3UB8A

Periplasmic portion of the helicobacter pylori chemoreceptor tlpb with formamide bound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
157
structure length
157
Chain Sequence
b'MEHLETGQYKKREKTLAYMTKILEQGIHEYYKSFDNDTARKMALDYFKRINDDKGMIYMVVVDKNGVVLFDPVNPKTVGQSGLDAQSVDGVYYVRGYLEAAKKGGGYTYYKMPKYDGGVPEKKFAYSHYDEVSQMVIAATSYYTDINTENKAIKEGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chemoreceptor TlpB
publication title Structure and proposed mechanism for the pH-sensing Helicobacter pylori chemoreceptor TlpB.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Membrane protein
total genus 54
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17200 sCache_2 Single Cache domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ub8A00
4XT2A 5A8BA 3MJQA 4LRYC 2VV6A 3MQQA 4RQ9A 5TBMB 2WKRA 4GS9A 5G4YA 4EW7A 4JGOA 1T1CA 1TS8A 3VE3A 4R70A 4NXBA 1XJ3A 5HSQA 2L1MA 5HDSA 5HD5A 5F69A 3LIDA 4HJ4A 3A0RA 3IBRA 1TS7A 2D02A 2V0WA 2QJ7A 3HJKA 5AVEA 1GSVA 1S1YA 3LICA 2PDRA 1VB6A 4XT2B 3CAXA 3P7NA 5HD3A 3IS2A 5IU1A 4NXGA 2INWA 4BBTA 1F9IA 4R38A 4GS9B 2H28A 3OLOA 2V9AA 4R3AA 3SW1A 3NOTC 3F1PA 2JN7A 3K3DA 3H7WA 4EETB 2CMNA 4HI4A 3C8CA 3RTYA 1TS6A 3FG8A 1N9LA 1JNUA 3A0VA 1OTDA 4I3IA 1UWPX 1LL8A 3IS2B 4GHIB 4PKYG 3LI8A 3UB8A 4HP9A 4L9GA 1OTAA 2VV8A 3UMEA 1UGUA 5HDDA 2V0UA 4BBUA 4K08A 2PR5A 2PHYA 4I38A 1D7EA 1LT0A 3NHQA 1EW0A 4I3AA 1MZUA 4I3JA 3ZQ5A 4EERA 1X0OA 3F1OA 3H7WB 2K7SA 4DJ2A 2EA9A 1OTEA 4R6LA 3KX0X 3BY8A 4EEUA 1V9YA 1TS0A 5KIZA 4HNBA 2I9VA 1BYWA 2M1CA 1XFQA 4H6JA 2OWHA 4LLOB 1DP8A 3MXQA 4HOIA 4HH2A 5HWTA 1S4SA 2V1AA 1OT9A 2Z6CA 1D06A 3EEHA 3PYPA 1WA9A 3F1OB 2OWJA 1OJ5A 3GECA 4L9FA 5HDCA 2OOLA 1KOUA 4HY8A 1V9ZA 2PD7A 4DJ3A 3C2WA 2VV7A 1P97A 2J80A 2WKQA 1LSVA 4LPZA 4NXFA 4H6JB 5F5YA 2L0WA 2KX6A 3RH8B 3LI9A 1S1ZA 3G6OA 2B02A 1OT6A 2A24A 3MR0A 4EXOA 4HHDA 2QJ5A 3LIAA 2W27A 3BWLA 3MFXA 3UB6A 2L4RA 1XJ4A 3ICYA 4PKYA 3E4OA 4MN6A 1OTIA 2QHKA 4I39A 2BASA 2V1BA 4WL9A 3A0SA 1S4RA 3B33A 4LRXC 1GSXA 3VE4A 2R78A 4EQ1A 3LUQA 5I5LA 3UB9A 3NOUC 4WLAA 3GDIA 4EEPA 1XFNA 3CWFA 2ZOIA 5TBMA 4WN5A 2ZBBA 1N9NA 3BY9A 3F1PB 4HJ3A 2PYRA 5HWWA 2VEAA 4JGPA 5F6AA 4GCZA 1T19A 2WKPA 2PR6A 2D01A 4E04A 5HZHA 3E4QA 4F3LA 2KDKA 3NOPC 1LSXA 4NXEA 1DRMA 4JGRA 4I5SA 1OJGA 3ULFA 3PHYA 3CLOA 4WUJA 3LIBA 5HWVA 4HH3A 3H82A 5DJTA 2P7JA 2QWSA 3T50A 1N9OA 4HIAA 5IS1A 4GW9A 3EWKA 1NWZA 1T1BA 1P0ZA 3E4PA 4F3LB 2PD8A 3UE6A 2GJ3A 3F1NA 2JHEA 4L9EA 2Z6DA 3UMDA 4EESA 3LIFA 1S67L 4GHIA 4HJ6A 1GSWA 5J4EA 3K3CA 3LYXA 4HP4A 1T1AA 5DJUA 3D72A 4B9OA 5DKLA 3UB7A 1S66L 2PYPA 5DKKA 3H82B 2ZOHA 1G28A 1DP9A 4HQAA 3H9WA 4MN5A 4KQDA 5G4ZA 4BBVA 1Y28A 2YKFA 5AVFA 3HJIA 4WF0A 1DP6A 1XJ6A 1XJ2A 3F1NB 4YWZA 1ODVA 3MQOA 2HV1A 1OTBA 1UWNX 2VLGA 2QKPA 4KUKA 1F98A 2A24B 4KUOA 5J3WA 3LIEA 1T18A 2YKHA 5F68A 1LSWA 3FC7A 2W0NA 5EFWA 4JGQA 4LRZE 4M4XA 5J7EA 3NJAA 3VOLA
chains in the Genus database with same CATH superfamily
1IOUA 1AXBA 2ZQDA 2KLIA 1NRFA 5A8BA 5EPHA 5F83A 4NK3A 2XLNA 2VJWA 3MZEA 5EVLA 3FKVA 2JKFA 4NETA 3M2JA 4GNUA 3LEZA 3NIAA 3GQZA 4GB7A 2ZM2A 4QJGA 4E3KA 1TDLA 4OQGA 5F69A 3HUOA 3JPUA 2ZQ8A 4Q0HA 5GHYA 1TS7A 1SKFA 3HJKA 3LICA 2R9WA 1YLTA 3L7HA 4UQIM 3Q7ZA 4R38A 4OP8A 1W7FA 4IVKA 1KVLA 3P01A 5FAPA 1YLWA 4S2MA 4UAAA 4OQHA 2HF6A 3VP3A 1ERMA 1MY8A 2Q0OA 4JF4A 1KGGA 3N4IA 4GLQA 3BQ8A 4QHCA 3DW0A 3NOTC 3B42A 2A49A 4KG2A 4WMCD 4ARZA 4EETB 2X01A 5IT5A 3S4XA 2Y2MA 4HI4A 1J9MA 4A5RA 1MWSA 5CGWA 1YMXA 1K55C 4WYYA 3RTYA 3FG8A 1JNUA 3N8RA 1PI5A 1N9BA 3T1RA 5A91A 1PI4A 4GHIB 5U47A 1PIOA 2HPBA 5BOHA 3HLCA 4WELA 3IT9A 3BECA 4HP9A 4QB8A 4PMAA 3O88A 1OTAA 2VV8A 5EECA 3TE8A 2MJ6A 1E4DA 4B93A 1L2SA 2PHYA 1W63M 2DCFA 4EERA 2WGWA 2XGNA 3F1OA 5FQMA 3H7WB 5F1FA 1I2WA 3NI9A 3FPWA 1IYQA 3KYEA 4R6LA 3BY8A 5TR7A 4R23A 5EOOA 3IX8A 4WM9A 5HAPA 1SCWA 1BYWA 4CPKA 1YMSA 4JXVA 3NDGA 4OOYA 3PBQA 1FR1A 4HOIA 4CLCA 1HZOA 3FYZA 3BEBA 3SOIA 3DWZA 1S4SA 4MBHA 2ZQ9A 2VX8A 4HBTA 3NDEA 1FSYA 4XXRA 3EEHA 1MXOA 3PYPA 2ZQAA 1KDSA 5FQJA 2XF3A 5A90A 5AQ7A 4PM8A 3GECA 5E2FA 5HDCA 3IXDA 5FI6A 4HY8A 2PD7A 4DJ3A 4S2JA 3C2WA 2VV7A 2J80A 4LV3A 3GV9A 2E8IA 3JVVA 2FFFB 3C5AA 1LI9A 4LPZA 2J3WA 4H6JB 2L0WA 3G2YA 4N1HA 1S1ZA 3ZFZA 3T4TA 4HHDA 2GNXA 5FEFA 3IQAA 1XJ4A 1GHIA 3UDFA 2XA7S 4MN6A 1MPLA 5EVID 2UWXA 3HLGA 4WL9A 1LLBA 1S4RA 2GDNA 4P6BA 1K57A 3MQ0A 1K38A 3DAVA 4R4SA 3BFGA 3OPRA 3GDIA 1XFNA 4IBRA 1KE3A 1K4EA 5J8XA 1AWIA 2W1TB 3ZHHA 3F1PB 2ACGA 1K55A 2ZC3B 3RFBA 1FQGA 5CGXA 3UE0A 5HWWA 3ZVTA 4GCZA 2WAEA 3Q7VB 2D01A 1NRJA 1YKDA 5FI2A 2VGKA 1ZG6A 1FCNA 1LSXA 1JWPA 4D60A 2JBFA 3MZFA 3S22A 3LEQA 3T4QA 1DRMA 3VP2A 4FH4A 5EVIB 1A0KA 3IH9A 4OPYA 1IKIA 4E3NA 4R3JA 5DFYA 2K31A 3LIBA 5F1GA 3S7NA 3C4PA 4HH3A 5GL9A 2P7JA 4Y7PA 5IS1A 5M19A 3SS3A 5EVEA 1MWUA 1T1BA 2P74A 4LFUA 4NEED 4F3LB 4R1GA 4E3MA 2O9AA 3QP6A 3W4OA 3UE6A 2HP5A 1XA7A 3F1NA 2JHEA 4L9EA 1FSWA 2ZMVA 4UEYA 5FDHA 3UPPA 5CX7A 4GHIA 4UA7A 1IKGA 5J4EA 1HVBA 3K3CA 5FQ9A 3LYXA 3S7PA 1T1AA 4PHTA 4CLCE 4B9OA 4EUZA 5EOEA 3IWQA 3ZYTA 2PBYA 2PYPA 3UNWA 3H82B 2ZOHA 3A3FA 3MXRA 4ESPA 4GOGA 5AQ9A 3EEAA 2WGIA 4KQDA 4BJPA 4H8RA 