1JTGA

Crystal structure of tem-1 beta-lactamase / beta-lactamase inhibitor protein complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
263
structure length
262
Chain Sequence
b'HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEAKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE TEM
molecule tags Hydrolase
source organism Escherichia coli
publication title Crystal structure and kinetic analysis of beta-lactamase inhibitor protein-II in complex with TEM-1 beta-lactamase.
pubmed doi rcsb
total genus 91
structure length 262
sequence length 263
chains with identical sequence C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1jtgA00
1CI9A 1RGYA 1KGGA 1I5QA 4KZBA 5FI2A 3CMZA 3UO9A 4XUZA 3A3EA 3FYZA 4OLDA 1H8YA 3DWKA 3AGEA 4WMCA 3WS0A 1EWZA 2ZC5B 2Y2OA 4JXWA 1JTDA 1BLHA 5CHMA 1O7EA 1WE4A 3IT9A 2Y2IA 2X02A 1YLTA 4P87A 1FOFA 4OLGA 2VGJA 2EX9A 5CGSA 5EVIC 2WADA 1TDLA 4R3BA 1GHPA 1H8ZA 1LI9A 2ZC3B 3M6BA 3ZVTA 3UPNA 1U60A 3MZFA 3VOZA 3S4XA 1W5DA 3BFCA 3OPLA 1ZG4A 3BECA 2Y2JA 3BFEA 1ES3A 4WZ5C 4YFMA 5E2EA 5E2GA 4R3JA 5FQQA 2XLNA 5HFOA 3WWXA 4EBNA 3IF6B 1PI5A 3S22A 2CC1A 3NI9A 1H5XA 1MPLA 4DE2A 3FZCA 4B4XA 3VP4A 2ZM0A 2J9OA 3G4PA 3HUNA 5JYPA 4OPRA 2WGWA 1XXMA 3DWZA 1ZKJA 3IQAA 4LCLA 1IKGA 2XD1A 1KE0A 2WKIA 1SDEA 4JLFA 1DJAA 3E2LA 5FSRA 2ZJ9A 4GD6A 1K6RA 1WYBA 4PM9A 5FATA 3SS3A 2ZC6B 4R4SA 4HBTA 3V3RA 3JYIA 5GLDA 3MZEA 3PBSA 4PM6A 1FSYA 5TGFA 4BL3A 4Y0TA 1G68A 1K56A 3ZVWA 4E3LA 4A5RA 5M19A 2Y2NA 4DKIA 3PBOA 5AQ9A 2ZQDA 4OQHA 4WEKA 1FCMA 3C4OA 4LENA 2WGVA 4S2KA 1QMEA 1N9BA 5CXWA 3MXSA 4FSFA 2HDQA 3VP3A 4OOYA 3HLBA 4LV3A 4UA9A 5CECA 2IWBA 2ZM2A 3MBZA 4DXBA 3W4QA 5AQAA 1BLSA 3WS4A 4E3JA 3FV7A 1VM1A 3UN7A 4IBRA 3UDXA 1K57A 4JF4A 4Y7PA 2P74A 2UWXA 3FKWA 4B88A 3Q7VA 3EQUA 1JWZA 2J7VA 5EOEA 1HD8A 2XFTA 3MKEA 5CGWA 5BOHA 1L0DA 1LL9A 1ALQA 1YLZA 5GLAA 4C6YA 1YT4A 5HARA 4X6TA 1HVBA 4GZBA 1OMEA 3GQZA 3A3DA 5CHJA 2XFSA 4QY5A 1YLWA 2BLSA 2WAFA 3Q81A 5AQBA 4EBLA 4E6WA 3D4FA 4R4RA 2Y2LA 4KZ5A 1LLBA 5G18A 1ERMA 5F82A 1YMSA 3OPPA 2Y55A 3MKFA 1S0WA 2Y2MA 5CEBA 4RX2A 1DJCA 3ZNYA 3GVBA 2Y91A 2JCHA 4CJNA 2H0YA 3P09A 3AGDA 1LL5A 2DCFA 4M3KA 3IF6C 4U3TA 4Y0OA 4BD1A 1TDGA 4DDYA 1K55C 3RJUA 1DJBA 1PYYA 3O88A 2C6WB 3ISGA 1YLPA 5HX9A 1BTLA 3IH8A 4WYYA 1ONGA 3M2JA 4FD8A 2EFUA 5A93A 3VSLA 4KZ9A 5KSCA 3O87A 1QMFA 3UPOA 3HL9A 5GHXA 3Q07A 1IKIA 5IHVA 2XDMA 3UDIA 4JF6A 4WZ5A 1ESIA 3IHBA 4N9KA 4OH0A 2HP6A 4OP5A 1FCOA 5GLBA 3N8LA 4P85A 2WKHA 4JKTA 2EX2A 1L0EA 3Q82A 3SS4A 5KZHA 2Y2QA 4E3MA 2P9VA 1KE4A 5FDHA 4WZ4A 3UPPA 4GNUA 4RVAA 5FAQA 3ZDJA 1PWDA 3IF6A 4K0WA 4S2NA 4P0MA 1K4EA 1VQQA 5KSHA 3UE3A 4FH2A 4MNRA 1I2SA 1MWRA 2G2WA 1YMXA 2JBFA 1RCJA 4KQRA 4MBFA 4KZ4A 3W4PA 2R9WA 4E3KA 4UHUA 5I94A 4O7DA 2HDUA 3VMAA 3QNCA 5GL9A 1NJ4A 4RX3A 2JE5A 5TR7A 2WKEA 3ZG9B 5CRFA 5M18A 5KMWA 4ZBEA 3BYDA 2XQZA 1Q2QA 4N1HA 1J9MA 1LI0A 4OPQA 4ZJ1A 1CK3A 2RL3A 3NDEA 3QNBA 3ZG5A 2Q9MA 3CG5A 3G2ZA 3VP0A 3WRZA 1NRFA 2EXBA 3BM6A 1PZPA 3S1YA 4N1XA 1K57C 3VFHA 4IVIA 2WAEA 3UDFA 4OOLA 1FR6A 1K25A 4S2NC 2IWCA 3G32A 4UA7A 3CJMA 3LCEA 4X69A 1GHMA 3ZNTA 4X55A 1MWSA 2J8YA 3PBTA 3N6IA 3OPRA 1ZC2A 4HBUA 5EECA 2Y59A 1CI8A 5EE8A 3ZG7B 3EQVA 3ZHHA 2A49A 2EXAA 1CEFA 3RXXA 3SH7A 1ZG6A 3LY4A 4ZJ2A 3BFGA 2Z2MB 3CZDA 3SH9A 4P6BA 3MXRA 4RA7A 2H5SA 4Y0UA 4X68A 1PW8A 2FFFB 2ZC7A 1ESUA 4GB7A 3UE0A 5FQKA 3VP1A 4DXCA 4EQIA 4Q8IA 4LCMA 2ZQAA 2HP5A 2Z2LB 3Q7VB 5E2FA 2Q9NA 1YLJA 3TSGA 2WK0A 4GDBA 1K55A 3N8SA 3OCLA 3N7WA 2BG1A 3IHAA 4MBHA 2QZ6A 1Z6FA 2XK1A 2XEPA 3BRMA 5CERA 3IWIA 2Y4AA 1MXOA 4JXGA 4JF5A 5U47A 4ZDXA 1S6RA 4LV2A 1IEMA 1NY0A 1IYPA 3AGFA 3IWQA 2PU4A 3NCKA 1BULA 2ZQ7A 3HREA 4DE1A 1XA7A 1JTGA 1PIOA 4WEJA 4KG5A 3OZHA 5CTMA 3ZGAB 2Y2PA 3GTCA 4KZ7A 3VP2A 4BENA 2OLVA 1XP4A 2EFXA 1L2SA 1YQSA 2RCXA 4OQGA 4BJPA 1L0GA 3IF5A 4E3IA 4RYEA 3NBLA 4LV1A 4FH4A 1BT5A 4R23A 3O86A 3WS2A 4MBKA 3HLEA 5E43A 3G30A 4F94A 4R0QA 4DDSA 3ZFZA 4BD0A 1TEMA 2HDRA 1E4DA 4KQQA 2X71A 4GD8A 3FWLA 4ZTKA 5HAQA 4S2IA 1NZOA 3MZDA 4DE3A 2ZQ8A 4X53A 4X56A 2WZXA 3DTMA 3GR2A 1WYCA 5DTTA 3HLGA 3ZG8B 5TFQA 4EWFA 1YLYA 4OPZA 3ITAA 1PI4A 3PBNA 4GKUA 5HAPA 1Y54A 4H8RA 1GA0A 3P98A 5DTKA 1ES4A 2OV5A 1FSWA 4WELA 4EBPA 4S2PA 5A91A 1KDSA 2XH9A 4OOMA 1W8QA 4OVDA 4LV0A 4XUXA 3ITBA 4E3OA 4KQOA 5GLCA 4WBGA 5DVAA 4HEFA 1MY8A 5DF9A 2ZQ9A 4IEDA 5EOOA 4FCFA 3W8KA 3FKVA 5F1GA 1I2WA 1KE3A 5EVID 3NDGA 3V3SA 2R9XA 1NZUA 3OCNA 2A3UA 1E25A 2C5WB 2ZM8A 1K56D 2Y2GA 4U0TA 5E2HA 3VOYA 4EUZA 3PBRA 3GRJA 2OSUA 4QD4A 1NXYA 1E3UA 5EUAA 3BEBA 4IBXA 1CEGA 2B5RA 5EVLA 1G6AA 3IXHA 1XX2A 4KZAA 4DE0A 3Q1FA 2VGKA 4PM7A 5FQJA 3WRTA 4BLMA 4GDNA 4S2JA 5M1AA 5FI7A 1MWUA 1XGIA 4KG6A 3G34A 1ES2A 4MEZA 4OKPA 1JWPA 5GHZA 2WZZA 3WS5A 1XGJA 3IXBA 4OPYA 3PBQA 2JC7A 1GCEA 1JVJA 3BFDA 3DW0A 3N4IA 1ERQA 3G2YA 2J9PA 1PWCA 3NIAA 4MLLA 2ZLYA 3LEZA 1N4OA 2HPBA 3GSGA 5HW3A 2PBYA 4C3QA 1KVLA 3PAEA 4PMAA 3UNWA 3TG9A 3VFFA 1XKZA 3HLWA 4QHCA 1TVFA 4ZJ3A 1PW1A 3BLMA 2EX6A 1KVMA 4NETA 2DRWA 3OC2A 1HZOA 1KGFA 1W7FA 2Y2HA 4WMCD 2ZQCA 3UY6A 2XF3A 3GV9A 2I72A 1K6SA 5F1FA 1LHYA 3IXDA 3HLDA 2QPNA 3BLSA 2WGIA 4OP8A 1IYSA 4D2OA 4N92A 5HL1A 1E3UD 3WS1A 1NYMA 2ZD8A 3B3XA 5FA7A 1Q2PA 5CGXA 1SDNA 5FQMA 2V2FF 3HBRA 4JXSA 1L0FA 5FI6A 3HLFA 4KZ3A 5GHYA 1IELA 4KENB 4OQIA 1SCWA 3M6HA 4GN2A 5FASA 1C3BA 4R1GA 5EVIA 3RXWA 2V20A 2XGNA 5AQ7A 4XXRA 4DRTA 3C4PA 3TOIA 4S2MA 3V5MA 3UE1A 4KG2A 4ZAMA 1BLCA 4S2LA 1K54C 4QY6A 5HAIA 4S2OA 1PZOA 1K4FA 1MBLA 4UA6A 1W8YA 2WYXA 5DF7A 3A3IA 2ZC4B 3O3VA 2IWDA 3V39A 2FFYA 2X01A 1RGZA 1KDWA 4QB8A 4IVKA 3I7JA 4JBFA 1XA1A 4KZ6A 4UAAA 5CHUA 5FQ9A 5FQIA 4E3NA 1BLPA 3NC8A 1EROA 3A3JA 1BUEA 1BSGA 4L0LA 3ZCZA 3PAGA 2HP9A 5FAPA 4ID4A 4E6XA 3W4OA 3HLCA 4NK3A 4PM8A 5CEDA 2E8IA 2XD5A 5FAOA 3HUMA 3QHYA 4B4ZA 4KZ8A 3Q7ZA 2DNSA 5J8XA 5JYOA 5F83A 3V50A 1MWTA 1M40A 2EX8A 4C75A 4N9LA 2H10A 3BFFA 3NY4A 3M2KA 3OPHA 1NYYA 4QU3A 4OQ0A 3SH8A 2GDNA 3A3FA 2V1ZA 1K54A 4PPRA 1K38A 1GA9A 1HTZA 4EV4A 3LY3A 4K91A 5DTSA 5A90A 1FCNA 1KGEA 2PU2A 2XR0A 1FQGA 4OONA 1SHVA 1PWGA 3C7VA 5CTNA 4K0XA 1M6KA 2ZMAA 1MKIA 4BL2A 1IYOA 1IYQA 2Y2KA 1RP5A 3C7UA 1DY6A 4YINA 2WUQA 1BZAA 4GOGA 5A92A 3N8RA 5L2FA 4CPKA 3VSKA 3IXGA 5EPHA 2OLUA 3SOIA 1JWVA 1W79A 3G31A 4PM5A 2QMIA 2G2UA 4WM9A 1EI5A 1ES5A 2WGWB 3LO7A 5D3OA 1FR1A 3MFDA 3C5AA 5DF8A 3G35A 4Z9QA 4HESA 3HVFA 4U0XA 4QJGA 1O07A 3IWOA 4JPMA 4DF6A 2H0TA 1SKFA 3E2KA 1ONHA 2HDSA 1XPBA 1YM1A 4BQMA 4JXVA 3IH9A 5EVIB 3PTEA 3ZG0A 1AXBA 3HUOA 2P9VB 1GHIA 3GMWA 3SS5A
chains in the Genus database with same CATH superfamily
