;  3KSH A;  2HP9 A;  1A0K A;  1ERQ A;  2JCH A;  4FCF A;  3M2J A;  3ZCZ A;  3C30 A;  3ZG5 A;  3MFX A;  4BBV A;  3F1P B;  1Z09 A;  1ES3 A;  2B95 A;  4JF4 A;  5J7E A;  3FC7 A;  1IYQ A;  4WN5 A;  4HOI A;  2EA9 A;  4I39 A;  3Q7Z A;  4PAU A;  2KDK A;  5FAP A;  2ZBB A;  1WA9 A;  1BYW A;  4QY5 A;  2W27 A;  4IBX A;  3D4F A;  3A3J A;  3PBR A;  5CGS A;  4MBF A;  1ALQ A;  1P9W A;  2VX8 A;  1E4D A;  4M4X A;  1M6K A;  2XEP A;  5FI6 A;  1BLH A;  4M3K A;  4DXC A;  3OPH A;  3ZVW A;  3S7P A;  1G28 A;  1MKI A;  4R38 A;  2X01 A;  2Q9M A;  2WUQ A;  1DJB A;  4IVI A;  1K54 A;  4JGR A;  3HRE A;  2GZA A;  4DDS A;  1XKZ A;  1P0Z A;  5AVF A;  3ZNY A;  4EBL A;  4C75 A;  2M7U A;  3T12 B;  4RVA A;  2VV8 A;  4S2N C;  1EW0 A;  4B88 A;  4K0X A;  1T1C A;  3E98 A;  1ZC2 A;  4O01 A;  3QP8 A;  5CTM A;  4ARZ A;  1MY8 A;  3IF6 B;  5FQJ A;  1XPB A;  2HDU A;  3QP5 A;  3DBA A;  3B47 A;  4LCL A;  4MDZ A;  1KVM A;  3GV9 A;  2H5S A;  1PZP A;  1YT4 A;  4QB8 A;  5KZH A;  3UB7 A;  4X69 A;  4Y3I A;  1RCJ A;  5DVA A;  1ES4 A;  5GHZ A;  4DMZ A;  3C8C A;  3Q1F A;  4OP8 A;  4RX3 A;  4OP5 A;  3O86 A;  3KYQ A;  1RGY A;  5HAI A;  2EWW A;  3WRT A;  1L0F A;  4Y13 A;  2I72 A;  1P97 A;  3SS5 A;  1FIL A;  1ES2 A;  1VQQ A;  5FEF A;  3BYD A;  3N8S A;  1PWG A;  1IOU A;  1BUL A;  3MBZ A;  5I5L A;  2JE5 A;  1LI9 A;  5FAS A;  5GLA A;  4PM7 A;  2VA0 A;  4HJ6 A;  3ZFZ A;  4G3K A;  1PZO A;  2W1R A;  1L0G A;  1QME A;  1NRJ A;  2WAE A;  3LIE A;  1XFN A;  2XRO A;  3CHW P;  2Z6C A;  3N4I A;  4PHT A;  5DKK A;  4OQG A;  3G30 A;  2FFY A;  1L2S A;  1MC0 A;  2EX9 A;  3DAV A;  4KG5 A;  5CGW A;  2BLS A;  3SH7 A;  4KQD A;  2JKR M;  2ZM8 A;  1T18 A;  3FWL A;  5E2G A;  4JGO A;  3SH9 A;  3UDF A;  1YLY A;  4WZ5 C;  4HP9 A;  1NJ4 A;  3MZD A;  4JLF A;  3WRZ A;  2A24 A;  1H5X A;  2EX2 A;  4QWO A;  1CK3 A;  2DNS A;  1MPL A;  3IHB A;  4MN5 A;  2Y2N A;  1PRQ A;  4HI4 A;  4HNB A;  1TVF A;  3SS4 A;  2D01 A;  2ZLY A;  2XK1 A;  4PM5 A;  2Y91 A;  2WKE A;  2UWX A;  3CG5 A;  5DTK A;  4P6B A;  2B5R A;  3W4Q A;  4CPK A;  2ZJ9 A;  3BFE A;  2V8C A;  1NWZ A;  4JXW A;  3GMW A;  4CLC C;  5HDD A;  5DTT A;  3PBT A;  3JVU A;  2XDM A;  5JYP A;  3ZVT A;  3DTI A;  4GD6 A;  1NYM A;  4JGP A;  1SKO A;  3FYZ A;  2BG1 A;  3EGX C;  4KZA A;  5GHX A;  3CJM A;  4N92 A;  1BLS A;  2JKF A;  3TE8 A;  1YLW A;  1IYP A;  1VET B;  1AWI A;  3G35 A;  2WAD A;  4C6Y A;  4WLA A;  2HF6 A;  4GHI A;  5F1G A;  3BEC A;  2P7J A;  1JTG A;  3UDI A;  2VV7 