1JTGA

Crystal structure of tem-1 beta-lactamase / beta-lactamase inhibitor protein complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
263
structure length
262
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEAKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE TEM
publication title Crystal structure and kinetic analysis of beta-lactamase inhibitor protein-II in complex with TEM-1 beta-lactamase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 91
structure length 262
sequence length 263
chains with identical sequence C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1jtgA00
3MXRA 1YM1A 3LO7A 4JF6A 1CI8A 1RGYA 1E3UD 4S2MA 2HP6A 4JXSA 4Y0OA 1IYQA 5CTMA 2EXBA 2V20A 3CJMA 4ZDXA 1NYYA 3W4OA 2WAEA 3C5AA 1K6RA 1L0GA 2ZQ9A 5CRFA 5J8XA 4N9LA 3BLMA 4OOYA 3N4IA 5BOHA 4EBPA 3PBNA 2OV5A 4DXCA 3ZG5A 1ERQA 4U0TA 1MXOA 4KG5A 1FSYA 1YLZA 2V1ZA 1N4OA 3ZG8B 3IXDA 3HLWA 2C5WB 4S2KA 2JCHA 2OLVA 2P9VB 1L0FA 4Z9QA 3OC2A 4E3LA 4MBFA 3WWXA 4BD1A 4LCMA 3MZFA 2WUQA 2QZ6A 1JTGA 1K54A 2G2UA 3WS5A 4KZ8A 2VGKA 3HLDA 4BENA 4S2IA 3W4QA 1ZG4A 4X56A 4LENA 2WGWB 2WK0A 3E2LA 3Q82A 3OPLA 1SDEA 4KQRA 4C75A 4Y0TA 3A3JA 4LV2A 1DY6A 1ZC2A 4B88A 4BQMA 2HPBA 1SDNA 2Y2JA 2EX8A 1ONGA 3SH7A 4ZJ2A 5AQBA 3UE1A 4OOLA 3AGFA 3UN7A 2I72A 1XA1A 4N9KA 1IKGA 1SKFA 4ZAMA 4OP5A 4D2OA 2XFSA 3NBLA 3P09A 5AQ7A 4MEZA 1ES3A 4RX2A 3O87A 3P98A 4GDBA 5FQMA 4QJGA 3VOYA 1K25A 4KQOA 1W5DA 4E3NA 2RL3A 2Y59A 1HD8A 4L0LA 2WGIA 4IVKA 2IWBA 3B3XA 1XP4A 2PU2A 1RCJA 4JF4A 4X53A 2ZQDA 1BSGA 3HLCA 1XKZA 3CZDA 4K91A 4R4SA 3BLSA 5GLBA 3IHBA 1S6RA 1LL5A 2B5RA 1QMEA 4JXGA 4PM7A 2XK1A 1GHPA 3G32A 5EOOA 3UDIA 4IEDA 2A3UA 2VGJA 2OSUA 1NZOA 3IXHA 3HBRA 2ZMAA 3BM6A 3FWLA 5EVLA 3PBSA 3ZGAB 1L0EA 4KZAA 4KQQA 4LV0A 3N8RA 1NY0A 4IBXA 4R3BA 4RYEA 5A90A 3VSKA 4UA9A 2Q9NA 5GL9A 5FA7A 1O07A 2P74A 4P85A 4ZBEA 5TFQA 3NDGA 2ZQCA 4GN2A 3WS1A 1K54C 4JXVA 2XD5A 3Q81A 1AXBA 2XQZA 1K55C 1W8QA 2ZM8A 4OPYA 2ZLYA 3RXWA 3ZCZA 4EUZA 4OPZA 3DTMA 4GOGA 4R3JA 4S2JA 5E2FA 1G6AA 5AQ9A 4BL3A 4X6TA 5DF9A 1DJAA 3G2ZA 2IWCA 5HARA 3Q7VA 1GHIA 1IEMA 1XPBA 4U0XA 1MPLA 5AQAA 1PI5A 4DE2A 4PM9A 2H5SA 5DF8A 3VP1A 4BJPA 4CPKA 3PBTA 5EVIA 4DE0A 4FD8A 3IH8A 4OPRA 3GQZA 4QU3A 1XGIA 1JWPA 1KVMA 4K0WA 4S2NA 1BT5A 1J9MA 2XD1A 4KZ7A 5DTTA 1PWCA 2Y2QA 4JPMA 4OQHA 1Q2PA 2ZC7A 3IHAA 5GLCA 3HLEA 4DXBA 3HLGA 2J9OA 1TDLA 5FQKA 2ZC4B 4B4XA 3N8SA 1FCMA 5EE8A 3QNCA 1H5XA 3ISGA 5IHVA 2WZXA 4ID4A 1KVLA 3WS4A 5FASA 5FAOA 4WMCD 4E6XA 5FQ9A 3N8LA 4S2LA 5EPHA 1U60A 3W8KA 1FR6A 1KGEA 4HEFA 2ZM2A 4C6YA 1MKIA 3IQAA 1FSWA 2EXAA 2WYXA 4BLMA 1L2SA 2ZQ7A 4R0QA 1Z6FA 3M2JA 4XUZA 4X68A 3UPNA 4OVDA 4S2PA 5TR7A 5KSCA 2Y2KA 1E25A 3VP4A 5FI2A 1VQQA 3JYIA 1JVJA 2E8IA 4GDNA 4DF6A 2DRWA 4N92A 1BLSA 1ERMA 5G18A 3DWZA 3VP2A 3HLBA 4EQIA 2H0TA 1ZG6A 5KMWA 3NI9A 2EX9A 1PW1A 3IWIA 5U47A 1NZUA 4RVAA 2JE5A 2Y4AA 4HESA 5KZHA 3UE3A 5EVIC 3M6BA 3MXSA 2ZQ8A 2UWXA 2Y55A 2X01A 4S2NC 5FQIA 1K57A 3RJUA 3VOZA 4NK3A 3BRMA 5GLDA 1ES4A 1EWZA 3IF6A 2BLSA 3G35A 3A3FA 1M6KA 3UE0A 1FCOA 1CI9A 3VP0A 1PI4A 3G30A 1I2SA 4WELA 5FI6A 4GD6A 2HDSA 5GLAA 3Q7VB 4WZ5A 3VFHA 4BD0A 4XUXA 4MLLA 1LHYA 4F94A 1CEGA 3N6IA 1PWGA 1Q2QA 3PTEA 1K4FA 1RGZA 3M6HA 5EVIB 5FDHA 4HBUA 4ZJ3A 1IYPA 3MZEA 3CMZA 3SOIA 1IYOA 3OCLA 4KZ6A 5FAQA 1LI9A 3O3VA 1W7FA 2H0YA 4GD8A 4OQGA 1BZAA 5CHMA 2RCXA 5GHZA 3ZG9B 3CG5A 5F83A 3UO9A 2EFXA 4GNUA 4QD4A 2ZM0A 3AGDA 5A93A 1E3UA 3IXBA 4Y0UA 1BTLA 5CGSA 3FKWA 2XLNA 1ESIA 4DDYA 3HUOA 2FFFB 1S0WA 3NCKA 3NY4A 2A49A 2C6WB 3G31A 3IH9A 1WYBA 3V50A 1OMEA 3BFGA 1ESUA 3M2KA 2EX6A 4NETA 3QNBA 1DJCA 3AGEA 3PAEA 4R1GA 3ZFZA 3FYZA 2JBFA 2ZC5B 3Q07A 1HVBA 4KZ9A 3ZVWA 1KDSA 1K57C 4M3KA 5FI7A 1TDGA 4IBRA 3O88A 4OH0A 1YMSA 2ZC3B 2DNSA 4JXWA 3BFDA 4KENB 3TOIA 4WBGA 4XXRA 5GHXA 1KE4A 3Q1FA 1FCNA 1PW8A 1W8YA 1YMXA 1FOFA 1YLTA 4DKIA 4QY6A 1LI0A 4WYYA 3C4OA 2WZZA 1L0DA 1MWRA 3NC8A 1ONHA 2X02A 2ZJ9A 4OPQA 3UDFA 1YLYA 2HDRA 1KE0A 5E2HA 2XEPA 4YFMA 3HUMA 5JYOA 2PBYA 3I7JA 1KGFA 4WZ5C 3ZNYA 3GR2A 3VMAA 1MY8A 1SCWA 1IELA 4GB7A 4WZ4A 4FH2A 2R9WA 3OPRA 1JWZA 2HDUA 1IKIA 4KG6A 4P87A 5EOEA 4UAAA 2J8YA 4S2OA 3IF5A 5HX9A 5L2FA 5M18A 2XF3A 4MBHA 1XGJA 3PBRA 1CK3A 4N1HA 5EUAA 5FQQA 3A3EA 5F1GA 2Y2PA 2QMIA 2Q9MA 3BFEA 3IWQA 3IF6B 3LEZA 3V39A 5FQJA 4OP8A 1NYMA 1ALQA 3BYDA 1BLHA 3VP3A 3G4PA 1ES2A 2JC7A 2Y2MA 3HLFA 4LV3A 3DWKA 4YINA 2R9XA 5EECA 3W4PA 4PM6A 5DF7A 3Q7ZA 1DJBA 1CEFA 4QB8A 5A91A 4OKPA 2WKHA 5FAPA 5F1FA 4OONA 2OLUA 2G2WA 4OQIA 4ZTKA 3A3DA 3OPPA 5GHYA 3LY4A 2WKEA 4UA6A 4RA7A 4C3QA 4Q8IA 5CHJA 1GCEA 1MWUA 3GTCA 2J7VA 3S22A 4E3IA 2ZC6B 4HBTA 3UY6A 4EV4A 4JBFA 3SS3A 5A92A 1NXYA 4DRTA 3WRZA 3EQUA 4PM8A 3HREA 3NIAA 4QHCA 1EROA 3IT9A 4OOMA 1LL9A 3HVFA 1BUEA 3ZG0A 1WE4A 2HP9A 3MZDA 4X55A 1MWTA 1PZOA 5CECA 3NDEA 5M1AA 4KZBA 5D3OA 2J9PA 3WS2A 3ITAA 1EI5A 1K56A 5CGXA 5KSHA 1I2WA 3N7WA 1GHMA 3V3SA 5CEBA 3PAGA 5TGFA 3GV9A 2Y2IA 5E2EA 1ES5A 5CEDA 1QMFA 3MKEA 1XX2A 1FR1A 3SH8A 4H8RA 2HP5A 4GKUA 2GDNA 4BL2A 4PM5A 4P0MA 2V2FF 3E2KA 4R4RA 2H10A 2ZD8A 3DW0A 3G2YA 4KZ3A 1BULA 3MKFA 1N9BA 1G68A 4OQ0A 4OLDA 3UNWA 5HFOA 4LCLA 2DCFA 2EFUA 3EQVA 3G34A 1K55A 2Y2NA 2Y2LA 2XR0A 2XH9A 3A3IA 2IWDA 3IXGA 5F82A 4EWFA 4N1XA 1NRFA 4LV1A 5HL1A 3LY3A 3QHYA 1VM1A 3SH9A 3OPHA 1W79A 4WMCA 5EVID 1YLWA 4WM9A 3C4PA 4DE1A 4GZBA 3GMWA 5DVAA 4UA7A 1PIOA 3OZHA 3SS5A 3TSGA 3FV7A 3C7UA 4JF5A 3ZNTA 1E4DA 5JYPA 3BEBA 4A5RA 2XGNA 2Z2MB 4IVIA 1C3BA 4RX3A 2HDQA 3SS4A 2X71A 1Y54A 1TVFA 4DE3A 4P6BA 3S4XA 3ZG7B 2PU4A 1XA7A 1HZOA 4CJNA 5HAPA 1BLPA 1LLBA 3IWOA 1MWSA 4OLGA 1FQGA 5FATA 4MBKA 3BFCA 4WEJA 4R23A 1K38A 1M40A 3GSGA 3ZHHA 2CC1A 4WEKA 2Y2OA 3MFDA 2Y2GA 4E3KA 1JTDA 2BG1A 2Y2HA 3IF6C 2P9VA 3D4FA 3FZCA 1WYCA 1I5QA 4KZ5A 4EBLA 3OCNA 2XDMA 4E6WA 5CHUA 1ZKJA 4O7DA 5CGWA 3ITBA 4UHUA 2XFTA 1PYYA 2WGWA 5HAQA 1GA0A 3V3RA 5CXWA 3GVBA 4U3TA 3LCEA 3C7VA 1K4EA 2WGVA 4KG2A 4X69A 1KGGA 5HAIA 1K6SA 1YLJA 3S1YA 3TG9A 5HW3A 5FSRA 1K56D 1O7EA 3WRTA 1IYSA 4Y7PA 2ZQAA 1MBLA 1H8ZA 1YT4A 3PBQA 4E3MA 1KE3A 2QPNA 4PPRA 4KZ4A 1RP5A 2WAFA 1HTZA 3GRJA 5DTKA 4E3JA 3ZVTA 4FH4A 3UPOA 1JWVA 1PWDA 1XXMA 3WS0A 3RXXA 4FCFA 4ZJ1A 2WADA 5CTNA 3HL9A 1KDWA 4JKTA 4B4ZA 1GA9A 4K0XA 3BECA 4PMAA 1PZPA 3UPPA 5E2GA 1YLPA 4MNRA 3MBZA 2Z2LB 5E43A 1BLCA 3VSLA 5CERA 2WKIA 5I94A 3FKVA 5DTSA 1TEMA 3PBOA 4JLFA 3VFFA 3HUNA 4EBNA 1H8YA 4E3OA 3ZDJA 1SHVA 2FFYA 4FSFA 1YQSA 3UDXA 5M19A 4QY5A 4DDSA 3V5MA 2EX2A 3O86A 2Y91A 1NJ4A 3BFFA
chains in the Genus database with same CATH superfamily