5FI2A 3CMZA 4XUZA 4HOIA 3F1PB 1EWZA 1JTDA 1BLHA 1O7EA 4I3IA 2Y2IA 1FOFA 3EGDC 4OLGA 2WADA 4F3LB 1TDLA 3E98A 3ZVTA 3UPNA 2PT7A 1W5DA 5HWTA 3BFCA 2Y2JA 1ES3A 5E2EA 4EEPA 4EBNA 5L07A 3MR0A 3S22A 2CC1A 1T1AA 1YPRA 1IFQA 2J9OA 1XXMA 1F9IA 2P08A 2VK3A 1SKOA 2W27A 3V3RA 3JYIA 2VKSA 2Y2NA 4DKIA 4LENA 4S2KA 2IWBA 2ZM2A 4I5SA 4E3JA 3UDXA 1K57A 5J7EA 2UWXA 3BQAA 4R38A 3EQUA 5BOHA 2J7VA 3T4LA 4C6YA 1YT4A 4DMZA 5HARA 1TS7A 4GZBA 2V8CA 2XFSA 3OLOA 4QY5A 2WAFA 4JGPA 3T1RA 3D4FA 2WKRA 4R4RA 2Y2LA 1P97A 5F82A 1UWPX 4F3LA 1DJCA 3ZNYA 1LL8A 5HPFA 4CJNA 3AGDA 1DRMA 4M3KA 4U3TA 4BD1A 3BWLA 1TDGA 5TBMB 1H3QA 1LSWA 1YLPA 5A93A 2VZWA 3QP2A 1MKMA 5GHXA 3LI9A 2XDMA 3IHBA 4N9KA 1NLYA 5GLBA 2WKHA 2EX2A 2ZL1B 5A8BA 2IA2A 1H0MA 4Y5FA 1LSVA 2W1RA 1W63M 3CI6A 4FH2A 1ZTUA 3LFVA 1I2SA 4LGWA 1YMXA 3KYZA 4E3KA 2L4RA 4UHUA 4Q0HA 2HDUA 3VMAA 3QNCA 1NJ4A 2JE5A 2EA9A 5KMWA 3BYDA 1K0KA 3R4KA 1CK3A 2VA0A 2JKTM 3U4LP 3VP0A 1NRFA 1Y28A 3S1YA 4N1XA 3C2WA 3NOPC 4OOLA 4UA7A 3LCEA 4WF0A 4X55A 2VV7A 3T4OA 1ZC2A 4HBUA 5EECA 3ZG7B 2A49A 4D60A 3LY4A 3BFGA 4O01A 4P6BA 4Y0UA 4X25A 4X68A 2A2LA 1ESUA 4IUHA 3RFBA 3VP1A 4LCMA 2JKFA 4ESPA 2KOIA 2W3FA 4GDBA 3TW8A 5DKKA 3OCLA 1Z6FA 2XK1A 3BRMA 5CERA 4NEED 5G4YA 2Y4AA 3K3DA 4JXGA 5U47A 1S6RA 1MC0A 5HDCA 3IWQA 2PU4A 3HREA 4WEJA 4HJ4A 4KG5A 4JGOA 3HJIA 3OZHA 2Y2PA 2OOLA 3VP2A 2RCXA 3E4OA 2XRNA 3NBLA 3FPVA 3D9YA 3NULA 3FG8A 3NJAA 2X71A 3DAVA 3KYEA 3MZDA 2WZXA 1WYCA 5DTTA 3HLGA 4GW9A 4I3JA 1YLYA 1YSPA 5HAPA 3UE6A 1GA0A 1G6OA 1A0KA 2PD8A 1KDSA 2XH9A 1S4RA 3H7WB 3R7WA 4OVDA 3ITBA 4HEFA 5DF9A 1S66L 3JPUA 5EVID 2NUPC 3V3SA 4Y3IA 2ZM8A 5G4ZA 3UMDA 3GRJA 4QD4A 1NXYA 1CEGA 5L09A 3IXHA 2VGKA 4S2JA 4L9EA 5M1AA 5FI7A 3KO6A 1PFLA 3GECA 2WZZA 3WS5A 1VETB 2JC7A 2ZMFA 1GCEA 2VLGA 1JVJA 3BFDA 3N4IA 1LT0A 4Y2FA 3LEZA 3UNWA 3E4QA 2Y79A 3TG9A 3VFFA 4QHCA 1TVFA 2EWVA 3BLMA 2JKRI 2EX6A 3OC2A 1XFNA 1HZOA 2Y2HA 1Z09A 2I72A 2FZ0A 1ZHHB 4EUVA 1NYMA 3B3XA 2JKGA 4HHDA 5CGXA 1SDNA 3HBRA 5FI6A 3HLFA 4KZ3A 1XJ4A 4KENB 4OQIA 2VV8A 1AWIA 1C3BA 4R1GA 5DJUA 3C38A 5EVIA 2V20A 4BBUA 5AQ7A 4XXRA 3C4PA 4S2MA 3V5MA 3UE1A 4FUWA 2AVXA 1N9NA 3A3IA 3O3VA 2X01A 4LLOB 1OTIA 1KDWA 4QB8A 5F68A 1MZUA 5AVFA 4KZ6A 2YKFA 4UAAA 4E3NA 2XSSA 3IX8A 5FQIA 3A3JA 3ZCZA 5EM1A 5FAPA 4DJ3A 1X0OA 2XD5A 5FAOA 4X1LA 1S67L 4EQ1A 1D7EA 3TRCA 1M40A 4N9LA 3BFFA 3M2KA 4QU3A 2V1ZA 3CITA 4L9FA 5EM0A 5A90A 1FCNA 1T19A 2PU2A 2XR0A 1SHVA 1PWGA 5CTNA 2ZMAA 4NXBA 3H7WA 3R7WB 1H8MA 5A92A 3CLOA 4CPKA 2OLUA 1W79A 2W0NA 4B93A 3KX0X 1ES5A 2WGWB 3LO7A 4HESA 3KSGA 5HDSA 4II7A 2D01A 4JPMA 3IWOA 1F5MA 1XPBA 4JXVA 3PTEA 1VEUB 3TJZC 4GHIA 3ZYTA 4ETXA 1OTBA 3QP6A 1I5QA 2O9CA 5DJTA 4EXOA 2ZC5B 2NUTC 3CWFA 5CHMA 3MXQA 1WE4A 3IT9A 1YLTA 1JNUA 2O9BA 4HNBA 2INWA 2KLIA 4R3BA 3MZFA 5IT5A 3S4XA 1CF0A 1DP6A 2W1TB 3OPLA 1VETA 4R3JA 5FQQA 5HFOA 3TE8A 1PI5A 2W3HA 3NI9A 1OJGA 3C30A 1V9ZA 4DE2A 4MCWA 4B4XA 3VP4A 3G4PA 1IKGA 1KE0A 2WKIA 3LIBA 3EOIA 5FSRA 3S7QA 5GLDA 4PM6A 4BL3A 2P7JA 4WL9A 2PR5A 4Y0TA 1G68A 5M19A 3PBOA 2ZBBA 3A0SA 1QMEA 1N9BA 4JGQA 4FSFA 3JVUA 4LV3A 4DXBA 3W4QA 5AQAA 1BLSA 4X1MA 5FL3A 3UN7A 2V1AA 4GS9A 5LBRA 3CAXA 5GLAA 2PYPA 3ULFA 4ARZB 3Q81A 5EVEA 4EEUA 4RX2A 3GVBA 2Y91A 2JCHA 3P09A 1LL5A 2DCFA 3LI8A 4DDYA 5AVEA 3RJUA 3O88A 1BTLA 1ONGA 3M2JA 2EFUA 2W3GA 4EERA 5KSCA 1QMFA 1VEUA 2ZMVA 4WUJA 4BMWA 2A24A 2QKPA 2WKPA 2HP6A 4JKTA 3SS4A 1L0EA 1Y4OA 4E3MA 2O9AA 5FAQA 2I9VA 2J3TC 3S7PA 3ZQ5A 1PWDA 4S2NA 4ZRRA 1KOUA 1VQQA 5KSHA 4MNRA 1MWRA 2HJ9C 3W4PA 2R9WA 4GS9B 4UEYA 3UB9A 3FPWA 2JKRM 5GL9A 1XJ2A 3ZG9B 4ZBEA 2XQZA 5EV0A 3OOVA 3ZG5A 3G2ZA 3WRZA 3BM6A 1DP9A 5DFYA 4IVIA 4S2NC 3RH8B 2IWCA 3G32A 4H6JA 1GHMA 3CUEA 3ZHHA 2EXAA 1UGUA 1CEFA 3KYQA 1CJFA 2B02A 4ZJ2A 3SH9A 4BBTA 3MXRA 2PR6A 2ZC7A 3U2AA 2VGLM 4EU0A 4DXCA 4EQIA 2XA7M 2ZQAA 2HP5A 3TSGA 2WK0A 3B42A 3N8SA 2BG1A 1S1ZA 4XT2A 3QP5A 3CUEC 4WN5A 1NY0A 1IYPA 3BY9A 3NCKA 1JTGA 1PIOA 5CTMA 4KZ7A 2ZOHA 3EWKA 3K3CA 5E43A 2Y8HA 3FWLA 4ZTKA 5HZHA 4S2IA 4Q0IA 4Q0JA 4X53A 4X56A 3GR2A 3CPTB 4EWFA 3PBNA 4H8RA 1ES4A 2QWSA 1FSWA 4WELA 5TJJA 1OJ5A 3E4PA 2J3TD 1W8QA 1N9LA 1EW0A 5C5KA 4WBGA 5DVAA 1MY8A 4IEDA 5EOOA 3W8KA 3FKVA 1KE3A 3NDGA 1NZUA 3OCNA 2VGLS 1NWZA 2CMNA 2Y2GA 4U0TA 4EUZA 4M4XA 1E3UA 2B5RA 4WLAA 5EVLA 3VE3A 1WA9A 1XX2A 1XGIA 4MEZA 5IU1A 2K7SA 4KQDA 4OKPA 3MF0A 2PD7A 3IXBA 4O8GA 4Z1WA 1P0ZA 4FTXA 3NIAA 3PHYA 4CLCA 5HW3A 1KVLA 3HLWA 4HY8A 2DRWA 1W7FA 2XF3A 1K6SA 3RTYA 1LHYA 4HJ6A 4R6LA 3HLDA 2QPNA 2WGIA 4H6JB 2Z6CA 4N92A 1N9OA 1E3UD 3WS1A 2ZD8A 1GSVA 1Q2PA 4CLCC 4GN2A 4G3VA 5FASA 1W63Q 3V67A 3TOIA 1BLCA 2VX8A 4S2LA 5L10A 4MN5A 4QY6A 4S2OA 1MBLA 4UA6A 3P7NA 2WYXA 3A0RA 2IWDA 3V39A 1BLPA 4FOFA 4L0LA 1BSGA 3IX4A 5CEDA 2E8IA 4KZ8A 5J8XA 3S7OA 3OBFA 5JYOA 3GDIA 3V50A 4C75A 4R70A 3A3FA 3LYXA 4EV4A 1HTZA 4Y13A 4HP9A 4OONA 3C7VA 4DN0A 3LIDA 1M6KA 1MKIA 2Y2KA 2DMWA 1RP5A 3IBJA 4MN7A 1DY6A 4YINA 2D02A 2WUQA 1BZAA 3N8RA 2GX5A 4I3AA 5EPHA 1JWVA 4CLCD 5D3OA 3BY8A 4U0XA 4QJGA 4DF6A 2H0TA 3E2KA 4LRXC 3IH9A 5EVIB 1IOUA 1AXBA 3KSHA 3GMWA 3SS5A 4UQIS 1CI9A 3F1NB 1RGYA 3BW6A 4KZBA 3UO9A 3A3EA 3DWKA 3AGEA 4JXWA 3D72A 4P87A 5EVIC 4CLCB 1LI9A 3M6BA 3VOZA 3SW1A 4WZ5C 3BECA 3BFEA 3EGXC 5E2GA 3IF6B 3H82A 1H5XA 4I39A 3FZCA 2ZM0A 3L9KA 5JYPA 4OPRA 2WGWA 2P04A 3IQAA 1ZKJA 4LCLA 2V1BA 4JLFA 2ZJ9A 4GD6A 1T1BA 1K6RA 5FATA 3UB8A 2ZC6B 4R4SA 1PRQA 3UB6A 3KSIA 3H9WA 3MZEA 3PBSA 2YKHA 1FSYA 2MJ6A 4E3LA 4A5RA 5AQ9A 4OQHA 5CXWA 3MXSA 3VP3A 3DTIA 1TS6A 1VM1A 3LR4A 4ME4A 4Y7PA 2B18A 2P74A 3IX3A 3Q7VA 5EOEA 1JWZA 5CGWA 1L0DA 4NKPA 1LL9A 5DFXA 1NLZA 1ALQA 1LSXA 1HVBA 1OMEA 5CHJA 3JVVA 1YLWA 4Y17A 5AQBA 4EBLA 4HJ3A 5G18A 1LLBA 3T4SA 1YMSA 3OPPA 2Y55A 5HL6A 5CEBA 5CX7A 3UB5P 4NXEA 4NG2A 4Y0OA 4E04A 3QP8A 1DJBA 2XA7S 4HH2A 5DKLA 3IH8A 2GZAA 1CQAA 4AFIA 3DBAA 3O87A 1DP8A 3UPOA 3HL9A 5IHVA 3DTEA 4IHQA 4WZ5A 1ESIA 1FCOA 3Q82A 5KZHA 3LIFA 2Y2QA 4WZ4A 4RVAA 1F98A 1OTEA 3L7HA 1T18A 4K0WA 1ACFA 1OPXA 4P0MA 1K4EA 3IS2A 3UE3A 4UQIM 1RCJA 2HF6A 4KQRA 4MBFA 5FEGA 4KZ4A 4O7DA 2E8JA 4MN6A 2WKEA 5M18A 1J9MA 1LI0A 4ZJ1A 4HP4A 2RL3A 3NDEA 3QNBA 3CG5A 1S1YA 1PZPA 3MMHA 1K57C 4GHIB 1FR6A 1K25A 5FEFA 1VB6A 3ZNTA 1MWSA 5K5BA 5HWWA 3N6IA 2Y59A 5EE8A 3LEQA 3RXXA 4YWZA 3SH7A 3MJQA 2Z2MB 3CZDA 4RA7A 2FFFB 4GB7A 3T1QB 4Q8IA 2K31A 2M7VA 3Q7VB 1OTAA 1YLJA 1YKDA 2WKQA 3D3OA 3N7WA 4MBHA 1BYWA 2QZ6A 5F69A 5MC7A 3FC7A 4LV2A 1IEMA 2VV6A 3AGFA 4DE1A 1BULA 2ZQ7A 1XA7A 4QPRA 3K2NA 3LR0A 2J80A 1TD5A 1XP4A 4BJPA 1YQSA 4E3IA 4OQGA 4RYEA 4FH4A 4R23A 4MBKA 5L8MA 4F94A 4R0QA 4DDSA 3ZFZA 1SZVA 1FILA 1TEMA 2HDRA 5HAQA 1NZOA 4DE3A 2ZQ8A 4EESA 2UV0E 3ZG8B 4HIAA 5TFQA 1PI4A 1Y54A 2W3DA 5DTKA 4IUKA 4EBPA 3NECA 4LV0A 4NXFA 3NOUC 4E3OA 2ZQ9A 4FCFA 5F1GA 1NRJA 3ICYA 3DTKA 3F1PA 3T4JA 2OSUA 1L3LA 5EUAA 3BEBA 3VV4A 3EEAA 1G6AA 4KZAA 4LRZE 4DE0A 1TS0A 5FQJA 4CLCE 4GDNA 1MWUA 3G34A 1ES2A 2G7UA 5EFWA 2PBDP 3PBQA 5IS1A 2QJ7A 3QP1A 3DW0A 2O0YA 1FIKA 3G2YA 3CPTA 2JHEA 2J9PA 1PWCA 4MLLA 2PBYA 3PAEA 4PMAA 4O0PA 3LICA 1XKZA 2V9AA 3E0YA 5FDSA 1D1JA 1GSXA 1T1CA 1KVMA 4NETA 3B47A 1KGFA 3MQ0A 5HD5A 3IXDA 1P9WA 4OP8A 1IYSA 4K08A 5FQMA 2V2FF 1IELA 5TBMA 1SCWA 3M6HA 4XT2B 4DRTA 4KG2A 4ZAMA 1K54C 2M1CA 5HAIA 1W8YA 2ACGA 5DF7A 3NOTC 2ZC4B 2J3WA 2FFYA 3IS2B 1RGZA 4P6ZS 5AJGA 3I7JA 3QP4A 