3UB8A

Periplasmic portion of the helicobacter pylori chemoreceptor tlpb with formamide bound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
157
structure length
157
Chain Sequence
MEHLETGQYKKREKTLAYMTKILEQGIHEYYKSFDNDTARKMALDYFKRINDDKGMIYMVVVDKNGVVLFDPVNPKTVGQSGLDAQSVDGVYYVRGYLEAAKKGGGYTYYKMPKYDGGVPEKKFAYSHYDEVSQMVIAATSYYTDINTENKAIKEGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chemoreceptor TlpB
publication title Structure and proposed mechanism for the pH-sensing Helicobacter pylori chemoreceptor TlpB.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Membrane protein
total genus 54
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17200 sCache_2 Single Cache domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ub8A00
5F68A 2WKRA 4GW9A 1OT6A 2PYPA 5TBMA 5J3WA 3BWLA 3BY9A 4H6JA 2GJ3A 3SW1A 1UGUA 1OTEA 2J80A 5DKLA 1GSWA 3RTYA 2JHEA 5EFWA 2I9VA 4I3AA 3UB7A 4EESA 4NXBA 5HD5A 3E4QA 1S4SA 3EWKA 1S66L 3K3DA 2WKPA 1GSXA 3T50A 2ZBBA 2PHYA 4LRZE 3IBRA 2CMNA 4R6LA 3LUQA 3FG8A 4GS9A 4GCZA 4GHIB 2ZOIA 1LL8A 3LIFA 4MN5A 3H7WB 3H9WA 1LSVA 3GDIA 3E4PA 2V1BA 2VV8A 3UB8A 4WUJA 4R38A 3VOLA 4EW7A 1OJ5A 4I3IA 1UWPX 5I5LA 3BY8A 4LRYC 4HH2A 3K3CA 4E04A 1XJ6A 5IU1A 1D06A 5HDDA 3F1NB 4R70A 3IS2B 3RH8B 4B9OA 3UB9A 4WF0A 2YKHA 4WLAA 1LSXA 3LI9A 1LT0A 4MN6A 4WN5A 2BASA 1TS6A 3D72A 2WKQA 2B02A 5IS1A 2W27A 4H6JB 4YWZA 1DRMA 3KX0X 1F9IA 4LLOB 3A0SA 1D7EA 4HJ4A 2K7SA 1V9YA 3MQOA 1X0OA 3VE3A 2INWA 5HWVA 1S67L 3NOTC 4L9GA 3HJIA 3MR0A 1XFNA 4KUOA 4F3LA 1T19A 3B33A 3P7NA 4HIAA 3A0RA 4R3AA 1OTAA 3G6OA 4HP4A 2OWHA 4KQDA 4DJ3A 2L0WA 5HZHA 2D01A 5J4EA 4JGRA 3MQQA 4HP9A 4HOIA 1TS0A 2A24A 4I38A 1DP8A 4HH3A 4NXEA 3F1PA 4JGQA 3VE4A 3LICA 1GSVA 2QWSA 2YKFA 2EA9A 3LIDA 1P0ZA 3H82A 1N9OA 2QJ5A 3NOUC 4XT2B 5DKKA 4EQ1A 1S1ZA 2D02A 3NJAA 1KOUA 2JN7A 2KX6A 3FC7A 5G4YA 4EETB 4NXGA 3C2WA 1XFQA 3MFXA 2PR6A 4HI4A 1VB6A 3F1OB 3LIAA 4LRXC 4EERA 4PKYA 2VV7A 2H28A 4WL9A 2KDKA 1OTDA 2PD7A 3LI8A 1OT9A 4I39A 3OLOA 3LYXA 5HDSA 1OTBA 5TBMB 3NOPC 2QKPA 4JGOA 4M4XA 3MXQA 2M1CA 1MZUA 4HNBA 3A0VA 1V9ZA 5AVEA 4HHDA 2A24B 1XJ3A 5KIZA 2V9AA 1TS7A 3ICYA 1DP9A 2V0WA 4GS9B 2R78A 3H82B 3EEHA 5HSQA 5DJTA 4HJ6A 5G4ZA 3IS2A 2V1AA 4K08A 3UMEA 5J7EA 3UE6A 3CAXA 1UWNX 2L1MA 1N9NA 4BBVA 2VEAA 3ZQ5A 3UMDA 5F5YA 3HJKA 1S4RA 2Z6CA 2QHKA 4RQ9A 1T1AA 2W0NA 3UB6A 4EEPA 4HY8A 5F6AA 3LIBA 3CWFA 2VV6A 5HDCA 1XJ4A 3C8CA 1OTIA 1Y28A 2OOLA 3E4OA 1XJ2A 2HV1A 5HWWA 1NWZA 4EXOA 2OWJA 3CLOA 5AVFA 2PYRA 1T1BA 1DP6A 2Z6DA 5F69A 5HD3A 1P97A 4F3LB 2QJ7A 4L9EA 2PD8A 2VLGA 1OJGA 4NXFA 3GECA 4BBUA 1S1YA 1EW0A 4GHIA 3PHYA 2ZOHA 1WA9A 4EEUA 4BBTA 4DJ2A 4XT2A 5A8BA 3H7WA 4PKYG 1N9LA 3LIEA 4JGPA 1T18A 3NHQA 5DJUA 1ODVA 4KUKA 3F1PB 3ULFA 2V0UA 4LPZA 2PDRA 2P7JA 4I5SA 1TS8A 3F1OA 1F98A 4HJ3A 3PYPA 1BYWA 4I3JA 1G28A 1JNUA 1T1CA 5HWTA 4L9FA 3F1NA 2PR5A 4HQAA 3MJQA 1LSWA 2L4RA
chains in the Genus database with same CATH superfamily
3EQUA 1K4EA 3DWZA 1PNEA 2P9VB 3BWLA 2B18A 3LEZA 1YLWA 2I72A 2WGIA 4S2KA 3BRMA 1GSWA 2JHEA 1PW8A 1XGIA 2Z2MB 5EFWA 1CK3A 2I9VA 5A93A 3FKWA 1IFQA 5HD5A 4OLDA 1S4SA 3VOZA 2WKPA 2W3FA 2XF3A 4QWOA 3LO7A 4CJNA 5HAIA 4LGWA 4GCZA 4GHIB 3OC2A 3LIFA 5EVIA 3H7WB 5L8MA 4LV3A 5GHYA 5HPFA 1IKGA 3E4PA 2V1BA 3FWLA 5EVIC 3BQAA 1XX2A 5F1FA 4WUJA 4RX3A 2HF6A 3GTCA 3TW8A 1O07A 1D1JA 4LRYC 1ZHHB 4OP5A 1KVMA 1GA0A 4DKIA 3IQAA 4YFMA 4WZ4A 5KZHA 1E3UD 3VFHA 4B9OA 1K55C 3UB9A 4PM7A 1C3BA 4XUZA 4E3MA 3O5YA 2J9PA 1DJBA 3N8SA 3KSFA 4ME4A 3ZNTA 1I2WA 2WKQA 2JKRI 5CGSA 4ZDXA 3B42A 4BMWA 1TD5A 5GLCA 2W1TA 1AWIA 2EFUA 1F9IA 5L09A 3EGXC 3DBAA 1EI5A 4GB7A 3LEQA 1SKOB 2Y2LA 3MQOA 4IVKA 3W4OA 3IXHA 1XFNA 2HP6A 1S0WA 5HW3A 3GSGA 4MDZA 4S2OA 1ACFA 1DJCA 4KZ3A 4C6YA 5BOHA 2Y2KA 2OWHA 1SZVA 4DJ3A 1LL5A 1CF0A 5GLBA 1L0GA 2O9AA 4HOIA 4S2NA 3KSHA 4I38A 5DFXA 3IF6B 2V1ZA 1BLPA 3LICA 3MXSA 1GSVA 2DMWA 3U2AA 4GKUA 3DTIA 2PBDP 2EA9A 3RXWA 2PAVP 3NOUC 4XT2B 3C4OA 1CJFA 2JN7A 5G4YA 4P0MA 2ZQAA 1K4FA 3F1OB 4LV2A 4EERA 3VP3A 3Q1FA 4BWIA 2VV7A 4JXVA 3HUMA 4CPKA 4N92A 2HP5A 4KQQA 4FH2A 1OT9A 4I39A 2VA0A 4NG2A 1P9RA 4EUVA 3S7PA 3G4PA 4E3OA 1Z09A 3OPLA 2H10A 1FCNA 2GZAA 3IWIA 2J3TC 1FILA 1PI4A 3MF0A 2ACGA 4WM9A 4Z1WA 3Q7ZA 4X6TA 4HEFA 3MZDA 3NECA 4N9KA 1VM1A 1NJ4A 3QP8A 2M7UA 4PPRA 2X71A 3OZHA 3VP0A 1SCWA 1ERMA 4KZ7A 5FQQA 3VP4A 2O0YA 3ICYA 5FAQA 2OV5A 1NZOA 4JF5A 4AFIA 4B4XA 3H82B 2PT7A 3BFGA 5CGXA 1YPRA 5DJTA 1KE3A 4HJ6A 2V1AA 1L0EA 3WRZA 3SS5A 4OPQA 3LR5A 1IOUA 3NULA 1N9NA 4O0PA 3UMDA 1DJAA 3RJUA 2QHKA 3PR6A 2XQZA 4RQ9A 3ZG5A 2W0NA 3EGDC 1SDNA 4MBFA 4ZJ3A 2WAEA 4EEPA 4IUKA 4S2PA 4M3KA 3HLGA 2ZD8A 4QU3A 4XXRA 1W63Q 2PBYA 2HJ9C 4OPYA 4WMCA 1XJ4A 4PM9A 4MNRA 2WK0A 3UDXA 5CECA 3QP2A 2WGWB 3BW6A 1ZTUA 2HV1A 3QHYA 4EXOA 2EWWA 2Y55A 1STZA 2OWJA 4OQHA 4KENB 4Y5FA 4Y17A 2P9VA 2JKTM 3N8LA 1DP6A 1FIKA 3SH8A 3PTEA 1SKFA 2WKHA 3EQVA 2JKFA 5EE8A 2VK3A 3PBOA 5M1AA 3BLSA 2QJ7A 5HPIA 2PD8A 3QNBA 1TVFA 5GHXA 3L7HA 2IWCA 4KZ4A 3UNWA 3VP1A 3LR0A 4JKTA 3A3IA 4IJGA 3ZG0A 1BLCA 1NXYA 4GHIA 5KMWA 4X1MA 4MBHA 3LGOA 4OQIA 3H7WA 1RP5A 3ZGAB 3M6HA 2QMIA 2Y2IA 3LIEA 4JGPA 3C7UA 5DJUA 1ODVA 