1JTGA

Crystal structure of tem-1 beta-lactamase / beta-lactamase inhibitor protein complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
263
structure length
262
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEAKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE TEM
publication title Crystal structure and kinetic analysis of beta-lactamase inhibitor protein-II in complex with TEM-1 beta-lactamase.
pubmed doi rcsb
source organism Escherichia coli
total genus 91
structure length 262
sequence length 263
chains with identical sequence C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1jtgA00
4DKIA 2JC7A 5GLDA 1PWDA 1W79A 1O07A 1L0FA 4E6XA 1JWVA 3W4PA 1LL5A 4OPRA 3VSKA 5DTSA 2X71A 2HP5A 1BLPA 2ZC3B 3LEZA 5EUAA 3M6BA 4RVAA 3NCKA 3V39A 5EVIB 3ZGAB 1XGJA 5M1AA 4LCMA 4LV2A 3QNBA 3MKEA 1IYSA 3UDIA 3FYZA 3G2YA 4GKUA 2WGIA 3C5AA 3WWXA 3N8RA 4HESA 3P09A 4WZ5A 5GLBA 5HW3A 3RXXA 1YLPA 2XK1A 3IXDA 3M6HA 4KZ9A 4ZJ2A 4PM5A 3UPNA 4KZAA 1LI9A 2FFFB 4EBPA 5L2FA 4KZ6A 1IKGA 1JTDA 1MPLA 5JYOA 3UE1A 2XD5A 3NDEA 4S2PA 4OLGA 2Y2GA 5E2FA 3V5MA 4Y0TA 2ZM2A 4QY6A 5FI7A 5EE8A 5F83A 3PAGA 5TFQA 4JF6A 3UN7A 2OSUA 2QZ6A 4U3TA 5CGSA 4FH2A 3WS5A 1FSWA 4X53A 5HAPA 1GCEA 3PBNA 2I72A 2ZQDA 4WZ4A 4OOYA 1ONGA 2XDMA 4S2OA 1NXYA 1ERQA 2DNSA 1M40A 3NIAA 1ES3A 1NYYA 4OQIA 3SH8A 1SKFA 3FV7A 4QU3A 4JF4A 2EX2A 2Y2JA 1W5DA 3IXGA 4C3QA 3UPOA 1MBLA 2J7VA 4N9KA 1CEFA 1RP5A 2GDNA 2VGJA 2Y91A 2WADA 3SS5A 4BD0A 5HX9A 4E3MA 5KZHA 5AQ9A 3G30A 5KSCA 2XR0A 4E6WA 1RGZA 2ZM8A 3HLGA 3IWQA 2XFTA 2HDQA 5EVLA 1PI4A 2ZC7A 1KE3A 2G2WA 4YINA 1Q2PA 2X02A 1RCJA 3Q7VA 3NC8A 4JF5A 4WELA 4E3NA 4DF6A 2HPBA 3PBRA 4S2MA 3E2LA 2WUQA 1TEMA 1K4EA 2A3UA 3G31A 3M2KA 5FSRA 4E3OA 3IH8A 4FCFA 4KQOA 4DE0A 4Y7PA 4GB7A 5FQMA 3MFDA 4M3KA 2Z2MB 1K56D 1XKZA 3G34A 5G18A 3QHYA 1XPBA 2Y2LA 4KZ3A 4S2NC 1JWZA 3ZG7B 5EVIA 5E2HA 1K54A 3ITBA 1Z6FA 3MBZA 5A93A 1ZG4A 4S2LA 3WRTA 1GHPA 4X55A 3GVBA 4ZDXA 4R4SA 2R9XA 4P85A 3GV9A 1NJ4A 3PAEA 1M6KA 1KVMA 4JXWA 4X6TA 2HDSA 4EWFA 4S2IA 5GL9A 5FDHA 3BEBA 2BLSA 4KG2A 4OPYA 4DRTA 1ZKJA 3Q82A 4QB8A 2HDUA 3LO7A 1PWGA 2V1ZA 1BLSA 1E3UD 4FD8A 1BT5A 1I2WA 3SH9A 4PM7A 2A49A 3O87A 2Y2MA 4KQQA 1L0DA 2H0YA 4WEJA 1DJBA 1G6AA 1KDSA 3AGFA 1TDGA 4KG5A 5JYPA 3A3FA 4MEZA 4PM6A 3CZDA 1WYCA 2HP9A 4GZBA 3S4XA 4LENA 1KVLA 3DTMA 2P9VB 2VGKA 1OMEA 1U60A 3OCLA 1HVBA 2C5WB 5KSHA 5FQIA 4E3IA 1CI9A 4R0QA 4X56A 3GQZA 3HVFA 3IQAA 4DE1A 1TDLA 4QJGA 3BECA 4DE3A 4F94A 1BTLA 4KZBA 5AQ7A 5BOHA 1SDNA 5M19A 1Q2QA 5FATA 3VP1A 1ES4A 3ZG0A 4WMCD 1S6RA 2P74A 2R9WA 4Y0OA 1WYBA 2ZJ9A 4N1XA 2EX6A 3DWKA 1BSGA 3G35A 2DRWA 4N1HA 1YMXA 2H5SA 5GLCA 3UE0A 1QMFA 3V50A 3Q7ZA 1MKIA 5FASA 5A90A 1ES5A 4JLFA 5CXWA 1MXOA 3QNCA 3MKFA 1BZAA 1FSYA 3HLFA 4Y0UA 1K55C 4EBLA 4E3LA 4OKPA 3TOIA 4OQHA 3HLDA 5E43A 3IXBA 3ZHHA 4BJPA 1QMEA 2WKIA 4IVIA 4PM8A 4K0WA 1YT4A 3SS3A 1L0EA 1LHYA 3LCEA 2ZQCA 1SCWA 1KE4A 1I2SA 3BYDA 4FH4A 1ZC2A 3HLWA 3LY4A 3OCNA 4P6BA 5DTKA 4B4ZA 5HAQA 1HZOA 4ID4A 1NZUA 2XH9A 2ZC5B 3G4PA 1ESIA 3SS4A 4E3JA 1EI5A 3MZDA 1ALQA 1BLHA 3G32A 2JBFA 4GD8A 4OPQA 5HAIA 1MWTA 2H10A 3A3DA 3BFFA 1K6RA 3HREA 4BENA 2J9PA 1IYPA 3FZCA 4QD4A 3PBOA 1JWPA 2PBYA 2EX9A 1H8YA 3VP2A 1XA1A 4NK3A 3WS1A 4OH0A 1IKIA 3Q81A 1MY8A 1N4OA 2BG1A 4OLDA 1NYMA 1E4DA 4L0LA 4UA7A 1FCOA 1L0GA 4KZ4A 4MNRA 3UPPA 5FQJA 4R1GA 4RX2A 1YLWA 3CG5A 1HTZA 3SOIA 3O86A 5E2GA 3Q07A 2P9VA 2PU4A 5EPHA 4MBKA 4BL2A 3WRZA 4OONA 5CHUA 3UY6A 4WM9A 4MBHA 1PW8A 2OLVA 5IHVA 1PZOA 4KZ8A 1YLZA 2WAFA 4HBTA 1JVJA 4UHUA 3TG9A 1DY6A 1J9MA 4K91A 1DJCA 4LV1A 2V2FF 4GNUA 1MWRA 3FKVA 5KMWA 5E2EA 4R3BA 3IHBA 3IWOA 2Y2KA 2X01A 3GMWA 4A5RA 3BFGA 4YFMA 5FI6A 5CGWA 1YM1A 3IXHA 1XXMA 1W8YA 4NETA 4ZTKA 3O88A 5CTNA 2IWBA 5CEBA 3PBSA 3FKWA 3HL9A 3UNWA 4QHCA 5FA7A 3BLMA 1CI8A 5EECA 4MBFA 3BLSA 3CMZA 1ESUA 3VP0A 1GHIA 1IELA 1K57C 4ZAMA 3CJMA 5HL1A 1W8QA 2XGNA 4S2NA 1AXBA 4GDNA 1KGEA 3NDGA 1YMSA 3HUMA 2CC1A 4HEFA 5FQ9A 3ZG5A 3Q1FA 1K57A 2RCXA 1TVFA 5J8XA 5EVID 1YLTA 3BFEA 3HUNA 4KZ5A 3E2KA 5EOEA 5M18A 2HDRA 2J8YA 2XQZA 4Z9QA 4B4XA 4RX3A 4MLLA 3OPHA 3UDXA 3D4FA 3C7VA 3UO9A 4BLMA 3A3EA 4CPKA 2EX8A 2V20A 2RL3A 4OQ0A 2XFSA 2IWCA 3V3SA 4DXCA 1MWSA 4H8RA 4PMAA 3VFHA 3BFDA 2ZM0A 1LLBA 2WKEA 3MXSA 3PBQA 5CGXA 1C3BA 4BQMA 1PZPA 2ZQ7A 3IF5A 3HLEA 4R4RA 3ZFZA 1CEGA 2DCFA 3UE3A 2WYXA 1ERMA 1GA9A 2Y2PA 1IYOA 1EWZA 4U0XA 2XLNA 2Y55A 3NBLA 5HFOA 4EQIA 4EV4A 4X69A 3VFFA 2ZLYA 2Y2IA 3W8KA 2J9OA 1XP4A 1HD8A 3GTCA 4C75A 3DWZA 3IF6B 5EOOA 5GHYA 3ZNTA 2Y2NA 1PIOA 2C6WB 1PW1A 3IHAA 3IWIA 4KZ7A 3N4IA 3IH9A 2Z2LB 4KENB 4ZJ3A 5GHZA 3UDFA 3HUOA 3N7WA 3HBRA 1FR1A 5AQBA 4DXBA 1YQSA 1ONHA 2ZQAA 1E25A 4C6YA 1FQGA 1VQQA 1SDEA 1K55A 3VOZA 2WGWB 2WKHA 1KE0A 2E8IA 2ZQ8A 3GRJA 3S22A 3C4OA 1EROA 3ZDJA 3GSGA 4S2JA 4LV0A 2QPNA 4WZ5C 3EQVA 2WZXA 4XXRA 2Y2HA 1VM1A 2ZC6B 4OP5A 1PI5A 5CERA 2FFYA 3O3VA 1KGGA 3C4PA 1IYQA 4D2OA 4JKTA 3TSGA 3A3JA 5CTMA 3MXRA 4OPZA 3HLCA 2Y59A 2QMIA 2Y4AA 5DTTA 2B5RA 1MWUA 1NZOA 5HARA 1BUEA 3RJUA 1GHMA 3N8SA 4GD6A 4XUZA 3B3XA 4JPMA 1K6SA 3HLBA 3VSLA 2H0TA 5TGFA 1GA0A 4CJNA 4R23A 3ZG9B 4IEDA 3EQUA 4U0TA 4XUXA 1ES2A 5D3OA 1KDWA 3FWLA 3IF6C 1LL9A 1LI0A 2ZD8A 3VP3A 3GR2A 2ZC4B 4OOMA 4R3JA 3ZCZA 2WAEA 1FR6A 4K0XA 5CHJA 4EBNA 2EFUA 1H5XA 5U47A 4OQGA 4JBFA 4P87A 3A3IA 4JXVA 1WE4A 1IEMA 2Q9NA 3PBTA 4S2KA 4UAAA 2Y2OA 2XF3A 3IF6A 4WYYA 5FAOA 2IWDA 3VP4A 4B88A 3JYIA 1KGFA 5FAQA 2G2UA 4PM9A 1O7EA 5AQAA 3WS4A 4O7DA 4GOGA 1K56A 3S1YA 4EUZA 3BFCA 4ZBEA 2EXBA 3P98A 2PU2A 5F82A 1XGIA 3N8LA 5DF7A 4BD1A 5GHXA 4BL3A 4X68A 1NY0A 5DVAA 4IBXA 5F1FA 3AGEA 2HP6A 2ZMAA 1S0WA 4IVKA 4E3KA 1FCNA 1XA7A 3OPRA 4P0MA 1H8ZA 5EVIC 2WGWA 5FAPA 1K54C 5FI2A 1G68A 3OPPA 3ZVTA 4GN2A 4WBGA 3SH7A 5DF8A 3NY4A 2JE5A 4GDBA 5A92A 3BM6A 3W4OA 4Q8IA 2Y2QA 1E3UA 3W4QA 5F1GA 5I94A 1CK3A 3WS2A 1NRFA 1K25A 3I7JA 3LY3A 4FSFA 5DF9A 4ZJ1A 2UWXA 3ZG8B 4DDSA 3NI9A 1FCMA 3BRMA 3OPLA 4OVDA 2WZZA 2ZQ9A 3WS0A 1YLJA 4UA9A 2XEPA 1FOFA 3V3RA 3M2JA 5CEDA 3RXWA 1JTGA 4DE2A 1BLCA 1XX2A 2EFXA 4N9LA 1L2SA 4UA6A 3G2ZA 2XD1A 3MZFA 2OLUA 5GLAA 3C7UA 4PPRA 2Q9MA 1PWCA 1N9BA 4LV3A 1ZG6A 4WMCA 4JXGA 4WEKA 3OZHA 5CRFA 2WK0A 4QY5A 1K4FA 2EXAA 3ITAA 3DW0A 1I5QA 2WGVA 4JXSA 1PYYA 3VMAA 3N6IA 3PTEA 1K38A 5CHMA 5TR7A 5FQQA 1YLYA 2OV5A 4DDYA 5CECA 4HBUA 4OP8A 4IBRA 1BULA 4RA7A 3ISGA 4KG6A 4LCLA 3MZEA 1W7FA 2JCHA 3ZNYA 4KQRA 1Y54A 3OC2A 1SHVA 3Q7VB 4RYEA 1RGYA 5FQKA 5A91A 4N92A 3AGDA 3VOYA 3IT9A 3ZVWA 4OOLA 1DJAA
chains in the Genus database with same CATH superfamily