A;  3V50 A;  3C4O A;  4BMW A;  2WGV A;  4OPY A;  3WS2 A;  3T4J A;  2PT7 A;  1Y4O A;  4HHD A;  4BLM A;  2EWV A;  1G5U A;  5HL1 A;  3VP2 A;  4WF0 A;  3LCE A;  4HBT A;  2Y2P A;  2ZOH A;  1YSP A;  1W5D A;  4WEK A;  2JKG A;  2QMI A;  1LHY A;  3HLD A;  1F5M A;  4GDB A;  1PW8 A;  4ZBE A;  2PU4 A;  4GZB A;  3CWF A;  3UE3 A;  3GEC A;  1BTL A;  4HJ3 A;  1VM1 A;  3Q81 A;  3NDE A;  3GRJ A;  3IHA A;  4EBP A;  3RXX A;  4R70 A;  4RA7 A;  5L2F A;  4X25 A;  2QJ7 A;  2X02 A;  1ZTU A;  5EUA A;  5DF7 A;  1K57 A;  3A3I A;  1CJF A;  3UE0 A;  5CX7 A;  5FL3 A;  3UMD A;  3LYX A;  3UE1 A;  3ZQ5 A;  4Q0H A;  3P01 A;  2FFF B;  3K3D A;  3EWK A;  4KUK A;  4GOG A;  2V2F F;  2QZ6 A;  5TBM B;  4HH3 A;  2WGI A;  4IJG A;  2XD5 A;  2Y2I A;  5IHV A;  1JTD A;  3D3O A;  4XUX A;  3IXG A;  2WGW A;  5J8X A;  4ZAM A;  3FKV A;  2JKT M;  2B18 A;  2YKF A;  3WS4 A;  5DF8 A;  3UME A;  3S4X A;  2P9V A;  1KE4 A;  3ZG8 B;  4DXB A;  5F1F A;  1LI0 A;  5TBM A;  1N4O A;  1OT9 A;  2JKT I;  4YOF A;  3O88 A;  3LFV A;  3MKF A;  1D7E A;  4Z9Q A;  2L4R A;  5CXW A;  4HIA A;  3HLG A;  4X6T A;  4N1X A;  2O99 A;  1T1B A;  4CLC B;  5GLC A;  3W8K A;  2ZMA A;  5EVI C;  3ZHH A;  4D2O A;  4ZRR A;  3EQV A;  2QKP A;  3AGF A;  4JF6 A;  2O9B A;  3KO6 A;  1D1J A;  3UB5 P;  2H0Y A;  2ZQ9 A;  2ZD8 A;  1K0K A;  2OSU A;  2Y2J A;  4F3L A;  1YPR A;  2VGJ A;  4Y15 A;  3FPV A;  3C4P A;  2M1C A;  4LV0 A;  4HBU A;  3T4K A;  2GJ3 A;  2ZQD A;  5HL6 A;  1PI4 A;  5TGF A;  1W63 Q;  3IF5 A;  1F98 A;  1O7E A;  4E3O A;  5BOH A;  2V8F A;  4BWI A;  4G3W A;  4OPQ A;  1BLP A;  1CEG A;  2ZMV A;  3BM6 A;  4YIN A;  3EEA A;  3V5M A;  3VOZ A;  4WM9 A;  3A3D A;  4F3L B;  4LV2 A;  2HPB A;  3E4P A;  2V1Z A;  2MJ6 A;  4B4Z A;  3CMZ A;  4IUK A;  3RTY A;  3E0Y A;  5CEC A;  3BY9 A;  3TW8 A;  3N8R A;  1S66 L;  4HP4 A;  2JN7 A;  2HDR A;  4FSF A;  2ZC4 B;  3U4L P;  3ULF A;  2L1M A;  3SS3 A;  3G32 A;  1TS7 A;  1GHP A;  3T1R A;  3IX3 A;  4Y17 A;  4GB7 A;  1LSX A;  3IWI A;  3HLB A;  2XFT A;  4UA9 A;  3NCK A;  5AQ9 A;  2BAS A;  3F1O B;  2V9A A;  3IWO A;  5CHU A;  3IQA A;  5E43 A;  1BSG A;  3LEZ A;  2WGW B;  2GX5 A;  5HAR A;  3VOL A;  4Y0O A;  3HUM A;  4GN2 A;  2ZM0 A;  5C5K A;  4OPZ A;  1NRF A;  2X71 A;  5I94 A;  3N6I A;  3ZG0 A;  4ZDX A;  4UA6 A;  1YQS A;  4GCZ A;  5FQK A;  3NY4 A;  4S2L A;  4S2I A;  1NLZ A;  2A2L A;  1H0M A;  1CI8 A;  5M18 A;  1GSV A;  1DP6 A;  3AGE A;  5HSQ A;  4LEN A;  4LV3 A;  3V3R A;  3BJN A;  5GLD A;  