4WBGA 3Q81A 3WS4A 1ACFA 4KZBA 1Y28A 5AVFA 3E0YA 4WF0A 1DP6A 1XJ6A 2O9BA 1XJ2A 2WKEA 4YWZA 2VGJA 3V5MA 2G2WA 4WMCA 2VK3A 2M7UA 4X1MA 1UWNX 1ZHHB 1G68A 4KUOA 1GHPA 2ZQ7A 3IX4A 4LCLA 4LGWA 1PW8A 1ES4A 1I2SA 4P6ZS 5A93A 2J7VA 2J3TD 5EFWA 4M4XA 3UO9A 1FR6A 5J7EA 3SH9A 3VOLA 2DRWA 1MBLA 3QP5A 4S2NC 1BLPA 3EQUA 3DTMA 4GN2A 2J9OA 4XUZA 4MLLA 3MJQA 4WEJA 5EM0A 2VV6A 1YM1A 1MKIA 4IUKA 1DJBA 5HAIA 1T1CA 3MF0A 5L07A 4OVDA 3RJUA 4OPZA 3U2AA 4IUHA 1BUEA 3E98A 3EQVA 3FZCA 4MDZA 1ZC2A 4OONA 3MXSA 2D02A 3W4PA 2QJ7A 1XKZA 1S1YA 1M40A 2Y59A 2PDRA 1VB6A 5FAOA 3IHBA 3IHAA 4XT2B 3UE1A 3MZDA 1KE4A 4O8GA 3WWXA 3P7NA 2VGLM 3IS2A 5IU1A 4NXGA 4DDSA 4BBTA 1F9IA 1W79A 3QNBA 4Y15A 4N1XA 3CPTB 4GS9B 5KSHA 2H28A 2XD1A 2V9AA 4IBXA 2W1TA 5DTTA 3F1PA 4FD8A 1XP4A 2JN7A 4UQIS 3UPOA 1QMFA 3W2ZA 4BL3A 5GHXA 4KQOA 2CMNA 1PNEA 4OP5A 1BTLA 2H0TA 3C8CA 1TS6A 3IH8A 3Q7VA 2RL3A 1OTDA 3IXHA 1W8YA 4I3IA 1UWPX 3E2LA 1SDEA 4PKYG 3T4SA 3UB8A 3N7WA 3Q82A 3LFVA 5HDDA 2V0UA 4JPMA 3OPHA 4JLFA 2J3TC 4CLCC 4I38A 4KZ3A 1LT0A 1EW0A 4I3JA 4LV2A 3K2NA 4KG6A 4RVAA 3UN7A 4N9KA 4KENB 2WUQA 4MCWA 1Y4OA 3D9YA 4ZJ3A 3M2KA 3BRMA 2XH9A 3UDXA 4EU0A 4RA7A 2XDMA 1Z09A 5FASA 1XFQA 3Q1FA 3A3IA 4ZDXA 3LR0A 3C7VA 2JKTM 2ZM8A 5FQQA 2OWHA 3DTIA 4EBLA 1N4OA 1W8QA 2V1AA 1OT9A 3TSGA 4S2NA 2Z6CA 4KZ8A 2JKTI 3EGXC 4KZ4A 3BLSA 1WA9A 2OWJA 1OJ5A 3LY3A 5JYPA 3HLBA 3T4JA 1GHMA 1KOUA 3R4KA 1V9ZA 4BL2A 3G30A 2JKRM 1EI5A 2BLSA 1G6AA 1WYBA 4ETZA 1K57C 2WKQA 1TEMA 4U0XA 5DTKA 2ZC6B 1YPRA 5K5BA 4BD0A 2JKRI 2P04A 4Y0TA 3O5YA 2O0YA 4E3OA 4R3BA 5M1AA 4EXOA 1DY6A 4UA6A 2W27A 5TFQA 2WKHA 3ICYA 4PKYA 4DN0A 2QHKA 2BASA 2V1BA 4OOMA 3MKEA 1LL5A 4BD1A 4DF6A 1H5XA 3ZG5A 5G18A 2Y2KA 3PBTA 3QP8A 3FV7A 3UB9A 4PM6A 1K54C 1JWZA 4OKPA 3CWFA 2C5WB 1BZAA 1Q2PA 2G2UA 4JKTA 3SS4A 3QHYA 3BY9A 4LV1A 3HUNA 4HJ3A 2PYRA 1DJCA 1PYYA 4RX3A 4ZJ1A 2PBDP 1M6KA 3HL9A 3OPLA 4E6WA 5E2GA 5FAQA 2VEAA 2WKPA 1RGZA 2PR6A 1PW1A 2O99A 2KOIA 3NBLA 4E3IA 5HZHA 5DF9A 3ZNYA 2LB9A 3MMHA 5CEBA 1KGFA 4LENA 3TOIA 4NXEA 4N9LA 4KZAA 4DRTA 5FEGA 4JXWA 3CPTA 1GA9A 3ULFA 4EBNA 1ESIA 1Y54A 3T4LA 4DKIA 4YNRA 4WUJA 4FTXA 4GKUA 1STZA 4ME4A 1L0EA 4Y0OA 1FOFA 3T50A 4HIAA 1XA1A 2DMWA 4X1LA 3GR2A 2EX8A 2ZJ9A 3CG5A 1P0ZA 2B5RA 1MC0A 3E4PA 2Q9NA 3NY4A 5CTNA 4P85A 4DMZA 5CXWA 2NUTC 2ZLYA 5F82A 3OPPA 1SHVA 4LV0A 2GJ3A 3PAEA 4OH0A 3VOZA 1S67L 2J9PA 4HP4A 1C3BA 2BG1A 3D72A 2W3DA 2XFTA 5DKKA 3PBNA 3CJMA 2H0YA 5IHVA 4E3LA 4CQHA 3BJNA 4MNRA 1DP9A 3IF6B 4HQAA 1ESUA 2W3EA 3OCNA 5HARA 5G4ZA 3DTKA 3KO6A 4BBVA 3C7UA 1TDGA 2Y2IA 3PBRA 5FA7A 2YKFA 3QP1A 1W5DA 4ZTKA 3EOIA 4K0WA 5KMWA 3UE3A 1E3UD 3KYZA 2HV1A 2V8CA 2ZQCA 4KUKA 2A24B 4K91A 2P9VB 5J3WA 3N6IA 3G2ZA 1NXYA 3UPNA 2YKHA 5EE8A 1KVMA 1CEFA 1LSWA 2V1ZA 4OPQA 5HPIA 4QY5A 1NLZA 3HCYA 2VKSA 2EXBA 4HBUA 4BMWA 3AGEA 1BLCA 3QP4A 5EUAA 2Y2JA 3OZHA 1K54A 2PU4A 3RXWA 5FL3A 3KSIA 3C30A 4X25A 2W3FA 2HP9A 1DJAA 3MQQA 4RQ9A 4QWOA 4PM7A 1PRQA 5HX9A 2E8JA 4JGOA 4EW7A 1TS8A 4FH2A 4ZBEA 2Y2GA 2HJ9C 3A3DA 3AGFA 5HSQA 2L1MA 5HDSA 2BTFP 3ITBA 2EX6A 2OSUA 2Y2NA 3LIDA 4HJ4A 3IBRA 2V0WA 2C6WB 4B4ZA 1L3LA 1J3WA 3E2KA 3O3VA 3BFFA 4FUWA 1K0KA 2XRNA 5GLDA 1IYOA 5CRFA 5HD3A 4BLMA 2INWA 4Q0JA 3MFDA 3BFEA 1L0GA 4JXGA 2Y2QA 3U4LP 2PT7A 4R3AA 1K6RA 1YLPA 1IFQA 5EVIC 3SW1A 4MN7A 1ES5A 3S1YA 3BM6A 1XGJA 3K3DA 3H7WA 4Z9QA 3UB5P 2VGLS 1L0FA 2RCXA 4WZ4A 2UV0E 3OOVA 3ZDJA 4O7DA 4F94A 4KZ7A 1N9LA 1WYCA 3P09A 3A0VA 3JVUA 2WKIA 1LL9A 4IJGA 3M6HA 2WGVA 5JYOA 4MMNA 3UMEA 3HLWA 2ZM0A 5TGFA 3WS2A 5E2HA 4K08A 2PR5A 3IWIA 1D7EA 3NHQA 4I3AA 5LBRA 1JWVA 2X02A 3ZQ5A 4P87A 2EA9A 1OTEA 2DNSA 4DDYA 4EEUA 4QPRA 3NC8A 5FSRA 2ZL1B 5L8MA 4DXCA 4GDBA 1HD8A 4Y13A 4Y3IA 2I9VA 1CQAA 4G3KA 4C75A 1YLZA 2WK0A 2ZMAA 4H6JA 4ZRRA 3KSFA 5KZHA 1DP8A 4PM9A 2OAP1 3WRTA 3BFCA 4HH2A 1KE0A 5HWTA 2Y2LA 3W8KA 3EGDC 2EWWA 1VM1A 3VFFA 3BQAA 2WGWB 3F1OB 2Y2HA 3D4FA 4EV4A 4EBPA 4EUVA 3WS5A 3BLMA 1PWDA 4BENA 3G4PA 2VA0A 1P97A 3DWKA 1F2KA 4G3WA 2OV5A 3PR6A 2XR0A 2QZ6A 4HESA 1K25A 2WZZA 3MBZA 1H8ZA 5DVAA 3T1XA 3HUMA 2KX6A 4L0LA 4NG2A 3RH8B 3LI9A 2B02A 1OT6A 2A24A 3MR0A 4C3QA 4WZ5C 3BFDA 1VHMA 3ZCZA 3UB6A 3E4OA 1ONGA 4OQ0A 1OTIA 4I39A 2J8YA 3A0SA 1MKMA 5CHUA 1S0WA 3CITA 2B18A 2HJEA 2P08A 3VE4A 3LUQA 1XPBA 4K0XA 2OAQ1 5EVIA 3GSGA 4EEPA 2ZOIA 3CMZA 4WN5A 2ZBBA 4R4RA 2A2LA 5HFOA 4X53A 4ID4A 2XFSA 1PWCA 4EWFA 4KQQA 1K56D 3SH8A 4JGPA 3UDIA 1SKOB 1P9RA 2Z2LB 4BWIA 4E04A 1E3UA 5E2EA 3E4QA 4F3LA 5CERA 2KDKA 3SH7A 3HREA 3CI6A 4IHQA 3VP1A 2EWVA 4X55A 3G34A 3VP0A 2HP6A 2ZD8A 5MC7A 3DBAA 3T4OA 4FSFA 4I5SA 4C6YA 1PFLA 3O87A 4Z1WA 2QPNA 3S7OA 1IYPA 2M7VA 4RX2A 4JXSA 1CF0A 3LCEA 3CLOA 1PZOA 1RP5A 3IF5A 3H82A 4PAUA 5DJTA 1IEMA 1N9OA 4MEZA 3CZDA 4D2OA 3JYIA 2Z2MB 1TVFA 2XROA 3MKFA 3HVFA 3V3RA 4O01A 3OBFA 2JCHA 3RXXA 3GVBA 4E3JA 3CUEC 4HEFA 1E25A 4JBFA 2HZ5A 2Z6DA 2XD5A 1VEUB 5FI7A 4R0QA 3LR4A 2ZMFA 4HJ6A 1OMEA 3VP4A 2Q9MA 1BULA 2VZWA 4B4XA 4GZBA 4Y0UA 4B88A 5GHZA 3A3JA 4IEDA 1O07A 4S2LA 3SZTA 2Y2OA 2OLUA 4U0TA 3H9WA 2IWCA 3M6BA 1YSPA 1ERQA 2FFYA 2IWDA 3HLEA 3ZGAB 2ZL1A 2W3GA 3KYQA 3F1NB 4WZ5A 5L2FA 2OLVA 1CI8A 3T1QB 4S2IA 1OTBA 3N8LA 2QKPA 3T12B 3PXPA 1PZPA 5F68A 