4K0WA 3VOYA 2C6WB 4LPZA 4I5SA 1TS8A 4HJ3A 3PYPA 5FEGA 4I3JA 4P6ZM 4ETZA 1ZC2A 1QMEA 4II7A 1Y4OA 3Q81A 1NLYA 2WYXA 4N9LA 1RGZA 4HQAA 4RYEA 3ZNYA 2W3HA 1OPXA 2WKRA 5EM1A 3HLFA 1TDGA 1GHPA 1ONHA 5CXWA 5FASA 5J3WA 4Y0UA 3MZFA 3BY9A 5CTNA 3V67A 3BEBA 1PZOA 4S2IA 1UGUA 3DTKA 1OTEA 3TRCA 3G32A 1ZG4A 1SKOA 3UB7A 4NXBA 4EU0A 3E4QA 4S2MA 2VKSA 2W3GA 3WRTA 1GSXA 3P09A 3PXPA 3T50A 4OPZA 4LRZE 1YLJA 4NK3A 1PYYA 2DRWA 3BM6A 2CMNA 3LUQA 4P6BA 4EQIA 4Q0HA 3FG8A 2B95A 3MFDA 4MMNA 1ESIA 3GDIA 3ITBA 2VV8A 3UPPA 3UB8A 3PAGA 5E2HA 1OJ5A 4CLCE 5L07A 2K2NA 3BY8A 4ZBEA 5HAPA 1W7FA 1JTGA 2QPNA 4GD6A 3NI9A 4E04A 5HDDA 4QPRA 4O7DA 5FA7A 3IF6C 3QP6A 1HD8A 2ZC3B 3P98A 3PBQA 2YKHA 4EV4A 3LI9A 1LT0A 1BUEA 3ZHHA 3KYZA 4Y13A 2BASA 2HDRA 3OPRA 3I7JA 1NRJA 4ESPA 2VGLS 3KYEA 2O99A 1K57A 1ERQA 2XD5A 5CEDA 1DRMA 4R1GA 3KX0X 3IF5A 3R7WB 2KLIA 2IWDA 1S67L 1MXOA 3NOTC 3O3VA 4H8RA 4PHTA 5CERA 3FZCA 4RA7A 2EX8A 4GD8A 4KUOA 4OQ0A 4F3LA 1CEFA 3MBZA 2ZLYA 2HGVA 4HIAA 4R3AA 3N6IA 1FR1A 3VMAA 2D01A 2BLSA 4JGRA 3OPPA 1GCEA 3QP1A 3O87A 3OCNA 1TS0A 3V3RA 1DP8A 1HZOA 2Y2OA 4NXEA 4JGQA 5MC7A 2R9WA 1FCMA 3PAEA 2UWXA 4FTXA 1P0ZA 3H82A 5TJJA 4EQ1A 2H5SA 2KX6A 4KG2A 4OP8A 4MEZA 2EXBA 3C2WA 1RGYA 2WKIA 1L3LA 3LIAA 4G3WA 3BFDA 1IKIA 1JTDA 5E2GA 1YM1A 5E2EA 2H28A 1N4OA 1OMEA 4ZJ1A 4U0TA 3LI8A 3N8RA 2G7UA 5FI7A 2OAQ1 1XA1A 3RFBA 5F83A 5HAQA 3IHBA 1VETB 3B47A 4MCWA 3NOPC 2CC1A 2QKPA 4JGOA 2M7VA 4M4XA 3MS6A 2WGWA 4ZRRA 2V8CA 2M1CA 1MZUA 4HNBA 3CHWP 4DDYA 3C5AA 2XDMA 4E3IA 4MLLA 5AVEA 3SS4A 3HLBA 2A24B 1HVBA 3IX8A 2WZXA 5E43A 1TS7A 3A3FA 2Y91A 3UDFA 5DTKA 4EBNA 3QP5A 2V0WA 4UAAA 2ZMAA 4KG6A 1VEUB 4DDSA 1XPBA 5HSQA 5D3OA 3E98A 5A91A 3IS2A 2XD1A 3Q7VB 5F1GA 1FOFA 5EM0A 1G6OA 3UMEA 3M2KA 2Y2HA 4QY5A 4BBVA 1YAXA 2VEAA 3ZQ5A 3T1XA 1E4DA 1KDSA 5TR7A 2Z6CA 5DF9A 3V5MA 2V8FA 4S2NC 1GA9A 3G31A 3UB6A 5F6AA 2HDQA 3HBRA 4IEDA 2Y59A 1IYSA 2JKGA 4CQHA 4E3NA 1YLTA 2VJWA 3T12B 2ZMVA 1PWGA 1ES4A 2XA7M 3SH7A 5DF8A 2FFYA 2VV6A 4EBPA 4BENA 2X01A 4F94A 3E4OA 4ARZB 1O7EA 1XJ2A 3OPHA 1NWZA 2ZC4B 5J8XA 5AVFA 4BLMA 1YLYA 2PYRA 4KZ9A 1T1BA 4YNRA 3T4QA 3OBFA 5FQ9A 1MBLA 3JVUA 1ES3A 4BD1A 3G30A 1BLHA 4ZTKA 4F3LB 5AQAA 1FSWA 3IXGA 5DFYA 3GQZA 3WS1A 1XGJA 1OJGA 3WS2A 4DXCA 3KYQA 3S4XA 3O88A 1BLSA 3LY4A 1S1YA 1EW0A 2GDNA 3UE0A 3PHYA 2ZOHA 3BFFA 1WA9A 5M18A 5C5KA 4BBTA 4DJ2A 5A8BA 3SZTA 1YMXA 1MWUA 3BYDA 1K6RA 2ZM2A 3S7NA 2A49A 1K54A 4KUKA 5TGFA 3LY3A 4R23A 3UE3A 2P7JA 5EVID 5FEFA 5HL6A 1MC0A 3WS4A 1K54C 4BL3A 3BECA 3DW0A 1JWVA 1KGFA 2BTFP 2XSSA 1WE4A 4L9FA 1ALQA 3LFVA 4Y7PA 3ZCZA 2PR5A 5E2FA 2EX2A 5EOOA 2XGNA 4GW9A 3VSKA 2Y2NA 3BJNA 1OT6A 4OVDA 4UQIM 2X02A 2ZQCA 1IYOA 2JCHA 2LB9A 3BFEA 4E3JA 4K0XA 3ISGA 5FL3A 4GZBA 2GJ3A 4GNUA 1K56A 2Y2MA 2J80A 4QD4A 3WS5A 3PBNA 1P9WA 4I3AA 3ZDJA 2JKTI 3R7WA 4EESA 4CLCA 3AGDA 1NYYA 4BJPA 3O86A 3FPWA 3GR2A 5GLAA 2PHYA 4FH4A 1CI8A 4RX2A 4QB8A 4R6LA 1BZAA 3VV4A 1ESUA 4X56A 2VX8A 2WUQA 4GS9A 5EOEA 2Z2LB 2ZOIA 4BQMA 1LL8A 5AQBA 4D60A 3N7WA 4JF4A 4MN5A 4WEKA 1XA7A 3H9WA 3KSGA 4G3KA 3G34A 4R38A 4EW7A 4I3IA 1MKIA 1GHMA 1TF1A 3IXBA 3HUOA 2Y79A 5I5LA 3T1SA 1XP4A 3CJMA 4BL2A 4HBUA 1PWDA 4DF6A 1ZKJA 4O01A 5KSCA 4HH2A 3K3CA 2GX5A 2XK1A 1KDWA 4KZBA 5IU1A 4GDBA 3F1NB 4R70A 3T4OA 1E25A 3IS2B 3ITAA 4WN5A 1IYQA 1PW1A 1J3WA 1F5MA 3M6BA 4Z9QA 5K5BA 3SOIA 4R0QA 2B02A 5IS1A 4H6JB 5G18A 1PRQA 4R3BA 3CUEA 3A0SA 3UO9A 4HJ4A 4G3VA 4KG5A 5CRFA 1X0OA 1XXMA 3CUEC 3EOIA 2INWA 4GJ4A 3DAVA 5F82A 4KZ5A 2EX9A 1W5DA 1ES5A 3MR0A 2FH5A 2XFSA 2W3DA 1VETA 3QNCA 1K38A 3VP2A 1NYMA 5CHMA 1T19A 3B33A 2J3WA 3P7NA 4UHUA 3A0RA 1MY8A 3A3JA 4HP4A 4KQDA 1TDLA 1K6SA 2J3TD 5FQJA 1K25A 3NY4A 3SS3A 1EROA 3BLMA 4HP9A 4JPMA 2A24A 1E3UA 2NUTC 1MKMA 2ZMFA 5IHVA 3P01A 1HLUP 2Y2JA 2Q9NA 2QWSA 1NY0A 2XROA 2YKFA 5JYOA 4KZ6A 5A92A 1VEUA 4WZ5A 3IHAA 1DY6A 1N9OA 2EFXA 4WYYA 5L10A 1I2SA 2W3EA 1LI0A 5DKKA 2D02A 3NJAA 2B5RA 4KQOA 1M40A 4EETB 3MSHA 3Q7VA 4JXSA 3LR4A 5CHJA 3MFXA 2PR6A 4HI4A 3B3XA 3T4SA 4LRXC 4PM6A 4JXWA 3LCEA 3CZDA 4QJGA 4IUHA 4WL9A 1OTDA 1L2SA 3DTEA 2PD7A 2H0TA 2IA2A 5EUAA 4X1LA 3LYXA 5HDSA 1Q2PA 3U4LP 4B93A 4Y0TA 4QHCA 2ZL1B 2FZ0A 3T4LA 4ARZA 2Y4AA 3OCLA 2ZC5B 3JYIA 3M2JA 2ZC6B 4N1HA 4WMCD 1YKDA 3CPTA 4MBKA 1K57C 4U0XA 1V9ZA 4DXBA 1RCJA 4CLCB 1YQSA 3ZVWA 1XJ3A 2V9AA 4UEYA 3T1RA 1H3QA 3QP4A 1YSPA 5A90A 3MKFA 3UB5P 5LBRA 2HPBA 4C3QA 4GS9B 3W2ZA 4RVAA 3GV9A 5FI2A 2WKEA 5G4ZA 4FSFA 3IXDA 3T1QB 2V20A 3D9YA 3IX3A 3HCYA 2J9OA 3CAXA 3UE6A 4NEED 1UWNX 2L1MA 5AQ7A 2EXAA 4BD0A 5FAPA 4OOMA 4HESA 4DE2A 3IWQA 1ONGA 3L9KA 4LFUA 4X53A 1S4RA 1L0FA 4P6ZS 3CI6A 2C5WB 1FSYA 1CEGA 2H0YA 1T1AA 5CX7A 3MKEA 3VFFA 1WYBA 3VSLA 4N1XA 1ES2A 4HY8A 5EVEA 3KSIA 3LIBA 4KQRA 4ETXA 1H0MA 4DMZA 3MXRA 4JXGA 4D2OA 3IX4A 3TJZC 2EX6A 1HTZA 3V50A 3HLWA 1OTIA 4OONA 2HDUA 2QZ6A 1YLPA 4FOFA 4E6XA 1Y28A 2EWVA 2WGVA 2OOLA 3S7QA 5HWWA 3C4PA 3ZG7B 3CLOA 4Y15A 2VGKA 1NZUA 5DVAA 3AGFA 3DWKA 2Z6DA 4X55A 1KGEA 4KZ8A 2PU4A 4IBXA 2IWBA 4U3TA 4ZJ2A 5HD3A 1P97A 5EPHA 1BSGA 4UA7A 1IYPA 1L0DA 2VLGA 1K55A 1YMSA 1Q2QA 4NXFA 3MQ0A 2E8JA 3GECA 1K0KA 1LL9A 4DE3A 1MWSA 3C30A 4UA9A 4OH0A 3BQ8A 2JE5A 4UA6A 5DTSA 4PKYG 