1S1ZA 5L8MA 1PWDA 1W79A 1L0FA 2Q0OA 1LT0A 4JGQA 3V67A 5L10A 1TS0A 4OPRA 3VSKA 5DTSA 2V0UA 1OTBA 5EUAA 3M6BA 5DKKA 3V39A 5EVIB 5M1AA 3UDIA 2PYRA 3N8RA 3P09A 4WZ5A 5HW3A 3RXXA 3M6HA 4PM5A 3UPNA 5L2FA 1IKGA 1XJ4A 1JTDA 1MPLA 5JYOA 2XD5A 4NXFA 3NDEA 1P97A 3QP1A 4Y15A 2GX5A 2ZM2A 5EE8A 4JF6A 4U3TA 4X53A 1ZHHB 3T12B 1ES3A 3SH8A 3FV7A 4JF4A 1MBLA 1CEFA 2QYBA 2VGJA 5HX9A 5KZHA 1VEUA 5AQ9A 3QP8A 2XR0A 2P04A 2ZM8A 2XFTA 5EVLA 1PI4A 3MQQA 1Q2PA 3HJIA 3A0VA 5FSRA 1K4EA 1IOUA 3A0RA 3IH8A 4DE0A 4GB7A 5FQMA 1G6OA 3MFXA 4HJ6A 4KZ3A 1JWZA 1OJGA 2GZAA 1K54A 3ITBA 1Z6FA 4ZDXA 4R4SA 4P85A 5HWTA 2VV8A 4HOIA 3BEBA 1H8MA 3T4LA 3TJZC 5HD5A 4CLCC 2A49A 2Y2MA 4KQQA 2H0YA 1ACFA 1DJBA 1KDSA 4ETXA 1N9NA 4PM6A 3S4XA 1KVLA 4NXGA 4O8GA 3T4QA 1U60A 5KSHA 3LUQA 1CI9A 4X56A 3LI8A 3H7WB 3BECA 1YPRA 3CI6A 4KZBA 1SDNA 4MN7A 3VP1A 1ES4A 5FEGA 4G3KA 1YMXA 2H5SA 2V8CA 2FH5A 4Z1WA 3UE0A 1MKIA 1T1CA 4WUJA 4WN5A 3QNCA 4E3LA 1BZAA 4Y0UA 4OKPA 3TOIA 1TF1A 4OQHA 2R78A 3HLDA 3L9KA 5E43A 4KQDA 3ZHHA 4BJPA 4IUHA 2M1CA 2WKIA 4IVIA 4PM8A 4K0WA 2ZQCA 1I2SA 3BYDA 3T4SA 5KIZA 3HLWA 3OCNA 4P6BA 1V9YA 1HZOA 1NZUA 3UB8A 3G4PA 1ESIA 1EI5A 1ALQA 1BLHA 2GJ3A 4GD8A 5HAIA 4HQAA 2W3DA 1JWPA 4L9FA 1H8YA 4NK3A 4OH0A 1WA9A 5HDCA 1MY8A 1N4OA 2NUTC 1DP8A 4UA7A 4CLCB 3BJNA 4NKPA 4MNRA 3MQOA 1EW0A 4E04A 1Y4OA 2PU4A 4MBKA 3WRZA 4PHTA 5CHUA 3UY6A 2V1BA 3IX8A 2OLVA 1JVJA 2V2FF 4XT2B 2KDKA 4MN5A 5CX7A 5EFWA 3BFGA 1NLZA 1P9WA 4G3VA 3B47A 1XXMA 3C8CA 4F3LB 3JVVA 2JKTM 3O88A 4QHCA 1CI8A 2B02A 5IU1A 3VP0A 5FL3A 4ZAMA 2PR6A 1W8QA 4S2NA 1D1JA 4ETZA 1BYWA 4Q0JA 4LFUA 1AXBA 4GDNA 4UEYA 4GLQA 5IT5A 3NDGA 2W27A 4FTXA 1K57A 4ZRRA 2GNXA 4KZ5A 2HDRA 3LIBA 4RX3A 3OPHA 3D4FA 3A3EA 4I3IA 1UWNX 3IS2B 2EX8A 4OQ0A 1MWSA 4PMAA 4WL9A 3BFDA 1C3BA 2ZQ7A 1ERMA 1GA9A 2VGLM 1IYOA 1EWZA 4U0XA 2Y55A 4EQIA 3NBLA 3VFFA 3W8KA 5EVEA 3H82A 3DWZA 5EOOA 2W1TA 5GHYA 3ZNTA 1XFNA 3DTIA 1PIOA 3IHAA 3IWIA 2KLIA 4KZ7A 3N4IA 1CJFA 3IH9A 1DRMA 4BWIA 3HUOA 3HBRA 5AQBA 4PKYA 1K55A 1SKOA 2VV7A 3GRJA 3S22A 1EROA 3GSGA 3P7NA 4S2JA 4LV0A 2QPNA 3EWKA 1PI5A 3O3VA 1IYQA 3IBJA 4JKTA 3TSGA 5CTMA 3A0SA 3OBFA 2JKRI 2Y59A 2Y4AA 2B5RA 1MWUA 3NOPC 2ZL1B 1T1AA 5HARA 3RJUA 4GD6A 1K6SA 1XFQA 5L09A 2KX6A 3ZG9B 3MF0A 5D3OA 1KDWA 3FWLA 3GR2A 1D7EA 2ZC4B 4OOMA 2WAEA 3MJQA 4I38A 5I5LA 5CHJA 4EBNA 4JXVA 4S2KA 5HPIA 2Y2OA 3CITA 3VP4A 4B88A 4PM9A 1O7EA 5AQAA 3WS4A 3QP4A 4GOGA 4EUZA 2EXBA 4FUWA 3EOIA 2LB9A 3JVUA 4BL3A 1LSVA 5DVAA 5IS1A 3AGEA 2VX8A 4IVKA 4X1MA 3OPRA 3ZVTA 3NY4A 2JE5A 3BM6A 3W4QA 5F1GA 1CK3A 3I7JA 3LR3A 3LY3A 5DF9A 4ZJ1A 3ZG8B 3K2NA 3CWFA 3V3RA 3JPUA 4DE2A 1BLCA 3CPTA 4N9LA 3C7UA 1PWCA 3MQ0A 5HSQA 3NULA 3K3CA 4LV3A 2OAQ1 1OJ5A 2INWA 2WK0A 1S4SA 4QY5A 1K4FA 2PD7A 1YLYA 1BULA 3ISGA 3MZEA 1CF0A 1W7FA 2O9AA 2JCHA 4KQRA 1Y54A 3LI9A 2VZWA 4BBVA 3KO6A 4RYEA 1DJAA 2JC7A 3RTYA 1O07A 1JWVA 1NWZA 3W4PA 4ARZB 1GSXA 3ZGAB 4LV2A 3MKEA 1IYSA 4GKUA 2WGIA 1DP9A 3C5AA 3OOVA 2ZMVA 4KZ9A 1LI9A 1YSQA 4EBPA 4KZ6A 4IUKA 4S2PA 3HCYA 3V5MA 4QY6A 1VETB 5F83A 2QZ6A 5HWWA 4FH2A 5HAPA 3SZTA 4WLAA 4WZ4A 4OOYA 2XDMA 3F1PA 1M40A 3NIAA 1NYYA 4OQIA 4QU3A 1DP6A 2WKRA 1W5DA 2V8FA 3UPOA 2J7VA 2GDNA 5G4YA 2Y91A 3SS5A 4E3MA 4Q0IA 4O01A 2HDQA 5FDSA 2G2WA 3Q7VA 2VK3A 4WELA 3U2AA 4LRZE 4IHQA 5MC7A 4S2MA 2WUQA 2A3UA 1S4RA 4FCFA 4KQOA 2Z2MB 1XKZA 3G34A 2B18A 3ZG7B 1P0ZA 3GVBA 1A0KA 2EA9A 4I3AA 2R9XA 1NJ4A 3PAEA 1M6KA 4X6TA 3MSHA 4OPYA 4DRTA 3LO7A 4HJ3A 2V1ZA 1BLSA 1T19A 1I2WA 1UWPX 4PM7A 5HPFA 4B93A 2BASA 3F1OB 1G6AA 3NJAA 3AGFA 3B42A 1TDGA 4KG5A 5C5KA 2HP9A 4GZBA 4LENA 2VGKA 1OMEA 4R0QA 3GQZA 3HVFA 3IQAA 2J3TD 4DE3A 3LEQA 4BBTA 2L1MA 4K08A 3VE3A 5FATA 1H3QA 2R9WA 5DJUA 3LFVA 2ZJ9A 4CPKA 3G35A 3V50A 3MKFA 3HLFA 1FSYA 4EBLA 5HDDA 2OWHA 3IXBA 5TBMA 3SS3A 1L0EA 1KE4A 2IA2A 3VE4A 3LY4A 5DTKA 4B4ZA 5HAQA 4JGRA 2M7UA 2HF6A 4CLCE 2ZC5B 3IX4A 2JBFA 4KUKA 3HREA 4L9EA 5DFYA 4X1LA 2PBYA 3T4JA 1XA1A 1IKIA 3Q81A 4EEUA 1E4DA 2ZOIA 2XA7M 4Q0HA 1FCOA 1L0GA 2I9VA 3ZQ5A 4R1GA 1YLWA 1HTZA 2A24A 4H6JB 2PYPA 2P9VA 4BL2A 3LICA 4OONA 2XROA 4HNBA 4WM9A 4MBHA 5IHVA 1PZOA 1YLZA 4HBTA 4UHUA 1LL8A 4GNUA 3FKVA 4R3BA 3TW8A 2Y2KA 4EXOA 1G28A 1W8YA 4NETA 4ZTKA 5CTNA 3PBSA 3FKWA 3FG8A 3HL9A 3ULFA 5FA7A 3BLMA 4MBFA 2O0YA 1IELA 5DFXA 1H0MA 2XGNA 1OTDA 3UB7A 1YMSA 3HUMA 2B95A 2CC1A 4HP4A 2RCXA 1TVFA 2ZOHA 2XQZA 4B4XA 2VJWA 3C7VA 2JKGA 1STZA 3D3OA 2RL3A 2IWCA 3V3SA 1LSWA 5CGXA 1PZPA 2MJ6A 1TS7A 3MMHA 3ZFZA 1CEGA 3R7WA 2DCFA 4GHIB 3UE3A 4X69A 2J9OA 4C75A 3IF6B 4ME4A 3GECA 2Y2NA 4HJ4A 2L0WA 2Z2LB 4KENB 1FR1A 4DXBA 1ONHA 2ZQAA 1E25A 4EESA 1FQGA 2D02A 1SDEA 4NEED 2WGWB 1KE0A 1VB6A 4HHDA 2ZQ8A 4WZ5C 2HGVA 2WZXA 4XXRA 4D2OA 2PR5A 2ZBBA 4I3JA 3BWLA 4DJ2A 1BUEA 3B3XA 5DKLA 4JPMA 3HLBA 1TD5A 3FC7A 1GA0A 4R23A 4IEDA 2JHEA 2W3GA 5EM1A 4XUXA 1ES2A 2ZD8A 3UB6A 3VP3A 3ZCZA 4R3JA 5U47A 1H5XA 4JBFA 5EM0A 1IEMA 2Q9NA 4UAAA 4Y13A 2OAP1 4WYYA 1W63Q 1KGFA 3BFCA 4ZBEA 3P98A 4IJGA 4BD1A 5F1FA 2HP6A 4P6ZS 1S0WA 4P0MA 1H8ZA 1K54C 5FI2A 3OPPA 2L4RA 3W2ZA 4GN2A 3LIFA 3W4OA 1K25A 4OVDA 1FILA 2VA0A 2OWJA 4UA9A 3M2JA 3RXWA 2QKPA 1P9RA 1YSPA 4EU0A 4UQIS 3KYQA 4UA6A 3G2ZA 2XD1A 1MC0A 4MCWA 1K0KA 3DAVA 2K7SA 2E8JA 1XJ6A 3F1NA 4WMCA 4JXGA 2JKRM 4WEKA 5CRFA 3DW0A 4X25A 2WGVA 3VMAA 3N6IA 3PTEA 1K38A 4GS9A 2OV5A 4DDYA 4OP8A 1VEUB 1SZVA 1MKMA 3OC2A 4JGOA 5A91A 3VOYA 1S66L 4OOLA 3ZVWA 3PR6A 4DKIA 3CUEC 3T1QB 4E6XA 1UGUA 2X71A 2HP5A 3LEZA 3KSGA 3NCKA 3QNBA 4QPRA 3EGXC 2W1RA 4HESA 5GLBA 1N9LA 1YLPA 4ZJ2A 2FFFB 4RQ9A 3RH8B 2XA7S 5E2FA 3NECA 4Y0TA 5TFQA 3PAGA 3UN7A 2OSUA 3BY9A 5CGSA 3UB9A 5HZHA 5AVFA 1GCEA 3PBNA 2I72A 2ZQDA 1ONGA 1NXYA 4QWOA 4PAUA 2PDRA 2EX2A 2Y2JA 3IXGA 3O5YA 3EGDC 3QP6A 2QJ7A 4N9KA 4YWZA 4BD0A 3IX3A 1AWIA 3LYXA 3C38A 5KSCA 5F6AA 4E6WA 3HLGA 3IWQA 3T4KA 1RCJA 3PXPA 4JF5A 3TE8A 3OLOA 4E3NA 4DF6A 2HPBA 3G31A 1TEMA 2W3EA 3LR0A 3KSFA 3MFDA 3QHYA 1XPBA 2Y2LA 4S2NC 2K2NA 5EVIA 5E2HA 3MBZA 1OTIA 1ZG4A 3WRTA 1GHPA 4EEPA 4MMNA 3GV9A 4JXWA 4EWFA 1KVMA 3DTEA 5GL9A 2BLSA 4KG2A 5AJGA 1ZKJA 2VLGA 4HI4A 4FD8A 1BT5A 3SH9A 3O87A 3KYEA 4WEJA 1L0DA 2NUPC 5JYPA 3D72A 1OTEA 1HVBA 4E3IA 4LLOB 4KUOA 4GW9A 2Y8HA 2YKHA 4DE1A 4QJGA 4F94A 2VKSA 5M19A 2HJ9C 4WMCD 1WYBA 4YFMA 1BSGA 2DRWA 1QMFA 3C2WA 1D06A 1V9ZA 3ICYA 4L9GA 5FASA 1ES5A 4JLFA 5CXWA 1MXOA 1K55C 1G5UA 2KOIA 2PAVP 1YT4A 3LCEA 4GJ4A 3D9YA 1SCWA 3LR4A 3UMDA 2EWWA 4ID4A 2XH9A 4E3JA 3MZDA 4OPQA 3G32A 1YKDA 1MWTA 2H10A 3A3DA 1K6RA 2HZ5A 2J9PA 1IYPA 4HY8A 3VP2A 1HLUP 5J3WA 1OTAA 2BG1A 4OLDA 2CMNA 3MR0A 3UPPA 3E4OA 5FQJA 1LSXA 4RX2A 3O86A 1S67L 3Q07A 5EPHA 2PHYA 4I39A 3H7WA 2WAFA 2D01A 3TG9A 1J9MA 4K91A 1DJCA 3H82B 4LV1A 1MWRA 2W1TB 5E2EA 2M7VA 4GS9B 3T1SA 1OT6A 3GMWA 5FI6A 4I5SA 1YM1A 1F98A 2IWBA 5CEBA 4P6ZM 5HDSA 3UNWA 3L7HA 1SKOB 1GHIA 2YKFA 3CJMA 5HL1A 2PRFA 4FOFA 2VV6A 3NOUC 5FQ9A 3Q1FA 4HH3A 5EVID 2H28A 3BFEA 3HUNA 3LGOA 4Z9QA 4MLLA 3UO9A 4BLMA 4UQIM 4CLCA 1Z09A 2JKFA 5F68A 5K5BA 3VFHA 3QP2A 1IFQA 4BQMA 3PBQA 1KOUA 3HLEA 4EV4A 4M4XA 1HD8A 4XT2A 2PBDP 2C6WB 1CQAA 4ZJ3A 5GHZA 4NXBA 4JGPA 4F3LA 3S7PA 3KSHA 4C6YA 1VQQA 5F5YA 3VOZA 4EQ1A 2WKHA 2E8IA 4EERA 4MDZA 2DMWA 3C4OA 3LIDA 3EQVA 2EWVA 2ZC6B 1VM1A 4OP5A 5CERA 2FFYA 1KGGA 1F5MA 4OPZA 3PHYA 3DTKA 4HH2A 1NZOA 1TS6A 2ACGA 3KSIA 1GHMA 4EETB 3IS2A 3CPTB 5TGFA 4R70A 4CJNA 3EQUA 4U0TA 3IF6C 1LL9A 