2OWHA

Structure of an early-microsecond photolyzed state of co-bjfixlh
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
116
structure length
116
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Time-resolved crystallographic studies of the heme domain of the oxygen sensor FixL: structural dynamics of ligand rebinding and their relation to signal transduction.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Oxygen storage/transport
molecule keywords Sensor protein fixL
total genus 29
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2owhA00
5A8BA 4E04A 2Z6DA 3K3CA 1D06A 3NOUC 5AVFA 3T50A 2Z6CA 4MN5A 1JNUA 1GSVA 4HI4A 3E4QA 3IS2A 1TS6A 2JHEA 2M1CA 3MXQA 3IS2B 1F9IA 2GJ3A 4HH3A 1DRMA 1V9ZA 3F1OB 1XJ6A 4HJ6A 5J3WA 1EW0A 3PYPA 4EXOA 1X0OA 2INWA 2PR5A 5F68A 4GW9A 4PKYA 3LIEA 3UB7A 4I39A 1UWPX 1T1CA 2V1BA 4I5SA 4GS9A 4NXGA 3H82B 1LL8A 1OTEA 1VB6A 2L0WA 1UGUA 4XT2A 3RTYA 2WKQA 2YKHA 3CLOA 5TBMB 1S4RA 3VE3A 2QJ5A 4RQ9A 1OTBA 3LIDA 2OWJA 4L9GA 3P7NA 4LRXC 1TS8A 1G28A 2K7SA 4NXEA 2D01A 4BBTA 5HZHA 2YKFA 1XFQA 5IU1A 2BASA 3BY8A 3LIFA 3UB8A 1XJ4A 2V0WA 2ZBBA 4HQAA 5G4ZA 3UB6A 3MJQA 2B02A 5AVEA 4K08A 1S4SA 3CAXA 3LICA 3MR0A 4WN5A 4EETB 5KIZA 1DP9A 1BYWA 3VE4A 3EEHA 3MQQA 4EESA 5J4EA 4R38A 3ULFA 4HY8A 2KX6A 5HWWA 4JGOA 1OT6A 1T1BA 4HJ4A 4EERA 4KUOA 1LSXA 4LRYC 4I3JA 4KQDA 1OTIA 2PR6A 5HDCA 3VOLA 2VV7A 1OJGA 3H7WA 2A24A 3E4PA 4HNBA 3F1PB 3F1NB 2KDKA 3LI8A 4F3LA 1DP6A 2JN7A 4JGQA 4HIAA 2I9VA 4GCZA 1LT0A 2D02A 2WKPA 4GHIB 3IBRA 1P97A 3HJIA 3K3DA 3H9WA 2ZOHA 3A0RA 3PHYA 4MN6A 4H6JB 5DJUA 4WLAA 4EW7A 2QWSA 2W27A 4R3AA 5IS1A 4WL9A 1LSWA 4YWZA 1N9NA 2QHKA 1OJ5A 5I5LA 1Y28A 2EA9A 2PYPA 5DKLA 2PHYA 5HDDA 1N9OA 4PKYG 4HHDA 4EEPA 4H6JA 5F69A 3NHQA 5HWTA 5J7EA 4B9OA 1T18A 4L9FA 1V9YA 2CMNA 4EQ1A 3MQOA 2VV6A 1S1YA 1D7EA 1OTAA 2V0UA 3F1PA 2A24B 2VV8A 1NWZA 3LI9A 3MFXA 2PDRA 2QKPA 2V9AA 2R78A 1S66L 4L9EA 4I3AA 3UMDA 2J80A 1N9LA 1TS0A 4JGPA 2V1AA 3ZQ5A 3EWKA 5F6AA 3LIAA 4NXBA 1LSVA 5HD5A 3UE6A 1OTDA 3OLOA 4R70A 3FG8A 3NOTC 3G6OA 4DJ2A 3E4OA 3BWLA 1T1AA 4WUJA 5G4YA 3D72A 3GECA 4HP9A 2PD7A 3SW1A 3UMEA 5HSQA 2OWHA 1XFNA 3C2WA 2L1MA 3KX0X 4LRZE 3LIBA 5DJTA 5HD3A 3F1NA 1S67L 3ICYA 4LPZA 1F98A 4XT2B 2W0NA 2HV1A 3H7WB 4HH2A 5EFWA 4M4XA 4EEUA 2H28A 1GSWA 1WA9A 2OOLA 1UWNX 3C8CA 2WKRA 4HJ3A 4I38A 4JGRA 1MZUA 1XJ2A 4WF0A 3LUQA 2PYRA 3B33A 4GHIA 5TBMA 1T19A 5HWVA 3NOPC 5HDSA 1OT9A 5DKKA 4DJ3A 2VEAA 1KOUA 4GS9B 3BY9A 4F3LB 2VLGA 2L4RA 1XJ3A 3A0VA 3GDIA 2ZOIA 4HOIA 1DP8A 3CWFA 4R6LA 1S1ZA 4KUKA 4NXFA 4LLOB 3HJKA 3RH8B 4BBVA 3A0SA 3F1OA 3NJAA 1TS7A 2PD8A 3UB9A 1GSXA 4BBUA 4HP4A 4I3IA 1ODVA 1P0ZA 2P7JA 5F5YA 2QJ7A 3H82A 3LYXA 3FC7A
chains in the Genus database with same CATH superfamily
4D60A 2JHEA 4N92A 3IS2B 3FKWA 2VKSA 3UB7A 4DE2A 2V1BA 3Q81A 4NXGA 4XT2A 4UA6A 2OAP1 1ES4A 4NXEA 4ETZA 1GHPA 3BFFA 3SZTA 2YKFA 3MXRA 2ZBBA 4HQAA 1EWZA 3GMWA 4N1XA 1MWSA 4U3TA 3WWXA 4UAAA 2R9WA 3S7NA 4GD6A 3MBZA 3Q82A 4HY8A 2KX6A 4YFMA 1E4DA 2G7UA 3NDGA 1KGGA 1QMEA 1VETA 4XXRA 2I9VA 4GD8A 3H9WA 3IF6A 4N1HA 2HDQA 3IH9A 2PHYA 4KZ7A 4PMAA 4H6JA 3FPVA 2A3UA 4OKPA 3UDXA 3PBNA 5U47A 1XXMA 4Q0IA 2Q9NA 2VGKA 3O5YA 2R78A 1N9LA 2XRNA 4QJGA 3PXPA 5F6AA 4OONA 3KYEA 3MQ0A 3FG8A 2HP6A 1MC0A 5DFYA 5E43A 4EEUA 1DJCA 3MXSA 3UE3A 4KZAA 1HLUP 4DN0A 1PW8A 4NETA 5HDSA 2VEAA 1BSGA 3ZG5A 3VP2A 1YLTA 4CPKA 1DP8A 2B5RA 3NJAA 3B42A 1XGJA 2V1ZA 3U2AA 1D06A 3T50A 4MN5A 1ES2A 4LCLA 3BLMA 2W3HA 4S2OA 5DF8A 5J3WA 1DRMA 2XQZA 1EW0A 5F68A 2XFSA 4ZJ3A 4WM9A 2L0WA 2LB5A 2Y2IA 5E2GA 2ZM2A 1N4OA 2QJ5A 4RQ9A 2FZ0A 2PU2A 3UB6A 3S7PA 3BM6A 5AVEA 3LEZA 2VX8A 4YOFA 5KIZA 1YLJA 5J4EA 1YM1A 5HWWA 3S4XA 1SDEA 4R23A 4RA7A 2VK3A 4Q0HA 1PWGA 1L0EA 2JN7A 1BLPA 4JGQA 1ZKJA 1XA7A 2D02A 4GHIB 5G4ZA 4MN6A 4BLMA 4E3IA 2FFFB 3WRTA 2ZQ7A 5F69A 4JBFA 5J7EA 4WMCA 1F5MA 4EQ1A 3FYZA 5HAIA 3UMDA 3VV4A 2GX5A 4DE0A 3E2KA 1J3WA 2V8CA 4PM7A 5KSHA 2Y55A 5HAQA 3OCNA 1H3QA 1OMEA 1VEUB 2EX8A 4QHCA 4O01A 3AGFA 2M7VA 3HLDA 3KX0X 1NLZA 4KQOA 1J9MA 1F98A 1K55A 3C8CA 2PYRA 3NOPC 4DJ3A 2K31A 3ZFZA 3BY9A 4HEFA 2Y79A 2LB9A 1MWTA 4UA7A 2ZQ9A 1FOFA 3Q7ZA 1TS7A 1CQAA 2Y2KA 1GCEA 5F5YA 5KZHA 2Y2QA 2WUQA 1KDWA 4H8RA 3SH8A 5HL1A 2W3GA 5GLCA 5DTSA 4NK3A 4PAUA 4B93A 4O8GA 3TRCA 4S2IA 2D01A 2PBYA 1YLZA 4NG2A 3CJMA 4OQIA 2HPBA 5E2HA 2UV0E 2ZQCA 1DP6A 3ISGA 4GOGA 2XFTA 3UPNA 1ES3A 4IVKA 4WEJA 3Q07A 5FQIA 1OJ5A 4L9FA 5BOHA 3BFGA 5FEGA 2HP5A 3SH9A 1IFQA 2ZMVA 2A24B 3M6BA 3UE6A 3OLOA 5M18A 2Y2OA 3GECA 5CRFA 3C2WA 3G32A 4BENA 3UPOA 4WZ5A 3AGEA 3V3RA 2Y2LA 1MZUA 2GDNA 3B33A 1MY8A 5KMWA 5GHYA 1PYYA 2ACGA 3BFDA 2PD8A 4BBUA 2Z6DA 3PBRA 5FA7A 4ZRRA 3MXQA 2Y2NA 2VGLM 4S2NA 3S7QA 1UWPX 1PI4A 5DFXA 1K6SA 3H82B 1OTEA 1UGUA 1G68A 1XA1A 5TBMB 1YMSA 1N9BA 3O3VA 3IX3A 3LIDA 3IWQA 1RGYA 1TS8A 2Y59A 2Q9MA 2WK0A 3UPPA 3L9KA 2V0WA 3W2ZA 3VSLA 3MF0A 1L2SA 4YINA 1S4SA 3S22A 4S2KA 3EQUA 1AXBA 1E3UD 2JC7A 3FKVA 2WADA 2HJEA 4B4XA 4I3JA 4KQDA 1OTIA 4CLCC 4X56A 1OJGA 3G2YA 3F1PB 1YKDA 1H8ZA 1Z09A 1RCJA 3ZG8B 1FIKA 1NZOA 3RXXA 3Q1FA 2PYPA 3M2KA 1K55C 3WRZA 3C4PA 2PT7A 2XGNA 3NC8A 3M6HA 