4JF6A 1RGYA 4S2MA 1NLYA 4Y0OA 4WUJA 2WAEA 3C5AA 2ZQ9A 5J8XA 2KOIA 3PBNA 3CPTB 2PHYA 3ZG5A 2V9AA 1FSYA 4EESA 3ZG8B 3DTIA 3HLWA 3OC2A 3WWXA 4LCMA 2EA9A 1JTGA 1K54A 1S4RA 2VGKA 4S2IA 3Q82A 4ETZA 3O5YA 4BQMA 4B88A 3LIBA 2EX8A 1ONGA 4ZJ2A 1T18A 3AGFA 2I72A 1XA1A 2ZBBA 3P01A 4D2OA 3P09A 1ES3A 2VJWA 1P0ZA 4GDBA 5FQMA 1K25A 4KQOA 4O01A 2WGIA 4IVKA 1X0OA 1XP4A 4PHTA 4X53A 3UB7A 2PRFA 3CITA 2B5RA 5EOOA 1K0KA 2A3UA 1TS0A 3IXHA 3HBRA 3BM6A 1T19A 3FWLA 1L0EA 3N8RA 4UA9A 2EWVA 2Q9NA 4NXGA 2VK3A 1O07A 5TFQA 4ZBEA 2W3HA 3H9WA 4GN2A 3WS1A 1H3QA 4JXVA 4RQ9A 1AXBA 2ZM8A 4II7A 3ZCZA 5I5LA 4EUZA 4OPZA 2E8JA 1G6AA 5AQ9A 3IS2B 4XT2B 1DJAA 5HARA 1GHIA 1XPBA 1PI5A 3FC7A 4PM9A 5DF8A 5EVIA 4FD8A 4OPRA 3IH8A 3WS2A 1KVMA 4QPRA 4X1MA 2CMNA 4OQHA 3VV4A 2ZC7A 2UV0E 3HLGA 3LR0A 5EE8A 5IHVA 2ZMFA 1KVLA 3WS4A 5J4EA 5FAOA 4E6XA 4S2LA 3T1RA 3CUEA 1KGEA 4BLMA 3QP2A 4X68A 2KLIA 4KQDA 4OVDA 1N9LA 3KYEA 4IUHA 1JVJA 2E8IA 2DRWA 4HJ4A 4MMNA 1ZG6A 3NI9A 4F3LA 3UE3A 3MXSA 2ZQ8A 2UWXA 4S2NC 4NK3A 3JVUA 2WKRA 5GLDA 1ES4A 2FH5A 3F1OA 3ULFA 3NHQA 3VP0A 1PI4A 1I2SA 3OBFA 2QKPA 3VFHA 4MLLA 1PWGA 1Q2QA 1RGZA 4ZJ3A 3MZEA 5HWTA 3SOIA 3OCLA 3IX8A 4HH3A 5CHMA 1Y4OA 1T1AA 3UO9A 4JGOA 3HUOA 4EETB 2FFFB 1S0WA 3G31A 3NOPC 2PD7A 4NETA 3QNBA 4R1GA 3FYZA 2O9BA 1HVBA 1KDSA 1K57C 3H82A 2O99A 4IBRA 4JXWA 4CLCA 3E98A 4WBGA 3UB5P 3LYXA 1FOFA 3EOIA 3C4OA 5F68A 2X02A 2ZJ9A 2HDRA 3HUMA 1P9RA 4WZ5C 4BBUA 1IELA 3LUQA 4WZ4A 4AFIA 2R9WA 4UQIM 2B95A 2J8YA 2KDKA 5HX9A 2XF3A 1FILA 2Y2PA 3BFEA 3V39A 2ZOHA 4LGWA 5HDDA 3VE4A 4PM6A 3Q7ZA 1CEFA 5A91A 4OKPA 4LRZE 2H28A 5FAPA 2G2WA 1SKOA 4Q8IA 5CHJA 2ZMVA 3GTCA 1IFQA 3T4QA 3UY6A 4JBFA 4DRTA 3LIAA 2J3TC 1OTAA 1LSXA 3K3CA 3HVFA 4X55A 3VE3A 4LPZA 4KZBA 2J9PA 3ITAA 2VX8A 5KSHA 3JPUA 5CEBA 4GHIA 3PAGA 5TGFA 5CEDA 5E2EA 3E0YA 3SH8A 1W63Q 4R4RA 2H10A 2V0UA 3G2YA 4KZ3A 1G68A 4Q0JA 2DCFA 3EQVA 3S7NA 2XROA 1K55A 4YWZA 2XR0A 2IWDA 4EWFA 3MS6A 1NRFA 3LY3A 3QHYA 4WM9A 3C4PA 4GZBA 2VV8A 4UA7A 3LR3A 3OZHA 3KYQA 3V67A 4O0PA 4A5RA 2XGNA 4IVIA 1C3BA 2HDQA 3LIEA 5IS1A 3D3OA 1UWPX 3MMHA 4OLGA 1K38A 1M40A 3GSGA 1BYWA 2P9VA 3D4FA 1WYCA 5KIZA 5CGWA 4Q0HA 2XFTA 5HPIA 3GVBA 3EWKA 1KGGA 5HAIA 1K56D 2OAQ1 5F6AA 3GDIA 1V9YA 1IYSA 1MBLA 4DJ3A 2QPNA 5EVEA 4PPRA 2PYRA 3GRJA 4FH4A 1JWVA 1PWDA 2WADA 5CTNA 1KDWA 4JKTA 1GA9A 4P6ZS 1S1ZA 2PDRA 3VSLA 5I94A 5DJTA 3FKVA 1TEMA 3VFFA 3HUNA 2QHKA 2EWWA 4E3OA 2A24A 4DDSA 2Y91A 1YM1A 2HJEA 4Z1WA 4JXSA 2EXBA 2V20A 3CJMA 3EEAA 3L7HA 3TW8A 3FG8A 1CQAA 1K6RA 5CRFA 3BLMA 2OV5A 1MXOA 4KG5A 1YLZA 1MC0A 2V1ZA 1N4OA 1OPXA 2C5WB 2QYBA 4S2KA 2JCHA 1J3WA 1L0FA 4MBFA 3LGOA 3MZFA 2WUQA 2QZ6A 3IBJA 5DKLA 2G2UA 3WS5A 4KZ8A 3HLDA 4LENA 2WGWB 2WK0A 4KQRA 3OPLA 1SDEA 4C75A 4Y0TA 2HPBA 1SDNA 3SH7A 1YPRA 2P7JA 4OOLA 4ETXA 1IOUA 5IT5A 1IKGA 1SKFA 4ZAMA 4OP5A 4MEZA 5HL6A 3O87A 4HJ6A 3UB8A 4QJGA 1TS6A 3VOYA 2RL3A 2XRNA 2Y59A 2AVXA 2PR6A 1HD8A 4L0LA 2IWBA 2PU2A 3HJKA 1VETB 1XKZA 3CZDA 4K91A 3IHBA 3RTYA 3H7WA 4PM7A 3UDIA 5EFWA 2ZMAA 5TBMA 2IA2A 2O9CA 4LV0A 4IBXA 2VA0A 4RYEA 5A90A 3VSKA 5GL9A 4P85A 4ME4A 2XD5A 3KX0X 5G4YA 1K55C 3IBRA 3T4SA 4EUVA 3DTMA 2QJ7A 3Q7VA 3F1NA 4LFUA 1MPLA 4HNBA 3T12B 3C8CA 4BJPA 4CPKA 3LEQA 1ZHHB 2PT7A 3PBTA 3QP1A 3GQZA 4K0WA 1JWPA 4S2NA 1D06A 1J9MA 4KZ7A 2Y2QA 4JPMA 2Y79A 1Q2PA 5GLCA 3HLEA 4DXBA 2J9OA 1TDLA 5L8MA 1FCMA 2WZXA 4BBTA 5FQ9A 5EPHA 1ACFA 4HEFA 4C6YA 4YOFA 1MKIA 2WYXA 2ZOIA 3U4LP 4X1LA 3DAVA 1TS8A 3QP5A 3UPNA 5TR7A 4ZRRA 4GS9A 1E25A 2V1BA 1G5UA 5HSQA 2W1TA 4N92A 1ERMA 3VP2A 2VGLM 2J3WA 1PW1A 2LB9A 3IWIA 1NRJA 2Y4AA 5KZHA 3M6BA 3PR6A 1JNUA 5FQIA 1K57A 3T1SA 4WL9A 2FZ0A 5TJJA 3LIFA 4WZ5A 4XUXA 1TF1A 1LHYA 1N9OA 1CEGA 3N6IA 5EVIB 1K4FA 2K7SA 1IYPA 1IYOA 4YNRA 3O3VA 4DMZA 5F83A 2EFXA 4Y3IA 2PAVP 3AGDA 4IJGA 5A93A 5CGSA 1BTLA 1ESIA 2GX5A 1WYBA 4R38A 3V50A 3F1PA 1ESUA 3M2KA 1DJCA 3AGEA 3MQOA 3C2WA 3ZFZA 1XJ3A 1F9IA 3LFVA 2W1RA 1TDGA 4OH0A 2ZC3B 2DNSA 5GHXA 4DKIA 1FCNA 1YMXA 1YLTA 4NG2A 2XSSA 5L10A 1MWRA 3UDFA 1YLYA 2XEPA 5JYOA 3I7JA 1KGFA 1VEUA 3VMAA 3LR5A 1SCWA 3OPRA 2YKFA 4G3WA 4P87A 4F3LB 5EOEA 4UAAA 2V1AA 4MBHA 4N1HA 5EUAA 3F1OB 2Q9MA 2HZ5A 5DFXA 2HGVA 5FQJA 4OP8A 3VP3A 3HLFA 1OJGA 4YINA 4PKYG 5K5BA 3JVVA 2WKHA 2OLUA 4OQIA 2WKEA 3E4QA 2BASA 1MWUA 2HJ9C 3S22A 4E3IA 4EV4A 3SS3A 2O0YA 3B47A 4PM8A 3HREA 5EV0A 5C5KA 5HDCA 5CECA 1LL8A 3A0VA 2MJ6A 5D3OA 1EI5A 3KSIA 3N7WA 4NXBA 4EERA 3GV9A 1XX2A 3H82B 1OTEA 2GDNA 4BL2A 4CLCB 3E2KA 1DP9A 3DW0A 3LIDA 5HFOA 3CLOA 2NUPC 3T4JA 3A3IA 2XH9A 5F82A 3IXGA 5F5YA 1VM1A 4HHDA 4HI4A 2YKHA 1PIOA 3FPWA 3SS5A 3S7OA 1E4DA 4GW9A 3SS4A 2X71A 4DE3A 3ZG7B 2PU4A 1HZOA 5DJUA 5EM1A 4MBKA 3BFCA 4R23A 1SKOB 4E3KA 2ZL1B 2Y2HA 1I5QA 4KZ5A 3TE8A 4O8GA 3OCNA 4LLOB 4JGQA 5CHUA 1ZKJA 3ITBA 4WN5A 4X69A 3MXQA 2JKRM 4GHIB 3WRTA 1H8ZA 4E3MA 1KE3A 4PKYA 1RP5A 2WAFA 2JKTM 3ZVTA 1XXMA 1OT9A 4FCFA 4ZJ1A 3HL9A 2GNXA 5J3WA 4WF0A 2J80A 3MF0A 5E2GA 1YLPA 3EGXC 3MBZA 3KYZA 5E43A 5CERA 2WKIA 1H0MA 5DTSA 1H8YA 2FFYA 3UDXA 2D01A 3UMDA 3BFFA 2HV1A 3S7PA 4CLCE 2P08A 2HP6A 1IYQA 1F5MA 5A8BA 4EQ1A 1NYYA 3W4OA 2A2LA 1L0GA 4N9LA 4OOYA 4EBPA 1ERQA 2V8FA 4U0TA 3D9YA 1UWNX 3IXDA 2P9VB 4Z9QA 4HY8A 3EEHA 4E3LA 4BD1A 1S66L 4H6JB 2L4RA 3T4TA 4PAUA 1ZG4A 4UQIS 3A3JA 4LV2A 1ZC2A 2QJ5A 3ICYA 3PHYA 5AQBA 4Y15A 3UE1A 3LR4A 3UN7A 5HZHA 4N9KA 2XFSA 1V9ZA 3NBLA 5AQ7A 2V0WA 2PBDP 1W5DA 1ZTUA 4E3NA 3T4KA 1G6OA 1CJFA 4I3IA 2INWA 3CAXA 3B3XA 1RCJA 4JF4A 2ZQDA 1BSGA 2VV6A 5GLBA 5LBRA 1QMEA 4JXGA 2XK1A 4HH2A 2A24B 2OSUA 1NZOA 1STZA 5EVLA 2JN7A 3PBSA 3ZGAB 4KQQA 1NY0A 4R3BA 5FA7A 3NDGA 2OAP1 4NXEA 1W8QA 2ZLYA 3S7QA 2PYPA 4R3JA 4S2JA 5E2FA 4D60A 4BL3A 4X6TA 5DF9A 1IEMA 4U0XA 5AQAA 4DE2A 4HQAA 1Y28A 3VP1A 3TRCA 1OTIA 3NECA 4DE0A 4HP4A 2I9VA 3CWFA 4QU3A 1XGIA 2R78A 1BT5A 5DTTA 5FQKA 4B4XA 3N8SA 1EW0A 4ID4A 5FASA 4WMCD 4BBVA 3N8LA 4LRXC 3R7WA 3W2ZA 1FR6A 1L3LA 2ZM2A 3IQAA 1TD5A 3NULA 2EXAA 1L2SA 3M2JA 4EEPA 4S2PA 2Y2KA 3T4LA 3VP4A 5FI2A 4GDNA 4DF6A 2Y8HA 1WA9A 3H7WB 1NLZA 1BLSA 4Y13A 5DFYA 4EQIA 5KMWA 2EX9A 1NZUA 5TBMB 2JE5A 4HESA 2X01A 2VLGA 3RJUA 3VOZA 4EW7A 3BRMA 2XA7M 1EWZA 3IF6A 2BLSA 3A3FA 1M6KA 3UE0A 1CI9A 3ZQ5A 3G30A 4WELA 5FI6A 4NXFA 5GLAA 3Q7VB 3F1NB 1XJ4A 4BD0A 3PTEA 3E4PA 5FDHA 4HBUA 4IUKA 5CX7A 4OQGA 1W7FA 3ZG9B 5GHZA 5HPFA 2RCXA 4GNUA 4QD4A 2ZM0A 4I39A 3K2NA 3IXBA 1S1YA 2XLNA 4DDYA 3P7NA 2A49A 2W0NA 2C6WB 3IH9A 2OWHA 4GCZA 1OMEA 2EX6A 3PAEA 2ZC5B 3ZVWA 1P97A 5FI7A 3O88A 1YMSA 3BFDA 4KENB 4XXRA 3HCYA 4GS9B 1KE4A 1PW8A 2JKGA 1S67L 2WZZA 4OPQA 3NC8A 4B9OA 2W1TB 3L9KA 1ODVA 2PBYA 1F98A 4FUWA 3QP8A 3ZNYA 1KOUA 4FH2A 1JWZA 4KG6A 3A0SA 4S2OA 2O9AA 1XGJA 5FQQA 1PRQA 1NYMA 1BLHA 2R9XA 5AJGA 2W3DA 5EECA 3W4PA 1DJBA 4QB8A 4ZTKA 3A3DA 3OPPA 4UA6A 2M7UA 1GCEA 2J7VA 4G3VA 2ZC6B 4EEUA 4KUKA 1NXYA 1DP6A 3SZTA 3WRZA 3NIAA 4QHCA 3MFXA 2NUTC 2B18A 1XFNA 1BUEA 3ZG0A 2GZAA 1WE4A 4ARZA 3MZDA 2WKQA 5M1AA 2W3EA 3OOVA 3T1QB 1K56A 3F1PB 5CGXA 1I2WA 4HIAA 2Y2IA 1ES5A 4E04A 3MKEA 4QWOA 1FR1A 4H8RA 2HP5A 4P0MA 3BQAA 1YAXA 4CLCD 4OQ0A 5AVFA 4OLDA 3U2AA 3G34A 2Y2NA 1VEUB 3SH9A 5MC7A 3OPHA 1W79A 4WMCA 1YLWA 4DE1A 2M7VA 5DVAA 1GSVA 3BW6A 3C7UA 3FV7A 3ZNTA 3BEBA 1PFLA 1Y54A 3S4XA 4CJNA 4BMWA 1D7EA 1BLPA 3IWOA 1FQGA 3CPTA 4WEJA 3ZHHA 2CC1A 4WEKA 2Y2OA 2PD8A 2Y2GA 3MFDA 5HD5A 2BG1A 3HJIA 3IF6C 4HOIA 2VGLS 4E6WA 4EXOA 1LSVA 