2OWHA

Structure of an early-microsecond photolyzed state of co-bjfixlh
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
116
structure length
116
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxygen storage/transport
molecule keywords Sensor protein fixL
publication title Time-resolved crystallographic studies of the heme domain of the oxygen sensor FixL: structural dynamics of ligand rebinding and their relation to signal transduction.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 29
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2owhA00
2OWHA 3NHQA 2YKHA 4B9OA 4L9EA 3VE4A 4GCZA 4MN5A 4I5SA 5I5LA 4GHIB 4HJ6A 5HD5A 1LSVA 4K08A 3PHYA 2PHYA 4F3LA 3IS2B 3LICA 3KX0X 4NXBA 4H6JA 5HDDA 2WKPA 3NJAA 3F1NA 1LSWA 4HP9A 1OT9A 1GSWA 2R78A 1TS0A 2PYRA 5HDSA 3UMEA 1LSXA 1TS7A 1DP8A 1DP9A 5G4YA 5TBMA 3BWLA 3VE3A 3MQOA 1XJ6A 3H82B 1UGUA 5DJTA 3FG8A 2CMNA 2V0WA 3T50A 2I9VA 4BBUA 4WN5A 1EW0A 5DJUA 1X0OA 4LRZE 3FC7A 3LIEA 2QJ5A 1OTBA 2Z6CA 4BBVA 3F1PA 1KOUA 2QKPA 2V1AA 5EFWA 3B33A 1TS8A 3K3CA 1N9NA 3NOPC 2ZOIA 4HNBA 2OWJA 2ZOHA 1S66L 1JNUA 2V9AA 3UB8A 3A0SA 4I3IA 4M4XA 1OTEA 4DJ2A 4E04A 2L4RA 3PYPA 3LUQA 3UMDA 1ODVA 3VOLA 2VV7A 1XJ4A 4HH3A 1DRMA 3ZQ5A 1P97A 3BY9A 2BASA 3H9WA 1XJ3A 3IBRA 2B02A 1P0ZA 5HD3A 3A0RA 3RH8B 1OJGA 4L9FA 3F1OB 3EWKA 4EERA 3UB9A 3NOTC 1OT6A 4R38A 4XT2A 1N9OA 4EETB 1GSVA 5KIZA 4PKYA 2D01A 5J4EA 1NWZA 2VV8A 1S4RA 1XFQA 2Z6DA 4I3AA 5HWVA 3BY8A 5IS1A 1DP6A 4MN6A 3E4QA 3G6OA 4KUOA 3LI8A 4EEUA 1T18A 1OTAA 2W27A 1UWPX 4EESA 5AVEA 3C8CA 2HV1A 4EEPA 4WLAA 3MJQA 2WKQA 4R70A 1D7EA 1OTDA 2K7SA 4NXFA 2VV6A 3C2WA 2H28A 4HJ3A 4GHIA 1G28A 4GW9A 4EQ1A 4GS9B 3IS2A 2INWA 4LRXC 1GSXA 3A0VA 4I39A 2PYPA 3CLOA 5HZHA 3UB6A 2KDKA 4EXOA 4PKYG 3UB7A 1UWNX 3H7WB 3ULFA 2P7JA 1T1BA 4WUJA 4HI4A 2EA9A 2J80A 3MXQA 3D72A 2W0NA 3H82A 2JHEA 4I38A 3LIBA 4HH2A 4EW7A 5F68A 4WF0A 5HSQA 5HWTA 4HJ4A 4NXGA 2V0UA 1D06A 2VEAA 5DKKA 4JGQA 1LT0A 2PR5A 4I3JA 4F3LB 2JN7A 5IU1A 3LYXA 1OTIA 4H6JB 2ZBBA 1MZUA 2PD7A 2V1BA 3F1NB 5HWWA 3P7NA 4YWZA 3LIFA 3LIAA 5DKLA 4HIAA 2A24B 3E4PA 1S1ZA 1Y28A 5TBMB 5F69A 4LPZA 3F1OA 1XJ2A 5HDCA 1XFNA 5G4ZA 1WA9A 3NOUC 2L0WA 1F9IA 1S1YA 3K3DA 2PR6A 1V9ZA 5A8BA 3E4OA 4R6LA 2PD8A 3EEHA 1V9YA 4JGOA 3F1PB 4R3AA 4RQ9A 3OLOA 3LI9A 2A24A 4HP4A 3CWFA 3GDIA 2VLGA 3HJKA 4JGPA 1S4SA 4KQDA 1T1CA 4HY8A 2OOLA 1T1AA 2QJ7A 2QHKA 2L1MA 4KUKA 2WKRA 4BBTA 1OJ5A 3CAXA 4DJ3A 3SW1A 1LL8A 2QWSA 4NXEA 2KX6A 3RTYA 4GS9A 4HHDA 1S67L 1F98A 2M1CA 4XT2B 3HJIA 4HOIA 5J7EA 3UE6A 5F5YA 3MFXA 1N9LA 4LRYC 3ICYA 5AVFA 3LIDA 2D02A 4HQAA 3H7WA 5J3WA 1BYWA 3MR0A 1TS6A 4L9GA 5F6AA 3MQQA 1VB6A 2YKFA 4JGRA 3GECA 2PDRA 4WL9A 1T19A 2GJ3A 4LLOB
chains in the Genus database with same CATH superfamily
2RL3A 1P9WA 2OWHA 4B9OA 3IWQA 3VE4A 2FH5A 3HUNA 3V3SA 5I5LA 3MSHA 4K91A 1LSVA 3WRZA 3CITA 2XA7M 4S2LA 1ESIA 3OPLA 1VETA 2M7VA 4G3KA 3UO9A 4H6JA 2IA2A 2WGVA 4KG2A 2EX8A 1OT9A 2G7UA 4DRTA 1L3LA 1GSWA 4EWFA 1Q2QA 2EX9A 3ITBA 4R4SA 1JWZA 4X53A 5HDSA 4BL3A 1TD5A 4XUXA 3UMEA 1TS7A 3CI6A 1DP9A 4IBRA 3FWLA 4WZ4A 5HAPA 4Y3IA 1DY6A 3MQOA 1BZAA 2WADA 1XJ6A 3S7PA 3GTCA 2Y4AA 2ZQAA 3G30A 3RXXA 2V0WA 4C3QA 4PM9A 4MLLA 4H8RA 4WN5A 1DJAA 1W8QA 3CHWP 2Y2HA 3OC2A 5FQKA 4UEYA 1X0OA 3FC7A 4MNRA 1Q2PA 2QJ5A 3SOIA 4BBVA 3S7NA 4FSFA 3A3JA 2HP6A 2V1AA 3B33A 2ZQDA 4JPMA 4O8GA 4N1HA 1H5XA 1S66L 2JKFA 1A0KA 5A92A 3PXPA 1FSWA 5CTNA 3N8LA 3IBJA 3ISGA 2BLSA 5GLBA 4KG6A 3UMDA 1BTLA 4ZJ3A 3MXSA 4HH3A 4O7DA 3BY9A 2BASA 5CGSA 3QP4A 3RH8B 4S2KA 2P08A 3EWKA 3C38A 4KZ5A 5HFOA 4R38A 1K54C 1H3QA 1N9OA 4EETB 3OCNA 4OOYA 5CHJA 5LBRA 5EECA 3SS5A 3HVFA 2JE5A 3NY4A 2J3TD 2R9XA 1NWZA 5CTMA 3Q1FA 2Z6DA 2ZMFA 5GHZA 5IS1A 2OLVA 3NC8A 4MN6A 2ZC4B 4HBUA 4EEUA 3MFDA 4MDZA 2WKEA 4R23A 2W27A 2DCFA 1DJBA 3UB5P 2Y2IA 3Q7ZA 3M2JA 3HLFA 3V5MA 4QY6A 1NXYA 5EE8A 4E6XA 3BFGA 5DFYA 1D7EA 2HDQA 4NXFA 2VV6A 3RXWA 3C30A 3PAEA 4O0PA 1NRJA 3S7OA 2H28A 4GZBA 4DXBA 4S2OA 4F94A 3NBLA 2V2FF 3VP0A 2NUPC 3O88A 4UQIS 2INWA 3ZG8B 2XD1A 3IXHA 3A0VA 3MZDA 3BYDA 3CLOA 1KE4A 1KVLA 4DKIA 2H5SA 3T4TA 3T1RA 3D3OA 5HAQA 4DN0A 4GJ4A 3MKEA 4KENB 3OPRA 4WMCD 3E0YA 2W1RA 3MZEA 5E2GA 4HI4A 1K55A 3SH9A 2J80A 3VP4A 5HARA 5HX9A 3D4FA 4RA7A 5EV0A 5HWTA 4ZRRA 5KMWA 2O9CA 3IXGA 2V0UA 5FQMA 3HUOA 1D06A 2VEAA 1W79A 3KSHA 1CF0A 2J3WA 1KE0A 2ZQ8A 2PR5A 4PM8A 1MXOA 4I3JA 4Y7PA 5IU1A 2ZBBA 5EVEA 3B3XA 5L09A 4RVAA 5G18A 3GMWA 3GVBA 5J8XA 1JTDA 4JXSA 3MQ0A 3N6IA 4KQQA 4PAUA 4ESPA 3EEAA 2OAQ1 4K0XA 4DE0A 4OQGA 4R1GA 3LIAA 4KZ7A 4HIAA 3E4PA 3CG5A 1K25A 3IF5A 3UN7A 1PRQA 4QB8A 3L9KA 5GHXA 2H0TA 5HDCA 1CI8A 1KDWA 4S2PA 3C7VA 3UE0A 2XA7S 5G4ZA 1I5QA 3C7UA 1Z09A 1F9IA 3HBRA 3QNCA 1FOFA 3K3DA 1K56D 4R6LA 2PD8A 3EEHA 3WWXA 4NG2A 2W3FA 2GNXA 1FR6A 3BFCA 3WS5A 5MC7A 3BLSA 3OLOA 5E43A 1ZKJA 1XGIA 2XD5A 3DAVA 1CEFA 4ARZB 1PYYA 3BFDA 3JVUA 4UA9A 4GB7A 2QHKA 1YQSA 2L1MA 4EBNA 5FQQA 4BBTA 1KGGA 1OJ5A 3CAXA 5DTKA 1LL5A 1YPRA 4E3MA 4JXVA 3ZG5A 1PZPA 3BRMA 2VJWA 1JVJA 2VX8A 1YMSA 1F98A 2EFXA 1Y4OA 4X56A 2M1CA 5CGXA 4XT2B 1BLHA 1TF1A 4DE3A 5J7EA 1STZA 4XUZA 5F5YA 3O86A 3ICYA 3UNWA 