4OOYA 1PIOA 1ZC2A 4UA9A 5L2FA 2DNSA 4OP8A 3MZFA 1K38A 1LSVA 5HD5A 5F82A 4QB8A 5HPFA 3G6OA 4JXWA 3LGOA 3HUNA 4E3NA 3UMEA 5HSQA 3LR5A 5M19A 2XD1A 2KOIA 4OVDA 4CLCE 1S67L 5EPHA 3T4OA 3H7WB 1KE4A 2OOLA 1K56A 2OLVA 5FAQA 3ZG0A 2HGVA 3P01A 1STZA 4R1GA 5A91A 4F3LB 3DW0A 3A0VA 1KVLA 4MNRA 3D3OA 3FWLA 3WS0A 3LY4A 4IUKA 3KYQA 3R7WA 3B47A 3IS2A 2M1CA 3IXGA 1W8YA 4DRTA 1ESUA 4Z9QA 4CLCB 3ZCZA 5FATA 3CLOA 4G3VA 5CEBA 3LIFA 3DAVA 4LV2A 3T1RA 5CHMA 4EETB 1PNEA 3CUEA 2Y2JA 2P04A 3MQQA 2QMIA 3C7UA 4JGOA 2HDUA 3PBSA 3VOLA 1BLHA 4HNBA 5EOEA 4OPYA 1XX2A 1HVBA 3Q7VB 2ZC4B 5JYPA 2Y8HA 3ZYTA 5HW3A 3IF6B 2Y2MA 1YQSA 1OTAA 5FQQA 2ZD8A 3LR4A 2VA0A 5EVID 1MXOA 1S6RA 4OPZA 4WUJA 5G4YA 5CGSA 1YT4A 1C3BA 1YLWA 1CK3A 1ONGA 2V20A 2Z2MB 3BECA 2J9PA 2W0NA 3IX4A 2H28A 5EOOA 1XKZA 4FTXA 1LI0A 3O87A 2H10A 4GS9B 5EV0A 3RH8B 3R4KA 2J3TD 2R9XA 3ZG9B 5HPIA 4FH4A 1P0ZA 2W3EA 4ZJ2A 3WS1A 4Y15A 3NY4A 3LY3A 4HESA 1V9ZA 3CG5A 3IXHA 3ZG7B 2X02A 4PKYA 4WZ5C 1KGEA 2XK1A 5CGXA 4ESPA 3VE3A 2WKQA 3QHYA 1Q2PA 1BTLA 4KQQA 3V67A 5HZHA 4Z1WA 2WGIA 1JWZA 4A5RA 1GHMA 2BASA 5A92A 2VJWA 3BLSA 4KZ6A 3IH8A 5EM0A 4ZJ1A 4LV3A 4O7DA 2P74A 3UE1A 2JKGA 3MZEA 4EERA 2PR6A 3NULA 3BFCA 1LL9A 3L7HA 2WKIA 2XDMA 5A90A 3QP1A 1PZOA 4M3KA 3A0RA 4Y0UA 3V3SA 2O9CA 4P87A 4AFIA 1NRFA 2B95A 3QP8A 4CLCD 5F1GA 2EWVA 3NBLA 1N9OA 1SHVA 4Q8IA 2JKRM 4ZAMA 4PHTA 4BL2A 1D7EA 3QP6A 4EU0A 1E25A 5FQMA 2GZAA 1WYCA 4GKUA 3G30A 4NXBA 4FOFA 4GB7A 5A93A 1OTDA 3GSGA 4DJ2A 2WKHA 1O07A 2PD7A 3S7OA 2ZC7A 3QP5A 4DXCA 3W8KA 2IWCA 4LPZA 5FAPA 3UDIA 3C38A 2J9OA 2ZC6B 4R6LA 1S0WA 2I72A 2XROA 4P0MA 1QMFA 1H8YA 1L0DA 1ODVA 2E8IA 5AJGA 3D4FA 2X71A 3BJNA 5AQ7A 3IT9A 5EVIB 3K2NA 3NIAA 5EVIA 4HH3A 1BT5A 1CI8A 3A3FA 2H0YA 3IHAA 3JYIA 2OV5A 4BBTA 4ARZB 5IU1A 3IHBA 4UEYA 3DTKA 4WN5A 2XD5A 2X01A 2VV7A 3OPPA 4F3LA 2OAQ1 4QY6A 5DF7A 3PHYA 2IWDA 2O9AA 2XA7M 4B9OA 1T18A 3HVFA 3SS4A 3C4OA 5E2FA 3RXWA 4PPRA 3LI9A 2JKRI 4PM9A 1IYQA 2BG1A 1ACFA 3KO6A 3V39A 3DTEA 3O86A 3NOTC 3LO7A 4PM8A 4KG5A 1XFNA 3LFVA 4LV0A 3F1NA 4IJGA 3HLGA 4M4XA 1WA9A 1SCWA 3LUQA 3E0YA 5HWVA 1WE4A 1G5UA 2QPNA 3KYZA 3JVVA 4E3LA 1IYSA 4KUKA 3FV7A 5KSCA 3F1OA 3C30A 4Y7PA 1BLSA 2P7JA 4HBTA 2FFYA 5CX7A 2H5SA 3R7WB 3WS2A 1ZHHB 2W1RA 3BYDA 1JNUA 3TJZC 5DF9A 1MKIA 1Y4OA 1K57A 1H0MA 2B18A 4IEDA 4R4RA 3O88A 1T1CA 3G34A 2JKTI 5IS1A 2XA7S 2G2UA 4NEED 5AQAA 4FUWA 1ESIA 2WGVA 4P6ZS 4LFUA 1BUEA 2EXBA 2OSUA 3RFBA 4KZ8A 5CGWA 2J7VA 4EWFA 4KZ4A 4R38A 3ULFA 5FQ9A 3NI9A 1EROA 5EVEA 2WKPA 1XPBA 1YAXA 1W63M 3ZNTA 1VEUA 4WL9A 5J8XA 1XP4A 2EFUA 5HDDA 1TF1A 2A2LA 5G18A 1Q2QA 4C6YA 3LCEA 1W7FA 1SDNA 1BLCA 3HLCA 4XUXA 3IXBA 4R70A 4EBNA 1HZOA 2C5WB 2L1MA 1W79A 5DJTA 2DCFA 1CJFA 4IBXA 4IHQA 3BW6A 4X1LA 5K5BA 1FCMA 1K25A 2WKRA 4Y5FA 1XJ2A 3SS5A 4L0LA 4DXBA 4RVAA 2WZZA 3QP4A 3P98A 3VOYA 5TFQA 1ZTUA 1FSYA 1KDSA 4Y17A 1IYOA 1NYMA 4R0QA 3ZDJA 4HP4A 2QYBA 5FEFA 3EGDC 3LYXA 4C75A 5I94A 5HARA 4E04A 4JLFA 5MC7A 3KSHA 4MLLA 3BQ8A 4FH2A 1OTBA 3VE4A 3OPRA 3MKFA 3UN7A 2CC1A 3VMAA 1DJBA 5FI7A 1BYWA 2G2WA 2WGWA 4S2LA 2VZWA 1CF0A 1LSXA 5L07A 1FCNA 3NECA 4UQIM 3BQAA 4OLDA 2A49A 4DF6A 4B88A 1LSWA 2Y91A 5EUAA 2AVXA 1Y28A 1IKGA 4PKYG 1RP5A 4P6ZM 3G31A 3NHQA 1FCOA 4KZ9A 1L0GA 1CEFA 2ZQDA 5GHZA 3E98A 1ZG4A 5GL9A 3V50A 3MKEA 2QKPA 4JXSA 2J80A 4BQMA 4JGPA 1IELA 1I2SA 2ZJ9A 3PTEA 2DMWA 1T1AA 2WAEA 2OWHA 2HZ5A 3IBJA 3CUEC 1CEGA 4OOLA 1K57C 3A3DA 4U0XA 4HH2A 3W4OA 4ARZA 1GSWA 1NYYA 2J8YA 4GHIA 2EX9A 5FI2A 2ZM8A 1H5XA 2ZOIA 3OCLA 3IQAA 4MCWA 2HDRA 3FC7A 4KZ3A 3MFDA 3NOUC 2EFXA 4EBLA 4KG6A 5FL3A 4DDYA 1G6OA 3VP4A 3MMHA 3LEQA 3CITA 4KZBA 5FQJA 1LL8A 1VB6A 4Y3IA 5EM1A 4L9GA 4HBUA 2WKEA 1PZPA 4UQIS 4ETXA 5JYOA 1YPRA 4JF5A 2V2FF 2XH9A 2QZ6A 2W3DA 3N8SA 3IWOA 2JE5A 3H7WA 4II7A 4BD0A 4JF4A 5C5KA 5M1AA 2JKFA 3UE0A 4IBRA 4C3QA 3GQZA 1P97A 2JKTM 4WYYA 4XUZA 1HD8A 4EW7A 1IKIA 1N9NA 2IWBA 3VOZA 4P6BA 1YLPA 1CI9A 1V9YA 2J3WA 4LV1A 3PBQA 3HLFA 4GDBA 2VV8A 1U60A 2PDRA 2V8FA 3PR6A 1TS0A 1KVMA 1MWRA 3EWKA 3KSGA 4F94A 2H0TA 1K4FA 3AGDA 4JKTA 1MPLA 2PBDP 4HJ3A 1MBLA 3VFHA 5TBMA 5DKKA 1M6KA 1OPXA 4OPQA 3T12B 4LLOB 3KSIA 2PU4A 4OQ0A 3UB9A 1GSXA 2VGJA 1K56D 2JCHA 3LR3A 1GSVA 4BMWA 2ZQAA 4FSFA 4EXOA 1XJ6A 3PYPA 2PR5A 3HLEA 4E3JA 4I39A 2P9VA 4EQIA 1XJ4A 2NUPC 3MS6A 3QNCA 3MJQA 2EXAA 1WYBA 2W1TA 1IOUA 1DP9A 3T1QB 1W8QA 4OP5A 4E3MA 3MSHA 5DTTA 3N8LA 4RYEA 4R3JA 3ITBA 3A3JA 2A24A 3F1NB 3ZVWA 1SZVA 2PAVP 2GNXA 2EX6A 5CHUA 3IX8A 4E6WA 3BFEA 2QHKA 3EEAA 3G4PA 2ZMAA 1ERMA 4EEPA 2JBFA 3Q7VA 3T4TA 1AWIA 4JPMA 4WBGA 2CMNA 1NRJA 3T4LA 3T1XA 4L9EA 1NWZA 5FAOA 2V1AA 2Y4AA 5FQKA 3LIAA 3ZHHA 5D3OA 1PFLA 2O9BA 1DY6A 1TEMA 1SKOA 2ZC3B 1RGZA 5HD3A 5CERA 1VETB 1Y54A 1EI5A 1UWNX 1K54C 2OLUA 4QWOA 4O0PA 1OT9A 3B3XA 4CLCA 1KOUA 1KE3A 2L4RA 5CTMA 3V5MA 2ZLYA 4QY5A 4BBVA 3PBTA 4I3IA 2Z2LB 4E3KA 2FH5A 4BJPA 3SOIA 2HDSA 1K4EA 1F9IA 1H8MA 3HL9A 4QU3A 4G3WA 1W5DA 2ZC5B 2K2NA 5LBRA 4S2PA 4X69A 4KG2A 4X1MA 2WZXA 3EOIA 4DE3A 4NKPA 1L0FA 4PM5A 3C5AA 5TGFA 4K0XA 3GTCA 4FCFA 1PWDA 1L3LA 4BD1A 1P9RA 3E4PA 4Y0OA 3LI8A 4DMZA 5L09A 5HAPA 1JTDA 1PRQA 1PW1A 2QWSA 3IWIA 4OPRA 4X25A 4Y13A 5HWTA 4RX3A 