5FQ9A 3NC8A 1EROA 3PAGA 3W4OA 5I5LA 2OWJA 4PAUA 3QHYA 3MQOA 1MWTA 2H10A 3NY4A 1NYYA 3SH8A 4PPRA 2KX6A 1GA9A 3LY3A 1GSWA 4K91A 1KGEA 3HCYA 3BQ8A 4BL2A 1IYOA 1IYQA 3C7UA 3H82B 4BBVA 5L2FA 3SOIA 2QMIA 2G2UA 3P01A 1EI5A 3MFDA 3C5AA 5DF8A 4Z9QA 2BTFP 3PXPA 2HDSA 4X6TA 2P9VB 1GHIA 4IJGA 3MSHA 1KGGA 3T1SA 1J3WA 3FYZA 4OLDA 1H8YA 4WMCA 3WS0A 2Y2OA 4KUKA 4PKYG 3T1XA 2X02A 2VGJA 2EX9A 5CGSA 2V8FA 1XJ6A 1GHPA 1H8ZA 2ZC3B 3HJKA 1U60A 2B95A 4YFMA 1ZG4A 2HZ5A 4HI4A 2XLNA 3WWXA 2V0WA 1MPLA 3HUNA 3DWZA 2XD1A 1SDEA 1DJAA 3E2LA 3F1OB 4ARZA 1WYBA 4PM9A 3SS3A 4HBTA 3O5YA 2M7UA 2PRFA 5TGFA 1K56A 2O99A 3ZVWA 1XFQA 2ZQDA 4WEKA 1FCMA 3C4OA 2WGVA 2VEAA 2HDQA 4OOYA 3HLBA 4UA9A 5CECA 3MBZA 3WS4A 4MDZA 3FV7A 4IBRA 4JF4A 3FKWA 4B88A 1HD8A 2XFTA 3MKEA 1YLZA 3GQZA 3A3DA 3F1OA 5HD3A 2BLSA 4E6WA 4HH3A 4KZ5A 1ERMA 2OAQ1 3MKFA 1S0WA 2Y2MA 4B9OA 4GCZA 2A24B 4G3WA 2H0YA 3T4TA 1G5UA 3IF6C 3BJNA 1P9RA 1K55C 1PYYA 2PDRA 2C6WB 4QWOA 3ISGA 5HX9A 4WYYA 1ODVA 2KDKA 4FD8A 3VSLA 4KZ9A 3Q07A 1IKIA 3KSFA 4RQ9A 3UDIA 4JF6A 2ZOIA 2Z6DA 4NXGA 4OH0A 4OP5A 3N8LA 3PR6A 4P85A 2VJWA 2L1MA 2P9VA 2W3EA 1KE4A 5FDHA 3UPPA 4GNUA 1OT9A 4I38A 3ZDJA 1SKOB 3T12B 3IF6A 2G2WA 2JBFA 5I94A 4Y15A 2OAP1 4HQAA 4RX3A 5TR7A 3UMEA 5CRFA 1HLUP 1Q2QA 4N1HA 5HSQA 4OPQA 3A0VA 2Q9MA 4PKYA 3MS6A 5HPIA 2EXBA 2EWWA 3VFHA 2WAEA 2HJEA 3UDFA 5J4EA 4X69A 3CJMA 2J8YA 3PBTA 3OPRA 1CI8A 2PHYA 3EQVA 4EETB 1ZG6A 4R3AA 2H5SA 1PW8A 3UE0A 3MQQA 5FQKA 2Z2LB 5E2FA 2Q9NA 2HGVA 4YOFA 5HDDA 1K55A 2QJ5A 3T50A 3IHAA 2XEPA 2JKTI 3CHWP 3EEHA 3IWIA 1MXOA 4JF5A 1VHMA 4ZDXA 3W2ZA 2XROA 1OT6A 4EW7A 3PYPA 3ZGAB 3GTCA 4BENA 2OLVA 2EFXA 1L2SA 1L0GA 3IF5A 4LV1A 1BT5A 3O86A 3WS2A 3HLEA 3F1NA 3G30A 2OWHA 1YSQA 4BD0A 4KQQA 1E4DA 4GD8A 3DTMA 2BASA 2W1TA 1G28A 2GJ3A 1PNEA 4OPZA 1XJ3A 3ITAA 2ZL1A 2H28A 4GKUA 2HV1A 3P98A 5HWVA 2OV5A 4S2PA 5A91A 4OOMA 3LIEA 4XUXA 3LIAA 4KUOA 4KQOA 5GLCA 3MFXA 1I2WA 2R9XA 5F6AA 2A3UA 3LGOA 1E25A 2C5WB 3B33A 1K56D 2PYRA 5E2HA 3VOYA 3VOLA 3PBRA 2QHKA 3LUQA 1STZA 2K2NA 4IBXA 3LR5A 3NHQA 5KIZA 3T4KA 4LPZA 4LFUA 3Q1FA 4PM7A 3LR3A 3WRTA 4BLMA 4GJ4A 4KG6A 2FH5A 4BWIA 2V0UA 1JWPA 5GHZA 2GNXA 1XGJA 4OPYA 3SZTA 4PHTA 1ERQA 2R78A 3T4QA 2ZLYA 5J3WA 2LB5A 4ETZA 1N4OA 2HPBA 3GSGA 4G3KA 4C3QA 1TS8A 1OTDA 4YNRA 2Q0OA 4ZJ3A 3S7NA 1PW1A 3C8CA 3IBRA 4CQHA 4WMCD 3UY6A 2PAVP 2ZQCA 3GV9A 5F1FA 3BLSA 4GLQA 1UWNX 2QYBA 4D2OA 5HL1A 5FA7A 4JXSA 1L0FA 5GHYA 3RXWA 1TF1A 2XGNA 1S4SA 3G6OA 1PZOA 1K4FA 2LB9A 4L9GA 4IVKA 4JBFA 1XA1A 5CHUA 1F2KA 4JGRA 1BUEA 2HP9A 4ID4A 1V9YA 4E6XA 3HLCA 4NK3A 4PM8A 3HUMA 4B4ZA 3Q7ZA 2DNSA 5F83A 2EX8A 1YAXA 3OPHA 4OQ0A 2GDNA 1D06A 1K54A 1K38A 2JN7A 5F5YA 4MMNA 5DTSA 1FQGA 3VE4A 4DJ2A 4K0XA 4LRYC 4GOGA 3VSKA 3IXGA 3G31A 4PM5A 4WM9A 3UB7A 1FR1A 3G35A 3HVFA 1O07A 1SKFA 1ONHA 1YM1A 4P6ZM 4BQMA 3ZG0A 2L0WA 3HUOA
chains in the Genus database with same CATH topology
1CI9A 1RGYA 1KGGA 1I5QA 4KZBA 5FI2A 3CMZA 3UO9A 4XUZA 3A3EA 3FYZA 4OLDA 1H8YA 3DWKA 3AGEA 4WMCA 3WS0A 1EWZA 2ZC5B 2Y2OA 4JXWA 1JTDA 1BLHA 5CHMA 1O7EA 1WE4A 3IT9A 2Y2IA 2X02A 1YLTA 4P87A 1FOFA 4OLGA 2VGJA 2EX9A 5CGSA 5EVIC 2WADA 1TDLA 4R3BA 1GHPA 1H8ZA 1LI9A 2ZC3B 3M6BA 3ZVTA 3UPNA 1U60A 3MZFA 3VOZA 3S4XA 1W5DA 3BFCA 3OPLA 1ZG4A 3BECA 2Y2JA 3BFEA 1ES3A 4WZ5C 4YFMA 5E2EA 5E2GA 4R3JA 5FQQA 2XLNA 5HFOA 3WWXA 4EBNA 3IF6B 1PI5A 3S22A 2CC1A 3NI9A 1H5XA 1MPLA 4DE2A 3FZCA 4B4XA 3VP4A 2ZM0A 2J9OA 3G4PA 3HUNA 5JYPA 4OPRA 2WGWA 1XXMA 3DWZA 1ZKJA 3IQAA 4LCLA 1IKGA 2XD1A 1KE0A 2WKIA 1SDEA 4JLFA 1DJAA 3E2LA 5FSRA 2ZJ9A 4GD6A 1K6RA 1WYBA 4PM9A 5FATA 3SS3A 2ZC6B 4R4SA 4HBTA 3V3RA 3JYIA 5GLDA 3MZEA 3PBSA 4PM6A 1FSYA 5TGFA 4BL3A 4Y0TA 1G68A 1K56A 3ZVWA 4E3LA 4A5RA 5M19A 2Y2NA 4DKIA 3PBOA 5AQ9A 2ZQDA 4OQHA 4WEKA 1FCMA 3C4OA 4LENA 2WGVA 4S2KA 1QMEA 1N9BA 5CXWA 3MXSA 4FSFA 2HDQA 3VP3A 4OOYA 3HLBA 4LV3A 4UA9A 5CECA 2IWBA 2ZM2A 3MBZA 4DXBA 3W4QA 5AQAA 1BLSA 3WS4A 4E3JA 3FV7A 1VM1A 3UN7A 4IBRA 3UDXA 1K57A 4JF4A 4Y7PA 2P74A 2UWXA 3FKWA 4B88A 3Q7VA 3EQUA 1JWZA 2J7VA 5EOEA 1HD8A 2XFTA 3MKEA 5CGWA 5BOHA 1L0DA 1LL9A 1ALQA 1YLZA 5GLAA 4C6YA 1YT4A 5HARA 4X6TA 1HVBA 4GZBA 1OMEA 3GQZA 3A3DA 5CHJA 2XFSA 4QY5A 1YLWA 2BLSA 2WAFA 3Q81A 5AQBA 4EBLA 4E6WA 3D4FA 4R4RA 2Y2LA 4KZ5A 1LLBA 5G18A 1ERMA 5F82A 1YMSA 3OPPA 2Y55A 3MKFA 1S0WA 2Y2MA 5CEBA 4RX2A 1DJCA 3ZNYA 3GVBA 2Y91A 2JCHA 4CJNA 2H0YA 3P09A 3AGDA 1LL5A 2DCFA 4M3KA 3IF6C 4U3TA 4Y0OA 4BD1A 1TDGA 4DDYA 1K55C 3RJUA 1DJBA 1PYYA 3O88A 2C6WB 3ISGA 1YLPA 5HX9A 1BTLA 3IH8A 4WYYA 1ONGA 3M2JA 4FD8A 2EFUA 5A93A 3VSLA 4KZ9A 5KSCA 3O87A 1QMFA 3UPOA 3HL9A 5GHXA 3Q07A 1IKIA 5IHVA 2XDMA 3UDIA 4JF6A 4WZ5A 1ESIA 3IHBA 4N9KA 4OH0A 2HP6A 4OP5A 1FCOA 5GLBA 3N8LA 4P85A 2WKHA 4JKTA 2EX2A 1L0EA 3Q82A 3SS4A 5KZHA 2Y2QA 4E3MA 2P9VA 1KE4A 5FDHA 4WZ4A 3UPPA 4GNUA 4RVAA 5FAQA 3ZDJA 1PWDA 3IF6A 4K0WA 4S2NA 4P0MA 1K4EA 1VQQA 5KSHA 3UE3A 4FH2A 4MNRA 1I2SA 1MWRA 2G2WA 1YMXA 2JBFA 1RCJA 4KQRA 4MBFA 4KZ4A 3W4PA 2R9WA 4E3KA 4UHUA 5I94A 4O7DA 2HDUA 3VMAA 3QNCA 5GL9A 1NJ4A 4RX3A 2JE5A 5TR7A 2WKEA 3ZG9B 5CRFA 5M18A 5KMWA 4ZBEA 3BYDA 2XQZA 1Q2QA 4N1HA 1J9MA 1LI0A 4OPQA 4ZJ1A 1CK3A 2RL3A 3NDEA 3QNBA 3ZG5A 2Q9MA 3CG5A 3G2ZA 3VP0A 3WRZA 1NRFA 2EXBA 3BM6A 1PZPA 3S1YA 4N1XA 1K57C 3VFHA 4IVIA 2WAEA 3UDFA 4OOLA 1FR6A 1K25A 4S2NC 2IWCA 3G32A 4UA7A 3CJMA 3LCEA 4X69A 1GHMA 3ZNTA 4X55A 1MWSA 2J8YA 3PBTA 3N6IA 3OPRA 1ZC2A 4HBUA 5EECA 2Y59A 1CI8A 5EE8A 3ZG7B 3EQVA 3ZHHA 2A49A 2EXAA 1CEFA 3RXXA 3SH7A 1ZG6A 3LY4A 4ZJ2A 3BFGA 2Z2MB 3CZDA 3SH9A 4P6BA 3MXRA 4RA7A 2H5SA 4Y0UA 4X68A 1PW8A 2FFFB 2ZC7A 1ESUA 4GB7A 3UE0A 5FQKA 3VP1A 4DXCA 4EQIA 4Q8IA 4LCMA 2ZQAA 2HP5A 2Z2LB 3Q7VB 5E2FA 2Q9NA 1YLJA 3TSGA 2WK0A 4GDBA 1K55A 3N8SA 3OCLA 3N7WA 2BG1A 3IHAA 4MBHA 2QZ6A 1Z6FA 2XK1A 2XEPA 3BRMA 5CERA 3IWIA 2Y4AA 1MXOA 4JXGA 4JF5A 5U47A 4ZDXA 1S6RA 4LV2A 1IEMA 1NY0A 1IYPA 3AGFA 3IWQA 2PU4A 3NCKA 1BULA 2ZQ7A 3HREA 4DE1A 1XA7A 1JTGA 1PIOA 4WEJA 4KG5A 3OZHA 5CTMA 3ZGAB 2Y2PA 3GTCA 4KZ7A 3VP2A 4BENA 2OLVA 1XP4A 2EFXA 1L2SA 1YQSA 2RCXA 4OQGA 4BJPA 1L0GA 3IF5A 4E3IA 4RYEA 3NBLA 4LV1A 4FH4A 1BT5A 4R23A 3O86A 3WS2A 4MBKA 3HLEA 5E43A 3G30A 4F94A 4R0QA 4DDSA 3ZFZA 4BD0A 1TEMA 2HDRA 1E4DA 4KQQA 2X71A 4GD8A 3FWLA 4ZTKA 5HAQA 4S2IA 1NZOA 3MZDA 4DE3A 2ZQ8A 4X53A 4X56A 2WZXA 3DTMA 3GR2A 1WYCA 5DTTA 3HLGA 3ZG8B 5TFQA 4EWFA 1YLYA 4OPZA 3ITAA 1PI4A 3PBNA 4GKUA 5HAPA 1Y54A 4H8RA 1GA0A 3P98A 5DTKA 1ES4A 2OV5A 1FSWA 4WELA 4EBPA 4S2PA 5A91A 1KDSA 2XH9A 4OOMA 1W8QA 4OVDA 4LV0A 4XUXA 3ITBA 4E3OA 4KQOA 5GLCA 4WBGA 5DVAA 4HEFA 1MY8A 5DF9A 2ZQ9A 4IEDA 5EOOA 4FCFA 3W8KA 3FKVA 5F1GA 1I2WA 1KE3A 5EVID 3NDGA 3V3SA 2R9XA 1NZUA 3OCNA 2A3UA 1E25A 2C5WB 2ZM8A 1K56D 2Y2GA 4U0TA 5E2HA 3VOYA 4EUZA 3PBRA 3GRJA 2OSUA 4QD4A 1NXYA 1E3UA 5EUAA 3BEBA 4IBXA 1CEGA 2B5RA 5EVLA 1G6AA 3IXHA 1XX2A 4KZAA 4DE0A 3Q1FA 2VGKA 4PM7A 5FQJA 3WRTA 4BLMA 4GDNA 4S2JA 5M1AA 5FI7A 1MWUA 1XGIA 4KG6A 3G34A 1ES2A 4MEZA 4OKPA 1JWPA 