4DDYA 4KQRA 4MBFA 4HQAA 1RGYA 1OMEA 4KZ3A 3MQQA 2YKFA 3GECA 5KZHA 1XA1A 5FSRA 2FFFB 3FKVA 4OOLA 4GCZA 3A3EA 4QD4A 1MY8A 5HD5A 3EGDC 1PNEA 3WS0A 3PHYA 5D3OA 1NYYA 5HW3A 1U60A 2PHYA 3KX0X 3G32A 4NXBA 1MKIA 4LV1A 1YMXA 4UQIM 1LSWA 2ZLYA 2XRNA 1GCEA 1Y54A 3CUEA 3HLWA 1IFQA 2R78A 4YNRA 3GRJA 3QP5A 1TS0A 2V1ZA 3UPOA 4EUVA 1EI5A 1LSXA 3W4QA 1DP8A 4G3WA 5A90A 3GSGA 3TSGA 4CJNA 4Y0OA 3FG8A 1IYSA 5HAIA 5CHMA 1BT5A 2QZ6A 3KSFA 1FSYA 3KSIA 2EWVA 5DJUA 2PU2A 3RFBA 4OPQA 3TRCA 3LIEA 1YSPA 2HPBA 5AQ9A 3HLGA 2NUTC 3IF6B 5EFWA 1N9NA 3ZVTA 4HNBA 5FAQA 1YAXA 2Y2MA 4ARZA 1XXMA 4HESA 3UB8A 3LCEA 4I3IA 3FZCA 3JVVA 3PBNA 3LUQA 3O3VA 3LEZA 2Y91A 1GA0A 5FL3A 2JBFA 1GA9A 2VV7A 1XJ4A 4EU0A 4S2MA 4WMCA 3T1XA 1P97A 3E2LA 1AWIA 1XJ3A 1P0ZA 3SH8A 5FDSA 5HD3A 3A0RA 1PWGA 4BMWA 2WGWB 3UPPA 1K54A 4L9FA 3KSGA 4EERA 3UB9A 3PBRA 5TJJA 1OT6A 4LENA 3VOYA 4EBPA 4C6YA 4XT2A 2JCHA 1CJFA 4MMNA 4JF5A 2OAP1 2A2LA 1S4RA 1XFQA 3DTKA 5CERA 4I3AA 5HWVA 3BY8A 3BECA 3G6OA 4KUOA 3LI8A 1T18A 1OTAA 1YLPA 1KE3A 5CEBA 2JC7A 1TDGA 3PBQA 2QMIA 3T4LA 4GD8A 4MBHA 4EUZA 4WELA 4EEPA 1K6RA 4FD8A 4L0LA 3M6BA 2J3TC 4B4ZA 3CUEC 4IUKA 1K57A 3IX3A 4Y5FA 2KLIA 4HJ3A 3GQZA 2I72A 5FQ9A 3MZFA 4X6TA 1ESUA 4EQ1A 2AVXA 4GS9B 3VSKA 4D2OA 2G2UA 4X1MA 2HJ9C 3RJUA 4O01A 4LRXC 4ZBEA 4IEDA 3BEBA 1LI0A 2ZQ7A 5HZHA 3PR6A 4EV4A 1OPXA 3V50A 1K56A 3HL9A 4PKYG 3UB7A 1TDLA 3KYEA 3HLBA 3VFHA 2DNSA 3S1YA 3T4QA 3MXQA 4OQIA 2W0NA 4GN2A 3IX8A 4P6BA 2VA0A 5FQIA 5IHVA 3MMHA 4EQIA 1NZOA 2Y55A 3UY6A 4HJ4A 1QMFA 3G34A 1C3BA 5TGFA 3V67A 4KQOA 2KOIA 5DKKA 4JGQA 2ZL1B 3PBOA 2R9WA 4ZAMA 1PIOA 5EM0A 1K6SA 3IF6A 4WBGA 1JWPA 4S2NA 3ZCZA 4CLCE 4U0XA 3LYXA 1BSGA 4WZ5A 4E3OA 1N4OA 2XFSA 5FDHA 3F1NB 5L10A 5L8MA 2FZ0A 1F5MA 2HDUA 1Z6FA 2RCXA 3P7NA 3BW6A 3LIFA 3FYZA 2EXBA 5DKLA 2ZMAA 4KZBA 4OP8A 4DE1A 3L7HA 4PMAA 3TJZC 3UDIA 4DF6A 3IT9A 4WM9A 2WGWA 3VP3A 4PHTA 4Y2FA 1VEUA 5AQBA 3MF0A 3DTMA 2E8IA 3OCLA 3N7WA 1XJ2A 2XK1A 3HLCA 3ZFZA 5DF7A 5EM1A 4ME4A 3T4SA 2Z2MB 3NOUC 1YSQA 1FQGA 2EX6A 1S1YA 1K57C 1PI5A 2VGJA 2X02A 1IYPA 2LB5A 1YT4A 1VQQA 4JGOA 1F2KA 1MWRA 5F1GA 2XH9A 1W5DA 1XGJA 5TR7A 4RQ9A 2ZM2A 3G31A 3M2KA 3QP6A 3LI9A 4MCWA 5HL6A 3NCKA 2PU4A 3CWFA 4B88A 2XFTA 4U3TA 2GZAA 2B18A 4P87A 2O9AA 2ZQCA 2EXAA 1E3UD 3P98A 3DTIA 3NDEA 4D60A 4R3BA 1YLZA 4GDBA 5DF9A 4X25A 2VGLS 5GLDA 2WKRA 3MBZA 1MBLA 1KVMA 5CECA 3N8RA 1ERMA 4NXEA 3T12B 1G68A 3EOIA 2KX6A 3VP2A 4GS9A 4LV3A 4IVIA 4P0MA 1S0WA 1ERQA 3N8SA 2Y2LA 3MFXA 3LR5A 4LRYC 5BOHA 2ZM0A 2W3HA 2Q9NA 4BD1A 1ZC2A 1TS6A 4L9GA 4MBKA 3ZVWA 1LHYA 5F6AA 3IF6C 1YM1A 4S2NC 4QU3A 4OKPA 4OPRA 4WZ5C 2GJ3A 2Y2QA 4U0TA 1NLYA 4GD6A 4NK3A 2Y2NA 3VMAA 3FPWA 3NHQA 3OBFA 1W7FA 2YKHA 2X01A 4WEKA 2JKGA 1EWZA 5F1FA 3OPHA 2WK0A 2ZL1A 3IH9A 4GHIB 2ZC6B 4HJ6A 3G2YA 1IYQA 3E2KA 3S4XA 4K08A 4BWIA 4ETXA 5EPHA 3R4KA 2W1TB 4IVKA 1MWTA 1IOUA 4BD0A 3C4OA 2WGIA 3HLDA 4FH2A 3UDXA 3WRTA 2WAFA 3F1NA 3IWIA 2H10A 4NKPA 2EX2A 4PM6A 2JKTI 5FI6A 4KZ6A 5G4YA 1FR1A 2G2WA 5E2HA 5DJTA 1ALQA 2J7VA 3Q7VB 2W3GA 2CMNA 5M18A 2OLUA 2I9VA 4BBUA 1EW0A 5GHYA 3LFVA 3B47A 2WYXA 4LRZE 3EGXC 2UV0E 5EOEA 1OTBA 2Z6CA 4FH4A 3IX4A 3GR2A 2O99A 1TS8A 4RX3A 3TOIA 1ES3A 3ZNTA 1XA7A 1W8YA 4Q8IA 2XSSA 2OWJA 1HZOA 1VM1A 2HDSA 2Y2KA 5CGWA 1CEGA 1JNUA 4LGWA 2V9AA 3C5AA 1W63M 4IBXA 4E3LA 4M4XA 3IQAA 4DJ2A 3I7JA 2L4RA 1DJCA 4N9KA 1WE4A 4BENA 1ODVA 1SDEA 3ZQ5A 3H9WA 3NECA 3IBRA 2B02A 3O5YA 3LEQA 2PRFA 5CRFA 3F1OB 3SZTA 3MXRA 2WKHA 3Q81A 3WS1A 4ZJ2A 2PBYA 4P6ZS 1GSVA 3W4OA 4CLCC 2XF3A 4X68A 3TG9A 4AFIA 1DP6A 3E4QA 4DXCA 2IWDA 2A49A 3JYIA 2Q0OA 5JYOA 4JBFA 3C8CA 2ZQ9A 4OQHA 2HGVA 2ZMVA 4WLAA 3VV4A 4KZAA 3MJQA 4YOFA 2XLNA 3JPUA 5FI7A 4ZJ1A 1ZHHB 5EVID 1ONHA 2E8JA 5U47A 4KZ8A 4GHIA 3EQUA 2JKRI 4YINA 1ZG6A 1ES4A 2VGLM 3Q82A 2WKIA 4RYEA 4LV2A 4DE2A 2A3UA 2J8YA 2HJEA 2W1TA 3CPTB 1L0DA 2FFYA 1BUEA 5FI2A 1GSXA 1NY0A 1ONGA 3NIAA 2DRWA 3DWKA 4I39A 4OLDA 4Q0JA 3WS2A 3FKWA 2PYPA 4M3KA 3UB6A 2KDKA 2J9PA 3IHAA 3V3RA 1BLCA 1UWNX 3ULFA 4PPRA 2P7JA 2V20A 5IT5A 4WUJA 4UHUA 1HD8A 3A3DA 3ZDJA 3HCYA 1GHPA 2JHEA 2C5WB 4HH2A 3Q7VA 4EW7A 5F68A 1MPLA 1E3UA 3C4PA 4WF0A 4E3KA 4CLCD 4Q0HA 1G6OA 3T1SA 4GKUA 3ZGAB 2Z2LB 3QP8A 1CI9A 5AJGA 1LT0A 3T1QB 1TEMA 4DDSA 2XQZA 4Y17A 1VEUB 1H8MA 4CPKA 2P74A 2VGKA 4QJGA 4A5RA 4QWOA 5FQJA 4F3LB 2HZ5A 3ZG0A 2PD7A 4HBTA 2VKSA 3P01A 5AQAA 3D9YA 2HP9A 1L0FA 2QPNA 4QY5A 4II7A 4YWZA 1O7EA 5FATA 2O0YA 2B95A 4ID4A 1FILA 3OPPA 3V39A 1BLPA 1J3WA 5TBMB 1EROA 5F69A 1NJ4A 4LPZA 5FAOA 5EUAA 4BQMA 1M6KA 2XROA 3UE1A 3F1OA 1K4EA 4WYYA 4GNUA 1LI9A 1XFNA 3SS3A 2GDNA 2WAEA 5EVIB 4BL2A 3U2AA 1V9ZA 3E4OA 1RP5A 3E98A 1V9YA 4R3JA 3F1PB 1K38A 3UPNA 4R3AA 1FIKA 2A24A 3N4IA 1YLWA 2PAVP 2VLGA 4UA7A 4JGPA 3ZG9B 1IKIA 4OOMA 2VZWA 1XX2A 1ACFA 2BG1A 3KYZA 4KQDA 1T1CA 4NEED 2OOLA 3EQVA 2QJ7A 1H0MA 4KUKA 2ZD8A 5GL9A 3W2ZA 3QHYA 4DMZA 3BFEA 5DFXA 4DJ3A 3LGOA 3SW1A 3FV7A 3PBSA 2QWSA 4LCLA 1IKGA 1GHMA 4IJGA 1E4DA 2ZC3B 4HHDA 1FCMA 3CPTA 1S67L 4OONA 3QNBA 5M1AA 1JWVA 4CLCB 4ETZA 1KDSA 3HJIA 3HLEA 4HOIA 1H8ZA 1ES5A 3FPVA 3ZHHA 2B5RA 4K0WA 3LIDA 4E3JA 3Q07A 4E3IA 4P6ZM 3W8KA 1BYWA 3MR0A 5J3WA 1CK3A 1AXBA 