4OLGA 3MS6A 4KZ6A 2W0NA 3C4OA 4QU3A 2QYBA 3NJAA 3S7QA 2WAFA 4GDNA 4XT2A 3KSHA 4LRYC 3G35A 1XX2A 2I72A 1JVJA 2HDRA 5L09A 2Y8HA 1TD5A 4ZAMA 5TBMB 2WKRA 4GS9A 4GJ4A 5HAQA 5G4YA 1XXMA 3VE3A 1CEGA 3FWLA 4R70A 1CI9A 4NXBA 3D3OA 1XJ3A 3A3EA 5HD5A 2XK1A 5GLBA 3BW6A 3A0RA 3QP2A 2Y4AA 2HDQA 4UA9A 3V50A 4S2KA 1EROA 5AVEA 1GSVA 2GZAA 4GD8A 4MBFA 4FCFA 5AQAA 1SZVA 1NZUA 4PM5A 2O9CA 3VMAA 3CAXA 3B47A 3V3SA 3MSHA 3IXBA 4OLDA 4UHUA 3WS0A 3G32A 1FCMA 3GRJA 2IWBA 3OLOA 4QY6A 4DE2A 1KGEA 2JC7A 2EXAA 3P98A 1ES3A 1BT5A 4Y5FA 3TRCA 3ZG7B 3FPVA 2ZC4B 3CUEA 3R7WB 5A92A 1D1JA 5FDSA 1SKOA 5GLAA 2HDSA 4O0PA 1IELA 1BLSA 1JTGA 2XEPA 4RYEA 2K2NA 1LL8A 3IS2B 1RCJA 1ZTUA 3LI8A 5DF8A 5HL6A 5AQBA 4YFMA 4L9GA 4P0MA 1UGUA 3O86A 4BBUA 3C38A 4Q8IA 1U60A 1QMEA 5E43A 1CJFA 2FH5A 1F5MA 2XSSA 2A3UA 4S2PA 1MZUA 2W1RA 1H8YA 1X0OA 5DTSA 4II7A 2K7SA 4DJ2A 2W3HA 3W4QA 5L10A 3KX0X 1I5QA 1V9YA 1TS0A 2WADA 5KIZA 2LB5A 3BYDA 1XGIA 1YQSA 3TG9A 4HNBA 4PPRA 3IF6C 2M1CA 2Y55A 3N8SA 3PBSA 5CTMA 1K56A 1VETB 5GLCA 1NLYA 1H8MA 3VOYA 3T1SA 1ES2A 4LLOB 3GMWA 3MXQA 1VEUA 2HGVA 4Q0IA 3CHWP 4LCMA 4EQIA 2V8FA 1TF1A 1BLHA 1D06A 3LR3A 4BQMA 1K4FA 1W63Q 1PWGA 3LR5A 4DE0A 4L9FA 3L9KA 4ETXA 2OOLA 4DXBA 3NECA 1VQQA 4NKPA 5CGSA 1ONHA 5D3OA 5M18A 1O7EA 2XA7M 2Y2PA 1LSVA 2XQZA 3AGDA 1YSQA 4NXFA 5F5YA 3IXGA 4OPRA 5AJGA 2H10A 3NCKA 2H5SA 4CJNA 2PRFA 3G6OA 5CHMA 3PBOA 3PAGA 2QJ5A 4U3TA 3LIAA 3BWLA 1P9WA 3MFXA 2L4RA 1OPXA 1YT4A 5EM1A 1H3QA 3VV4A 1GCEA 3IX3A 1LHYA 2AVXA 2IA2A 3FKWA 5TJJA 4N92A 3B33A 3OC2A 5FATA 1NZOA 4LRXC 4DE3A 1GSXA 3VSLA 2R78A 4EQ1A 5I5LA 5CHJA 3NOUC 4FOFA 4WLAA 4JF6A 5TBMA 4Y2FA 4WEKA 4XUXA 4X6TA 1NJ4A 1ALQA 1N9NA 3OCLA 1MWTA 1KDWA 4ARZB 2EFUA 1FILA 4YINA 1S6RA 1NY0A 5F6AA 1T19A 2EFXA 3VSKA 4CLCD 5DFXA 2G7UA 3NOPC 2JE5A 1NYYA 3HBRA 2X71A 5HW3A 1EWZA 3WRZA 3DTEA 2PU2A 1WE4A 2GX5A 1HTZA 4MBKA 1RGYA 4S2OA 1H0MA 3UY6A 4JGRA 2NUPC 2ZC7A 3GTCA 4X68A 1BSGA 1OJGA 3V67A 2QMIA 3PHYA 1FIKA 5HWVA 3ZVWA 1NYMA 1YLYA 3ZNTA 1ZKJA 2JKGA 4KG5A 2WYXA 2QWSA 3TJZC 4GW9A 2Y91A 4M3KA 3PTEA 5HPFA 3IF6A 3EWKA 3LGOA 1NWZA 4KZ9A 1GA0A 1CK3A 2V2FF 2PD8A 5C5KA 3R7WA 3NULA 2WZXA 3QNCA 1ZG4A 1G5UA 5CEDA 3ISGA 3G31A 3Q07A 3ITAA 3UMDA 4EESA 2V20A 2CC1A 1YLJA 3LIFA 4CLCB 4IVIA 2P9VA 1SDNA 3SS5A 3TW8A 1GSWA 1FCOA 4KZ5A 4E6XA 2ZC5B 5DJUA 3HLFA 2HDUA 4JF5A 5DKLA 3KSGA 3UB7A 5HL1A 1HLUP 3LO7A 1S66L 4OOLA 4YOFA 2EX9A 4QD4A 5FQKA 3V39A 4ZJ2A 2EX2A 4OQIA 1MWRA 1G28A 1G6OA 1YAXA 2B95A 1L0DA 2PAVP 4MN5A 1IYSA 4P6ZM 1Q2QA 2FZ0A 1K6SA 5CECA 5KSCA 4Y17A 3IBJA 3HJIA 2Y79A 3I7JA 1ODVA 3B3XA 5FQIA 5I94A 3ZG0A 3IWOA 4GD6A 3MQOA 1JTDA 1Z6FA 4G3VA 2VLGA 4AFIA 3ZG9B 1F98A 4X56A 1VETA 3LIEA 3ZG8B 3HLDA 1T18A 5EV0A 3WS1A 3FC7A 3T4KA 2R9XA 5DF7A 4KQRA 3VFHA 4JGQA 4LRZE 1LI0A 4DE1A 3LY4A 4X69A
chains in the Genus database with same CATH topology
3EQUA 1IOUA 2KLIA 5FL3A 3KSIA 4XT2A 5A8BA 3C30A 3MJQA 3KSHA 2W3FA 4WEJA 4LRYC 2VV6A 3MQQA 2Y8HA 1TD5A 4RQ9A 4IUKA 2VJWA 5TBMB 2WKRA 4GS9A 4GJ4A 5G4YA 4EW7A 4JGOA 1T1CA 1TS8A 3MF0A 3VE3A 4R70A 3U2AA 4NXBA 3D3OA 4IUHA 1XJ3A 2HJ9C 5HSQA 2L1MA 3E98A 5HDSA 5HD5A 3EQVA 5F69A 3LIDA 4HJ4A 4MDZA 3BW6A 3A0RA 4Q0HA 3IBRA 1TS7A 2D02A 2V0WA 2QJ7A 3HJKA 5AVEA 1GSVA 1S1YA 2GZAA 3LICA 2PDRA 1VB6A 2XRNA 4XT2B 2O9CA 4UQIM 3CAXA 4O8GA 3B47A 3P7NA 2VGLM 3IS2A 5HD3A 5IU1A 4NXGA 2INWA 4Q0JA 4BBTA 1F9IA 4R38A 4GS9B 5KSHA 2H28A 3P01A 2HF6A 3OLOA 4GLQA 2PT7A 2V9AA 3BQ8A 4R3AA 1IFQA 3SW1A 2W1TA 3NOTC 3B42A 4MN7A 3F1PA 2JN7A 4UQIS 3K3DA 3H7WA 4ARZA 4EETB 3W2ZA 3TRCA 4Y5FA 5IT5A 2VGLS 4KQOA 2CMNA 4HI4A 3FPVA 3CUEA 3OOVA 3C8CA 3R7WB 3RTYA 1TS6A 3FG8A 1N9LA 1JNUA 3A0VA 1OTDA 4O0PA 3JVUA 4I3IA 1UWPX 2K2NA 4IJGA 1LL8A 3IS2B 4GHIB 4PKYG 1ZTUA 3LI8A 4WELA 5HL6A 3T4SA 3UB8A 4HP9A 4L9GA 4MMNA 1OTAA 2VV8A 3LFVA 3UMEA 1UGUA 5HDDA 2V0UA 3TE8A 4BBUA 3C38A 2MJ6A 4K08A 4B93A 2PR5A 2PHYA 2FH5A 2J3TC 4CLCC 1F5MA 2XSSA 4I38A 1D7EA 1LT0A 3NHQA 1EW0A 4I3AA 1MZUA 1W63M 2W1RA 4I3JA 3K2NA 5LBRA 3ZQ5A 4EERA 1X0OA 3F1OA 3H7WB 4II7A 2K7SA 3FPWA 4DJ2A 2EA9A 2W3HA 1OTEA 4R6LA 3KX0X 3BY8A 4MCWA 1V9YA 4EEUA 4QPRA 1TS0A 4EU0A 5L8MA 5KIZA 2LB5A 4HNBA 4Y3IA 2I9VA 1BYWA 4G3KA 2M1CA 1XFQA 3PBSA 3LR0A 4H6JA 2JKTM 3PBQA 2OWHA 4ZRRA 1NLYA 1H8MA 3KSFA 4LLOB 1DP8A 3MXQA 2OAP1 2HGVA 4HOIA 4HH2A 4Q0IA 4CLCA 5HWTA 1S4SA 2V1AA 1OT9A 2VX8A 2Z6CA 1TF1A 3EGDC 2EWWA 1D06A 3EEHA 3LR3A 3BQAA 2JKTI 3PYPA 3EGXC 1W63Q 1WA9A 3F1OB 2OWJA 1OJ5A 3GECA 3LR5A 4L9FA 3T4JA 5HDCA 4ETXA 2OOLA 1KOUA 3R4KA 1V9ZA 4HY8A 4EUVA 2PD7A 4DJ3A 2JKRM 3C2WA 2VA0A 2VV7A 1P97A 4NKPA 4ETZA 4G3WA 2J80A 3PR6A 2XA7M 3JVVA 2WKQA 1LSVA 4LPZA 1YSQA 4NXFA 2J3WA 4H6JB 5F5YA 2L0WA 2KX6A 5AJGA 5K5BA 4L0LA 2JKRI 2P04A 3RH8B 3LI9A 1S1ZA 3G6OA 3O5YA 2B02A 1OT6A 2A24A 2O0YA 3MR0A 3T4TA 1VHMA 4HHDA 2GNXA 3PBOA 4EXOA 2QJ5A 3LIAA 2W27A 1P9WA 3BWLA 3MFXA 2L4RA 3UB6A 1OPXA 1XJ4A 3ICYA 4PKYA 3E4OA 1H3QA 2XA7S 4MN6A 1OTIA 4DN0A 3VV4A 2QHKA 4I39A 2BASA 2V1BA 4WL9A 4OOMA 3A0SA 2IA2A 1MKMA 5TJJA 3CITA 1S4RA 2B18A 2HJEA 3B33A 3OC2A 2P08A 3MQ0A 3PBTA 4LRXC 1GSXA 3VE4A 2R78A 4EQ1A 3LUQA 5I5LA 3UB9A 3NOUC 2OAQ1 4FOFA 4WLAA 3GDIA 4EEPA 1XFNA 3CWFA 