1N9LA 2FFFB 3K2NA 2JBFA 5L2FA 1KGGA 3CG5A 3ULFA 2V0UA 1LI9A 1J9MA 5EECA 2G2UA 1BYWA 3G35A 3C38A 2Y8HA 5GL9A 1T1CA 3V3SA 1W8QA 3PBRA 5AJGA 1AXBA 3D4FA 3F1NA 3S1YA 3W8KA 2JKRM 3S22A 3NC8A 4YOFA 5CEBA 4Q8IA 1LSWA 2L4RA 3UY6A 2BG1A 5F68A 3FYZA 3IH8A 4A5RA 2XFTA 2PYPA 5TBMA 3IWOA 4X25A 1KVLA 4OQGA 4Y2FA 1F2KA 2QYBA 1N9BA 4H6JA 1BTLA 3SW1A 3IBJA 1G6AA 5DKLA 2Q9MA 3MZEA 3RTYA 4LCMA 4IHQA 1FQGA 2AVXA 4DE0A 3EWKA 1H5XA 1S66L 3K3DA 2ZBBA 2JC7A 3IBRA 4HBTA 1Z6FA 3A3EA 5M19A 1W63M 3ZG8B 4E6WA 3CPTB 4YINA 2Y2QA 4L0LA 4XUXA 1LSVA 1PI5A 3WS0A 2HP9A 4GLQA 1GHIA 2ZC7A 3VOLA 1UWPX 5U47A 3E2KA 5CGWA 3PBSA 3WWXA 1YT4A 1XJ6A 2WZZA 4B88A 1D06A 1S6RA 4WBGA 4PM5A 5FDHA 1W79A 5FAOA 3A3DA 3RH8B 4WF0A 3EEAA 4WLAA 2VGJA 2O9BA 1G5UA 1LSXA 4MN6A 4OKPA 4KZAA 3HLCA 3Q82A 1TS6A 4WELA 3D72A 5CTMA 3R4KA 4P87A 1CI9A 2W27A 3W4PA 4YWZA 2XEPA 4JBFA 2OLUA 2XR0A 4LLOB 2J8YA 4S2LA 1D7EA 2K7SA 4GOGA 2E8IA 1V9YA 3VE3A 3GRJA 5HWVA 2P08A 3DTMA 1FR6A 3IH9A 1YSQA 1NLZA 2DCFA 4L9GA 1JVJA 3HJIA 5IT5A 2XH9A 3JVVA 2HZ5A 3PBTA 2ZQ8A 1M6KA 5FSRA 2ZL1A 3NDGA 3ZVTA 1OTAA 2A3UA 3GMWA 3N4IA 2OAP1 3G6OA 5EVIB 4PAUA 2HDSA 2L0WA 4JLFA 5HZHA 5J4EA 5EV0A 3ZYTA 2XRNA 3MQQA 4JF6A 5CHUA 3C7VA 3HUNA 2LB5A 1H8YA 4FUWA 5DF7A 2W1RA 4HH3A 2UV0E 3F1PA 5KSHA 4CLCC 3VE4A 4ID4A 3ZG9B 3V39A 3LIDA 2QJ5A 4OOLA 1ZG6A 3E0YA 1S1ZA 3FKVA 1KOUA 3FC7A 2ZQDA 3FPVA 1CQAA 2MJ6A 4NXGA 1Y54A 1U60A 1XFQA 4FD8A 4DRTA 5GLDA 3IT9A 1A0KA 1VB6A 2W1TB 3HL9A 2ZM8A 2VZWA 2VGLM 4PKYA 1SDEA 4R3JA 2RCXA 3NIAA 2KDKA 2WADA 3UDIA 3HLEA 3CITA 4DN0A 1PIOA 2NUPC 1JWPA 2XA7S 2O9CA 5HX9A 1KE0A 3OLOA 4NETA 3OOVA 2GNXA 2ZQ7A 1EWZA 1OTBA 4E3LA 3CMZA 5TBMB 3JPUA 4X68A 3G2ZA 2OSUA 1H8MA 3TG9A 4R4RA 4Y0OA 5FQIA 3MXQA 4S2JA 1IELA 5JYPA 3A0VA 1YLZA 4HHDA 1FCOA 4EUZA 2Y2PA 3TE8A 3TSGA 5FATA 5FI6A 3S7OA 5KIZA 4E3KA 2V2FF 3GVBA 3NDEA 4LV1A 1DP9A 3KO6A 3FV7A 4P85A 3AGEA 2R78A 4Q0IA 3EEHA 1VQQA 4OPRA 4IVIA 4R4SA 4K08A 1QMFA 5FQMA 1IEMA 5J7EA 4K91A 1MWTA 2Q0OA 3NCKA 3MMHA 3T4TA 5F5YA 3HJKA 2Y2GA 1BULA 1PWCA 1JWZA 1W8YA 3HVFA 3G2YA 1SHVA 4ZAMA 2ZJ9A 4PMAA 2KOIA 4LV0A 5HFOA 2K31A 1G68A 3T4JA 1I5QA 3CWFA 2ZQ9A 4WZ5C 4B4ZA 4UQIS 5HDCA 2J7VA 3C8CA 4NKPA 5HARA 4Y3IA 3E2LA 4OLGA 3UPOA 4FCFA 1KE4A 3D3OA 4PM8A 1PFLA 1H8ZA 2WAFA 1PZPA 4OOYA 4O8GA 3UN7A 1MPLA 5F69A 2A2LA 4Q0JA 1NRFA 3ZFZA 3TOIA 1LHYA 4LENA 3BFCA 4DE1A 4GDNA 2OLVA 1BT5A 1K56D 2R9XA 4L9EA 3IF6A 5I94A 4MN7A 5EVLA 5GHZA 2DNSA 1LLBA 3HREA 4CLCD 1XKZA 4BBUA 3UPNA 3LR3A 5HL1A 4EEUA 4XT2A 2PRFA 3W4QA 2ZM0A 4QY6A 4IBRA 2P04A 5FDSA 5DTTA 1T18A 3NHQA 2HJEA 5AQ9A 3UE1A 5FQKA 2RL3A 3F1PB 2PDRA 2P74A 3F1OA 3NBLA 1F98A 4C75A 4GN2A 3SH9A 1G28A 1VHMA 1JNUA 4EBLA 1TEMA 4LCLA 5HWTA 4WEJA 1MWRA 1WYCA 3Q07A 3HLDA 3RXXA 4X69A 4EWFA 2XLNA 2G2WA 3MJQA 2PU2A 5TFQA 3T4KA
chains in the Genus database with same CATH topology
3EQUA 5F68A 2W3HA 1OPXA 2WKRA 4GW9A 3BJNA 1OT6A 4UQIM 2PYPA 5TBMA 2LB9A 4Y2FA 2QYBA 5J3WA 3BWLA 2B18A 5FL3A 3BY9A 4H6JA 3V67A 2GJ3A 3SW1A 3IBJA 1UGUA 1OTEA 2J80A 5DKLA 1GSWA 3RTYA 2JHEA 3TRCA 3PBNA 5EFWA 4IHQA 1P9WA 2I9VA 4I3AA 3UB7A 2JKTI 3R7WA 4EESA 1IFQA 4NXBA 4CLCA 5HD5A 3E4QA 4EU0A 1S4SA 2VKSA 3EWKA 2W3GA 1S66L 3K3DA 2WKPA 1GSXA 3PXPA 3T50A 2W3FA 4BJPA 3FPWA 2ZBBA 2PHYA 4LRZE 3IBRA 2CMNA 4R6LA 3LUQA 3VV4A 2VX8A 4Q0HA 3FG8A 4GS9A 4GCZA 4GHIB 2ZOIA 3OC2A 1W63M 1LL8A 3LIFA 4MN5A 3H7WB 4L0LA 4WEKA 3H9WA 5L8MA 5HPFA 4MMNA 3KSGA 1LSVA 3GDIA 3E4PA 2V1BA 4G3KA 2VV8A 3BQAA 4GLQA 3UB8A 4WUJA 2HF6A 4R38A 3TW8A 3VOLA 4EW7A 4CLCE 1OJ5A 4I3IA 1UWPX 1TF1A 5I5LA 2K2NA 2Y79A 3BY8A 4O01A 4LRYC 1ZHHB 4HH2A 3K3CA 3PBSA 2GX5A 4E04A 1XJ6A 5IU1A 1D06A 5HDDA 3F1NB 4QPRA 4R70A 3T4OA 3IS2B 3PBQA 3RH8B 4B9OA 3UB9A 4WF0A 3EEAA 2YKHA 4WLAA 2O9BA 1LSXA 3LI9A 3O5YA 1LT0A 4MN6A 4WN5A 3KYZA 2BASA 3KSFA 1F5MA 1NRJA 1TS6A 4WELA 3D72A 4ME4A 5K5BA 2WKQA 2VGLS 2JKRI 2B02A 3R4KA 5IS1A 3B42A 4BMWA 2O99A 2W27A 4H6JB 1TD5A 4YWZA 1DRMA 2W1TA 3KX0X 3CUEA 1F9IA 4LLOB 3EGXC 3A0SA 3DBAA 1D7EA 4HJ4A 2K7SA 4G3VA 1V9YA 3MQOA 1X0OA 3R7WB 3VE3A 3CUEC 3EOIA 2INWA 2KLIA 4GJ4A 2P08A 5HWVA 1S67L 3NOTC 1YSQA 1NLZA 4L9GA 3HJIA 3MR0A 4PHTA 1XFNA 2FH5A 5IT5A 3JVVA 2W3DA 4KUOA 4F3LA 4MDZA 3PBTA 1T19A 3B33A 2J3WA 3P7NA 2HGVA 4HIAA 3A0RA 4R3AA 1OTAA 2OAP1 3G6OA 4HP4A 2OWHA 4KQDA 4PAUA 2L0WA 4DJ3A 5HZHA 2D01A 2J3TD 5J4EA 4JGRA 3ZYTA 2XRNA 3MQQA 4HP9A 3OCNA 2LB5A 2O9AA 4HOIA 1TS0A 3KSHA 2A24A 2NUTC 4I38A 5DFXA 1DP8A 1MKMA 2W1RA 4HH3A 2ZMFA 4NXEA 3F1PA 5KSHA 3P01A 4CLCC 4JGQA 5MC7A 3VE4A 3LICA 1GSVA 2DMWA 3U2AA 2QWSA 2XROA 2YKFA 2EA9A 3LIDA 1P0ZA 3H82A 1N9OA 2QJ5A 4OOLA 2W3EA 3NOUC 4XT2B 5TJJA 3E0YA 5DKKA 4EQ1A 1S1ZA 2D02A 3NJAA 4KQOA 1KOUA 2JN7A 2KX6A 3FC7A 3FPVA 5G4YA 4EETB 2MJ6A 3LR4A 4NXGA 3C2WA 1XFQA 3MFXA 2PR6A 4HI4A 1VB6A 3F1OB 3LIAA 4G3WA 2W1TB 3T4SA 4LRXC 2VZWA 2VGLM 4EERA 4PKYA 4IUHA 4BWIA 2VV7A 2H28A 4WL9A 2KDKA 1OTDA 3CITA 2PD7A 3LI8A 2IA2A 2G7UA 4DN0A 1OT9A 4I39A 2NUPC 2XA7S 2O9CA 2VA0A 2OAQ1 3OLOA 3RFBA 1P9RA 3LYXA 4EUVA 3S7PA 5HDSA 3OOVA 2GNXA 3B47A 1OTBA 4MCWA 5TBMB 4B93A 3NOPC 2QKPA 4JGOA 2M7VA 4M4XA 2GZAA 1H8MA 4ZRRA 2FZ0A 3MXQA 3T4LA 2J3TC 4ARZA 2M1CA 1MZUA 