5GHZA 2WZZA 3WS5A 1XGJA 3IXBA 4OPYA 3PBQA 2JC7A 1GCEA 1JVJA 3BFDA 3DW0A 3N4IA 1ERQA 3G2YA 2J9PA 1PWCA 3NIAA 4MLLA 2ZLYA 3LEZA 1N4OA 2HPBA 3GSGA 5HW3A 2PBYA 4C3QA 1KVLA 3PAEA 4PMAA 3UNWA 3TG9A 3VFFA 1XKZA 3HLWA 4QHCA 1TVFA 4ZJ3A 1PW1A 3BLMA 2EX6A 1KVMA 4NETA 2DRWA 3OC2A 1HZOA 1KGFA 1W7FA 2Y2HA 4WMCD 2ZQCA 3UY6A 2XF3A 3GV9A 2I72A 1K6SA 5F1FA 1LHYA 3IXDA 3HLDA 2QPNA 3BLSA 2WGIA 4OP8A 1IYSA 4D2OA 4N92A 5HL1A 1E3UD 3WS1A 1NYMA 2ZD8A 3B3XA 5FA7A 1Q2PA 5CGXA 1SDNA 5FQMA 2V2FF 3HBRA 4JXSA 1L0FA 5FI6A 3HLFA 4KZ3A 5GHYA 1IELA 4KENB 4OQIA 1SCWA 3M6HA 4GN2A 5FASA 1C3BA 4R1GA 5EVIA 3RXWA 2V20A 2XGNA 5AQ7A 4XXRA 4DRTA 3C4PA 3TOIA 4S2MA 3V5MA 3UE1A 4KG2A 4ZAMA 1BLCA 4S2LA 1K54C 4QY6A 5HAIA 4S2OA 1PZOA 1K4FA 1MBLA 4UA6A 1W8YA 2WYXA 5DF7A 3A3IA 2ZC4B 3O3VA 2IWDA 3V39A 2FFYA 2X01A 1RGZA 1KDWA 4QB8A 4IVKA 3I7JA 4JBFA 1XA1A 4KZ6A 4UAAA 5CHUA 5FQ9A 5FQIA 4E3NA 1BLPA 3NC8A 1EROA 3A3JA 1BUEA 1BSGA 4L0LA 3ZCZA 3PAGA 2HP9A 5FAPA 4ID4A 4E6XA 3W4OA 3HLCA 4NK3A 4PM8A 5CEDA 2E8IA 2XD5A 5FAOA 3HUMA 3QHYA 4B4ZA 4KZ8A 3Q7ZA 2DNSA 5J8XA 5JYOA 5F83A 3V50A 1MWTA 1M40A 2EX8A 4C75A 4N9LA 2H10A 3BFFA 3NY4A 3M2KA 3OPHA 1NYYA 4QU3A 4OQ0A 3SH8A 2GDNA 3A3FA 2V1ZA 1K54A 4PPRA 1K38A 1GA9A 1HTZA 4EV4A 3LY3A 4K91A 5DTSA 5A90A 1FCNA 1KGEA 2PU2A 2XR0A 1FQGA 4OONA 1SHVA 1PWGA 3C7VA 5CTNA 4K0XA 1M6KA 2ZMAA 1MKIA 4BL2A 1IYOA 1IYQA 2Y2KA 1RP5A 3C7UA 1DY6A 4YINA 2WUQA 1BZAA 4GOGA 5A92A 3N8RA 5L2FA 4CPKA 3VSKA 3IXGA 5EPHA 2OLUA 3SOIA 1JWVA 1W79A 3G31A 4PM5A 2QMIA 2G2UA 4WM9A 1EI5A 1ES5A 2WGWB 3LO7A 5D3OA 1FR1A 3MFDA 3C5AA 5DF8A 3G35A 4Z9QA 4HESA 3HVFA 4U0XA 4QJGA 1O07A 3IWOA 4JPMA 4DF6A 2H0TA 1SKFA 3E2KA 1ONHA 2HDSA 1XPBA 1YM1A 4BQMA 4JXVA 3IH9A 5EVIB 3PTEA 3ZG0A 1AXBA 3HUOA 2P9VB 1GHIA 3GMWA 3SS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CI9 A;  1RGY A;  1KGG A;  1I5Q A;  4KZB A;  5FI2 A;  3CMZ A;  3UO9 A;  4XUZ A;  3A3E A;  3FYZ A;  4OLD A;  1H8Y A;  3DWK A;  3AGE A;  4WMC A;  3WS0 A;  1EWZ A;  2ZC5 B;  2Y2O A;  4JXW A;  1JTD A;  1BLH A;  5CHM A;  1O7E A;  1WE4 A;  3IT9 A;  2Y2I A;  2X02 A;  1YLT A;  4P87 A;  1FOF A;  4OLG A;  2VGJ A;  2EX9 A;  5CGS A;  5EVI C;  2WAD A;  1TDL A;  4R3B A;  1GHP A;  1H8Z A;  1LI9 A;  2ZC3 B;  3M6B A;  3ZVT A;  3UPN A;  1U60 A;  3MZF A;  3VOZ A;  3S4X A;  1W5D A;  3BFC A;  3OPL A;  1ZG4 A;  3BEC A;  2Y2J A;  3BFE A;  1ES3 A;  4WZ5 C;  4YFM A;  5E2E A;  5E2G A;  4R3J A;  5FQQ A;  2XLN A;  5HFO A;  3WWX A;  4EBN A;  3IF6 B;  1PI5 A;  3S22 A;  2CC1 A;  3NI9 A;  1H5X A;  1MPL A;  4DE2 A;  3FZC A;  4B4X A;  3VP4 A;  2ZM0 A;  2J9O A;  3G4P A;  3HUN A;  5JYP A;  4OPR A;  2WGW A;  1XXM A;  3DWZ A;  1ZKJ A;  3IQA A;  4LCL A;  1IKG A;  2XD1 A;  1KE0 A;  2WKI A;  1SDE A;  4JLF A;  1DJA A;  3E2L A;  5FSR A;  2ZJ9 A;  4GD6 A;  1K6R A;  1WYB A;  4PM9 A;  5FAT A;  3SS3 A;  2ZC6 B;  4R4S A;  4HBT A;  3V3R A;  3JYI A;  5GLD A;  3MZE A;  3PBS A;  4PM6 A;  1FSY A;  5TGF A;  4BL3 A;  4Y0T A;  1G68 A;  1K56 A;  3ZVW A;  4E3L A;  4A5R A;  5M19 A;  2Y2N A;  4DKI A;  3PBO A;  5AQ9 A;  2ZQD A;  4OQH A;  4WEK A;  1FCM A;  3C4O A;  4LEN A;  2WGV A;  4S2K A;  1QME A;  1N9B A;  5CXW A;  3MXS A;  4FSF A;  2HDQ A;  3VP3 A;  4OOY A;  3HLB A;  4LV3 A;  4UA9 A;  5CEC A;  2IWB A;  2ZM2 A;  3MBZ A;  4DXB A;  3W4Q A;  5AQA A;  1BLS A;  3WS4 A;  4E3J A;  3FV7 A;  1VM1 A;  3UN7 A;  4IBR A;  3UDX A;  1K57 A;  4JF4 A;  4Y7P A;  2P74 A;  2UWX A;  3FKW A;  4B88 A;  3Q7V A;  3EQU A;  1JWZ A;  2J7V A;  5EOE A;  1HD8 A;  2XFT A;  3MKE A;  5CGW A;  5BOH A;  1L0D A;  1LL9 A;  1ALQ A;  1YLZ A;  5GLA A;  4C6Y A;  1YT4 A;  5HAR A;  4X6T A;  1HVB A;  4GZB A;  1OME A;  3GQZ A;  3A3D A;  5CHJ A;  2XFS A;  4QY5 A;  1YLW A;  2BLS A;  2WAF A;  3Q81 A;  5AQB A;  4EBL A;  4E6W A;  3D4F A;  4R4R A;  2Y2L A;  4KZ5 A;  1LLB A;  5G18 A;  1ERM A;  5F82 A;  1YMS A;  3OPP A;  2Y55 A;  3MKF A;  1S0W A;  2Y2M A;  5CEB A;  4RX2 A;  1DJC A;  3ZNY A;  3GVB A;  2Y91 A;  2JCH A;  4CJN A;  2H0Y A;  3P09 A;  3AGD A;  1LL5 A;  2DCF A;  4M3K A;  3IF6 C;  4U3T A;  4Y0O A;  4BD1 A;  1TDG A;  4DDY A;  1K55 C;  3RJU A;  1DJB A;  1PYY A;  3O88 A;  2C6W B;  3ISG A;  1YLP A;  5HX9 A;  1BTL A;  3IH8 A;  4WYY A;  1ONG A;  3M2J A;  4FD8 A;  2EFU A;  5A93 A;  3VSL A;  4KZ9 A;  5KSC A;  3O87 A;  1QMF A;  3UPO A;  3HL9 A;  5GHX A;  3Q07 A;  1IKI A;  5IHV A;  2XDM A;  3UDI A;  4JF6 A;  4WZ5 A;  1ESI A;  3IHB A;  4N9K A;  4OH0 A;  2HP6 A;  4OP5 A;  1FCO A;  5GLB A;  3N8L A;  4P85 A;  2WKH A;  4JKT A;  2EX2 A;  1L0E A;  3Q82 A;  3SS4 A;  5KZH A;  2Y2Q A;  4E3M A;  2P9V A;  1KE4 A;  5FDH A;  4WZ4 A;  3UPP A;  4GNU A;  4RVA A;  5FAQ A;  3ZDJ A;  1PWD A;  3IF6 A;  4K0W A;  4S2N A;  4P0M A;  1K4E A;  1VQQ A;  5KSH A;  3UE3 A;  4FH2 A;  4MNR A;  1I2S A;  1MWR A;  2G2W A;  1YMX A;  2JBF A;  1RCJ A;  4KQR A;  4MBF A;  4KZ4 A;  3W4P A;  2R9W A;  4E3K A;  4UHU A;  5I94 A;  4O7D A;  2HDU A;  3VMA A;  3QNC A;  5GL9 A;  1NJ4 A;  4RX3 A;  2JE5 A;  5TR7 A;  2WKE A;  3ZG9 B;  5CRF A;  5M18 A;  5KMW A;  4ZBE A;  3BYD A;  2XQZ A;  1Q2Q A;  4N1H A;  1J9M A;  1LI0 A;  4OPQ A;  4ZJ1 A;  1CK3 A;  2RL3 A;  3NDE A;  3QNB A;  3ZG5 A;  2Q9M A;  3CG5 A;  3G2Z A;  3VP0 A;  3WRZ A;  1NRF A;  2EXB A;  3BM6 A;  1PZP A;  3S1Y A;  4N1X A;  1K57 C;  3VFH A;  4IVI A;  2WAE A;  3UDF A;  4OOL A;  1FR6 A;  1K25 A;  4S2N C;  2IWC A;  3G32 A;  4UA7 A;  3CJM A;  3LCE A;  4X69 A;  1GHM A;  3ZNT A;  4X55 A;  1MWS A;  2J8Y A;  3PBT A;  3N6I A;  3OPR A;  1ZC2 A;  4HBU A;  5EEC A;  2Y59 A;  1CI8 A;  5EE8 A;  3ZG7 B;  3EQV A;  3ZHH A;  2A49 A;  2EXA A;  1CEF A;  3RXX A;  3SH7 A;  1ZG6 A;  3LY4 A;  4ZJ2 A;  3BFG A;  2Z2M B;  3CZD A;  3SH9 A;  4P6B A;  3MXR A;  4RA7 A;  2H5S A;  4Y0U A;  4X68 A;  1PW8 A;  2FFF B;  2ZC7 A;  1ESU A;  4GB7 A;  3UE0 A;  5FQK A;  3VP1 A;  4DXC A;  4EQI A;  4Q8I A;  4LCM A;  2ZQA A;  2HP5 A;  2Z2L B;  3Q7V B;  5E2F A;  2Q9N A;  1YLJ A;  3TSG A;  2WK0 A;  4GDB A;  1K55 A;  3N8S A;  3OCL A;  3N7W A;  2BG1 A;  3IHA A;  4MBH A;  2QZ6 A;  1Z6F A;  2XK1 A;  2XEP A;  3BRM A;  5CER A;  3IWI A;  2Y4A A;  1MXO A;  4JXG A;  4JF5 A;  5U47 A;  4ZDX A;  1S6R A;  4LV2 A;  1IEM A;  1NY0 A;  1IYP A;  3AGF A;  3IWQ A;  2PU4 A;  3NCK A;  1BUL A;  2ZQ7 A;  3HRE A;  4DE1 A;  1XA7 A;  1JTG A;  1PIO A;  4WEJ A;  4KG5 A;  3OZH A;  5CTM A;  3ZGA B;  2Y2P A;  3GTC A;  4KZ7 A;  3VP2 A;  4BEN A;  2OLV A;  1XP4 A;  2EFX A;  1L2S A;  1YQS A;  2RCX A;  4OQG A;  4BJP A;  1L0G A;  3IF5 A;  4E3I A;  4RYE A;  3NBL A;  4LV1 A;  4FH4 A;  1BT5 A;  4R23 A;  3O86 A;  3WS2 A;  4MBK A;  3HLE A;  5E43 A;  3G30 A;  4F94 A;  4R0Q A;  4DDS A;  3ZFZ A;  4BD0 A;  1TEM A;  2HDR A;  1E4D A;  4KQQ A;  2X71 A;  4GD8 A;  3FWL A;  4ZTK A;  5HAQ A;  4S2I A;  1NZO A;  3MZD A;  4DE3 A;  2ZQ8 A;  4X53 A;  4X56 A;  2WZX A;  3DTM A;  3GR2 A;  1WYC A;  5DTT