2ZOIA 5TBMA 4WN5A 4Y2FA 2ZBBA 4WEKA 1N9NA 2W1TB 2A2LA 3OCLA 3BY9A 3F1PB 4HJ3A 2PYRA 3RFBA 4ARZB 5HWWA 2VEAA 4JGPA 5F6AA 4GCZA 1T19A 2WKPA 2PR6A 1P9RA 2O99A 2KOIA 2D01A 4BWIA 4CLCD 4E04A 5DFXA 5HZHA 1NRJA 5DF9A 3E4QA 4F3LA 2G7UA 1YKDA 2LB9A 2KDKA 3MMHA 3NOPC 3CI6A 4IHQA 2EWVA 1LSXA 2GX5A 4NXEA 5MC7A 3T4QA 1DRMA 3DBAA 3T4OA 4JGRA 4FSFA 2NUPC 4I5SA 1OJGA 3ULFA 4Z1WA 3S7OA 3V67A 2M7VA 3T4LA 5DFYA 3PHYA 4YNRA 3CLOA 2K31A 3LIBA 4WUJA 5HWVA 1STZA 3S7NA 4HH3A 3H82A 4PAUA 4ME4A 2P7JA 5DJTA 2QWSA 3T50A 1N9OA 4HIAA 3TJZC 5IS1A 4GW9A 2DMWA 5HPFA 3EWKA 2XROA 1NWZA 1T1BA 1P0ZA 1MC0A 3E4PA 4O01A 4NEED 4F3LB 3OBFA 2PD8A 5C5KA 3R7WA 2O9AA 4DMZA 2NUTC 3UE6A 2GJ3A 3CUEC 3F1NA 2JHEA 4L9EA 2Z6DA 3UMDA 4EESA 2ZMVA 4UEYA 3LIFA 5CX7A 4CLCB 1S67L 4GHIA 3LR4A 2ZMFA 4HJ6A 3TW8A 1GSWA 5J4EA 2VZWA 3K3CA 3LYXA 4HP4A 3S7PA 1T1AA 4PHTA 4CLCE 5DJUA 3D72A 4B9OA 3ZYTA 5DKLA 2W3DA 3KSGA 3UB7A 1S66L 2PYPA 5DKKA 3PBNA 3H82B 2ZOHA 4OOLA 4YOFA 4CQHA 1G28A 3BJNA 1G6OA 1DP9A 1YAXA 3EEAA 4HQAA 3H9WA 2W3EA 4MN5A 3OCNA 1YSPA 4KQDA 4P6ZM 4BJPA 2FZ0A 5G4ZA 3KO6A 4BBVA 1Y28A 3PBRA 2YKFA 5AVFA 3E0YA 3EOIA 3IBJA 3HJIA 4WF0A 1DP6A 2W3GA 1XJ6A 3KYQA 2Y79A 2O9BA 3F1NB 1XJ2A 4YWZA 1ODVA 3UE3A 3MQOA 2M7UA 3KYZA 2HV1A 1OTBA 4G3VA 1UWNX 1ZHHB 2VLGA 2QKPA 4AFIA 4KUKA 1F98A 2A24B 4KUOA 5J3WA 3PXPA 3LIEA 1T18A 2YKHA 5F68A 1LSWA 3FC7A 4P6ZS 3T4KA 2W0NA 5HPIA 1NLZA 2J3TD 5EFWA 2QYBA 3HCYA 2VKSA 4JGQA 4LRZE 4BMWA 4M4XA 5J7EA 3NJAA 3VOLA 3S7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XT2 A;  5A8B A;  3MJQ A;  4LRY C;  2VV6 A;  3MQQ A;  4RQ9 A;  5TBM B;  2WKR A;  4GS9 A;  5G4Y A;  4EW7 A;  4JGO A;  1T1C A;  1TS8 A;  3VE3 A;  4R70 A;  4NXB A;  1XJ3 A;  5HSQ A;  2L1M A;  5HDS A;  5HD5 A;  5F69 A;  3LID A;  4HJ4 A;  3A0R A;  3IBR A;  1TS7 A;  2D02 A;  2V0W A;  2QJ7 A;  3HJK A;  5AVE A;  1GSV A;  1S1Y A;  3LIC A;  2PDR A;  1VB6 A;  4XT2 B;  3CAX A;  3P7N A;  5HD3 A;  3IS2 A;  5IU1 A;  4NXG A;  2INW A;  4BBT A;  1F9I A;  4R38 A;  4GS9 B;  2H28 A;  3OLO A;  2V9A A;  4R3A A;  3SW1 A;  3NOT C;  3F1P A;  2JN7 A;  3K3D A;  3H7W A;  4EET B;  2CMN A;  4HI4 A;  3C8C A;  3RTY A;  1TS6 A;  3FG8 A;  1N9L A;  1JNU A;  3A0V A;  1OTD A;  4I3I A;  1UWP X;  1LL8 A;  3IS2 B;  4GHI B;  4PKY G;  3LI8 A;  3UB8 A;  4HP9 A;  4L9G A;  1OTA A;  2VV8 A;  3UME A;  1UGU A;  5HDD A;  2V0U A;  4BBU A;  4K08 A;  2PR5 A;  2PHY A;  4I38 A;  1D7E A;  1LT0 A;  3NHQ A;  1EW0 A;  4I3A A;  1MZU A;  4I3J A;  3ZQ5 A;  4EER A;  1X0O A;  3F1O A;  3H7W B;  2K7S A;  4DJ2 A;  2EA9 A;  1OTE A;  4R6L A;  3KX0 X;  3BY8 A;  4EEU A;  1V9Y A;  1TS0 A;  5KIZ A;  4HNB A;  2I9V A;  1BYW A;  2M1C A;  1XFQ A;  4H6J A;  2OWH A;  4LLO B;  1DP8 A;  3MXQ A;  4HOI A;  4HH2 A;  5HWT A;  1S4S A;  2V1A A;  1OT9 A;  2Z6C A;  1D06 A;  3EEH A;  3PYP A;  1WA9 A;  3F1O B;  2OWJ A;  1OJ5 A;  3GEC A;  4L9F A;  5HDC A;  2OOL A;  1KOU A;  4HY8 A;  1V9Z A;  2PD7 A;  4DJ3 A;  3C2W A;  2VV7 A;  1P97 A;  2J80 A;  2WKQ A;  1LSV A;  4LPZ A;  4NXF A;  4H6J B;  5F5Y A;  2L0W A;  2KX6 A;  3RH8 B;  3LI9 A;  1S1Z A;  3G6O A;  2B02 A;  1OT6 A;  2A24 A;  3MR0 A;  4EXO A;  4HHD A;  2QJ5 A;  3LIA A;  2W27 A;  3BWL A;  3MFX A;  3UB6 A;  2L4R A;  1XJ4 A;  3ICY A;  4PKY A;  3E4O A;  4MN6 A;  1OTI A;  2QHK A;  4I39 A;  2BAS A;  2V1B A;  4WL9 A;  3A0S A;  1S4R A;  3B33 A;  4LRX C;  1GSX A;  3VE4 A;  2R78 A;  4EQ1 A;  3LUQ A;  5I5L A;  3UB9 A;  3NOU C;  4WLA A;  3GDI A;  4EEP A;  1XFN A;  3CWF A;  2ZOI A;  5TBM A;  4WN5 A;  2ZBB A;  1N9N A;  3BY9 A;  3F1P B;  4HJ3 A;  2PYR A;  5HWW A;  2VEA A;  4JGP A;  5F6A A;  4GCZ A;  1T19 A;  2WKP A;  2PR6 A;  2D01 A;  4E04 A;  5HZH A;  3E4Q A;  4F3L A;  2KDK A;  3NOP C;  1LSX A;  4NXE A;  1DRM A;  4JGR A;  4I5S A;  1OJG A;  3ULF A;  3PHY A;  3CLO A;  4WUJ A;  3LIB A;  5HWV A;  4HH3 A;  3H82 A;  5DJT A;  2P7J A;  2QWS A;  3T50 A;  1N9O A;  4HIA A;  5IS1 A;  4GW9 A;  3EWK A;  1NWZ A;  1T1B A;  1P0Z A;  3E4P A;  4F3L B;  2PD8 A;  3UE6 A;  2GJ3 A;  3F1N A;  2JHE A;  4L9E A;  2Z6D A;  3UMD A;  4EES A;  3LIF A;  1S67 L;  4GHI A;  4HJ6 A;  1GSW A;  5J4E A;  3K3C A;  3LYX A;  4HP4 A;  1T1A A;  5DJU A;  3D72 A;  4B9O A;  5DKL A;  3UB7 A;  1S66 L;  2PYP A;  5DKK A;  3H82 B;  2ZOH A;  1G28 A;  1DP9 A;  4HQA A;  3H9W A;  4MN5 A;  4KQD A;  5G4Z A;  4BBV A;  1Y28 A;  2YKF A;  5AVF A;  3HJI A;  4WF0 A;  1DP6 A;  1XJ6 A;  1XJ2 A;  3F1N B;  4YWZ A;  1ODV A;  3MQO A;  2HV1 A;  1OTB A;  1UWN X;  2VLG A;  2QKP A;  4KUK A;  1F98 A;  2A24 B;  4KUO A;  5J3W A;  3LIE A;  1T18 A;  2YKH A;  5F68 A;  1LSW A;  3FC7 A;  2W0N A;  5EFW A;  4JGQ A;  4LRZ E;  4M4X A;  5J7E A;  3NJA A;  3VOL A; 
#chains in the Genus database with same CATH topology