1NZUA 3MQOA 2V9AA 3HREA 4DDSA 3OBFA 4GZBA 3PAGA 5E2EA 3W4PA 5HL6A 4G3KA 1TDLA 3E4OA 3TW8A 5CTNA 3UDFA 3CPTB 5GLBA 3ICYA 2UWXA 3OOVA 3VP1A 3DTMA 1D1JA 3CWFA 4MDZA 1JWPA 3WS5A 3VFFA 3GV9A 4XT2B 5AVFA 1BZAA 5L10A 2P08A 4HI4A 4WZ4A 3F1OB 4GW9A 4DE1A 1O7EA 4WMCD 4GS9A 1LLBA 3VP0A 1ERQA 3ZVTA 1S4RA 4DKIA 3A3EA 1G28A 1MWUA 4Y2FA 3TE8A 1Z6FA 5HX9A 3E2LA 4E6XA 3LICA 3CAXA 5FASA 4R3BA 4EESA 4R4SA 3CPTA 1I5QA 2DRWA 4GN2A 1TVFA 4GJ4A 4LRYC 2W3FA 2EX2A 4GDNA 4QPRA 3CZDA 2XEPA 3VSKA 4HIAA 3IBRA 2ZOHA 4H6JB 2O99A 2W27A 3G35A 1ALQA 4LENA 3VP3A 4KENB 2ZL1B 4B4ZA 4JF6A 4Q0JA 2VV6A 3S1YA 1S66L 4OLGA 3ZQ5A 4S2MA 3T4JA 3BWLA 3HLWA 4RX2A 3C7VA 4PM6A 4Y0TA 4OQGA 5CHJA 5CXWA 4LRZE 3LIBA 3W4QA 4OH0A 2KLIA 4I38A 1GA0A 2RCXA 1I2WA 3T4KA 3GDIA 4YNRA 1JWVA 3PBOA 3CMZA 5A8BA 2NUTC 1HTZA 4D2OA 2Z6CA 4N9KA 1TS6A 4HJ6A 3U4LP 3NCKA 3HUOA 3OC2A 3LIEA 4I5SA 3FPWA 1K54A 1ZG6A 3RTYA 4ZTKA 5TR7A 3NDEA 4LRXC 3RJUA 4MBHA 4X68A 3CHWP 1XFQA 3A3IA 3TG9A 3EQVA 3JPUA 5EECA 2HJ9C 1GHIA 1SKFA 1IEMA 2XR0A 1OT6A 5FSRA 2WYXA 2M7UA 5TJJA 2HF6A 1XGIA 5HDCA 5GLAA 5IT5A 5CECA 2WAFA 3KSFA 4N9LA 1BULA 3UY6A 4EUVA 4IUHA 5IHVA 4R3AA 5I5LA 1K6RA 1G6AA 1IYPA 4HHDA 1DJAA 1M40A 2RL3A 3OPHA 1S1YA 1JTGA 1NLYA 3WS4A 2ZQ8A 1ES5A 4I3AA 2Y2HA 4IVIA 4LCMA 1MKMA 5EE8A 1YLYA 5FDSA 4K0WA 1A0KA 2Q0OA 5EFWA 2HV1A 4GNUA 2XSSA 1NY0A 1S1ZA 1YSQA 3HJKA 4ID4A 1K0KA 2P9VB 4KQRA 3GVBA 4LGWA 1NJ4A 2PRFA 3BEBA 1F2KA 1LHYA 4WELA 4BL3A 3ITAA 2O0YA 3E4QA 3UNWA 1KGFA 3IF5A 2INWA 1LL5A 3JVUA 3G2ZA 3T1SA 1JVJA 2YKHA 2E8JA 3P7NA 3IF6C 4X6TA 1PI5A 3CI6A 3SH7A 2B02A 5GHXA 4K08A 2C6WB 4UHUA 5AQ9A 1VM1A 4OOMA 1VQQA 1KE0A 1T1BA 4HJ4A 1FR6A 4KUOA 4K91A 2BLSA 3OPLA 2EWWA 3ZNYA 4GCZA 3HUMA 4MEZA 1LT0A 2BTFP 3HJIA 5DJUA 4WLAA 5AQBA 3GR2A 4YWZA 2VGLS 3N6IA 4CQHA 3HBRA 5EVIC 4MBFA 3DBAA 2V0UA 4S2NC 1ONHA 1TD5A 3TOIA 4OQHA 4HP9A 3SW1A 1FSWA 4ZBEA 4EBPA 3SS3A 2ZMFA 1TDGA 2Y2PA 1GA9A 2XF3A 5GLDA 1T19A 4U0TA 1VHMA 2VLGA 1XJ3A 4KZ5A 2WGWB 3D9YA 4HOIA 3IXDA 4NXFA 3T4SA 1FILA 2XLNA 5EVLA 4MBKA 3QP2A 2QJ7A 3H82A 5F83A 3K3CA 4JXGA 3PAEA 1FQGA 5DTKA 3DWKA 2GJ3A 3HCYA 1X0OA 3M2JA 4FD8A 4QD4A 5DVAA 2OWJA 2K7SA 1YMXA 3OZHA 4S2JA 5F1FA 3UB8A 3BY8A 2Y2GA 4P85A 3MR0A 1PWCA 1P9WA 3GRJA 4ME4A 3EEHA 2IA2A 3N7WA 3T4QA 1SKOB 3N8RA 4JXVA 4E3OA 3LR0A 1NXYA 2KDKA 3ZGAB 4GLQA 3QNBA 1E3UA 3K3DA 5CEDA 3I7JA 4CJNA 3UB5P 2EA9A 5DKLA 3BRMA 3DTIA 4MN7A 3DWZA 4X55A 3TSGA 4BWIA 3UO9A 1YSPA 3F1PA 5L8MA 3MFXA 2ZM0A 2MJ6A 4WEKA 4MMNA 5FDHA 5HFOA 4X53A 1LI9A 2ZL1A 3D72A 5FI6A 3N4IA 1W63Q 4EV4A 3P09A 2J3TC 4JGRA 3HLBA 4WF0A 2HP9A 2W1TB 4EUZA 1FR1A 3MZDA 3A0SA 3EGXC 4ZDXA 3FZCA
chains in the Genus database with same CATH topology
4E04A 5AVFA 3KYQA 3R7WA 3B47A 2P08A 4HI4A 3IS2A 2JHEA 2M1CA 3IS2B 5MC7A 3F1OB 3KSHA 4GW9A 2VKSA 3UB7A 2V1BA 4GS9A 4NXGA 4CLCB 4XT2A 3CLOA 1S4RA 3BQ8A 2OAP1 1OTBA 4G3VA 4NXEA 4ETZA 1G28A 4Y2FA 3TE8A 2YKFA 3VE4A 3LIFA 2ZBBA 4HQAA 3LICA 3CAXA 4EETB 3CUEA 1BYWA 3S7NA 2P04A 3MQQA 4EESA 4HY8A 2KX6A 4JGOA 2VZWA 4GJ4A 1LSXA 4LRYC 3PBSA 2G7UA 2W3FA 3VOLA 4UQIM 4HNBA 4QPRA 3BQAA 4HIAA 2I9VA 3IBRA 3H9WA 2ZOHA 4H6JB 2Y8HA 2O99A 2W27A 3ZYTA 1LSWA 1Y28A 2PHYA 4PKYG 4P6ZM 4H6JA 3NHQA 3FPVA 3PBNA 4Q0JA 2VV6A 4Q0IA 3E98A 1OTAA 2QKPA 3O5YA 2R78A 1S66L 3LR4A 2J80A 1N9LA 2XRNA 4JGPA 3PXPA 2VA0A 3ZQ5A 5F6AA 3MQ0A 3FG8A 2DMWA 4WUJA 3BWLA 1T1AA 5G4YA 3T4JA 1MC0A 2OWHA 5DFYA 3IBJA 3CUEC 4OOLA 4LRZE 3LIBA 4XT2B 2W0NA 4HH2A 4ARZA 4EEUA 3UE3A 2H28A 1GSWA 2KLIA 4I38A 4GHIA 4DN0A 5HDSA 2VEAA 4GS9B 3T4KA 3GDIA 2ZOIA 1DP8A 3RH8B 3R4KA 3OCLA 2J3TD 4YNRA 3NJAA 5HPIA 3B42A 3PBOA 1P0ZA 4MCWA 3FC7A 5A8BA 2W3EA 3U2AA 1D06A 3NOUC 2NUTC 3T50A 2Z6CA 4MN5A 1TS6A 2W3HA 5FL3A 1G6OA 4HJ6A 5J3WA 1DRMA 1V9ZA 3OC2A 1EW0A 5F68A 3MMHA 4PKYA 3LIEA 3CITA 4I5SA 3FPWA 1LL8A 2L0WA 1VB6A 2LB5A 4Y3IA 3RTYA 3VE3A 2WKQA 2QJ5A 4RQ9A 3V67A 4L9GA 4LRXC 5HZHA 4Z1WA 2FZ0A 1XFQA 2BASA 3UB6A 3S7PA 3EQVA 4UQIS 2VJWA 4ETXA 5AVEA 2VX8A 2HJ9C 4YOFA 5KIZA 5J4EA 5HWWA 2W3DA 1OT6A 4EERA 2M7UA 5TJJA 2HF6A 4Q0HA 5HDCA 2PR6A 5IT5A 3H7WA 3KSFA 4II7A 2JN7A 5C5KA 4JGQA 4EUVA 2D02A 4GHIB 1P97A 4IUHA 4MN6A 5G4ZA 2JKTM 3A0RA 4EW7A 2O9CA 4R3AA 4AFIA 1N9NA 4CLCD 5I5LA 2EWVA 1N9OA 4HHDA 5F69A 5J7EA 1F5MA 2JKRM 4PHTA 1V9YA 4EQ1A 2J3WA 1S1YA 3PBQA 1D7EA 4EU0A 1NLYA 2VV8A 2PDRA 3UMDA 3VV4A 4I3AA 2GZAA 2GX5A 1TS0A 3PR6A 3EWKA 5KSHA 4NXBA 3OCNA 4FOFA 1H3QA 1OTDA 1MKMA 4DJ2A 4O01A 2M7VA 3KSGA 2PD7A 3S7OA 3KX0X 1NLZA 4KQOA 4LPZA 5EFWA 1F98A 2HV1A 3C8CA 4HJ3A 3C38A 2PYRA 5TBMA 2XSSA 3NOPC 4DJ3A 5DKKA 2K31A 1OPXA 3BY9A 2Y79A 2LB9A 4R6LA 1S1ZA 1YSQA 3HJKA 3KSIA 4LLOB 2XROA 1TS7A 3UB9A 1GSXA 5F5YA 1ODVA 4WELA 5AJGA 3BJNA 3LR3A 1GSVA 2O0YA 3E4QA 2W3GA 3K2NA 4BMWA 4HH3A 4EXOA 4FSFA 1XJ6A 3PYPA 2PR5A 2INWA 4PAUA 4I39A 3JVUA 4B93A 2YKHA 4O8GA 3TRCA 3P7NA 4BBTA 2D01A 3CI6A 5IU1A 4ARZB 1XJ4A 2NUPC 4UEYA 3MJQA 2B02A 4K08A 4WN5A 2W1TA 1IOUA 1DP9A 4OOMA 1T1BA 4HJ4A 4KUOA 2VV7A 2EWWA 2A24A 4F3LA 2OAQ1 3F1NB 1DP6A 4GCZA 1LT0A 2GNXA 3HJIA 3PHYA 5DJUA 4WLAA 4WEJA 4YWZA 2QHKA 2VGLS 1OJ5A 2O9AA 3EEAA 4CQHA 4EEPA 2XA7M 3T4TA 4B9OA 1T18A 4L9FA 