4HNBA 3OCLA 3MF0A 4Z1WA 3A0VA 1YKDA 1V9ZA 2M7UA 5AVEA 4CLCB 4HHDA 2A24B 3TE8A 3S7OA 1XJ3A 5KIZA 2V9AA 4UEYA 1TS7A 1H3QA 2O0YA 1YSPA 3ICYA 5LBRA 4AFIA 1DP9A 3KO6A 2V0WA 4GS9B 3W2ZA 2R78A 3H82B 4Q0IA 2PT7A 3EEHA 5HSQA 5DJTA 4HJ6A 5G4ZA 3E98A 4FSFA 3IS2A 2V1AA 4K08A 3UMEA 1G6OA 3LR5A 3HCYA 5J7EA 3CAXA 3UE6A 4NEED 1UWNX 2L1MA 1IOUA 1N9NA 4BBVA 1YAXA 2VEAA 4O0PA 3ZQ5A 4OOMA 3UMDA 3MMHA 3T4TA 5F5YA 3HJKA 1S4RA 3CI6A 2Z6CA 4P6ZS 2QHKA 3PR6A 4RQ9A 5DF9A 1T1AA 5CX7A 2W0NA 3EGDC 3UB6A 4EEPA 4HY8A 5F6AA 4IUKA 2KOIA 3KSIA 3LIBA 4CQHA 2K31A 4ETXA 1W63Q 2VJWA 3T4JA 4DMZA 3CWFA 2ZMVA 2HJ9C 2XA7M 3TJZC 2VV6A 4UQIS 5HDCA 1XJ4A 3C8CA 4NKPA 1OTIA 4FOFA 4Y3IA 1Y28A 2EWVA 2OOLA 3S7QA 3E4OA 4ARZB 1XJ2A 3BW6A 1ZTUA 2HV1A 5HWWA 1NWZA 4EXOA 2EWWA 1STZA 3D3OA 2OWJA 3CLOA 5AVFA 4Y5FA 2JKTM 2PYRA 1T1BA 1DP6A 4YNRA 4O8GA 3T4QA 2Z6DA 3OBFA 5F69A 2A2LA 3JVUA 4Q0JA 3EQVA 5HD3A 1P97A 4F3LB 3PBOA 2QJ7A 5HPIA 5DFYA 4L9EA 2PD8A 4MN7A 2VLGA 1OJGA 3KYQA 4NXFA 3MQ0A 4CLCD 3GECA 3LR0A 4IJGA 4BBUA 1S1YA 3C30A 1EW0A 4GHIA 3PHYA 2ZOHA 3LR3A 1WA9A 4EEUA 5C5KA 4BBTA 4XT2A 4DJ2A 3BQ8A 5A8BA 3H7WA 4PKYG 1N9LA 3LIEA 2P04A 4JGPA 3S7NA 1T18A 3K2NA 3NHQA 2HJEA 5DJUA 1ODVA 4KUKA 3F1PB 3ULFA 2V0UA 4LPZA 3UE3A 2PDRA 2P7JA 4I5SA 1TS8A 3F1OA 1F98A 5HL6A 1MC0A 4HJ3A 3PYPA 1BYWA 3C38A 4I3JA 4P6ZM 2Y8HA 4ETZA 1G28A 1JNUA 1VHMA 1T1CA 2XSSA 5HWTA 4WEJA 3PBRA 4L9FA 5AJGA 3LFVA 3F1NA 4II7A 2PR5A 1NLYA 2JKRM 4HQAA 3MJQA 4YOFA 1LSWA 2L4RA 3T4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F68 A;  2WKR A;  4GW9 A;  1OT6 A;  2PYP A;  5TBM A;  5J3W A;  3BWL A;  3BY9 A;  4H6J A;  2GJ3 A;  3SW1 A;  1UGU A;  1OTE A;  2J80 A;  5DKL A;  1GSW A;  3RTY A;  2JHE A;  5EFW A;  2I9V A;  4I3A A;  3UB7 A;  4EES A;  4NXB A;  5HD5 A;  3E4Q A;  1S4S A;  3EWK A;  1S66 L;  3K3D A;  2WKP A;  1GSX A;  3T50 A;  2ZBB A;  2PHY A;  4LRZ E;  3IBR A;  2CMN A;  4R6L A;  3LUQ A;  3FG8 A;  4GS9 A;  4GCZ A;  4GHI B;  2ZOI A;  1LL8 A;  3LIF A;  4MN5 A;  3H7W B;  3H9W A;  1LSV A;  3GDI A;  3E4P A;  2V1B A;  2VV8 A;  3UB8 A;  4WUJ A;  4R38 A;  3VOL A;  4EW7 A;  1OJ5 A;  4I3I A;  1UWP X;  5I5L A;  3BY8 A;  4LRY C;  4HH2 A;  3K3C A;  4E04 A;  1XJ6 A;  5IU1 A;  1D06 A;  5HDD A;  3F1N B;  4R70 A;  3IS2 B;  3RH8 B;  4B9O A;  3UB9 A;  4WF0 A;  2YKH A;  4WLA A;  1LSX A;  3LI9 A;  1LT0 A;  4MN6 A;  4WN5 A;  2BAS A;  1TS6 A;  3D72 A;  2WKQ A;  2B02 A;  5IS1 A;  2W27 A;  4H6J B;  4YWZ A;  1DRM A;  3KX0 X;  1F9I A;  4LLO B;  3A0S A;  1D7E A;  4HJ4 A;  2K7S A;  1V9Y A;  3MQO A;  1X0O A;  3VE3 A;  2INW A;  5HWV A;  1S67 L;  3NOT C;  4L9G A;  3HJI A;  3MR0 A;  1XFN A;  4KUO A;  4F3L A;  1T19 A;  3B33 A;  3P7N A;  4HIA A;  3A0R A;  4R3A A;  1OTA A;  3G6O A;  4HP4 A;  2OWH A;  4KQD A;  4DJ3 A;  2L0W A;  5HZH A;  2D01 A;  5J4E A;  4JGR A;  3MQQ A;  4HP9 A;  4HOI A;  1TS0 A;  2A24 A;  4I38 A;  1DP8 A;  4HH3 A;  4NXE A;  3F1P A;  4JGQ A;  3VE4 A;  3LIC A;  1GSV A;  2QWS A;  2YKF A;  2EA9 A;  3LID A;  1P0Z A;  3H82 A;  1N9O A;  2QJ5 A;  3NOU C;  4XT2 B;  5DKK A;  4EQ1 A;  1S1Z A;  2D02 A;  3NJA A;  1KOU A;  2JN7 A;  2KX6 A;  3FC7 A;  5G4Y A;  4EET B;  4NXG A;  3C2W A;  1XFQ A;  3MFX A;  2PR6 A;  4HI4 A;  1VB6 A;  3F1O B;  3LIA A;  4LRX C;  4EER A;  4PKY A;  2VV7 A;  2H28 A;  4WL9 A;  2KDK A;  1OTD A;  2PD7 A;  3LI8 A;  1OT9 A;  4I39 A;  3OLO A;  3LYX A;  5HDS A;  1OTB A;  5TBM B;  3NOP C;  2QKP A;  4JGO A;  4M4X A;  3MXQ A;  2M1C A;  1MZU A;  4HNB A;  3A0V A;  1V9Z A;  5AVE A;  4HHD A;  2A24 B;  1XJ3 A;  5KIZ A;  2V9A A;  1TS7 A;  3ICY A;  1DP9 A;  2V0W A;  4GS9 B;  2R78 A;  3H82 B;  3EEH A;  5HSQ A;  5DJT A;  4HJ6 A;  5G4Z A;  3IS2 A;  2V1A A;  4K08 A;  3UME A;  5J7E A;  3UE6 A;  3CAX A;  1UWN X;  2L1M A;  1N9N A;  4BBV A;  2VEA A;  3ZQ5 A;  3UMD A;  5F5Y A;  3HJK A;  1S4R A;  2Z6C A;  2QHK A;  4RQ9 A;  1T1A A;  2W0N A;  3UB6 A;  4EEP A;  4HY8 A;  5F6A A;  3LIB A;  3CWF A;  2VV6 A;  5HDC A;  1XJ4 A;  3C8C A;  1OTI A;  1Y28 A;  2OOL A;  3E4O A;  1XJ2 A;  2HV1 A;  5HWW A;  1NWZ A;  4EXO A;  2OWJ A;  3CLO A;  5AVF A;  2PYR A;  1T1B A;  1DP6 A;  2Z6D A;  5F69 A;  5HD3 A;  1P97 A;  4F3L B;  2QJ7 A;  4L9E A;  2PD8 A;  2VLG A;  1OJG A;  4NXF A;  3GEC A;  4BBU A;  1S1Y A;  1EW0 A;  4GHI A;  3PHY A;  2ZOH A;  1WA9 A;  4EEU A;  4BBT A;  4DJ2 A;  4XT2 A;  5A8B A;  3H7W A;  4PKY G;  1N9L A;  3LIE A;  4JGP A;  1T18 A;  3NHQ A;  5DJU A;  1ODV A;  4KUK A;  3F1P B;  3ULF A;  2V0U A;  4LPZ A;  2PDR A;  2P7J A;  4I5S A;  1TS8 A;  3F1O A;  1F98 A;  4HJ3 A;  3PYP A;  1BYW A;  4I3J A;  1G28 A;  1JNU A;  1T1C A;  5HWT A;  4L9F A;  3F1N A;  2PR5 A;  4HQA A;  3MJQ A;  1LSW A;  2L4R A; 
#chains in the Genus database with same CATH topology