1LI0A 3QP5A 1PRQA 3LIAA 4P87A 3SW1A 3PBTA 5FAOA 2XF3A 3HJKA 3JYIA 5FAQA 2G2UA 4WF0A 4LRYC 1K56A 3S1YA 1S1YA 5F69A 2PU2A 1XGIA 3N8LA 5DF7A 5GHXA 1NY0A 4IBXA 2ZMAA 5FAPA 4R38A 4II7A 3BQAA 3C30A 5DF8A 4GDBA 5A92A 2G7UA 2Y2QA 1E3UA 5I94A 3WS2A 4FSFA 2UWXA 2XSSA 4DDSA 3NI9A 3S7QA 1FCMA 3BRMA 3OPLA 2QHKA 2ZQ9A 2J80A 2XEPA 1FOFA 4Y3IA 2ZL1A 5CEDA 5A8BA 1L3LA 3RFBA 3VV4A 4PPRA 2Q9MA 1MZUA 3F1PB 4Y17A 1N9BA 1ZG6A 4CLCD 3OZHA 5HWVA 2EXAA 2O9CA 3ITAA 5TR7A 4LPZA 4GCZA 5CHMA 5CECA 4IBRA 5EV0A 4KG6A 3PYPA 3BQ8A 3H9WA 3BW6A 2Z6DA 1SHVA 3Q7VB 5AVEA 4N92A 3AGDA 3IT9A 2PD8A 1FIKA 5GLDA 2A2LA 4R6LA 5HL6A 1LL5A 1BLPA 2ZC3B 4NG2A 4RVAA 1XGJA 4LCMA 3CUEA 3MS6A 3FYZA 3G2YA 4BBUA 3WWXA 2K31A 2XK1A 3IXDA 4KZAA 3E98A 3UE1A 4OLGA 2Y2GA 5FI7A 2BTFP 3T4OA 3WS5A 1FSWA 1PNEA 4S2OA 3GDIA 1ERQA 2DNSA 1SKFA 2XRNA 1NLYA 4C3QA 1RP5A 2WADA 3G30A 1RGZA 2WKPA 2ZC7A 4YINA 1KE3A 4CQHA 2X02A 3K3DA 3NC8A 2O9BA 3PBRA 2P08A 3E2LA 3M2KA 4E3OA 2JN7A 5TBMB 4Y7PA 4B9OA 4BMWA 4M3KA 3ZYTA 4ARZA 1K56D 4HP9A 5G18A 3T50A 3CAXA 5A93A 4S2LA 4X55A 1XJ3A 3CHWP 2HDSA 4S2IA 5FDHA 3Q82A 4QB8A 2HDUA 1PWGA 1E3UD 1YAXA 4EUVA 3S7OA 1VETA 3A3FA 4MEZA 2W3HA 3NOTC 3CZDA 1WYCA 3DTMA 2A24B 2P9VB 1GSVA 3OCLA 2C5WB 2JKTI 5FQIA 1NRJA 1TDLA 1BTLA 5AQ7A 5J7EA 5BOHA 1Q2QA 3S7NA 3ZG0A 1JNUA 1S6RA 2P74A 3KYZA 4Y0OA 4N1XA 2EX6A 3DWKA 4N1HA 5GLCA 2HV1A 3Q7ZA 4YNRA 5A90A 5FEFA 1QMEA 4AFIA 2Z6CA 1LHYA 3LR5A 4FH4A 1ZC2A 1PFLA 1OPXA 3SS4A 3BFFA 4DMZA 1F9IA 4BENA 3FZCA 4QD4A 3PBOA 2EX9A 3NHQA 3WS1A 1NYMA 4L0LA 3E4QA 4G3WA 3F1OA 4KZ4A 3CG5A 2V0WA 3SOIA 5E2GA 5J4EA 4ESPA 1OT9A 5L07A 3R7WB 1PW8A 2QJ5A 4KZ8A 3EEHA 1DY6A 5KMWA 3IHBA 3IWOA 2V9AA 2X01A 4NXEA 4A5RA 1W63M 5CGWA 3IXHA 2W3FA 3BY8A 2W0NA 4Y2FA 5EECA 3BLSA 3CMZA 3E4PA 1ESUA 4DN0A 1K57C 3CLOA 1KGEA 4HEFA 2PT7A 3ZG5A 2UV0E 5J8XA 1Y28A 1YLTA 3UE6A 3E2KA 5EOEA 5M18A 2J8YA 1N9OA 3UDXA 3UB5P 3T1RA 4D60A 2OOLA 3LIEA 4DJ3A 2V20A 4LRXC 2XFSA 4DXCA 4H8RA 4O0PA 3U4LP 2ZM0A 4H6JA 1LLBA 2WKEA 3MXSA 3IF5A 4R4RA 3E0YA 2WYXA 2V1AA 2Y2PA 2Y79A 3FPVA 5LBRA 1J3WA 2XLNA 5HFOA 3TRCA 2ZLYA 2Y2IA 5DJTA 1XP4A 2AVXA 3GTCA 2LB5A 1PW1A 1TS8A 3UMEA 4PKYG 3UDFA 3N7WA 1YQSA 1ZTUA 5TJJA 4Y5FA 3ZDJA 4LGWA 2Y2HA 3C4PA 1XJ2A 3FPWA 3A3JA 3MXRA 3HLCA 2QMIA 5DTTA 1VHMA 5G4ZA 3N8SA 4XUZA 3VSLA 4MN6A 2H0TA 2QWSA 3EEAA 3F1NB 2WKQA 3R4KA 2J3WA 3T4TA 4GHIA 3G6OA 1FR6A 4K0XA 1F2KA 2EFUA 4OQGA 3A3IA 1WE4A 3T1XA 3IF6A 2IWDA 4O7DA 5F82A 4X68A 4E3KA 1FCNA 1XA7A 1GSWA 5EVIC 2WGWA 2ZMFA 1G68A 3VOLA 4WBGA 3SH7A 1T1BA 3IBRA 4HIAA 4Q8IA 1NRFA 2WZZA 1X0OA 3WS0A 1YLJA 2VEAA 2P7JA 2J3TC 3P01A 4R3AA 5HD3A 3B33A 1JTGA 2HJEA 1ODVA 1XX2A 2EFXA 1L2SA 3MZFA 2OLUA 5GLAA 2O99A 4YOFA 3KX0X 3MXQA 1I5QA 4JXSA 1PYYA 2VGLS 2FZ0A 5FQQA 4HBUA 3DBAA 4RA7A 4LCLA 3ZNYA 4EW7A 1RGYA 5FQKA 1T18A
chains in the Genus database with same CATH topology
4DKIA 2JC7A 5GLDA 1PWDA 1W79A 1O07A 1L0FA 4E6XA 1JWVA 3W4PA 1LL5A 4OPRA 3VSKA 5DTSA 2X71A 2HP5A 1BLPA 2ZC3B 3LEZA 5EUAA 3M6BA 4RVAA 3NCKA 3V39A 5EVIB 3ZGAB 1XGJA 5M1AA 4LCMA 4LV2A 3QNBA 3MKEA 1IYSA 3UDIA 3FYZA 3G2YA 4GKUA 2WGIA 3C5AA 3WWXA 3N8RA 4HESA 3P09A 4WZ5A 5GLBA 5HW3A 3RXXA 1YLPA 2XK1A 3IXDA 3M6HA 4KZ9A 4ZJ2A 4PM5A 3UPNA 4KZAA 1LI9A 2FFFB 4EBPA 5L2FA 4KZ6A 1IKGA 1JTDA 1MPLA 5JYOA 3UE1A 2XD5A 3NDEA 4S2PA 4OLGA 2Y2GA 5E2FA 3V5MA 4Y0TA 2ZM2A 4QY6A 5FI7A 5EE8A 5F83A 3PAGA 5TFQA 4JF6A 3UN7A 2OSUA 2QZ6A 4U3TA 5CGSA 4FH2A 3WS5A 1FSWA 4X53A 5HAPA 1GCEA 3PBNA 2I72A 2ZQDA 4WZ4A 4OOYA 1ONGA 2XDMA 4S2OA 1NXYA 1ERQA 2DNSA 1M40A 3NIAA 1ES3A 1NYYA 4OQIA 3SH8A 1SKFA 3FV7A 4QU3A 4JF4A 2EX2A 2Y2JA 1W5DA 3IXGA 4C3QA 3UPOA 1MBLA 2J7VA 4N9KA 1CEFA 1RP5A 2GDNA 2VGJA 2Y91A 2WADA 3SS5A 4BD0A 5HX9A 4E3MA 5KZHA 5AQ9A 3G30A 5KSCA 2XR0A 4E6WA 1RGZA 2ZM8A 3HLGA 3IWQA 2XFTA 2HDQA 5EVLA 1PI4A 2ZC7A 1KE3A 2G2WA 4YINA 1Q2PA 2X02A 1RCJA 3Q7VA 3NC8A 4JF5A 4WELA 4E3NA 4DF6A 2HPBA 3PBRA 4S2MA 3E2LA 2WUQA 1TEMA 1K4EA 2A3UA 3G31A 3M2KA 5FSRA 4E3OA 3IH8A 4FCFA 4KQOA 4DE0A 4Y7PA 4GB7A 5FQMA 3MFDA 4M3KA 2Z2MB 1K56D 1XKZA 3G34A 5G18A 3QHYA 1XPBA 2Y2LA 4KZ3A 4S2NC 1JWZA 3ZG7B 5EVIA 5E2HA 1K54A 3ITBA 1Z6FA 3MBZA 5A93A 1ZG4A 4S2LA 3WRTA 1GHPA 4X55A 3GVBA 4ZDXA 4R4SA 2R9XA 4P85A 3GV9A 1NJ4A 3PAEA 1M6KA 1KVMA 4JXWA 4X6TA 2HDSA 4EWFA 4S2IA 5GL9A 5FDHA 3BEBA 2BLSA 4KG2A 4OPYA 4DRTA 1ZKJA 3Q82A 4QB8A 2HDUA 3LO7A 1PWGA 2V1ZA 1BLSA 1E3UD 4FD8A 1BT5A 1I2WA 3SH9A 4PM7A 2A49A 3O87A 2Y2MA 4KQQA 1L0DA 2H0YA 4WEJA 1DJBA 1G6AA 1KDSA 3AGFA 1TDGA 4KG5A 5JYPA 3A3FA 4MEZA 4PM6A 3CZDA 1WYCA 2HP9A 4GZBA 3S4XA 4LENA 1KVLA 3DTMA 2P9VB 2VGKA 1OMEA 1U60A 3OCLA 1HVBA 2C5WB 5KSHA 5FQIA 4E3IA 1CI9A 4R0QA 4X56A 3GQZA 3HVFA 3IQAA 4DE1A 1TDLA 4QJGA 3BECA 4DE3A 4F94A 1BTLA 4KZBA 5AQ7A 5BOHA 1SDNA 5M19A 1Q2QA 5FATA 3VP1A 1ES4A 3ZG0A 4WMCD 1S6RA 2P74A 2R9WA 4Y0OA 1WYBA 2ZJ9A 4N1XA 2EX6A 3DWKA 1BSGA 3G35A 2DRWA 4N1HA 1YMXA 2H5SA 5GLCA 3UE0A 1QMFA 3V50A 3Q7ZA 1MKIA 5FASA 5A90A 1ES5A 4JLFA 5CXWA 1MXOA 3QNCA 3MKFA 1BZAA 1FSYA 3HLFA 4Y0UA 1K55C 4EBLA 4E3LA 4OKPA 3TOIA 4OQHA 3HLDA 5E43A 3IXBA 3ZHHA 4BJPA 1QMEA 2WKIA 4IVIA 4PM8A 4K0WA 1YT4A 3SS3A 1L0EA 1LHYA 3LCEA 2ZQCA 1SCWA 1KE4A 1I2SA 3BYDA 4FH4A 1ZC2A 3HLWA 3LY4A 3OCNA 4P6BA 5DTKA 4B4ZA 5HAQA 1HZOA 4ID4A 1NZUA 2XH9A 2ZC5B 3G4PA 1ESIA 3SS4A 4E3JA 1EI5A 3MZDA 1ALQA 1BLHA 3G32A 2JBFA 4GD8A 4OPQA 5HAIA 1MWTA 2H10A 3A3DA 3BFFA 1K6RA 3HREA 4BENA 2J9PA 1IYPA 3FZCA 4QD4A 3PBOA 1JWPA 2PBYA 2EX9A 1H8YA 3VP2A 1XA1A 4NK3A 3WS1A 4OH0A 1IKIA 3Q81A 1MY8A 1N4OA 2BG1A 4OLDA 1NYMA 1E4DA 4L0LA 4UA7A 1FCOA 1L0GA 4KZ4A 4MNRA 3UPPA 5FQJA 4R1GA 4RX2A 1YLWA 3CG5A 1HTZA 3SOIA 3O86A 5E2GA 3Q07A 2P9VA 2PU4A 5EPHA 4MBKA 4BL2A 3WRZA 4OONA 5CHUA 3UY6A 4WM9A 4MBHA 1PW8A 2OLVA 5IHVA 1PZOA 4KZ8A 1YLZA 2WAFA 4HBTA 1JVJA 4UHUA 3TG9A 1DY6A 1J9MA 4K91A 1DJCA 4LV1A 2V2FF 4GNUA 1MWRA 3FKVA 5KMWA 5E2EA 4R3BA 3IHBA 3IWOA 2Y2KA 2X01A 3GMWA 4A5RA 3BFGA 4YFMA 5FI6A 5CGWA 1YM1A 3IXHA 1XXMA 1W8YA 4NETA 4ZTKA 3O88A 5CTNA 2IWBA 5CEBA 3PBSA 3FKWA 3HL9A 3UNWA 4QHCA 5FA7A 3BLMA 1CI8A 5EECA 4MBFA 3BLSA 3CMZA 1ESUA 3VP0A 1GHIA 1IELA 1K57C 4ZAMA 3CJMA 5HL1A 1W8QA 2XGNA 4S2NA 1AXBA 4GDNA 1KGEA 3NDGA 1YMSA 3HUMA 2CC1A 4HEFA 5FQ9A 3ZG5A 3Q1FA 1K57A 2RCXA 1TVFA 5J8XA 5EVID 1YLTA 3BFEA 3HUNA 4KZ5A 3E2KA 5EOEA 5M18A 2HDRA 2J8YA 2XQZA 4Z9QA 4B4XA 4RX3A 4MLLA 3OPHA 3UDXA 3D4FA 3C7VA 3UO9A 4BLMA 3A3EA 4CPKA 2EX8A 2V20A 2RL3A 4OQ0A 2XFSA 2IWCA 3V3SA 4DXCA 1MWSA 4H8RA 4PMAA 3VFHA 3BFDA 2ZM0A 1LLBA 2WKEA 3MXSA 3PBQA 5CGXA 1C3BA 4BQMA 1PZPA 2ZQ7A 3IF5A 3HLEA 4R4RA 3ZFZA 1CEGA 2DCFA 3UE3A 2WYXA 1ERMA 1GA9A 2Y2PA 1IYOA 1EWZA 4U0XA 2XLNA 2Y55A 3NBLA 5HFOA 4EQIA 4EV4A 4X69A 3VFFA 2ZLYA 2Y2IA 3W8KA 2J9OA 1XP4A 1HD8A 3GTCA 4C75A 3DWZA 3IF6B 5EOOA 5GHYA 3ZNTA 2Y2NA 1PIOA 2C6WB 1PW1A 3IHAA 3IWIA 4KZ7A 3N4IA 3IH9A 2Z2LB 4KENB 4ZJ3A 5GHZA 3UDFA 3HUOA 3N7WA 3HBRA 1FR1A 5AQBA 4DXBA 1YQSA 1ONHA 2ZQAA 1E25A 4C6YA 1FQGA 1VQQA 1SDEA 1K55A 