5F82 A;  5HPI A;  4EES A;  3PBO A;  1SCW A;  1YLJ A;  1MZU A;  2H0T A;  4X55 A;  3CIT A;  2NUP C;  1PWD A;  5TJJ A;  3HCY A;  4P87 A;  4X1L A;  2QJ5 A;  3KSF A;  3ZNT A;  3R7W A;  4IVK A;  4OQI A;  1OTB A;  4KZ9 A;  2GDN A;  5EVI B;  3PYP A;  3S7O A;  1YM1 A;  3H7W A;  4S2J A;  4DN0 A;  3ZG7 B;  1XJ6 A;  2KLI A;  4B4X A;  3TOI A;  3BWL A;  1GSX A;  2INW A;  4EV4 A;  1O07 A;  1Q2P A;  4XUZ A;  2XA7 S;  4IBR A;  1LSV A;  2Y2H A;  4KQO A;  4UEY A;  2VEA A;  3A3F A;  3NHQ A;  1K56 D;  5FQM A;  3ZGA B;  2LB5 A;  2O0Y A;  2PAV P;  4BBU A;  4Z1W A;  4WZ5 A;  3UNW A;  2EXA A;  1MWU A;  4PPR A;  4K0W A;  3K3C A;  4WUJ A;  2ZQ7 A;  3OOV A;  4X68 A;  4DJ3 A;  2WKP A;  4NG2 A;  4Q0J A;  4WEL A;  4CLC A;  3N7W A;  4BL2 A;  4II7 A;  1FSY A;  1H8Y A;  5M19 A;  4DRT A;  3RJU A;  1DJC A;  3W4P A;  2XLN A;  1SKF A;  2ZQA A;  2Y2Q A;  4CLC E;  3MZE A;  1SDE A;  1KVL A;  2DRW A;  4PKY A;  5HX9 A;  4KZ5 A;  4JF5 A;  1S6R A;  2EX6 A;  3IXB A;  4MBK A;  3PBS A;  2G7U A;  4UHU A;  4O0P A;  1LT0 A;  2P74 A;  4R3B A;  4YNR A;  5FSR A;  5HWT A;  4E3N A;  5FA7 A;  4OQ0 A;  2H28 A;  1K56 A;  4R3A A;  3HJK A;  2HZ5 A;  4BBT A;  1KGF A;  3G4P A;  5L09 A;  4QJG A;  4GHI B;  5FAQ A;  3F1N A;  2R78 A;  5F6A A;  1LL5 A;  3KSI A;  1M40 A;  3O3V A;  2PBY A;  1G6A A;  1HLU P;  3RXW A;  5EVL A;  1UWP X;  3T4L A;  3NC8 A;  1I5Q A;  3GR2 A;  3IS2 B;  4FUW A;  1L0E A;  4NK3 A;  3V67 A;  4EWF A;  5G4Y A;  1GHI A;  2ZMF A;  2W3D A;  1J9M A;  4C3Q A;  3G2Y A;  2J3T C;  3FPW A;  4GDN A;  1PNE A;  3MQ0 A;  1TD5 A;  1MWT A;  1ODV A;  3C2W A;  3D72 A;  1SDN A;  3HLF A;  2ZM2 A;  1CI9 A;  2ZL1 B;  3H9W A;  3CUE A;  1AXB A;  1XX2 A;  4PKY G;  3MQQ A;  2KX6 A;  4E3L A;  4HQA A;  2ZQC A;  3NJA A;  3MKE A;  3CPT B;  4DDY A;  2Q9N A;  3VFF A;  4NXF A;  2HJE A;  3LGO A;  4BJP A;  1JWP A;  3MMH A;  3ZYT A;  3WS1 A;  1UWN X;  2JHE A;  5FQ9 A;  4FOF A;  3HBR A;  2V20 A;  3MZF A;  2Y2K A;  3A0V A;  3VSL A;  3PAE A;  4U3T A;  4JPM A;  3BRM A;  1IKI A;  3LIB A;  3HUO A;  5EM1 A;  4CJN A;  2PYP A;  5HWV A;  3D9Y A;  3BLS A;  4CQH A;  4N9K A;  3MS6 A;  3ITB A;  4G3V A;  3A0R A;  2J8Y A;  1E25 A;  5M1A A;  3UB6 A;  2VJW A;  1IYS A;  4KZB A;  3TJZ C;  4IHQ A;  5L8M A;  2GNX A;  4ZJ2 A;  3MR0 A;  1Y54 A;  2HP5 A;  1K4F A;  1HTZ A;  2VGK A;  2XRN A;  1EWZ A;  2M7V A;  3OLO A;  5GL9 A;  5E2H A;  2W0N A;  4LPZ A;  1KE0 A;  1OJ5 A;  2PDR A;  3QHY A;  2J9O A;  3MXR A;  1F9I A;  3RFB A;  