 3EQU A;  1K4E A;  3DWZ A;  1PNE A;  2P9V B;  3BWL A;  2B18 A;  3LEZ A;  1YLW A;  2I72 A;  2WGI A;  4S2K A;  3BRM A;  1GSW A;  2JHE A;  1PW8 A;  1XGI A;  2Z2M B;  5EFW A;  1CK3 A;  2I9V A;  5A93 A;  3FKW A;  1IFQ A;  5HD5 A;  4OLD A;  1S4S A;  3VOZ A;  2WKP A;  2W3F A;  2XF3 A;  4QWO A;  3LO7 A;  4CJN A;  5HAI A;  4LGW A;  4GCZ A;  4GHI B;  3OC2 A;  3LIF A;  5EVI A;  3H7W B;  5L8M A;  4LV3 A;  5GHY A;  5HPF A;  1IKG A;  3E4P A;  2V1B A;  3FWL A;  5EVI C;  3BQA A;  1XX2 A;  5F1F A;  4WUJ A;  4RX3 A;  2HF6 A;  3GTC A;  3TW8 A;  1O07 A;  1D1J A;  4LRY C;  1ZHH B;  4OP5 A;  1KVM A;  1GA0 A;  4DKI A;  3IQA A;  4YFM A;  4WZ4 A;  5KZH A;  1E3U D;  3VFH A;  4B9O A;  1K55 C;  3UB9 A;  4PM7 A;  1C3B A;  4XUZ A;  4E3M A;  3O5Y A;  2J9P A;  1DJB A;  3N8S A;  3KSF A;  4ME4 A;  3ZNT A;  1I2W A;  2WKQ A;  2JKR I;  5CGS A;  4ZDX A;  3B42 A;  4BMW A;  1TD5 A;  5GLC A;  2W1T A;  1AWI A;  2EFU A;  1F9I A;  5L09 A;  3EGX C;  3DBA A;  1EI5 A;  4GB7 A;  3LEQ A;  1SKO B;  2Y2L A;  3MQO A;  4IVK A;  3W4O A;  3IXH A;  1XFN A;  2HP6 A;  1S0W A;  5HW3 A;  3GSG A;  4MDZ A;  4S2O A;  1ACF A;  1DJC A;  4KZ3 A;  4C6Y A;  5BOH A;  2Y2K A;  2OWH A;  1SZV A;  4DJ3 A;  1LL5 A;  1CF0 A;  5GLB A;  1L0G A;  2O9A A;  4HOI A;  4S2N A;  3KSH A;  4I38 A;  5DFX A;  3IF6 B;  2V1Z A;  1BLP A;  3LIC A;  3MXS A;  1GSV A;  2DMW A;  3U2A A;  4GKU A;  3DTI A;  2PBD P;  2EA9 A;  3RXW A;  2PAV P;  3NOU C;  4XT2 B;  3C4O A;  1CJF A;  2JN7 A;  5G4Y A;  4P0M A;  2ZQA A;  1K4F A;  3F1O B;  4LV2 A;  4EER A;  3VP3 A;  3Q1F A;  4BWI A;  2VV7 A;  4JXV A;  3HUM A;  4CPK A;  4N92 A;  2HP5 A;  4KQQ A;  4FH2 A;  1OT9 A;  4I39 A;  2VA0 A;  4NG2 A;  1P9R A;  4EUV A;  3S7P A;  3G4P A;  4E3O A;  1Z09 A;  3OPL A;  2H10 A;  1FCN A;  2GZA A;  3IWI A;  2J3T C;  1FIL A;  1PI4 A;  3MF0 A;  2ACG A;  4WM9 A;  4Z1W A;  3Q7Z A;  4X6T A;  4HEF A;  3MZD A;  3NEC A;  4N9K A;  1VM1 A;  1NJ4 A;  3QP8 A;  2M7U A;  4PPR A;  2X71 A;  3OZH A;  3VP0 A;  1SCW A;  1ERM A;  4KZ7 A;  5FQQ A;  3VP4 A;  2O0Y A;  3ICY A;  5FAQ A;  2OV5 A;  1NZO A;  4JF5 A;  4AFI A;  4B4X A;  3H82 B;  2PT7 A;  3BFG A;  5CGX A;  1YPR A;  5DJT A;  1KE3 A;  4HJ6 A;  2V1A A;  1L0E A;  3WRZ A;  3SS5 A;  4OPQ A;  3LR5 A;  1IOU A;  3NUL A;  1N9N A;  4O0P A;  3UMD A;  1DJA A;  3RJU A;  2QHK A;  3PR6 A;  2XQZ A;  4RQ9 A;  3ZG5 A;  2W0N A;  3EGD C;  1SDN A;  4MBF A;  4ZJ3 A;  2WAE A;  4EEP A;  4IUK A;  4S2P A;  4M3K A;  3HLG A;  2ZD8 A;  4QU3 A;  4XXR A;  1W63 Q;  2PBY A;  2HJ9 C;  4OPY A;  4WMC A;  1XJ4 A;  4PM9 A;  4MNR A;  2WK0 A;  3UDX A;  5CEC A;  3QP2 A;  2WGW B;  3BW6 A;  1ZTU A;  2HV1 A;  3QHY A;  4EXO A;  2EWW A;  2Y55 A;  1STZ A;  2OWJ A;  4OQH A;  4KEN B;  4Y5F A;  4Y17 A;  2P9V A;  2JKT M;  3N8L A;  1DP6 A;  1FIK A;  3SH8 A;  3PTE A;  1SKF A;  2WKH A;  3EQV A;  2JKF A;  5EE8 A;  2VK3 A;  3PBO A;  5M1A A;  3BLS A;  2QJ7 A;  5HPI A;  2PD8 A;  3QNB A;  1TVF A;  5GHX A;  3L7H A;  2IWC A;  4KZ4 A;  3UNW A;  3VP1 A;  3LR0 A;  4JKT A;  3A3I A;  4IJG A;  3ZG0 A;  1BLC A;  1NXY A;  4GHI A;  5KMW A;  4X1M A;  4MBH A;  3LGO A;  4OQI A;  3H7W A;  1RP5 A;  3ZGA B;  3M6H A;  2QMI A;  2Y2I A;  3LIE A;  4JGP A;  3C7U A;  5DJU A;  1ODV A;  4K0W A;  3VOY A;  2C6W B;  4LPZ A;  4I5S A;  1TS8 A;  4HJ3 A;  3PYP A;  5FEG A;  4I3J A;  4P6Z M;  4ETZ A;  1ZC2 A;  1QME A;  4II7 A;  1Y4O A;  3Q81 A;  1NLY A;  2WYX A;  4N9L A;  1RGZ A;  4HQA A;  4RYE A;  3ZNY A;  2W3H A;  1OPX A;  2WKR A;  5EM1 A;  3HLF A;  1TDG A;  1GHP A;  1ONH A;  5CXW A;  5FAS A;  5J3W A;  4Y0U A;  3MZF A;  3BY9 A;  5CTN A;  3V67 A;  3BEB A;  1PZO A;  4S2I A;  1UGU A;  3DTK A;  1OTE A;  3TRC A;  3G32 A;  1ZG4 A;  1SKO A;  3UB7 A;  4NXB A;  4EU0 A;  3E4Q A;  4S2M A;  2VKS A;  2W3G A;  3WRT A;  1GSX A;  3P09 A;  3PXP A;  3T50 A;  4OPZ A;  4LRZ E;  1YLJ A;  4NK3 A;  1PYY A;  2DRW A;  3BM6 A;  2CMN A;  3LUQ A;  4P6B A;  4EQI A;  4Q0H A;  3FG8 A;  2B95 A;  3MFD A;  4MMN A;  1ESI A;  3GDI A;  3ITB A;  2VV8 A;  3UPP A;  3UB8 A;  3PAG A;  5E2H A;  1OJ5 A;  4CLC E;  5L07 A;  2K2N A;  3BY8 A;  4ZBE A;  5HAP A;  1W7F A;  1JTG A;  2QPN A;  4GD6 A;  3NI9 A;  4E04 A;  5HDD A;  4QPR A;  4O7D A;  5FA7 A;  3IF6 C;  3QP6 A;  1HD8 A;  2ZC3 B;  3P98 A;  3PBQ A;  2YKH A;  4EV4 A;  3LI9 A;  1LT0 A;  1BUE A;  3ZHH A;  3KYZ A;  4Y13 A;  2BAS A;  2HDR A;  3OPR A;  3I7J A;  1NRJ A;  4ESP A;  2VGL S;  3KYE A;  2O99 A;  1K57 A;  1ERQ A;  2XD5 A;  5CED A;  1DRM A;  4R1G A;  3KX0 X;  3IF5 A;  3R7W B;  2KLI A;  2IWD A;  1S67 L;  1MXO A;  3NOT C;  3O3V A;  4H8R A;  4PHT A;  5CER A;  3FZC A;  4RA7 A;  2EX8 A;  4GD8 A;  4KUO A;  4OQ0 A;  4F3L A;  1CEF A;  3MBZ A;  2ZLY A;  2HGV A;  4HIA A;  4R3A A;  3N6I A;  1FR1 A;  3VMA A;  2D01 A;  2BLS A;  4JGR A;  3OPP A;  1GCE A;  3QP1 A;  3O87 A;  3OCN A;  1TS0 A;  3V3R A;  1DP8 A;  1HZO A;  2Y2O A;  4NXE A;  4JGQ A;  5MC7 A;  2R9W A;  1FCM A;  3PAE A;  2UWX A;  4FTX A;  1P0Z A;  3H82 A;  5TJJ A;  4EQ1 A;  2H5S A;  2KX6 A;  4KG2 A;  4OP8 A;  4MEZ A;  2EXB A;  3C2W A;  1RGY A;  2WKI A;  1L3L A;  3LIA A;  4G3W A;  3BFD A;  1IKI A;  1JTD A;  5E2G A;  1YM1 A;  5E2E A;  2H28 A;  1N4O A;  1OME A;  4ZJ1 A;  4U0T A;  3LI8 A;  3N8R A;  2G7U A;  5FI7 A;  2OAQ 1;  1XA1 A;  3RFB A;  5F83 A;  5HAQ A;  3IHB A;  1VET B;  3B47 A;  4MCW A;  3NOP C;  2CC1 A;  2QKP A;  4JGO A;  2M7V A;  4M4X A;  3MS6 A;  2WGW A;  4ZRR A;  2V8C A;  2M1C A;  1MZU A;  4HNB A;  3CHW P;  4DDY A;  