3DBAA 2CMNA 1NRJA 3T4LA 1IFQA 2ZMVA 2V0UA 2A24B 3LI9A 1NWZA 4L9EA 2JKRI 1TD5A 2V1AA 3KO6A 3LIAA 3UE6A 3OLOA 3NOTC 2O9BA 3GECA 4HP9A 3SW1A 1XFNA 3C2WA 2ZMFA 5HD3A 3LFVA 3F1NA 4IJGA 4M4XA 1WA9A 1UWNX 1MZUA 3LUQA 3E0YA 3B33A 4O0PA 1T19A 5HWVA 1OT9A 4CLCA 1KOUA 1VHMA 2VLGA 2L4RA 1XJ3A 3KYZA 3JVVA 4HOIA 4KUKA 4NXFA 4BBVA 3T4SA 3F1OA 3C30A 2PD8A 3PBTA 4BBUA 4I3IA 2P7JA 2QJ7A 3H82A 5CX7A 3R7WB 2Z6DA 3K3CA 3PBRA 1ZHHB 2W1RA 1JNUA 2FH5A 3TJZC 5DF9A 4ZRRA 4BJPA 3MXQA 1F9IA 2GJ3A 1H8MA 3HCYA 2B18A 1X0OA 2VGLM 3S7QA 1UWPX 1T1CA 4G3WA 5DFXA 2JKTI 3H82B 1OTEA 1UGUA 5IS1A 5TBMB 2XA7S 4NEED 3LIDA 2K2NA 2OWJA 5LBRA 1TS8A 2K7SA 4P6ZS 3UB8A 3BY8A 2V0WA 3W2ZA 3MF0A 3RFBA 1S4SA 3MR0A 1P9WA 3EOIA 3EQUA 4ME4A 3EEHA 4NKPA 4R38A 3ULFA 2HJEA 2IA2A 3T4QA 4I3JA 4KQDA 1OTIA 4CLCC 1P9RA 1OJGA 3LR0A 3E4PA 3F1PB 1YKDA 2KDKA 3LI8A 4DMZA 4GLQA 2WKPA 3K3DA 1YAXA 1W63M 2QWSA 4WL9A 2EA9A 2PYPA 5DKLA 5HDDA 4MN7A 2PT7A 1TF1A 2A2LA 5HWTA 4BWIA 3MQOA 1YSPA 3F1PA 5L8MA 3MFXA 2V9AA 3OBFA 2MJ6A 4WEKA 1LSVA 5HD5A 4MMNA 4R70A 5HL6A 5HPFA 4G3KA 3G6OA 3E4OA 3TW8A 3D72A 3UMEA 5HSQA 1W63Q 3LR5A 2L1MA 5DJTA 2J3TC 2KOIA 4IHQA 4CLCE 3BW6A 1S67L 3ICYA 3T4OA 5K5BA 3H7WB 4JGRA 2OOLA 2WKRA 4WF0A 4Y5FA 1XJ2A 2W1TB 3OOVA 4L0LA 2HGVA 3P01A 1STZA 4F3LB 1ZTUA 3A0VA 3CWFA 4MDZA 3A0SA 3EGXC 4HP4A 3D3OA 2QYBA 3EGDC 3LYXA 4IUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A8B A;  4E04 A;  2Z6D A;  3K3C A;  1D06 A;  3NOU C;  5AVF A;  3T50 A;  2Z6C A;  4MN5 A;  1JNU A;  1GSV A;  4HI4 A;  3E4Q A;  3IS2 A;  1TS6 A;  2JHE A;  2M1C A;  3MXQ A;  3IS2 B;  1F9I A;  2GJ3 A;  4HH3 A;  1DRM A;  1V9Z A;  3F1O B;  1XJ6 A;  4HJ6 A;  5J3W A;  1EW0 A;  3PYP A;  4EXO A;  1X0O A;  2INW A;  2PR5 A;  5F68 A;  4GW9 A;  4PKY A;  3LIE A;  3UB7 A;  4I39 A;  1UWP X;  1T1C A;  2V1B A;  4I5S A;  4GS9 A;  4NXG A;  3H82 B;  1LL8 A;  1OTE A;  1VB6 A;  2L0W A;  1UGU A;  4XT2 A;  3RTY A;  2WKQ A;  2YKH A;  3CLO A;  5TBM B;  1S4R A;  3VE3 A;  2QJ5 A;  4RQ9 A;  1OTB A;  3LID A;  2OWJ A;  4L9G A;  3P7N A;  4LRX C;  1TS8 A;  1G28 A;  2K7S A;  4NXE A;  2D01 A;  4BBT A;  5HZH A;  2YKF A;  1XFQ A;  5IU1 A;  2BAS A;  3BY8 A;  3LIF A;  3UB8 A;  1XJ4 A;  2V0W A;  2ZBB A;  4HQA A;  5G4Z A;  3UB6 A;  3MJQ A;  2B02 A;  5AVE A;  4K08 A;  1S4S A;  3CAX A;  3LIC A;  3MR0 A;  4WN5 A;  4EET B;  5KIZ A;  1DP9 A;  1BYW A;  3VE4 A;  3EEH A;  3MQQ A;  4EES A;  5J4E A;  4R38 A;  3ULF A;  4HY8 A;  2KX6 A;  5HWW A;  4JGO A;  1OT6 A;  1T1B A;  4HJ4 A;  4EER A;  4KUO A;  1LSX A;  4LRY C;  4I3J A;  4KQD A;  1OTI A;  2PR6 A;  5HDC A;  3VOL A;  2VV7 A;  1OJG A;  3H7W A;  2A24 A;  3E4P A;  4HNB A;  3F1P B;  3F1N B;  2KDK A;  3LI8 A;  4F3L A;  1DP6 A;  2JN7 A;  4JGQ A;  4HIA A;  2I9V A;  4GCZ A;  1LT0 A;  2D02 A;  2WKP A;  4GHI B;  3IBR A;  1P97 A;  3HJI A;  3K3D A;  3H9W A;  2ZOH A;  3A0R A;  3PHY A;  4MN6 A;  4H6J B;  5DJU A;  4WLA A;  4EW7 A;  2QWS A;  2W27 A;  4R3A A;  5IS1 A;  4WL9 A;  1LSW A;  4YWZ A;  1N9N A;  2QHK A;  1OJ5 A;  5I5L A;  1Y28 A;  2EA9 A;  2PYP A;  5DKL A;  2PHY A;  5HDD A;  1N9O A;  4PKY G;  4HHD A;  4EEP A;  4H6J A;  5F69 A;  3NHQ A;  5HWT A;  5J7E A;  4B9O A;  1T18 A;  4L9F A;  1V9Y A;  2CMN A;  4EQ1 A;  3MQO A;  2VV6 A;  1S1Y A;  1D7E A;  1OTA A;  2V0U A;  3F1P A;  2A24 B;  2VV8 A;  1NWZ A;  3LI9 A;  3MFX A;  2PDR A;  2QKP A;  2V9A A;  2R78 A;  1S66 L;  4L9E A;  4I3A A;  3UMD A;  2J80 A;  1N9L A;  1TS0 A;  4JGP A;  2V1A A;  3ZQ5 A;  3EWK A;  5F6A A;  3LIA A;  4NXB A;  1LSV A;  5HD5 A;  3UE6 A;  1OTD A;  3OLO A;  4R70 A;  3FG8 A;  3NOT C;  3G6O A;  4DJ2 A;  3E4O A;  3BWL A;  1T1A A;  4WUJ A;  5G4Y A;  3D72 A;  3GEC A;  4HP9 A;  2PD7 A;  3SW1 A;  3UME A;  5HSQ A;  2OWH A;  1XFN A;  3C2W A;  2L1M A;  3KX0 X;  4LRZ E;  3LIB A;  5DJT A;  5HD3 A;  3F1N A;  1S67 L;  3ICY A;  4LPZ A;  1F98 A;  4XT2 B;  2W0N A;  2HV1 A;  3H7W B;  4HH2 A;  5EFW A;  4M4X A;  4EEU A;  2H28 A;  1GSW A;  1WA9 A;  2OOL A;  1UWN X;  3C8C A;  2WKR A;  4HJ3 A;  4I38 A;  4JGR A;  1MZU A;  1XJ2 A;  4WF0 A;  3LUQ A;  2PYR A;  3B33 A;  4GHI A;  5TBM A;  1T19 A;  5HWV A;  3NOP C;  5HDS A;  1OT9 A;  5DKK A;  4DJ3 A;  2VEA A;  1KOU A;  4GS9 B;  3BY9 A;  4F3L B;  2VLG A;  2L4R A;  1XJ3 A;  3A0V A;  3GDI A;  2ZOI A;  4HOI A;  1DP8 A;  3CWF A;  4R6L A;  1S1Z A;  4KUK A;  4NXF A;  4LLO B;  3HJK A;  3RH8 B;  4BBV A;  3A0S A;  3F1O A;  3NJA A;  1TS7 A;  2PD8 A;  3UB9 A;  1GSX A;  4BBU A;  4HP4 A;  4I3I A;  1ODV A;  1P0Z A;  2P7J A;  5F5Y A;  2QJ7 A;  3H82 A;  3LYX A;  3FC7 A; 
#chains in the Genus database with same CATH topology
