4MMNA

Structural and biochemical analysis of type ii free methionine-r-sulfoxide reductase from thermoplasma acidophilum
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
141
structure length
141
Chain Sequence
DLKEFARSQMQAACQYLKEKNPKYDWVGFYVLEHGKLKLEAFVGEKTDHVEINLGDGLCSLAVLKNDIVNEYDVKSNPKYLACFPSTQSEIVVPVRYQGEPIGEIDIDSDKKAAFSKEDEAMLSSIADLMAPLVHEFFVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein Ta0848
publication title Structural and biochemical analysis of a type II free methionine-R-sulfoxide reductase from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 45
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4mmnA00
2VKSA 5HPIA 2B18A 2HGVA 2VZWA 4MN7A 4ZRRA 5DFXA 2O9CA 3IBRA 2IA2A 3K2NA 1MC0A 3NOTC 1VHMA 1YSPA 2W3FA 2LB9A 3S7NA 3C2WA 2Y79A 4Y3IA 4LRXC 2LB5A 2W1RA 4DMZA 3S7QA 3KSFA 3O5YA 4E04A 4QPRA 4MDZA 4YNRA 3CI6A 4G3WA 3IBJA 1YKDA 2QYBA 3G6OA 3E0YA 4MMNA 2OOLA 4BWIA 3D3OA 2K2NA 4R70A 1TF1A 3OOVA 3KO6A 3HCYA 2M7VA 4Z1WA 4IJGA 5L8MA 2VEAA 4GW9A 4R6LA 3LFVA 2Y8HA 3CITA 3NOPC 3MQ0A 4DN0A 4ME4A 2O0YA 3S7OA 2W1TA 5C5KA 4EUVA 2O99A 4Q0JA 3KSIA 4GLQA 4Y2FA 3E98A 1STZA 4G3KA 4LRYC 4CQHA 4ETZA 4O8GA 5LBRA 2K31A 2VJWA 5DFYA 2XSSA 2W1TB 1ZTUA 1TD5A 3KSHA 3TRCA 4MCWA 4FOFA 4RQ9A 1F5MA 5K5BA 4YOFA 2W3HA 2M7UA 5HSQA 3R4KA 3EEAA 4Y5FA 1YSQA 2GX5A 3DBAA 4LRZE 2W3EA 3ZQ5A 2KLIA 3W2ZA 4G3VA 2XROA 2KOIA 4O0PA 3BJNA 4ETXA 2O9BA 3RFBA 4Q0IA 3S7PA 3MMHA 3NHQA 2XRNA 5HL6A 2G7UA 5AJGA 3OBFA 4O01A 5HPFA 2W3DA 5I5LA 4IUHA 1MKMA 5TJJA 4IUKA 4Q0HA 3MF0A 2W3GA 3KSGA 3VV4A 2O9AA 4EU0A 2ZMFA 4PAUA 3NOUC
chains in the Genus database with same CATH superfamily
3IXGA 2HV1A 2FH5A 5FDHA 3BFGA 1JTGA 2P9VB 4CLCA 1GSVA 3A3IA 3LO7A 4S2OA 1CK3A 2PR5A 1W63Q 4KQQA 5HWWA 2V1BA 5EV0A 1H0MA 4DJ2A 2WKEA 4QHCA 5AQBA 3ULFA 2PBDP 1ONHA 4BL2A 1W8YA 2R9XA 2Z2MB 4P6ZM 4FSFA 4HI4A 3GTCA 1DP8A 2JKRM 5A8BA 5GHXA 2Y8HA 5CEBA 1PZOA 2JHEA 1H8ZA 5DF9A 3ZHHA 4JGOA 4GDNA 1G5UA 3B47A 2Y2QA 3R7WB 5DFYA 3IWOA 3WS1A 1XGIA 3TG9A 1HTZA 3TRCA 1L0DA 4GDBA 4X55A 4FOFA 3QP6A 5F5YA 4CLCC 4HIAA 1YSQA 5MC7A 1W63M 2XQZA 1Z09A 3A3EA 3LY3A 1YLZA 3MZDA 4DKIA 4S2MA 4IBRA 3NC8A 5F1GA 4RYEA 4K0XA 1K4FA 1BLPA 2VV6A 3VOZA 1KDSA 4X25A 3CHWP 3BFFA 5GLAA 3M2KA 2A24A 4OQIA 3ZG5A 4EQ1A 1PZPA 2ZOHA 1HLUP 3CAXA 1K38A 2R78A 3G32A 3Q81A 1S4SA 1M6KA 2J7VA 3K2NA 