A;  3HLG A;  3ZG8 B;  5TFQ A;  4EWF A;  1YLY A;  4OPZ A;  3ITA A;  1PI4 A;  3PBN A;  4GKU A;  5HAP A;  1Y54 A;  4H8R A;  1GA0 A;  3P98 A;  5DTK A;  1ES4 A;  2OV5 A;  1FSW A;  4WEL A;  4EBP A;  4S2P A;  5A91 A;  1KDS A;  2XH9 A;  4OOM A;  1W8Q A;  4OVD A;  4LV0 A;  4XUX A;  3ITB A;  4E3O A;  4KQO A;  5GLC A;  4WBG A;  5DVA A;  4HEF A;  1MY8 A;  5DF9 A;  2ZQ9 A;  4IED A;  5EOO A;  4FCF A;  3W8K A;  3FKV A;  5F1G A;  1I2W A;  1KE3 A;  5EVI D;  3NDG A;  3V3S A;  2R9X A;  1NZU A;  3OCN A;  2A3U A;  1E25 A;  2C5W B;  2ZM8 A;  1K56 D;  2Y2G A;  4U0T A;  5E2H A;  3VOY A;  4EUZ A;  3PBR A;  3GRJ A;  2OSU A;  4QD4 A;  1NXY A;  1E3U A;  5EUA A;  3BEB A;  4IBX A;  1CEG A;  2B5R A;  5EVL A;  1G6A A;  3IXH A;  1XX2 A;  4KZA A;  4DE0 A;  3Q1F A;  2VGK A;  4PM7 A;  5FQJ A;  3WRT A;  4BLM A;  4GDN A;  4S2J A;  5M1A A;  5FI7 A;  1MWU A;  1XGI A;  4KG6 A;  3G34 A;  1ES2 A;  4MEZ A;  4OKP A;  1JWP A;  5GHZ A;  2WZZ A;  3WS5 A;  1XGJ A;  3IXB A;  4OPY A;  3PBQ A;  2JC7 A;  1GCE A;  1JVJ A;  3BFD A;  3DW0 A;  3N4I A;  1ERQ A;  3G2Y A;  2J9P A;  1PWC A;  3NIA A;  4MLL A;  2ZLY A;  3LEZ A;  1N4O A;  2HPB A;  3GSG A;  5HW3 A;  2PBY A;  4C3Q A;  1KVL A;  3PAE A;  4PMA A;  3UNW A;  3TG9 A;  3VFF A;  1XKZ A;  3HLW A;  4QHC A;  1TVF A;  4ZJ3 A;  1PW1 A;  3BLM A;  2EX6 A;  1KVM A;  4NET A;  2DRW A;  3OC2 A;  1HZO A;  1KGF A;  1W7F A;  2Y2H A;  4WMC D;  2ZQC A;  3UY6 A;  2XF3 A;  3GV9 A;  2I72 A;  1K6S A;  5F1F A;  1LHY A;  3IXD A;  3HLD A;  2QPN A;  3BLS A;  2WGI A;  4OP8 A;  1IYS A;  4D2O A;  4N92 A;  5HL1 A;  1E3U D;  3WS1 A;  1NYM A;  2ZD8 A;  3B3X A;  5FA7 A;  1Q2P A;  5CGX A;  1SDN A;  5FQM A;  2V2F F;  3HBR A;  4JXS A;  1L0F A;  5FI6 A;  3HLF A;  4KZ3 A;  5GHY A;  1IEL A;  4KEN B;  4OQI A;  1SCW A;  3M6H A;  4GN2 A;  5FAS A;  1C3B A;  4R1G A;  5EVI A;  3RXW A;  2V20 A;  2XGN A;  5AQ7 A;  4XXR A;  4DRT A;  3C4P A;  3TOI A;  4S2M A;  3V5M A;  3UE1 A;  4KG2 A;  4ZAM A;  1BLC A;  4S2L A;  1K54 C;  4QY6 A;  5HAI A;  4S2O A;  1PZO A;  1K4F A;  1MBL A;  4UA6 A;  1W8Y A;  2WYX A;  5DF7 A;  3A3I A;  2ZC4 B;  3O3V A;  2IWD A;  3V39 A;  2FFY A;  2X01 A;  1RGZ A;  1KDW A;  4QB8 A;  4IVK A;  3I7J A;  4JBF A;  1XA1 A;  4KZ6 A;  4UAA A;  5CHU A;  5FQ9 A;  5FQI A;  4E3N A;  1BLP A;  3NC8 A;  1ERO A;  3A3J A;  1BUE A;  1BSG A;  4L0L A;  3ZCZ A;  3PAG A;  2HP9 A;  5FAP A;  4ID4 A;  4E6X A;  3W4O A;  3HLC A;  4NK3 A;  4PM8 A;  5CED A;  2E8I A;  2XD5 A;  5FAO A;  3HUM A;  3QHY A;  4B4Z A;  4KZ8 A;  3Q7Z A;  2DNS A;  5J8X A;  5JYO A;  5F83 A;  3V50 A;  1MWT A;  1M40 A;  2EX8 A;  4C75 A;  4N9L A;  2H10 A;  3BFF A;  3NY4 A;  3M2K A;  3OPH A;  1NYY A;  4QU3 A;  4OQ0 A;  3SH8 A;  2GDN A;  3A3F A;  2V1Z A;  1K54 A;  4PPR A;  1K38 A;  1GA9 A;  1HTZ A;  4EV4 A;  3LY3 A;  4K91 A;  5DTS A;  5A90 A;  1FCN A;  1KGE A;  2PU2 A;  2XR0 A;  1FQG A;  4OON A;  1SHV A;  1PWG A;  3C7V A;  5CTN A;  4K0X A;  1M6K A;  2ZMA A;  1MKI A;  4BL2 A;  1IYO A;  1IYQ A;  2Y2K A;  1RP5 A;  3C7U A;  1DY6 A;  4YIN A;  2WUQ A;  1BZA A;  4GOG A;  5A92 A;  3N8R A;  5L2F A;  4CPK A;  3VSK A;  3IXG A;  5EPH A;  2OLU A;  3SOI A;  1JWV A;  1W79 A;  3G31 A;  4PM5 A;  2QMI A;  2G2U A;  4WM9 A;  1EI5 A;  1ES5 A;  2WGW B;  3LO7 A;  5D3O A;  1FR1 A;  3MFD A;  3C5A A;  5DF8 A;  3G35 A;  4Z9Q A;  4HES A;  3HVF A;  4U0X A;  4QJG A;  1O07 A;  3IWO A;  4JPM A;  4DF6 A;  2H0T A;  1SKF A;  3E2K A;  1ONH A;  2HDS A;  1XPB A;  1YM1 A;  4BQM A;  4JXV A;  3IH9 A;  5EVI B;  3PTE A;  3ZG0 A;  1AXB A;  3HUO A;  2P9V B;  1GHI A;  3GMW A;  3SS5 A; 
#chains in the Genus database with same CATH topology
 5FI2 A;  3CMZ A;  4XUZ A;  4HOI A;  3F1P B;  1EWZ A;  1JTD A;  1BLH A;  1O7E A;  4I3I A;  2Y2I A;  1FOF A;  3EGD C;  4OLG A;  2WAD A;  4F3L B;  1TDL A;  3E98 A;  3ZVT A;  3UPN A;  2PT7 A;  1W5D A;  5HWT A;  3BFC A;  2Y2J A;  1ES3 A;  5E2E A;  4EEP A;  4EBN A;  5L07 A;  3MR0 A;  3S22 A;  2CC1 A;  1T1A A;  1YPR A;  1IFQ A;  2J9O A;  1XXM A;  1F9I A;  2P08 A;  2VK3 A;  1SKO A;  2W27 A;  3V3R A;  3JYI A;  2VKS A;  2Y2N A;  4DKI A;  4LEN A;  4S2K A;  2IWB A;  2ZM2 A;  4I5S A;  4E3J A;  3UDX A;  1K57 A;  5J7E A;  2UWX A;  3BQA A;  4R38 A;  3EQU A;  5BOH A;  2J7V A;  3T4L A;  4C6Y A;  1YT4 A;  4DMZ A;  5HAR A;  1TS7 A;  4GZB A;  2V8C A;  2XFS A;  3OLO A;  4QY5 A;  2WAF A;  4JGP A;  3T1R A;  3D4F A;  2WKR A;  4R4R A;  2Y2L A;  1P97 A;  5F82 A;  1UWP X;  4F3L A;  1DJC A;  3ZNY A;  1LL8 A;  5HPF A;  4CJN A;  3AGD A;  1DRM A;  4M3K A;  4U3T A;  4BD1 A;  3BWL A;  1TDG A;  5TBM B;  1H3Q A;  1LSW A;  1YLP A;  5A93 A;  2VZW A;  3QP2 A;  1MKM A;  5GHX A;  3LI9 A;  2XDM A;  3IHB A;  4N9K A;  1NLY A;  5GLB A;  2WKH A;  2EX2 A;  2ZL1 B;  5A8B A;  2IA2 A;  1H0M A;  4Y5F A;  1LSV A;  2W1R A;  1W63 M;  3CI6 A;  4FH2 A;  1ZTU A;  3LFV A;  1I2S A;  4LGW A;  1YMX A;  3KYZ A;  4E3K A;  2L4R A;  4UHU A;  4Q0H A;  2HDU A;  3VMA A;  3QNC A;  1NJ4 A;  2JE5 A;  2EA9 A;  5KMW A;  3BYD A;  1K0K A;  3R4K A;  1CK3 A;  2VA0 A;  2JKT M;  3U4L P;  3VP0 A;  1NRF A;  1Y28 A;  3S1Y A;  4N1X A;  3C2W A;  3NOP C;  4OOL A;  4UA7 A;  3LCE A;  4WF0 A;  4X55 A;  2VV7 A;  3T4O A;  1ZC2 A;  4HBU A;  5EEC A;  3ZG7 B;  2A49 A;  4D60 A;  3LY4 A;  3BFG A;  4O01 A;  4P6B A;  4Y0U A;  4X25 A;  4X68 A;  2A2L A;  1ESU A;  4IUH A;  3RFB A;  3VP1 A;  4LCM A;  2JKF A;  4ESP A;  2KOI A;  2W3F A;  4GDB A;  3TW8 A;  5DKK A;  3OCL A;  1Z6F A;  2XK1 A;  3BRM A;  5CER A;  4NEE D;  5G4Y A;  2Y4A A;  3K3D A;  4JXG A;  5U47 A;  1S6R A;  1MC0 A;  5HDC A;  3IWQ A;  2PU4 A;  3HRE A;  4WEJ A;  4HJ4 A;  4KG5 A;  4JGO A;  3HJI A;  3OZH A;  2Y2P A;  2OOL A;  3VP2 A;  2RCX A;  3E4O A;  2XRN A;  3NBL A;  3FPV A;  3D9Y A;  3NUL A;  3FG8 A;  3NJA A;  2X71 A;  3DAV A;  3KYE A;  3MZD A;  2WZX A;  1WYC A;  5DTT A;  3HLG A;  4GW9 A;  4I3J A;  1YLY A;  1YSP A;  5HAP A;  3UE6 A;  1GA0 A;  1G6O A;  1A0K A;  2PD8 A;  1KDS A;  2XH9 A;  1S4R A;  3H7W B;  3R7W A;  4OVD A;  3ITB A;  4HEF A;  5DF9 A;  1S66 L;  3JPU A;  5EVI D;  2NUP C;  3V3S A;  4Y3I A;  2ZM8 A;  5G4Z A;  3UMD A;  3GRJ A;  4QD4 A;  1NXY A;  1CEG A;  5L09 A;  3IXH A;  2VGK A;  4S2J A;  4L9E A;  5M1A A;  5FI7 A;  3KO6 A;  1PFL A;  3GEC A;  2WZZ A;  3WS5 A;  1VET B;  2JC7 A;  2ZMF A;  1GCE A;  2VLG A;  1JVJ A;  3BFD A;  3N4I A;  1LT0 A;  4Y2F A;  3LEZ A;  3UNW A;  3E4Q A;  2Y79 A;  3TG9 A;  3VFF A;  4QHC A;  1TVF A;  2EWV A;  3BLM A;  2JKR I;  2EX6 A;  3OC2 A;  1XFN A;  1HZO A;  2Y2H A;  1Z09 A;  2I72 A;  2FZ0 A;  1ZHH B;  4EUV A;  1NYM A;  3B3X A;  2JKG A;  4HHD A;  5CGX A;  1SDN A;  3HBR A;  5FI6 A;  3HLF A;  4KZ3 A;  1XJ4 A;  4KEN B;  4OQI A;  2VV8 A;  1AWI A;  1C3B A;  4R1G A;  5DJU A;  3C38 A;  5EVI A;  2V20 A;  4BBU A;  5AQ7 A;  4XXR A;  3C4P A;  4S2M A;  3V5M A;  3UE1 A;  4FUW A;  2AVX A;  1N9N A;  3A3I A;  