5FEFA 3VOLA 4UHUA 3MQ0A 1GA0A 4U3TA 3C7VA 1GSWA 1YKDA 3S1YA 3BWLA 5FSRA 4Y7PA 1YT4A 3PBQA 4M4XA 3CHWP 4KZ4A 3BQ8A 4E3JA 5DTKA 3A0RA 4K0XA 4PMAA 3NJAA 1PZPA 1MZUA 4MNRA 2Z2LB 1OJ5A 5HDSA 1BLCA 3PBOA 4JLFA 4EBNA 1SHVA 4FSFA 2W3FA 1LT0A 4QY5A 1VB6A 2EX2A 4BENA 1NJ4A 3SW1A 4FTXA 3MXRA 3LO7A 1CI8A 1E3UD 3ZYTA 3NOTC 5CTMA 4ZDXA 2D02A 5HD3A 3B33A 3IS2A 3N4IA 5BOHA 4XT2A 4DXCA 2WKPA 4BWIA 5HWWA 2OLVA 4X25A 1T1CA 3W4QA 4X56A 3QP6A 3E2LA 1XJ6A 1DY6A 2Y2JA 3MR0A 1DRMA 4RX2A 3P98A 3KSGA 3UB6A 1LSWA 4DN0A 4MN7A 4R6LA 4HJ3A 3HLCA 4R4SA 2VKSA 3DTKA 3BLSA 1S6RA 1LL5A 1TS7A 1GHPA 3G32A 4IEDA 2VGJA 4KZAA 4JGPA 4IHQA 2P74A 2ZQCA 1K54C 1OT6A 4MN5A 3Q81A 2OWJA 2XQZA 4OPYA 1AWIA 3RXWA 3C30A 3MSHA 4GOGA 3G2ZA 2IWCA 2Z6CA 2VEAA 1YSPA 2H5SA 3PYPA 3KO6A 2JHEA 1W63M 2XD1A 1F2KA 1PWCA 4I38A 3IHAA 3T4OA 4GJ4A 2ZC4B 3QNCA 1H5XA 2GJ3A 3ISGA 3BY9A 3LICA 3UE6A 1U60A 3W8KA 2K31A 4L9EA 4ESPA 1FSWA 2ZQ7A 4R0QA 2QWSA 3RFBA 1Z6FA 2PR5A 4XUZA 2ZL1A 5KSCA 1H8MA 4R70A 3LI8A 1VQQA 3JYIA 4MN6A 5G18A 3DWZA 3HLBA 2H0TA 4G3KA 5U47A 4Y17A 4RVAA 2W3GA 5EVIC 3CI6A 2Y55A 5HWVA 2L1MA 3G35A 1FCOA 4DJ2A 3K3DA 3UMEA 4GD6A 4EU0A 2HDSA 2G7UA 4MCWA 1VHMA 1S4SA 3CUEC 2JKRI 2B02A 4F94A 4P6ZM 3QP4A 3M6HA 3CMZA 4KZ6A 5FAQA 1LI9A 2H0YA 2JKTI 4GD8A 1BZAA 3CG5A 1E3UA 4Y0UA 3FKWA 2Z6DA 5DKKA 2BTFP 1N9NA 3KSHA 3NY4A 3NCKA 3R7WB 3BFGA 1DP8A 2JKFA 5L07A 1A0KA 3Q07A 2JBFA 4KZ9A 2Q0OA 4JGRA 4M3KA 3TOIA 3Q1FA 1W8YA 3C38A 4NKPA 4MDZA 4QY6A 1LI0A 4WYYA 4H6JA 1L0DA 1ONHA 4WLAA 1KE0A 5F69A 5E2HA 3T50A 4YFMA 3GR2A 1MY8A 2DMWA 1XFQA 4GB7A 3R4KA 4I3AA 2M1CA 2HDUA 1IKIA 2P04A 3IF5A 3LI9A 5L2FA 5M18A 3PBRA 1CK3A 3MQQA 3A3EA 5F1GA 2VV7A 2QMIA 3IWQA 3IF6B 3LEZA 1ALQA 3BYDA 3G4PA 1ES2A 2JC7A 2Y2MA 5J7EA 1SZVA 1OTBA 3DWKA 4LV3A 2ACGA 2VZWA 5DF7A 2K2NA 5F1FA 1T1BA 4OONA 5GHYA 3LY4A 2HF6A 4RA7A 4Y5FA 4C3QA 3IX3A 2LB5A 4HBTA 5A92A 3EGDC 3EQUA 4CLCC 1EROA 3IT9A 4OOMA 1LL9A 2HP9A 3T1XA 1MWTA 1PZOA 4R3AA 3NDEA 2V8CA 5FEGA 4KUOA 3V3SA 1GHMA 3DBAA 1P9WA 1QMFA 2L0WA 3DTEA 5EM0A 4L9FA 4GKUA 4PM5A 4Y2FA 2V2FF 4NEED 4B93A 2ZD8A 3D72A 1BULA 3MKFA 1N9BA 2J3TD 2W27A 3UNWA 4I3JA 4LCLA 3NOUC 2EFUA 1Z09A 4I5SA 1UGUA 2Y2LA 3PXPA 5AVEA 4N1XA 4LV1A 5HL1A 5EVID 3IX4A 5G4ZA 3GMWA 4L9GA 4CQHA 3TSGA 4JF5A 5JYPA 4GLQA 2Z2MB 4RX3A 5FDSA 1TVFA 4P6BA 1XA7A 3GECA 5HAPA 1LLBA 1MWSA 5FATA 4LRYC 3BY8A 1XJ2A 1JTDA 3BJNA 5L09A 3FZCA 1G28A 4Q0IA 4EBLA 3G6OA 2XDMA 3FPVA 4O7DA 1YSQA 4ARZB 4UEYA 3B42A 1PYYA 2WGWA 5HAQA 1MKMA 5CXWA 3V3RA 1GSXA 3LCEA 4KG2A 1K4EA 2WGVA 4K08A 2KX6A 2XA7S 3UB9A 1K6SA 3TJZC 1YLJA 5FL3A 2OOLA 3TG9A 5HW3A 5IU1A 1O7EA 3MJQA 1FIKA 2ZQAA 4HP9A 1HTZA 3UPOA 3OLOA 3WS0A 3RXXA 1CF0A 1D1JA 4B4ZA 3E4OA 1OTDA 3BECA 3UPPA 1VETA 3KSFA 1PNEA 4FOFA 3ZDJA 1NWZA 1HLUP 1YQSA 5M19A 3RH8B 3V5MA 3O86A
chains in the Genus database with same CATH topology
3MXRA 1YM1A 3LO7A 4JF6A 1CI8A 1RGYA 1E3UD 4S2MA 2HP6A 4JXSA 4Y0OA 1IYQA 5CTMA 2EXBA 2V20A 3CJMA 4ZDXA 1NYYA 3W4OA 2WAEA 3C5AA 1K6RA 1L0GA 2ZQ9A 5CRFA 5J8XA 4N9LA 3BLMA 4OOYA 3N4IA 5BOHA 4EBPA 3PBNA 2OV5A 4DXCA 3ZG5A 1ERQA 4U0TA 1MXOA 4KG5A 1FSYA 1YLZA 2V1ZA 1N4OA 3ZG8B 3IXDA 3HLWA 2C5WB 4S2KA 2JCHA 2OLVA 2P9VB 1L0FA 4Z9QA 3OC2A 4E3LA 4MBFA 3WWXA 4BD1A 4LCMA 3MZFA 2WUQA 2QZ6A 1JTGA 1K54A 2G2UA 3WS5A 4KZ8A 2VGKA 3HLDA 4BENA 4S2IA 3W4QA 1ZG4A 4X56A 4LENA 2WGWB 2WK0A 3E2LA 3Q82A 3OPLA 1SDEA 4KQRA 4C75A 4Y0TA 3A3JA 4LV2A 1DY6A 1ZC2A 4B88A 4BQMA 2HPBA 1SDNA 2Y2JA 2EX8A 1ONGA 3SH7A 4ZJ2A 5AQBA 3UE1A 4OOLA 3AGFA 3UN7A 2I72A 1XA1A 4N9KA 1IKGA 1SKFA 4ZAMA 4OP5A 4D2OA 2XFSA 3NBLA 3P09A 5AQ7A 4MEZA 1ES3A 4RX2A 3O87A 3P98A 4GDBA 5FQMA 4QJGA 3VOYA 1K25A 4KQOA 1W5DA 4E3NA 2RL3A 2Y59A 1HD8A 4L0LA 2WGIA 4IVKA 2IWBA 3B3XA 1XP4A 2PU2A 1RCJA 4JF4A 4X53A 2ZQDA 1BSGA 3HLCA 1XKZA 3CZDA 4K91A 4R4SA 3BLSA 5GLBA 3IHBA 1S6RA 1LL5A 2B5RA 1QMEA 4JXGA 4PM7A 2XK1A 1GHPA 3G32A 5EOOA 3UDIA 4IEDA 2A3UA 2VGJA 2OSUA 1NZOA 3IXHA 3HBRA 2ZMAA 3BM6A 3FWLA 5EVLA 3PBSA 3ZGAB 1L0EA 4KZAA 4KQQA 4LV0A 3N8RA 1NY0A 4IBXA 4R3BA 4RYEA 5A90A 3VSKA 4UA9A 2Q9NA 5GL9A 5FA7A 1O07A 2P74A 4P85A 4ZBEA 5TFQA 3NDGA 2ZQCA 4GN2A 3WS1A 1K54C 4JXVA 2XD5A 3Q81A 1AXBA 2XQZA 1K55C 1W8QA 2ZM8A 4OPYA 2ZLYA 3RXWA 3ZCZA 4EUZA 4OPZA 3DTMA 4GOGA 4R3JA 4S2JA 5E2FA 1G6AA 5AQ9A 4BL3A 4X6TA 5DF9A 1DJAA 3G2ZA 2IWCA 5HARA 3Q7VA 1GHIA 1IEMA 1XPBA 4U0XA 1MPLA 5AQAA 1PI5A 4DE2A 4PM9A 2H5SA 5DF8A 3VP1A 4BJPA 4CPKA 3PBTA 5EVIA 4DE0A 4FD8A 3IH8A 4OPRA 3GQZA 4QU3A 1XGIA 1JWPA 1KVMA 4K0WA 4S2NA 1BT5A 1J9MA 2XD1A 4KZ7A 5DTTA 1PWCA 2Y2QA 4JPMA 4OQHA 1Q2PA 2ZC7A 3IHAA 5GLCA 3HLEA 4DXBA 3HLGA 2J9OA 1TDLA 5FQKA 2ZC4B 4B4XA 3N8SA 1FCMA 5EE8A 3QNCA 1H5XA 3ISGA 5IHVA 2WZXA 4ID4A 1KVLA 3WS4A 5FASA 5FAOA 4WMCD 4E6XA 5FQ9A 3N8LA 4S2LA 5EPHA 1U60A 3W8KA 1FR6A 1KGEA 4HEFA 2ZM2A 4C6YA 1MKIA 3IQAA 1FSWA 2EXAA 2WYXA 4BLMA 1L2SA 2ZQ7A 4R0QA 1Z6FA 3M2JA 4XUZA 4X68A 3UPNA 4OVDA 4S2PA 5TR7A 5KSCA 2Y2KA 1E25A 3VP4A 5FI2A 1VQQA 3JYIA 1JVJA 2E8IA 4GDNA 4DF6A 2DRWA 4N92A 1BLSA 1ERMA 5G18A 3DWZA 3VP2A 3HLBA 4EQIA 2H0TA 1ZG6A 5KMWA 3NI9A 2EX9A 1PW1A 3IWIA 5U47A 1NZUA 4RVAA 2JE5A 2Y4AA 4HESA 5KZHA 3UE3A 5EVIC 3M6BA 3MXSA 2ZQ8A 2UWXA 2Y55A 2X01A 4S2NC 5FQIA 1K57A 3RJUA 3VOZA 4NK3A 3BRMA 5GLDA 1ES4A 1EWZA 3IF6A 2BLSA 3G35A 3A3FA 1M6KA 3UE0A 1FCOA 1CI9A 3VP0A 1PI4A 3G30A 1I2SA 4WELA 5FI6A 4GD6A 2HDSA 5GLAA 3Q7VB 4WZ5A 3VFHA 4BD0A 4XUXA 4MLLA 1LHYA 4F94A 1CEGA 3N6IA 1PWGA 1Q2QA 3PTEA 1K4FA 1RGZA 3M6HA 5EVIB 5FDHA 4HBUA 4ZJ3A 1IYPA 3MZEA 3CMZA 3SOIA 1IYOA 3OCLA 4KZ6A 5FAQA 1LI9A 3O3VA 1W7FA 2H0YA 4GD8A 4OQGA 1BZAA 5CHMA 2RCXA 5GHZA 3ZG9B 3CG5A 5F83A 3UO9A 2EFXA 4GNUA 4QD4A 2ZM0A 3AGDA 5A93A 1E3UA 3IXBA 4Y0UA 1BTLA 5CGSA 3FKWA 2XLNA 1ESIA 4DDYA 3HUOA 2FFFB 1S0WA 3NCKA 3NY4A 2A49A 2C6WB 3G31A 3IH9A 1WYBA 3V50A 1OMEA 3BFGA 1ESUA 3M2KA 2EX6A 4NETA 3QNBA 1DJCA 3AGEA 3PAEA 4R1GA 3ZFZA 3FYZA 2JBFA 2ZC5B 3Q07A 1HVBA 4KZ9A 3ZVWA 1KDSA 1K57C 4M3KA 5FI7A 1TDGA 4IBRA 3O88A 4OH0A 1YMSA 2ZC3B 2DNSA 4JXWA 3BFDA 4KENB 3TOIA 4WBGA 4XXRA 5GHXA 1KE4A 3Q1FA 1FCNA 1PW8A 1W8YA 1YMXA 1FOFA 1YLTA 4DKIA 4QY6A 1LI0A 4WYYA 3C4OA 2WZZA 1L0DA 1MWRA 3NC8A 1ONHA 2X02A 2ZJ9A 4OPQA 3UDFA 1YLYA 2HDRA 1KE0A 5E2HA 2XEPA 4YFMA 3HUMA 5JYOA 2PBYA 3I7JA 1KGFA 4WZ5C 3ZNYA 3GR2A 3VMAA 1MY8A 1SCWA 1IELA 4GB7A 4WZ4A 4FH2A 2R9WA 3OPRA 1JWZA 2HDUA 1IKIA 4KG6A 4P87A 5EOEA 4UAAA 2J8YA 4S2OA 3IF5A 5HX9A 5L2FA 5M18A 2XF3A 4MBHA 1XGJA 3PBRA 1CK3A 4N1HA 5EUAA 5FQQA 3A3EA 5F1GA 2Y2PA 2QMIA 2Q9MA 3BFEA 3IWQA 3IF6B 3LEZA 3V39A 5FQJA 4OP8A 1NYMA 1ALQA 3BYDA 1BLHA 3VP3A 3G4PA 1ES2A 2JC7A 2Y2MA 3HLFA 4LV3A 3DWKA 4YINA 2R9XA 5EECA 3W4PA 4PM6A 5DF7A 3Q7ZA 1DJBA 1CEFA 4QB8A 5A91A 4OKPA 2WKHA 5FAPA 5F1FA 4OONA 2OLUA 2G2WA 4OQIA 4ZTKA 3A3DA 3OPPA 5GHYA 3LY4A 2WKEA 4UA6A 4RA7A 4C3QA 4Q8IA 5CHJA 1GCEA 1MWUA 3GTCA 2J7VA 3S22A 4E3IA 2ZC6B 4HBTA 3UY6A 4EV4A 4JBFA 3SS3A 5A92A 1NXYA 4DRTA 3WRZA 3EQUA 4PM8A 3HREA 3NIAA 4QHCA 