3VOZA 2WGWB 2WKHA 1KE0A 2E8IA 2ZQ8A 3GRJA 3S22A 3C4OA 1EROA 3ZDJA 3GSGA 4S2JA 4LV0A 2QPNA 4WZ5C 3EQVA 2WZXA 4XXRA 2Y2HA 1VM1A 2ZC6B 4OP5A 1PI5A 5CERA 2FFYA 3O3VA 1KGGA 3C4PA 1IYQA 4D2OA 4JKTA 3TSGA 3A3JA 5CTMA 3MXRA 4OPZA 3HLCA 2Y59A 2QMIA 2Y4AA 5DTTA 2B5RA 1MWUA 1NZOA 5HARA 1BUEA 3RJUA 1GHMA 3N8SA 4GD6A 4XUZA 3B3XA 4JPMA 1K6SA 3HLBA 3VSLA 2H0TA 5TGFA 1GA0A 4CJNA 4R23A 3ZG9B 4IEDA 3EQUA 4U0TA 4XUXA 1ES2A 5D3OA 1KDWA 3FWLA 3IF6C 1LL9A 1LI0A 2ZD8A 3VP3A 3GR2A 2ZC4B 4OOMA 4R3JA 3ZCZA 2WAEA 1FR6A 4K0XA 5CHJA 4EBNA 2EFUA 1H5XA 5U47A 4OQGA 4JBFA 4P87A 3A3IA 4JXVA 1WE4A 1IEMA 2Q9NA 3PBTA 4S2KA 4UAAA 2Y2OA 2XF3A 3IF6A 4WYYA 5FAOA 2IWDA 3VP4A 4B88A 3JYIA 1KGFA 5FAQA 2G2UA 4PM9A 1O7EA 5AQAA 3WS4A 4O7DA 4GOGA 1K56A 3S1YA 4EUZA 3BFCA 4ZBEA 2EXBA 3P98A 2PU2A 5F82A 1XGIA 3N8LA 5DF7A 4BD1A 5GHXA 4BL3A 4X68A 1NY0A 5DVAA 4IBXA 5F1FA 3AGEA 2HP6A 2ZMAA 1S0WA 4IVKA 4E3KA 1FCNA 1XA7A 3OPRA 4P0MA 1H8ZA 5EVIC 2WGWA 5FAPA 1K54C 5FI2A 1G68A 3OPPA 3ZVTA 4GN2A 4WBGA 3SH7A 5DF8A 3NY4A 2JE5A 4GDBA 5A92A 3BM6A 3W4OA 4Q8IA 2Y2QA 1E3UA 3W4QA 5F1GA 5I94A 1CK3A 3WS2A 1NRFA 1K25A 3I7JA 3LY3A 4FSFA 5DF9A 4ZJ1A 2UWXA 3ZG8B 4DDSA 3NI9A 1FCMA 3BRMA 3OPLA 4OVDA 2WZZA 2ZQ9A 3WS0A 1YLJA 4UA9A 2XEPA 1FOFA 3V3RA 3M2JA 5CEDA 3RXWA 1JTGA 4DE2A 1BLCA 1XX2A 2EFXA 4N9LA 1L2SA 4UA6A 3G2ZA 2XD1A 3MZFA 2OLUA 5GLAA 3C7UA 4PPRA 2Q9MA 1PWCA 1N9BA 4LV3A 1ZG6A 4WMCA 4JXGA 4WEKA 3OZHA 5CRFA 2WK0A 4QY5A 1K4FA 2EXAA 3ITAA 3DW0A 1I5QA 2WGVA 4JXSA 1PYYA 3VMAA 3N6IA 3PTEA 1K38A 5CHMA 5TR7A 5FQQA 1YLYA 2OV5A 4DDYA 5CECA 4HBUA 4OP8A 4IBRA 1BULA 4RA7A 3ISGA 4KG6A 4LCLA 3MZEA 1W7FA 2JCHA 3ZNYA 4KQRA 1Y54A 3OC2A 1SHVA 3Q7VB 4RYEA 1RGYA 5FQKA 5A91A 4N92A 3AGDA 3VOYA 3IT9A 3ZVWA 4OOLA 1DJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DKI A;  2JC7 A;  5GLD A;  1PWD A;  1W79 A;  1O07 A;  1L0F A;  4E6X A;  1JWV A;  3W4P A;  1LL5 A;  4OPR A;  3VSK A;  5DTS A;  2X71 A;  2HP5 A;  1BLP A;  2ZC3 B;  3LEZ A;  5EUA A;  3M6B A;  4RVA A;  3NCK A;  3V39 A;  5EVI B;  3ZGA B;  1XGJ A;  5M1A A;  4LCM A;  4LV2 A;  3QNB A;  3MKE A;  1IYS A;  3UDI A;  3FYZ A;  3G2Y A;  4GKU A;  2WGI A;  3C5A A;  3WWX A;  3N8R A;  4HES A;  3P09 A;  4WZ5 A;  5GLB A;  5HW3 A;  3RXX A;  1YLP A;  2XK1 A;  3IXD A;  3M6H A;  4KZ9 A;  4ZJ2 A;  4PM5 A;  3UPN A;  4KZA A;  1LI9 A;  2FFF B;  4EBP A;  5L2F A;  4KZ6 A;  1IKG A;  1JTD A;  1MPL A;  5JYO A;  3UE1 A;  2XD5 A;  3NDE A;  4S2P A;  4OLG A;  2Y2G A;  5E2F A;  3V5M A;  4Y0T A;  2ZM2 A;  4QY6 A;  5FI7 A;  5EE8 A;  5F83 A;  3PAG A;  5TFQ A;  4JF6 A;  3UN7 A;  2OSU A;  2QZ6 A;  4U3T A;  5CGS A;  4FH2 A;  3WS5 A;  1FSW A;  4X53 A;  5HAP A;  1GCE A;  3PBN A;  2I72 A;  2ZQD A;  4WZ4 A;  4OOY A;  1ONG A;  2XDM A;  4S2O A;  1NXY A;  1ERQ A;  2DNS A;  1M40 A;  3NIA A;  1ES3 A;  1NYY A;  4OQI A;  3SH8 A;  1SKF A;  3FV7 A;  4QU3 A;  4JF4 A;  2EX2 A;  2Y2J A;  1W5D A;  3IXG A;  4C3Q A;  3UPO A;  1MBL A;  2J7V A;  4N9K A;  1CEF A;  1RP5 A;  2GDN A;  2VGJ A;  2Y91 A;  2WAD A;  3SS5 A;  4BD0 A;  5HX9 A;  4E3M A;  5KZH A;  5AQ9 A;  3G30 A;  5KSC A;  2XR0 A;  4E6W A;  1RGZ A;  2ZM8 A;  3HLG A;  3IWQ A;  2XFT A;  2HDQ A;  5EVL A;  1PI4 A;  2ZC7 A;  1KE3 A;  2G2W A;  4YIN A;  1Q2P A;  2X02 A;  1RCJ A;  3Q7V A;  3NC8 A;  4JF5 A;  4WEL A;  4E3N A;  4DF6 A;  2HPB A;  3PBR A;  4S2M A;  3E2L A;  2WUQ A;  1TEM A;  1K4E A;  2A3U A;  3G31 A;  3M2K A;  5FSR A;  4E3O A;  3IH8 A;  4FCF A;  4KQO A;  4DE0 A;  4Y7P A;  4GB7 A;  5FQM A;  3MFD A;  4M3K A;  2Z2M B;  1K56 D;  1XKZ A;  3G34 A;  5G18 A;  3QHY A;  1XPB A;  2Y2L A;  4KZ3 A;  4S2N C;  1JWZ A;  3ZG7 B;  5EVI A;  5E2H A;  1K54 A;  3ITB A;  1Z6F A;  3MBZ A;  5A93 A;  1ZG4 A;  4S2L A;  3WRT A;  1GHP A;  4X55 A;  3GVB A;  4ZDX A;  4R4S A;  2R9X A;  4P85 A;  3GV9 A;  1NJ4 A;  3PAE A;  1M6K A;  1KVM A;  4JXW A;  4X6T A;  2HDS A;  4EWF A;  4S2I A;  5GL9 A;  5FDH A;  3BEB A;  2BLS A;  4KG2 A;  4OPY A;  4DRT A;  1ZKJ A;  3Q82 A;  4QB8 A;  2HDU A;  3LO7 A;  1PWG A;  2V1Z A;  1BLS A;  1E3U D;  4FD8 A;  1BT5 A;  1I2W A;  3SH9 A;  4PM7 A;  2A49 A;  3O87 A;  2Y2M A;  4KQQ A;  1L0D A;  2H0Y A;  4WEJ A;  1DJB A;  1G6A A;  1KDS A;  3AGF A;  1TDG A;  4KG5 A;  5JYP A;  3A3F A;  4MEZ A;  4PM6 A;  3CZD A;  1WYC A;  2HP9 A;  4GZB A;  3S4X A;  4LEN A;  1KVL A;  3DTM A;  2P9V B;  2VGK A;  1OME A;  1U60 A;  3OCL A;  1HVB A;  2C5W B;  5KSH A;  5FQI A;  4E3I A;  1CI9 A;  4R0Q A;  4X56 A;  3GQZ A;  3HVF A;  3IQA A;  4DE1 A;  1TDL A;  4QJG A;  3BEC A;  4DE3 A;  4F94 A;  1BTL A;  4KZB A;  5AQ7 A;  5BOH A;  1SDN A;  5M19 A;  1Q2Q A;  5FAT A;  3VP1 A;  1ES4 A;  3ZG0 A;  4WMC D;  1S6R A;  2P74 A;  2R9W A;  4Y0O A;  1WYB A;  2ZJ9 A;  4N1X A;  2EX6 A;  3DWK A;  1BSG A;  3G35 A;  2DRW A;  4N1H A;  1YMX A;  2H5S A;  5GLC A;  3UE0 A;  1QMF A;  3V50 A;  3Q7Z A;  1MKI A;  5FAS A;  5A90 A;  1ES5 A;  4JLF A;  5CXW A;  1MXO A;  3QNC A;  3MKF A;  1BZA A;  1FSY A;  3HLF A;  4Y0U A;  1K55 C;  4EBL A;  4E3L A;  4OKP A;  3TOI A;  4OQH A;  3HLD A;  5E43 A;  3IXB A;  3ZHH A;  4BJP A;  1QME A;  2WKI A;  4IVI A;  4PM8 A;  4K0W A;  1YT4 A;  3SS3 A;  1L0E A;  1LHY A;  3LCE A;  2ZQC A;  1SCW A;  1KE4 A;  1I2S A;  3BYD A;  4FH4 A;  1ZC2 A;  3HLW A;  3LY4 A;  3OCN A;  4P6B A;  5DTK A;  4B4Z A;  5HAQ A;  1HZO A;  4ID4 A;  1NZU A;  2XH9 A;  2ZC5 B;  3G4P A;  1ESI A;  3SS4 A;  4E3J A;  1EI5 A;  3MZD A;  1ALQ A;  1BLH A;  3G32 A;  2JBF A;  4GD8 A;  4OPQ A;  5HAI A;  1MWT A;  2H10 A;  3A3D A;  3BFF A;  1K6R A;  3HRE A;  4BEN A;  2J9P A;  1IYP A;  3FZC A;  4QD4 A;  3PBO A;  1JWP A;  2PBY A;  2EX9 A;  1H8Y A;  3VP2 A;  1XA1 A;  4NK3 A;  3WS1 A;  4OH0 A;  1IKI A;  3Q81 A;  1MY8 A;  1N4O A;  2BG1 A;  4OLD A;  1NYM A;  1E4D A;  4L0L A;  4UA7 A;  1FCO A;  1L0G A;  4KZ4 A;  4MNR A;  3UPP A;  5FQJ A;  4R1G A;  4RX2 A;  1YLW A;  3CG5 A;  1HTZ A;  3SOI A;  3O86 A;  5E2G A;  3Q07 A;  2P9V A;  2PU4 A;  5EPH A;  4MBK A;  4BL2 A;  3WRZ A;  4OON A;  5CHU A;  3UY6 A;  4WM9 A;  4MBH A;  1PW8 A;  2OLV A;  5IHV A;  1PZO A;  4KZ8 A;  1YLZ A;  2WAF A;  4HBT A;  1JVJ A;  4UHU A;  3TG9 A;  1DY6 A;  1J9M A;  4K91 A;  1DJC A;  4LV1 A;  2V2F F;  4GNU A;  1MWR A;  3FKV A;  5KMW A;  5E2E A;  4R3B A;  3IHB A;  3IWO A;  2Y2K A;  2X01 A;  3GMW A;  4A5R A;  3BFG A;  4YFM A;  5FI6 A;  5CGW A;  1YM1 A;  3IXH A;  1XXM A;  1W8Y A;  4NET A;  4ZTK A;  3O88 A;  5CTN A;  2IWB A;  5CEB A;  3PBS A;  3FKW A;  3HL9 A;  3UNW A;  4QHC A;  5FA7 A;  3BLM A;  1CI8 A;  5EEC A;  4MBF A;  3BLS A;  3CMZ A;  1ESU A;  3VP0 A;  1GHI A;  1IEL A;  1K57 C;  4ZAM A;  3CJM A;  5HL1 A;  1W8Q A;  2XGN A;  4S2N A;  1AXB A;  4GDN A;  1KGE A;  3NDG A;  1YMS A;  3HUM A;  2CC1 A;  4HEF A;  5FQ9 A;  3ZG5 A;  3Q1F A;  1K57 A;  2RCX A;  1TVF A;  5J8X A;  5EVI D;  1YLT A;  3BFE A;  3HUN A;  4KZ5 A;  3E2K A;  5EOE A;  5M18 A;  2HDR A;  