2O9BA 4P85A 5CXWA 1VB6A 2PDRA 2P04A 1KGEA 4WL9A 4Z1WA 4LCMA 1PWDA 2ZJ9A 5JYPA 4E3NA 1S6RA 3QP2A 2MJ6A 4L9EA 3HREA 1P9RA 1MKMA 5E2EA 4MN5A 3S22A 2Q9MA 1G5UA 4I5SA 1BULA 2WZZA 1MC0A 3CMZA 3LO7A 4JF4A 4ZDXA 1QMEA 4OQ0A 4F3LA 5EOOA 3IS2B 3LICA 5HDDA 2WKPA 2EFUA 3NJAA 4HP9A 2JKTM 1SZVA 3VSLA 4RX2A 4OVDA 2Y2OA 3AGEA 1D1JA 1KGFA 1ES2A 2K31A 2PYRA 3DWZA 4CQHA 4QPRA 5TBMA 3BWLA 3VE3A 4FTXA 3H82B 1UGUA 2P9VB 4B4XA 4S2JA 3PTEA 3T50A 2Y2GA 1I2SA 3UE3A 3A3FA 4X69A 5EVIA 5GLCA 4ZTKA 3ZYTA 3F1PA 1KOUA 2QKPA 3K3CA 3NOPC 2XR0A 2ZOIA 3T4OA 2ZOHA 3ZNYA 3IWOA 3DTEA 2CC1A 1WYBA 3T4JA 1XP4A 5DF8A 3A0SA 2H0YA 5FAPA 4PM5A 2HP5A 1OTEA 4E04A 3VP1A 3PYPA 1SKOB 4R0QA 5C5KA 3VOLA 1YLJA 5E2FA 3R7WB 3SS4A 3GV9A 1DRMA 4MN7A 1CQAA 2VK3A 1W63Q 3ZG7B 5HPFA 5CX7A 2Y2PA 1OJGA 4LFUA 4OPYA 5A93A 3CJMA 3M6HA 3NOTC 2M7UA 1I2WA 1SCWA 1NRFA 3SH7A 4CLCA 3ITAA 4Y13A 1E25A 2PT7A 2DMWA 2XEPA 3KYQA 5KIZA 3O87A 2WZXA 4PKYA 3NI9A 2D01A 1J9MA 1O07A 5J4EA 2VV8A 3BQAA 4N92A 3CZDA 5KSHA 1XKZA 1IELA 3AGFA 2OSUA 1M40A 4LV0A 5DTSA 1JTGA 3IHBA 3BM6A 5K5BA 5F83A 1H8YA 1SHVA 1UWPX 5FEGA 4EESA 5AVEA 3LY4A 1TVFA 4Q0IA 2HV1A 2Y59A 3UDFA 3P09A 4PM7A 1ZTUA 3BJNA 2WKQA 4R70A 1IYOA 2K7SA 1OTDA 4B93A 2BTFP 2JKRM 1PW1A 3C2WA 3LY3A 2LB9A 4KZ4A 1G28A 4GW9A 5DVAA 1PWCA 3BQ8A 3QP1A 1WYCA 4JKTA 1NZUA 3PAGA 3IS2A 1HTZA 1LL9A 4GDNA 1RCJA 3A3IA 5HPIA 1BLSA 2GX5A 5EVIC 2WUQA 2UWXA 4EXOA 5AQ7A 5M19A 5HL1A 3HUMA 2ZM8A 3H7WB 4QHCA 1T1BA 4UAAA 5CHUA 4HEFA 2EA9A 4GLQA 4JXGA 4OP5A 3D72A 3K2NA 3H82A 1RGZA 4I38A 3LIBA 2P9VA 1K55C 3WS4A 3NULA 3G4PA 5HSQA 1PI4A 4NETA 4X55A 1SKFA 3LR3A 4NXGA 1NYMA 5GLAA 1G6AA 4BJPA 5L07A 4Y15A 3U4LP 3PBTA 1XPBA 1YLYA 4EBLA 5FEFA 2ZC5B 4N9LA 5L2FA 1VETB 3B42A 4XXRA 4FOFA 4Z9QA 1HLUP 1FCNA 2IWCA 3DW0A 2JN7A 4N1XA 3OOVA 1YLTA 1PFLA 1OTIA 4H6JB 4OH0A 1MZUA 3VFFA 4UA6A 2V1BA 1N9BA 4Y0TA 5HWWA 5CEDA 3LR4A 5DTTA 2W3EA 3W4PA 3LR0A 1SKOA 4FUWA 2ZC7A 3R7WA 2A24B 1S1ZA 1Y28A 2K2NA 1K4FA 3OZHA 1L0GA 4C75A 5EVLA 4MEZA 3T4KA 3G35A 1IEMA 2QYBA 3AGDA 4S2IA 4JLFA 4OLGA 3S7QA 5FASA 3TE8A 1PZOA 4G3VA 4IUHA 2Y2JA 1WA9A 1FCOA 2L0WA 2ACGA 2PR6A 5A8BA 2J9OA 1MWSA 2C6WB 5FA7A 2HDRA 2X71A 2EWWA 1GHIA 4HP4A 3GDIA 4BLMA 3IXBA 2XGNA 3HJKA 3IH8A 2V8CA 1S4SA 3VOZA 2HF6A 4HY8A 1MWUA 1PW8A 3MS6A 1T1AA 5KSCA 3BLMA 4Y0UA 5TFQA 4E6WA 2W3DA 4YFMA 5I94A 4X1LA 3DBAA 2XDMA 4GOGA 4KG5A 2Y8HA 1LL8A 2OV5A 3TW8A 5F82A 4R4RA 4JXWA 2Y79A 5A91A 3RTYA 1YKDA 2V8FA 2PBDP 2IWBA 1NLZA 3UE6A 1SDNA 4OPZA 1N9LA 1L0EA 1LLBA 3MKFA 5AVFA 2D02A 3IXDA 1L2SA 4WEJA 3H7WA 4JF6A 3KO6A 4KZ9A 4IHQA 1K0KA 3G2ZA 1VHMA 4JGRA 1HVBA 3NDGA 1T19A 4FCFA 3BFFA 1ZG4A 4LLOB
chains in the Genus database with same CATH topology
1P9WA 3FPWA 2OWHA 3NHQA 3OBFA 2YKHA 4B9OA 2MJ6A 4WEKA 4OOLA 4L9EA 1P9RA 1MKMA 3VE4A 2FH5A 4GCZA 4MN5A 4I5SA 5I5LA 4GHIB 4HJ6A 5HD5A 1MC0A 3EGDC 1LSVA 3CITA 2XA7M 4K08A 4BWIA 3PHYA 4ETXA 3R4KA 2PHYA 4F3LA 2M7VA 2W1TB 4G3KA 3IS2B 1IOUA 3LICA 3KX0X 4NXBA 4H6JA 5HDDA 2IA2A 2WKPA 3NJAA 3F1NA 4UQIM 1LSWA 4HP9A 2XRNA 1OT9A 4NKPA 2JKTM 2G7UA 3CUEA 1GSWA 1IFQA 2R78A 4YNRA 2JKTI 2K31A 1TS0A 2PYRA 5HDSA 4EUVA 1TD5A 3UMEA 4CQHA 1LSXA 1TS7A 1DP8A 3CI6A 4QPRA 1DP9A 5G4YA 5TBMA 3BWLA 3VE3A 4G3WA 4Y3IA 3MQOA 1XJ6A 3H82B 3S7PA 1UGUA 5DJTA 3FG8A 2W3GA 2CMNA 2V0WA 3T50A 2I9VA 4BBUA 4WN5A 3KSFA 1EW0A 3KSIA 2EWVA 5DJUA 3OC2A 3RFBA 4UEYA 3LFVA 3UE3A 3B47A 1X0OA 4LRZE 3TRCA 3EGXC 3FC7A 3LIEA 3ZYTA 2QJ5A 1OTBA 2Z6CA 4BBVA 1YSPA 3F1PA 3S7NA 4FSFA 1KOUA 2QKPA 2V1AA 2O99A 2NUTC 1TS8A 3B33A 3K3CA 5EFWA 1N9NA 3NOPC 2ZOIA 3T4OA 2XSSA 4O8GA 4HNBA 2OWJA 2ZOHA 1S66L 1YAXA 4ARZA 1JNUA 2V9AA 3UB8A 3T4JA 3PXPA 3A0SA 1W63M 4I3IA 4M4XA 1OTEA 3JVVA 4DJ2A 4E04A 3IBJA 2L4RA 3PYPA 3PBNA 3LUQA 3UMDA 5C5KA 1ODVA 5FL3A 3VOLA 2VV7A 1XJ4A 3R7WB 4HH3A 4EU0A 1DRMA 3ZQ5A 1P97A 3BY9A 2BASA 4MN7A 3H9WA 1XJ3A 3IBRA 2B02A 1W63Q 5HPFA 1P0ZA 3O5YA 5HD3A 3A0RA 5CX7A 4BMWA 3RH8B 1OJGA 4L9FA 2P08A 3EWKA 3F1OB 3C38A 3KSGA 4EERA 3UB9A 3NOTC 3PBRA 2M7UA 5TJJA 1OT6A 4R38A 1H3QA 4CLCA 4XT2A 1N9OA 4EETB 3OCNA 4P6ZS 1GSVA 4MMNA 2PT7A 2DMWA 3KYQA 2OAP1 4CLCC 5KIZA 5LBRA 4PKYA 2D01A 2J3TD 5J4EA 1NWZA 2VV8A 2A2LA 1S4RA 3BQAA 5KSHA 1XFQA 2Z6DA 2ZMFA 4I3AA 5HWVA 3BY8A 4AFIA 5IS1A 1DP6A 4MN6A 3E4QA 3G6OA 4KUOA 3LI8A 4EEUA 4MDZA 1T18A 1OTAA 5K5BA 2W27A 3PBQA 1UWPX 4EESA 5AVEA 3T4LA 3C8CA 4Q0IA 4WELA 2HV1A 4EEPA 2HGVA 2ZMVA 4WLAA 1ZTUA 3VV4A 3MJQA 4YOFA 4L0LA 3BJNA 2WKQA 4R70A 2J3TC 5DFYA 1D7EA 1OTDA 2K7SA 3CUEC 4IUKA 4NXFA 4B93A 2VV6A 3C30A 4O0PA 1ZHHB 2JKRM 4Y5FA 2KLIA 1NRJA 3S7OA 3C2WA 2H28A 4HJ3A 4GHIA 2LB9A 1G28A 4GW9A 3EQUA 2JKRI 3BQ8A 2VGLM 4EQ1A 4GS9B 2W1TA 2HJEA 3IS2A 2NUPC 4UQIS 2INWA 2HJ9C 4O01A 1GSXA 4LRXC 3A0VA 5HPIA 4I39A 4Q0JA 2PYPA 3CLOA 5HZHA 3PR6A 3T4TA 2GX5A 3D3OA 1OPXA 3UB6A 2KDKA 4DN0A 4EXOA 4GJ4A 4PKYG 3UB7A 1UWNX 3H7WB 3ULFA 2P7JA 3E0YA 2W1RA 1T1BA 5IT5A 4WUJA 4HI4A 2EA9A 4GLQA 3T4QA 2J80A 3MXQA 3D72A 3K2NA 2W0NA 3HCYA 3H82A 2JHEA 4I38A 3LIBA 4HH2A 2VA0A 4EW7A 5F68A 3MMHA 4WF0A 5HSQA 5HWTA 4ZRRA 4CLCD 4HJ4A 4Q0HA 2O9CA 1G6OA 3LR3A 4NXGA 3V67A 2V0UA 4BJPA 4KQOA 2KOIA 1D06A 2VEAA 5DKKA 