1EROA 3IT9A 4OOMA 1LL9A 3HVFA 1BUEA 3ZG0A 1WE4A 2HP9A 3MZDA 4X55A 1MWTA 1PZOA 5CECA 3NDEA 5M1AA 4KZBA 5D3OA 2J9PA 3WS2A 3ITAA 1EI5A 1K56A 5CGXA 5KSHA 1I2WA 3N7WA 1GHMA 3V3SA 5CEBA 3PAGA 5TGFA 3GV9A 2Y2IA 5E2EA 1ES5A 5CEDA 1QMFA 3MKEA 1XX2A 1FR1A 3SH8A 4H8RA 2HP5A 4GKUA 2GDNA 4BL2A 4PM5A 4P0MA 2V2FF 3E2KA 4R4RA 2H10A 2ZD8A 3DW0A 3G2YA 4KZ3A 1BULA 3MKFA 1N9BA 1G68A 4OQ0A 4OLDA 3UNWA 5HFOA 4LCLA 2DCFA 2EFUA 3EQVA 3G34A 1K55A 2Y2NA 2Y2LA 2XR0A 2XH9A 3A3IA 2IWDA 3IXGA 5F82A 4EWFA 4N1XA 1NRFA 4LV1A 5HL1A 3LY3A 3QHYA 1VM1A 3SH9A 3OPHA 1W79A 4WMCA 5EVID 1YLWA 4WM9A 3C4PA 4DE1A 4GZBA 3GMWA 5DVAA 4UA7A 1PIOA 3OZHA 3SS5A 3TSGA 3FV7A 3C7UA 4JF5A 3ZNTA 1E4DA 5JYPA 3BEBA 4A5RA 2XGNA 2Z2MB 4IVIA 1C3BA 4RX3A 2HDQA 3SS4A 2X71A 1Y54A 1TVFA 4DE3A 4P6BA 3S4XA 3ZG7B 2PU4A 1XA7A 1HZOA 4CJNA 5HAPA 1BLPA 1LLBA 3IWOA 1MWSA 4OLGA 1FQGA 5FATA 4MBKA 3BFCA 4WEJA 4R23A 1K38A 1M40A 3GSGA 3ZHHA 2CC1A 4WEKA 2Y2OA 3MFDA 2Y2GA 4E3KA 1JTDA 2BG1A 2Y2HA 3IF6C 2P9VA 3D4FA 3FZCA 1WYCA 1I5QA 4KZ5A 4EBLA 3OCNA 2XDMA 4E6WA 5CHUA 1ZKJA 4O7DA 5CGWA 3ITBA 4UHUA 2XFTA 1PYYA 2WGWA 5HAQA 1GA0A 3V3RA 5CXWA 3GVBA 4U3TA 3LCEA 3C7VA 1K4EA 2WGVA 4KG2A 4X69A 1KGGA 5HAIA 1K6SA 1YLJA 3S1YA 3TG9A 5HW3A 5FSRA 1K56D 1O7EA 3WRTA 1IYSA 4Y7PA 2ZQAA 1MBLA 1H8ZA 1YT4A 3PBQA 4E3MA 1KE3A 2QPNA 4PPRA 4KZ4A 1RP5A 2WAFA 1HTZA 3GRJA 5DTKA 4E3JA 3ZVTA 4FH4A 3UPOA 1JWVA 1PWDA 1XXMA 3WS0A 3RXXA 4FCFA 4ZJ1A 2WADA 5CTNA 3HL9A 1KDWA 4JKTA 4B4ZA 1GA9A 4K0XA 3BECA 4PMAA 1PZPA 3UPPA 5E2GA 1YLPA 4MNRA 3MBZA 2Z2LB 5E43A 1BLCA 3VSLA 5CERA 2WKIA 5I94A 3FKVA 5DTSA 1TEMA 3PBOA 4JLFA 3VFFA 3HUNA 4EBNA 1H8YA 4E3OA 3ZDJA 1SHVA 2FFYA 4FSFA 1YQSA 3UDXA 5M19A 4QY5A 4DDSA 3V5MA 2EX2A 3O86A 2Y91A 1NJ4A 3BFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXR A;  1YM1 A;  3LO7 A;  4JF6 A;  1CI8 A;  1RGY A;  1E3U D;  4S2M A;  2HP6 A;  4JXS A;  4Y0O A;  1IYQ A;  5CTM A;  2EXB A;  2V20 A;  3CJM A;  4ZDX A;  1NYY A;  3W4O A;  2WAE A;  3C5A A;  1K6R A;  1L0G A;  2ZQ9 A;  5CRF A;  5J8X A;  4N9L A;  3BLM A;  4OOY A;  3N4I A;  5BOH A;  4EBP A;  3PBN A;  2OV5 A;  4DXC A;  3ZG5 A;  1ERQ A;  4U0T A;  1MXO A;  4KG5 A;  1FSY A;  1YLZ A;  2V1Z A;  1N4O A;  3ZG8 B;  3IXD A;  3HLW A;  2C5W B;  4S2K A;  2JCH A;  2OLV A;  2P9V B;  1L0F A;  4Z9Q A;  3OC2 A;  4E3L A;  4MBF A;  3WWX A;  4BD1 A;  4LCM A;  3MZF A;  2WUQ A;  2QZ6 A;  1JTG A;  1K54 A;  2G2U A;  3WS5 A;  4KZ8 A;  2VGK A;  3HLD A;  4BEN A;  4S2I A;  3W4Q A;  1ZG4 A;  4X56 A;  4LEN A;  2WGW B;  2WK0 A;  3E2L A;  3Q82 A;  3OPL A;  1SDE A;  4KQR A;  4C75 A;  4Y0T A;  3A3J A;  4LV2 A;  1DY6 A;  1ZC2 A;  4B88 A;  4BQM A;  2HPB A;  1SDN A;  2Y2J A;  2EX8 A;  1ONG A;  3SH7 A;  4ZJ2 A;  5AQB A;  3UE1 A;  4OOL A;  3AGF A;  3UN7 A;  2I72 A;  1XA1 A;  4N9K A;  1IKG A;  1SKF A;  4ZAM A;  4OP5 A;  4D2O A;  2XFS A;  3NBL A;  3P09 A;  5AQ7 A;  4MEZ A;  1ES3 A;  4RX2 A;  3O87 A;  3P98 A;  4GDB A;  5FQM A;  4QJG A;  3VOY A;  1K25 A;  4KQO A;  1W5D A;  4E3N A;  2RL3 A;  2Y59 A;  1HD8 A;  4L0L A;  2WGI A;  4IVK A;  2IWB A;  3B3X A;  1XP4 A;  2PU2 A;  1RCJ A;  4JF4 A;  4X53 A;  2ZQD A;  1BSG A;  3HLC A;  1XKZ A;  3CZD A;  4K91 A;  4R4S A;  3BLS A;  5GLB A;  3IHB A;  1S6R A;  1LL5 A;  2B5R A;  1QME A;  4JXG A;  4PM7 A;  2XK1 A;  1GHP A;  3G32 A;  5EOO A;  3UDI A;  4IED A;  2A3U A;  2VGJ A;  2OSU A;  1NZO A;  3IXH A;  3HBR A;  2ZMA A;  3BM6 A;  3FWL A;  5EVL A;  3PBS A;  3ZGA B;  1L0E A;  4KZA A;  4KQQ A;  4LV0 A;  3N8R A;  1NY0 A;  4IBX A;  4R3B A;  4RYE A;  5A90 A;  3VSK A;  4UA9 A;  2Q9N A;  5GL9 A;  5FA7 A;  1O07 A;  2P74 A;  4P85 A;  4ZBE A;  5TFQ A;  3NDG A;  2ZQC A;  4GN2 A;  3WS1 A;  1K54 C;  4JXV A;  2XD5 A;  3Q81 A;  1AXB A;  2XQZ A;  1K55 C;  1W8Q A;  2ZM8 A;  4OPY A;  2ZLY A;  3RXW A;  3ZCZ A;  4EUZ A;  4OPZ A;  3DTM A;  4GOG A;  4R3J A;  4S2J A;  5E2F A;  1G6A A;  5AQ9 A;  4BL3 A;  4X6T A;  5DF9 A;  1DJA A;  3G2Z A;  2IWC A;  5HAR A;  3Q7V A;  1GHI A;  1IEM A;  1XPB A;  4U0X A;  1MPL A;  5AQA A;  1PI5 A;  4DE2 A;  4PM9 A;  2H5S A;  5DF8 A;  3VP1 A;  4BJP A;  4CPK A;  3PBT A;  5EVI A;  4DE0 A;  4FD8 A;  3IH8 A;  4OPR A;  3GQZ A;  4QU3 A;  1XGI A;  1JWP A;  1KVM A;  4K0W A;  4S2N A;  1BT5 A;  1J9M A;  2XD1 A;  4KZ7 A;  5DTT A;  1PWC A;  2Y2Q A;  4JPM A;  4OQH A;  1Q2P A;  2ZC7 A;  3IHA A;  5GLC A;  3HLE A;  4DXB A;  3HLG A;  2J9O A;  1TDL A;  5FQK A;  2ZC4 B;  4B4X A;  3N8S A;  1FCM A;  5EE8 A;  3QNC A;  1H5X A;  3ISG A;  5IHV A;  2WZX A;  4ID4 A;  1KVL A;  3WS4 A;  5FAS A;  5FAO A;  4WMC D;  4E6X A;  5FQ9 A;  3N8L A;  4S2L A;  5EPH A;  1U60 A;  3W8K A;  1FR6 A;  1KGE A;  4HEF A;  2ZM2 A;  4C6Y A;  1MKI A;  3IQA A;  1FSW A;  2EXA A;  2WYX A;  4BLM A;  1L2S A;  2ZQ7 A;  4R0Q A;  1Z6F A;  3M2J A;  4XUZ A;  4X68 A;  3UPN A;  4OVD A;  4S2P A;  5TR7 A;  5KSC A;  2Y2K A;  1E25 A;  3VP4 A;  5FI2 A;  1VQQ A;  3JYI A;  1JVJ A;  2E8I A;  4GDN A;  4DF6 A;  2DRW A;  4N92 A;  1BLS A;  1ERM A;  5G18 A;  3DWZ A;  3VP2 A;  3HLB A;  4EQI A;  2H0T A;  1ZG6 A;  5KMW A;  3NI9 A;  2EX9 A;  1PW1 A;  3IWI A;  5U47 A;  1NZU A;  4RVA A;  2JE5 A;  2Y4A A;  4HES A;  5KZH A;  3UE3 A;  5EVI C;  3M6B A;  3MXS A;  2ZQ8 A;  2UWX A;  2Y55 A;  2X01 A;  4S2N C;  5FQI A;  1K57 A;  3RJU A;  3VOZ A;  4NK3 A;  3BRM A;  5GLD A;  1ES4 A;  1EWZ A;  3IF6 A;  2BLS A;  3G35 A;  3A3F A;  1M6K A;  3UE0 A;  1FCO A;  1CI9 A;  3VP0 A;  1PI4 A;  3G30 A;  1I2S A;  4WEL A;  5FI6 A;  4GD6 A;  2HDS A;  5GLA A;  3Q7V B;  4WZ5 A;  3VFH A;  4BD0 A;  4XUX A;  4MLL A;  1LHY A;  4F94 A;  1CEG A;  3N6I A;  1PWG A;  1Q2Q A;  3PTE A;  1K4F A;  1RGZ A;  3M6H A;  5EVI B;  5FDH A;  4HBU A;  4ZJ3 A;  1IYP A;  3MZE A;  3CMZ A;  3SOI A;  1IYO A;  3OCL A;  4KZ6 A;  5FAQ A;  1LI9 A;  3O3V A;  1W7F A;  2H0Y A;  4GD8 A;  4OQG A;  1BZA A;  5CHM A;  2RCX A;  5GHZ A;  3ZG9 B;  3CG5 A;  5F83 A;  3UO9 A;  2EFX A;  4GNU A;  4QD4 A;  2ZM0 A;  3AGD A;  5A93 A;  1E3U A;  3IXB A;  4Y0U A;  1BTL A;  5CGS A;  3FKW A;  2XLN A;  1ESI A;  4DDY A;  3HUO A;  2FFF B;  1S0W A;  3NCK A;  3NY4 A;  2A49 A;  2C6W B;  3G31 A;  3IH9 A;  1WYB A;  3V50 A;  1OME A;  3BFG A;  1ESU A;  3M2K A;  2EX6 A;  4NET A;  3QNB A;  1DJC A;  3AGE A;  3PAE A;  4R1G A;  3ZFZ A;  3FYZ A;  2JBF A;  2ZC5 B;  3Q07 A;  1HVB A;  4KZ9 A;  3ZVW A;  1KDS A;  1K57 C;  4M3K A;  5FI7 A;  1TDG A;  4IBR A;  3O88 A;  4OH0 A;  1YMS A;  2ZC3 B;  2DNS A;  4JXW A;  3BFD A;  4KEN B;  3TOI A;  4WBG A;  4XXR A;  5GHX A;  1KE4 A;  3Q1F A;  1FCN A;  1PW8 A;  1W8Y A;  1YMX A;  1FOF A;  1YLT A;  4DKI A;  4QY6 A;  1LI0 A;  4WYY A;  3C4O A;  2WZZ A;  1L0D A;  1MWR A;  3NC8 A;  1ONH A;  2X02 A;  2ZJ9 A;  4OPQ A;  3UDF A;  1YLY A;  2HDR A;  1KE0 A;  5E2H A;  2XEP A;  4YFM A;  3HUM A;  5JYO A;  2PBY A;  3I7J A;  1KGF A;  4WZ5 C;  3ZNY A;  3GR2 A;  3VMA A;  1MY8 A;  1SCW A;  1IEL