2J8Y A;  2XQZ A;  4Z9Q A;  4B4X A;  4RX3 A;  4MLL A;  3OPH A;  3UDX A;  3D4F A;  3C7V A;  3UO9 A;  4BLM A;  3A3E A;  4CPK A;  2EX8 A;  2V20 A;  2RL3 A;  4OQ0 A;  2XFS A;  2IWC A;  3V3S A;  4DXC A;  1MWS A;  4H8R A;  4PMA A;  3VFH A;  3BFD A;  2ZM0 A;  1LLB A;  2WKE A;  3MXS A;  3PBQ A;  5CGX A;  1C3B A;  4BQM A;  1PZP A;  2ZQ7 A;  3IF5 A;  3HLE A;  4R4R A;  3ZFZ A;  1CEG A;  2DCF A;  3UE3 A;  2WYX A;  1ERM A;  1GA9 A;  2Y2P A;  1IYO A;  1EWZ A;  4U0X A;  2XLN A;  2Y55 A;  3NBL A;  5HFO A;  4EQI A;  4EV4 A;  4X69 A;  3VFF A;  2ZLY A;  2Y2I A;  3W8K A;  2J9O A;  1XP4 A;  1HD8 A;  3GTC A;  4C75 A;  3DWZ A;  3IF6 B;  5EOO A;  5GHY A;  3ZNT A;  2Y2N A;  1PIO A;  2C6W B;  1PW1 A;  3IHA A;  3IWI A;  4KZ7 A;  3N4I A;  3IH9 A;  2Z2L B;  4KEN B;  4ZJ3 A;  5GHZ A;  3UDF A;  3HUO A;  3N7W A;  3HBR A;  1FR1 A;  5AQB A;  4DXB A;  1YQS A;  1ONH A;  2ZQA A;  1E25 A;  4C6Y A;  1FQG A;  1VQQ A;  1SDE A;  1K55 A;  3VOZ A;  2WGW B;  2WKH A;  1KE0 A;  2E8I A;  2ZQ8 A;  3GRJ A;  3S22 A;  3C4O A;  1ERO A;  3ZDJ A;  3GSG A;  4S2J A;  4LV0 A;  2QPN A;  4WZ5 C;  3EQV A;  2WZX A;  4XXR A;  2Y2H A;  1VM1 A;  2ZC6 B;  4OP5 A;  1PI5 A;  5CER A;  2FFY A;  3O3V A;  1KGG A;  3C4P A;  1IYQ A;  4D2O A;  4JKT A;  3TSG A;  3A3J A;  5CTM A;  3MXR A;  4OPZ A;  3HLC A;  2Y59 A;  2QMI A;  2Y4A A;  5DTT A;  2B5R A;  1MWU A;  1NZO A;  5HAR A;  1BUE A;  3RJU A;  1GHM A;  3N8S A;  4GD6 A;  4XUZ A;  3B3X A;  4JPM A;  1K6S A;  3HLB A;  3VSL A;  2H0T A;  5TGF A;  1GA0 A;  4CJN A;  4R23 A;  3ZG9 B;  4IED A;  3EQU A;  4U0T A;  4XUX A;  1ES2 A;  5D3O A;  1KDW A;  3FWL A;  3IF6 C;  1LL9 A;  1LI0 A;  2ZD8 A;  3VP3 A;  3GR2 A;  2ZC4 B;  4OOM A;  4R3J A;  3ZCZ A;  2WAE A;  1FR6 A;  4K0X A;  5CHJ A;  4EBN A;  2EFU A;  1H5X A;  5U47 A;  4OQG A;  4JBF A;  4P87 A;  3A3I A;  4JXV A;  1WE4 A;  1IEM A;  2Q9N A;  3PBT A;  4S2K A;  4UAA A;  2Y2O A;  2XF3 A;  3IF6 A;  4WYY A;  5FAO A;  2IWD A;  3VP4 A;  4B88 A;  3JYI A;  1KGF A;  5FAQ A;  2G2U A;  4PM9 A;  1O7E A;  5AQA A;  3WS4 A;  4O7D A;  4GOG A;  1K56 A;  3S1Y A;  4EUZ A;  3BFC A;  4ZBE A;  2EXB A;  3P98 A;  2PU2 A;  5F82 A;  1XGI A;  3N8L A;  5DF7 A;  4BD1 A;  5GHX A;  4BL3 A;  4X68 A;  1NY0 A;  5DVA A;  4IBX A;  5F1F A;  3AGE A;  2HP6 A;  2ZMA A;  1S0W A;  4IVK A;  4E3K A;  1FCN A;  1XA7 A;  3OPR A;  4P0M A;  1H8Z A;  5EVI C;  2WGW A;  5FAP A;  1K54 C;  5FI2 A;  1G68 A;  3OPP A;  3ZVT A;  4GN2 A;  4WBG A;  3SH7 A;  5DF8 A;  3NY4 A;  2JE5 A;  4GDB A;  5A92 A;  3BM6 A;  3W4O A;  4Q8I A;  2Y2Q A;  1E3U A;  3W4Q A;  5F1G A;  5I94 A;  1CK3 A;  3WS2 A;  1NRF A;  1K25 A;  3I7J A;  3LY3 A;  4FSF A;  5DF9 A;  4ZJ1 A;  2UWX A;  3ZG8 B;  4DDS A;  3NI9 A;  1FCM A;  3BRM A;  3OPL A;  4OVD A;  2WZZ A;  2ZQ9 A;  3WS0 A;  1YLJ A;  4UA9 A;  2XEP A;  1FOF A;  3V3R A;  3M2J A;  5CED A;  3RXW A;  1JTG A;  4DE2 A;  1BLC A;  1XX2 A;  2EFX A;  4N9L A;  1L2S A;  4UA6 A;  3G2Z A;  2XD1 A;  3MZF A;  2OLU A;  5GLA A;  3C7U A;  4PPR A;  2Q9M A;  1PWC A;  1N9B A;  4LV3 A;  1ZG6 A;  4WMC A;  4JXG A;  4WEK A;  3OZH A;  5CRF A;  2WK0 A;  4QY5 A;  1K4F A;  2EXA A;  3ITA A;  3DW0 A;  1I5Q A;  2WGV A;  4JXS A;  1PYY A;  3VMA A;  3N6I A;  3PTE A;  1K38 A;  5CHM A;  5TR7 A;  5FQQ A;  1YLY A;  2OV5 A;  4DDY A;  5CEC A;  4HBU A;  4OP8 A;  4IBR A;  1BUL A;  4RA7 A;  3ISG A;  4KG6 A;  4LCL A;  3MZE A;  1W7F A;  2JCH A;  3ZNY A;  4KQR A;  1Y54 A;  3OC2 A;  1SHV A;  3Q7V B;  4RYE A;  1RGY A;  5FQK A;  5A91 A;  4N92 A;  3AGD A;  3VOY A;  3IT9 A;  3ZVW A;  4OOL A;  1DJA A; 
#chains in the Genus database with same CATH topology
 1S1Z A;  5L8M A;  1PWD A;  1W79 A;  1L0F A;  2Q0O A;  1LT0 A;  4JGQ A;  3V67 A;  5L10 A;  1TS0 A;  4OPR A;  3VSK A;  5DTS A;  2V0U A;  1OTB A;  5EUA A;  3M6B A;  5DKK A;  3V39 A;  5EVI B;  5M1A A;  3UDI A;  2PYR A;  3N8R A;  3P09 A;  4WZ5 A;  5HW3 A;  3RXX A;  3M6H A;  4PM5 A;  3UPN A;  5L2F A;  1IKG A;  1XJ4 A;  1JTD A;  1MPL A;  5JYO A;  2XD5 A;  4NXF A;  3NDE A;  1P97 A;  3QP1 A;  4Y15 A;  2GX5 A;  2ZM2 A;  5EE8 A;  4JF6 A;  4U3T A;  4X53 A;  1ZHH B;  3T12 B;  1ES3 A;  3SH8 A;  3FV7 A;  4JF4 A;  1MBL A;  1CEF A;  2QYB A;  2VGJ A;  5HX9 A;  5KZH A;  1VEU A;  5AQ9 A;  3QP8 A;  2XR0 A;  2P04 A;  2ZM8 A;  2XFT A;  5EVL A;  1PI4 A;  3MQQ A;  1Q2P A;  3HJI A;  3A0V A;  5FSR A;  1K4E A;  1IOU A;  3A0R A;  3IH8 A;  4DE0 A;  4GB7 A;  5FQM A;  1G6O A;  3MFX A;  4HJ6 A;  4KZ3 A;  1JWZ A;  1OJG A;  2GZA A;  1K54 A;  3ITB A;  1Z6F A;  4ZDX A;  4R4S A;  4P85 A;  5HWT A;  2VV8 A;  4HOI A;  3BEB A;  1H8M A;  3T4L A;  3TJZ C;  5HD5 A;  4CLC C;  2A49 A;  2Y2M A;  4KQQ A;  2H0Y A;  1ACF A;  1DJB A;  1KDS A;  4ETX A;  1N9N A;  4PM6 A;  3S4X A;  1KVL A;  4NXG A;  4O8G A;  3T4Q A;  1U60 A;  5KSH A;  3LUQ A;  1CI9 A;  4X56 A;  3LI8 A;  3H7W B;  3BEC A;  1YPR A;  3CI6 A;  4KZB A;  1SDN A;  4MN7 A;  3VP1 A;  1ES4 A;  5FEG A;  4G3K A;  1YMX A;  2H5S A;  2V8C A;  2FH5 A;  4Z1W A;  3UE0 A;  1MKI A;  1T1C A;  4WUJ A;  4WN5 A;  3QNC A;  4E3L A;  1BZA A;  4Y0U A;  4OKP A;  3TOI A;  1TF1 A;  4OQH A;  2R78 A;  3HLD A;  3L9K A;  5E43 A;  4KQD A;  3ZHH A;  4BJP A;  4IUH A;  2M1C A;  2WKI A;  4IVI A;  4PM8 A;  4K0W A;  2ZQC A;  1I2S A;  3BYD A;  3T4S A;  5KIZ A;  3HLW A;  3OCN A;  4P6B A;  1V9Y A;  1HZO A;  1NZU A;  3UB8 A;  3G4P A;  1ESI A;  1EI5 A;  1ALQ A;  1BLH A;  2GJ3 A;  4GD8 A;  5HAI A;  4HQA A;  2W3D A;  1JWP A;  4L9F A;  1H8Y A;  4NK3 A;  4OH0 A;  1WA9 A;  5HDC A;  1MY8 A;  1N4O A;  2NUT C;  1DP8 A;  4UA7 A;  4CLC B;  3BJN A;  4NKP A;  4MNR A;  3MQO A;  1EW0 A;  4E04 A;  1Y4O A;  2PU4 A;  4MBK A;  3WRZ A;  4PHT A;  5CHU A;  3UY6 A;  2V1B A;  3IX8 A;  2OLV A;  1JVJ A;  2V2F F;  4XT2 B;  2KDK A;  4MN5 A;  5CX7 A;  5EFW A;  3BFG A;  1NLZ A;  1P9W A;  4G3V A;  3B47 A;  1XXM A;  3C8C A;  4F3L B;  3JVV A;  2JKT M;  3O88 A;  4QHC A;  1CI8 A;  2B02 A;  5IU1 A;  3VP0 A;  5FL3 A;  4ZAM A;  2PR6 A;  1W8Q A;  4S2N A;  1D1J A;  4ETZ A;  1BYW A;  4Q0J A;  4LFU A;  1AXB A;  4GDN A;  4UEY A;  4GLQ A;  5IT5 A;  3NDG A;  2W27 A;  4FTX A;  1K57 A;  4ZRR A;  2GNX A;  4KZ5 A;  2HDR A;  3LIB A;  4RX3 A;  3OPH A;  3D4F A;  3A3E A;  4I3I A;  1UWN X;  3IS2 B;  2EX8 A;  4OQ0 A;  1MWS A;  4PMA A;  4WL9 A;  3BFD A;  1C3B A;  2ZQ7 A;  1ERM A;  1GA9 A;  2VGL M;  1IYO A;  1EWZ A;  4U0X A;  2Y55 A;  4EQI A;  3NBL A;  3VFF A;  3W8K A;  5EVE A;  3H82 A;  3DWZ A;  5EOO A;  2W1T A;  5GHY A;  3ZNT A;  1XFN A;  3DTI A;  1PIO A;  3IHA A;  3IWI A;  2KLI A;  4KZ7 A;  3N4I A;  1CJF A;  3IH9 A;  1DRM A;  4BWI A;  3HUO A;  3HBR A;  5AQB A;  4PKY A;  1K55 A;  1SKO A;  2VV7 A;  3GRJ A;  3S22 A;  1ERO A;  3GSG A;  3P7N A;  4S2J A;  4LV0 A;  2QPN A;  3EWK A;  1PI5 A;  3O3V A;  1IYQ A;  3IBJ A;  4JKT A;  3TSG A;  5CTM A;  3A0S A;  3OBF A;  2JKR I;  2Y59 A;  2Y4A A;  2B5R A;  