1YSPA 3N8RA 3S7NA 2PRFA 1CQAA 3Q7VB 3A0RA 4DMZA 3F1NA 4UAAA 3RXXA 2EX9A 3IX3A 1Q2QA 4OOYA 1JWPA 3ISGA 5EM0A 3MZFA 3T4JA 2DRWA 3NIAA 3E0YA 4HNBA 3PBRA 3CWFA 4KZBA 2EWWA 1K6SA 5FL3A 3CITA 5CECA 1ES5A 4ME4A 1YT4A 4EUVA 3CMZA 4R3BA 3KSIA 4GLQA 4PKYG 3TW8A 3G34A 4ETZA 4I3IA 4KG6A 2HP9A 4KG2A 3UB7A 4II7A 1TS8A 2J9PA 4LENA 2INWA 4KQOA 1SDEA 3ICYA 3SZTA 1TS0A 3UPOA 1K4EA 1ZHHB 3U2AA 1E25A 3LR3A 2XDMA 3V3SA 3MSHA 2H0YA 4HBUA 3U4LP 3D4FA 2KX6A 3W4PA 2HPBA 3MFDA 5HDDA 1BUEA 3EOIA 3UMDA 1CEGA 3LIDA 2XRNA 4XT2B 1NY0A 3OZHA 2HDUA 2VX8A 2Q9MA 3DWKA 3MS6A 3EQVA 3KYEA 2W3GA 4BL3A 3E2LA 3Q7ZA 2PHYA 4A5RA 2ZM8A 4EQIA 4DJ3A 1MWUA 3QP5A 2QJ5A 5CRFA 2IWBA 4UQIM 4P0MA 3FKVA 2A49A 4OQHA 4DDSA 4DXCA 3PR6A 2HDQA 3G2YA 4EBLA 2QYBA 3F1PA 3MXSA 5HFOA 3KO6A 3V39A 4CJNA 5CHJA 1GA0A 3E2KA 4GW9A 4JXVA 2B95A 5CTNA 1NWZA 2OLVA 4NK3A 1XJ2A 2EX8A 4EETB 2VGLM 2XA7S 3MKEA 3LCEA 2VJWA 3BQAA 1DP6A 3TE8A 4YINA 5TR7A 4HJ6A 2ZQ7A 1L0FA 3HL9A 3H9WA 2Y2OA 4Y5FA 2Z2LB 2GX5A 5CX7A 5E43A 5KSCA 4IVKA 3JYIA 4EXOA 4YFMA 1OT6A 1FSWA 1S67L 3VP3A 3BJNA 4OP5A 4UQIS 1YLPA 4NKPA 3QP1A 3IS2A 3HLBA 4RVAA 3PBNA 5AJGA 3C38A 4QWOA 4IUHA 3UB6A 3GR2A 2WGVA 5E2EA 3KSGA 3MQQA 4PAUA 3T4TA 3NBLA 1NJ4A 1OTAA 2Q9NA 2ZC5B 4OLGA 5IHVA 3RJUA 4Y7PA 1XJ4A 3KSFA 2B02A 1N9BA 5TBMA 4WF0A 4G3WA 2XD5A 2IWDA 3FYZA 3S4XA 1YLWA 5FSRA 2Y2GA 1P0ZA 4MN6A 4ZJ3A 4F3LA 3DAVA 5EFWA 3A3JA 3G30A 4H8RA 3BFDA 2VA0A 2A3UA 3NCKA 4ARZA 3RH8B 4B4ZA 1XFQA 4BENA 5HWTA 3LEQA 3ZYTA 4DDYA 5JYOA 5J3WA 2XK1A 5F69A 4HHDA 2XGNA 3GVBA 1IYPA 4EBNA 1VEUA 4KZ6A 3SH7A 2E8IA 1IYQA 1XX2A 4YOFA 3R4KA 5HARA 4XUZA 3DTIA 4KUKA 1MXOA 3MJQA 3VE3A 2PYPA 3H82B 3CJMA 3UB5P 3HJIA 5HPFA 1TVFA 2P9VA 1TS6A 4KZ7A 3VP4A 1LI0A 2V1ZA 3IF6B 2K7SA 2OAP1 3BLSA 1YMXA 4E3KA 4GCZA 2XFSA 2O9CA 3UE6A 4NETA 4BJPA 3FG8A 4JGPA 4JXSA 5CHMA 2P08A 3VP0A 1KDWA 1A0KA 1IYSA 4DE3A 3DW0A 2XFTA 3UB9A 4BD1A 3MQOA 2P7JA 5FEFA 1RCJA 2V0WA 2ZJ9A 4NXFA 3PBQA 1JWZA 1WYCA 5TGFA 2HF6A 4HH3A 4MMNA 4R70A 1ES3A 3LR4A 1ZG4A 4L9EA 3T1RA 2JN7A 1N9NA 3ZVWA 3MQ0A 1BLHA 5J4EA 1XGJA 4YWZA 4WEJA 1IEMA 3R7WA 2O0YA 5G4ZA 1OTDA 2O99A 3BLMA 1ERQA 4KZ9A 4EEPA 5DTSA 1MWSA 2A2LA 3IXDA 4M3KA 4CQHA 4GJ4A 2K31A 2BTFP 3HUMA 4GD6A 5HX9A 3HLCA 4HBTA 5DVAA 5FQ9A 4MN5A 1M40A 2DCFA 1W5DA 3LGOA 2W3EA 2PT7A 2G2UA 4E3JA 4I39A 4ARZB 2Y2HA 1MY8A 1O07A 5BOHA 3HLWA 3KX0X 2GZAA 4BQMA 