A;  4GB7 A;  4WZ4 A;  4FH2 A;  2R9W A;  3OPR A;  1JWZ A;  2HDU A;  1IKI A;  4KG6 A;  4P87 A;  5EOE A;  4UAA A;  2J8Y A;  4S2O A;  3IF5 A;  5HX9 A;  5L2F A;  5M18 A;  2XF3 A;  4MBH A;  1XGJ A;  3PBR A;  1CK3 A;  4N1H A;  5EUA A;  5FQQ A;  3A3E A;  5F1G A;  2Y2P A;  2QMI A;  2Q9M A;  3BFE A;  3IWQ A;  3IF6 B;  3LEZ A;  3V39 A;  5FQJ A;  4OP8 A;  1NYM A;  1ALQ A;  3BYD A;  1BLH A;  3VP3 A;  3G4P A;  1ES2 A;  2JC7 A;  2Y2M A;  3HLF A;  4LV3 A;  3DWK A;  4YIN A;  2R9X A;  5EEC A;  3W4P A;  4PM6 A;  5DF7 A;  3Q7Z A;  1DJB A;  1CEF A;  4QB8 A;  5A91 A;  4OKP A;  2WKH A;  5FAP A;  5F1F A;  4OON A;  2OLU A;  2G2W A;  4OQI A;  4ZTK A;  3A3D A;  3OPP A;  5GHY A;  3LY4 A;  2WKE A;  4UA6 A;  4RA7 A;  4C3Q A;  4Q8I A;  5CHJ A;  1GCE A;  1MWU A;  3GTC A;  2J7V A;  3S22 A;  4E3I A;  2ZC6 B;  4HBT A;  3UY6 A;  4EV4 A;  4JBF A;  3SS3 A;  5A92 A;  1NXY A;  4DRT A;  3WRZ A;  3EQU A;  4PM8 A;  3HRE A;  3NIA A;  4QHC A;  1ERO A;  3IT9 A;  4OOM A;  1LL9 A;  3HVF A;  1BUE A;  3ZG0 A;  1WE4 A;  2HP9 A;  3MZD A;  4X55 A;  1MWT A;  1PZO A;  5CEC A;  3NDE A;  5M1A A;  4KZB A;  5D3O A;  2J9P A;  3WS2 A;  3ITA A;  1EI5 A;  1K56 A;  5CGX A;  5KSH A;  1I2W A;  3N7W A;  1GHM A;  3V3S A;  5CEB A;  3PAG A;  5TGF A;  3GV9 A;  2Y2I A;  5E2E A;  1ES5 A;  5CED A;  1QMF A;  3MKE A;  1XX2 A;  1FR1 A;  3SH8 A;  4H8R A;  2HP5 A;  4GKU A;  2GDN A;  4BL2 A;  4PM5 A;  4P0M A;  2V2F F;  3E2K A;  4R4R A;  2H10 A;  2ZD8 A;  3DW0 A;  3G2Y A;  4KZ3 A;  1BUL A;  3MKF A;  1N9B A;  1G68 A;  4OQ0 A;  4OLD A;  3UNW A;  5HFO A;  4LCL A;  2DCF A;  2EFU A;  3EQV A;  3G34 A;  1K55 A;  2Y2N A;  2Y2L A;  2XR0 A;  2XH9 A;  3A3I A;  2IWD A;  3IXG A;  5F82 A;  4EWF A;  4N1X A;  1NRF A;  4LV1 A;  5HL1 A;  3LY3 A;  3QHY A;  1VM1 A;  3SH9 A;  3OPH A;  1W79 A;  4WMC A;  5EVI D;  1YLW A;  4WM9 A;  3C4P A;  4DE1 A;  4GZB A;  3GMW A;  5DVA A;  4UA7 A;  1PIO A;  3OZH A;  3SS5 A;  3TSG A;  3FV7 A;  3C7U A;  4JF5 A;  3ZNT A;  1E4D A;  5JYP A;  3BEB A;  4A5R A;  2XGN A;  2Z2M B;  4IVI A;  1C3B A;  4RX3 A;  2HDQ A;  3SS4 A;  2X71 A;  1Y54 A;  1TVF A;  4DE3 A;  4P6B A;  3S4X A;  3ZG7 B;  2PU4 A;  1XA7 A;  1HZO A;  4CJN A;  5HAP A;  1BLP A;  1LLB A;  3IWO A;  1MWS A;  4OLG A;  1FQG A;  5FAT A;  4MBK A;  3BFC A;  4WEJ A;  4R23 A;  1K38 A;  1M40 A;  3GSG A;  3ZHH A;  2CC1 A;  4WEK A;  2Y2O A;  3MFD A;  2Y2G A;  4E3K A;  1JTD A;  2BG1 A;  2Y2H A;  3IF6 C;  2P9V A;  3D4F A;  3FZC A;  1WYC A;  1I5Q A;  4KZ5 A;  4EBL A;  3OCN A;  2XDM A;  4E6W A;  5CHU A;  1ZKJ A;  4O7D A;  5CGW A;  3ITB A;  4UHU A;  2XFT A;  1PYY A;  2WGW A;  5HAQ A;  1GA0 A;  3V3R A;  5CXW A;  3GVB A;  4U3T A;  3LCE A;  3C7V A;  1K4E A;  2WGV A;  4KG2 A;  4X69 A;  1KGG A;  5HAI A;  1K6S A;  1YLJ A;  3S1Y A;  3TG9 A;  5HW3 A;  5FSR A;  1K56 D;  1O7E A;  3WRT A;  1IYS A;  4Y7P A;  2ZQA A;  1MBL A;  1H8Z A;  1YT4 A;  3PBQ A;  4E3M A;  1KE3 A;  2QPN A;  4PPR A;  4KZ4 A;  1RP5 A;  2WAF A;  1HTZ A;  3GRJ A;  5DTK A;  4E3J A;  3ZVT A;  4FH4 A;  3UPO A;  1JWV A;  1PWD A;  1XXM A;  3WS0 A;  3RXX A;  4FCF A;  4ZJ1 A;  2WAD A;  5CTN A;  3HL9 A;  1KDW A;  4JKT A;  4B4Z A;  1GA9 A;  4K0X A;  3BEC A;  4PMA A;  1PZP A;  3UPP A;  5E2G A;  1YLP A;  4MNR A;  3MBZ A;  2Z2L B;  5E43 A;  1BLC A;  3VSL A;  5CER A;  2WKI A;  5I94 A;  3FKV A;  5DTS A;  1TEM A;  3PBO A;  4JLF A;  3VFF A;  3HUN A;  4EBN A;  1H8Y A;  4E3O A;  3ZDJ A;  1SHV A;  2FFY A;  4FSF A;  1YQS A;  3UDX A;  5M19 A;  4QY5 A;  4DDS A;  3V5M A;  2EX2 A;  3O86 A;  2Y91 A;  1NJ4 A;  3BFF A; 
#chains in the Genus database with same CATH topology
 4JF6 A;  1RGY A;  4S2M A;  1NLY A;  4Y0O A;  4WUJ A;  2WAE A;  3C5A A;  2ZQ9 A;  5J8X A;  2KOI A;  3PBN A;  3CPT B;  2PHY A;  3ZG5 A;  2V9A A;  1FSY A;  4EES A;  3ZG8 B;  3DTI A;  3HLW A;  3OC2 A;  3WWX A;  4LCM A;  2EA9 A;  1JTG A;  1K54 A;  1S4R A;  2VGK A;  4S2I A;  3Q82 A;  4ETZ A;  3O5Y A;  4BQM A;  4B88 A;  3LIB A;  2EX8 A;  1ONG A;  4ZJ2 A;  1T18 A;  3AGF A;  2I72 A;  1XA1 A;  2ZBB A;  3P01 A;  4D2O A;  3P09 A;  1ES3 A;  2VJW A;  1P0Z A;  4GDB A;  5FQM A;  1K25 A;  4KQO A;  4O01 A;  2WGI A;  4IVK A;  1X0O A;  1XP4 A;  4PHT A;  4X53 A;  3UB7 A;  2PRF A;  3CIT A;  2B5R A;  5EOO A;  1K0K A;  2A3U A;  1TS0 A;  3IXH A;  3HBR A;  3BM6 A;  1T19 A;  3FWL A;  1L0E A;  3N8R A;  4UA9 A;  2EWV A;  2Q9N A;  4NXG A;  2VK3 A;  1O07 A;  5TFQ A;  4ZBE A;  2W3H A;  3H9W A;  4GN2 A;  3WS1 A;  1H3Q A;  4JXV A;  4RQ9 A;  1AXB A;  2ZM8 A;  4II7 A;  3ZCZ A;  5I5L A;  4EUZ A;  4OPZ A;  2E8J A;  1G6A A;  5AQ9 A;  3IS2 B;  4XT2 B;  1DJA A;  5HAR A;  1GHI A;  1XPB A;  1PI5 A;  3FC7 A;  4PM9 A;  5DF8 A;  5EVI A;  4FD8 A;  4OPR A;  3IH8 A;  3WS2 A;  1KVM A;  4QPR A;  4X1M A;  2CMN A;  4OQH A;  3VV4 A;  2ZC7 A;  2UV0 E;  3HLG A;  3LR0 A;  5EE8 A;  5IHV A;  2ZMF A;  1KVL A;  3WS4 A;  5J4E A;  5FAO A;  4E6X A;  4S2L A;  3T1R A;  3CUE A;  1KGE A;  4BLM A;  3QP2 A;  4X68 A;  2KLI A;  4KQD A;  4OVD A;  1N9L A;  3KYE A;  4IUH A;  1JVJ A;  2E8I A;  2DRW A;  4HJ4 A;  4MMN A;  1ZG6 A;  3NI9 A;  4F3L A;  3UE3 A;  3MXS A;  2ZQ8 A;  2UWX A;  4S2N C;  4NK3 A;  3JVU A;  2WKR A;  5GLD A;  1ES4 A;  2FH5 A;  3F1O A;  3ULF A;  3NHQ A;  3VP0 A;  1PI4 A;  1I2S A;  3OBF A;  2QKP A;  3VFH A;  4MLL A;  1PWG A;  1Q2Q A;  1RGZ A;  4ZJ3 A;  3MZE A;  5HWT A;  3SOI A;  3OCL A;  3IX8 A;  4HH3 A;  5CHM A;  1Y4O A;  1T1A A;  3UO9 A;  4JGO A;  3HUO A;  4EET B;  2FFF B;  1S0W A;  3G31 A;  3NOP C;  2PD7 A;  4NET A;  3QNB A;  4R1G A;  3FYZ A;  2O9B A;  1HVB A;  1KDS A;  1K57 C;  3H82 A;  2O99 A;  4IBR A;  4JXW A;  4CLC A;  3E98 A;  4WBG A;  3UB5 P;  3LYX A;  1FOF A;  3EOI A;  3C4O A;  5F68 A;  2X02 A;  2ZJ9 A;  2HDR A;  3HUM A;  1P9R A;  4WZ5 C;  4BBU A;  1IEL A;  3LUQ A;  4WZ4 A;  4AFI A;  2R9W A;  4UQI M;  2B95 A;  2J8Y A;  2KDK A;  5HX9 A;  2XF3 A;  1FIL A;  2Y2P A;  3BFE A;  3V39 A;  2ZOH A;  4LGW A;  5HDD A;  3VE4 A;  4PM6 A;  3Q7Z A;  1CEF A;  5A91 A;  4OKP A;  4LRZ E;  2H28 A;  5FAP A;  2G2W A;  1SKO A;  4Q8I A;  5CHJ A;  2ZMV A;  3GTC A;  1IFQ A;  3T4Q A;  3UY6 A;  4JBF A;  4DRT A;  3LIA A;  2J3T C;  1OTA A;  1LSX A;  3K3C A;  3HVF A;  4X55 A;  3VE3 A;  4LPZ A;  4KZB A;  2J9P A;  3ITA A;  2VX8 A;  5KSH A;  3JPU A;  5CEB A;  4GHI A;  3PAG A;  5TGF A;  5CED A;  5E2E A;  3E0Y A;  3SH8 A;  1W63 Q;  4R4R A;  2H10 A;  2V0U A;  3G2Y A;  4KZ3 A;  1G68 A;  4Q0J A;  2DCF A;  3EQV A;  3S7N A;  2XRO A;  1K55 A;  4YWZ A;  2XR0 A;  2IWD A;  4EWF A;  3MS6 A;  1NRF A;  3LY3 A;  3QHY A;  4WM9 A;  3C4P A;  4GZB A;  2VV8 A;  4UA7 A;  3LR3 A;  3OZH A;  3KYQ A;  3V67 A;  4O0P A;  4A5R A;  2XGN A;  4IVI A;  1C3B A;  2HDQ A;  3LIE A;  5IS1 A;  3D3O A;  1UWP X;  3MMH A;  4OLG A;  1K38 A;  1M40 A;  3GSG A;  1BYW A;  2P9V A;  3D4F A;  1WYC A;  5KIZ A;  5CGW A;  4Q0H A;  2XFT A;  5HPI