3C5A A;  2XDM A;  4E3I A;  4MLL A;  5AVE A;  3SS4 A;  3HLB A;  2A24 B;  1HVB A;  3IX8 A;  2WZX A;  5E43 A;  1TS7 A;  3A3F A;  2Y91 A;  3UDF A;  5DTK A;  4EBN A;  3QP5 A;  2V0W A;  4UAA A;  2ZMA A;  4KG6 A;  1VEU B;  4DDS A;  1XPB A;  5HSQ A;  5D3O A;  3E98 A;  5A91 A;  3IS2 A;  2XD1 A;  3Q7V B;  5F1G A;  1FOF A;  5EM0 A;  1G6O A;  3UME A;  3M2K A;  2Y2H A;  4QY5 A;  4BBV A;  1YAX A;  2VEA A;  3ZQ5 A;  3T1X A;  1E4D A;  1KDS A;  5TR7 A;  2Z6C A;  5DF9 A;  3V5M A;  2V8F A;  4S2N C;  1GA9 A;  3G31 A;  3UB6 A;  5F6A A;  2HDQ A;  3HBR A;  4IED A;  2Y59 A;  1IYS A;  2JKG A;  4CQH A;  4E3N A;  1YLT A;  2VJW A;  3T12 B;  2ZMV A;  1PWG A;  1ES4 A;  2XA7 M;  3SH7 A;  5DF8 A;  2FFY A;  2VV6 A;  4EBP A;  4BEN A;  2X01 A;  4F94 A;  3E4O A;  4ARZ B;  1O7E A;  1XJ2 A;  3OPH A;  1NWZ A;  2ZC4 B;  5J8X A;  5AVF A;  4BLM A;  1YLY A;  2PYR A;  4KZ9 A;  1T1B A;  4YNR A;  3T4Q A;  3OBF A;  5FQ9 A;  1MBL A;  3JVU A;  1ES3 A;  4BD1 A;  3G30 A;  1BLH A;  4ZTK A;  4F3L B;  5AQA A;  1FSW A;  3IXG A;  5DFY A;  3GQZ A;  3WS1 A;  1XGJ A;  1OJG A;  3WS2 A;  4DXC A;  3KYQ A;  3S4X A;  3O88 A;  1BLS A;  3LY4 A;  1S1Y A;  1EW0 A;  2GDN A;  3UE0 A;  3PHY A;  2ZOH A;  3BFF A;  1WA9 A;  5M18 A;  5C5K A;  4BBT A;  4DJ2 A;  5A8B A;  3SZT A;  1YMX A;  1MWU A;  3BYD A;  1K6R A;  2ZM2 A;  3S7N A;  2A49 A;  1K54 A;  4KUK A;  5TGF A;  3LY3 A;  4R23 A;  3UE3 A;  2P7J A;  5EVI D;  5FEF A;  5HL6 A;  1MC0 A;  3WS4 A;  1K54 C;  4BL3 A;  3BEC A;  3DW0 A;  1JWV A;  1KGF A;  2BTF P;  2XSS A;  1WE4 A;  4L9F A;  1ALQ A;  3LFV A;  4Y7P A;  3ZCZ A;  2PR5 A;  5E2F A;  2EX2 A;  5EOO A;  2XGN A;  4GW9 A;  3VSK A;  2Y2N A;  3BJN A;  1OT6 A;  4OVD A;  4UQI M;  2X02 A;  2ZQC A;  1IYO A;  2JCH A;  2LB9 A;  3BFE A;  4E3J A;  4K0X A;  3ISG A;  5FL3 A;  4GZB A;  2GJ3 A;  4GNU A;  1K56 A;  2Y2M A;  2J80 A;  4QD4 A;  3WS5 A;  3PBN A;  1P9W A;  4I3A A;  3ZDJ A;  2JKT I;  3R7W A;  4EES A;  4CLC A;  3AGD A;  1NYY A;  4BJP A;  3O86 A;  3FPW A;  3GR2 A;  5GLA A;  2PHY A;  4FH4 A;  1CI8 A;  4RX2 A;  4QB8 A;  4R6L A;  1BZA A;  3VV4 A;  1ESU A;  4X56 A;  2VX8 A;  2WUQ A;  4GS9 A;  5EOE A;  2Z2L B;  2ZOI A;  4BQM A;  1LL8 A;  5AQB A;  4D60 A;  3N7W A;  4JF4 A;  4MN5 A;  4WEK A;  1XA7 A;  3H9W A;  3KSG A;  4G3K A;  3G34 A;  4R38 A;  4EW7 A;  4I3I A;  1MKI A;  1GHM A;  1TF1 A;  3IXB A;  3HUO A;  2Y79 A;  5I5L A;  3T1S A;  1XP4 A;  3CJM A;  4BL2 A;  4HBU A;  1PWD A;  4DF6 A;  1ZKJ A;  4O01 A;  5KSC A;  4HH2 A;  3K3C A;  2GX5 A;  2XK1 A;  1KDW A;  4KZB A;  5IU1 A;  4GDB A;  3F1N B;  4R70 A;  3T4O A;  1E25 A;  3IS2 B;  3ITA A;  4WN5 A;  1IYQ A;  1PW1 A;  1J3W A;  1F5M A;  3M6B A;  4Z9Q A;  5K5B A;  3SOI A;  4R0Q A;  2B02 A;  5IS1 A;  4H6J B;  5G18 A;  1PRQ A;  4R3B A;  3CUE A;  3A0S A;  3UO9 A;  4HJ4 A;  4G3V A;  4KG5 A;  5CRF A;  1X0O A;  1XXM A;  3CUE C;  3EOI A;  2INW A;  4GJ4 A;  3DAV A;  5F82 A;  4KZ5 A;  2EX9 A;  1W5D A;  1ES5 A;  3MR0 A;  2FH5 A;  2XFS A;  2W3D A;  1VET A;  3QNC A;  1K38 A;  3VP2 A;  1NYM A;  5CHM A;  1T19 A;  3B33 A;  2J3W A;  3P7N A;  4UHU A;  3A0R A;  1MY8 A;  3A3J A;  4HP4 A;  4KQD A;  1TDL A;  1K6S A;  2J3T D;  5FQJ A;  1K25 A;  3NY4 A;  3SS3 A;  1ERO A;  3BLM A;  4HP9 A;  4JPM A;  2A24 A;  1E3U A;  2NUT C;  1MKM A;  2ZMF A;  5IHV A;  3P01 A;  1HLU P;  2Y2J A;  2Q9N A;  2QWS A;  1NY0 A;  2XRO A;  2YKF A;  5JYO A;  4KZ6 A;  5A92 A;  1VEU A;  4WZ5 A;  3IHA A;  1DY6 A;  1N9O A;  2EFX A;  4WYY A;  5L10 A;  1I2S A;  2W3E A;  1LI0 A;  5DKK A;  2D02 A;  3NJA A;  2B5R A;  4KQO A;  1M40 A;  4EET B;  3MSH A;  3Q7V A;  4JXS A;  3LR4 A;  5CHJ A;  3MFX A;  2PR6 A;  4HI4 A;  3B3X A;  3T4S A;  4LRX C;  4PM6 A;  4JXW A;  3LCE A;  3CZD A;  4QJG A;  4IUH A;  4WL9 A;  1OTD A;  1L2S A;  3DTE A;  2PD7 A;  2H0T A;  2IA2 A;  5EUA A;  4X1L A;  3LYX A;  5HDS A;  1Q2P A;  3U4L P;  4B93 A;  4Y0T A;  4QHC A;  2ZL1 B;  2FZ0 A;  3T4L A;  4ARZ A;  2Y4A A;  3OCL A;  2ZC5 B;  3JYI A;  3M2J A;  2ZC6 B;  4N1H A;  4WMC D;  1YKD A;  3CPT A;  4MBK A;  1K57 C;  4U0X A;  1V9Z A;  4DXB A;  1RCJ A;  4CLC B;  1YQS A;  3ZVW A;  1XJ3 A;  2V9A A;  4UEY A;  3T1R A;  1H3Q A;  3QP4 A;  1YSP A;  5A90 A;  3MKF A;  3UB5 P;  5LBR A;  2HPB A;  4C3Q A;  4GS9 B;  3W2Z A;  4RVA A;  3GV9 A;  5FI2 A;  2WKE A;  5G4Z A;  4FSF A;  3IXD A;  3T1Q B;  2V20 A;  3D9Y A;  3IX3 A;  3HCY A;  2J9O A;  3CAX A;  3UE6 A;  4NEE D;  1UWN X;  2L1M A;  5AQ7 A;  2EXA A;  4BD0 A;  5FAP A;  4OOM A;  4HES A;  4DE2 A;  3IWQ A;  1ONG A;  3L9K A;  4LFU A;  4X53 A;  1S4R A;  1L0F A;  4P6Z S;  3CI6 A;  2C5W B;  1FSY A;  1CEG A;  2H0Y A;  1T1A A;  5CX7 A;  3MKE A;  3VFF A;  1WYB A;  3VSL A;  4N1X A;  1ES2 A;  4HY8 A;  5EVE A;  3KSI A;  3LIB A;  4KQR A;  4ETX A;  1H0M A;  4DMZ A;  3MXR A;  4JXG A;  4D2O A;  3IX4 A;  3TJZ C;  2EX6 A;  1HTZ A;  3V50 A;  3HLW A;  1OTI A;  4OON A;  2HDU A;  2QZ6 A;  1YLP A;  4FOF A;  4E6X A;  1Y28 A;  2EWV A;  2WGV A;  2OOL A;  3S7Q A;  5HWW A;  3C4P A;  3ZG7 B;  3CLO A;  4Y15 A;  2VGK A;  1NZU A;  5DVA A;  3AGF A;  3DWK A;  2Z6D A;  4X55 A;  1KGE A;  4KZ8 