4WEKA 3T4KA 1KGFA 2JE5A 5EE8A 3TJZC 1IFQA 1NRJA 1S4RA 3HVFA 4Y15A 3T4OA 1XJ6A 2O9AA 4HEFA 4PM6A 4QJGA 5M1AA 1PWCA 5HPIA 3Q07A 2JKFA 4EERA 1ERMA 1Q2PA 1SZVA 2EX6A 3PBTA 2FZ0A 4Y0OA 1DJBA 4KG5A 5FQIA 4GHIB 1JVJA 3BY8A 1W79A 3UO9A 4WZ4A 3DTEA 5A91A 4QY5A 3AGDA 3G6OA 1BSGA 4BWIA 2K2NA 4MNRA 3IHAA 4IJGA 4LV3A 4R6LA 3LFVA 1XPBA 1F9IA 2ZC3B 5GHZA 4N1HA 3KYZA 2EXBA 4WMCD 1AXBA 1DJAA 5C5KA 2PU2A 2X02A 4WBGA 1XFNA 4I5SA 1NYYA 5JYPA 3UE3A 4OQ0A 3RXWA 4LPZA 3MXQA 3LICA 4ZJ1A 3T1XA 2HDRA 1ZTUA 4JXGA 4D60A 2WGWA 1ZG6A 3C7UA 3HJKA 4HQAA 2KDKA 3UE0A 3VFFA 4Y17A 5HWVA 1KE3A 2ZD8A 4XUXA 3ZQ5A 1OTBA 4XT2A 1LL9A 1KOUA 4G3VA 4WYYA 3ZNTA 3VOYA 3M2JA 1LI9A 2P04A 4P87A 2ZL1A 3LI8A 4OH0A 4OKPA 1I2WA 4Q0HA 3VV4A 2V8CA 5E2FA 2Y55A 1L0GA 2Y2LA 2HZ5A 3HLGA 1IKIA 3D9YA 5FAPA 3N8LA 3SH9A 4PM7A 2ZMVA 4B93A 5EM1A 1SHVA 4KENB 5CXWA 1PI4A 3M6BA 1YPRA 3NULA 2PD8A 4N1XA 1G6AA 1EROA 2JKRI 3BFCA 3HBRA 4KZ5A 4DE0A 3E4PA 1YQSA 4Y13A 2M7VA 5HL1A 3OCLA 3G35A 1DP9A 1V9ZA 4GOGA 1GCEA 5FQJA 5GLCA 1GSXA 1OTIA 5DTTA 2FFYA 1HZOA 3E98A 4G3KA 4LRYC 1ESUA 5LBRA 4X1LA 4UA6A 3N7WA 4WM9A 1KE4A 3H7WB 1CJFA 1MPLA 3OC2A 4R4RA 5CHUA 5K5BA 1K57A 2Y2IA 2XH9A 4LV0A 2HDSA 3N8SA 4S2PA 4KUOA 4BBUA 1G68A 1ONGA 3RTYA 4LLOB 3RFBA 2WKRA 3GSGA 2WGIA 1K0KA 3OBFA 3WS4A 2I72A 1XXMA 1OMEA 3HREA 5F1FA 4GNUA 3OPHA 3IHBA 2H28A 2Y91A 5CERA 3T4SA 2HGVA 2WGWB 3OPRA 2DNSA 4EUZA 4M4XA 4ID4A 1QMFA 1NLZA 3EEHA 3UPPA 3F1OA 5F82A 4E3IA 4GS9A 3ITAA 4UA9A 3QP8A 2XA7M 3CPTA 2EFUA 3GECA 2WUQA 5FAQA 1MKIA 4QPRA 2JCHA 3NDGA 2CMNA 4UA7A 2ZL1B 3BRMA 4RX3A 3A3FA 4X56A 2NUTC 1K57C 3OOVA 1NZUA 3V3RA 4BBVA 3UDFA 4DN0A 3FPVA 3MR0A 5FEGA 2HP5A 1UWPX 1TDGA 4MBHA 1FR6A 3OPLA 2ZLYA 5CGXA 4HESA 1XA1A 2W0NA 1FOFA 2BASA 5AQAA 4MCWA 4IVIA 1OTEA 5FATA 3NY4A 3H82A 3NECA 3ZG7B 4UHUA 3W2ZA 2KOIA 5L07A 1UWNX 1NXYA 4ETXA 1PI5A 3Q82A 5E2HA 3T1QB 2Y2PA 3IF6A 1P9WA 5FDSA 1K55A 2BG1A 3LIAA 1YLYA 3MF0A 4BBTA 2ZMFA 2ZC6B 1PW1A 1GHMA 3VP2A 4WUJA 2H10A 3IBRA 3K3CA 3NOTC 1YM1A 1S6RA 5F68A 1LL5A 2EXAA 2X01A 4E3OA 3C4PA 4I3AA 2QWSA 2HJ9C 3WS5A 1ZKJA 1CF0A 3JVUA 4IBXA 4Z9QA 1H8MA 3D3OA 1TF1A 4Z1WA 1I2SA 3ZCZA 3T12B 4NXGA 4F94A 3FKWA 4R23A 3L7HA 3DTMA 3WS0A 3F1OB 3B33A 1YLTA 4GS9B 4Q0JA 2VGKA 1OPXA 1YAXA 2E8JA 3PBOA 3IF6C 4R0QA 3CPTB 4O7DA 4H6JB 1K55C 3VFHA 1IOUA 2VGJA 5EVIB 3QHYA 5J7EA 1FCMA 2EX2A 4S2LA 5EVID 