3O3V A;  2X01 A;  4LLO B;  1OTI A;  1KDW A;  4QB8 A;  5F68 A;  1MZU A;  5AVF A;  4KZ6 A;  2YKF A;  4UAA A;  4E3N A;  2XSS A;  3IX8 A;  5FQI A;  3A3J A;  3ZCZ A;  5EM1 A;  5FAP A;  4DJ3 A;  1X0O A;  2XD5 A;  5FAO A;  4X1L A;  1S67 L;  4EQ1 A;  1D7E A;  3TRC A;  1M40 A;  4N9L A;  3BFF A;  3M2K A;  4QU3 A;  2V1Z A;  3CIT A;  4L9F A;  5EM0 A;  5A90 A;  1FCN A;  1T19 A;  2PU2 A;  2XR0 A;  1SHV A;  1PWG A;  5CTN A;  2ZMA A;  4NXB A;  3H7W A;  3R7W B;  1H8M A;  5A92 A;  3CLO A;  4CPK A;  2OLU A;  1W79 A;  2W0N A;  4B93 A;  3KX0 X;  1ES5 A;  2WGW B;  3LO7 A;  4HES A;  3KSG A;  5HDS A;  4II7 A;  2D01 A;  4JPM A;  3IWO A;  1F5M A;  1XPB A;  4JXV A;  3PTE A;  1VEU B;  3TJZ C;  4GHI A;  3ZYT A;  4ETX A;  1OTB A;  3QP6 A;  1I5Q A;  2O9C A;  5DJT A;  4EXO A;  2ZC5 B;  2NUT C;  3CWF A;  5CHM A;  3MXQ A;  1WE4 A;  3IT9 A;  1YLT A;  1JNU A;  2O9B A;  4HNB A;  2INW A;  2KLI A;  4R3B A;  3MZF A;  5IT5 A;  3S4X A;  1CF0 A;  1DP6 A;  2W1T B;  3OPL A;  1VET A;  4R3J A;  5FQQ A;  5HFO A;  3TE8 A;  1PI5 A;  2W3H A;  3NI9 A;  1OJG A;  3C30 A;  1V9Z A;  4DE2 A;  4MCW A;  4B4X A;  3VP4 A;  3G4P A;  1IKG A;  1KE0 A;  2WKI A;  3LIB A;  3EOI A;  5FSR A;  3S7Q A;  5GLD A;  4PM6 A;  4BL3 A;  2P7J A;  4WL9 A;  2PR5 A;  4Y0T A;  1G68 A;  5M19 A;  3PBO A;  2ZBB A;  3A0S A;  1QME A;  1N9B A;  4JGQ A;  4FSF A;  3JVU A;  4LV3 A;  4DXB A;  3W4Q A;  5AQA A;  1BLS A;  4X1M A;  5FL3 A;  3UN7 A;  2V1A A;  4GS9 A;  5LBR A;  3CAX A;  5GLA A;  2PYP A;  3ULF A;  4ARZ B;  3Q81 A;  5EVE A;  4EEU A;  4RX2 A;  3GVB A;  2Y91 A;  2JCH A;  3P09 A;  1LL5 A;  2DCF A;  3LI8 A;  4DDY A;  5AVE A;  3RJU A;  3O88 A;  1BTL A;  1ONG A;  3M2J A;  2EFU A;  2W3G A;  4EER A;  5KSC A;  1QMF A;  1VEU A;  2ZMV A;  4WUJ A;  4BMW A;  2A24 A;  2QKP A;  2WKP A;  2HP6 A;  4JKT A;  3SS4 A;  1L0E A;  1Y4O A;  4E3M A;  2O9A A;  5FAQ A;  2I9V A;  2J3T C;  3S7P A;  3ZQ5 A;  1PWD A;  4S2N A;  4ZRR A;  1KOU A;  1VQQ A;  5KSH A;  4MNR A;  1MWR A;  2HJ9 C;  3W4P A;  2R9W A;  4GS9 B;  4UEY A;  3UB9 A;  3FPW A;  2JKR M;  5GL9 A;  1XJ2 A;  3ZG9 B;  4ZBE A;  2XQZ A;  5EV0 A;  3OOV A;  3ZG5 A;  3G2Z A;  3WRZ A;  3BM6 A;  1DP9 A;  5DFY A;  4IVI A;  4S2N C;  3RH8 B;  2IWC A;  3G32 A;  4H6J A;  1GHM A;  3CUE A;  3ZHH A;  2EXA A;  1UGU A;  1CEF A;  3KYQ A;  1CJF A;  2B02 A;  4ZJ2 A;  3SH9 A;  4BBT A;  3MXR A;  2PR6 A;  2ZC7 A;  3U2A A;  2VGL M;  4EU0 A;  4DXC A;  4EQI A;  2XA7 M;  2ZQA A;  2HP5 A;  3TSG A;  2WK0 A;  3B42 A;  3N8S A;  2BG1 A;  1S1Z A;  4XT2 A;  3QP5 A;  3CUE C;  4WN5 A;  1NY0 A;  1IYP A;  3BY9 A;  3NCK A;  1JTG A;  1PIO A;  5CTM A;  4KZ7 A;  2ZOH A;  3EWK A;  3K3C A;  5E43 A;  2Y8H A;  3FWL A;  4ZTK A;  5HZH A;  4S2I A;  4Q0I A;  4Q0J A;  4X53 A;  4X56 A;  3GR2 A;  3CPT B;  4EWF A;  3PBN A;  4H8R A;  1ES4 A;  2QWS A;  1FSW A;  4WEL A;  5TJJ A;  1OJ5 A;  3E4P A;  2J3T D;  1W8Q A;  1N9L A;  1EW0 A;  5C5K A;  4WBG A;  5DVA A;  1MY8 A;  4IED A;  5EOO A;  3W8K A;  3FKV A;  1KE3 A;  3NDG A;  1NZU A;  3OCN A;  2VGL S;  1NWZ A;  2CMN A;  2Y2G A;  4U0T A;  4EUZ A;  4M4X A;  1E3U A;  2B5R A;  4WLA A;  5EVL A;  3VE3 A;  1WA9 A;  1XX2 A;  1XGI A;  4MEZ A;  5IU1 A;  2K7S A;  4KQD A;  4OKP A;  3MF0 A;  2PD7 A;  3IXB A;  4O8G A;  4Z1W A;  1P0Z A;  4FTX A;  3NIA A;  3PHY A;  4CLC A;  5HW3 A;  1KVL A;  3HLW A;  4HY8 A;  2DRW A;  1W7F A;  2XF3 A;  1K6S A;  3RTY A;  1LHY A;  4HJ6 A;  4R6L A;  3HLD A;  2QPN A;  2WGI A;  4H6J B;  2Z6C A;  4N92 A;  1N9O A;  1E3U D;  3WS1 A;  2ZD8 A;  1GSV A;  1Q2P A;  4CLC C;  4GN2 A;  4G3V A;  5FAS A;  1W63 Q;  3V67 A;  3TOI A;  1BLC A;  2VX8 A;  4S2L A;  5L10 A;  4MN5 A;  4QY6 A;  4S2O A;  1MBL A;  4UA6 A;  3P7N A;  2WYX A;  3A0R A;  2IWD A;  3V39 A;  1BLP A;  4FOF A;  4L0L A;  1BSG A;  3IX4 A;  5CED A;  2E8I A;  4KZ8 A;  5J8X A;  3S7O A;  3OBF A;  5JYO A;  3GDI A;  3V50 A;  4C75 A;  4R70 A;  3A3F A;  3LYX A;  4EV4 A;  1HTZ A;  4Y13 A;  4HP9 A;  4OON A;  3C7V A;  4DN0 A;  3LID A;  1M6K A;  1MKI A;  2Y2K A;  2DMW A;  1RP5 A;  3IBJ A;  4MN7 A;  1DY6 A;  4YIN A;  2D02 A;  2WUQ A;  1BZA A;  3N8R A;  2GX5 A;  4I3A A;  5EPH A;  1JWV A;  4CLC D;  5D3O A;  3BY8 A;  4U0X A;  4QJG A;  4DF6 A;  2H0T A;  3E2K A;  4LRX C;  3IH9 A;  5EVI B;  1IOU A;  1AXB A;  3KSH A;  3GMW A;  3SS5 A;  4UQI S;  1CI9 A;  3F1N B;  1RGY A;  3BW6 A;  4KZB A;  3UO9 A;  3A3E A;  3DWK A;  3AGE A;  4JXW A;  3D72 A;  4P87 A;  5EVI C;  4CLC B;  1LI9 A;  3M6B A;  3VOZ A;  3SW1 A;  4WZ5 C;  3BEC A;  3BFE A;  3EGX C;  5E2G A;  3IF6 B;  3H82 A;  1H5X A;  4I39 A;  3FZC A;  2ZM0 A;  3L9K A;  5JYP A;  4OPR A;  2WGW A;  2P04 A;  3IQA A;  1ZKJ A;  4LCL A;  2V1B A;  4JLF A;  2ZJ9 A;  4GD6 A;  1T1B A;  1K6R A;  5FAT A;  3UB8 A;  2ZC6 B;  4R4S A;  1PRQ A;  3UB6 A;  3KSI A;  3H9W A;  3MZE A;  3PBS A;  2YKH A;  1FSY A;  2MJ6 A;  4E3L A;  4A5R A;  5AQ9 A;  4OQH A;  5CXW A;  3MXS A;  3VP3 A;  3DTI A;  1TS6 A;  1VM1 A;  3LR4 A;  4ME4 A;  4Y7P A;  2B18 A;  2P74 A;  3IX3 A;  3Q7V A;  5EOE A;  1JWZ A;  5CGW A;  1L0D A;  4NKP A;  1LL9 A;  5DFX A;  1NLZ A;  1ALQ A;  1LSX A;  1HVB A;  1OME A;  5CHJ A;  3JVV A;  1YLW A;  4Y17 A;  5AQB A;  4EBL A;  4HJ3 A;  5G18 A;  1LLB A;  3T4S A;  1YMS A;  3OPP A;  2Y55 A;  5HL6 A;  5CEB A;  5CX7 A;  3UB5 P;  4NXE A;  4NG2 A;  4Y0O A;  4E04 A;  3QP8 A;  1DJB A;  2XA7 S;  4HH2 A;  5DKL A;  3IH8 A;  2GZA A;  1CQA A;  4AFI A;  3DBA A;  3O87 A;  1DP8 A;  3UPO A;  3HL9 A;  5IHV A;  3DTE A;  4IHQ A;  4WZ5 A;  1ESI A;  1FCO A;  3Q82 A;  5KZH A;  3LIF A;  2Y2Q A;  4WZ4 A;  4RVA A;  1F98 A;  1OTE A;  3L7H A;  1T18 A;  4K0W A;  1ACF A;  1OPX A;  4P0M A;  1K4E A;  3IS2 A;  3UE3 A;  4UQI M;  1RCJ A;  2HF6 A;  4KQR A;  4MBF A;  5FEG A;  4KZ4 A;  4O7D A;  2E8J A;  4MN6 A;  2WKE A;  5M18 A;  1J9M A;  1LI0 A;  4ZJ1 A;  4HP4 A;  2RL3 A;  3NDE A;  3QNB A;  3CG5 A;  1S1Y A;  1PZP A;  3MMH A;  1K57 C;  4GHI B;  1FR6 A;  1K25 A;  5FEF A;  1VB6 A;  3ZNT A;  1MWS A;  5K5B A;  5HWW A;  3N6I A;  2Y59 A;  5EE8 A;  3LEQ A;  3RXX A;  4YWZ A;  3SH7 A;  3MJQ A;  2Z2M B;  3CZD A;  4RA7 A;  2FFF B;  4GB7 A;  3T1Q B;  4Q8I A;  2K31 A;  2M7V A;  3Q7V B;  1OTA A;  1YLJ A;  1YKD A;  2WKQ A;  3D3O A;  3N7W A;  4MBH A;  1BYW A;  2QZ6 A;  5F69 A;  5MC7 A;  3FC7 A;  4LV2 A;  1IEM A;  2VV6 A;  3AGF A;  4DE1 A;  1BUL A;  2ZQ7 A;  1XA7 A;  4QPR A;  3K2N A;  3LR0 A;  2J80 A;  1TD5 A;  1XP4 A;  4BJP A;  1YQS A;  4E3I A;  4OQG A;  4RYE A;  4FH4 A;  4R23 A;  4MBK A;  5L8M A;  4F94 A;  4R0Q A;  4DDS A;  3ZFZ A;  1SZV A;  1FIL A;  1TEM A;  2HDR A;  5HAQ A;  1NZO A;  4DE3 A;  2ZQ8 A;  4EES A;  2UV0 E;  3ZG8 B;  4HIA A;  5TFQ A;  1PI4 A;  1Y54 A;  2W3D A;  5DTK A;  4IUK A;  4EBP A;  3NEC A;  4LV0 A;  4NXF A;  3NOU C;  4E3O A;  2ZQ9 A;  4FCF A;  5F1G A;  1NRJ A;  3ICY A;  3DTK A;  3F1P A;  3T4J A;  2OSU A;  1L3L A;  5EUA