 4D60 A;  2JHE A;  4N92 A;  3IS2 B;  3FKW A;  2VKS A;  3UB7 A;  4DE2 A;  2V1B A;  3Q81 A;  4NXG A;  4XT2 A;  4UA6 A;  2OAP 1;  1ES4 A;  4NXE A;  4ETZ A;  1GHP A;  3BFF A;  3SZT A;  2YKF A;  3MXR A;  2ZBB A;  4HQA A;  1EWZ A;  3GMW A;  4N1X A;  1MWS A;  4U3T A;  3WWX A;  4UAA A;  2R9W A;  3S7N A;  4GD6 A;  3MBZ A;  3Q82 A;  4HY8 A;  2KX6 A;  4YFM A;  1E4D A;  2G7U A;  3NDG A;  1KGG A;  1QME A;  1VET A;  4XXR A;  2I9V A;  4GD8 A;  3H9W A;  3IF6 A;  4N1H A;  2HDQ A;  3IH9 A;  2PHY A;  4KZ7 A;  4PMA A;  4H6J A;  3FPV A;  2A3U A;  4OKP A;  3UDX A;  3PBN A;  5U47 A;  1XXM A;  4Q0I A;  2Q9N A;  2VGK A;  3O5Y A;  2R78 A;  1N9L A;  2XRN A;  4QJG A;  3PXP A;  5F6A A;  4OON A;  3KYE A;  3MQ0 A;  3FG8 A;  2HP6 A;  1MC0 A;  5DFY A;  5E43 A;  4EEU A;  1DJC A;  3MXS A;  3UE3 A;  4KZA A;  1HLU P;  4DN0 A;  1PW8 A;  4NET A;  5HDS A;  2VEA A;  1BSG A;  3ZG5 A;  3VP2 A;  1YLT A;  4CPK A;  1DP8 A;  2B5R A;  3NJA A;  3B42 A;  1XGJ A;  2V1Z A;  3U2A A;  1D06 A;  3T50 A;  4MN5 A;  1ES2 A;  4LCL A;  3BLM A;  2W3H A;  4S2O A;  5DF8 A;  5J3W A;  1DRM A;  2XQZ A;  1EW0 A;  5F68 A;  2XFS A;  4ZJ3 A;  4WM9 A;  2L0W A;  2LB5 A;  2Y2I A;  5E2G A;  2ZM2 A;  1N4O A;  2QJ5 A;  4RQ9 A;  2FZ0 A;  2PU2 A;  3UB6 A;  3S7P A;  3BM6 A;  5AVE A;  3LEZ A;  2VX8 A;  4YOF A;  5KIZ A;  1YLJ A;  5J4E A;  1YM1 A;  5HWW A;  3S4X A;  1SDE A;  4R23 A;  4RA7 A;  2VK3 A;  4Q0H A;  1PWG A;  1L0E A;  2JN7 A;  1BLP A;  4JGQ A;  1ZKJ A;  1XA7 A;  2D02 A;  4GHI B;  5G4Z A;  4MN6 A;  4BLM A;  4E3I A;  2FFF B;  3WRT A;  2ZQ7 A;  5F69 A;  4JBF A;  5J7E A;  4WMC A;  1F5M A;  4EQ1 A;  3FYZ A;  5HAI A;  3UMD A;  3VV4 A;  2GX5 A;  4DE0 A;  3E2K A;  1J3W A;  2V8C A;  4PM7 A;  5KSH A;  2Y55 A;  5HAQ A;  3OCN A;  1H3Q A;  1OME A;  1VEU B;  2EX8 A;  4QHC A;  4O01 A;  3AGF A;  2M7V A;  3HLD A;  3KX0 X;  1NLZ A;  4KQO A;  1J9M A;  1F98 A;  1K55 A;  3C8C A;  2PYR A;  3NOP C;  4DJ3 A;  2K31 A;  3ZFZ A;  3BY9 A;  4HEF A;  2Y79 A;  2LB9 A;  1MWT A;  4UA7 A;  2ZQ9 A;  1FOF A;  3Q7Z A;  1TS7 A;  1CQA A;  2Y2K A;  1GCE A;  5F5Y A;  5KZH A;  2Y2Q A;  2WUQ A;  1KDW A;  4H8R A;  3SH8 A;  5HL1 A;  2W3G A;  5GLC A;  5DTS A;  4NK3 A;  4PAU A;  4B93 A;  4O8G A;  3TRC A;  4S2I A;  2D01 A;  2PBY A;  1YLZ A;  4NG2 A;  3CJM A;  4OQI A;  2HPB A;  5E2H A;  2UV0 E;  2ZQC A;  1DP6 A;  3ISG A;  4GOG A;  2XFT A;  3UPN A;  1ES3 A;  4IVK A;  4WEJ A;  3Q07 A;  5FQI A;  1OJ5 A;  4L9F A;  5BOH A;  3BFG A;  5FEG A;  2HP5 A;  3SH9 A;  1IFQ A;  2ZMV A;  2A24 B;  3M6B A;  3UE6 A;  3OLO A;  5M18 A;  2Y2O A;  3GEC A;  5CRF A;  3C2W A;  3G32 A;  4BEN A;  3UPO A;  4WZ5 A;  3AGE A;  3V3R A;  2Y2L A;  1MZU A;  2GDN A;  3B33 A;  1MY8 A;  5KMW A;  5GHY A;  1PYY A;  2ACG A;  3BFD A;  2PD8 A;  4BBU A;  2Z6D A;  3PBR A;  5FA7 A;  4ZRR A;  3MXQ A;  2Y2N A;  2VGL M;  4S2N A;  3S7Q A;  1UWP X;  1PI4 A;  5DFX A;  1K6S A;  3H82 B;  1OTE A;  1UGU A;  1G68 A;  1XA1 A;  5TBM B;  1YMS A;  1N9B A;  3O3V A;  3IX3 A;  3LID A;  3IWQ A;  1RGY A;  1TS8 A;  2Y59 A;  2Q9M A;  2WK0 A;  3UPP A;  3L9K A;  2V0W A;  3W2Z A;  3VSL A;  3MF0 A;  1L2S A;  4YIN A;  1S4S A;  3S22 A;  4S2K A;  3EQU A;  1AXB A;  1E3U D;  2JC7 A;  3FKV A;  2WAD A;  2HJE A;  4B4X A;  4I3J A;  4KQD A;  1OTI A;  4CLC C;  4X56 A;  1OJG A;  3G2Y A;  3F1P B;  1YKD A;  1H8Z A;  1Z09 A;  1RCJ A;  3ZG8 B;  1FIK A;  1NZO A;  3RXX A;  3Q1F A;  2PYP A;  3M2K A;  1K55 C;  3WRZ A;  3C4P A;  2PT7 A;  2XGN A;  3NC8 A;  3M6H A;  4OOY A;  1PIO A;  1ZC2 A;  4UA9 A;  5L2F A;  2DNS A;  4OP8 A;  3MZF A;  1K38 A;  1LSV A;  5HD5 A;  5F82 A;  4QB8 A;  5HPF A;  3G6O A;  4JXW A;  3LGO A;  3HUN A;  4E3N A;  3UME A;  5HSQ A;  3LR5 A;  5M19 A;  2XD1 A;  2KOI A;  4OVD A;  4CLC E;  1S67 L;  5EPH A;  3T4O A;  3H7W B;  1KE4 A;  2OOL A;  1K56 A;  2OLV A;  5FAQ A;  3ZG0 A;  2HGV A;  3P01 A;  1STZ A;  4R1G A;  5A91 A;  4F3L B;  3DW0 A;  3A0V A;  1KVL A;  4MNR A;  3D3O A;  3FWL A;  3WS0 A;  3LY4 A;  4IUK A;  3KYQ A;  3R7W A;  3B47 A;  3IS2 A;  2M1C A;  3IXG A;  1W8Y A;  4DRT A;  1ESU A;  4Z9Q A;  4CLC B;  3ZCZ A;  5FAT A;  3CLO A;  4G3V A;  5CEB A;  3LIF A;  3DAV A;  4LV2 A;  3T1R A;  5CHM A;  4EET B;  1PNE A;  3CUE A;  2Y2J A;  2P04 A;  3MQQ A;  2QMI A;  3C7U A;  4JGO A;  2HDU A;  3PBS A;  3VOL A;  1BLH A;  4HNB A;  5EOE A;  4OPY A;  1XX2 A;  1HVB A;  3Q7V B;  2ZC4 B;  5JYP A;  2Y8H A;  3ZYT A;  5HW3 A;  3IF6 B;  2Y2M A;  1YQS A;  1OTA A;  5FQQ A;  2ZD8 A;  3LR4 A;  2VA0 A;  5EVI D;  1MXO A;  1S6R A;  4OPZ A;  4WUJ A;  5G4Y A;  5CGS A;  1YT4 A;  1C3B A;  1YLW A;  1CK3 A;  1ONG A;  2V20 A;  2Z2M B;  3BEC A;  2J9P A;  2W0N A;  3IX4 A;  2H28 A;  5EOO A;  1XKZ A;  4FTX A;  1LI0 A;  3O87 A;  2H10 A;  4GS9 B;  5EV0 A;  3RH8 B;  3R4K A;  2J3T D;  2R9X A;  3ZG9 B;  5HPI A;  4FH4 A;  1P0Z A;  2W3E A;  4ZJ2 A;  3WS1 A;  4Y15 A;  3NY4 A;  3LY3 A;  4HES A;  1V9Z A;  3CG5 A;  3IXH A;  3ZG7 B;  2X02 A;  4PKY A;  4WZ5 C;  1KGE A;  2XK1 A;  5CGX A;  4ESP A;  3VE3 A;  2WKQ A;  3QHY A;  1Q2P A;  1BTL A;  4KQQ A;  3V67 A;  5HZH A;  4Z1W A;  2WGI A;  1JWZ A;  4A5R A;  1GHM A;  2BAS A;  5A92 A;  2VJW A;  3BLS A;  4KZ6 A;  3IH8 A;  5EM0 A;  4ZJ1 A;  4LV3 A;  4O7D A;  2P74 A;  3UE1 A;  2JKG A;  3MZE A;  4EER A;  2PR6 A;  3NUL A;  3BFC A;  1LL9 A;  3L7H A;  2WKI A;  2XDM A;  5A90 A;  3QP1 A;  1PZO A;  4M3K A;  3A0R A;  4Y0U A;  3V3S A;  2O9C A;  4P87 A;  4AFI A;  1NRF A;  2B95 A;  3QP8 A;  4CLC D;  5F1G A;  2EWV A;  3NBL A;  1N9O A;  1SHV A;  4Q8I A;  2JKR M;  4ZAM A;  4PHT A;  4BL2 A;  