4JGQA 3KSHA 5AJGA 1LT0A 2J3WA 3PBOA 3PBTA 2PR5A 1H8MA 3B42A 4I3JA 4FOFA 4F3LB 2JN7A 5IU1A 4CLCE 3OOVA 3LYXA 1OTIA 4H6JB 2ZBBA 1MZUA 2PD7A 2V1BA 2VKSA 3P01A 3F1NB 5L8MA 5HWWA 2FZ0A 3LR4A 1F5MA 3MQ0A 2W3EA 3LR0A 4PAUA 3P7NA 4II7A 4YWZA 3BW6A 3LIFA 2O0YA 2OAQ1 3EEAA 3R7WA 3LIAA 5DKLA 4HIAA 2A24B 3E4PA 1S1ZA 1Y28A 2K2NA 5TBMB 5F69A 3TJZC 4LPZA 3T4KA 2XROA 4PHTA 4Y2FA 3F1OA 3MF0A 2QYBA 3OCLA 1XJ2A 5HDCA 3S7QA 3TE8A 4G3VA 4IUHA 2XA7S 1XFNA 5G4ZA 1WA9A 4ME4A 3T4SA 1YSQA 3NOUC 2L0WA 1F9IA 1S1YA 3K3DA 3U2AA 2PR6A 1V9ZA 5A8BA 2LB5A 3E4OA 4R6LA 3E98A 2PD8A 3EEHA 1V9YA 4JGOA 3F1PB 2W3FA 2GNXA 4R3AA 2EWWA 4RQ9A 5MC7A 3OLOA 3LI9A 2A24A 4MCWA 5HL6A 4HP4A 3CWFA 3GDIA 2VLGA 3HJKA 2GZAA 2B18A 4ARZB 4JGPA 2O9AA 3JVUA 4OOMA 2VZWA 1S4SA 3KYZA 2HF6A 4KQDA 1T1CA 4NEED 4HY8A 2OOLA 1T1AA 3EQVA 2QJ7A 2QHKA 2L1MA 4KUKA 5DF9A 2W3DA 2VGLS 3W2ZA 2WKRA 4BBTA 4DMZA 1OJ5A 3CAXA 5DFXA 3DBAA 4DJ3A 2Y8HA 3SW1A 1LL8A 3PBSA 2QWSA 3TW8A 4IJGA 4NXEA 3EOIA 2KX6A 2Y79A 3RTYA 4GS9A 4HHDA 2VJWA 1YKDA 1S67L 2VX8A 1F98A 2M1CA 4CLCB 4ETZA 4XT2B 3HJIA 4HOIA 1TF1A 5J7EA 1STZA 1NLZA 3UE6A 5F5YA 3FPVA 3MFXA 3LR5A 1N9LA 4LRYC 3ICYA 5AVFA 3LIDA 2W3HA 2D02A 4P6ZM 4HQAA 4WEJA 3H7WA 1BYWA 3KO6A 3MR0A 5J3WA 4IHQA 1TS6A 4L9GA 2O9BA 5F6AA 3MQQA 1VB6A 1VHMA 2YKFA 4JGRA 3GECA 2PDRA 2P04A 1T19A 4WL9A 2GJ3A 1NLYA 4Z1WA 4LLOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OWH A;  3NHQ A;  2YKH A;  4B9O A;  4L9E A;  3VE4 A;  4GCZ A;  4MN5 A;  4I5S A;  5I5L A;  4GHI B;  4HJ6 A;  5HD5 A;  1LSV A;  4K08 A;  3PHY A;  2PHY A;  4F3L A;  3IS2 B;  3LIC A;  3KX0 X;  4NXB A;  4H6J A;  5HDD A;  2WKP A;  3NJA A;  3F1N A;  1LSW A;  4HP9 A;  1OT9 A;  1GSW A;  2R78 A;  1TS0 A;  2PYR A;  5HDS A;  3UME A;  1LSX A;  1TS7 A;  1DP8 A;  1DP9 A;  5G4Y A;  5TBM A;  3BWL A;  3VE3 A;  3MQO A;  1XJ6 A;  3H82 B;  1UGU A;  5DJT A;  3FG8 A;  2CMN A;  2V0W A;  3T50 A;  2I9V A;  4BBU A;  4WN5 A;  1EW0 A;  5DJU A;  1X0O A;  4LRZ E;  3FC7 A;  3LIE A;  2QJ5 A;  1OTB A;  2Z6C A;  4BBV A;  3F1P A;  1KOU A;  2QKP A;  2V1A A;  5EFW A;  3B33 A;  1TS8 A;  3K3C A;  1N9N A;  3NOP C;  2ZOI A;  4HNB A;  2OWJ A;  2ZOH A;  1S66 L;  1JNU A;  2V9A A;  3UB8 A;  3A0S A;  4I3I A;  4M4X A;  1OTE A;  4DJ2 A;  4E04 A;  2L4R A;  3PYP A;  3LUQ A;  3UMD A;  1ODV A;  3VOL A;  2VV7 A;  1XJ4 A;  4HH3 A;  1DRM A;  3ZQ5 A;  1P97 A;  3BY9 A;  2BAS A;  3H9W A;  1XJ3 A;  3IBR A;  2B02 A;  1P0Z A;  5HD3 A;  3A0R A;  3RH8 B;  1OJG A;  4L9F A;  3F1O B;  3EWK A;  4EER A;  3UB9 A;  3NOT C;  1OT6 A;  4R38 A;  4XT2 A;  1N9O A;  4EET B;  1GSV A;  5KIZ A;  4PKY A;  2D01 A;  5J4E A;  1NWZ A;  2VV8 A;  1S4R A;  1XFQ A;  2Z6D A;  4I3A A;  5HWV A;  3BY8 A;  5IS1 A;  1DP6 A;  4MN6 A;  3E4Q A;  3G6O A;  4KUO A;  3LI8 A;  4EEU A;  1T18 A;  1OTA A;  2W27 A;  1UWP X;  4EES A;  5AVE A;  3C8C A;  2HV1 A;  4EEP A;  4WLA A;  3MJQ A;  2WKQ A;  4R70 A;  1D7E A;  1OTD A;  2K7S A;  4NXF A;  2VV6 A;  3C2W A;  2H28 A;  4HJ3 A;  4GHI A;  1G28 A;  4GW9 A;  4EQ1 A;  4GS9 B;  3IS2 A;  2INW A;  4LRX C;  1GSX A;  3A0V A;  4I39 A;  2PYP A;  3CLO A;  5HZH A;  3UB6 A;  2KDK A;  4EXO A;  4PKY G;  3UB7 A;  1UWN X;  3H7W B;  3ULF A;  2P7J A;  1T1B A;  4WUJ A;  4HI4 A;  2EA9 A;  2J80 A;  3MXQ A;  3D72 A;  2W0N A;  3H82 A;  2JHE A;  4I38 A;  3LIB A;  4HH2 A;  4EW7 A;  5F68 A;  4WF0 A;  5HSQ A;  5HWT A;  4HJ4 A;  4NXG A;  2V0U A;  1D06 A;  2VEA A;  5DKK A;  4JGQ A;  1LT0 A;  2PR5 A;  4I3J A;  4F3L B;  2JN7 A;  5IU1 A;  3LYX A;  1OTI A;  4H6J B;  2ZBB A;  1MZU A;  2PD7 A;  2V1B A;  3F1N B;  5HWW A;  3P7N A;  4YWZ A;  3LIF A;  3LIA A;  5DKL A;  4HIA A;  2A24 B;  3E4P A;  1S1Z A;  1Y28 A;  5TBM B;  5F69 A;  4LPZ A;  3F1O A;  1XJ2 A;  5HDC A;  1XFN A;  5G4Z A;  1WA9 A;  3NOU C;  2L0W A;  1F9I A;  1S1Y A;  3K3D A;  2PR6 A;  1V9Z A;  5A8B A;  3E4O A;  4R6L A;  2PD8 A;  3EEH A;  1V9Y A;  4JGO A;  3F1P B;  4R3A A;  4RQ9 A;  3OLO A;  3LI9 A;  2A24 A;  4HP4 A;  3CWF A;  3GDI A;  2VLG A;  3HJK A;  4JGP A;  1S4S A;  4KQD A;  1T1C A;  4HY8 A;  2OOL A;  1T1A A;  2QJ7 A;  2QHK A;  2L1M A;  4KUK A;  2WKR A;  4BBT A;  1OJ5 A;  3CAX A;  4DJ3 A;  3SW1 A;  1LL8 A;  2QWS A;  4NXE A;  2KX6 A;  3RTY A;  4GS9 A;  4HHD A;  1S67 L;  1F98 A;  2M1C A;  4XT2 B;  3HJI A;  4HOI A;  5J7E A;  3UE6 A;  5F5Y A;  3MFX A;  1N9L A;  4LRY C;  3ICY A;  5AVF A;  3LID A;  2D02 A;  4HQA A;  3H7W A;  5J3W A;  1BYW A;  3MR0 A;  1TS6 A;  4L9G A;  5F6A A;  3MQQ A;  1VB6 A;  2YKF A;  4JGR A;  3GEC A;  2PDR A;  4WL9 A;  1T19 A;  2GJ3 A;  4LLO B; 
#chains in the Genus database with same CATH topology