2H5SA 2L1MA 4NG2A 1FILA 3EEAA 1CI9A 2ZQAA 3PBSA 4WL9A 4EESA 4N9KA 1U60A 4OPQA 2OWHA 3CLOA 3IF5A 4LV2A 1EW0A 3PAGA 5EUAA 2G2WA 2OAQ1 4OLDA 3QP2A 3ZNYA 2V1AA 3HLDA 1L0EA 4GHIA 3WRTA 1IELA 4MN7A 3T4QA 4EW7A 1S1ZA 1SCWA 5M18A 4GKUA 4MBFA 3P01A 2M1CA 1S66L 4L9GA 1RP5A 1MC0A 1VHMA 1E3UD 2ZC7A 5U47A 3C30A 4GN2A 4EEUA 1TDLA 4BMWA 2JKTM 3WWXA 3P98A 2ZBBA 1Y28A 4WMCA 2VLGA 2EFXA 4R1GA 1S1YA 2WKQA 1J3WA 2QKPA 4BD0A 5HD5A 4OOLA 3UB8A 5HW3A 1FCOA 3LIEA 2YKHA 3BYDA 3S7OA 3BQ8A 2ZC4B 3HUNA 4JGRA 2GNXA 4MBKA 2VV8A 2ZOIA 3AGFA 4S2NA 4KQDA 4HP4A 3W8KA 1W8QA 3NDEA 2XLNA 3E4OA 2QPNA 3FZCA 2AVXA 3PTEA 1AWIA 5CGSA 1VQQA 5IS1A 3IQAA 1VETB 2L0WA 5HSQA 4S2KA 4U0XA 2PBYA 4X69A 4AFIA 4UEYA 1GA9A 1KGEA 3OLOA 3ZGAB 2XROA 4O0PA 2P74A 1H5XA 5I94A 3FPWA 4PM9A 1VM1A 1MWRA 1J9MA 4EWFA 1SKOA 1H8YA 3IWIA 1G28A 4Q8IA 4WELA 3BEBA 3UN7A 4E6WA 2VZWA 4L9FA 2PU4A 1PWDA 3G2ZA 4OQGA 5DFXA 1S0WA 1Y4OA 3P7NA 2X71A 3FV7A 3AGEA 3HLEA 3LY4A 5M19A 2LB5A 3LR0A 3G31A 4S2NC 5E2GA 3E4QA 4E3MA 3UDXA 1DRMA 5A93A 5HAPA 4YNRA 4B88A 2FFFB 1T1AA 3V67A 4KZ8A 4E3NA 3EQUA 2VEAA 1RGZA 5DKLA 4FUWA 4ZJ2A 2I9VA 1UGUA 5IU1A 5FI2A 1DY6A 3H7WA 3PXPA 4O8GA 5GL9A 3DTKA 4E6XA 3Q1FA 4CPKA 3IX8A 1C3BA 4JF6A 4FD8A 3IWQA 5TFQA 1QMEA 3S22A 1T19A 5CGWA 4LRZE 4X1MA 5DJTA 4I38A 1V9YA 4HH2A 5EOOA 1ODVA 5G4YA 3GRJA 2O9BA 4QD4A 1ESIA 1P9RA 4RA7A 3MMHA 3LYXA 2L4RA 2NUPC 1BT5A 3NJAA 5FI7A 1CI8A 3IH9A 3T1SA 3IXBA 4HOIA 3MFXA 4DE2A 2HJEA 1K56D 1BULA 2D02A 2R9WA 5DJUA 1NZOA 3JPUA 2PYRA 4KZAA 1N4OA 3K3DA 3BW6A 4DF6A 2V0UA 4GZBA 3C2WA 4Y3IA 2OLUA 3LUQA 3UY6A 3O5YA 4MDZA 4L0LA 5FQQA 5IT5A 3IX4A 1FSYA 5EVLA 3EGXC 1SKOB 3ZG8B 3SS4A 3UDIA 2DMWA 1O7EA 1D06A 2ACGA 4EBPA 5FAOA 1Z6FA 2J3WA 2W27A 3SOIA 1OJ5A 2RCXA 2XSSA 1HD8A 2V2FF 2ZMAA 2W1TB 4OPZA 2BLSA 5FQMA 4LGWA 5GLBA 4P6ZS 3BY9A 5G18A 4ZBEA 2OWJA 4Y0UA 2M7UA 1H3QA 5HDCA 1KE0A 4K08A 2QJ7A 1E4DA 3O3VA 4PHTA 3V50A 3LIBA 5AVFA 5HL6A 2G7UA 3P09A 4NXEA 4WN5A 5TJJA 2YKFA 3IT9A 3N4IA 3QP4A 3MKFA 2PDRA 1YLJA 4ZTKA 5KZHA 2B18A 1WE4A 3CG5A 2J3TC 4KZ4A 1RGYA 1FCNA 2WK0A 2ZQDA 4CLCE 5AVEA 3QNBA 2QZ6A 1LLBA 1JTDA 1BLCA 3MBZA 2WKIA 2Y79A 1FR1A 2WYXA 4CLCB 1LT0A 3ZFZA 3A0VA 2QMIA 4CLCD 2JKGA 4P6BA 4E04A 4IEDA 1JWVA 4N92A 3IBJA 3WS2A 2VK3A 2UWXA 2Y2NA 3BWLA 5EECA 1PYYA 5DF8A 1PFLA 3VSKA 3UMEA 2ZM0A 4JLFA 5F83A 4RX2A 5GHYA 4H6JA 4HJ4A 2EA9A 2WZZA 3FC7A 