 1IOU A;  1AXB A;  2ZQD A;  2KLI A;  1NRF A;  5A8B A;  5EPH A;  5F83 A;  4NK3 A;  2XLN A;  2VJW A;  3MZE A;  5EVL A;  3FKV A;  2JKF A;  4NET A;  3M2J A;  4GNU A;  3LEZ A;  3NIA A;  3GQZ A;  4GB7 A;  2ZM2 A;  4QJG A;  4E3K A;  1TDL A;  4OQG A;  5F69 A;  3HUO A;  3JPU A;  2ZQ8 A;  4Q0H A;  5GHY A;  1TS7 A;  1SKF A;  3HJK A;  3LIC A;  2R9W A;  1YLT A;  3L7H A;  4UQI M;  3Q7Z A;  4R38 A;  4OP8 A;  1W7F A;  4IVK A;  1KVL A;  3P01 A;  5FAP A;  1YLW A;  4S2M A;  4UAA A;  4OQH A;  2HF6 A;  3VP3 A;  1ERM A;  1MY8 A;  2Q0O A;  4JF4 A;  1KGG A;  3N4I A;  4GLQ A;  3BQ8 A;  4QHC A;  3DW0 A;  3NOT C;  3B42 A;  2A49 A;  4KG2 A;  4WMC D;  4ARZ A;  4EET B;  2X01 A;  5IT5 A;  3S4X A;  2Y2M A;  4HI4 A;  1J9M A;  4A5R A;  1MWS A;  5CGW A;  1YMX A;  1K55 C;  4WYY A;  3RTY A;  3FG8 A;  1JNU A;  3N8R A;  1PI5 A;  1N9B A;  3T1R A;  5A91 A;  1PI4 A;  4GHI B;  5U47 A;  1PIO A;  2HPB A;  5BOH A;  3HLC A;  4WEL A;  3IT9 A;  3BEC A;  4HP9 A;  4QB8 A;  4PMA A;  3O88 A;  1OTA A;  2VV8 A;  5EEC A;  3TE8 A;  2MJ6 A;  1E4D A;  4B93 A;  1L2S A;  2PHY A;  1W63 M;  2DCF A;  4EER A;  2WGW A;  2XGN A;  3F1O A;  5FQM A;  3H7W B;  5F1F A;  1I2W A;  3NI9 A;  3FPW A;  1IYQ A;  3KYE A;  4R6L A;  3BY8 A;  5TR7 A;  4R23 A;  5EOO A;  3IX8 A;  4WM9 A;  5HAP A;  1SCW A;  1BYW A;  4CPK A;  1YMS A;  4JXV A;  3NDG A;  4OOY A;  3PBQ A;  1FR1 A;  4HOI A;  4CLC A;  1HZO A;  3FYZ A;  3BEB A;  3SOI A;  3DWZ A;  1S4S A;  4MBH A;  2ZQ9 A;  2VX8 A;  4HBT A;  3NDE A;  1FSY A;  4XXR A;  3EEH A;  1MXO A;  3PYP A;  2ZQA A;  1KDS A;  5FQJ A;  2XF3 A;  5A90 A;  5AQ7 A;  4PM8 A;  3GEC A;  5E2F A;  5HDC A;  3IXD A;  5FI6 A;  4HY8 A;  2PD7 A;  4DJ3 A;  4S2J A;  3C2W A;  2VV7 A;  2J80 A;  4LV3 A;  3GV9 A;  2E8I A;  3JVV A;  2FFF B;  3C5A A;  1LI9 A;  4LPZ A;  2J3W A;  4H6J B;  2L0W A;  3G2Y A;  4N1H A;  1S1Z A;  3ZFZ A;  3T4T A;  4HHD A;  2GNX A;  5FEF A;  3IQA A;  1XJ4 A;  1GHI A;  3UDF A;  2XA7 S;  4MN6 A;  1MPL A;  5EVI D;  2UWX A;  3HLG A;  4WL9 A;  1LLB A;  1S4R A;  2GDN A;  4P6B A;  1K57 A;  3MQ0 A;  1K38 A;  3DAV A;  4R4S A;  3BFG A;  3OPR A;  3GDI A;  1XFN A;  4IBR A;  1KE3 A;  1K4E A;  5J8X A;  1AWI A;  2W1T B;  3ZHH A;  3F1P B;  2ACG A;  1K55 A;  2ZC3 B;  3RFB A;  1FQG A;  5CGX A;  3UE0 A;  5HWW A;  3ZVT A;  4GCZ A;  2WAE A;  3Q7V B;  2D01 A;  1NRJ A;  1YKD A;  5FI2 A;  2VGK A;  1ZG6 A;  1FCN A;  1LSX A;  1JWP A;  4D60 A;  2JBF A;  3MZF A;  3S22 A;  3LEQ A;  3T4Q A;  1DRM A;  3VP2 A;  4FH4 A;  5EVI B;  1A0K A;  3IH9 A;  4OPY A;  1IKI A;  4E3N A;  4R3J A;  5DFY A;  2K31 A;  3LIB A;  5F1G A;  3S7N A;  3C4P A;  4HH3 A;  5GL9 A;  2P7J A;  4Y7P A;  5IS1 A;  5M19 A;  3SS3 A;  5EVE A;  1MWU A;  1T1B A;  2P74 A;  4LFU A;  4NEE D;  4F3L B;  4R1G A;  4E3M A;  2O9A A;  3QP6 A;  3W4O A;  3UE6 A;  2HP5 A;  1XA7 A;  3F1N A;  2JHE A;  4L9E A;  1FSW A;  2ZMV A;  4UEY A;  5FDH A;  3UPP A;  5CX7 A;  4GHI A;  4UA7 A;  1IKG A;  5J4E A;  1HVB A;  3K3C A;  5FQ9 A;  3LYX A;  3S7P A;  1T1A A;  4PHT A;  4CLC E;  4B9O A;  4EUZ A;  5EOE A;  3IWQ A;  3ZYT A;  2PBY A;  2PYP A;  3UNW A;  3H82 B;  2ZOH A;  3A3F A;  3MXR A;  4ESP A;  4GOG A;  5AQ9 A;  3EEA A;  2WGI A;  4KQD A;  4BJP A;  4H8R A;  4WBG A;  3Q81 A;  3WS4 A;  1ACF A;  4KZB A;  1Y28 A;  5AVF A;  3E0Y A;  4WF0 A;  1DP6 A;  1XJ6 A;  2O9B A;  1XJ2 A;  2WKE A;  4YWZ A;  2VGJ A;  3V5M A;  2G2W A;  4WMC A;  2VK3 A;  2M7U A;  4X1M A;  1UWN X;  1ZHH B;  1G68 A;  4KUO A;  1GHP A;  2ZQ7 A;  3IX4 A;  4LCL A;  4LGW A;  1PW8 A;  1ES4 A;  1I2S A;  4P6Z S;  5A93 A;  2J7V A;  2J3T D;  5EFW A;  4M4X A;  3UO9 A;  1FR6 A;  5J7E A;  3SH9 A;  3VOL A;  2DRW A;  1MBL A;  3QP5 A;  4S2N C;  1BLP A;  3EQU A;  3DTM A;  4GN2 A;  2J9O A;  4XUZ A;  4MLL A;  3MJQ A;  4WEJ A;  5EM0 A;  2VV6 A;  1YM1 A;  1MKI A;  4IUK A;  1DJB A;  5HAI A;  1T1C A;  3MF0 A;  5L07 A;  4OVD A;  3RJU A;  4OPZ A;  3U2A A;  4IUH A;  1BUE A;  3E98 A;  3EQV A;  3FZC A;  4MDZ A;  1ZC2 A;  4OON A;  3MXS A;  2D02 A;  3W4P A;  2QJ7 A;  1XKZ A;  1S1Y A;  1M40 A;  2Y59 A;  2PDR A;  1VB6 A;  5FAO A;  3IHB A;  3IHA A;  4XT2 B;  3UE1 A;  3MZD A;  1KE4 A;  4O8G A;  3WWX A;  3P7N A;  2VGL M;  3IS2 A;  5IU1 A;  4NXG A;  4DDS A;  4BBT A;  1F9I A;  1W79 A;  3QNB A;  4Y15 A;  4N1X A;  3CPT B;  4GS9 B;  5KSH A;  2H28 A;  2XD1 A;  2V9A A;  4IBX A;  2W1T A;  5DTT A;  3F1P A;  4FD8 A;  1XP4 A;  2JN7 A;  4UQI S;  3UPO A;  1QMF A;  3W2Z A;  4BL3 A;  5GHX A;  4KQO A;  2CMN A;  1PNE A;  4OP5 A;  1BTL A;  2H0T A;  3C8C A;  1TS6 A;  3IH8 A;  3Q7V A;  2RL3 A;  1OTD A;  3IXH A;  1W8Y A;  4I3I A;  1UWP X;  3E2L A;  1SDE A;  4PKY G;  3T4S A;  3UB8 A;  3N7W A;  3Q82 A;  3LFV A;  5HDD A;  2V0U A;  4JPM A;  3OPH A;  4JLF A;  2J3T C;  4CLC C;  4I38 A;  4KZ3 A;  1LT0 A;  1EW0 A;  4I3J A;  4LV2 A;  3K2N A;  4KG6 A;  4RVA A;  3UN7 A;  4N9K A;  4KEN B;  2WUQ A;  4MCW A;  1Y4O A;  3D9Y A;  4ZJ3 A;  3M2K A;  3BRM A;  2XH9 A;  3UDX A;  4EU0 A;  4RA7 A;  2XDM A;  1Z09 A;  5FAS A;  1XFQ A;  3Q1F A;  3A3I A;  4ZDX A;  3LR0 A;  3C7V A;  2JKT M;  2ZM8 A;  5FQQ A;  2OWH A;  3DTI A;  4EBL A;  1N4O A;  1W8Q A;  2V1A A;  1OT9 A;  3TSG A;  4S2N A;  2Z6C A;  4KZ8 A;  2JKT I;  3EGX C;  4KZ4 A;  3BLS A;  1WA9 A;  2OWJ A;  1OJ5 A;  3LY3 A;  5JYP A;  3HLB A;  3T4J A;  1GHM A;  1KOU A;  3R4K A;  1V9Z A;  4BL2 A;  3G30 A;  2JKR M;  1EI5 A;  2BLS A;  1G6A A;  1WYB A;  4ETZ A;  1K57 C;  2WKQ A;  1TEM A;  4U0X A;  5DTK A;  2ZC6 B;  1YPR A;  