 2RL3 A;  1P9W A;  2OWH A;  4B9O A;  3IWQ A;  3VE4 A;  2FH5 A;  3HUN A;  3V3S A;  5I5L A;  3MSH A;  4K91 A;  1LSV A;  3WRZ A;  3CIT A;  2XA7 M;  4S2L A;  1ESI A;  3OPL A;  1VET A;  2M7V A;  4G3K A;  3UO9 A;  4H6J A;  2IA2 A;  2WGV A;  4KG2 A;  2EX8 A;  1OT9 A;  2G7U A;  4DRT A;  1L3L A;  1GSW A;  4EWF A;  1Q2Q A;  2EX9 A;  3ITB A;  4R4S A;  1JWZ A;  4X53 A;  5HDS A;  4BL3 A;  1TD5 A;  4XUX A;  3UME A;  1TS7 A;  3CI6 A;  1DP9 A;  4IBR A;  3FWL A;  4WZ4 A;  5HAP A;  4Y3I A;  1DY6 A;  3MQO A;  1BZA A;  2WAD A;  1XJ6 A;  3S7P A;  3GTC A;  2Y4A A;  2ZQA A;  3G30 A;  3RXX A;  2V0W A;  4C3Q A;  4PM9 A;  4MLL A;  4H8R A;  4WN5 A;  1DJA A;  1W8Q A;  3CHW P;  2Y2H A;  3OC2 A;  5FQK A;  4UEY A;  1X0O A;  3FC7 A;  4MNR A;  1Q2P A;  2QJ5 A;  3SOI A;  4BBV A;  3S7N A;  4FSF A;  3A3J A;  2HP6 A;  2V1A A;  3B33 A;  2ZQD A;  4JPM A;  4O8G A;  4N1H A;  1H5X A;  1S66 L;  2JKF A;  1A0K A;  5A92 A;  3PXP A;  1FSW A;  5CTN A;  3N8L A;  3IBJ A;  3ISG A;  2BLS A;  5GLB A;  4KG6 A;  3UMD A;  1BTL A;  4ZJ3 A;  3MXS A;  4HH3 A;  4O7D A;  3BY9 A;  2BAS A;  5CGS A;  3QP4 A;  3RH8 B;  4S2K A;  2P08 A;  3EWK A;  3C38 A;  4KZ5 A;  5HFO A;  4R38 A;  1K54 C;  1H3Q A;  1N9O A;  4EET B;  3OCN A;  4OOY A;  5CHJ A;  5LBR A;  5EEC A;  3SS5 A;  3HVF A;  2JE5 A;  3NY4 A;  2J3T D;  2R9X A;  1NWZ A;  5CTM A;  3Q1F A;  2Z6D A;  2ZMF A;  5GHZ A;  5IS1 A;  2OLV A;  3NC8 A;  4MN6 A;  2ZC4 B;  4HBU A;  4EEU A;  3MFD A;  4MDZ A;  2WKE A;  4R23 A;  2W27 A;  2DCF A;  1DJB A;  3UB5 P;  2Y2I A;  3Q7Z A;  3M2J A;  3HLF A;  3V5M A;  4QY6 A;  1NXY A;  5EE8 A;  4E6X A;  3BFG A;  5DFY A;  1D7E A;  2HDQ A;  4NXF A;  2VV6 A;  3RXW A;  3C30 A;  3PAE A;  4O0P A;  1NRJ A;  3S7O A;  2H28 A;  4GZB A;  4DXB A;  4S2O A;  4F94 A;  3NBL A;  2V2F F;  3VP0 A;  2NUP C;  3O88 A;  4UQI S;  2INW A;  3ZG8 B;  2XD1 A;  3IXH A;  3A0V A;  3MZD A;  3BYD A;  3CLO A;  1KE4 A;  1KVL A;  4DKI A;  2H5S A;  3T4T A;  3T1R A;  3D3O A;  5HAQ A;  4DN0 A;  4GJ4 A;  3MKE A;  4KEN B;  3OPR A;  4WMC D;  3E0Y A;  2W1R A;  3MZE A;  5E2G A;  4HI4 A;  1K55 A;  3SH9 A;  2J80 A;  3VP4 A;  5HAR A;  5HX9 A;  3D4F A;  4RA7 A;  5EV0 A;  5HWT A;  4ZRR A;  5KMW A;  2O9C A;  3IXG A;  2V0U A;  5FQM A;  3HUO A;  1D06 A;  2VEA A;  1W79 A;  3KSH A;  1CF0 A;  2J3W A;  1KE0 A;  2ZQ8 A;  2PR5 A;  4PM8 A;  1MXO A;  4I3J A;  4Y7P A;  5IU1 A;  2ZBB A;  5EVE A;  3B3X A;  5L09 A;  4RVA A;  5G18 A;  3GMW A;  3GVB A;  5J8X A;  1JTD A;  4JXS A;  3MQ0 A;  3N6I A;  4KQQ A;  4PAU A;  4ESP A;  3EEA A;  2OAQ 1;  4K0X A;  4DE0 A;  4OQG A;  4R1G A;  3LIA A;  4KZ7 A;  4HIA A;  3E4P A;  3CG5 A;  1K25 A;  3IF5 A;  3UN7 A;  1PRQ A;  4QB8 A;  3L9K A;  5GHX A;  2H0T A;  5HDC A;  1CI8 A;  1KDW A;  4S2P A;  3C7V A;  3UE0 A;  2XA7 S;  5G4Z A;  1I5Q A;  3C7U A;  1Z09 A;  1F9I A;  3HBR A;  3QNC A;  1FOF A;  3K3D A;  1K56 D;  4R6L A;  2PD8 A;  3EEH A;  3WWX A;  4NG2 A;  2W3F A;  2GNX A;  1FR6 A;  3BFC A;  3WS5 A;  5MC7 A;  3BLS A;  3OLO A;  5E43 A;  1ZKJ A;  1XGI A;  2XD5 A;  3DAV A;  1CEF A;  4ARZ B;  1PYY A;  3BFD A;  3JVU A;  4UA9 A;  4GB7 A;  2QHK A;  1YQS A;  2L1M A;  4EBN A;  5FQQ A;  4BBT A;  1KGG A;  1OJ5 A;  3CAX A;  5DTK A;  1LL5 A;  1YPR A;  4E3M A;  4JXV A;  3ZG5 A;  1PZP A;  3BRM A;  2VJW A;  1JVJ A;  2VX8 A;  1YMS A;  1F98 A;  2EFX A;  1Y4O A;  4X56 A;  2M1C A;  5CGX A;  4XT2 B;  1BLH A;  1TF1 A;  4DE3 A;  5J7E A;  1STZ A;  4XUZ A;  5F5Y A;  3O86 A;  3ICY A;  3UNW A;  4DDY A;  4KQR A;  4MBF A;  4HQA A;  1RGY A;  1OME A;  4KZ3 A;  3MQQ A;  2YKF A;  3GEC A;  5KZH A;  1XA1 A;  5FSR A;  2FFF B;  3FKV A;  4OOL A;  4GCZ A;  3A3E A;  4QD4 A;  1MY8 A;  5HD5 A;  3EGD C;  1PNE A;  3WS0 A;  3PHY A;  5D3O A;  1NYY A;  5HW3 A;  1U60 A;  2PHY A;  3KX0 X;  3G32 A;  4NXB A;  1MKI A;  4LV1 A;  1YMX A;  4UQI M;  1LSW A;  2ZLY A;  2XRN A;  1GCE A;  1Y54 A;  3CUE A;  3HLW A;  1IFQ A;  2R78 A;  4YNR A;  3GRJ A;  3QP5 A;  1TS0 A;  2V1Z A;  3UPO A;  4EUV A;  1EI5 A;  1LSX A;  3W4Q A;  1DP8 A;  4G3W A;  5A90 A;  3GSG A;  3TSG A;  4CJN A;  4Y0O A;  3FG8 A;  1IYS A;  5HAI A;  5CHM A;  1BT5 A;  2QZ6 A;  3KSF A;  1FSY A;  3KSI A;  2EWV A;  5DJU A;  2PU2 A;  3RFB A;  4OPQ A;  3TRC A;  3LIE A;  1YSP A;  2HPB A;  5AQ9 A;  3HLG A;  2NUT C;  3IF6 B;  5EFW A;  1N9N A;  3ZVT A;  4HNB A;  5FAQ A;  1YAX A;  2Y2M A;  4ARZ A;  1XXM A;  4HES A;  3UB8 A;  3LCE A;  4I3I A;  3FZC A;  3JVV A;  3PBN A;  3LUQ A;  3O3V A;  3LEZ A;  2Y91 A;  1GA0 A;  5FL3 A;  2JBF A;  1GA9 A;  2VV7 A;  1XJ4 A;  4EU0 A;  4S2M A;  4WMC A;  3T1X A;  1P97 A;  3E2L A;  1AWI A;  1XJ3 A;  1P0Z A;  3SH8 A;  5FDS A;  5HD3 A;  3A0R A;  1PWG A;  4BMW A;  2WGW B;  3UPP A;  1K54 A;  4L9F A;  3KSG A;  4EER A;  3UB9 A;  3PBR A;  5TJJ A;  1OT6 A;  4LEN A;  3VOY A;  4EBP A;  4C6Y A;  4XT2 A;  2JCH A;  1CJF A;  4MMN A;  4JF5 A;  2OAP 1;  2A2L A;  1S4R A;  1XFQ A;  3DTK A;  5CER A;  4I3A A;  5HWV A;  3BY8 A;  3BEC A;  3G6O A;  4KUO A;  3LI8 A;  1T18 A;  1OTA A;  1YLP A;  1KE3 A;  5CEB A;  2JC7 A;  1TDG A;  3PBQ A;  2QMI A;  3T4L A;  4GD8 A;  4MBH A;  4EUZ A;  4WEL A;  4EEP A;  1K6R A;  4FD8 A;  4L0L A;  3M6B A;  2J3T C;  4B4Z A;  3CUE C;  4IUK A;  1K57 A;  3IX3 A;  4Y5F A;  2KLI A;  4HJ3 A;  3GQZ A;  2I72 A;  5FQ9 A;  3MZF A;  4X6T A;  1ESU A;  4EQ1 A;  2AVX A;  4GS9 B;  3VSK A;  4D2O A;  2G2U A;  4X1M A;  2HJ9 C;  3RJU A;  4O01 A;  4LRX C;  4ZBE A;  4IED A;  3BEB A;  1LI0 A;  2ZQ7 A;  5HZH A;  3PR6 A;  4EV4 A;  1OPX A;  3V50 A;  1K56 A;  3HL9 A;  4PKY G;  3UB7 A;  1TDL