1MWU A;  3NOP C;  2ZL1 B;  1T1A A;  5HAR A;  3RJU A;  4GD6 A;  1K6S A;  1XFQ A;  5L09 A;  2KX6 A;  3ZG9 B;  3MF0 A;  5D3O A;  1KDW A;  3FWL A;  3GR2 A;  1D7E A;  2ZC4 B;  4OOM A;  2WAE A;  3MJQ A;  4I38 A;  5I5L A;  5CHJ A;  4EBN A;  4JXV A;  4S2K A;  5HPI A;  2Y2O A;  3CIT A;  3VP4 A;  4B88 A;  4PM9 A;  1O7E A;  5AQA A;  3WS4 A;  3QP4 A;  4GOG A;  4EUZ A;  2EXB A;  4FUW A;  3EOI A;  2LB9 A;  3JVU A;  4BL3 A;  1LSV A;  5DVA A;  5IS1 A;  3AGE A;  2VX8 A;  4IVK A;  4X1M A;  3OPR A;  3ZVT A;  3NY4 A;  2JE5 A;  3BM6 A;  3W4Q A;  5F1G A;  1CK3 A;  3I7J A;  3LR3 A;  3LY3 A;  5DF9 A;  4ZJ1 A;  3ZG8 B;  3K2N A;  3CWF A;  3V3R A;  3JPU A;  4DE2 A;  1BLC A;  3CPT A;  4N9L A;  3C7U A;  1PWC A;  3MQ0 A;  5HSQ A;  3NUL A;  3K3C A;  4LV3 A;  2OAQ 1;  1OJ5 A;  2INW A;  2WK0 A;  1S4S A;  4QY5 A;  1K4F A;  2PD7 A;  1YLY A;  1BUL A;  3ISG A;  3MZE A;  1CF0 A;  1W7F A;  2O9A A;  2JCH A;  4KQR A;  1Y54 A;  3LI9 A;  2VZW A;  4BBV A;  3KO6 A;  4RYE A;  1DJA A;  2JC7 A;  3RTY A;  1O07 A;  1JWV A;  1NWZ A;  3W4P A;  4ARZ B;  1GSX A;  3ZGA B;  4LV2 A;  3MKE A;  1IYS A;  4GKU A;  2WGI A;  1DP9 A;  3C5A A;  3OOV A;  2ZMV A;  4KZ9 A;  1LI9 A;  1YSQ A;  4EBP A;  4KZ6 A;  4IUK A;  4S2P A;  3HCY A;  3V5M A;  4QY6 A;  1VET B;  5F83 A;  2QZ6 A;  5HWW A;  4FH2 A;  5HAP A;  3SZT A;  4WLA A;  4WZ4 A;  4OOY A;  2XDM A;  3F1P A;  1M40 A;  3NIA A;  1NYY A;  4OQI A;  4QU3 A;  1DP6 A;  2WKR A;  1W5D A;  2V8F A;  3UPO A;  2J7V A;  2GDN A;  5G4Y A;  2Y91 A;  3SS5 A;  4E3M A;  4Q0I A;  4O01 A;  2HDQ A;  5FDS A;  2G2W A;  3Q7V A;  2VK3 A;  4WEL A;  3U2A A;  4LRZ E;  4IHQ A;  5MC7 A;  4S2M A;  2WUQ A;  2A3U A;  1S4R A;  4FCF A;  4KQO A;  2Z2M B;  1XKZ A;  3G34 A;  2B18 A;  3ZG7 B;  1P0Z A;  3GVB A;  1A0K A;  2EA9 A;  4I3A A;  2R9X A;  1NJ4 A;  3PAE A;  1M6K A;  4X6T A;  3MSH A;  4OPY A;  4DRT A;  3LO7 A;  4HJ3 A;  2V1Z A;  1BLS A;  1T19 A;  1I2W A;  1UWP X;  4PM7 A;  5HPF A;  4B93 A;  2BAS A;  3F1O B;  1G6A A;  3NJA A;  3AGF A;  3B42 A;  1TDG A;  4KG5 A;  5C5K A;  2HP9 A;  4GZB A;  4LEN A;  2VGK A;  1OME A;  4R0Q A;  3GQZ A;  3HVF A;  3IQA A;  2J3T D;  4DE3 A;  3LEQ A;  4BBT A;  2L1M A;  4K08 A;  3VE3 A;  5FAT A;  1H3Q A;  2R9W A;  5DJU A;  3LFV A;  2ZJ9 A;  4CPK A;  3G35 A;  3V50 A;  3MKF A;  3HLF A;  1FSY A;  4EBL A;  5HDD A;  2OWH A;  3IXB A;  5TBM A;  3SS3 A;  1L0E A;  1KE4 A;  2IA2 A;  3VE4 A;  3LY4 A;  5DTK A;  4B4Z A;  5HAQ A;  4JGR A;  2M7U A;  2HF6 A;  4CLC E;  2ZC5 B;  3IX4 A;  2JBF A;  4KUK A;  3HRE A;  4L9E A;  5DFY A;  4X1L A;  2PBY A;  3T4J A;  1XA1 A;  1IKI A;  3Q81 A;  4EEU A;  1E4D A;  2ZOI A;  2XA7 M;  4Q0H A;  1FCO A;  1L0G A;  2I9V A;  3ZQ5 A;  4R1G A;  1YLW A;  1HTZ A;  2A24 A;  4H6J B;  2PYP A;  2P9V A;  4BL2 A;  3LIC A;  4OON A;  2XRO A;  4HNB A;  4WM9 A;  4MBH A;  5IHV A;  1PZO A;  1YLZ A;  4HBT A;  4UHU A;  1LL8 A;  4GNU A;  3FKV A;  4R3B A;  3TW8 A;  2Y2K A;  4EXO A;  1G28 A;  1W8Y A;  4NET A;  4ZTK A;  5CTN A;  3PBS A;  3FKW A;  3FG8 A;  3HL9 A;  3ULF A;  5FA7 A;  3BLM A;  4MBF A;  2O0Y A;  1IEL A;  5DFX A;  1H0M A;  2XGN A;  1OTD A;  3UB7 A;  1YMS A;  3HUM A;  2B95 A;  2CC1 A;  4HP4 A;  2RCX A;  1TVF A;  2ZOH A;  2XQZ A;  4B4X A;  2VJW A;  3C7V A;  2JKG A;  1STZ A;  3D3O A;  2RL3 A;  2IWC A;  3V3S A;  1LSW A;  5CGX A;  1PZP A;  2MJ6 A;  1TS7 A;  3MMH A;  3ZFZ A;  1CEG A;  3R7W A;  2DCF A;  4GHI B;  3UE3 A;  4X69 A;  2J9O A;  4C75 A;  3IF6 B;  4ME4 A;  3GEC A;  2Y2N A;  4HJ4 A;  2L0W A;  2Z2L B;  4KEN B;  1FR1 A;  4DXB A;  1ONH A;  2ZQA A;  1E25 A;  4EES A;  1FQG A;  2D02 A;  1SDE A;  4NEE D;  2WGW B;  1KE0 A;  1VB6 A;  4HHD A;  2ZQ8 A;  4WZ5 C;  2HGV A;  2WZX A;  4XXR A;  4D2O A;  2PR5 A;  2ZBB A;  4I3J A;  3BWL A;  4DJ2 A;  1BUE A;  3B3X A;  5DKL A;  4JPM A;  3HLB A;  1TD5 A;  3FC7 A;  1GA0 A;  4R23 A;  4IED A;  2JHE A;  2W3G A;  5EM1 A;  4XUX A;  1ES2 A;  2ZD8 A;  3UB6 A;  3VP3 A;  3ZCZ A;  4R3J A;  5U47 A;  1H5X A;  4JBF A;  5EM0 A;  1IEM A;  2Q9N A;  4UAA A;  4Y13 A;  2OAP 1;  4WYY A;  1W63 Q;  1KGF A;  3BFC A;  4ZBE A;  3P98 A;  4IJG A;  4BD1 A;  5F1F A;  2HP6 A;  4P6Z S;  1S0W A;  4P0M A;  1H8Z A;  1K54 C;  5FI2 A;  3OPP A;  2L4R A;  3W2Z A;  4GN2 A;  3LIF A;  3W4O A;  1K25 A;  4OVD A;  1FIL A;  2VA0 A;  2OWJ A;  4UA9 A;  3M2J A;  3RXW A;  2QKP A;  1P9R A;  1YSP A;  4EU0 A;  4UQI S;  3KYQ A;  4UA6 A;  3G2Z A;  2XD1 A;  1MC0 A;  4MCW A;  1K0K A;  3DAV A;  2K7S A;  2E8J A;  1XJ6 A;  3F1N A;  4WMC A;  4JXG A;  2JKR M;  4WEK A;  5CRF A;  3DW0 A;  4X25 A;  2WGV A;  3VMA A;  3N6I A;  3PTE A;  1K38 A;  4GS9 A;  2OV5 A;  4DDY A;  4OP8 A;  1VEU B;  1SZV A;  1MKM A;  3OC2 A;  4JGO A;  5A91 A;  3VOY A;  1S66 L;  4OOL A;  3ZVW A;  3PR6 A;  4DKI A;  3CUE C;  3T1Q B;  4E6X A;  1UGU A;  2X71 A;  2HP5 A;  3LEZ A;  3KSG A;  3NCK A;  3QNB A;  4QPR A;  3EGX C;  2W1R A;  4HES A;  5GLB A;  1N9L A;  1YLP A;  4ZJ2 A;  2FFF B;  4RQ9 A;  3RH8 B;  2XA7 S;  5E2F A;  3NEC A;  4Y0T A;  5TFQ A;  3PAG A;  3UN7 A;  2OSU A;  3BY9 A;  5CGS A;  3UB9 A;  5HZH A;  5AVF A;  1GCE A;  3PBN A;  2I72 A;  2ZQD A;  1ONG A;  1NXY A;  4QWO A;  4PAU A;  2PDR A;  2EX2 A;  2Y2J A;  3IXG A;  3O5Y A;  3EGD C;  3QP6 A;  2QJ7 A;  4N9K A;  4YWZ A;  4BD0 A;  3IX3 A;  1AWI A;  3LYX A;  3C38 A;  5KSC A;  5F6A A;  4E6W A;  3HLG A;  3IWQ A;  3T4K A;  1RCJ A;  3PXP A;  4JF5 A;  3TE8 A;  3OLO A;  4E3N A;  4DF6 A;  2HPB A;  3G31 A;  1TEM A;  2W3E A;  3LR0 A;  3KSF A;  3MFD A;  3QHY A;  1XPB A;  2Y2L A;  4S2N C;  2K2N A;  5EVI A;  5E2H A;  3MBZ A;  1OTI A;  1ZG4 A;  3WRT A;  1GHP A;  4EEP A;  4MMN A;  3GV9 A;  4JXW A;  4EWF A;  1KVM A;  3DTE A;  5GL9 A;  2BLS A;  4KG2 A;  5AJG A;  1ZKJ A;  2VLG A;  4HI4 A;  4FD8 A;  1BT5 A;  3SH9 A;  3O87 A;  3KYE A;  4WEJ A;  1L0D A;  2NUP C;  5JYP A;  3D72 A;  1OTE A;  1HVB A;  4E3I A;  4LLO B;  4KUO A;  4GW9 A;  2Y8H A;  2YKH A;  4DE1 A;  4QJG A;  4F94 A;  2VKS A;  5M19 A;  2HJ9 C;  4WMC D;  1WYB A;  4YFM A;  1BSG A;  2DRW A;  1QMF A;  3C2W A;  1D06 A;  1V9Z A;  3ICY A;  4L9G A;  5FAS A;  1ES5 A;  4JLF A;  5CXW A;  1MXO A;  1K55 C;  1G5U A;  2KOI A;  2PAV P;  1YT4 A;  3LCE A;  4GJ4 A;  3D9Y A;  1SCW A;  3LR4 A;  3UMD A;  2EWW A;  4ID4 A;  2XH9 A;  4E3J A;  3MZD A;  4OPQ A;  3G32 A;  1YKD A;  1MWT A;  2H10 A;  3A3D A;  1K6R A;  2HZ5 A;  2J9P A;  1IYP A;  4HY8 A;  3VP2 A;  1HLU P;  5J3W A;  1OTA A;  2BG1 A;  4OLD A;  2CMN A;  3MR0 A;  3UPP A;  3E4O A;  5FQJ A;  1LSX A;  4RX2 A;  3O86 A;  1S67 L;  3Q07 A;  5EPH A;  2PHY A;  4I39 A;  3H7W A;  2WAF A;  2D01 A;  3TG9 A;  1J9M A;  4K91 A;  1DJC A;  3H82 B;  4LV1 A;  1MWR A;  2W1T B;  5E2E A;  2M7V A;  4GS9 B;  3T1S A;  1OT6 A;  3GMW A;  5FI6 A;  4I5S A;  1YM1 A;  1F98 A;  2IWB A;  5CEB A;  4P6Z M;  5HDS A;  3UNW A;  3L7H A;  1SKO B;  1GHI A;  2YKF A;  3CJM A;  5HL1 A;  