1D7E A;  3QP6 A;  4EU0 A;  1E25 A;  5FQM A;  2GZA A;  1WYC A;  4GKU A;  3G30 A;  4NXB A;  4FOF A;  4GB7 A;  5A93 A;  1OTD A;  3GSG A;  4DJ2 A;  2WKH A;  1O07 A;  2PD7 A;  3S7O A;  2ZC7 A;  3QP5 A;  4DXC A;  3W8K A;  2IWC A;  4LPZ A;  5FAP A;  3UDI A;  3C38 A;  2J9O A;  2ZC6 B;  4R6L A;  1S0W A;  2I72 A;  2XRO A;  4P0M A;  1QMF A;  1H8Y A;  1L0D A;  1ODV A;  2E8I A;  5AJG A;  3D4F A;  2X71 A;  3BJN A;  5AQ7 A;  3IT9 A;  5EVI B;  3K2N A;  3NIA A;  5EVI A;  4HH3 A;  1BT5 A;  1CI8 A;  3A3F A;  2H0Y A;  3IHA A;  3JYI A;  2OV5 A;  4BBT A;  4ARZ B;  5IU1 A;  3IHB A;  4UEY A;  3DTK A;  4WN5 A;  2XD5 A;  2X01 A;  2VV7 A;  3OPP A;  4F3L A;  2OAQ 1;  4QY6 A;  5DF7 A;  3PHY A;  2IWD A;  2O9A A;  2XA7 M;  4B9O A;  1T18 A;  3HVF A;  3SS4 A;  3C4O A;  5E2F A;  3RXW A;  4PPR A;  3LI9 A;  2JKR I;  4PM9 A;  1IYQ A;  2BG1 A;  1ACF A;  3KO6 A;  3V39 A;  3DTE A;  3O86 A;  3NOT C;  3LO7 A;  4PM8 A;  4KG5 A;  1XFN A;  3LFV A;  4LV0 A;  3F1N A;  4IJG A;  3HLG A;  4M4X A;  1WA9 A;  1SCW A;  3LUQ A;  3E0Y A;  5HWV A;  1WE4 A;  1G5U A;  2QPN A;  3KYZ A;  3JVV A;  4E3L A;  1IYS A;  4KUK A;  3FV7 A;  5KSC A;  3F1O A;  3C30 A;  4Y7P A;  1BLS A;  2P7J A;  4HBT A;  2FFY A;  5CX7 A;  2H5S A;  3R7W B;  3WS2 A;  1ZHH B;  2W1R A;  3BYD A;  1JNU A;  3TJZ C;  5DF9 A;  1MKI A;  1Y4O A;  1K57 A;  1H0M A;  2B18 A;  4IED A;  4R4R A;  3O88 A;  1T1C A;  3G34 A;  2JKT I;  5IS1 A;  2XA7 S;  2G2U A;  4NEE D;  5AQA A;  4FUW A;  1ESI A;  2WGV A;  4P6Z S;  4LFU A;  1BUE A;  2EXB A;  2OSU A;  3RFB A;  4KZ8 A;  5CGW A;  2J7V A;  4EWF A;  4KZ4 A;  4R38 A;  3ULF A;  5FQ9 A;  3NI9 A;  1ERO A;  5EVE A;  2WKP A;  1XPB A;  1YAX A;  1W63 M;  3ZNT A;  1VEU A;  4WL9 A;  5J8X A;  1XP4 A;  2EFU A;  5HDD A;  1TF1 A;  2A2L A;  5G18 A;  1Q2Q A;  4C6Y A;  3LCE A;  1W7F A;  1SDN A;  1BLC A;  3HLC A;  4XUX A;  3IXB A;  4R70 A;  4EBN A;  1HZO A;  2C5W B;  2L1M A;  1W79 A;  5DJT A;  2DCF A;  1CJF A;  4IBX A;  4IHQ A;  3BW6 A;  4X1L A;  5K5B A;  1FCM A;  1K25 A;  2WKR A;  4Y5F A;  1XJ2 A;  3SS5 A;  4L0L A;  4DXB A;  4RVA A;  2WZZ A;  3QP4 A;  3P98 A;  3VOY A;  5TFQ A;  1ZTU A;  1FSY A;  1KDS A;  4Y17 A;  1IYO A;  1NYM A;  4R0Q A;  3ZDJ A;  4HP4 A;  2QYB A;  5FEF A;  3EGD C;  3LYX A;  4C75 A;  5I94 A;  5HAR A;  4E04 A;  4JLF A;  5MC7 A;  3KSH A;  4MLL A;  3BQ8 A;  4FH2 A;  1OTB A;  3VE4 A;  3OPR A;  3MKF A;  3UN7 A;  2CC1 A;  3VMA A;  1DJB A;  5FI7 A;  1BYW A;  2G2W A;  2WGW A;  4S2L A;  2VZW A;  1CF0 A;  1LSX A;  5L07 A;  1FCN A;  3NEC A;  4UQI M;  3BQA A;  4OLD A;  2A49 A;  4DF6 A;  4B88 A;  1LSW A;  2Y91 A;  5EUA A;  2AVX A;  1Y28 A;  1IKG A;  4PKY G;  1RP5 A;  4P6Z M;  3G31 A;  3NHQ A;  1FCO A;  4KZ9 A;  1L0G A;  1CEF A;  2ZQD A;  5GHZ A;  3E98 A;  1ZG4 A;  5GL9 A;  3V50 A;  3MKE A;  2QKP A;  4JXS A;  2J80 A;  4BQM A;  4JGP A;  1IEL A;  1I2S A;  2ZJ9 A;  3PTE A;  2DMW A;  1T1A A;  2WAE A;  2OWH A;  2HZ5 A;  3IBJ A;  3CUE C;  1CEG A;  4OOL A;  1K57 C;  3A3D A;  4U0X A;  4HH2 A;  3W4O A;  4ARZ A;  1GSW A;  1NYY A;  2J8Y A;  4GHI A;  2EX9 A;  5FI2 A;  2ZM8 A;  1H5X A;  2ZOI A;  3OCL A;  3IQA A;  4MCW A;  2HDR A;  3FC7 A;  4KZ3 A;  3MFD A;  3NOU C;  2EFX A;  4EBL A;  4KG6 A;  5FL3 A;  4DDY A;  1G6O A;  3VP4 A;  3MMH A;  3LEQ A;  3CIT A;  4KZB A;  5FQJ A;  1LL8 A;  1VB6 A;  4Y3I A;  5EM1 A;  4L9G A;  4HBU A;  2WKE A;  1PZP A;  4UQI S;  4ETX A;  5JYO A;  1YPR A;  4JF5 A;  2V2F F;  2XH9 A;  2QZ6 A;  2W3D A;  3N8S A;  3IWO A;  2JE5 A;  3H7W A;  4II7 A;  4BD0 A;  4JF4 A;  5C5K A;  5M1A A;  2JKF A;  3UE0 A;  4IBR A;  4C3Q A;  3GQZ A;  1P97 A;  2JKT M;  4WYY A;  4XUZ A;  1HD8 A;  4EW7 A;  1IKI A;  1N9N A;  2IWB A;  3VOZ A;  4P6B A;  1YLP A;  1CI9 A;  1V9Y A;  2J3W A;  4LV1 A;  3PBQ A;  3HLF A;  4GDB A;  2VV8 A;  1U60 A;  2PDR A;  2V8F A;  3PR6 A;  1TS0 A;  1KVM A;  1MWR A;  3EWK A;  3KSG A;  4F94 A;  2H0T A;  1K4F A;  3AGD A;  4JKT A;  1MPL A;  2PBD P;  4HJ3 A;  1MBL A;  3VFH A;  5TBM A;  5DKK A;  1M6K A;  1OPX A;  4OPQ A;  3T12 B;  4LLO B;  3KSI A;  2PU4 A;  4OQ0 A;  3UB9 A;  1GSX A;  2VGJ A;  1K56 D;  2JCH A;  3LR3 A;  1GSV A;  4BMW A;  2ZQA A;  4FSF A;  4EXO A;  1XJ6 A;  3PYP A;  2PR5 A;  3HLE A;  4E3J A;  4I39 A;  2P9V A;  4EQI A;  1XJ4 A;  2NUP C;  3MS6 A;  3QNC A;  3MJQ A;  2EXA A;  1WYB A;  2W1T A;  1IOU A;  1DP9 A;  3T1Q B;  1W8Q A;  4OP5 A;  4E3M A;  3MSH A;  5DTT A;  3N8L A;  4RYE A;  4R3J A;  3ITB A;  3A3J A;  2A24 A;  3F1N B;  3ZVW A;  1SZV A;  2PAV P;  2GNX A;  2EX6 A;  5CHU A;  3IX8 A;  4E6W A;  3BFE A;  2QHK A;  3EEA A;  3G4P A;  2ZMA A;  1ERM A;  4EEP A;  2JBF A;  3Q7V A;  3T4T A;  1AWI A;  4JPM A;  4WBG A;  2CMN A;  1NRJ A;  3T4L A;  3T1X A;  4L9E A;  1NWZ A;  5FAO A;  2V1A A;  2Y4A A;  5FQK A;  3LIA A;  3ZHH A;  5D3O A;  1PFL A;  2O9B A;  1DY6 A;  1TEM A;  1SKO A;  2ZC3 B;  1RGZ A;  5HD3 A;  5CER A;  1VET B;  1Y54 A;  1EI5 A;  1UWN X;  1K54 C;  2OLU A;  4QWO A;  4O0P A;  1OT9 A;  3B3X A;  4CLC A;  1KOU A;  1KE3 A;  2L4R A;  5CTM A;  3V5M A;  2ZLY A;  4QY5 A;  4BBV A;  3PBT A;  4I3I