A;  3KYE A;  3HLB A;  3VFH A;  2DNS A;  3S1Y A;  3T4Q A;  3MXQ A;  4OQI A;  2W0N A;  4GN2 A;  3IX8 A;  4P6B A;  2VA0 A;  5FQI A;  5IHV A;  3MMH A;  4EQI A;  1NZO A;  2Y55 A;  3UY6 A;  4HJ4 A;  1QMF A;  3G34 A;  1C3B A;  5TGF A;  3V67 A;  4KQO A;  2KOI A;  5DKK A;  4JGQ A;  2ZL1 B;  3PBO A;  2R9W A;  4ZAM A;  1PIO A;  5EM0 A;  1K6S A;  3IF6 A;  4WBG A;  1JWP A;  4S2N A;  3ZCZ A;  4CLC E;  4U0X A;  3LYX A;  1BSG A;  4WZ5 A;  4E3O A;  1N4O A;  2XFS A;  5FDH A;  3F1N B;  5L10 A;  5L8M A;  2FZ0 A;  1F5M A;  2HDU A;  1Z6F A;  2RCX A;  3P7N A;  3BW6 A;  3LIF A;  3FYZ A;  2EXB A;  5DKL A;  2ZMA A;  4KZB A;  4OP8 A;  4DE1 A;  3L7H A;  4PMA A;  3TJZ C;  3UDI A;  4DF6 A;  3IT9 A;  4WM9 A;  2WGW A;  3VP3 A;  4PHT A;  4Y2F A;  1VEU A;  5AQB A;  3MF0 A;  3DTM A;  2E8I A;  3OCL A;  3N7W A;  1XJ2 A;  2XK1 A;  3HLC A;  3ZFZ A;  5DF7 A;  5EM1 A;  4ME4 A;  3T4S A;  2Z2M B;  3NOU C;  1YSQ A;  1FQG A;  2EX6 A;  1S1Y A;  1K57 C;  1PI5 A;  2VGJ A;  2X02 A;  1IYP A;  2LB5 A;  1YT4 A;  1VQQ A;  4JGO A;  1F2K A;  1MWR A;  5F1G A;  2XH9 A;  1W5D A;  1XGJ A;  5TR7 A;  4RQ9 A;  2ZM2 A;  3G31 A;  3M2K A;  3QP6 A;  3LI9 A;  4MCW A;  5HL6 A;  3NCK A;  2PU4 A;  3CWF A;  4B88 A;  2XFT A;  4U3T A;  2GZA A;  2B18 A;  4P87 A;  2O9A A;  2ZQC A;  2EXA A;  1E3U D;  3P98 A;  3DTI A;  3NDE A;  4D60 A;  4R3B A;  1YLZ A;  4GDB A;  5DF9 A;  4X25 A;  2VGL S;  5GLD A;  2WKR A;  3MBZ A;  1MBL A;  1KVM A;  5CEC A;  3N8R A;  1ERM A;  4NXE A;  3T12 B;  1G68 A;  3EOI A;  2KX6 A;  3VP2 A;  4GS9 A;  4LV3 A;  4IVI A;  4P0M A;  1S0W A;  1ERQ A;  3N8S A;  2Y2L A;  3MFX A;  3LR5 A;  4LRY C;  5BOH A;  2ZM0 A;  2W3H A;  2Q9N A;  4BD1 A;  1ZC2 A;  1TS6 A;  4L9G A;  4MBK A;  3ZVW A;  1LHY A;  5F6A A;  3IF6 C;  1YM1 A;  4S2N C;  4QU3 A;  4OKP A;  4OPR A;  4WZ5 C;  2GJ3 A;  2Y2Q A;  4U0T A;  1NLY A;  4GD6 A;  4NK3 A;  2Y2N A;  3VMA A;  3FPW A;  3NHQ A;  3OBF A;  1W7F A;  2YKH A;  2X01 A;  4WEK A;  2JKG A;  1EWZ A;  5F1F A;  3OPH A;  2WK0 A;  2ZL1 A;  3IH9 A;  4GHI B;  2ZC6 B;  4HJ6 A;  3G2Y A;  1IYQ A;  3E2K A;  3S4X A;  4K08 A;  4BWI A;  4ETX A;  5EPH A;  3R4K A;  2W1T B;  4IVK A;  1MWT A;  1IOU A;  4BD0 A;  3C4O A;  2WGI A;  3HLD A;  4FH2 A;  3UDX A;  3WRT A;  2WAF A;  3F1N A;  3IWI A;  2H10 A;  4NKP A;  2EX2 A;  4PM6 A;  2JKT I;  5FI6 A;  4KZ6 A;  5G4Y A;  1FR1 A;  2G2W A;  5E2H A;  5DJT A;  1ALQ A;  2J7V A;  3Q7V B;  2W3G A;  2CMN A;  5M18 A;  2OLU A;  2I9V A;  4BBU A;  1EW0 A;  5GHY A;  3LFV A;  3B47 A;  2WYX A;  4LRZ E;  3EGX C;  2UV0 E;  5EOE A;  1OTB A;  2Z6C A;  4FH4 A;  3IX4 A;  3GR2 A;  2O99 A;  1TS8 A;  4RX3 A;  3TOI A;  1ES3 A;  3ZNT A;  1XA7 A;  1W8Y A;  4Q8I A;  2XSS A;  2OWJ A;  1HZO A;  1VM1 A;  2HDS A;  2Y2K A;  5CGW A;  1CEG A;  1JNU A;  4LGW A;  2V9A A;  3C5A A;  1W63 M;  4IBX A;  4E3L A;  4M4X A;  3IQA A;  4DJ2 A;  3I7J A;  2L4R A;  1DJC A;  4N9K A;  1WE4 A;  4BEN A;  1ODV A;  1SDE A;  3ZQ5 A;  3H9W A;  3NEC A;  3IBR A;  2B02 A;  3O5Y A;  3LEQ A;  2PRF A;  5CRF A;  3F1O B;  3SZT A;  3MXR A;  2WKH A;  3Q81 A;  3WS1 A;  4ZJ2 A;  2PBY A;  4P6Z S;  1GSV A;  3W4O A;  4CLC C;  2XF3 A;  4X68 A;  3TG9 A;  4AFI A;  1DP6 A;  3E4Q A;  4DXC A;  2IWD A;  2A49 A;  3JYI A;  2Q0O A;  5JYO A;  4JBF A;  3C8C A;  2ZQ9 A;  4OQH A;  2HGV A;  2ZMV A;  4WLA A;  3VV4 A;  4KZA A;  3MJQ A;  4YOF A;  2XLN A;  3JPU A;  5FI7 A;  4ZJ1 A;  1ZHH B;  5EVI D;  1ONH A;  2E8J A;  5U47 A;  4KZ8 A;  4GHI A;  3EQU A;  2JKR I;  4YIN A;  1ZG6 A;  1ES4 A;  2VGL M;  3Q82 A;  2WKI A;  4RYE A;  4LV2 A;  4DE2 A;  2A3U A;  2J8Y A;  2HJE A;  2W1T A;  3CPT B;  1L0D A;  2FFY A;  1BUE A;  5FI2 A;  1GSX A;  1NY0 A;  1ONG A;  3NIA A;  2DRW A;  3DWK A;  4I39 A;  4OLD A;  4Q0J A;  3WS2 A;  3FKW A;  2PYP A;  4M3K A;  3UB6 A;  2KDK A;  2J9P A;  3IHA A;  3V3R A;  1BLC A;  1UWN X;  3ULF A;  4PPR A;  2P7J A;  2V20 A;  5IT5 A;  4WUJ A;  4UHU A;  1HD8 A;  3A3D A;  3ZDJ A;  3HCY A;  1GHP A;  2JHE A;  2C5W B;  4HH2 A;  3Q7V A;  4EW7 A;  5F68 A;  1MPL A;  1E3U A;  3C4P A;  4WF0 A;  4E3K A;  4CLC D;  4Q0H A;  1G6O A;  3T1S A;  4GKU A;  3ZGA B;  2Z2L B;  3QP8 A;  1CI9 A;  5AJG A;  1LT0 A;  3T1Q B;  1TEM A;  4DDS A;  2XQZ A;  4Y17 A;  1VEU B;  1H8M A;  4CPK A;  2P74 A;  2VGK A;  4QJG A;  4A5R A;  4QWO A;  5FQJ A;  4F3L B;  2HZ5 A;  3ZG0 A;  2PD7 A;  4HBT A;  2VKS A;  3P01 A;  5AQA A;  3D9Y A;  2HP9 A;  1L0F A;  2QPN A;  4QY5 A;  4II7 A;  4YWZ A;  1O7E A;  5FAT A;  2O0Y A;  2B95 A;  4ID4 A;  1FIL A;  3OPP A;  3V39 A;  1BLP A;  1J3W A;  5TBM B;  1ERO A;  5F69 A;  1NJ4 A;  4LPZ A;  5FAO A;  5EUA A;  4BQM A;  1M6K A;  2XRO A;  3UE1 A;  3F1O A;  1K4E A;  4WYY A;  4GNU A;  1LI9 A;  1XFN A;  3SS3 A;  2GDN A;  2WAE A;  5EVI B;  4BL2 A;  3U2A A;  1V9Z A;  3E4O A;  1RP5 A;  3E98 A;  1V9Y A;  4R3J A;  3F1P B;  1K38 A;  3UPN A;  4R3A A;  1FIK A;  2A24 A;  3N4I A;  1YLW A;  2PAV P;  2VLG A;  4UA7 A;  4JGP A;  3ZG9 B;  1IKI A;  4OOM A;  2VZW A;  1XX2 A;  1ACF A;  2BG1 A;  3KYZ A;  4KQD A;  1T1C A;  4NEE D;  2OOL A;  3EQV A;  2QJ7 A;  1H0M A;  4KUK