4ID4 A;  1PIO A;  5FQQ A;  4PM9 A;  3UB8 A;  2ZC7 A;  3P09 A;  2A24 B;  3G2Z A;  2VK3 A;  4S2K A;  5MC7 A;  4QHC A;  2P08 A;  3P98 A;  3C7U A;  4MN6 A;  3V3S A;  1TS6 A;  2Q0O A;  4K08 A;  4P6Z S;  2WAF A;  3C7V A;  4U0X A;  1K38 A;  1BT5 A;  3IF6 A;  4DE0 A;  4PM8 A;  2HDS A;  2Y55 A;  5FQI A;  4X53 A;  2J80 A;  4RX2 A;  1DJA A;  2JKR I;  1U60 A;  3P7N A;  3H7W B;  2D02 A;  4DE2 A;  1KDW A;  1UGU A;  4PMA A;  4R0Q A;  4KZ4 A;  3VE3 A;  3UDX A;  3GSG A;  4FD8 A;  5DF9 A;  3NDG A;  3VOY A;  1SZV A;  5A92 A;  2XR0 A;  2R9W A;  5U47 A;  4EU0 A;  4LCM A;  3F1P A;  5TFQ A;  3S7N A;  3CPT A;  1MKM A;  5D3O A;  4P6Z M;  4A5R A;  3E4O A;  4I38 A;  3T4S A;  2EX8 A;  3C38 A;  4EUV A;  1W79 A;  1NXY A;  3CUE C;  1OTD A;  2WZX A;  1S4R A;  1TF1 A;  2Z2L B;  5DFX A;  1IFQ A;  1ZG6 A;  3T4T A;  4MEZ A;  1K6S A;  4RYE A;  3NI9 A;  1XGI A;  4B9O A;  1G68 A;  5FEG A;  4GLQ A;  2VKS A;  1PW1 A;  4BQM A;  4HH2 A;  4MMN A;  3MQO A;  4LLO B;  3ICY A;  2CC1 A;  2JC7 A;  4Y5F A;  1XP4 A;  4R23 A;  3HLE A;  5DJU A;  4GKU A;  3NBL A;  1QMF A;  4NKP A;  1MWR A;  4LFU A;  3UPN A;  4R4S A;  5HFO A;  2OWJ A;  2XH9 A;  1DY6 A;  3QNC A;  2EFX A;  3H82 A;  1WE4 A;  1YLP A;  4OPR A;  1E3U D;  3GQZ A;  4WMC D;  1FR6 A;  1XGJ A;  4PM6 A;  5HWW A;  2XA7 M;  3FKW A;  5F5Y A;  3WS0 A;  3F1O A;  4IED A;  1GA0 A;  2ZC3 B;  3FZC A;  5LBR A;  2C5W B;  3DTE A;  3MXS A;  4NXG A;  3T1X A;  2OLV A;  4KZ6 A;  5DJT A;  4MBH A;  5EM0 A;  2XSS A;  5J4E A;  2Y2M A;  4I5S A;  5CEB A;  1LL8 A;  4U0T A;  2QPN A;  4H6J B;  3JYI A;  3MFD A;  3A0S A;  3IBJ A;  4GW9 A;  3PXP A;  3LEQ A;  3VP1 A;  3NOU C;  3MJQ A;  2NUT C;  3CLO A;  1T1A A;  4NEE D;  2C6W B;  2J9P A;  5TR7 A;  3OPP A;  5HDS A;  2VV6 A;  3IXD A;  2E8I A;  4ETZ A;  1K6R A;  5EPH A;  4OLG A;  5FI7 A;  4NXE A;  1RGZ A;  3S7Q A;  4GNU A;  3R4K A;  1W8Q A;  3EEH A;  3HVF A;  1D06 A;  1NZO A;  3IXH A;  4O7D A;  5GLB A;  4E3J A;  5F69 A;  2XFS A;  3U2A A;  5IT5 A;  1S1Y A;  2QHK A;  5FDS A;  4S2P A;  5AQ7 A;  4LRY C;  1W8Y A;  2J3T D;  1OTA A;  4H6J A;  5FAO A;  1L3L A;  3PBQ A;  1C3B A;  3LR0 A;  4ETX A;  3M2K A;  1K55 C;  3HL9 A;  3IX8 A;  4E3M A;  4DKI A;  2B02 A;  3I7J A;  2LB9 A;  2PYR A;  3GTC A;  4RQ9 A;  3QP4 A;  5KIZ A;  1XA7 A;  1XFQ A;  4S2N A;  2J3W A;  1ES5 A;  5E2E A;  3VFH A;  2HJ9 C;  3QP2 A;  4WEJ A;  1P9R A;  2ACG A;  3CI6 A;  4KG6 A;  1FCM A;  4BD0 A;  2PHY A;  4OON A;  3LID A;  3VP3 A;  4BD1 