A;  2Z2L B;  4E3K A;  2FH5 A;  4BJP A;  3SOI A;  2HDS A;  1K4E A;  1F9I A;  1H8M A;  3HL9 A;  4QU3 A;  4G3W A;  1W5D A;  2ZC5 B;  2K2N A;  5LBR A;  4S2P A;  4X69 A;  4KG2 A;  4X1M A;  2WZX A;  3EOI A;  4DE3 A;  4NKP A;  1L0F A;  4PM5 A;  3C5A A;  5TGF A;  4K0X A;  3GTC A;  4FCF A;  1PWD A;  1L3L A;  4BD1 A;  1P9R A;  3E4P A;  4Y0O A;  3LI8 A;  4DMZ A;  5L09 A;  5HAP A;  1JTD A;  1PRQ A;  1PW1 A;  2QWS A;  3IWI A;  4OPR A;  4X25 A;  4Y13 A;  5HWT A;  4RX3 A;  1NZU A;  3MQO A;  2V9A A;  3HRE A;  4DDS A;  3OBF A;  4GZB A;  3PAG A;  5E2E A;  3W4P A;  5HL6 A;  4G3K A;  1TDL A;  3E4O A;  3TW8 A;  5CTN A;  3UDF A;  3CPT B;  5GLB A;  3ICY A;  2UWX A;  3OOV A;  3VP1 A;  3DTM A;  1D1J A;  3CWF A;  4MDZ A;  1JWP A;  3WS5 A;  3VFF A;  3GV9 A;  4XT2 B;  5AVF A;  1BZA A;  5L10 A;  2P08 A;  4HI4 A;  4WZ4 A;  3F1O B;  4GW9 A;  4DE1 A;  1O7E A;  4WMC D;  4GS9 A;  1LLB A;  3VP0 A;  1ERQ A;  3ZVT A;  1S4R A;  4DKI A;  3A3E A;  1G28 A;  1MWU A;  4Y2F A;  3TE8 A;  1Z6F A;  5HX9 A;  3E2L A;  4E6X A;  3LIC A;  3CAX A;  5FAS A;  4R3B A;  4EES A;  4R4S A;  3CPT A;  1I5Q A;  2DRW A;  4GN2 A;  1TVF A;  4GJ4 A;  4LRY C;  2W3F A;  2EX2 A;  4GDN A;  4QPR A;  3CZD A;  2XEP A;  3VSK A;  4HIA A;  3IBR A;  2ZOH A;  4H6J B;  2O99 A;  2W27 A;  3G35 A;  1ALQ A;  4LEN A;  3VP3 A;  4KEN B;  2ZL1 B;  4B4Z A;  4JF6 A;  4Q0J A;  2VV6 A;  3S1Y A;  1S66 L;  4OLG A;  3ZQ5 A;  4S2M A;  3T4J A;  3BWL A;  3HLW A;  4RX2 A;  3C7V A;  4PM6 A;  4Y0T A;  4OQG A;  5CHJ A;  5CXW A;  4LRZ E;  3LIB A;  3W4Q A;  4OH0 A;  2KLI A;  4I38 A;  1GA0 A;  2RCX A;  1I2W A;  3T4K A;  3GDI A;  4YNR A;  1JWV A;  3PBO A;  3CMZ A;  5A8B A;  2NUT C;  1HTZ A;  4D2O A;  2Z6C A;  4N9K A;  1TS6 A;  4HJ6 A;  3U4L P;  3NCK A;  3HUO A;  3OC2 A;  3LIE A;  4I5S A;  3FPW A;  1K54 A;  1ZG6 A;  3RTY A;  4ZTK A;  5TR7 A;  3NDE A;  4LRX C;  3RJU A;  4MBH A;  4X68 A;  3CHW P;  1XFQ A;  3A3I A;  3TG9 A;  3EQV A;  3JPU A;  5EEC A;  2HJ9 C;  1GHI A;  1SKF A;  1IEM A;  2XR0 A;  1OT6 A;  5FSR A;  2WYX A;  2M7U A;  5TJJ A;  2HF6 A;  1XGI A;  5HDC A;  5GLA A;  5IT5 A;  5CEC A;  2WAF A;  3KSF A;  4N9L A;  1BUL A;  3UY6 A;  4EUV A;  4IUH A;  5IHV A;  4R3A A;  5I5L A;  1K6R A;  1G6A A;  1IYP A;  4HHD A;  1DJA A;  1M40 A;  2RL3 A;  3OPH A;  1S1Y A;  1JTG A;  1NLY A;  3WS4 A;  2ZQ8 A;  1ES5 A;  4I3A A;  2Y2H A;  4IVI A;  4LCM A;  1MKM A;  5EE8 A;  1YLY A;  5FDS A;  4K0W A;  1A0K A;  2Q0O A;  5EFW A;  2HV1 A;  4GNU A;  2XSS A;  1NY0 A;  1S1Z A;  1YSQ A;  3HJK A;  4ID4 A;  1K0K A;  2P9V B;  4KQR A;  3GVB A;  4LGW A;  1NJ4 A;  2PRF A;  3BEB A;  1F2K A;  1LHY A;  4WEL A;  4BL3 A;  3ITA A;  2O0Y A;  3E4Q A;  3UNW A;  1KGF A;  3IF5 A;  2INW A;  1LL5 A;  3JVU A;  3G2Z A;  3T1S A;  1JVJ A;  2YKH A;  2E8J A;  3P7N A;  3IF6 C;  4X6T A;  1PI5 A;  3CI6 A;  3SH7 A;  2B02 A;  5GHX A;  4K08 A;  2C6W B;  4UHU A;  5AQ9 A;  1VM1 A;  4OOM A;  1VQQ A;  1KE0 A;  1T1B A;  4HJ4 A;  1FR6 A;  4KUO A;  4K91 A;  2BLS A;  3OPL A;  2EWW A;  3ZNY A;  4GCZ A;  3HUM A;  4MEZ A;  1LT0 A;  2BTF P;  3HJI A;  5DJU A;  4WLA A;  5AQB A;  3GR2 A;  4YWZ A;  2VGL S;  3N6I A;  4CQH A;  3HBR A;  5EVI C;  4MBF A;  3DBA A;  2V0U A;  4S2N C;  1ONH A;  1TD5 A;  3TOI A;  4OQH A;  4HP9 A;  3SW1 A;  1FSW A;  4ZBE A;  4EBP A;  3SS3 A;  2ZMF A;  1TDG A;  2Y2P A;  1GA9 A;  2XF3 A;  5GLD A;  1T19 A;  4U0T A;  1VHM A;  2VLG A;  1XJ3 A;  4KZ5 A;  2WGW B;  3D9Y A;  4HOI A;  3IXD A;  4NXF A;  3T4S A;  1FIL A;  2XLN A;  5EVL A;  4MBK A;  3QP2 A;  2QJ7 A;  3H82 A;  5F83 A;  3K3C A;  4JXG A;  3PAE A;  1FQG A;  5DTK A;  3DWK A;  2GJ3 A;  3HCY A;  1X0O A;  3M2J A;  4FD8 A;  4QD4 A;  5DVA A;  2OWJ A;  2K7S A;  1YMX A;  3OZH A;  4S2J A;  5F1F A;  3UB8 A;  3BY8 A;  2Y2G A;  4P85 A;  3MR0 A;  1PWC A;  1P9W A;  3GRJ A;  4ME4 A;  3EEH A;  2IA2 A;  3N7W A;  3T4Q A;  1SKO B;  3N8R A;  4JXV A;  4E3O A;  3LR0 A;  1NXY A;  2KDK A;  3ZGA B;  4GLQ A;  3QNB A;  1E3U A;  3K3D A;  5CED A;  3I7J A;  4CJN A;  3UB5 P;  2EA9 A;  5DKL A;  3BRM A;  3DTI A;  4MN7 A;  3DWZ A;  4X55 A;  3TSG A;  4BWI A;  3UO9 A;  1YSP A;  3F1P A;  5L8M A;  3MFX A;  2ZM0 A;  2MJ6 A;  4WEK A;  4MMN A;  5FDH A;  5HFO A;  4X53 A;  1LI9 A;  2ZL1 A;  3D72 A;  5FI6 A;  3N4I A;  1W63 Q;  4EV4 A;  3P09 A;  2J3T C;  4JGR A;  3HLB A;  4WF0 A;  2HP9 A;  2W1T B;  4EUZ A;  1FR1 A;  3MZD A;  3A0S A;  3EGX C;  4ZDX A;  3FZC A; 
#chains in the Genus database with same CATH homology