A;  2ZD8 A;  5GL9 A;  3W2Z A;  3QHY A;  4DMZ A;  3BFE A;  5DFX A;  4DJ3 A;  3LGO A;  3SW1 A;  3FV7 A;  3PBS A;  2QWS A;  4LCL A;  1IKG A;  1GHM A;  4IJG A;  1E4D A;  2ZC3 B;  4HHD A;  1FCM A;  3CPT A;  1S67 L;  4OON A;  3QNB A;  5M1A A;  1JWV A;  4CLC B;  4ETZ A;  1KDS A;  3HJI A;  3HLE A;  4HOI A;  1H8Z A;  1ES5 A;  3FPV A;  3ZHH A;  2B5R A;  4K0W A;  3LID A;  4E3J A;  3Q07 A;  4E3I A;  4P6Z M;  3W8K A;  1BYW A;  3MR0 A;  5J3W A;  1CK3 A;  1AXB A;  2O9B A;  4P85 A;  5CXW A;  1VB6 A;  2PDR A;  2P04 A;  1KGE A;  4WL9 A;  4Z1W A;  4LCM A;  1PWD A;  2ZJ9 A;  5JYP A;  4E3N A;  1S6R A;  3QP2 A;  2MJ6 A;  4L9E A;  3HRE A;  1P9R A;  1MKM A;  5E2E A;  4MN5 A;  3S22 A;  2Q9M A;  1G5U A;  4I5S A;  1BUL A;  2WZZ A;  1MC0 A;  3CMZ A;  3LO7 A;  4JF4 A;  4ZDX A;  1QME A;  4OQ0 A;  4F3L A;  5EOO A;  3IS2 B;  3LIC A;  5HDD A;  2WKP A;  2EFU A;  3NJA A;  4HP9 A;  2JKT M;  1SZV A;  3VSL A;  4RX2 A;  4OVD A;  2Y2O A;  3AGE A;  1D1J A;  1KGF A;  1ES2 A;  2K31 A;  2PYR A;  3DWZ A;  4CQH A;  4QPR A;  5TBM A;  3BWL A;  3VE3 A;  4FTX A;  3H82 B;  1UGU A;  2P9V B;  4B4X A;  4S2J A;  3PTE A;  3T50 A;  2Y2G A;  1I2S A;  3UE3 A;  3A3F A;  4X69 A;  5EVI A;  5GLC A;  4ZTK A;  3ZYT A;  3F1P A;  1KOU A;  2QKP A;  3K3C A;  3NOP C;  2XR0 A;  2ZOI A;  3T4O A;  2ZOH A;  3ZNY A;  3IWO A;  3DTE A;  2CC1 A;  1WYB A;  3T4J A;  1XP4 A;  5DF8 A;  3A0S A;  2H0Y A;  5FAP A;  4PM5 A;  2HP5 A;  1OTE A;  4E04 A;  3VP1 A;  3PYP A;  1SKO B;  4R0Q A;  5C5K A;  3VOL A;  1YLJ A;  5E2F A;  3R7W B;  3SS4 A;  3GV9 A;  1DRM A;  4MN7 A;  1CQA A;  2VK3 A;  1W63 Q;  3ZG7 B;  5HPF A;  5CX7 A;  2Y2P A;  1OJG A;  4LFU A;  4OPY A;  5A93 A;  3CJM A;  3M6H A;  3NOT C;  2M7U A;  1I2W A;  1SCW A;  1NRF A;  3SH7 A;  4CLC A;  3ITA A;  4Y13 A;  1E25 A;  2PT7 A;  2DMW A;  2XEP A;  3KYQ A;  5KIZ A;  3O87 A;  2WZX A;  4PKY A;  3NI9 A;  2D01 A;  1J9M A;  1O07 A;  5J4E A;  2VV8 A;  3BQA A;  4N92 A;  3CZD A;  5KSH A;  1XKZ A;  1IEL A;  3AGF A;  2OSU A;  1M40 A;  4LV0 A;  5DTS A;  1JTG A;  3IHB A;  3BM6 A;  5K5B A;  5F83 A;  1H8Y A;  1SHV A;  1UWP X;  5FEG A;  4EES A;  5AVE A;  3LY4 A;  1TVF A;  4Q0I A;  2HV1 A;  2Y59 A;  3UDF A;  3P09 A;  4PM7 A;  1ZTU A;  3BJN A;  2WKQ A;  4R70 A;  1IYO A;  2K7S A;  1OTD A;  4B93 A;  2BTF P;  2JKR M;  1PW1 A;  3C2W A;  3LY3 A;  2LB9 A;  4KZ4 A;  1G28 A;  4GW9 A;  5DVA A;  1PWC A;  3BQ8 A;  3QP1 A;  1WYC A;  4JKT A;  1NZU A;  3PAG A;  3IS2 A;  1HTZ A;  1LL9 A;  4GDN A;  1RCJ A;  3A3I A;  5HPI A;  1BLS A;  2GX5 A;  5EVI C;  2WUQ A;  2UWX A;  4EXO A;  5AQ7 A;  5M19 A;  5HL1 A;  3HUM A;  2ZM8 A;  3H7W B;  4QHC A;  1T1B A;  4UAA A;  5CHU A;  4HEF A;  2EA9 A;  4GLQ A;  4JXG A;  4OP5 A;  3D72 A;  3K2N A;  3H82 A;  1RGZ A;  4I38 A;  3LIB A;  2P9V A;  1K55 C;  3WS4 A;  3NUL A;  3G4P A;  5HSQ A;  1PI4 A;  4NET A;  4X55 A;  1SKF A;  3LR3 A;  4NXG A;  1NYM A;  5GLA A;  1G6A A;  4BJP A;  5L07 A;  4Y15 A;  3U4L P;  3PBT A;  1XPB A;  1YLY A;  4EBL A;  5FEF A;  2ZC5 B;  4N9L A;  5L2F A;  1VET B;  3B42 A;  4XXR A;  4FOF A;  4Z9Q A;  1HLU P;  1FCN A;  2IWC A;  3DW0 A;  2JN7 A;  4N1X A;  3OOV A;  1YLT A;  1PFL A;  1OTI A;  4H6J B;  4OH0 A;  1MZU A;  3VFF A;  4UA6 A;  2V1B A;  1N9B A;  4Y0T A;  5HWW A;  5CED A;  3LR4 A;  5DTT A;  2W3E A;  3W4P A;  3LR0 A;  1SKO A;  4FUW A;  2ZC7 A;  3R7W A;  2A24 B;  1S1Z A;  1Y28 A;  2K2N A;  1K4F A;  3OZH A;  1L0G A;  4C75 A;  5EVL A;  4MEZ A;  3T4K A;  3G35 A;  1IEM A;  2QYB A;  3AGD A;  4S2I A;  4JLF A;  4OLG A;  3S7Q A;  5FAS A;  3TE8 A;  1PZO A;  4G3V A;  4IUH A;  2Y2J A;  1WA9 A;  1FCO A;  2L0W A;  2ACG A;  2PR6 A;  5A8B A;  2J9O A;  1MWS A;  2C6W B;  5FA7 A;  2HDR A;  2X71 A;  2EWW A;  1GHI A;  4HP4 A;  3GDI A;  4BLM A;  3IXB A;  2XGN A;  3HJK A;  3IH8 A;  2V8C A;  1S4S A;  3VOZ A;  2HF6 A;  4HY8 A;  1MWU A;  1PW8 A;  3MS6 A;  1T1A A;  5KSC A;  3BLM A;  4Y0U A;  5TFQ A;  4E6W A;  2W3D A;  4YFM A;  5I94 A;  4X1L A;  3DBA A;  2XDM A;  4GOG A;  4KG5 A;  2Y8H A;  1LL8 A;  2OV5 A;  3TW8 A;  5F82 A;  4R4R A;  4JXW A;  2Y79 A;  5A91 A;  3RTY A;  1YKD A;  2V8F A;  2PBD P;  2IWB A;  1NLZ A;  3UE6 A;  1SDN A;  4OPZ A;  1N9L A;  1L0E A;  1LLB A;  3MKF A;  5AVF A;  2D02 A;  3IXD A;  1L2S A;  4WEJ A;  3H7W A;  4JF6 A;  3KO6 A;  4KZ9 A;  4IHQ A;  1K0K A;  3G2Z A;  1VHM A;  4JGR A;  1HVB A;  3NDG A;  1T19 A;  4FCF A;  3BFF A;  1ZG4 A;  4LLO B; 
#chains in the Genus database with same CATH homology