5K5B A;  4BD0 A;  2JKR I;  2P04 A;  4Y0T A;  3O5Y A;  2O0Y A;  4E3O A;  4R3B A;  5M1A A;  4EXO A;  1DY6 A;  4UA6 A;  2W27 A;  5TFQ A;  2WKH A;  3ICY A;  4PKY A;  4DN0 A;  2QHK A;  2BAS A;  2V1B A;  4OOM A;  3MKE A;  1LL5 A;  4BD1 A;  4DF6 A;  1H5X A;  3ZG5 A;  5G18 A;  2Y2K A;  3PBT A;  3QP8 A;  3FV7 A;  3UB9 A;  4PM6 A;  1K54 C;  1JWZ A;  4OKP A;  3CWF A;  2C5W B;  1BZA A;  1Q2P A;  2G2U A;  4JKT A;  3SS4 A;  3QHY A;  3BY9 A;  4LV1 A;  3HUN A;  4HJ3 A;  2PYR A;  1DJC A;  1PYY A;  4RX3 A;  4ZJ1 A;  2PBD P;  1M6K A;  3HL9 A;  3OPL A;  4E6W A;  5E2G A;  5FAQ A;  2VEA A;  2WKP A;  1RGZ A;  2PR6 A;  1PW1 A;  2O99 A;  2KOI A;  3NBL A;  4E3I A;  5HZH A;  5DF9 A;  3ZNY A;  2LB9 A;  3MMH A;  5CEB A;  1KGF A;  4LEN A;  3TOI A;  4NXE A;  4N9L A;  4KZA A;  4DRT A;  5FEG A;  4JXW A;  3CPT A;  1GA9 A;  3ULF A;  4EBN A;  1ESI A;  1Y54 A;  3T4L A;  4DKI A;  4YNR A;  4WUJ A;  4FTX A;  4GKU A;  1STZ A;  4ME4 A;  1L0E A;  4Y0O A;  1FOF A;  3T50 A;  4HIA A;  1XA1 A;  2DMW A;  4X1L A;  3GR2 A;  2EX8 A;  2ZJ9 A;  3CG5 A;  1P0Z A;  2B5R A;  1MC0 A;  3E4P A;  2Q9N A;  3NY4 A;  5CTN A;  4P85 A;  4DMZ A;  5CXW A;  2NUT C;  2ZLY A;  5F82 A;  3OPP A;  1SHV A;  4LV0 A;  2GJ3 A;  3PAE A;  4OH0 A;  3VOZ A;  1S67 L;  2J9P A;  4HP4 A;  1C3B A;  2BG1 A;  3D72 A;  2W3D A;  2XFT A;  5DKK A;  3PBN A;  3CJM A;  2H0Y A;  5IHV A;  4E3L A;  4CQH A;  3BJN A;  4MNR A;  1DP9 A;  3IF6 B;  4HQA A;  1ESU A;  2W3E A;  3OCN A;  5HAR A;  5G4Z A;  3DTK A;  3KO6 A;  4BBV A;  3C7U A;  1TDG A;  2Y2I A;  3PBR A;  5FA7 A;  2YKF A;  3QP1 A;  1W5D A;  4ZTK A;  3EOI A;  4K0W A;  5KMW A;  3UE3 A;  1E3U D;  3KYZ A;  2HV1 A;  2V8C A;  2ZQC A;  4KUK A;  2A24 B;  4K91 A;  2P9V B;  5J3W A;  3N6I A;  3G2Z A;  1NXY A;  3UPN A;  2YKH A;  5EE8 A;  1KVM A;  1CEF A;  1LSW A;  2V1Z A;  4OPQ A;  5HPI A;  4QY5 A;  1NLZ A;  3HCY A;  2VKS A;  2EXB A;  4HBU A;  4BMW A;  3AGE A;  1BLC A;  3QP4 A;  5EUA A;  2Y2J A;  3OZH A;  1K54 A;  2PU4 A;  3RXW A;  5FL3 A;  3KSI A;  3C30 A;  4X25 A;  2W3F A;  2HP9 A;  1DJA A;  3MQQ A;  4RQ9 A;  4QWO A;  4PM7 A;  1PRQ A;  5HX9 A;  2E8J A;  4JGO A;  4EW7 A;  1TS8 A;  4FH2 A;  4ZBE A;  2Y2G A;  2HJ9 C;  3A3D A;  3AGF A;  5HSQ A;  2L1M A;  5HDS A;  2BTF P;  3ITB A;  2EX6 A;  2OSU A;  2Y2N A;  3LID A;  4HJ4 A;  3IBR A;  2V0W A;  2C6W B;  4B4Z A;  1L3L A;  1J3W A;  3E2K A;  3O3V A;  3BFF A;  4FUW A;  1K0K A;  2XRN A;  5GLD A;  1IYO A;  5CRF A;  5HD3 A;  4BLM A;  2INW A;  4Q0J A;  3MFD A;  3BFE A;  1L0G A;  4JXG A;  2Y2Q A;  3U4L P;  2PT7 A;  4R3A A;  1K6R A;  1YLP A;  1IFQ A;  5EVI C;  3SW1 A;  4MN7 A;  1ES5 A;  3S1Y A;  3BM6 A;  1XGJ A;  3K3D A;  3H7W A;  4Z9Q A;  3UB5 P;  2VGL S;  1L0F A;  2RCX A;  4WZ4 A;  2UV0 E;  3OOV A;  3ZDJ A;  4O7D A;  4F94 A;  4KZ7 A;  1N9L A;  1WYC A;  3P09 A;  3A0V A;  3JVU A;  2WKI A;  1LL9 A;  4IJG A;  3M6H A;  2WGV A;  5JYO A;  4MMN A;  3UME A;  3HLW A;  2ZM0 A;  5TGF A;  3WS2 A;  5E2H A;  4K08 A;  2PR5 A;  3IWI A;  1D7E A;  3NHQ A;  4I3A A;  5LBR A;  1JWV A;  2X02 A;  3ZQ5 A;  4P87 A;  2EA9 A;  1OTE A;  2DNS A;  4DDY A;  4EEU A;  4QPR A;  3NC8 A;  5FSR A;  2ZL1 B;  5L8M A;  4DXC A;  4GDB A;  1HD8 A;  4Y13 A;  4Y3I A;  2I9V A;  1CQA A;  4G3K A;  4C75 A;  1YLZ A;  2WK0 A;  2ZMA A;  4H6J A;  4ZRR A;  3KSF A;  5KZH A;  1DP8 A;  4PM9 A;  2OAP 1;  3WRT A;  3BFC A;  4HH2 A;  1KE0 A;  5HWT A;  2Y2L A;  3W8K A;  3EGD C;  2EWW A;  1VM1 A;  3VFF A;  3BQA A;  2WGW B;  3F1O B;  2Y2H A;  3D4F A;  4EV4 A;  4EBP A;  4EUV A;  3WS5 A;  3BLM A;  1PWD A;  4BEN A;  3G4P A;  2VA0 A;  1P97 A;  3DWK A;  1F2K A;  4G3W A;  2OV5 A;  3PR6 A;  2XR0 A;  2QZ6 A;  4HES A;  1K25 A;  2WZZ A;  3MBZ A;  1H8Z A;  5DVA A;  3T1X A;  3HUM A;  2KX6 A;  4L0L A;  4NG2 A;  3RH8 B;  3LI9 A;  2B02 A;  1OT6 A;  2A24 A;  3MR0 A;  4C3Q A;  4WZ5 C;  3BFD A;  1VHM A;  3ZCZ A;  3UB6 A;  3E4O A;  1ONG A;  4OQ0 A;  1OTI A;  4I39 A;  2J8Y A;  3A0S A;  1MKM A;  5CHU A;  1S0W A;  3CIT A;  2B18 A;  2HJE A;  2P08 A;  3VE4 A;  3LUQ A;  1XPB A;  4K0X A;  2OAQ 1;  5EVI A;  3GSG A;  4EEP A;  2ZOI A;  3CMZ A;  4WN5 A;  2ZBB A;  4R4R A;  2A2L A;  5HFO A;  4X53 A;  4ID4 A;  2XFS A;  1PWC A;  4EWF A;  4KQQ A;  1K56 D;  3SH8 A;  4JGP A;  3UDI A;  1SKO B;  1P9R A;  2Z2L B;  4BWI A;  4E04 A;  1E3U A;  5E2E A;  3E4Q A;  4F3L A;  5CER A;  2KDK A;  3SH7 A;  3HRE A;  3CI6 A;  4IHQ A;  3VP1 A;  2EWV A;  4X55 A;  3G34 A;  3VP0 A;  2HP6 A;  2ZD8 A;  5MC7 A;  3DBA A;  3T4O A;  4FSF A;  4I5S A;  4C6Y A;  1PFL A;  3O87 A;  4Z1W A;  2QPN A;  3S7O A;  1IYP A;  2M7V A;  4RX2 A;  4JXS A;  1CF0 A;  3LCE A;  3CLO A;  1PZO A;  1RP5 A;  3IF5 A;  3H82 A;  4PAU A;  5DJT A;  1IEM A;  1N9O A;  4MEZ A;  3CZD A;  4D2O A;  3JYI A;  2Z2M B;  1TVF A;  2XRO A;  3MKF A;  3HVF A;  3V3R A;  4O01 A;  3OBF A;  2JCH A;  3RXX A;  3GVB A;  4E3J A;  3CUE C;  4HEF A;  1E25 A;  4JBF A;  2HZ5 A;  2Z6D A;  2XD5 A;  1VEU B;  5FI7 A;  4R0Q A;  3LR4 A;  2ZMF A;  4HJ6 A;  1OME A;  3VP4 A;  2Q9M A;  1BUL A;  2VZW A;  4B4X A;  4GZB A;  4Y0U A;  4B88 A;  5GHZ A;  3A3J A;  4IED