A;  3GVB A;  3EWK A;  1KGG A;  5HAI A;  1K56 D;  2OAQ 1;  5F6A A;  3GDI A;  1V9Y A;  1IYS A;  1MBL A;  4DJ3 A;  2QPN A;  5EVE A;  4PPR A;  2PYR A;  3GRJ A;  4FH4 A;  1JWV A;  1PWD A;  2WAD A;  5CTN A;  1KDW A;  4JKT A;  1GA9 A;  4P6Z S;  1S1Z A;  2PDR A;  3VSL A;  5I94 A;  5DJT A;  3FKV A;  1TEM A;  3VFF A;  3HUN A;  2QHK A;  2EWW A;  4E3O A;  2A24 A;  4DDS A;  2Y91 A;  1YM1 A;  2HJE A;  4Z1W A;  4JXS A;  2EXB A;  2V20 A;  3CJM A;  3EEA A;  3L7H A;  3TW8 A;  3FG8 A;  1CQA A;  1K6R A;  5CRF A;  3BLM A;  2OV5 A;  1MXO A;  4KG5 A;  1YLZ A;  1MC0 A;  2V1Z A;  1N4O A;  1OPX A;  2C5W B;  2QYB A;  4S2K A;  2JCH A;  1J3W A;  1L0F A;  4MBF A;  3LGO A;  3MZF A;  2WUQ A;  2QZ6 A;  3IBJ A;  5DKL A;  2G2U A;  3WS5 A;  4KZ8 A;  3HLD A;  4LEN A;  2WGW B;  2WK0 A;  4KQR A;  3OPL A;  1SDE A;  4C75 A;  4Y0T A;  2HPB A;  1SDN A;  3SH7 A;  1YPR A;  2P7J A;  4OOL A;  4ETX A;  1IOU A;  5IT5 A;  1IKG A;  1SKF A;  4ZAM A;  4OP5 A;  4MEZ A;  5HL6 A;  3O87 A;  4HJ6 A;  3UB8 A;  4QJG A;  1TS6 A;  3VOY A;  2RL3 A;  2XRN A;  2Y59 A;  2AVX A;  2PR6 A;  1HD8 A;  4L0L A;  2IWB A;  2PU2 A;  3HJK A;  1VET B;  1XKZ A;  3CZD A;  4K91 A;  3IHB A;  3RTY A;  3H7W A;  4PM7 A;  3UDI A;  5EFW A;  2ZMA A;  5TBM A;  2IA2 A;  2O9C A;  4LV0 A;  4IBX A;  2VA0 A;  4RYE A;  5A90 A;  3VSK A;  5GL9 A;  4P85 A;  4ME4 A;  2XD5 A;  3KX0 X;  5G4Y A;  1K55 C;  3IBR A;  3T4S A;  4EUV A;  3DTM A;  2QJ7 A;  3Q7V A;  3F1N A;  4LFU A;  1MPL A;  4HNB A;  3T12 B;  3C8C A;  4BJP A;  4CPK A;  3LEQ A;  1ZHH B;  2PT7 A;  3PBT A;  3QP1 A;  3GQZ A;  4K0W A;  1JWP A;  4S2N A;  1D06 A;  1J9M A;  4KZ7 A;  2Y2Q A;  4JPM A;  2Y79 A;  1Q2P A;  5GLC A;  3HLE A;  4DXB A;  2J9O A;  1TDL A;  5L8M A;  1FCM A;  2WZX A;  4BBT A;  5FQ9 A;  5EPH A;  1ACF A;  4HEF A;  4C6Y A;  4YOF A;  1MKI A;  2WYX A;  2ZOI A;  3U4L P;  4X1L A;  3DAV A;  1TS8 A;  3QP5 A;  3UPN A;  5TR7 A;  4ZRR A;  4GS9 A;  1E25 A;  2V1B A;  1G5U A;  5HSQ A;  2W1T A;  4N92 A;  1ERM A;  3VP2 A;  2VGL M;  2J3W A;  1PW1 A;  2LB9 A;  3IWI A;  1NRJ A;  2Y4A A;  5KZH A;  3M6B A;  3PR6 A;  1JNU A;  5FQI A;  1K57 A;  3T1S A;  4WL9 A;  2FZ0 A;  5TJJ A;  3LIF A;  4WZ5 A;  4XUX A;  1TF1 A;  1LHY A;  1N9O A;  1CEG A;  3N6I A;  5EVI B;  1K4F A;  2K7S A;  1IYP A;  1IYO A;  4YNR A;  3O3V A;  4DMZ A;  5F83 A;  2EFX A;  4Y3I A;  2PAV P;  3AGD A;  4IJG A;  5A93 A;  5CGS A;  1BTL A;  1ESI A;  2GX5 A;  1WYB A;  4R38 A;  3V50 A;  3F1P A;  1ESU A;  3M2K A;  1DJC A;  3AGE A;  3MQO A;  3C2W A;  3ZFZ A;  1XJ3 A;  1F9I A;  3LFV A;  2W1R A;  1TDG A;  4OH0 A;  2ZC3 B;  2DNS A;  5GHX A;  4DKI A;  1FCN A;  1YMX A;  1YLT A;  4NG2 A;  2XSS A;  5L10 A;  1MWR A;  3UDF A;  1YLY A;  2XEP A;  5JYO A;  3I7J A;  1KGF A;  1VEU A;  3VMA A;  3LR5 A;  1SCW A;  3OPR A;  2YKF A;  4G3W A;  4P87 A;  4F3L B;  5EOE A;  4UAA A;  2V1A A;  4MBH A;  4N1H A;  5EUA A;  3F1O B;  2Q9M A;  2HZ5 A;  5DFX A;  2HGV A;  5FQJ A;  4OP8 A;  3VP3 A;  3HLF A;  1OJG A;  4YIN A;  4PKY G;  5K5B A;  3JVV A;  2WKH A;  2OLU A;  4OQI A;  2WKE A;  3E4Q A;  2BAS A;  1MWU A;  2HJ9 C;  3S22 A;  4E3I A;  4EV4 A;  3SS3 A;  2O0Y A;  3B47 A;  4PM8 A;  3HRE A;  5EV0 A;  5C5K A;  5HDC A;  5CEC A;  1LL8 A;  3A0V A;  2MJ6 A;  5D3O A;  1EI5 A;  3KSI A;  3N7W A;  4NXB A;  4EER A;  3GV9 A;  1XX2 A;  3H82 B;  1OTE A;  2GDN A;  4BL2 A;  4CLC B;  3E2K A;  1DP9 A;  3DW0 A;  3LID A;  5HFO A;  3CLO A;  2NUP C;  3T4J A;  3A3I A;  2XH9 A;  5F82 A;  3IXG A;  5F5Y A;  1VM1 A;  4HHD A;  4HI4 A;  2YKH A;  1PIO A;  3FPW A;  3SS5 A;  3S7O A;  1E4D A;  4GW9 A;  3SS4 A;  2X71 A;  4DE3 A;  3ZG7 B;  2PU4 A;  1HZO A;  5DJU A;  5EM1 A;  4MBK A;  3BFC A;  4R23 A;  1SKO B;  4E3K A;  2ZL1 B;  2Y2H A;  1I5Q A;  4KZ5 A;  3TE8 A;  4O8G A;  3OCN A;  4LLO B;  4JGQ A;  5CHU A;  1ZKJ A;  3ITB A;  4WN5 A;  4X69 A;  3MXQ A;  2JKR M;  4GHI B;  3WRT A;  1H8Z A;  4E3M A;  1KE3 A;  4PKY A;  1RP5 A;  2WAF A;  2JKT M;  3ZVT A;  1XXM A;  1OT9 A;  4FCF A;  4ZJ1 A;  3HL9 A;  2GNX A;  5J3W A;  4WF0 A;  2J80 A;  3MF0 A;  5E2G A;  1YLP A;  3EGX C;  3MBZ A;  3KYZ A;  5E43 A;  5CER A;  2WKI A;  1H0M A;  5DTS A;  1H8Y A;  2FFY A;  3UDX A;  2D01 A;  3UMD A;  3BFF A;  2HV1 A;  3S7P A;  4CLC E;  2P08 A;  2HP6 A;  1IYQ A;  1F5M A;  5A8B A;  4EQ1 A;  1NYY A;  3W4O A;  2A2L A;  1L0G A;  4N9L A;  4OOY A;  4EBP A;  1ERQ A;  2V8F A;  4U0T A;  3D9Y A;  1UWN X;  3IXD A;  2P9V B;  4Z9Q A;  4HY8 A;  3EEH A;  4E3L A;  4BD1 A;  1S66 L;  4H6J B;  2L4R A;  3T4T A;  4PAU A;  1ZG4 A;  4UQI S;  3A3J A;  4LV2 A;  1ZC2 A;  2QJ5 A;  3ICY A;  3PHY A;  5AQB A;  4Y15 A;  3UE1 A;  3LR4 A;  3UN7 A;  5HZH A;  4N9K A;  2XFS A;  1V9Z A;  3NBL A;  5AQ7 A;  2V0W A;  2PBD P;  1W5D A;  1ZTU A;  4E3N A;  3T4K A;  1G6O A;  1CJF A;  4I3I A;  2INW A;  3CAX A;  3B3X A;  1RCJ A;  4JF4 A;  2ZQD A;  1BSG A;  2VV6 A;  5GLB A;  5LBR A;  1QME A;  4JXG A;  2XK1 A;  4HH2 A;  2A24 B;  2OSU A;  1NZO A;  1STZ A;  5EVL A;  2JN7 A;  3PBS A;  3ZGA B;  4KQQ A;  1NY0 A;  4R3B A;  5FA7 A;  3NDG A;  2OAP 1;  4NXE A;  1W8Q A;  2ZLY A;  3S7Q A;  2PYP A;  4R3J A;  4S2J A;  5E2F A;  4D60 A;  4BL3 A;  4X6T A;  5DF9 A;  1IEM A;  4U0X A;  5AQA A;  4DE2 A;  4HQA A;  1Y28 A;  3VP1 A;  3TRC A;  1OTI A;  3NEC A;  4DE0 A;  4HP4 A;  2I9V A;  3CWF A;  4QU3 A;  1XGI A;  2R78 A;  1BT5 A;  5DTT A;  5FQK A;  4B4X A;  3N8S A;  1EW0 A;  4ID4 A;  5FAS A;  4WMC D;  4BBV A;  3N8L A;  4LRX C;  3R7W A;  3W2Z A;  1FR6 A;  1L3L A;  2ZM2 A;  3IQA A;  1TD5 A;  3NUL A;  2EXA A;  1L2S A;  3M2J A;  4EEP A;  4S2P A;  2Y2K A;  3T4L A;  3VP4 A;  5FI2 A;  4GDN A;  4DF6 A;  2Y8H A;  1WA9 A;  3H7W B;  1NLZ A;  1BLS A;  4Y13 A;  5DFY A;  4EQI A;  5KMW A;  2EX9 A;  1NZU A;  5TBM B;  2JE5 A;  4HES A;  2X01 A;  2VLG A;  3RJU A;  3VOZ A;  4EW7 A;  3BRM A;  2XA7 M;  1EWZ A;  3IF6 A;  2BLS A;  3A3F A;  1M6K A;  3UE0 A;  1CI9 A;  3ZQ5 A;  3G30 A;  4WEL A;  5FI6 A;  4NXF A;  5GLA A;  3Q7V B;  3F1N B;  1XJ4 A;  4BD0 A;  3PTE A;  3E4P A;  5FDH A;  4HBU A;  4IUK A;  5CX7 A;  4OQG A;  1W7F A;  3ZG9 B;  5GHZ A;  5HPF A;  2RCX A;  4GNU A;  4QD4 A;  2ZM0 A;  4I39 A;  3K2N A;  3IXB A;  1S1Y A;  2XLN A;  4DDY A;  3P7N A;  2A49 A;  2W0N A;  2C6W B;  3IH9 A;  2OWH A;  4GCZ A;  1OME A;  2EX6 A;  3PAE A;  2ZC5 B;  3ZVW A;  1P97 A;  5FI7 A;  3O88 A;  1YMS A;  3BFD A;  4KEN B;  4XXR A;  3HCY A;  4GS9 B;  1KE4 A;  1PW8 A;  2JKG A;  1S67 L;  2WZZ A;  4OPQ A;  3NC8 A;  4B9O A;  2W1T B;  3L9K A;  1ODV A;  2PBY A;  1F98 A;  4FUW A;  3QP8 A;  3ZNY A;  1KOU A;  4FH2 A;  1JWZ A;  4KG6 A;  3A0S A;  4S2O A;  2O9A A;  1XGJ A;  5FQQ A;  1PRQ A;  1NYM A;  1BLH A;  2R9X A;  5AJG A;  2W3D A;  5EEC A;  3W4P A;  1DJB A;  4QB8 A;  4ZTK A;  3A3D A;  3OPP A;  4UA6 A;  2M7U A;  1GCE A;  2J7V A;  4G3V A;  2ZC6 B;  4EEU A;  4KUK A;  1NXY A;  1DP6 A;  3SZT A;  