A;  3PHY A;  1KGG A;  1GA9 A;  1H8M A;  4KQR A;  5A8B A;  3VMA A;  2Y2L A;  4LRZ E;  4MNR A;  5HPF A;  3OZH A;  5G4Z A;  4ARZ B;  2V0U A;  4EQ1 A;  2JBF A;  2L0W A;  3VV4 A;  4ZTK A;  4WMC A;  3EGD C;  2V0W A;  3ISG A;  3G34 A;  4EEP A;  4UQI M;  1ONH A;  1XJ2 A;  4FTX A;  4NET A;  4E6X A;  2IA2 A;  4E6W A;  1FQG A;  3C5A A;  1N9O A;  4BL3 A;  3LUQ A;  3M6B A;  3BY8 A;  1WYC A;  3BFG A;  3SH8 A;  4LRX C;  1SHV A;  3L9K A;  1NZU A;  2V1B A;  3OC2 A;  3CAX A;  1JVJ A;  1TDG A;  3WWX A;  2K7S A;  3KYZ A;  3O87 A;  1ERO A;  4P85 A;  4OLD A;  4KZ3 A;  3B3X A;  1YSQ A;  3MF0 A;  5CRF A;  2DCF A;  2OOL A;  2WZZ A;  5KSC A;  1YMX A;  2HP6 A;  1OME A;  4DE1 A;  2O9A A;  4EET B;  3O5Y A;  2RL3 A;  3BFC A;  1EI5 A;  3QP6 A;  2W3F A;  1KE3 A;  5HZH A;  1FIK A;  2HGV A;  1PFL A;  4Q0I A;  2WK0 A;  5EE8 A;  3EQU A;  4JXV A;  1XJ3 A;  5K5B A;  3LO7 A;  5CHJ A;  1BZA A;  5DKL A;  4E3K A;  2Y59 A;  1K25 A;  2Y8H A;  1X0O A;  4H8R A;  2R9X A;  4XT2 A;  4EUZ A;  3K2N A;  4OKP A;  4JGQ A;  1YKD A;  1CQA A;  4KEN B;  4L0L A;  5A93 A;  3HJI A;  3IH9 A;  3UB9 A;  4KUO A;  2ZQ8 A;  5L10 A;  2ZOI A;  1Q2Q A;  1JWV A;  5DTS A;  1YLZ A;  3AGD A;  3VSK A;  2OWH A;  4GJ4 A;  4O8G A;  3S22 A;  1YLT A;  2OAP 1;  3UY6 A;  2ZL1 A;  3W2Z A;  3GDI A;  4LV1 A;  5DFY A;  5HDC A;  5CER A;  4S2M A;  1SKO B;  2Y2G A;  2VGL S;  4FH2 A;  1PI5 A;  1E3U A;  2Z2M B;  1MBL A;  3WS5 A;  5KMW A;  3ZG9 B;  4Q8I A;  4X1M A;  4HEF A;  3B42 A;  1FCN A;  4GD8 A;  4BEN A;  1VET A;  4HJ4 A;  4X56 A;  2QYB A;  3FG8 A;  4IUH A;  3KX0 X;  3IX4 A;  1H8Z A;  3Q7V B;  4DJ2 A;  5EOO A;  1H3Q A;  5JYO A;  3UE6 A;  4Y0T A;  5GHY A;  1NY0 A;  5AJG A;  2FH5 A;  1KOU A;  4GS9 B;  1TDL A;  2ZC5 B;  4MLL A;  4AFI A;  4ESP A;  4ZJ1 A;  5HAP A;  1ZHH B;  3OPR A;  3BW6 A;  2W3G A;  2W1T A;  3LI8 A;  3DWZ A;  5CED A;  1FCO A;  4QY6 A;  5CGX A;  1LLB A;  2PBD P;  4KQQ A;  4ME4 A;  4NXB A;  5HD3 A;  3UO9 A;  1N9B A;  4UAA A;  1IKG A;  2Z6D A;  5L07 A;  2PR6 A;  1K54 C;  2W1T B;  4JBF A;  3RH8 B;  5HAQ A;  1OT6 A;  3FV7 A;  1S67 L;  2VZW A;  1ONG A;  3KYE A;  5EVI D;  1F2K A;  2IWC A;  2CMN A;  3E2K A;  1LSW A;  3OCL A;  3ZDJ A;  4D60 A;  5FAT A;  5CTN A;  3T1Q B;  3SOI A;  3PTE A;  4R6L A;  4DE3 A;  4HES A;  2HV1 A;  1ESI A;  1STZ A;  2Y2O A;  5EEC A;  4QD4 A;  2IWD A;  1HVB A;  3OPL A;  1K57 C;  4I3I A;  2RCX A;  1VEU B;  3OCN A;  3G31 A;  3TSG A;  2EXB A;  3Q7V A;  4YFM A;  3QP1 A;  1V9Z