A;  3BEB A;  3VV4 A;  3EEA A;  1G6A A;  4KZA A;  4LRZ E;  4DE0 A;  1TS0 A;  5FQJ A;  4CLC E;  4GDN A;  1MWU A;  3G34 A;  1ES2 A;  2G7U A;  5EFW A;  2PBD P;  3PBQ A;  5IS1 A;  2QJ7 A;  3QP1 A;  3DW0 A;  2O0Y A;  1FIK A;  3G2Y A;  3CPT A;  2JHE A;  2J9P A;  1PWC A;  4MLL A;  2PBY A;  3PAE A;  4PMA A;  4O0P A;  3LIC A;  1XKZ A;  2V9A A;  3E0Y A;  5FDS A;  1D1J A;  1GSX A;  1T1C A;  1KVM A;  4NET A;  3B47 A;  1KGF A;  3MQ0 A;  5HD5 A;  3IXD A;  1P9W A;  4OP8 A;  1IYS A;  4K08 A;  5FQM A;  2V2F F;  1IEL A;  5TBM A;  1SCW A;  3M6H A;  4XT2 B;  4DRT A;  4KG2 A;  4ZAM A;  1K54 C;  2M1C A;  5HAI A;  1W8Y A;  2ACG A;  5DF7 A;  3NOT C;  2ZC4 B;  2J3W A;  2FFY A;  3IS2 B;  1RGZ A;  4P6Z S;  5AJG A;  3I7J A;  3QP4 A;  5FQ9 A;  3NC8 A;  1ERO A;  3PAG A;  3W4O A;  5I5L A;  2OWJ A;  4PAU A;  3QHY A;  3MQO A;  1MWT A;  2H10 A;  3NY4 A;  1NYY A;  3SH8 A;  4PPR A;  2KX6 A;  1GA9 A;  3LY3 A;  1GSW A;  4K91 A;  1KGE A;  3HCY A;  3BQ8 A;  4BL2 A;  1IYO A;  1IYQ A;  3C7U A;  3H82 B;  4BBV A;  5L2F A;  3SOI A;  2QMI A;  2G2U A;  3P01 A;  1EI5 A;  3MFD A;  3C5A A;  5DF8 A;  4Z9Q A;  2BTF P;  3PXP A;  2HDS A;  4X6T A;  2P9V B;  1GHI A;  4IJG A;  3MSH A;  1KGG A;  3T1S A;  1J3W A;  3FYZ A;  4OLD A;  1H8Y A;  4WMC A;  3WS0 A;  2Y2O A;  4KUK A;  4PKY G;  3T1X A;  2X02 A;  2VGJ A;  2EX9 A;  5CGS A;  2V8F A;  1XJ6 A;  1GHP A;  1H8Z A;  2ZC3 B;  3HJK A;  1U60 A;  2B95 A;  4YFM A;  1ZG4 A;  2HZ5 A;  4HI4 A;  2XLN A;  3WWX A;  2V0W A;  1MPL A;  3HUN A;  3DWZ A;  2XD1 A;  1SDE A;  1DJA A;  3E2L A;  3F1O B;  4ARZ A;  1WYB A;  4PM9 A;  3SS3 A;  4HBT A;  3O5Y A;  2M7U A;  2PRF A;  5TGF A;  1K56 A;  2O99 A;  3ZVW A;  1XFQ A;  2ZQD A;  4WEK A;  1FCM A;  3C4O A;  2WGV A;  2VEA A;  2HDQ A;  4OOY A;  3HLB A;  4UA9 A;  5CEC A;  3MBZ A;  3WS4 A;  4MDZ A;  3FV7 A;  4IBR A;  4JF4 A;  3FKW A;  4B88 A;  1HD8 A;  2XFT A;  3MKE A;  1YLZ A;  3GQZ A;  3A3D A;  3F1O A;  5HD3 A;  2BLS A;  4E6W A;  4HH3 A;  4KZ5 A;  1ERM A;  2OAQ 1;  3MKF A;  1S0W A;  2Y2M A;  4B9O A;  4GCZ A;  2A24 B;  4G3W A;  2H0Y A;  3T4T A;  1G5U A;  3IF6 C;  3BJN A;  1P9R A;  1K55 C;  1PYY A;  2PDR A;  2C6W B;  4QWO A;  3ISG A;  5HX9 A;  4WYY A;  1ODV A;  2KDK A;  4FD8 A;  3VSL A;  4KZ9 A;  3Q07 A;  1IKI A;  3KSF A;  4RQ9 A;  3UDI A;  4JF6 A;  2ZOI A;  2Z6D A;  4NXG A;  4OH0 A;  4OP5 A;  3N8L A;  3PR6 A;  4P85 A;  2VJW A;  2L1M A;  2P9V A;  2W3E A;  1KE4 A;  5FDH A;  3UPP A;  4GNU A;  1OT9 A;  4I38 A;  3ZDJ A;  1SKO B;  3T12 B;  3IF6 A;  2G2W A;  2JBF A;  5I94 A;  4Y15 A;  2OAP 1;  4HQA A;  4RX3 A;  5TR7 A;  3UME A;  5CRF A;  1HLU P;  1Q2Q A;  4N1H A;  5HSQ A;  4OPQ A;  3A0V A;  2Q9M A;  4PKY A;  3MS6 A;  5HPI A;  2EXB A;  2EWW A;  3VFH A;  2WAE A;  2HJE A;  3UDF A;  5J4E A;  4X69 A;  3CJM A;  2J8Y A;  3PBT A;  3OPR A;  1CI8 A;  2PHY A;  3EQV A;  4EET B;  1ZG6 A;  4R3A A;  2H5S A;  1PW8 A;  3UE0 A;  3MQQ A;  5FQK A;  2Z2L B;  5E2F A;  2Q9N A;  2HGV A;  4YOF A;  5HDD A;  1K55 A;  2QJ5 A;  3T50 A;  3IHA A;  2XEP A;  2JKT I;  3CHW P;  3EEH A;  3IWI A;  1MXO A;  4JF5 A;  1VHM A;  4ZDX A;  3W2Z A;  2XRO A;  1OT6 A;  4EW7 A;  3PYP A;  3ZGA B;  3GTC A;  4BEN A;  2OLV A;  2EFX A;  1L2S A;  1L0G A;  3IF5 A;  4LV1 A;  1BT5 A;  3O86 A;  3WS2 A;  3HLE A;  3F1N A;  3G30 A;  2OWH A;  1YSQ A;  4BD0 A;  4KQQ A;  1E4D A;  4GD8 A;  3DTM A;  2BAS A;  2W1T A;  1G28 A;  2GJ3 A;  1PNE A;  4OPZ A;  1XJ3 A;  3ITA A;  2ZL1 A;  2H28 A;  4GKU A;  2HV1 A;  3P98 A;  5HWV A;  2OV5 A;  4S2P A;  5A91 A;  4OOM A;  3LIE A;  4XUX A;  3LIA A;  4KUO A;  4KQO A;  5GLC A;  3MFX A;  1I2W A;  2R9X A;  5F6A A;  2A3U A;  3LGO A;  1E25 A;  2C5W B;  3B33 A;  1K56 D;  2PYR A;  5E2H A;  3VOY A;  3VOL A;  3PBR A;  2QHK A;  3LUQ A;  1STZ A;  2K2N A;  4IBX A;  3LR5 A;  3NHQ A;  5KIZ A;  3T4K A;  4LPZ A;  4LFU A;  3Q1F A;  4PM7 A;  3LR3 A;  3WRT A;  4BLM A;  4GJ4 A;  4KG6 A;  2FH5 A;  4BWI A;  2V0U A;  1JWP A;  5GHZ A;  2GNX A;  1XGJ A;  4OPY A;  3SZT A;  4PHT A;  1ERQ A;  2R78 A;  3T4Q A;  2ZLY A;  5J3W A;  2LB5 A;  4ETZ A;  1N4O A;  2HPB A;  3GSG A;  4G3K A;  4C3Q A;  1TS8 A;  1OTD A;  4YNR A;  2Q0O A;  4ZJ3 A;  3S7N A;  1PW1 A;  3C8C A;  3IBR A;  4CQH A;  4WMC D;  3UY6 A;  2PAV P;  2ZQC A;  3GV9 A;  5F1F A;  3BLS A;  4GLQ A;  1UWN X;  2QYB A;  4D2O A;  5HL1 A;  5FA7 A;  4JXS A;  1L0F A;  5GHY A;  3RXW A;  1TF1 A;  2XGN A;  1S4S A;  3G6O A;  1PZO A;  1K4F A;  2LB9 A;  4L9G A;  4IVK A;  4JBF A;  1XA1 A;  5CHU A;  1F2K A;  4JGR A;  1BUE A;  2HP9 A;  4ID4 A;  1V9Y A;  4E6X A;  3HLC A;  4NK3 A;  4PM8 A;  3HUM A;  4B4Z A;  3Q7Z A;  2DNS A;  5F83 A;  2EX8 A;  1YAX A;  3OPH A;  4OQ0 A;  2GDN A;  1D06 A;  1K54 A;  1K38 A;  2JN7 A;  5F5Y A;  4MMN A;  5DTS A;  1FQG A;  3VE4 A;  4DJ2 A;  4K0X A;  4LRY C;  4GOG A;  3VSK A;  3IXG A;  3G31 A;  4PM5 A;  4WM9 A;  3UB7 A;  1FR1 A;  3G35 A;  3HVF A;  1O07 A;  1SKF A;  1ONH A;  1YM1 A;  4P6Z M;  4BQM A;  3ZG0 A;  2L0W A;  3HUO A; 
#chains in the Genus database with same CATH homology
 1CI9 A;  1RGY A;  1KGG A;  1I5Q A;  4KZB A;  5FI2 A;  3CMZ A;  3UO9 A;  4XUZ A;  3A3E A;  3FYZ A;  4OLD A;  1H8Y A;  3DWK A;  3AGE A;  4WMC A;  3WS0 A;  1EWZ A;  2ZC5 B;  2Y2O A;  4JXW A;  1JTD A;  1BLH A;  5CHM A;  1O7E A;  1WE4 A;  3IT9 A;  2Y2I A;  2X02 A;  1YLT A;  4P87 A;  1FOF A;  4OLG A;  2VGJ A;  2EX9 A;  5CGS A;  5EVI C;  2WAD A;  1TDL A;  4R3B A;  1GHP A;  1H8Z A;  1LI9 A;  2ZC3 B;  3M6B A;  3ZVT A;  3UPN A;  1U60 A;  3MZF A;  3VOZ A;  3S4X A;  1W5D A;  3BFC A;  3OPL A;  1ZG4 A;  3BEC A;  2Y2J A;  3BFE A;  1ES3 A;  4WZ5 C;  4YFM A;  5E2E A;  5E2G A;  4R3J A;  5FQQ A;  2XLN A;  5HFO A;  3WWX A;  4EBN A;  3IF6 B;  1PI5 A;  3S22 A;  2CC1 A;  3NI9 A;  1H5X A;  1MPL A;  4DE2 A;  3FZC A;  4B4X A;  3VP4 A;  2ZM0 A;  2J9O A;  3G4P A;  3HUN A;  5JYP A;  4OPR A;  2WGW A;  1XXM A;  3DWZ A;  1ZKJ A;  3IQA A;  4LCL A;  1IKG A;  2XD1 A;  1KE0 A;  2WKI A;  1SDE A;  4JLF A;  1DJA A;  3E2L A;  5FSR A;  2ZJ9 A;  4GD6 A;  1K6R A;  1WYB A;  4PM9 A;  5FAT A;  3SS3 A;  2ZC6 B;  4R4S A;  4HBT A;  3V3R A;  3JYI A;  5GLD A;  3MZE A;  3PBS A;  4PM6 A;  1FSY A;  5TGF A;  4BL3 A;  4Y0T A;  1G68 A;  1K56 A;  3ZVW A;  4E3L A;  4A5R A;  5M19 A;  2Y2N A;  4DKI A;  3PBO A;  5AQ9 A;  2ZQD A;  4OQH A;  4WEK A;  1FCM A;  3C4O A;  4LEN A;  2WGV A;  4S2K A;  1QME A;  1N9B A;  5CXW A;  3MXS A;  4FSF A;  2HDQ A;  3VP3 A;  4OOY A;  3HLB A;  4LV3 A;  4UA9 A;  5CEC A;  2IWB A;  2ZM2 A;  3MBZ A;  4DXB A;  3W4Q A;  5AQA A;  1BLS A;  3WS4 A;  4E3J A;  3FV7 A;  1VM1 A;  3UN7 A;  4IBR A;  3UDX A;  1K57 A;  4JF4 A;  4Y7P A;  2P74 A;  2UWX A;  3FKW A;  4B88 A;  3Q7V A;  3EQU A;  1JWZ A;  2J7V A;  5EOE A;  1HD8 A;  2XFT A;  3MKE A;  5CGW A;  5BOH A;  1L0D A;  1LL9 A;  1ALQ A;  1YLZ A;  5GLA A;  4C6Y A;  1YT4 A;  5HAR A;  4X6T A;  1HVB A;  