3WRZ A;  3NIA A;  4QHC A;  3MFX A;  2NUT C;  2B18 A;  1XFN A;  1BUE A;  3ZG0 A;  2GZA A;  1WE4 A;  4ARZ A;  3MZD A;  2WKQ A;  5M1A A;  2W3E A;  3OOV A;  3T1Q B;  1K56 A;  3F1P B;  5CGX A;  1I2W A;  4HIA A;  2Y2I A;  1ES5 A;  4E04 A;  3MKE A;  4QWO A;  1FR1 A;  4H8R A;  2HP5 A;  4P0M A;  3BQA A;  1YAX A;  4CLC D;  4OQ0 A;  5AVF A;  4OLD A;  3U2A A;  3G34 A;  2Y2N A;  1VEU B;  3SH9 A;  5MC7 A;  3OPH A;  1W79 A;  4WMC A;  1YLW A;  4DE1 A;  2M7V A;  5DVA A;  1GSV A;  3BW6 A;  3C7U A;  3FV7 A;  3ZNT A;  3BEB A;  1PFL A;  1Y54 A;  3S4X A;  4CJN A;  4BMW A;  1D7E A;  1BLP A;  3IWO A;  1FQG A;  3CPT A;  4WEJ A;  3ZHH A;  2CC1 A;  4WEK A;  2Y2O A;  2PD8 A;  2Y2G A;  3MFD A;  5HD5 A;  2BG1 A;  3HJI A;  3IF6 C;  4HOI A;  2VGL S;  4E6W A;  4EXO A;  1LSV A;  5FEF A;  3VOL A;  4UHU A;  3MQ0 A;  1GA0 A;  4U3T A;  3C7V A;  1GSW A;  1YKD A;  3S1Y A;  3BWL A;  5FSR A;  4Y7P A;  1YT4 A;  3PBQ A;  4M4X A;  3CHW P;  4KZ4 A;  3BQ8 A;  4E3J A;  5DTK A;  3A0R A;  4K0X A;  4PMA A;  3NJA A;  1PZP A;  1MZU A;  4MNR A;  2Z2L B;  1OJ5 A;  5HDS A;  1BLC A;  3PBO A;  4JLF A;  4EBN A;  1SHV A;  4FSF A;  2W3F A;  1LT0 A;  4QY5 A;  1VB6 A;  2EX2 A;  4BEN A;  1NJ4 A;  3SW1 A;  4FTX A;  3MXR A;  3LO7 A;  1CI8 A;  1E3U D;  3ZYT A;  3NOT C;  5CTM A;  4ZDX A;  2D02 A;  5HD3 A;  3B33 A;  3IS2 A;  3N4I A;  5BOH A;  4XT2 A;  4DXC A;  2WKP A;  4BWI A;  5HWW A;  2OLV A;  4X25 A;  1T1C A;  3W4Q A;  4X56 A;  3QP6 A;  3E2L A;  1XJ6 A;  1DY6 A;  2Y2J A;  3MR0 A;  1DRM A;  4RX2 A;  3P98 A;  3KSG A;  3UB6 A;  1LSW A;  4DN0 A;  4MN7 A;  4R6L A;  4HJ3 A;  3HLC A;  4R4S A;  2VKS A;  3DTK A;  3BLS A;  1S6R A;  1LL5 A;  1TS7 A;  1GHP A;  3G32 A;  4IED A;  2VGJ A;  4KZA A;  4JGP A;  4IHQ A;  2P74 A;  2ZQC A;  1K54 C;  1OT6 A;  4MN5 A;  3Q81 A;  2OWJ A;  2XQZ A;  4OPY A;  1AWI A;  3RXW A;  3C30 A;  3MSH A;  4GOG A;  3G2Z A;  2IWC A;  2Z6C A;  2VEA A;  1YSP A;  2H5S A;  3PYP A;  3KO6 A;  2JHE A;  1W63 M;  2XD1 A;  1F2K A;  1PWC A;  4I38 A;  3IHA A;  3T4O A;  4GJ4 A;  2ZC4 B;  3QNC A;  1H5X A;  2GJ3 A;  3ISG A;  3BY9 A;  3LIC A;  3UE6 A;  1U60 A;  3W8K A;  2K31 A;  4L9E A;  4ESP A;  1FSW A;  2ZQ7 A;  4R0Q A;  2QWS A;  3RFB A;  1Z6F A;  2PR5 A;  4XUZ A;  2ZL1 A;  5KSC A;  1H8M A;  4R70 A;  3LI8 A;  1VQQ A;  3JYI A;  4MN6 A;  5G18 A;  3DWZ A;  3HLB A;  2H0T A;  4G3K A;  5U47 A;  4Y17 A;  4RVA A;  2W3G A;  5EVI C;  3CI6 A;  2Y55 A;  5HWV A;  2L1M A;  3G35 A;  1FCO A;  4DJ2 A;  3K3D A;  3UME A;  4GD6 A;  4EU0 A;  2HDS A;  2G7U A;  4MCW A;  1VHM A;  1S4S A;  3CUE C;  2JKR I;  2B02 A;  4F94 A;  4P6Z M;  3QP4 A;  3M6H A;  3CMZ A;  4KZ6 A;  5FAQ A;  1LI9 A;  2H0Y A;  2JKT I;  4GD8 A;  1BZA A;  3CG5 A;  1E3U A;  4Y0U A;  3FKW A;  2Z6D A;  5DKK A;  2BTF P;  1N9N A;  3KSH A;  3NY4 A;  3NCK A;  3R7W B;  3BFG A;  1DP8 A;  2JKF A;  5L07 A;  1A0K A;  3Q07 A;  2JBF A;  4KZ9 A;  2Q0O A;  4JGR A;  4M3K A;  3TOI A;  3Q1F A;  1W8Y A;  3C38 A;  4NKP A;  4MDZ A;  4QY6 A;  1LI0 A;  4WYY A;  4H6J A;  1L0D A;  1ONH A;  4WLA A;  1KE0 A;  5F69 A;  5E2H A;  3T50 A;  4YFM A;  3GR2 A;  1MY8 A;  2DMW A;  1XFQ A;  4GB7 A;  3R4K A;  4I3A A;  2M1C A;  2HDU A;  1IKI A;  2P04 A;  3IF5 A;  3LI9 A;  5L2F A;  5M18 A;  3PBR A;  1CK3 A;  3MQQ A;  3A3E A;  5F1G A;  2VV7 A;  2QMI A;  3IWQ A;  3IF6 B;  3LEZ A;  1ALQ A;  3BYD A;  3G4P A;  1ES2 A;  2JC7 A;  2Y2M A;  5J7E A;  1SZV A;  1OTB A;  3DWK A;  4LV3 A;  2ACG A;  2VZW A;  5DF7 A;  2K2N A;  5F1F A;  1T1B A;  4OON A;  5GHY A;  3LY4 A;  2HF6 A;  4RA7 A;  4Y5F A;  4C3Q A;  3IX3 A;  2LB5 A;  4HBT A;  5A92 A;  3EGD C;  3EQU A;  4CLC C;  1ERO A;  3IT9 A;  4OOM A;  1LL9 A;  2HP9 A;  3T1X A;  1MWT A;  1PZO A;  4R3A A;  3NDE A;  2V8C A;  5FEG A;  4KUO A;  3V3S A;  1GHM A;  3DBA A;  1P9W A;  1QMF A;  2L0W A;  3DTE A;  5EM0 A;  4L9F A;  4GKU A;  4PM5 A;  4Y2F A;  2V2F F;  4NEE D;  4B93 A;  2ZD8 A;  3D72 A;  1BUL A;  3MKF A;  1N9B A;  2J3T D;  2W27 A;  3UNW A;  4I3J A;  4LCL A;  3NOU C;  2EFU A;  1Z09 A;  4I5S A;  1UGU A;  2Y2L A;  3PXP A;  5AVE A;  4N1X A;  4LV1 A;  5HL1 A;  5EVI D;  3IX4 A;  5G4Z A;  3GMW A;  4L9G A;  4CQH A;  3TSG A;  4JF5 A;  5JYP A;  4GLQ A;  2Z2M B;  4RX3 A;  5FDS A;  1TVF A;  4P6B A;  1XA7 A;  3GEC A;  5HAP A;  1LLB A;  1MWS A;  5FAT A;  4LRY C;  3BY8 A;  1XJ2 A;  1JTD A;  3BJN A;  5L09 A;  3FZC A;  1G28 A;  4Q0I A;  4EBL A;  3G6O A;  2XDM A;  3FPV A;  4O7D A;  1YSQ A;  4ARZ B;  4UEY A;  3B42 A;  1PYY A;  2WGW A;  5HAQ A;  1MKM A;  5CXW A;  3V3R A;  1GSX A;  3LCE A;  4KG2 A;  1K4E A;  2WGV A;  4K08 A;  2KX6 A;  2XA7 S;  3UB9 A;  1K6S A;  3TJZ C;  1YLJ A;  5FL3 A;  2OOL A;  3TG9 A;  5HW3 A;  5IU1 A;  1O7E A;  3MJQ A;  1FIK A;  2ZQA A;  4HP9 A;  1HTZ A;  3UPO A;  3OLO A;  3WS0 A;  3RXX A;  1CF0 A;  1D1J A;  4B4Z A;  3E4O A;  1OTD A;  3BEC A;  3UPP A;  1VET A;  3KSF A;  1PNE A;  4FOF A;  3ZDJ A;  1NWZ A;  1HLU P;  1YQS A;  5M19 A;  3RH8 B;  3V5M A;  3O86 A; 
#chains in the Genus database with same CATH homology
 3MXR A;  1YM1 A;  3LO7 A;  4JF6 A;  1CI8 A;  1RGY A;  1E3U D;  4S2M A;  2HP6 A;  4JXS A;  4Y0O A;  1IYQ A;  5CTM A;  2EXB A;  2V20 A;  3CJM A;  4ZDX A;  1NYY A;  3W4O A;  2WAE A;  3C5A A;  1K6R A;  1L0G A;  2ZQ9 A;  5CRF A;  5J8X A;  4N9L A;  3BLM A;  4OOY A;  3N4I A;  5BOH A;  4EBP A;  3PBN A;  2OV5 A;  4DXC A;  3ZG5 A;  1ERQ A;  4U0T A;  1MXO A;  4KG5 A;  1FSY A;  1YLZ A;  2V1Z A;  1N4O A;  3ZG8 B;  3IXD A;  3HLW A;  2C5W B;  4S2K A;  2JCH A;  2OLV A;  2P9V B;  1L0F A;  4Z9Q A;  3OC2 A;  4E3L A;  4MBF A;  3WWX A;  4BD1 A;  4LCM A;  3MZF A;  2WUQ A;  2QZ6 A;  1JTG A;  1K54 A;  2G2U A;  3WS5 A;  4KZ8 A;  2VGK A;  3HLD A;  4BEN A;  4S2I A;  3W4Q A;  1ZG4 A;  4X56 A;  4LEN A;  2WGW B;  2WK0 A;  3E2L A;  3Q82 A;  3OPL A;  1SDE A;  4KQR A;  4C75 A;  4Y0T A;  3A3J A;  4LV2 A;  1DY6 A;  1ZC2 A;  4B88 A;  4BQM A;  2HPB A;  1SDN A;  2Y2J A;  2EX8 A;  1ONG A;  3SH7 A;  4ZJ2 A;  5AQB A;  3UE1 A;  4OOL A;  3AGF A;  3UN7 A;  2I72 A;  1XA1 A;  4N9K A;  1IKG A;  1SKF A;  4ZAM A;  4OP5 A;  4D2O A;  2XFS A;  3NBL A;  3P09 A;  5AQ7 A;  4MEZ A;  1ES3 A;  4RX2 A;  3O87 A;  3P98 A;  4GDB A;  5FQM A;  4QJG A;  3VOY A;  1K25 A;  4KQO A;  1W5D A;  4E3N A;  2RL3 A;  2Y59 A;  1HD8 A;  4L0L A;  2WGI A;  4IVK A;  2IWB A;  3B3X A;  1XP4 A;  2PU2 A;  1RCJ A;  4JF4 A;  4X53 A;  2ZQD A;  1BSG A;  3HLC A;  1XKZ A;  3CZD A;  4K91 A;  4R4S A;  3BLS A;  5GLB A;  3IHB A;  1S6R A;  1LL5 A;  2B5R A;  1QME A;  4JXG A;  4PM7 A;  2XK1 A;  1GHP A;  3G32 A;  5EOO A;  3UDI A;  4IED A;  2A3U A;  2VGJ A;  2OSU A;  1NZO A;  3IXH A;  3HBR A;  2ZMA A;  3BM6 A;  3FWL A;  5EVL A;  3PBS A;  3ZGA B;  1L0E A;  4KZA A;  4KQQ A;  4LV0 A;  3N8R A;  1NY0 A;  4IBX A;  4R3B A;  4RYE A;  5A90 A;  3VSK A;  4UA9 A;  2Q9N A;  5GL9 A;  5FA7 A;  1O07 A;  2P74 A;  4P85 