5EVIA 5L2FA 3VSLA 4Y0TA 2WADA 3SW1A 4R3JA 5KIZA 1NLYA 1N9OA 3GMWA 3LEZA 5FI6A 2XF3A 4X6TA 5CTMA 1PIOA 4X68A 3DWZA 1SDNA 3GDIA 5L10A 5HAIA 4X53A 3VE4A 2J3TD 4GB7A 5DF7A 1X0OA 2QHKA 3PHYA 4NXBA 3NHQA 4FTXA 4MLLA 1MKMA 1ES4A 2Z6DA 2OSUA 4D2OA 1E3UA 1TEMA 4BLMA 3M6HA 4U0TA 2VKSA 3FWLA 3GQZA 3UNWA 4S2JA 2D01A 4ZRRA 4DXBA 2IA2A 1LSXA 3CZDA 2B5RA 4E3LA 5EVIC 1PW8A 2W3FA 3C8CA 2WAFA 2A24B 2Y4AA 5DKKA 2H0TA 2W1RA 3N6IA 4P85A 3S7QA 1HVBA 3BECA 1WA9A 5KMWA 5FQKA 3HLFA 4R38A 4ESPA 2GDNA 2PD7A 3F1NB 4OOMA 1PNEA 4WZ5A 3IXHA 1ZC2A 4HP9A 3NOPC 2ZM2A 2WKPA 3MZEA 2WAEA 3KYQA 3T50A 3W4OA 3ZG0A 4KQRA 1VETA 1BLSA 1LHYA 3VP1A 5HAQA 1L3LA 1L2SA 1TD5A 2UV0E 4NEED 4U3TA 4JF5A 1OJGA 5KSHA 2XEPA 1D7EA 1D1JA 2V20A 4RQ9A 2RL3A 1F5MA 3WRZA 2HP6A 4B9OA 4LCMA 4PKYA 1GHPA 3O86A 3DBAA 4C6YA 1GHIA 3LR5A 2KLIA 4QB8A 1OT9A 1W7FA 4JXWA 5HDSA 1JNUA 4LV1A 5AQ7A 1LL8A 3ZDJA 4ZAMA 1P97A 2VGLS 1BYWA 3O88A 5J8XA 1EI5A 1F98A 3A0SA 3SS3A 3C5AA 1KGGA 2WZXA 3D72A 1GSWA 2V8FA 1K6RA 3OCNA 2C6WB 3NOUC 3VOLA 4WZ5C 4FH4A 1KVMA 5HD3A 5AQ9A 3PYPA 1PWGA 4R3AA 5D3OA 3TOIA 3TSGA 4OPYA 1SKFA 2EWVA 5A92A 1K54A 4HJ3A 1MWTA 4FH2A 1CEFA 4LRXC 2ZQCA 2Y2MA 4QU3A 5FA7A 3OPPA 1ACFA 4OONA 2OOLA 2V9AA 3HCYA 3VMAA 3SH8A 2ZQ8A 1VB6A 5L8MA 1YMSA 4K91A 2J80A 3F1PB 1T1BA 4JKTA 3BFEA 4FCFA 3SS5A 1EWZA 3LI9A 1DJCA 1ALQA 2PAVP 2VV7A 1STZA 1N9LA 1FIKA 1LSWA 4B4XA 3EGDC 3PAEA 5EOEA 2J8YA 2JBFA 1IKGA 1G6OA 1KVLA 5GLDA 4K0WA 3IH8A 4HY8A 3ZG9B 3GV9A 4JF4A 4ZDXA 4OPRA 1ES2A 1K54C 1XKZA 2CC1A 1BZAA 4KZ3A 4Q0IA 3V5MA 4JBFA 4PM8A 4LCLA 3ZVTA 2ZQ9A 4GD8A 5DTKA 1K56A 3MXRA 4S2IA 4O01A 3BM6A 1PRQA 5I5LA 5EVEA 2XD1A 4EU0A 3ITBA 1WYBA 3IS2B 4DE1A 1NYMA 3QNCA 4LFUA 3CUEA 1MZUA 2JKTI 1T18A 4OVDA 1IYOA 1XJ3A 2LB9A 3LIFA 4PMAA 1T1CA 1XP4A 5F6AA 3A3DA 3W4QA 1TS7A 4QY6A 1LSVA 3CI6A 1MBLA 1YKDA 5HZHA 4C3QA 1NRFA 4EV4A 2Z6CA 5TBMB 2Y2JA 2GJ3A 4JGQA 4C75A 2J9OA 3UPNA 4MEZA 3C7VA 4F3LB 3B42A 2PR6A 4R4SA 3NI9A 4PM5A 2W1TA 3UE1A 1Y54A 4Y2FA 4PPRA 3HUOA 3JVVA 2JC7A 1F2KA 4OP8A 3KSHA 4DRTA 5A90A 2WKHA 4I3JA 4JPMA 3CUEC 2W3HA 1K25A 5CEDA 2OV5A 4IHQA 2C5WB 5L09A 1VEUB 3G4PA 2Y2KA 3Q7VA 1BTLA 2XR0A 3I7JA 2Y59A 3B3XA 3S7PA 5FASA 3C4OA 3T4LA 3O87A 3L9KA 1XA7A 4N9LA 1I5QA 5EPHA 2MJ6A 1FQGA 2W3DA 3S1YA 2Q0OA 4IUKA 4WLAA 2IWCA 3EWKA 4XXRA
chains in the Genus database with same CATH topology