4GZB A;  1OME A;  3GQZ A;  3A3D A;  5CHJ A;  2XFS A;  4QY5 A;  1YLW A;  2BLS A;  2WAF A;  3Q81 A;  5AQB A;  4EBL A;  4E6W A;  3D4F A;  4R4R A;  2Y2L A;  4KZ5 A;  1LLB A;  5G18 A;  1ERM A;  5F82 A;  1YMS A;  3OPP A;  2Y55 A;  3MKF A;  1S0W A;  2Y2M A;  5CEB A;  4RX2 A;  1DJC A;  3ZNY A;  3GVB A;  2Y91 A;  2JCH A;  4CJN A;  2H0Y A;  3P09 A;  3AGD A;  1LL5 A;  2DCF A;  4M3K A;  3IF6 C;  4U3T A;  4Y0O A;  4BD1 A;  1TDG A;  4DDY A;  1K55 C;  3RJU A;  1DJB A;  1PYY A;  3O88 A;  2C6W B;  3ISG A;  1YLP A;  5HX9 A;  1BTL A;  3IH8 A;  4WYY A;  1ONG A;  3M2J A;  4FD8 A;  2EFU A;  5A93 A;  3VSL A;  4KZ9 A;  5KSC A;  3O87 A;  1QMF A;  3UPO A;  3HL9 A;  5GHX A;  3Q07 A;  1IKI A;  5IHV A;  2XDM A;  3UDI A;  4JF6 A;  4WZ5 A;  1ESI A;  3IHB A;  4N9K A;  4OH0 A;  2HP6 A;  4OP5 A;  1FCO A;  5GLB A;  3N8L A;  4P85 A;  2WKH A;  4JKT A;  2EX2 A;  1L0E A;  3Q82 A;  3SS4 A;  5KZH A;  2Y2Q A;  4E3M A;  2P9V A;  1KE4 A;  5FDH A;  4WZ4 A;  3UPP A;  4GNU A;  4RVA A;  5FAQ A;  3ZDJ A;  1PWD A;  3IF6 A;  4K0W A;  4S2N A;  4P0M A;  1K4E A;  1VQQ A;  5KSH A;  3UE3 A;  4FH2 A;  4MNR A;  1I2S A;  1MWR A;  2G2W A;  1YMX A;  2JBF A;  1RCJ A;  4KQR A;  4MBF A;  4KZ4 A;  3W4P A;  2R9W A;  4E3K A;  4UHU A;  5I94 A;  4O7D A;  2HDU A;  3VMA A;  3QNC A;  5GL9 A;  1NJ4 A;  4RX3 A;  2JE5 A;  5TR7 A;  2WKE A;  3ZG9 B;  5CRF A;  5M18 A;  5KMW A;  4ZBE A;  3BYD A;  2XQZ A;  1Q2Q A;  4N1H A;  1J9M A;  1LI0 A;  4OPQ A;  4ZJ1 A;  1CK3 A;  2RL3 A;  3NDE A;  3QNB A;  3ZG5 A;  2Q9M A;  3CG5 A;  3G2Z A;  3VP0 A;  3WRZ A;  1NRF A;  2EXB A;  3BM6 A;  1PZP A;  3S1Y A;  4N1X A;  1K57 C;  3VFH A;  4IVI A;  2WAE A;  3UDF A;  4OOL A;  1FR6 A;  1K25 A;  4S2N C;  2IWC A;  3G32 A;  4UA7 A;  3CJM A;  3LCE A;  4X69 A;  1GHM A;  3ZNT A;  4X55 A;  1MWS A;  2J8Y A;  3PBT A;  3N6I A;  3OPR A;  1ZC2 A;  4HBU A;  5EEC A;  2Y59 A;  1CI8 A;  5EE8 A;  3ZG7 B;  3EQV A;  3ZHH A;  2A49 A;  2EXA A;  1CEF A;  3RXX A;  3SH7 A;  1ZG6 A;  3LY4 A;  4ZJ2 A;  3BFG A;  2Z2M B;  3CZD A;  3SH9 A;  4P6B A;  3MXR A;  4RA7 A;  2H5S A;  4Y0U A;  4X68 A;  1PW8 A;  2FFF B;  2ZC7 A;  1ESU A;  4GB7 A;  3UE0 A;  5FQK A;  3VP1 A;  4DXC A;  4EQI A;  4Q8I A;  4LCM A;  2ZQA A;  2HP5 A;  2Z2L B;  3Q7V B;  5E2F A;  2Q9N A;  1YLJ A;  3TSG A;  2WK0 A;  4GDB A;  1K55 A;  3N8S A;  3OCL A;  3N7W A;  2BG1 A;  3IHA A;  4MBH A;  2QZ6 A;  1Z6F A;  2XK1 A;  2XEP A;  3BRM A;  5CER A;  3IWI A;  2Y4A A;  1MXO A;  4JXG A;  4JF5 A;  5U47 A;  4ZDX A;  1S6R A;  4LV2 A;  1IEM A;  1NY0 A;  1IYP A;  3AGF A;  3IWQ A;  2PU4 A;  3NCK A;  1BUL A;  2ZQ7 A;  3HRE A;  4DE1 A;  1XA7 A;  1JTG A;  1PIO A;  4WEJ A;  4KG5 A;  3OZH A;  5CTM A;  3ZGA B;  2Y2P A;  3GTC A;  4KZ7 A;  3VP2 A;  4BEN A;  2OLV A;  1XP4 A;  2EFX A;  1L2S A;  1YQS A;  2RCX A;  4OQG A;  4BJP A;  1L0G A;  3IF5 A;  4E3I A;  4RYE A;  3NBL A;  4LV1 A;  4FH4 A;  1BT5 A;  4R23 A;  3O86 A;  3WS2 A;  4MBK A;  3HLE A;  5E43 A;  3G30 A;  4F94 A;  4R0Q A;  4DDS A;  3ZFZ A;  4BD0 A;  1TEM A;  2HDR A;  1E4D A;  4KQQ A;  2X71 A;  4GD8 A;  3FWL A;  4ZTK A;  5HAQ A;  4S2I A;  1NZO A;  3MZD A;  4DE3 A;  2ZQ8 A;  4X53 A;  4X56 A;  2WZX A;  3DTM A;  3GR2 A;  1WYC A;  5DTT A;  3HLG A;  3ZG8 B;  5TFQ A;  4EWF A;  1YLY A;  4OPZ A;  3ITA A;  1PI4 A;  3PBN A;  4GKU A;  5HAP A;  1Y54 A;  4H8R A;  1GA0 A;  3P98 A;  5DTK A;  1ES4 A;  2OV5 A;  1FSW A;  4WEL A;  4EBP A;  4S2P A;  5A91 A;  1KDS A;  2XH9 A;  4OOM A;  1W8Q A;  4OVD A;  4LV0 A;  4XUX A;  3ITB A;  4E3O A;  4KQO A;  5GLC A;  4WBG A;  5DVA A;  4HEF A;  1MY8 A;  5DF9 A;  2ZQ9 A;  4IED A;  5EOO A;  4FCF A;  3W8K A;  3FKV A;  5F1G A;  1I2W A;  1KE3 A;  5EVI D;  3NDG A;  3V3S A;  2R9X A;  1NZU A;  3OCN A;  2A3U A;  1E25 A;  2C5W B;  2ZM8 A;  1K56 D;  2Y2G A;  4U0T A;  5E2H A;  3VOY A;  4EUZ A;  3PBR A;  3GRJ A;  2OSU A;  4QD4 A;  1NXY A;  1E3U A;  5EUA A;  3BEB A;  4IBX A;  1CEG A;  2B5R A;  5EVL A;  1G6A A;  3IXH A;  1XX2 A;  4KZA A;  4DE0 A;  3Q1F A;  2VGK A;  4PM7 A;  5FQJ A;  3WRT A;  4BLM A;  4GDN A;  4S2J A;  5M1A A;  5FI7 A;  1MWU A;  1XGI A;  4KG6 A;  3G34 A;  1ES2 A;  4MEZ A;  4OKP A;  1JWP A;  5GHZ A;  2WZZ A;  3WS5 A;  1XGJ A;  3IXB A;  4OPY A;  3PBQ A;  2JC7 A;  1GCE A;  1JVJ A;  3BFD A;  3DW0 A;  3N4I A;  1ERQ A;  3G2Y A;  2J9P A;  1PWC A;  3NIA A;  4MLL A;  2ZLY A;  3LEZ A;  1N4O A;  2HPB A;  3GSG A;  5HW3 A;  2PBY A;  4C3Q A;  1KVL A;  3PAE A;  4PMA A;  3UNW A;  3TG9 A;  3VFF A;  1XKZ A;  3HLW A;  4QHC A;  1TVF A;  4ZJ3 A;  1PW1 A;  3BLM A;  2EX6 A;  1KVM A;  4NET A;  2DRW A;  3OC2 A;  1HZO A;  1KGF A;  1W7F A;  2Y2H A;  4WMC D;  2ZQC A;  3UY6 A;  2XF3 A;  3GV9 A;  2I72 A;  1K6S A;  5F1F A;  1LHY A;  3IXD A;  3HLD A;  2QPN A;  3BLS A;  2WGI A;  4OP8 A;  1IYS A;  4D2O A;  4N92 A;  5HL1 A;  1E3U D;  3WS1 A;  1NYM A;  2ZD8 A;  3B3X A;  5FA7 A;  1Q2P A;  5CGX A;  1SDN A;  5FQM A;  2V2F F;  3HBR A;  4JXS A;  1L0F A;  5FI6 A;  3HLF A;  4KZ3 A;  5GHY A;  1IEL A;  4KEN B;  4OQI A;  1SCW A;  3M6H A;  4GN2 A;  5FAS A;  1C3B A;  4R1G A;  5EVI A;  3RXW A;  2V20 A;  2XGN A;  5AQ7 A;  4XXR A;  4DRT A;  3C4P A;  3TOI A;  4S2M A;  3V5M A;  3UE1 A;  4KG2 A;  4ZAM A;  1BLC A;  4S2L A;  1K54 C;  4QY6 A;  5HAI A;  4S2O A;  1PZO A;  1K4F A;  1MBL A;  4UA6 A;  1W8Y A;  2WYX A;  5DF7 A;  3A3I A;  2ZC4 B;  3O3V A;  2IWD A;  3V39 A;  2FFY A;  2X01 A;  1RGZ A;  1KDW A;  4QB8 A;  4IVK A;  3I7J A;  4JBF A;  1XA1 A;  4KZ6 A;  4UAA A;  5CHU A;  5FQ9 A;  5FQI A;  4E3N A;  1BLP A;  3NC8 A;  1ERO A;  3A3J A;  1BUE A;  1BSG A;  4L0L A;  3ZCZ A;  3PAG A;  2HP9 A;  5FAP A;  4ID4 A;  4E6X A;  3W4O A;  3HLC A;  4NK3 A;  4PM8 A;  5CED A;  2E8I A;  2XD5 A;  5FAO A;  3HUM A;  3QHY A;  4B4Z A;  4KZ8 A;  3Q7Z A;  2DNS A;  5J8X A;  5JYO A;  5F83 A;  3V50 A;  1MWT A;  1M40 A;  2EX8 A;  4C75 A;  4N9L A;  2H10 A;  3BFF A;  3NY4 A;  3M2K A;  3OPH A;  1NYY A;  4QU3 A;  4OQ0 A;  3SH8 A;  2GDN A;  3A3F A;  2V1Z A;  1K54 A;  4PPR A;  1K38 A;  1GA9 A;  1HTZ A;  4EV4 A;  3LY3 A;  4K91 A;  5DTS A;  5A90 A;  1FCN A;  1KGE A;  2PU2 A;  2XR0 A;  1FQG A;  4OON A;  1SHV A;  1PWG A;  3C7V A;  5CTN A;  4K0X A;  1M6K A;  2ZMA A;  1MKI A;  4BL2 A;  1IYO A;  1IYQ A;  2Y2K A;  1RP5 A;  3C7U A;  1DY6 A;  4YIN A;  2WUQ A;  1BZA A;  4GOG A;  5A92 A;  3N8R A;  5L2F A;  4CPK A;  3VSK A;  3IXG A;  5EPH A;  2OLU A;  3SOI A;  1JWV A;  1W79 A;  3G31 A;  4PM5 A;  2QMI A;  2G2U A;  4WM9 A;  1EI5 A;  1ES5 A;  2WGW B;  3LO7 A;  5D3O A;  1FR1 A;  3MFD A;  3C5A A;  5DF8 A;  3G35 A;  4Z9Q A;  4HES A;  3HVF A;  4U0X A;  4QJG A;  1O07 A;  3IWO A;  4JPM A;  4DF6 A;  2H0T A;  1SKF A;  3E2K A;  1ONH A;  2HDS A;  1XPB A;  1YM1 A;  4BQM A;  4JXV A;  3IH9 A;  5EVI B;  3PTE A;  3ZG0 A;  1AXB A;  3HUO A;  2P9V B;  1GHI A;  3GMW A;  3SS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...