A;  2PU4 A;  4IBX A;  2IWB A;  4U3T A;  4ZJ2 A;  5HD3 A;  1P97 A;  5EPH A;  1BSG A;  4UA7 A;  1IYP A;  1L0D A;  2VLG A;  1K55 A;  1YMS A;  1Q2Q A;  4NXF A;  3MQ0 A;  2E8J A;  3GEC A;  1K0K A;  1LL9 A;  4DE3 A;  1MWS A;  3C30 A;  4UA9 A;  4OH0 A;  3BQ8 A;  2JE5 A;  4UA6 A;  5DTS A;  4PKY G;  1N9L A;  2FFF B;  3K2N A;  2JBF A;  5L2F A;  1KGG A;  3CG5 A;  3ULF A;  2V0U A;  1LI9 A;  1J9M A;  5EEC A;  2G2U A;  1BYW A;  3G35 A;  3C38 A;  2Y8H A;  5GL9 A;  1T1C A;  3V3S A;  1W8Q A;  3PBR A;  5AJG A;  1AXB A;  3D4F A;  3F1N A;  3S1Y A;  3W8K A;  2JKR M;  3S22 A;  3NC8 A;  4YOF A;  5CEB A;  4Q8I A;  1LSW A;  2L4R A;  3UY6 A;  2BG1 A;  5F68 A;  3FYZ A;  3IH8 A;  4A5R A;  2XFT A;  2PYP A;  5TBM A;  3IWO A;  4X25 A;  1KVL A;  4OQG A;  4Y2F A;  1F2K A;  2QYB A;  1N9B A;  4H6J A;  1BTL A;  3SW1 A;  3IBJ A;  1G6A A;  5DKL A;  2Q9M A;  3MZE A;  3RTY A;  4LCM A;  4IHQ A;  1FQG A;  2AVX A;  4DE0 A;  3EWK A;  1H5X A;  1S66 L;  3K3D A;  2ZBB A;  2JC7 A;  3IBR A;  4HBT A;  1Z6F A;  3A3E A;  5M19 A;  1W63 M;  3ZG8 B;  4E6W A;  3CPT B;  4YIN A;  2Y2Q A;  4L0L A;  4XUX A;  1LSV A;  1PI5 A;  3WS0 A;  2HP9 A;  4GLQ A;  1GHI A;  2ZC7 A;  3VOL A;  1UWP X;  5U47 A;  3E2K A;  5CGW A;  3PBS A;  3WWX A;  1YT4 A;  1XJ6 A;  2WZZ A;  4B88 A;  1D06 A;  1S6R A;  4WBG A;  4PM5 A;  5FDH A;  1W79 A;  5FAO A;  3A3D A;  3RH8 B;  4WF0 A;  3EEA A;  4WLA A;  2VGJ A;  2O9B A;  1G5U A;  1LSX A;  4MN6 A;  4OKP A;  4KZA A;  3HLC A;  3Q82 A;  1TS6 A;  4WEL A;  3D72 A;  5CTM A;  3R4K A;  4P87 A;  1CI9 A;  2W27 A;  3W4P A;  4YWZ A;  2XEP A;  4JBF A;  2OLU A;  2XR0 A;  4LLO B;  2J8Y A;  4S2L A;  1D7E A;  2K7S A;  4GOG A;  2E8I A;  1V9Y A;  3VE3 A;  3GRJ A;  5HWV A;  2P08 A;  3DTM A;  1FR6 A;  3IH9 A;  1YSQ A;  1NLZ A;  2DCF A;  4L9G A;  1JVJ A;  3HJI A;  5IT5 A;  2XH9 A;  3JVV A;  2HZ5 A;  3PBT A;  2ZQ8 A;  1M6K A;  5FSR A;  2ZL1 A;  3NDG A;  3ZVT A;  1OTA A;  2A3U A;  3GMW A;  3N4I A;  2OAP 1;  3G6O A;  5EVI B;  4PAU A;  2HDS A;  2L0W A;  4JLF A;  5HZH A;  5J4E A;  5EV0 A;  3ZYT A;  2XRN A;  3MQQ A;  4JF6 A;  5CHU A;  3C7V A;  3HUN A;  2LB5 A;  1H8Y A;  4FUW A;  5DF7 A;  2W1R A;  4HH3 A;  2UV0 E;  3F1P A;  5KSH A;  4CLC C;  3VE4 A;  4ID4 A;  3ZG9 B;  3V39 A;  3LID A;  2QJ5 A;  4OOL A;  1ZG6 A;  3E0Y A;  1S1Z A;  3FKV A;  1KOU A;  3FC7 A;  2ZQD A;  3FPV A;  1CQA A;  2MJ6 A;  4NXG A;  1Y54 A;  1U60 A;  1XFQ A;  4FD8 A;  4DRT A;  5GLD A;  3IT9 A;  1A0K A;  1VB6 A;  2W1T B;  3HL9 A;  2ZM8 A;  2VZW A;  2VGL M;  4PKY A;  1SDE A;  4R3J A;  2RCX A;  3NIA A;  2KDK A;  2WAD A;  3UDI A;  3HLE A;  3CIT A;  4DN0 A;  1PIO A;  2NUP C;  1JWP A;  2XA7 S;  2O9C A;  5HX9 A;  1KE0 A;  3OLO A;  4NET A;  3OOV A;  2GNX A;  2ZQ7 A;  1EWZ A;  1OTB A;  4E3L A;  3CMZ A;  5TBM B;  3JPU A;  4X68 A;  3G2Z A;  2OSU A;  1H8M A;  3TG9 A;  4R4R A;  4Y0O A;  5FQI A;  3MXQ A;  4S2J A;  1IEL A;  5JYP A;  3A0V A;  1YLZ A;  4HHD A;  1FCO A;  4EUZ A;  2Y2P A;  3TE8 A;  3TSG A;  5FAT A;  5FI6 A;  3S7O A;  5KIZ A;  4E3K A;  2V2F F;  3GVB A;  3NDE A;  4LV1 A;  1DP9 A;  3KO6 A;  3FV7 A;  4P85 A;  3AGE A;  2R78 A;  4Q0I A;  3EEH A;  1VQQ A;  4OPR A;  4IVI A;  4R4S A;  4K08 A;  1QMF A;  5FQM A;  1IEM A;  5J7E A;  4K91 A;  1MWT A;  2Q0O A;  3NCK A;  3MMH A;  3T4T A;  5F5Y A;  3HJK A;  2Y2G A;  1BUL A;  1PWC A;  1JWZ A;  1W8Y A;  3HVF A;  3G2Y A;  1SHV A;  4ZAM A;  2ZJ9 A;  4PMA A;  2KOI A;  4LV0 A;  5HFO A;  2K31 A;  1G68 A;  3T4J A;  1I5Q A;  3CWF A;  2ZQ9 A;  4WZ5 C;  4B4Z A;  4UQI S;  5HDC A;  2J7V A;  3C8C A;  4NKP A;  5HAR A;  4Y3I A;  3E2L A;  4OLG A;  3UPO A;  4FCF A;  1KE4 A;  3D3O A;  4PM8 A;  1PFL A;  1H8Z A;  2WAF A;  1PZP A;  4OOY A;  4O8G A;  3UN7 A;  1MPL A;  5F69 A;  2A2L A;  4Q0J A;  1NRF A;  3ZFZ A;  3TOI A;  1LHY A;  4LEN A;  3BFC A;  4DE1 A;  4GDN A;  2OLV A;  1BT5 A;  1K56 D;  2R9X A;  4L9E A;  3IF6 A;  5I94 A;  4MN7 A;  5EVL A;  5GHZ A;  2DNS A;  1LLB A;  3HRE A;  4CLC D;  1XKZ A;  4BBU A;  3UPN A;  3LR3 A;  5HL1 A;  4EEU A;  4XT2 A;  2PRF A;  3W4Q A;  2ZM0 A;  4QY6 A;  4IBR A;  2P04 A;  5FDS A;  5DTT A;  1T18 A;  3NHQ A;  2HJE A;  5AQ9 A;  3UE1 A;  5FQK A;  2RL3 A;  3F1P B;  2PDR A;  2P74 A;  3F1O A;  3NBL A;  1F98 A;  4C75 A;  4GN2 A;  3SH9 A;  1G28 A;  1VHM A;  1JNU A;  4EBL A;  1TEM A;  4LCL A;  5HWT A;  4WEJ A;  1MWR A;  1WYC A;  3Q07 A;  3HLD A;  3RXX A;  4X69 A;  4EWF A;  2XLN A;  2G2W A;  3MJQ A;  2PU2 A;  5TFQ A;  3T4K A; 
#chains in the Genus database with same CATH homology