A;  4JKT A;  3BQA A;  4K91 A;  1GSW A;  4JXS A;  1OJG A;  4WBG A;  1IEL A;  4N9L A;  3BFF A;  5E2F A;  2K2N A;  3LR4 A;  5AVE A;  3DTK A;  5AQB A;  2VLG A;  2J7V A;  3NOP C;  3LY4 A;  2Y4A A;  2OV5 A;  4UA7 A;  4L9F A;  4EER A;  3QNB A;  4OH0 A;  4QU3 A;  5EVE A;  2PR5 A;  1W7F A;  2XGN A;  2OAQ 1;  3IBR A;  4OVD A;  2G2W A;  2WYX A;  4E3I A;  1S4S A;  1VEU A;  4CLC D;  3CZD A;  1K4E A;  2BTF P;  2IWB A;  2ZC6 B;  1S1Z A;  1HZO A;  1WYB A;  2P9V B;  4Y0U A;  3E2L A;  4XT2 B;  4WL9 A;  1JNU A;  1S0W A;  4MCW A;  3B33 A;  4R1G A;  3JPU A;  4L9E A;  2KOI A;  4UQI S;  5KSH A;  3E4Q A;  3M6H A;  3HUN A;  4LGW A;  3NEC A;  3Q82 A;  1ZG4 A;  2FZ0 A;  2DMW A;  3A3E A;  1XJ4 A;  4R3J A;  1TS8 A;  3G6O A;  1ESU A;  3UN7 A;  4OOL A;  2WKQ A;  4XXR A;  1IEM A;  2I9V A;  1OPX A;  4QPR A;  1XXM A;  4EXO A;  3JVV A;  1NYY A;  2AVX A;  3GVB A;  4Y7P A;  3MXQ A;  3IT9 A;  4P0M A;  1KGE A;  3NOT C;  1K55 A;  3V39 A;  1BUE A;  1J3W A;  3BQ8 A;  2UV0 E;  1VB6 A;  2PD8 A;  2G2U A;  1FOF A;  3VP0 A;  3PBN A;  1GHM A;  1CF0 A;  3T50 A;  1MXO A;  4FH4 A;  1W63 M;  2HDQ A;  5IS1 A;  1MWS A;  3DTM A;  3L7H A;  1FR1 A;  1NLY A;  4L9G A;  4MN7 A;  3DW0 A;  3H82 B;  1VHM A;  4Y2F A;  3UPP A;  3T4Q A;  1ZKJ A;  2EFU A;  1JWZ A;  1T19 A;  4EEU A;  1TS0 A;  3LR5 A;  2O9C A;  1FSW A;  3HLW A;  3DWK A;  2WKH A;  5J3W A;  3VE4 A;  4I3J A;  3SW1 A;  3SZT A;  1LL9 A;  3HLC A;  2H10 A;  3MSH A;  2A3U A;  5HD5 A;  4E04 A;  5HW3 A;  4KZ7 A;  2PRF A;  5F83 A;  4WZ4 A;  1YAX A;  3IH8 A;  3VP4 A;  1PYY A;  4S2O A;  3T1S A;  4I3A A;  5FDH A;  4DF6 A;  5A91 A;  1G6O A;  1DRM A;  5G18 A;  3LIC A;  2XD1 A;  4HY8 A;  1OTI A;  2OLU A;  2QWS A; 
#chains in the Genus database with same CATH homology
 3H9W A;  3CUE A;  1V9Y A;  4PKY G;  5CX7 A;  5EFW A;  5FL3 A;  3UMD A;  3MQQ A;  2KX6 A;  2VGL M;  4HQA A;  2O9A A;  3LYX A;  4EET B;  3NJA A;  3O5Y A;  3ZQ5 A;  3LI9 A;  4NXF A;  2W3F A;  4Q0H A;  5HZH A;  3P01 A;  2HGV A;  3K3D A;  4GS9 A;  2HJE A;  3EWK A;  4Q0I A;  4KUK A;  3KSG A;  4BJP A;  3MMH A;  3EOI A;  3EQU A;  1XJ3 A;  3PR6 A;  3ZYT A;  1UWN X;  2JHE A;  5K5B A;  4FOF A;  5TBM B;  1Y28 A;  4HH3 A;  4IJG A;  5DKL A;  3D3O A;  2Y8H A;  3T4O A;  2WKR A;  3A0V A;  1X0O A;  2JKT M;  2B18 A;  2YKF A;  3F1N B;  3UME A;  2V1A A;  4XT2 A;  3LIB A;  3K2N A;  4JGQ A;  1YKD A;  5IU1 A;  5TBM A;  1OT9 A;  2PYP A;  4L0L A;  5HWV A;  3HJI A;  4CQH A;  3OBF A;  2JKT I;  