A;  1O07 A;  4S2L A;  3SZT A;  2Y2O A;  2OLU A;  4U0T A;  3H9W A;  2IWC A;  3M6B A;  1YSP A;  1ERQ A;  2FFY A;  2IWD A;  3HLE A;  3ZGA B;  2ZL1 A;  2W3G A;  3KYQ A;  3F1N B;  4WZ5 A;  5L2F A;  2OLV A;  1CI8 A;  3T1Q B;  4S2I A;  1OTB A;  3N8L A;  2QKP A;  3T12 B;  3PXP A;  1PZP A;  5F68 A;  4OLG A;  3MS6 A;  4KZ6 A;  2W0N A;  3C4O A;  4QU3 A;  2QYB A;  3NJA A;  3S7Q A;  2WAF A;  4GDN A;  4XT2 A;  3KSH A;  4LRY C;  3G35 A;  1XX2 A;  2I72 A;  1JVJ A;  2HDR A;  5L09 A;  2Y8H A;  1TD5 A;  4ZAM A;  5TBM B;  2WKR A;  4GS9 A;  4GJ4 A;  5HAQ A;  5G4Y A;  1XXM A;  3VE3 A;  1CEG A;  3FWL A;  4R70 A;  1CI9 A;  4NXB A;  3D3O A;  1XJ3 A;  3A3E A;  5HD5 A;  2XK1 A;  5GLB A;  3BW6 A;  3A0R A;  3QP2 A;  2Y4A A;  2HDQ A;  4UA9 A;  3V50 A;  4S2K A;  1ERO A;  5AVE A;  1GSV A;  2GZA A;  4GD8 A;  4MBF A;  4FCF A;  5AQA A;  1SZV A;  1NZU A;  4PM5 A;  2O9C A;  3VMA A;  3CAX A;  3B47 A;  3V3S A;  3MSH A;  3IXB A;  4OLD A;  4UHU A;  3WS0 A;  3G32 A;  1FCM A;  3GRJ A;  2IWB A;  3OLO A;  4QY6 A;  4DE2 A;  1KGE A;  2JC7 A;  2EXA A;  3P98 A;  1ES3 A;  1BT5 A;  4Y5F A;  3TRC A;  3ZG7 B;  3FPV A;  2ZC4 B;  3CUE A;  3R7W B;  5A92 A;  1D1J A;  5FDS A;  1SKO A;  5GLA A;  2HDS A;  4O0P A;  1IEL A;  1BLS A;  1JTG A;  2XEP A;  4RYE A;  2K2N A;  1LL8 A;  3IS2 B;  1RCJ A;  1ZTU A;  3LI8 A;  5DF8 A;  5HL6 A;  5AQB A;  4YFM A;  4L9G A;  4P0M A;  1UGU A;  3O86 A;  4BBU A;  3C38 A;  4Q8I A;  1U60 A;  1QME A;  5E43 A;  1CJF A;  2FH5 A;  1F5M A;  2XSS A;  2A3U A;  4S2P A;  1MZU A;  2W1R A;  1H8Y A;  1X0O A;  5DTS A;  4II7 A;  2K7S A;  4DJ2 A;  2W3H A;  3W4Q A;  5L10 A;  3KX0 X;  1I5Q A;  1V9Y A;  1TS0 A;  2WAD A;  5KIZ A;  2LB5 A;  3BYD A;  1XGI A;  1YQS A;  3TG9 A;  4HNB A;  4PPR A;  3IF6 C;  2M1C A;  2Y55 A;  3N8S A;  3PBS A;  5CTM A;  1K56 A;  1VET B;  5GLC A;  1NLY A;  1H8M A;  3VOY A;  3T1S A;  1ES2 A;  4LLO B;  3GMW A;  3MXQ A;  1VEU A;  2HGV A;  4Q0I A;  3CHW P;  4LCM A;  4EQI A;  2V8F A;  1TF1 A;  1BLH A;  1D06 A;  3LR3 A;  4BQM A;  1K4F A;  1W63 Q;  1PWG A;  3LR5 A;  4DE0 A;  4L9F A;  3L9K A;  4ETX A;  2OOL A;  4DXB A;  3NEC A;  1VQQ A;  4NKP A;  5CGS A;  1ONH A;  5D3O A;  5M18 A;  1O7E A;  2XA7 M;  2Y2P A;  1LSV A;  2XQZ A;  3AGD A;  1YSQ A;  4NXF A;  5F5Y A;  3IXG A;  4OPR A;  5AJG A;  2H10 A;  3NCK A;  2H5S A;  4CJN A;  2PRF A;  3G6O A;  5CHM A;  3PBO A;  3PAG A;  2QJ5 A;  4U3T A;  3LIA A;  3BWL A;  1P9W A;  3MFX A;  2L4R A;  1OPX A;  1YT4 A;  5EM1 A;  1H3Q A;  3VV4 A;  1GCE A;  3IX3 A;  1LHY A;  2AVX A;  2IA2 A;  3FKW A;  5TJJ A;  4N92 A;  3B33 A;  3OC2 A;  5FAT A;  1NZO A;  4LRX C;  4DE3 A;  1GSX A;  3VSL A;  2R78 A;  4EQ1 A;  5I5L A;  5CHJ A;  3NOU C;  4FOF A;  4WLA A;  4JF6 A;  5TBM A;  4Y2F A;  4WEK A;  4XUX A;  4X6T A;  1NJ4 A;  1ALQ A;  1N9N A;  3OCL A;  1MWT A;  1KDW A;  4ARZ B;  2EFU A;  1FIL A;  4YIN A;  1S6R A;  1NY0 A;  5F6A A;  1T19 A;  2EFX A;  3VSK A;  4CLC D;  5DFX A;  2G7U A;  3NOP C;  2JE5 A;  1NYY A;  3HBR A;  2X71 A;  5HW3 A;  1EWZ A;  3WRZ A;  3DTE A;  2PU2 A;  1WE4 A;  2GX5 A;  1HTZ A;  4MBK A;  1RGY A;  4S2O A;  1H0M A;  3UY6 A;  4JGR A;  2NUP C;  2ZC7 A;  3GTC A;  4X68 A;  1BSG A;  1OJG A;  3V67 A;  2QMI A;  3PHY A;  1FIK A;  5HWV A;  3ZVW A;  1NYM A;  1YLY A;  3ZNT A;  1ZKJ A;  2JKG A;  4KG5 A;  2WYX A;  2QWS A;  3TJZ C;  4GW9 A;  2Y91 A;  4M3K A;  3PTE A;  5HPF A;  3IF6 A;  3EWK A;  3LGO A;  1NWZ A;  4KZ9 A;  1GA0 A;  1CK3 A;  2V2F F;  2PD8 A;  5C5K A;  3R7W A;  3NUL A;  2WZX A;  3QNC A;  1ZG4 A;  1G5U A;  5CED A;  3ISG A;  3G31 A;  3Q07 A;  3ITA A;  3UMD A;  4EES A;  2V20 A;  2CC1 A;  1YLJ A;  3LIF A;  4CLC B;  4IVI A;  2P9V A;  1SDN A;  3SS5 A;  3TW8 A;  1GSW A;  1FCO A;  4KZ5 A;  4E6X A;  2ZC5 B;  5DJU A;  3HLF A;  2HDU A;  4JF5 A;  5DKL A;  3KSG A;  3UB7 A;  5HL1 A;  1HLU P;  3LO7 A;  1S66 L;  4OOL A;  4YOF A;  2EX9 A;  4QD4 A;  5FQK A;  3V39 A;  4ZJ2 A;  2EX2 A;  4OQI A;  1MWR A;  1G28 A;  1G6O A;  1YAX A;  2B95 A;  1L0D A;  2PAV P;  4MN5 A;  1IYS A;  4P6Z M;  1Q2Q A;  2FZ0 A;  1K6S A;  5CEC A;  5KSC A;  4Y17 A;  3IBJ A;  3HJI A;  2Y79 A;  3I7J A;  1ODV A;  3B3X A;  5FQI A;  5I94 A;  3ZG0 A;  3IWO A;  4GD6 A;  3MQO A;  1JTD A;  1Z6F A;  4G3V A;  2VLG A;  4AFI A;  3ZG9 B;  1F98 A;  4X56 A;  1VET A;  3LIE A;  3ZG8 B;  3HLD A;  1T18 A;  5EV0 A;  3WS1 A;  3FC7 A;  3T4K A;  2R9X A;  5DF7 A;  4KQR A;  3VFH A;  4JGQ A;  4LRZ E;  1LI0 A;  4DE1 A;  3LY4 A;  4X69 A; 
#chains in the Genus database with same CATH homology