 1P9W A;  3FPW A;  2OWH A;  3NHQ A;  3OBF A;  2YKH A;  4B9O A;  2MJ6 A;  4WEK A;  4OOL A;  4L9E A;  1P9R A;  1MKM A;  3VE4 A;  2FH5 A;  4GCZ A;  4MN5 A;  4I5S A;  5I5L A;  4GHI B;  4HJ6 A;  5HD5 A;  1MC0 A;  3EGD C;  1LSV A;  3CIT A;  2XA7 M;  4K08 A;  4BWI A;  3PHY A;  4ETX A;  3R4K A;  2PHY A;  4F3L A;  2M7V A;  2W1T B;  4G3K A;  3IS2 B;  1IOU A;  3LIC A;  3KX0 X;  4NXB A;  4H6J A;  5HDD A;  2IA2 A;  2WKP A;  3NJA A;  3F1N A;  4UQI M;  1LSW A;  4HP9 A;  2XRN A;  1OT9 A;  4NKP A;  2JKT M;  2G7U A;  3CUE A;  1GSW A;  1IFQ A;  2R78 A;  4YNR A;  2JKT I;  2K31 A;  1TS0 A;  2PYR A;  5HDS A;  4EUV A;  1TD5 A;  3UME A;  4CQH A;  1LSX A;  1TS7 A;  1DP8 A;  3CI6 A;  4QPR A;  1DP9 A;  5G4Y A;  5TBM A;  3BWL A;  3VE3 A;  4G3W A;  4Y3I A;  3MQO A;  1XJ6 A;  3H82 B;  3S7P A;  1UGU A;  5DJT A;  3FG8 A;  2W3G A;  2CMN A;  2V0W A;  3T50 A;  2I9V A;  4BBU A;  4WN5 A;  3KSF A;  1EW0 A;  3KSI A;  2EWV A;  5DJU A;  3OC2 A;  3RFB A;  4UEY A;  3LFV A;  3UE3 A;  3B47 A;  1X0O A;  4LRZ E;  3TRC A;  3EGX C;  3FC7 A;  3LIE A;  3ZYT A;  2QJ5 A;  1OTB A;  2Z6C A;  4BBV A;  1YSP A;  3F1P A;  3S7N A;  4FSF A;  1KOU A;  2QKP A;  2V1A A;  2O99 A;  2NUT C;  1TS8 A;  3B33 A;  3K3C A;  5EFW A;  1N9N A;  3NOP C;  2ZOI A;  3T4O A;  2XSS A;  4O8G A;  4HNB A;  2OWJ A;  2ZOH A;  1S66 L;  1YAX A;  4ARZ A;  1JNU A;  2V9A A;  3UB8 A;  3T4J A;  3PXP A;  3A0S A;  1W63 M;  4I3I A;  4M4X A;  1OTE A;  3JVV A;  4DJ2 A;  4E04 A;  3IBJ A;  2L4R A;  3PYP A;  3PBN A;  3LUQ A;  3UMD A;  5C5K A;  1ODV A;  5FL3 A;  3VOL A;  2VV7 A;  1XJ4 A;  3R7W B;  4HH3 A;  4EU0 A;  1DRM A;  3ZQ5 A;  1P97 A;  3BY9 A;  2BAS A;  4MN7 A;  3H9W A;  1XJ3 A;  3IBR A;  2B02 A;  1W63 Q;  5HPF A;  1P0Z A;  3O5Y A;  5HD3 A;  3A0R A;  5CX7 A;  4BMW A;  3RH8 B;  1OJG A;  4L9F A;  2P08 A;  3EWK A;  3F1O B;  3C38 A;  3KSG A;  4EER A;  3UB9 A;  3NOT C;  3PBR A;  2M7U A;  5TJJ A;  1OT6 A;  4R38 A;  1H3Q A;  4CLC A;  4XT2 A;  1N9O A;  4EET B;  3OCN A;  4P6Z S;  1GSV A;  4MMN A;  2PT7 A;  2DMW A;  3KYQ A;  2OAP 1;  4CLC C;  5KIZ A;  5LBR A;  4PKY A;  2D01 A;  2J3T D;  5J4E A;  1NWZ A;  2VV8 A;  2A2L A;  1S4R A;  3BQA A;  5KSH A;  1XFQ A;  2Z6D A;  2ZMF A;  4I3A A;  5HWV A;  3BY8 A;  4AFI A;  5IS1 A;  1DP6 A;  4MN6 A;  3E4Q A;  3G6O A;  4KUO A;  3LI8 A;  4EEU A;  4MDZ A;  1T18 A;  1OTA A;  5K5B A;  2W27 A;  3PBQ A;  1UWP X;  4EES A;  5AVE A;  3T4L A;  3C8C A;  4Q0I A;  4WEL A;  2HV1 A;  4EEP A;  2HGV A;  2ZMV A;  4WLA A;  1ZTU A;  3VV4 A;  3MJQ A;  4YOF A;  4L0L A;  3BJN A;  2WKQ A;  4R70 A;  2J3T C;  5DFY A;  1D7E A;  1OTD A;  2K7S A;  3CUE C;  4IUK A;  4NXF A;  4B93 A;  2VV6 A;  3C30 A;  4O0P A;  1ZHH B;  2JKR M;  4Y5F A;  2KLI A;  1NRJ A;  3S7O A;  3C2W A;  2H28 A;  4HJ3 A;  4GHI A;  2LB9 A;  1G28 A;  4GW9 A;  3EQU A;  2JKR I;  3BQ8 A;  2VGL M;  4EQ1 A;  4GS9 B;  2W1T A;  2HJE A;  3IS2 A;  2NUP C;  4UQI S;  2INW A;  2HJ9 C;  4O01 A;  1GSX A;  4LRX C;  3A0V A;  5HPI A;  4I39 A;  4Q0J A;  2PYP A;  3CLO A;  5HZH A;  3PR6 A;  3T4T A;  2GX5 A;  3D3O A;  1OPX A;  3UB6 A;  2KDK A;  4DN0 A;  4EXO A;  4GJ4 A;  4PKY G;  3UB7 A;  1UWN X;  3H7W B;  3ULF A;  2P7J A;  3E0Y A;  2W1R A;  1T1B A;  5IT5 A;  4WUJ A;  4HI4 A;  2EA9 A;  4GLQ A;  3T4Q A;  2J80 A;  3MXQ A;  3D72 A;  3K2N A;  2W0N A;  3HCY A;  3H82 A;  2JHE A;  4I38 A;  3LIB A;  4HH2 A;  2VA0 A;  4EW7 A;  5F68 A;  3MMH A;  4WF0 A;  5HSQ A;  5HWT A;  4ZRR A;  4CLC D;  4HJ4 A;  4Q0H A;  2O9C A;  1G6O A;  3LR3 A;  4NXG A;  3V67 A;  2V0U A;  4BJP A;  4KQO A;  2KOI A;  1D06 A;  2VEA A;  5DKK A;  4JGQ A;  3KSH A;  5AJG A;  1LT0 A;  2J3W A;  3PBO A;  3PBT A;  2PR5 A;  1H8M A;  3B42 A;  4I3J A;  4FOF A;  4F3L B;  2JN7 A;  5IU1 A;  4CLC E;  3OOV A;  3LYX A;  1OTI A;  4H6J B;  2ZBB A;  1MZU A;  2PD7 A;  2V1B A;  2VKS A;  3P01 A;  3F1N B;  5L8M A;  5HWW A;  2FZ0 A;  3LR4 A;  1F5M A;  3MQ0 A;  2W3E A;  3LR0 A;  4PAU A;  3P7N A;  4II7 A;  4YWZ A;  3BW6 A;  3LIF A;  2O0Y A;  2OAQ 1;  3EEA A;  3R7W A;  3LIA A;  5DKL A;  4HIA A;  2A24 B;  3E4P A;  1S1Z A;  1Y28 A;  2K2N A;  5TBM B;  5F69 A;  3TJZ C;  4LPZ A;  3T4K A;  2XRO A;  4PHT A;  4Y2F A;  3F1O A;  3MF0 A;  2QYB A;  3OCL A;  1XJ2 A;  5HDC A;  3S7Q A;  3TE8 A;  4G3V A;  4IUH A;  2XA7 S;  1XFN A;  5G4Z A;  1WA9 A;  4ME4 A;  3T4S A;  1YSQ A;  3NOU C;  2L0W A;  1F9I A;  1S1Y A;  3K3D A;  3U2A A;  2PR6 A;  1V9Z A;  5A8B A;  2LB5 A;  3E4O A;  4R6L A;  3E98 A;  2PD8 A;  3EEH A;  1V9Y A;  4JGO A;  3F1P B;  2W3F A;  2GNX A;  4R3A A;  2EWW A;  4RQ9 A;  5MC7 A;  3OLO A;  3LI9 A;  2A24 A;  4MCW A;  5HL6 A;  4HP4 A;  3CWF A;  3GDI A;  2VLG A;  3HJK A;  2GZA A;  2B18 A;  4ARZ B;  4JGP A;  2O9A A;  3JVU A;  4OOM A;  2VZW A;  1S4S A;  3KYZ A;  2HF6 A;  4KQD A;  1T1C A;  4NEE D;  4HY8 A;  2OOL A;  1T1A A;  3EQV A;  2QJ7 A;  2QHK A;  2L1M A;  4KUK A;  5DF9 A;  2W3D A;  2VGL S;  3W2Z A;  2WKR A;  4BBT A;  4DMZ A;  1OJ5 A;  3CAX A;  5DFX A;  3DBA A;  4DJ3 A;  2Y8H A;  3SW1 A;  1LL8 A;  3PBS A;  2QWS A;  3TW8 A;  4IJG A;  4NXE A;  3EOI A;  2KX6 A;  2Y79 A;  3RTY A;  4GS9 A;  4HHD A;  2VJW A;  1YKD A;  1S67 L;  2VX8 A;  1F98 A;  2M1C A;  4CLC B;  4ETZ A;  4XT2 B;  3HJI A;  4HOI A;  1TF1 A;  5J7E A;  1STZ A;  1NLZ A;  3UE6 A;  5F5Y A;  3FPV A;  3MFX A;  3LR5 A;  1N9L A;  4LRY C;  3ICY A;  5AVF A;  3LID A;  2W3H A;  2D02 A;  4P6Z M;  4HQA A;  4WEJ A;  3H7W A;  1BYW A;  3KO6 A;  3MR0 A;  5J3W A;  4IHQ A;  1TS6 A;  4L9G A;  2O9B A;  5F6A A;  3MQQ A;  1VB6 A;  1VHM A;  2YKF A;  4JGR A;  3GEC A;  2PDR A;  2P04 A;  1T19 A;  4WL9 A;  2GJ3 A;  1NLY A;  4Z1W A;  4LLO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...