 3EQU A;  5F68 A;  2W3H A;  1OPX A;  2WKR A;  4GW9 A;  3BJN A;  1OT6 A;  4UQI M;  2PYP A;  5TBM A;  2LB9 A;  4Y2F A;  2QYB A;  5J3W A;  3BWL A;  2B18 A;  5FL3 A;  3BY9 A;  4H6J A;  3V67 A;  2GJ3 A;  3SW1 A;  3IBJ A;  1UGU A;  1OTE A;  2J80 A;  5DKL A;  1GSW A;  3RTY A;  2JHE A;  3TRC A;  3PBN A;  5EFW A;  4IHQ A;  1P9W A;  2I9V A;  4I3A A;  3UB7 A;  2JKT I;  3R7W A;  4EES A;  1IFQ A;  4NXB A;  4CLC A;  5HD5 A;  3E4Q A;  4EU0 A;  1S4S A;  2VKS A;  3EWK A;  2W3G A;  1S66 L;  3K3D A;  2WKP A;  1GSX A;  3PXP A;  3T50 A;  2W3F A;  4BJP A;  3FPW A;  2ZBB A;  2PHY A;  4LRZ E;  3IBR A;  2CMN A;  4R6L A;  3LUQ A;  3VV4 A;  2VX8 A;  4Q0H A;  3FG8 A;  4GS9 A;  4GCZ A;  4GHI B;  2ZOI A;  3OC2 A;  1W63 M;  1LL8 A;  3LIF A;  4MN5 A;  3H7W B;  4L0L A;  4WEK A;  3H9W A;  5L8M A;  5HPF A;  4MMN A;  3KSG A;  1LSV A;  3GDI A;  3E4P A;  2V1B A;  4G3K A;  2VV8 A;  3BQA A;  4GLQ A;  3UB8 A;  4WUJ A;  2HF6 A;  4R38 A;  3TW8 A;  3VOL A;  4EW7 A;  4CLC E;  1OJ5 A;  4I3I A;  1UWP X;  1TF1 A;  5I5L A;  2K2N A;  2Y79 A;  3BY8 A;  4O01 A;  4LRY C;  1ZHH B;  4HH2 A;  3K3C A;  3PBS A;  2GX5 A;  4E04 A;  1XJ6 A;  5IU1 A;  1D06 A;  5HDD A;  3F1N B;  4QPR A;  4R70 A;  3T4O A;  3IS2 B;  3PBQ A;  3RH8 B;  4B9O A;  3UB9 A;  4WF0 A;  3EEA A;  2YKH A;  4WLA A;  2O9B A;  1LSX A;  3LI9 A;  3O5Y A;  1LT0 A;  4MN6 A;  4WN5 A;  3KYZ A;  2BAS A;  3KSF A;  1F5M A;  1NRJ A;  1TS6 A;  4WEL A;  3D72 A;  4ME4 A;  5K5B A;  2WKQ A;  2VGL S;  2JKR I;  2B02 A;  3R4K A;  5IS1 A;  3B42 A;  4BMW A;  2O99 A;  2W27 A;  4H6J B;  1TD5 A;  4YWZ A;  1DRM A;  2W1T A;  3KX0 X;  3CUE A;  1F9I A;  4LLO B;  3EGX C;  3A0S A;  3DBA A;  1D7E A;  4HJ4 A;  2K7S A;  4G3V A;  1V9Y A;  3MQO A;  1X0O A;  3R7W B;  3VE3 A;  3CUE C;  3EOI A;  2INW A;  2KLI A;  4GJ4 A;  2P08 A;  5HWV A;  1S67 L;  3NOT C;  1YSQ A;  1NLZ A;  4L9G A;  3HJI A;  3MR0 A;  4PHT A;  1XFN A;  2FH5 A;  5IT5 A;  3JVV A;  2W3D A;  4KUO A;  4F3L A;  4MDZ A;  3PBT A;  1T19 A;  3B33 A;  2J3W A;  3P7N A;  2HGV A;  4HIA A;  3A0R A;  4R3A A;  1OTA A;  2OAP 1;  3G6O A;  4HP4 A;  2OWH A;  4KQD A;  4PAU A;  2L0W A;  4DJ3 A;  5HZH A;  2D01 A;  2J3T D;  5J4E A;  4JGR A;  3ZYT A;  2XRN A;  3MQQ A;  4HP9 A;  3OCN A;  2LB5 A;  2O9A A;  4HOI A;  1TS0 A;  3KSH A;  2A24 A;  2NUT C;  4I38 A;  5DFX A;  1DP8 A;  1MKM A;  2W1R A;  4HH3 A;  2ZMF A;  4NXE A;  3F1P A;  5KSH A;  3P01 A;  4CLC C;  4JGQ A;  5MC7 A;  3VE4 A;  3LIC A;  1GSV A;  2DMW A;  3U2A A;  2QWS A;  2XRO A;  2YKF A;  2EA9 A;  3LID A;  1P0Z A;  3H82 A;  1N9O A;  2QJ5 A;  4OOL A;  2W3E A;  3NOU C;  4XT2 B;  5TJJ A;  3E0Y A;  5DKK A;  4EQ1 A;  1S1Z A;  2D02 A;  3NJA A;  4KQO A;  1KOU A;  2JN7 A;  2KX6 A;  3FC7 A;  3FPV A;  5G4Y A;  4EET B;  2MJ6 A;  3LR4 A;  4NXG A;  3C2W A;  1XFQ A;  3MFX A;  2PR6 A;  4HI4 A;  1VB6 A;  3F1O B;  3LIA A;  4G3W A;  2W1T B;  3T4S A;  4LRX C;  2VZW A;  2VGL M;  4EER A;  4PKY A;  4IUH A;  4BWI A;  2VV7 A;  2H28 A;  4WL9 A;  2KDK A;  1OTD A;  3CIT A;  2PD7 A;  3LI8 A;  2IA2 A;  2G7U A;  4DN0 A;  1OT9 A;  4I39 A;  2NUP C;  2XA7 S;  2O9C A;  2VA0 A;  2OAQ 1;  3OLO A;  3RFB A;  1P9R A;  3LYX A;  4EUV A;  3S7P A;  5HDS A;  3OOV A;  2GNX A;  3B47 A;  1OTB A;  4MCW A;  5TBM B;  4B93 A;  3NOP C;  2QKP A;  4JGO A;  2M7V A;  4M4X A;  2GZA A;  1H8M A;  4ZRR A;  2FZ0 A;  3MXQ A;  3T4L A;  2J3T C;  4ARZ A;  2M1C A;  1MZU A;  4HNB A;  3OCL A;  3MF0 A;  4Z1W A;  3A0V A;  1YKD A;  1V9Z A;  2M7U A;  5AVE A;  4CLC B;  4HHD A;  2A24 B;  3TE8 A;  3S7O A;  1XJ3 A;  5KIZ A;  2V9A A;  4UEY A;  1TS7 A;  1H3Q A;  2O0Y A;  1YSP A;  3ICY A;  5LBR A;  4AFI A;  1DP9 A;  3KO6 A;  2V0W A;  4GS9 B;  3W2Z A;  2R78 A;  3H82 B;  4Q0I A;  2PT7 A;  3EEH A;  5HSQ A;  5DJT A;  4HJ6 A;  5G4Z A;  3E98 A;  4FSF A;  3IS2 A;  2V1A A;  4K08 A;  3UME A;  1G6O A;  3LR5 A;  3HCY A;  5J7E A;  3CAX A;  3UE6 A;  4NEE D;  1UWN X;  2L1M A;  1IOU A;  1N9N A;  4BBV A;  1YAX A;  2VEA A;  4O0P A;  3ZQ5 A;  4OOM A;  3UMD A;  3MMH A;  3T4T A;  5F5Y A;  3HJK A;  1S4R A;  3CI6 A;  2Z6C A;  4P6Z S;  2QHK A;  3PR6 A;  4RQ9 A;  5DF9 A;  1T1A A;  5CX7 A;  2W0N A;  3EGD C;  3UB6 A;  4EEP A;  4HY8 A;  5F6A A;  4IUK A;  2KOI A;  3KSI A;  3LIB A;  4CQH A;  2K31 A;  4ETX A;  1W63 Q;  2VJW A;  3T4J A;  4DMZ A;  3CWF A;  2ZMV A;  2HJ9 C;  2XA7 M;  3TJZ C;  2VV6 A;  4UQI S;  5HDC A;  1XJ4 A;  3C8C A;  4NKP A;  1OTI A;  4FOF A;  4Y3I A;  1Y28 A;  2EWV A;  2OOL A;  3S7Q A;  3E4O A;  4ARZ B;  1XJ2 A;  3BW6 A;  1ZTU A;  2HV1 A;  5HWW A;  1NWZ A;  4EXO A;  2EWW A;  1STZ A;  3D3O A;  2OWJ A;  3CLO A;  5AVF A;  4Y5F A;  2JKT M;  2PYR A;  1T1B A;  1DP6 A;  4YNR A;  4O8G A;  3T4Q A;  2Z6D A;  3OBF A;  5F69 A;  2A2L A;  3JVU A;  4Q0J A;  3EQV A;  5HD3 A;  1P97 A;  4F3L B;  3PBO A;  2QJ7 A;  5HPI A;  5DFY A;  4L9E A;  2PD8 A;  4MN7 A;  2VLG A;  1OJG A;  3KYQ A;  4NXF A;  3MQ0 A;  4CLC D;  3GEC A;  3LR0 A;  4IJG A;  4BBU A;  1S1Y A;  3C30 A;  1EW0 A;  4GHI A;  3PHY A;  2ZOH A;  3LR3 A;  1WA9 A;  4EEU A;  5C5K A;  4BBT A;  4XT2 A;  4DJ2 A;  3BQ8 A;  5A8B A;  3H7W A;  4PKY G;  1N9L A;  3LIE A;  2P04 A;  4JGP A;  3S7N A;  1T18 A;  3K2N A;  3NHQ A;  2HJE A;  5DJU A;  1ODV A;  4KUK A;  3F1P B;  3ULF A;  2V0U A;  4LPZ A;  3UE3 A;  2PDR A;  2P7J A;  4I5S A;  1TS8 A;  3F1O A;  1F98 A;  5HL6 A;  1MC0 A;  4HJ3 A;  3PYP A;  1BYW A;  3C38 A;  4I3J A;  4P6Z M;  2Y8H A;  4ETZ A;  1G28 A;  1JNU A;  1VHM A;  1T1C A;  2XSS A;  5HWT A;  4WEJ A;  3PBR A;  4L9F A;  5AJG A;  3LFV A;  3F1N A;  4II7 A;  2PR5 A;  1NLY A;  2JKR M;  4HQA A;  3MJQ A;  4YOF A;  1LSW A;  2L4R A;  3T4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...