2HV1A 2B18A 2FH5A 2K7SA 2OAP1 2J3TC 4WUJA 4CLCA 1GSVA 4CLCE 4GCZA 5AVEA 2O9CA 3IBRA 3UE6A 3K3CA 4BJPA 2PR5A 1W63Q 3NOTC 3FG8A 4JGPA 5HWWA 2P08A 2Y79A 2V1BA 4CLCB 1LT0A 4DJ2A 3A0VA 5F68A 3UB9A 4I3AA 3ULFA 3MQOA 2P7JA 2QWSA 4CLCD 4E04A 2HJ9C 2V0WA 3IBJA 3PBQA 4NXFA 4P6ZM 3JVUA 2HF6A 4HH3A 1H8MA 4MMNA 4FSFA 3D3OA 3BWLA 4HI4A 4R70A 1TF1A 1DP8A 3LR4A 4Z1WA 2JKRM 4L9EA 3UMEA 4NXGA 2JN7A 5A8BA 2Y8HA 1N9NA 3MQ0A 2JHEA 4H6JA 5J4EA 4HJ4A 4YWZA 4WEJA 3R7WA 2EA9A 2O0YA 3F1OB 3FC7A 5DF9A 5G4ZA 1OTDA 3B33A 2O99A 4GS9B 4Q0JA 1OPXA 1YAXA 4JGOA 4EEPA 3PBOA 2A2LA 3SW1A 4CQHA 4H6JB 4GJ4A 2K31A 3B47A 3R7WB 5KIZA 1NLYA 5DFYA 1IOUA 1N9OA 5J7EA 3TRCA 4FOFA 2L1MA 4MN5A 5F5YA 4CLCC 3EEAA 4HIAA 1YSQA 5MC7A 3PBSA 4WL9A 2W3EA 2PT7A 1W63M 4EESA 3GDIA 2OWHA 4I39A 3VE4A 4ARZB 3CLOA 2J3TD 1X0OA 1EW0A 2QHKA 3PHYA 3KX0X 4NXBA 3NHQA 2GZAA 4WEKA 2OAQ1 2VV6A 3T4KA 3TJZC 1IFQA 1NRJA 1MKMA 1S4RA 2Z6DA 3T4OA 1XJ6A 2O9AA 2V1AA 2VKSA 5HPIA 4EERA 2A24A 4GHIA 2D01A 4EQ1A 4MN7A 4ZRRA 3T4QA 1S1ZA 4EW7A 2ZOHA 3CAXA 2IA2A 1LSXA 2R78A 2M1CA 3P01A 1S66L 4L9GA 1S4SA 3PBTA 2FZ0A 3K2NA 1MC0A 1VHMA 1YSPA 2W3FA 3C8CA 3S7NA 2A24B 4GHIB 3C30A 5DKKA 3BY8A 3A0RA 2W1RA 4EEUA 4DMZA 3S7QA 4BMWA 3F1NA 2JKTM 1WA9A 3T4JA 4R38A 2ZBBA 3G6OA 1Y28A 3E0YA 2PD7A 2VLGA 4HNBA 4BWIA 2K2NA 1S1YA 3F1NB 3PBRA 3CWFA 4OOMA 2WKQA 2QKPA 4IJGA 2EWWA 5FL3A 4R6LA 3LFVA 5HD5A 4OOLA 3UB8A 3CITA 4HP9A 3NOPC 1F9IA 3LIEA 3KYZA 4ME4A 2WKPA 2YKHA 3KYQA 3T50A 3S7OA 4EUVA 5C5KA 3BQ8A 3KSIA 4GLQA 4PKYG 4JGRA 2GNXA 3TW8A 1XFNA 4I5SA 2VV8A 2ZOIA 3UE3A 4KQDA 4ETZA 4I3IA 4LPZA 3MXQA 4HP4A 3LICA 3UB7A 4II7A 1TD5A 1ZTUA 1TS8A 4KQOA 4NEED 2INWA 3E4OA 4HQAA 3HJKA 3ICYA 1OJGA 2KDKA 5KSHA 1TS0A 1D7EA 1ZHHB 4RQ9A 3U2AA 1F5MA 5IS1A 4B9OA 4PKYA 2L0WA 5HWVA 3LR3A 5HSQA 3DBAA 3ZQ5A 2KX6A 3LR5A 2KLIA 1OTBA 4XT2A 4AFIA 1OT9A 4UEYA 1KOUA 3OLOA 4G3VA 5HDDA 1JNUA 5HDSA 2XROA 4O0PA 1LL8A 3EOIA 3UMDA 1P97A 3FPWA 2VGLS 3LIDA 2P04A 1BYWA 2XRNA 4XT2B 1F98A 3A0SA 3LI8A 2VX8A 3D72A 1GSWA 3EQVA 3OCNA 2W3GA 4Q0HA 3VV4A 1G28A 4WELA 3NOUC 3VOLA 2VZWA 5HD3A 2PHYA 4L9FA 3PYPA 4R3AA 5DFXA 2ZMVA 4B93A 3P7NA 2EWVA 4DJ3A 4HJ3A 2QJ5A 4LRXC 2LB5A 3LR0A 4UQIM 3E4QA 1DRMA 2PD8A 3PR6A 4YNRA 2JKRI 1T1AA 3V67A 2QYBA 3F1PA 2OOLA 3E4PA 3KO6A 2V9AA 3EQUA 3HCYA 2M7VA 3OCLA 1VB6A 5L8MA 1DP9A 1V9ZA 2VEAA 4GW9A 2J80A 3F1PB 5DKLA 1NWZA 1T1BA 1GSXA 