2PRF A;  4FOF A;  2VV6 A;  3NOU C;  5FQ9 A;  3Q1F A;  4HH3 A;  5EVI D;  2H28 A;  3BFE A;  3HUN A;  3LGO A;  4Z9Q A;  4MLL A;  3UO9 A;  4BLM A;  4UQI M;  4CLC A;  1Z09 A;  2JKF A;  5F68 A;  5K5B A;  3VFH A;  3QP2 A;  1IFQ A;  4BQM A;  3PBQ A;  1KOU A;  3HLE A;  4EV4 A;  4M4X A;  1HD8 A;  4XT2 A;  2PBD P;  2C6W B;  1CQA A;  4ZJ3 A;  5GHZ A;  4NXB A;  4JGP A;  4F3L A;  3S7P A;  3KSH A;  4C6Y A;  1VQQ A;  5F5Y A;  3VOZ A;  4EQ1 A;  2WKH A;  2E8I A;  4EER A;  4MDZ A;  2DMW A;  3C4O A;  3LID A;  3EQV A;  2EWV A;  2ZC6 B;  1VM1 A;  4OP5 A;  5CER A;  2FFY A;  1KGG A;  1F5M A;  4OPZ A;  3PHY A;  3DTK A;  4HH2 A;  1NZO A;  1TS6 A;  2ACG A;  3KSI A;  1GHM A;  4EET B;  3IS2 A;  3CPT B;  5TGF A;  4R70 A;  4CJN A;  3EQU A;  4U0T A;  3IF6 C;  1LL9 A;  1LI0 A;  3QP5 A;  1PRQ A;  3LIA A;  4P87 A;  3SW1 A;  3PBT A;  5FAO A;  2XF3 A;  3HJK A;  3JYI A;  5FAQ A;  2G2U A;  4WF0 A;  4LRY C;  1K56 A;  3S1Y A;  1S1Y A;  5F69 A;  2PU2 A;  1XGI A;  3N8L A;  5DF7 A;  5GHX A;  1NY0 A;  4IBX A;  2ZMA A;  5FAP A;  4R38 A;  4II7 A;  3BQA A;  3C30 A;  5DF8 A;  4GDB A;  5A92 A;  2G7U A;  2Y2Q A;  1E3U A;  5I94 A;  3WS2 A;  4FSF A;  2UWX A;  2XSS A;  4DDS A;  3NI9 A;  3S7Q A;  1FCM A;  3BRM A;  3OPL A;  2QHK A;  2ZQ9 A;  2J80 A;  2XEP A;  1FOF A;  4Y3I A;  2ZL1 A;  5CED A;  5A8B A;  1L3L A;  3RFB A;  3VV4 A;  4PPR A;  2Q9M A;  1MZU A;  3F1P B;  4Y17 A;  1N9B A;  1ZG6 A;  4CLC D;  3OZH A;  5HWV A;  2EXA A;  2O9C A;  3ITA A;  5TR7 A;  4LPZ A;  4GCZ A;  5CHM A;  5CEC A;  4IBR A;  5EV0 A;  4KG6 A;  3PYP A;  3BQ8 A;  3H9W A;  3BW6 A;  2Z6D A;  1SHV A;  3Q7V B;  5AVE A;  4N92 A;  3AGD A;  3IT9 A;  2PD8 A;  1FIK A;  5GLD A;  2A2L A;  4R6L A;  5HL6 A;  1LL5 A;  1BLP A;  2ZC3 B;  4NG2 A;  4RVA A;  1XGJ A;  4LCM A;  3CUE A;  3MS6 A;  3FYZ A;  3G2Y A;  4BBU A;  3WWX A;  2K31 A;  2XK1 A;  3IXD A;  4KZA A;  3E98 A;  3UE1 A;  4OLG A;  2Y2G A;  5FI7 A;  2BTF P;  3T4O A;  3WS5 A;  1FSW A;  1PNE A;  4S2O A;  3GDI A;  1ERQ A;  2DNS A;  1SKF A;  2XRN A;  1NLY A;  4C3Q A;  1RP5 A;  2WAD A;  3G30 A;  1RGZ A;  2WKP A;  2ZC7 A;  4YIN A;  1KE3 A;  4CQH A;  2X02 A;  3K3D A;  3NC8 A;  2O9B A;  3PBR A;  2P08 A;  3E2L A;  3M2K A;  4E3O A;  2JN7 A;  5TBM B;  4Y7P A;  4B9O A;  4BMW A;  4M3K A;  3ZYT A;  4ARZ A;  1K56 D;  4HP9 A;  5G18 A;  3T50 A;  3CAX A;  5A93 A;  4S2L A;  4X55 A;  1XJ3 A;  3CHW P;  2HDS A;  4S2I A;  5FDH A;  3Q82 A;  4QB8 A;  2HDU A;  1PWG A;  1E3U D;  1YAX A;  4EUV A;  3S7O A;  1VET A;  3A3F A;  4MEZ A;  2W3H A;  3NOT C;  3CZD A;  1WYC A;  3DTM A;  2A24 B;  2P9V B;  1GSV A;  3OCL A;  2C5W B;  2JKT I;  5FQI A;  1NRJ A;  1TDL A;  1BTL A;  5AQ7 A;  5J7E A;  5BOH A;  1Q2Q A;  3S7N A;  3ZG0 A;  1JNU A;  1S6R A;  2P74 A;  3KYZ A;  4Y0O A;  4N1X A;  2EX6 A;  3DWK A;  4N1H A;  5GLC A;  2HV1 A;  3Q7Z A;  4YNR A;  5A90 A;  5FEF A;  1QME A;  4AFI A;  2Z6C A;  1LHY A;  3LR5 A;  4FH4 A;  1ZC2 A;  1PFL A;  1OPX A;  3SS4 A;  3BFF A;  4DMZ A;  1F9I A;  4BEN A;  3FZC A;  4QD4 A;  3PBO A;  2EX9 A;  3NHQ A;  3WS1 A;  1NYM A;  4L0L A;  3E4Q A;  4G3W A;  3F1O A;  4KZ4 A;  3CG5 A;  2V0W A;  3SOI A;  5E2G A;  5J4E A;  4ESP A;  1OT9 A;  5L07 A;  3R7W B;  1PW8 A;  2QJ5 A;  4KZ8 A;  3EEH A;  1DY6 A;  5KMW A;  3IHB A;  3IWO A;  2V9A A;  2X01 A;  4NXE A;  4A5R A;  1W63 M;  5CGW A;  3IXH A;  2W3F A;  3BY8 A;  2W0N A;  4Y2F A;  5EEC A;  3BLS A;  3CMZ A;  3E4P A;  1ESU A;  4DN0 A;  1K57 C;  3CLO A;  1KGE A;  4HEF A;  2PT7 A;  3ZG5 A;  2UV0 E;  5J8X A;  1Y28 A;  1YLT A;  3UE6 A;  3E2K A;  5EOE A;  5M18 A;  2J8Y A;  1N9O A;  3UDX A;  3UB5 P;  3T1R A;  4D60 A;  2OOL A;  3LIE A;  4DJ3 A;  2V20 A;  4LRX C;  2XFS A;  4DXC A;  4H8R A;  4O0P A;  3U4L P;  2ZM0 A;  4H6J A;  1LLB A;  2WKE A;  3MXS A;  3IF5 A;  4R4R A;  3E0Y A;  2WYX A;  2V1A A;  2Y2P A;  2Y79 A;  3FPV A;  5LBR A;  1J3W A;  2XLN A;  5HFO A;  3TRC A;  2ZLY A;  2Y2I A;  5DJT A;  1XP4 A;  2AVX A;  3GTC A;  2LB5 A;  1PW1 A;  1TS8 A;  3UME A;  4PKY G;  3UDF A;  3N7W A;  1YQS A;  1ZTU A;  5TJJ A;  4Y5F A;  3ZDJ A;  4LGW A;  2Y2H A;  3C4P A;  1XJ2 A;  3FPW A;  3A3J A;  3MXR A;  3HLC A;  2QMI A;  5DTT A;  1VHM A;  5G4Z A;  3N8S A;  4XUZ A;  3VSL A;  4MN6 A;  2H0T A;  2QWS A;  3EEA A;  3F1N B;  2WKQ A;  3R4K A;  2J3W A;  3T4T A;  4GHI A;  3G6O A;  1FR6 A;  4K0X A;  1F2K A;  2EFU A;  4OQG A;  3A3I A;  1WE4 A;  3T1X A;  3IF6 A;  2IWD A;  4O7D A;  5F82 A;  4X68 A;  4E3K A;  1FCN A;  1XA7 A;  1GSW A;  5EVI C;  2WGW A;  2ZMF A;  1G68 A;  3VOL A;  4WBG A;  3SH7 A;  1T1B A;  3IBR A;  4HIA A;  4Q8I A;  1NRF A;  2WZZ A;  1X0O A;  3WS0 A;  1YLJ A;  2VEA A;  2P7J A;  2J3T C;  3P01 A;  4R3A A;  5HD3 A;  3B33 A;  1JTG A;  2HJE A;  1ODV A;  1XX2 A;  2EFX A;  1L2S A;  3MZF A;  2OLU A;  5GLA A;  2O99 A;  4YOF A;  3KX0 X;  3MXQ A;  1I5Q A;  4JXS A;  1PYY A;  2VGL S;  2FZ0 A;  5FQQ A;  4HBU A;  3DBA A;  4RA7 A;  4LCL A;  3ZNY A;  4EW7 A;  1RGY A;  5FQK A;  1T18 A; 
#chains in the Genus database with same CATH homology
 4DKI A;  2JC7 A;  5GLD A;  1PWD A;  1W79 A;  1O07 A;  1L0F A;  4E6X A;  1JWV A;  3W4P A;  1LL5 A;  4OPR A;  3VSK A;  5DTS A;  2X71 A;  2HP5 A;  1BLP A;  2ZC3 B;  3LEZ A;  5EUA A;  3M6B A;  4RVA A;  3NCK A;  3V39 A;  5EVI B;  3ZGA B;  1XGJ A;  5M1A A;  4LCM A;  4LV2 A;  3QNB A;  3MKE A;  1IYS A;  3UDI A;  3FYZ A;  3G2Y A;  4GKU A;  2WGI A;  3C5A A;  3WWX A;  3N8R A;  4HES A;  3P09 A;  4WZ5 A;  5GLB A;  5HW3 A;  3RXX A;  1YLP A;  2XK1 A;  3IXD A;  3M6H A;  4KZ9 A;  4ZJ2 A;  4PM5 A;  3UPN A;  4KZA A;  1LI9 A;  2FFF B;  4EBP A;  5L2F A;  4KZ6 A;  1IKG A;  1JTD A;  1MPL A;  5JYO A;  3UE1 A;  2XD5 A;  3NDE A;  4S2P A;  4OLG A;  2Y2G A;  5E2F A;  3V5M A;  4Y0T A;  2ZM2 A;  4QY6 A;  5FI7 A;  5EE8 A;  5F83 A;  3PAG A;  5TFQ A;  4JF6 A;  3UN7 A;  2OSU A;  2QZ6 A;  4U3T A;  5CGS A;  4FH2 A;  3WS5 A;  1FSW A;  4X53 A;  5HAP A;  1GCE A;  3PBN A;  2I72 A;  2ZQD A;  4WZ4 A;  4OOY A;  1ONG A;  2XDM A;  4S2O A;  1NXY A;  1ERQ A;  2DNS A;  1M40 A;  3NIA A;  1ES3 A;  1NYY A;  4OQI A;  3SH8 A;  1SKF A;  3FV7 A;  4QU3 A;  4JF4 A;  2EX2 A;  2Y2J A;  1W5D A;  3IXG A;  4C3Q A;  3UPO A;  1MBL A;  2J7V A;  4N9K A;  1CEF A;  1RP5 A;  2GDN A;  2VGJ A;  2Y91 A;  2WAD A;  3SS5 A;  4BD0 A;  5HX9 A;  4E3M A;  5KZH A;  5AQ9 A;  3G30 A;  5KSC A;  2XR0 A;  4E6W A;  1RGZ A;  2ZM8 A;  3HLG A;  3IWQ A;  2XFT A;  2HDQ A;  5EVL A;  1PI4 A;  2ZC7 A;  1KE3 A;  2G2W A;  4YIN A;  1Q2P A;  2X02 A;  1RCJ A;  3Q7V A;  3NC8 A;  4JF5 A;  4WEL A;  4E3N A;  4DF6 A;  2HPB A;  3PBR A;  4S2M A;  3E2L A;  2WUQ A;  1TEM A;  1K4E A;  2A3U A;  3G31 A;  3M2K A;  5FSR A;  4E3O A;  3IH8 A;  4FCF A;  4KQO A;  4DE0 A;  4Y7P A;  4GB7 A;  5FQM A;  3MFD A;  4M3K A;  2Z2M B;  1K56 D;  1XKZ A;  3G34 A;  5G18 A;  3QHY A;  1XPB A;  2Y2L A;  4KZ3 A;  4S2N C;  1JWZ A;  3ZG7 