 4E04 A;  5AVF A;  3KYQ A;  3R7W A;  3B47 A;  2P08 A;  4HI4 A;  3IS2 A;  2JHE A;  2M1C A;  3IS2 B;  5MC7 A;  3F1O B;  3KSH A;  4GW9 A;  2VKS A;  3UB7 A;  2V1B A;  4GS9 A;  4NXG A;  4CLC B;  4XT2 A;  3CLO A;  1S4R A;  3BQ8 A;  2OAP 1;  1OTB A;  4G3V A;  4NXE A;  4ETZ A;  1G28 A;  4Y2F A;  3TE8 A;  2YKF A;  3VE4 A;  3LIF A;  2ZBB A;  4HQA A;  3LIC A;  3CAX A;  4EET B;  3CUE A;  1BYW A;  3S7N A;  2P04 A;  3MQQ A;  4EES A;  4HY8 A;  2KX6 A;  4JGO A;  2VZW A;  4GJ4 A;  1LSX A;  4LRY C;  3PBS A;  2G7U A;  2W3F A;  3VOL A;  4UQI M;  4HNB A;  4QPR A;  3BQA A;  4HIA A;  2I9V A;  3IBR A;  3H9W A;  2ZOH A;  4H6J B;  2Y8H A;  2O99 A;  2W27 A;  3ZYT A;  1LSW A;  1Y28 A;  2PHY A;  4PKY G;  4P6Z M;  4H6J A;  3NHQ A;  3FPV A;  3PBN A;  4Q0J A;  2VV6 A;  4Q0I A;  3E98 A;  1OTA A;  2QKP A;  3O5Y A;  2R78 A;  1S66 L;  3LR4 A;  2J80 A;  1N9L A;  2XRN A;  4JGP A;  3PXP A;  2VA0 A;  3ZQ5 A;  5F6A A;  3MQ0 A;  3FG8 A;  2DMW A;  4WUJ A;  3BWL A;  1T1A A;  5G4Y A;  3T4J A;  1MC0 A;  2OWH A;  5DFY A;  3IBJ A;  3CUE C;  4OOL A;  4LRZ E;  3LIB A;  4XT2 B;  2W0N A;  4HH2 A;  4ARZ A;  4EEU A;  3UE3 A;  2H28 A;  1GSW A;  2KLI A;  4I38 A;  4GHI A;  4DN0 A;  5HDS A;  2VEA A;  4GS9 B;  3T4K A;  3GDI A;  2ZOI A;  1DP8 A;  3RH8 B;  3R4K A;  3OCL A;  2J3T D;  4YNR A;  3NJA A;  5HPI A;  3B42 A;  3PBO A;  1P0Z A;  4MCW A;  3FC7 A;  5A8B A;  2W3E A;  3U2A A;  1D06 A;  3NOU C;  2NUT C;  3T50 A;  2Z6C A;  4MN5 A;  1TS6 A;  2W3H A;  5FL3 A;  1G6O A;  4HJ6 A;  5J3W A;  1DRM A;  1V9Z A;  3OC2 A;  1EW0 A;  5F68 A;  3MMH A;  4PKY A;  3LIE A;  3CIT A;  4I5S A;  3FPW A;  1LL8 A;  2L0W A;  1VB6 A;  2LB5 A;  4Y3I A;  3RTY A;  3VE3 A;  2WKQ A;  2QJ5 A;  4RQ9 A;  3V67 A;  4L9G A;  4LRX C;  5HZH A;  4Z1W A;  2FZ0 A;  1XFQ A;  2BAS A;  3UB6 A;  3S7P A;  3EQV A;  4UQI S;  2VJW A;  4ETX A;  5AVE A;  2VX8 A;  2HJ9 C;  4YOF A;  5KIZ A;  5J4E A;  5HWW A;  2W3D A;  1OT6 A;  4EER A;  2M7U A;  5TJJ A;  2HF6 A;  4Q0H A;  5HDC A;  2PR6 A;  5IT5 A;  3H7W A;  3KSF A;  4II7 A;  2JN7 A;  5C5K A;  4JGQ A;  4EUV A;  2D02 A;  4GHI B;  1P97 A;  4IUH A;  4MN6 A;  5G4Z A;  2JKT M;  3A0R A;  4EW7 A;  2O9C A;  4R3A A;  4AFI A;  1N9N A;  4CLC D;  5I5L A;  2EWV A;  1N9O A;  4HHD A;  5F69 A;  5J7E A;  1F5M A;  2JKR M;  4PHT A;  1V9Y A;  4EQ1 A;  2J3W A;  1S1Y A;  3PBQ A;  1D7E A;  4EU0 A;  1NLY A;  2VV8 A;  2PDR A;  3UMD A;  3VV4 A;  4I3A A;  2GZA A;  2GX5 A;  1TS0 A;  3PR6 A;  3EWK A;  5KSH A;  4NXB A;  3OCN A;  4FOF A;  1H3Q A;  1OTD A;  1MKM A;  4DJ2 A;  4O01 A;  2M7V A;  3KSG A;  2PD7 A;  3S7O A;  3KX0 X;  1NLZ A;  4KQO A;  4LPZ A;  5EFW A;  1F98 A;  2HV1 A;  3C8C A;  4HJ3 A;  3C38 A;  2PYR A;  5TBM A;  2XSS A;  3NOP C;  4DJ3 A;  5DKK A;  2K31 A;  1OPX A;  3BY9 A;  2Y79 A;  2LB9 A;  4R6L A;  1S1Z A;  1YSQ A;  3HJK A;  3KSI A;  4LLO B;  2XRO A;  1TS7 A;  3UB9 A;  1GSX A;  5F5Y A;  1ODV A;  4WEL A;  5AJG A;  3BJN A;  3LR3 A;  1GSV A;  2O0Y A;  3E4Q A;  2W3G A;  3K2N A;  4BMW A;  4HH3 A;  4EXO A;  4FSF A;  1XJ6 A;  3PYP A;  2PR5 A;  2INW A;  4PAU A;  4I39 A;  3JVU A;  4B93 A;  2YKH A;  4O8G A;  3TRC A;  3P7N A;  4BBT A;  2D01 A;  3CI6 A;  5IU1 A;  4ARZ B;  1XJ4 A;  2NUP C;  4UEY A;  3MJQ A;  2B02 A;  4K08 A;  4WN5 A;  2W1T A;  1IOU A;  1DP9 A;  4OOM A;  1T1B A;  4HJ4 A;  4KUO A;  2VV7 A;  2EWW A;  2A24 A;  4F3L A;  2OAQ 1;  3F1N B;  1DP6 A;  4GCZ A;  1LT0 A;  2GNX A;  3HJI A;  3PHY A;  5DJU A;  4WLA A;  4WEJ A;  4YWZ A;  2QHK A;  2VGL S;  1OJ5 A;  2O9A A;  3EEA A;  4CQH A;  4EEP A;  2XA7 M;  3T4T A;  4B9O A;  1T18 A;  4L9F A;  3DBA A;  2CMN A;  1NRJ A;  3T4L A;  1IFQ A;  2ZMV A;  2V0U A;  2A24 B;  3LI9 A;  1NWZ A;  4L9E A;  2JKR I;  1TD5 A;  2V1A A;  3KO6 A;  3LIA A;  3UE6 A;  3OLO A;  3NOT C;  2O9B A;  3GEC A;  4HP9 A;  3SW1 A;  1XFN A;  3C2W A;  2ZMF A;  5HD3 A;  3LFV A;  3F1N A;  4IJG A;  4M4X A;  1WA9 A;  1UWN X;  1MZU A;  3LUQ A;  3E0Y A;  3B33 A;  4O0P A;  1T19 A;  5HWV A;  1OT9 A;  4CLC A;  1KOU A;  1VHM A;  2VLG A;  2L4R A;  1XJ3 A;  3KYZ A;  3JVV A;  4HOI A;  4KUK A;  4NXF A;  4BBV A;  3T4S A;  3F1O A;  3C30 A;  2PD8 A;  3PBT A;  4BBU A;  4I3I A;  2P7J A;  2QJ7 A;  3H82 A;  5CX7 A;  3R7W B;  2Z6D A;  3K3C A;  3PBR A;  1ZHH B;  2W1R A;  1JNU A;  2FH5 A;  3TJZ C;  5DF9 A;  4ZRR A;  4BJP A;  3MXQ A;  1F9I A;  2GJ3 A;  1H8M A;  3HCY A;  2B18 A;  1X0O A;  2VGL M;  3S7Q A;  1UWP X;  1T1C A;  4G3W A;  5DFX A;  2JKT I;  3H82 B;  1OTE A;  1UGU A;  5IS1 A;  5TBM B;  2XA7 S;  4NEE D;  3LID A;  2K2N A;  2OWJ A;  5LBR A;  1TS8 A;  2K7S A;  4P6Z S;  3UB8 A;  3BY8 A;  2V0W A;  3W2Z A;  3MF0 A;  3RFB A;  1S4S A;  3MR0 A;  1P9W A;  3EOI A;  3EQU A;  4ME4 A;  3EEH A;  4NKP A;  4R38 A;  3ULF A;  2HJE A;  2IA2 A;  3T4Q A;  4I3J A;  4KQD A;  1OTI A;  4CLC C;  1P9R A;  1OJG A;  3LR0 A;  3E4P A;  3F1P B;  1YKD A;  2KDK A;  3LI8 A;  4DMZ A;  4GLQ A;  2WKP A;  3K3D A;  1YAX A;  1W63 M;  2QWS A;  4WL9 A;  2EA9 A;  2PYP A;  5DKL A;  5HDD A;  4MN7 A;  2PT7 A;  1TF1 A;  2A2L A;  5HWT A;  4BWI A;  3MQO A;  1YSP A;  3F1P A;  5L8M A;  3MFX A;  2V9A A;  3OBF A;  2MJ6 A;  4WEK A;  1LSV A;  5HD5 A;  4MMN A;  4R70 A;  5HL6 A;  5HPF A;  4G3K A;  3G6O A;  3E4O A;  3TW8 A;  3D72 A;  3UME A;  5HSQ A;  1W63 Q;  3LR5 A;  2L1M A;  5DJT A;  2J3T C;  2KOI A;  4IHQ A;  4CLC E;  3BW6 A;  1S67 L;  3ICY A;  3T4O A;  5K5B A;  3H7W B;  4JGR A;  2OOL A;  2WKR A;  4WF0 A;  4Y5F A;  1XJ2 A;  2W1T B;  3OOV A;  4L0L A;  2HGV A;  3P01 A;  1STZ A;  4F3L B;  1ZTU A;  3A0V A;  3CWF A;  4MDZ A;  3A0S A;  3EGX C;  4HP4 A;  3D3O A;  2QYB A;  3EGD C;  3LYX A;  4IUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...