1OTIA 3LI9A 2I9VA 1UGUA 1XJ2A 4EETB 2VGLM 2VV7A 5IU1A 2XA7S 3E98A 1STZA 3H7WA 4G3KA 4LRYC 1N9LA 3PXPA 1LSWA 3EGDC 4O8GA 5LBRA 2VJWA 3BQAA 1DP6A 3TE8A 1G6OA 3H7WB 4HJ6A 3OC2A 5K5BA 4HY8A 3H9WA 1T19A 4Y5FA 4LRZE 2GX5A 5CX7A 5DJTA 4I38A 1V9YA 4EXOA 1OT6A 4HH2A 4KUOA 1S67L 4BBUA 1ODVA 5G4YA 3BJNA 4UQIS 3RTYA 4LLOB 2O9BA 3RFBA 4Q0IA 2WKRA 1P9RA 3MMHA 3LYXA 4NKPA 2L4RA 3IS2A 3PBNA 2NUPC 3NJAA 5AJGA 3C38A 3OBFA 4O01A 5I5LA 4IUHA 3UB6A 3KSGA 4EU0A 2H28A 3MQQA 4PAUA 3IS2B 3T4TA 4HOIA 3T4SA 1OTAA 2HGVA 3MFXA 2HJEA 3CUEA 4M4XA 2D02A 1NLZA 3EEHA 3F1OA 5DJUA 1MZUA 2PYRA 4GS9A 3K3DA 2JKTI 3BW6A 2V0UA 1T18A 1XJ3A 2LB9A 3LIFA 3C2WA 4Y3IA 1T1CA 2XA7M 3GECA 5F6AA 3LUQA 1TS7A 1XJ4A 3KSFA 3O5YA 2B02A 4QPRA 4MDZA 4L0LA 1LSVA 2CMNA 3CI6A 4G3WA 4WF0A 5TBMA 1YKDA 5IT5A 5HZHA 1P0ZA 2NUTC 3EGXC 4MN6A 4F3LA 3OOVA 5EFWA 2Z6CA 5TBMB 2VA0A 2GJ3A 4JGQA 4ARZA 4BBVA 4DN0A 3FPVA 4F3LB 3B42A 2DMWA 2PR6A 3MR0A 3RH8B 1XFQA 2W1TA 1D06A 4Y2FA 1UWPX 5HWTA 2J3WA 3JVVA 2W27A 3ZYTA 1OJ5A 2XSSA 2W0NA 5J3WA 5F69A 2W1TB 2BASA 4HHDA 3KSHA 4MCWA 3BY9A 4P6ZS 4I3JA 2OWJA 3CUEC 4YOFA 2W3HA 2M7UA 3R4KA 1OTEA 4IHQA 1H3QA 5HDCA 3H82A 4K08A 2QJ7A 4KUKA 3W2ZA 2KOIA 1UWNX 3MJQA 4PHTA 3VE3A 4ETXA 2PYPA 3S7PA 3H82B 3LIBA 3T4LA 5AVFA 5HL6A 2G7UA 1P9WA 3HJIA 5HPFA 2MJ6A 4NXEA 3LIAA 2W3DA 4WN5A 5TJJA 2YKFA 4IUKA 1TS6A 3MF0A 4WLAA 4BBTA 2ZMFA 2PDRA 3EWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKS A;  5HPI A;  2B18 A;  2HGV A;  2VZW A;  4MN7 A;  4ZRR A;  5DFX A;  2O9C A;  3IBR A;  2IA2 A;  3K2N A;  1MC0 A;  3NOT C;  1VHM A;  1YSP A;  2W3F A;  2LB9 A;  3S7N A;  3C2W A;  2Y79 A;  4Y3I A;  4LRX C;  2LB5 A;  2W1R A;  4DMZ A;  3S7Q A;  3KSF A;  3O5Y A;  4E04 A;  4QPR A;  4MDZ A;  4YNR A;  3CI6 A;  4G3W A;  3IBJ A;  1YKD A;  2QYB A;  3G6O A;  3E0Y A;  4MMN A;  2OOL A;  4BWI A;  3D3O A;  2K2N A;  4R70 A;  1TF1 A;  3OOV A;  3KO6 A;  3HCY A;  2M7V A;  4Z1W A;  4IJG A;  5L8M A;  2VEA A;  4GW9 A;  4R6L A;  3LFV A;  2Y8H A;  3CIT A;  3NOP C;  3MQ0 A;  4DN0 A;  4ME4 A;  2O0Y A;  3S7O A;  2W1T A;  5C5K A;  4EUV A;  2O99 A;  4Q0J A;  3KSI A;  4GLQ A;  4Y2F A;  3E98 A;  1STZ A;  4G3K A;  4LRY C;  4CQH A;  4ETZ A;  4O8G A;  5LBR A;  2K31 A;  2VJW A;  5DFY A;  2XSS A;  2W1T B;  1ZTU A;  1TD5 A;  3KSH A;  3TRC A;  4MCW A;  4FOF A;  4RQ9 A;  1F5M A;  5K5B A;  4YOF