2PD7 A;  3UB9 A;  4YOF A;  4KUO A;  2ZOI A;  3LIF A;  3LFV A;  4G3V A;  1D7E A;  3IS2 A;  2L4R A;  4HIA A;  3A0R A;  2OWH A;  4GJ4 A;  4O8G A;  1N9N A;  2O99 A;  2Y79 A;  2OAP 1;  3W2Z A;  1T1B A;  4CLC B;  3UB6 A;  2VJW A;  3GDI A;  5DFY A;  5HDC A;  3TJZ C;  3R7W B;  4IHQ A;  5L8M A;  5F68 A;  2GNX A;  3MR0 A;  4ZRR A;  3EQV A;  2QKP A;  2VGL S;  2XRN A;  2M7V A;  1DP8 A;  3OLO A;  1N9L A;  3LR3 A;  2O9B A;  2W3H A;  3KO6 A;  4OOM A;  1OTE A;  3TRC A;  2W0N A;  4LPZ A;  1OJ5 A;  2PDR A;  2YKH A;  1F9I A;  4B93 A;  2W3E A;  4YWZ A;  3RFB A;  4EW7 A;  2P04 A;  1DP9 A;  3LIA A;  4F3L A;  2K31 A;  3UB8 A;  3KSH A;  2A24 B;  5MC7 A;  2P08 A;  3FPV A;  3B42 A;  2M1C A;  4MN6 A;  1TS6 A;  4HJ4 A;  2QYB A;  3FG8 A;  4K08 A;  4IUH A;  4P6Z S;  3KX0 X;  3T4K A;  2GJ3 A;  5HL6 A;  4DJ2 A;  1H3Q A;  3C30 A;  3MFX A;  3UE6 A;  4BBV A;  5AJG A;  3F1P B;  1W63 Q;  2FH5 A;  1KOU A;  2J80 A;  1F98 A;  4GS9 B;  5J7E A;  2JKR I;  3P7N A;  3FC7 A;  4WN5 A;  3H7W B;  2D02 A;  4HOI A;  4AFI A;  2EA9 A;  4I39 A;  4PAU A;  1UGU A;  2KDK A;  1ZHH B;  2ZBB A;  3VE3 A;  1WA9 A;  1BYW A;  4BWI A;  4G3W A;  3BW6 A;  2W27 A;  2ZMV A;  2W3G A;  5DF9 A;  3EEA A;  3PBR A;  4F3L B;  2W1T A;  3LI8 A;  1P9W A;  3E4P A;  2VX8 A;  4M4X A;  2MJ6 A;  4EU0 A;  3F1P A;  4IUK A;  3RTY A;  3E0Y A;  4ME4 A;  3S7N A;  1MKM A;  3BY9 A;  3TW8 A;  4NXB A;  1S66 L;  4P6Z M;  3E4O A;  4HP4 A;  1G28 A;  5HD3 A;  3S7P A;  2JN7 A;  2Z6D A;  4I38 A;  4R38 A;  3T4S A;  2PR6 A;  3C38 A;  2W1T B;  4FSF A;  4EUV A;  3ULF A;  4JGR A;  3RH8 B;  2GZA A;  2L1M A;  1OTD A;  3CUE C;  1P0Z A;  5AVF A;  1OT6 A;  1TS7 A;  1S4R A;  1S67 L;  1TF1 A;  2M7U A;  5DFX A;  1IFQ A;  2VZW A;  3T4T A;  2VV8 A;  1EW0 A;  1LSX A;  2CMN A;  4B9O A;  1LSW A;  3OCL A;  1T1C A;  3E98 A;  4GLQ A;  4O01 A;  2VKS A;  2BAS A;  3F1O B;  4ARZ A;  2V9A A;  4HH2 A;  4R6L A;  4MMN A;  3MQO A;  4LLO B;  3ICY A;  4Y5F A;  2GX5 A;  3DBA A;  3VOL A;  3B47 A;  5DJU A;  4MDZ A;  2HV1 A;  5C5K A;  1STZ A;  4NKP A;  3UB7 A;  4Y3I A;  4I3I A;  3OCN A;  2OWJ A;  4GCZ A;  4DMZ A;  1NLZ A;  3C8C A;  2A2L A;  3H82 A;  1V9Z A;  1GSV A;  1DP6 A;  5HSQ A;  3KYQ A;  2EWW A;  3BQA A;  5HWW A;  1GSW A;  2XA7 M;  3BJN A;  1P97 A;  5F5Y A;  1OJG A;  3F1O A;  5HPI A;  4EES A;  3PBO A;  1MZU A;  2K2N A;  5LBR A;  3LR4 A;  5AVE A;  1IOU A;  4NXG A;  2VLG A;  3CIT A;  5I5L A;  2NUP C;  3NOP C;  5TJJ A;  3HCY A;  2QJ5 A;  3KSF A;  