A;  4ZBE A;  5TFQ A;  3NDG A;  2ZQC A;  4GN2 A;  3WS1 A;  1K54 C;  4JXV A;  2XD5 A;  3Q81 A;  1AXB A;  2XQZ A;  1K55 C;  1W8Q A;  2ZM8 A;  4OPY A;  2ZLY A;  3RXW A;  3ZCZ A;  4EUZ A;  4OPZ A;  3DTM A;  4GOG A;  4R3J A;  4S2J A;  5E2F A;  1G6A A;  5AQ9 A;  4BL3 A;  4X6T A;  5DF9 A;  1DJA A;  3G2Z A;  2IWC A;  5HAR A;  3Q7V A;  1GHI A;  1IEM A;  1XPB A;  4U0X A;  1MPL A;  5AQA A;  1PI5 A;  4DE2 A;  4PM9 A;  2H5S A;  5DF8 A;  3VP1 A;  4BJP A;  4CPK A;  3PBT A;  5EVI A;  4DE0 A;  4FD8 A;  3IH8 A;  4OPR A;  3GQZ A;  4QU3 A;  1XGI A;  1JWP A;  1KVM A;  4K0W A;  4S2N A;  1BT5 A;  1J9M A;  2XD1 A;  4KZ7 A;  5DTT A;  1PWC A;  2Y2Q A;  4JPM A;  4OQH A;  1Q2P A;  2ZC7 A;  3IHA A;  5GLC A;  3HLE A;  4DXB A;  3HLG A;  2J9O A;  1TDL A;  5FQK A;  2ZC4 B;  4B4X A;  3N8S A;  1FCM A;  5EE8 A;  3QNC A;  1H5X A;  3ISG A;  5IHV A;  2WZX A;  4ID4 A;  1KVL A;  3WS4 A;  5FAS A;  5FAO A;  4WMC D;  4E6X A;  5FQ9 A;  3N8L A;  4S2L A;  5EPH A;  1U60 A;  3W8K A;  1FR6 A;  1KGE A;  4HEF A;  2ZM2 A;  4C6Y A;  1MKI A;  3IQA A;  1FSW A;  2EXA A;  2WYX A;  4BLM A;  1L2S A;  2ZQ7 A;  4R0Q A;  1Z6F A;  3M2J A;  4XUZ A;  4X68 A;  3UPN A;  4OVD A;  4S2P A;  5TR7 A;  5KSC A;  2Y2K A;  1E25 A;  3VP4 A;  5FI2 A;  1VQQ A;  3JYI A;  1JVJ A;  2E8I A;  4GDN A;  4DF6 A;  2DRW A;  4N92 A;  1BLS A;  1ERM A;  5G18 A;  3DWZ A;  3VP2 A;  3HLB A;  4EQI A;  2H0T A;  1ZG6 A;  5KMW A;  3NI9 A;  2EX9 A;  1PW1 A;  3IWI A;  5U47 A;  1NZU A;  4RVA A;  2JE5 A;  2Y4A A;  4HES A;  5KZH A;  3UE3 A;  5EVI C;  3M6B A;  3MXS A;  2ZQ8 A;  2UWX A;  2Y55 A;  2X01 A;  4S2N C;  5FQI A;  1K57 A;  3RJU A;  3VOZ A;  4NK3 A;  3BRM A;  5GLD A;  1ES4 A;  1EWZ A;  3IF6 A;  2BLS A;  3G35 A;  3A3F A;  1M6K A;  3UE0 A;  1FCO A;  1CI9 A;  3VP0 A;  1PI4 A;  3G30 A;  1I2S A;  4WEL A;  5FI6 A;  4GD6 A;  2HDS A;  5GLA A;  3Q7V B;  4WZ5 A;  3VFH A;  4BD0 A;  4XUX A;  4MLL A;  1LHY A;  4F94 A;  1CEG A;  3N6I A;  1PWG A;  1Q2Q A;  3PTE A;  1K4F A;  1RGZ A;  3M6H A;  5EVI B;  5FDH A;  4HBU A;  4ZJ3 A;  1IYP A;  3MZE A;  3CMZ A;  3SOI A;  1IYO A;  3OCL A;  4KZ6 A;  5FAQ A;  1LI9 A;  3O3V A;  1W7F A;  2H0Y A;  4GD8 A;  4OQG A;  1BZA A;  5CHM A;  2RCX A;  5GHZ A;  3ZG9 B;  3CG5 A;  5F83 A;  3UO9 A;  2EFX A;  4GNU A;  4QD4 A;  2ZM0 A;  3AGD A;  5A93 A;  1E3U A;  3IXB A;  4Y0U A;  1BTL A;  5CGS A;  3FKW A;  2XLN A;  1ESI A;  4DDY A;  3HUO A;  2FFF B;  1S0W A;  3NCK A;  3NY4 A;  2A49 A;  2C6W B;  3G31 A;  3IH9 A;  1WYB A;  3V50 A;  1OME A;  3BFG A;  1ESU A;  3M2K A;  2EX6 A;  4NET A;  3QNB A;  1DJC A;  3AGE A;  3PAE A;  4R1G A;  3ZFZ A;  3FYZ A;  2JBF A;  2ZC5 B;  3Q07 A;  1HVB A;  4KZ9 A;  3ZVW A;  1KDS A;  1K57 C;  4M3K A;  5FI7 A;  1TDG A;  4IBR A;  3O88 A;  4OH0 A;  1YMS A;  2ZC3 B;  2DNS A;  4JXW A;  3BFD A;  4KEN B;  3TOI A;  4WBG A;  4XXR A;  5GHX A;  1KE4 A;  3Q1F A;  1FCN A;  1PW8 A;  1W8Y A;  1YMX A;  1FOF A;  1YLT A;  4DKI A;  4QY6 A;  1LI0 A;  4WYY A;  3C4O A;  2WZZ A;  1L0D A;  1MWR A;  3NC8 A;  1ONH A;  2X02 A;  2ZJ9 A;  4OPQ A;  3UDF A;  1YLY A;  2HDR A;  1KE0 A;  5E2H A;  2XEP A;  4YFM A;  3HUM A;  5JYO A;  2PBY A;  3I7J A;  1KGF A;  4WZ5 C;  3ZNY A;  3GR2 A;  3VMA A;  1MY8 A;  1SCW A;  1IEL A;  4GB7 A;  4WZ4 A;  4FH2 A;  2R9W A;  3OPR A;  1JWZ A;  2HDU A;  1IKI A;  4KG6 A;  4P87 A;  5EOE A;  4UAA A;  2J8Y A;  4S2O A;  3IF5 A;  5HX9 A;  5L2F A;  5M18 A;  2XF3 A;  4MBH A;  1XGJ A;  3PBR A;  1CK3 A;  4N1H A;  5EUA A;  5FQQ A;  3A3E A;  5F1G A;  2Y2P A;  2QMI A;  2Q9M A;  3BFE A;  3IWQ A;  3IF6 B;  3LEZ A;  3V39 A;  5FQJ A;  4OP8 A;  1NYM A;  1ALQ A;  3BYD A;  1BLH A;  3VP3 A;  3G4P A;  1ES2 A;  2JC7 A;  2Y2M A;  3HLF A;  4LV3 A;  3DWK A;  4YIN A;  2R9X A;  5EEC A;  3W4P A;  4PM6 A;  5DF7 A;  3Q7Z A;  1DJB A;  1CEF A;  4QB8 A;  5A91 A;  4OKP A;  2WKH A;  5FAP A;  5F1F A;  4OON A;  2OLU A;  2G2W A;  4OQI A;  4ZTK A;  3A3D A;  3OPP A;  5GHY A;  3LY4 A;  2WKE A;  4UA6 A;  4RA7 A;  4C3Q A;  4Q8I A;  5CHJ A;  1GCE A;  1MWU A;  3GTC A;  2J7V A;  3S22 A;  4E3I A;  2ZC6 B;  4HBT A;  3UY6 A;  4EV4 A;  4JBF A;  3SS3 A;  5A92 A;  1NXY A;  4DRT A;  3WRZ A;  3EQU A;  4PM8 A;  3HRE A;  3NIA A;  4QHC A;  1ERO A;  3IT9 A;  4OOM A;  1LL9 A;  3HVF A;  1BUE A;  3ZG0 A;  1WE4 A;  2HP9 A;  3MZD A;  4X55 A;  1MWT A;  1PZO A;  5CEC A;  3NDE A;  5M1A A;  4KZB A;  5D3O A;  2J9P A;  3WS2 A;  3ITA A;  1EI5 A;  1K56 A;  5CGX A;  5KSH A;  1I2W A;  3N7W A;  1GHM A;  3V3S A;  5CEB A;  3PAG A;  5TGF A;  3GV9 A;  2Y2I A;  5E2E A;  1ES5 A;  5CED A;  1QMF A;  3MKE A;  1XX2 A;  1FR1 A;  3SH8 A;  4H8R A;  2HP5 A;  4GKU A;  2GDN A;  4BL2 A;  4PM5 A;  4P0M A;  2V2F F;  3E2K A;  4R4R A;  2H10 A;  2ZD8 A;  3DW0 A;  3G2Y A;  4KZ3 A;  1BUL A;  3MKF A;  1N9B A;  1G68 A;  4OQ0 A;  4OLD A;  3UNW A;  5HFO A;  4LCL A;  2DCF A;  2EFU A;  3EQV A;  3G34 A;  1K55 A;  2Y2N A;  2Y2L A;  2XR0 A;  2XH9 A;  3A3I A;  2IWD A;  3IXG A;  5F82 A;  4EWF A;  4N1X A;  1NRF A;  4LV1 A;  5HL1 A;  3LY3 A;  3QHY A;  1VM1 A;  3SH9 A;  3OPH A;  1W79 A;  4WMC A;  5EVI D;  1YLW A;  4WM9 A;  3C4P A;  4DE1 A;  4GZB A;  3GMW A;  5DVA A;  4UA7 A;  1PIO A;  3OZH A;  3SS5 A;  3TSG A;  3FV7 A;  3C7U A;  4JF5 A;  3ZNT A;  1E4D A;  5JYP A;  3BEB A;  4A5R A;  2XGN A;  2Z2M B;  4IVI A;  1C3B A;  4RX3 A;  2HDQ A;  3SS4 A;  2X71 A;  1Y54 A;  1TVF A;  4DE3 A;  4P6B A;  3S4X A;  3ZG7 B;  2PU4 A;  1XA7 A;  1HZO A;  4CJN A;  5HAP A;  1BLP A;  1LLB A;  3IWO A;  1MWS A;  4OLG A;  1FQG A;  5FAT A;  4MBK A;  3BFC A;  4WEJ A;  4R23 A;  1K38 A;  1M40 A;  3GSG A;  3ZHH A;  2CC1 A;  4WEK A;  2Y2O A;  3MFD A;  2Y2G A;  4E3K A;  1JTD A;  2BG1 A;  2Y2H A;  3IF6 C;  2P9V A;  3D4F A;  3FZC A;  1WYC A;  1I5Q A;  4KZ5 A;  4EBL A;  3OCN A;  2XDM A;  4E6W A;  5CHU A;  1ZKJ A;  4O7D A;  5CGW A;  3ITB A;  4UHU A;  2XFT A;  1PYY A;  2WGW A;  5HAQ A;  1GA0 A;  3V3R A;  5CXW A;  3GVB A;  4U3T A;  3LCE A;  3C7V A;  1K4E A;  2WGV A;  4KG2 A;  4X69 A;  1KGG A;  5HAI A;  1K6S A;  1YLJ A;  3S1Y A;  3TG9 A;  5HW3 A;  5FSR A;  1K56 D;  1O7E A;  3WRT A;  1IYS A;  4Y7P A;  2ZQA A;  1MBL A;  1H8Z A;  1YT4 A;  3PBQ A;  4E3M A;  1KE3 A;  2QPN A;  4PPR A;  4KZ4 A;  1RP5 A;  2WAF A;  1HTZ A;  3GRJ A;  5DTK A;  4E3J A;  3ZVT A;  4FH4 A;  3UPO A;  1JWV A;  1PWD A;  1XXM A;  3WS0 A;  3RXX A;  4FCF A;  4ZJ1 A;  2WAD A;  5CTN A;  3HL9 A;  1KDW A;  4JKT A;  4B4Z A;  1GA9 A;  4K0X A;  3BEC A;  4PMA A;  1PZP A;  3UPP A;  5E2G A;  1YLP A;  4MNR A;  3MBZ A;  2Z2L B;  5E43 A;  1BLC A;  3VSL A;  5CER A;  2WKI A;  5I94 A;  3FKV A;  5DTS A;  1TEM A;  3PBO A;  4JLF A;  3VFF A;  3HUN A;  4EBN A;  1H8Y A;  4E3O A;  3ZDJ A;  1SHV A;  2FFY A;  4FSF A;  1YQS A;  3UDX A;  5M19 A;  4QY5 A;  4DDS A;  3V5M A;  2EX2 A;  3O86 A;  2Y91 A;  1NJ4 A;  3BFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...