B;  5EVI A;  5E2H A;  1K54 A;  3ITB A;  1Z6F A;  3MBZ A;  5A93 A;  1ZG4 A;  4S2L A;  3WRT A;  1GHP A;  4X55 A;  3GVB A;  4ZDX A;  4R4S A;  2R9X A;  4P85 A;  3GV9 A;  1NJ4 A;  3PAE A;  1M6K A;  1KVM A;  4JXW A;  4X6T A;  2HDS A;  4EWF A;  4S2I A;  5GL9 A;  5FDH A;  3BEB A;  2BLS A;  4KG2 A;  4OPY A;  4DRT A;  1ZKJ A;  3Q82 A;  4QB8 A;  2HDU A;  3LO7 A;  1PWG A;  2V1Z A;  1BLS A;  1E3U D;  4FD8 A;  1BT5 A;  1I2W A;  3SH9 A;  4PM7 A;  2A49 A;  3O87 A;  2Y2M A;  4KQQ A;  1L0D A;  2H0Y A;  4WEJ A;  1DJB A;  1G6A A;  1KDS A;  3AGF A;  1TDG A;  4KG5 A;  5JYP A;  3A3F A;  4MEZ A;  4PM6 A;  3CZD A;  1WYC A;  2HP9 A;  4GZB A;  3S4X A;  4LEN A;  1KVL A;  3DTM A;  2P9V B;  2VGK A;  1OME A;  1U60 A;  3OCL A;  1HVB A;  2C5W B;  5KSH A;  5FQI A;  4E3I A;  1CI9 A;  4R0Q A;  4X56 A;  3GQZ A;  3HVF A;  3IQA A;  4DE1 A;  1TDL A;  4QJG A;  3BEC A;  4DE3 A;  4F94 A;  1BTL A;  4KZB A;  5AQ7 A;  5BOH A;  1SDN A;  5M19 A;  1Q2Q A;  5FAT A;  3VP1 A;  1ES4 A;  3ZG0 A;  4WMC D;  1S6R A;  2P74 A;  2R9W A;  4Y0O A;  1WYB A;  2ZJ9 A;  4N1X A;  2EX6 A;  3DWK A;  1BSG A;  3G35 A;  2DRW A;  4N1H A;  1YMX A;  2H5S A;  5GLC A;  3UE0 A;  1QMF A;  3V50 A;  3Q7Z A;  1MKI A;  5FAS A;  5A90 A;  1ES5 A;  4JLF A;  5CXW A;  1MXO A;  3QNC A;  3MKF A;  1BZA A;  1FSY A;  3HLF A;  4Y0U A;  1K55 C;  4EBL A;  4E3L A;  4OKP A;  3TOI A;  4OQH A;  3HLD A;  5E43 A;  3IXB A;  3ZHH A;  4BJP A;  1QME A;  2WKI A;  4IVI A;  4PM8 A;  4K0W A;  1YT4 A;  3SS3 A;  1L0E A;  1LHY A;  3LCE A;  2ZQC A;  1SCW A;  1KE4 A;  1I2S A;  3BYD A;  4FH4 A;  1ZC2 A;  3HLW A;  3LY4 A;  3OCN A;  4P6B A;  5DTK A;  4B4Z A;  5HAQ A;  1HZO A;  4ID4 A;  1NZU A;  2XH9 A;  2ZC5 B;  3G4P A;  1ESI A;  3SS4 A;  4E3J A;  1EI5 A;  3MZD A;  1ALQ A;  1BLH A;  3G32 A;  2JBF A;  4GD8 A;  4OPQ A;  5HAI A;  1MWT A;  2H10 A;  3A3D A;  3BFF A;  1K6R A;  3HRE A;  4BEN A;  2J9P A;  1IYP A;  3FZC A;  4QD4 A;  3PBO A;  1JWP A;  2PBY A;  2EX9 A;  1H8Y A;  3VP2 A;  1XA1 A;  4NK3 A;  3WS1 A;  4OH0 A;  1IKI A;  3Q81 A;  1MY8 A;  1N4O A;  2BG1 A;  4OLD A;  1NYM A;  1E4D A;  4L0L A;  4UA7 A;  1FCO A;  1L0G A;  4KZ4 A;  4MNR A;  3UPP A;  5FQJ A;  4R1G A;  4RX2 A;  1YLW A;  3CG5 A;  1HTZ A;  3SOI A;  3O86 A;  5E2G A;  3Q07 A;  2P9V A;  2PU4 A;  5EPH A;  4MBK A;  4BL2 A;  3WRZ A;  4OON A;  5CHU A;  3UY6 A;  4WM9 A;  4MBH A;  1PW8 A;  2OLV A;  5IHV A;  1PZO A;  4KZ8 A;  1YLZ A;  2WAF A;  4HBT A;  1JVJ A;  4UHU A;  3TG9 A;  1DY6 A;  1J9M A;  4K91 A;  1DJC A;  4LV1 A;  2V2F F;  4GNU A;  1MWR A;  3FKV A;  5KMW A;  5E2E A;  4R3B A;  3IHB A;  3IWO A;  2Y2K A;  2X01 A;  3GMW A;  4A5R A;  3BFG A;  4YFM A;  5FI6 A;  5CGW A;  1YM1 A;  3IXH A;  1XXM A;  1W8Y A;  4NET A;  4ZTK A;  3O88 A;  5CTN A;  2IWB A;  5CEB A;  3PBS A;  3FKW A;  3HL9 A;  3UNW A;  4QHC A;  5FA7 A;  3BLM A;  1CI8 A;  5EEC A;  4MBF A;  3BLS A;  3CMZ A;  1ESU A;  3VP0 A;  1GHI A;  1IEL A;  1K57 C;  4ZAM A;  3CJM A;  5HL1 A;  1W8Q A;  2XGN A;  4S2N A;  1AXB A;  4GDN A;  1KGE A;  3NDG A;  1YMS A;  3HUM A;  2CC1 A;  4HEF A;  5FQ9 A;  3ZG5 A;  3Q1F A;  1K57 A;  2RCX A;  1TVF A;  5J8X A;  5EVI D;  1YLT A;  3BFE A;  3HUN A;  4KZ5 A;  3E2K A;  5EOE A;  5M18 A;  2HDR A;  2J8Y A;  2XQZ A;  4Z9Q A;  4B4X A;  4RX3 A;  4MLL A;  3OPH A;  3UDX A;  3D4F A;  3C7V A;  3UO9 A;  4BLM A;  3A3E A;  4CPK A;  2EX8 A;  2V20 A;  2RL3 A;  4OQ0 A;  2XFS A;  2IWC A;  3V3S A;  4DXC A;  1MWS A;  4H8R A;  4PMA A;  3VFH A;  3BFD A;  2ZM0 A;  1LLB A;  2WKE A;  3MXS A;  3PBQ A;  5CGX A;  1C3B A;  4BQM A;  1PZP A;  2ZQ7 A;  3IF5 A;  3HLE A;  4R4R A;  3ZFZ A;  1CEG A;  2DCF A;  3UE3 A;  2WYX A;  1ERM A;  1GA9 A;  2Y2P A;  1IYO A;  1EWZ A;  4U0X A;  2XLN A;  2Y55 A;  3NBL A;  5HFO A;  4EQI A;  4EV4 A;  4X69 A;  3VFF A;  2ZLY A;  2Y2I A;  3W8K A;  2J9O A;  1XP4 A;  1HD8 A;  3GTC A;  4C75 A;  3DWZ A;  3IF6 B;  5EOO A;  5GHY A;  3ZNT A;  2Y2N A;  1PIO A;  2C6W B;  1PW1 A;  3IHA A;  3IWI A;  4KZ7 A;  3N4I A;  3IH9 A;  2Z2L B;  4KEN B;  4ZJ3 A;  5GHZ A;  3UDF A;  3HUO A;  3N7W A;  3HBR A;  1FR1 A;  5AQB A;  4DXB A;  1YQS A;  1ONH A;  2ZQA A;  1E25 A;  4C6Y A;  1FQG A;  1VQQ A;  1SDE A;  1K55 A;  3VOZ A;  2WGW B;  2WKH A;  1KE0 A;  2E8I A;  2ZQ8 A;  3GRJ A;  3S22 A;  3C4O A;  1ERO A;  3ZDJ A;  3GSG A;  4S2J A;  4LV0 A;  2QPN A;  4WZ5 C;  3EQV A;  2WZX A;  4XXR A;  2Y2H A;  1VM1 A;  2ZC6 B;  4OP5 A;  1PI5 A;  5CER A;  2FFY A;  3O3V A;  1KGG A;  3C4P A;  1IYQ A;  4D2O A;  4JKT A;  3TSG A;  3A3J A;  5CTM A;  3MXR A;  4OPZ A;  3HLC A;  2Y59 A;  2QMI A;  2Y4A A;  5DTT A;  2B5R A;  1MWU A;  1NZO A;  5HAR A;  1BUE A;  3RJU A;  1GHM A;  3N8S A;  4GD6 A;  4XUZ A;  3B3X A;  4JPM A;  1K6S A;  3HLB A;  3VSL A;  2H0T A;  5TGF A;  1GA0 A;  4CJN A;  4R23 A;  3ZG9 B;  4IED A;  3EQU A;  4U0T A;  4XUX A;  1ES2 A;  5D3O A;  1KDW A;  3FWL A;  3IF6 C;  1LL9 A;  1LI0 A;  2ZD8 A;  3VP3 A;  3GR2 A;  2ZC4 B;  4OOM A;  4R3J A;  3ZCZ A;  2WAE A;  1FR6 A;  4K0X A;  5CHJ A;  4EBN A;  2EFU A;  1H5X A;  5U47 A;  4OQG A;  4JBF A;  4P87 A;  3A3I A;  4JXV A;  1WE4 A;  1IEM A;  2Q9N A;  3PBT A;  4S2K A;  4UAA A;  2Y2O A;  2XF3 A;  3IF6 A;  4WYY A;  5FAO A;  2IWD A;  3VP4 A;  4B88 A;  3JYI A;  1KGF A;  5FAQ A;  2G2U A;  4PM9 A;  1O7E A;  5AQA A;  3WS4 A;  4O7D A;  4GOG A;  1K56 A;  3S1Y A;  4EUZ A;  3BFC A;  4ZBE A;  2EXB A;  3P98 A;  2PU2 A;  5F82 A;  1XGI A;  3N8L A;  5DF7 A;  4BD1 A;  5GHX A;  4BL3 A;  4X68 A;  1NY0 A;  5DVA A;  4IBX A;  5F1F A;  3AGE A;  2HP6 A;  2ZMA A;  1S0W A;  4IVK A;  4E3K A;  1FCN A;  1XA7 A;  3OPR A;  4P0M A;  1H8Z A;  5EVI C;  2WGW A;  5FAP A;  1K54 C;  5FI2 A;  1G68 A;  3OPP A;  3ZVT A;  4GN2 A;  4WBG A;  3SH7 A;  5DF8 A;  3NY4 A;  2JE5 A;  4GDB A;  5A92 A;  3BM6 A;  3W4O A;  4Q8I A;  2Y2Q A;  1E3U A;  3W4Q A;  5F1G A;  5I94 A;  1CK3 A;  3WS2 A;  1NRF A;  1K25 A;  3I7J A;  3LY3 A;  4FSF A;  5DF9 A;  4ZJ1 A;  2UWX A;  3ZG8 B;  4DDS A;  3NI9 A;  1FCM A;  3BRM A;  3OPL A;  4OVD A;  2WZZ A;  2ZQ9 A;  3WS0 A;  1YLJ A;  4UA9 A;  2XEP A;  1FOF A;  3V3R A;  3M2J A;  5CED A;  3RXW A;  1JTG A;  4DE2 A;  1BLC A;  1XX2 A;  2EFX A;  4N9L A;  1L2S A;  4UA6 A;  3G2Z A;  2XD1 A;  3MZF A;  2OLU A;  5GLA A;  3C7U A;  4PPR A;  2Q9M A;  1PWC A;  1N9B A;  4LV3 A;  1ZG6 A;  4WMC A;  4JXG A;  4WEK A;  3OZH A;  5CRF A;  2WK0 A;  4QY5 A;  1K4F A;  2EXA A;  3ITA A;  3DW0 A;  1I5Q A;  2WGV A;  4JXS A;  1PYY A;  3VMA A;  3N6I A;  3PTE A;  1K38 A;  5CHM A;  5TR7 A;  5FQQ A;  1YLY A;  2OV5 A;  4DDY A;  5CEC A;  4HBU A;  4OP8 A;  4IBR A;  1BUL A;  4RA7 A;  3ISG A;  4KG6 A;  4LCL A;  3MZE A;  1W7F A;  2JCH A;  3ZNY A;  4KQR A;  1Y54 A;  3OC2 A;  1SHV A;  3Q7V B;  4RYE A;  1RGY A;  5FQK A;  5A91 A;  4N92 A;  3AGD A;  3VOY A;  3IT9 A;  3ZVW A;  4OOL A;  1DJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...