3R7W A;  1OTB A;  4L9F A;  5DJT A;  5J4E A;  2XSS A;  2VA0 A;  4HJ6 A;  4I5S A;  3PYP A;  4EER A;  1LL8 A;  3S7O A;  4H6J B;  4G3K A;  2PR5 A;  2W1R A;  3A0S A;  3IBJ A;  4GW9 A;  2OAQ 1;  1NRJ A;  3LIE A;  3IBR A;  1XFN A;  3PXP A;  2XRO A;  3H7W A;  3NOU C;  3MJQ A;  2NUT C;  4DN0 A;  1S4S A;  2Z6C A;  4PHT A;  3CLO A;  1T1A A;  4CLC D;  4NEE D;  1XJ6 A;  5DKK A;  2KLI A;  3BWL A;  1MC0 A;  1GSX A;  1S1Z A;  2INW A;  5HDS A;  2VV6 A;  4KQD A;  2JKR M;  4XT2 B;  1T18 A;  4WL9 A;  1JNU A;  2XA7 S;  4JGO A;  3B33 A;  1LSV A;  4MCW A;  4KQO A;  4UEY A;  2VEA A;  4ETZ A;  3NHQ A;  4L9E A;  2KOI A;  4UQI S;  5KSH A;  3E4Q A;  4HP9 A;  2LB5 A;  2O0Y A;  4NXE A;  4BBU A;  4Z1W A;  3S7Q A;  2A24 A;  2FZ0 A;  3R4K A;  3EEH A;  2DMW A;  1XJ4 A;  4MN5 A;  1D06 A;  3K3C A;  1TS8 A;  4WUJ A;  3G6O A;  4HI4 A;  5F69 A;  4HNB A;  4OOL A;  3U2A A;  3OOV A;  5IT5 A;  2D01 A;  2WKQ A;  2QHK A;  1S1Y A;  4DJ3 A;  2I9V A;  1OPX A;  4QPR A;  2WKP A;  4LRY C;  2J3T D;  4Q0J A;  4EXO A;  1OTA A;  4H6J A;  4WEL A;  3PBQ A;  4CLC A;  3JVV A;  3LR0 A;  1NWZ A;  4II7 A;  3MXQ A;  4ETX A;  4CLC C;  5HDD A;  3NOT C;  2B02 A;  3PBT A;  3JVU A;  2LB9 A;  2PYR A;  4RQ9 A;  3BQ8 A;  1VB6 A;  2PD8 A;  4CLC E;  5KIZ A;  1XFQ A;  4PKY A;  2J3W A;  3PBN A;  4JGP A;  2HJ9 C;  1P9R A;  4WEJ A;  3EGX C;  3T50 A;  3CI6 A;  1W63 M;  3TE8 A;  5IS1 A;  2PHY A;  3LID A;  1NLY A;  3PHY A;  3PBS A;  2G7U A;  4L9G A;  4O0P A;  1H8M A;  4MN7 A;  1LT0 A;  5A8B A;  4WLA A;  3H82 B;  1VHM A;  4Y2F A;  2HF6 A;  4LRZ E;  4YNR A;  3T4Q A;  4GHI A;  5HPF A;  5G4Z A;  4ARZ B;  2P7J A;  5HWT A;  2V0U A;  4EQ1 A;  2VV7 A;  2H28 A;  2L0W A;  3VV4 A;  1T19 A;  4EEU A;  1TS0 A;  3EGD C;  3LR5 A;  2O9C A;  4R3A A;  2V0W A;  4BMW A;  4EEP A;  3T4J A;  2PT7 A;  3HJK A;  4BBT A;  4HHD A;  2EWV A;  4UQI M;  4WF0 A;  1XJ2 A;  5J3W A;  2IA2 A;  4GHI B;  3F1N A;  2R78 A;  2ZOH A;  3VE4 A;  4I3J A;  1YSP A;  5F6A A;  3KSI A;  3SW1 A;  1N9O A;  4WEK A;  3LUQ A;  3BY8 A;  5HD5 A;  1F5M A;  1UWP X;  3T4L A;  4E04 A;  4LRX C;  1YAX A;  3IS2 B;  3OC2 A;  2V1B A;  3CAX A;  3V67 A;  3CWF A;  5G4Y A;  2ZMF A;  3UE3 A;  2W3D A;  4I3A A;  3GEC A;  4HJ3 A;  2K7S A;  2J3T C;  3FPW A;  3MQ0 A;  1G6O A;  3KYZ A;  1TD5 A;  1DRM A;  3LIC A;  4R70 A;  1ODV A;  4HY8 A;  1OTI A;  3C2W A;  1YSQ A;  3MF0 A;  3D72 A;  2QJ7 A;  1ZTU A;  2OOL A;  2QWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...