 3EQU A;  1IOU A;  2KLI A;  5FL3 A;  3KSI A;  4XT2 A;  5A8B A;  3C30 A;  3MJQ A;  3KSH A;  2W3F A;  4WEJ A;  4LRY C;  2VV6 A;  3MQQ A;  2Y8H A;  1TD5 A;  4RQ9 A;  4IUK A;  2VJW A;  5TBM B;  2WKR A;  4GS9 A;  4GJ4 A;  5G4Y A;  4EW7 A;  4JGO A;  1T1C A;  1TS8 A;  3MF0 A;  3VE3 A;  4R70 A;  3U2A A;  4NXB A;  3D3O A;  4IUH A;  1XJ3 A;  2HJ9 C;  5HSQ A;  2L1M A;  3E98 A;  5HDS A;  5HD5 A;  3EQV A;  5F69 A;  3LID A;  4HJ4 A;  4MDZ A;  3BW6 A;  3A0R A;  4Q0H A;  3IBR A;  1TS7 A;  2D02 A;  2V0W A;  2QJ7 A;  3HJK A;  5AVE A;  1GSV A;  1S1Y A;  2GZA A;  3LIC A;  2PDR A;  1VB6 A;  2XRN A;  4XT2 B;  2O9C A;  4UQI M;  3CAX A;  4O8G A;  3B47 A;  3P7N A;  2VGL M;  3IS2 A;  5HD3 A;  5IU1 A;  4NXG A;  2INW A;  4Q0J A;  4BBT A;  1F9I A;  4R38 A;  4GS9 B;  5KSH A;  2H28 A;  3P01 A;  2HF6 A;  3OLO A;  4GLQ A;  2PT7 A;  2V9A A;  3BQ8 A;  4R3A A;  1IFQ A;  3SW1 A;  2W1T A;  3NOT C;  3B42 A;  4MN7 A;  3F1P A;  2JN7 A;  4UQI S;  3K3D A;  3H7W A;  4ARZ A;  4EET B;  3W2Z A;  3TRC A;  4Y5F A;  5IT5 A;  2VGL S;  4KQO A;  2CMN A;  4HI4 A;  3FPV A;  3CUE A;  3OOV A;  3C8C A;  3R7W B;  3RTY A;  1TS6 A;  3FG8 A;  1N9L A;  1JNU A;  3A0V A;  1OTD A;  4O0P A;  3JVU A;  4I3I A;  1UWP X;  2K2N A;  4IJG A;  1LL8 A;  3IS2 B;  4GHI B;  4PKY G;  1ZTU A;  3LI8 A;  4WEL A;  5HL6 A;  3T4S A;  3UB8 A;  4HP9 A;  4L9G A;  4MMN A;  1OTA A;  2VV8 A;  3LFV A;  3UME A;  1UGU A;  5HDD A;  2V0U A;  3TE8 A;  4BBU A;  3C38 A;  2MJ6 A;  4K08 A;  4B93 A;  2PR5 A;  2PHY A;  2FH5 A;  2J3T C;  4CLC C;  1F5M A;  2XSS A;  4I38 A;  1D7E A;  1LT0 A;  3NHQ A;  1EW0 A;  4I3A A;  1MZU A;  1W63 M;  2W1R A;  4I3J A;  3K2N A;  5LBR A;  3ZQ5 A;  4EER A;  1X0O A;  3F1O A;  3H7W B;  4II7 A;  2K7S A;  3FPW A;  4DJ2 A;  2EA9 A;  2W3H A;  1OTE A;  4R6L A;  3KX0 X;  3BY8 A;  4MCW A;  1V9Y A;  4EEU A;  4QPR A;  1TS0 A;  4EU0 A;  5L8M A;  5KIZ A;  2LB5 A;  4HNB A;  4Y3I A;  2I9V A;  1BYW A;  4G3K A;  2M1C A;  1XFQ A;  3PBS A;  3LR0 A;  4H6J A;  2JKT M;  3PBQ A;  2OWH A;  4ZRR A;  1NLY A;  1H8M A;  3KSF A;  4LLO B;  1DP8 A;  3MXQ A;  2OAP 1;  2HGV A;  4HOI A;  4HH2 A;  4Q0I A;  4CLC A;  5HWT A;  1S4S A;  2V1A A;  1OT9 A;  2VX8 A;  2Z6C A;  1TF1 A;  3EGD C;  2EWW A;  1D06 A;  3EEH A;  3LR3 A;  3BQA A;  2JKT I;  3PYP A;  3EGX C;  1W63 Q;  1WA9 A;  3F1O B;  2OWJ A;  1OJ5 A;  3GEC A;  3LR5 A;  4L9F A;  3T4J A;  5HDC A;  4ETX A;  2OOL A;  1KOU A;  3R4K A;  1V9Z A;  4HY8 A;  4EUV A;  2PD7 A;  4DJ3 A;  2JKR M;  3C2W A;  2VA0 A;  2VV7 A;  1P97 A;  4NKP A;  4ETZ A;  4G3W A;  2J80 A;  3PR6 A;  2XA7 M;  3JVV A;  2WKQ A;  1LSV A;  4LPZ A;  1YSQ A;  4NXF A;  2J3W A;  4H6J B;  5F5Y A;  2L0W A;  2KX6 A;  5AJG A;  5K5B A;  4L0L A;  2JKR I;  2P04 A;  3RH8 B;  3LI9 A;  1S1Z A;  3G6O A;  3O5Y A;  2B02 A;  1OT6 A;  2A24 A;  2O0Y A;  3MR0 A;  3T4T A;  1VHM A;  4HHD A;  2GNX A;  3PBO A;  4EXO A;  2QJ5 A;  3LIA A;  2W27 A;  1P9W A;  3BWL A;  3MFX A;  2L4R A;  3UB6 A;  1OPX A;  1XJ4 A;  3ICY A;  4PKY A;  3E4O A;  1H3Q A;  2XA7 S;  4MN6 A;  1OTI A;  4DN0 A;  3VV4 A;  2QHK A;  4I39 A;  2BAS A;  2V1B A;  4WL9 A;  4OOM A;  3A0S A;  2IA2 A;  1MKM A;  5TJJ A;  3CIT A;  1S4R A;  2B18 A;  2HJE A;  3B33 A;  3OC2 A;  2P08 A;  3MQ0 A;  3PBT A;  4LRX C;  1GSX A;  3VE4 A;  2R78 A;  4EQ1 A;  3LUQ A;  5I5L A;  3UB9 A;  3NOU C;  2OAQ 1;  4FOF A;  4WLA A;  3GDI A;  4EEP A;  1XFN A;  3CWF A;  2ZOI A;  5TBM A;  4WN5 A;  4Y2F A;  2ZBB A;  4WEK A;  1N9N A;  2W1T B;  2A2L A;  3OCL A;  3BY9 A;  3F1P B;  4HJ3 A;  2PYR A;  3RFB A;  4ARZ B;  5HWW A;  2VEA A;  4JGP A;  5F6A A;  4GCZ A;  1T19 A;  2WKP A;  2PR6 A;  1P9R A;  2O99 A;  2KOI A;  2D01 A;  4BWI A;  4CLC D;  4E04 A;  5DFX A;  5HZH A;  1NRJ A;  5DF9 A;  3E4Q A;  4F3L A;  2G7U A;  1YKD A;  2LB9 A;  2KDK A;  3MMH A;  3NOP C;  3CI6 A;  4IHQ A;  2EWV A;  1LSX A;  2GX5 A;  4NXE A;  5MC7 A;  3T4Q A;  1DRM A;  3DBA A;  3T4O A;  4JGR A;  4FSF A;  2NUP C;  4I5S A;  1OJG A;  3ULF A;  4Z1W A;  3S7O A;  3V67 A;  2M7V A;  3T4L A;  5DFY A;  3PHY A;  4YNR A;  3CLO A;  2K31 A;  3LIB A;  4WUJ A;  5HWV A;  1STZ A;  3S7N A;  4HH3 A;  3H82 A;  4PAU A;  4ME4 A;  2P7J A;  5DJT A;  2QWS A;  3T50 A;  1N9O A;  4HIA A;  3TJZ C;  5IS1 A;  4GW9 A;  2DMW A;  5HPF A;  3EWK A;  2XRO A;  1NWZ A;  1T1B A;  1P0Z A;  1MC0 A;  3E4P A;  4O01 A;  4NEE D;  4F3L B;  3OBF A;  2PD8 A;  5C5K A;  3R7W A;  2O9A A;  4DMZ A;  2NUT C;  3UE6 A;  2GJ3 A;  3CUE C;  3F1N A;  2JHE A;  4L9E A;  2Z6D A;  3UMD A;  4EES A;  2ZMV A;  4UEY A;  3LIF A;  5CX7 A;  4CLC B;  1S67 L;  4GHI A;  3LR4 A;  2ZMF A;  4HJ6 A;  3TW8 A;  1GSW A;  5J4E A;  2VZW A;  3K3C A;  3LYX A;  4HP4 A;  3S7P A;  1T1A A;  4PHT A;  4CLC E;  5DJU A;  3D72 A;  4B9O A;  3ZYT A;  5DKL A;  2W3D A;  3KSG A;  3UB7 A;  1S66 L;  2PYP A;  5DKK A;  3PBN A;  3H82 B;  2ZOH A;  4OOL A;  4YOF A;  4CQH A;  1G28 A;  3BJN A;  1G6O A;  1DP9 A;  1YAX A;  3EEA A;  4HQA A;  3H9W A;  2W3E A;  4MN5 A;  3OCN A;  1YSP A;  4KQD A;  4P6Z M;  4BJP A;  2FZ0 A;  5G4Z A;  3KO6 A;  4BBV A;  1Y28 A;  3PBR A;  2YKF A;  5AVF A;  3E0Y A;  3EOI A;  3IBJ A;  3HJI A;  4WF0 A;  1DP6 A;  2W3G A;  1XJ6 A;  3KYQ A;  2Y79 A;  2O9B A;  3F1N B;  1XJ2 A;  4YWZ A;  1ODV A;  3UE3 A;  3MQO A;  2M7U A;  3KYZ A;  2HV1 A;  1OTB A;  4G3V A;  1UWN X;  1ZHH B;  2VLG A;  2QKP A;  4AFI A;  4KUK A;  1F98 A;  2A24 B;  4KUO A;  5J3W A;  3PXP A;  3LIE A;  1T18 A;  2YKH A;  5F68 A;  1LSW A;  3FC7 A;  4P6Z S;  3T4K A;  2W0N A;  5HPI A;  1NLZ A;  2J3T D;  5EFW A;  2QYB A;  3HCY A;  2VKS A;  4JGQ A;  4LRZ E;  4BMW A;  4M4X A;  5J7E A;  3NJA A;  3VOL A;  3S7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...