A;  2W3H A;  2M7U A;  5HSQ A;  3R4K A;  3EEA A;  4Y5F A;  1YSQ A;  2GX5 A;  3DBA A;  4LRZ E;  2W3E A;  3ZQ5 A;  2KLI A;  3W2Z A;  4G3V A;  2XRO A;  2KOI A;  4O0P A;  3BJN A;  4ETX A;  2O9B A;  3RFB A;  4Q0I A;  3S7P A;  3MMH A;  3NHQ A;  2XRN A;  5HL6 A;  2G7U A;  5AJG A;  3OBF A;  4O01 A;  5HPF A;  2W3D A;  5I5L A;  4IUH A;  1MKM A;  5TJJ A;  4IUK A;  4Q0H A;  3MF0 A;  2W3G A;  3KSG A;  3VV4 A;  2O9A A;  4EU0 A;  2ZMF A;  4PAU A;  3NOU C; 
#chains in the Genus database with same CATH topology
 3IXG A;  2HV1 A;  2FH5 A;  5FDH A;  3BFG A;  1JTG A;  2P9V B;  4CLC A;  1GSV A;  3A3I A;  3LO7 A;  4S2O A;  1CK3 A;  2PR5 A;  1W63 Q;  4KQQ A;  5HWW A;  2V1B A;  5EV0 A;  1H0M A;  4DJ2 A;  2WKE A;  4QHC A;  5AQB A;  3ULF A;  2PBD P;  1ONH A;  4BL2 A;  1W8Y A;  2R9X A;  2Z2M B;  4P6Z M;  4FSF A;  4HI4 A;  3GTC A;  1DP8 A;  2JKR M;  5A8B A;  5GHX A;  2Y8H A;  5CEB A;  1PZO A;  2JHE A;  1H8Z A;  5DF9 A;  3ZHH A;  4JGO A;  4GDN A;  1G5U A;  3B47 A;  2Y2Q A;  3R7W B;  5DFY A;  3IWO A;  3WS1 A;  1XGI A;  3TG9 A;  1HTZ A;  3TRC A;  1L0D A;  4GDB A;  4X55 A;  4FOF A;  3QP6 A;  5F5Y A;  4CLC C;  4HIA A;  1YSQ A;  5MC7 A;  1W63 M;  2XQZ A;  1Z09 A;  3A3E A;  3LY3 A;  1YLZ A;  3MZD A;  4DKI A;  4S2M A;  4IBR A;  3NC8 A;  5F1G A;  4RYE A;  4K0X A;  1K4F A;  1BLP A;  2VV6 A;  3VOZ A;  1KDS A;  4X25 A;  3CHW P;  3BFF A;  5GLA A;  3M2K A;  2A24 A;  4OQI A;  3ZG5 A;  4EQ1 A;  1PZP A;  2ZOH A;  1HLU P;  3CAX A;  1K38 A;  2R78 A;  3G32 A;  3Q81 A;  1S4S A;  1M6K A;  2J7V A;  3K2N A;  1YSP A;  3N8R A;  3S7N A;  2PRF A;  1CQA A;  3Q7V B;  3A0R A;  4DMZ A;  3F1N A;  4UAA A;  3RXX A;  2EX9 A;  3IX3 A;  1Q2Q A;  4OOY A;  1JWP A;  3ISG A;  5EM0 A;  3MZF A;  3T4J A;  2DRW A;  3NIA A;  3E0Y A;  4HNB A;  3PBR A;  3CWF A;  4KZB A;  2EWW A;  1K6S A;  5FL3 A;  3CIT A;  5CEC A;  1ES5 A;  4ME4 A;  1YT4 A;  4EUV A;  3CMZ A;  4R3B A;  3KSI A;  4GLQ A;  4PKY G;  3TW8 A;  3G34 A;  4ETZ A;  4I3I A;  4KG6 A;  2HP9 A;  4KG2 A;  3UB7 A;  4II7 A;  1TS8 A;  2J9P A;  4LEN A;  2INW A;  4KQO A;  1SDE A;  3ICY A;  3SZT A;  1TS0 A;  3UPO A;  1K4E A;  1ZHH B;  3U2A A;  1E25 A;  3LR3 A;  2XDM A;  3V3S A;  3MSH A;  2H0Y A;  4HBU A;  3U4L P;  3D4F A;  2KX6 A;  3W4P A;  2HPB A;  3MFD A;  5HDD A;  1BUE A;  3EOI A;  3UMD A;  1CEG A;  3LID A;  2XRN A;  4XT2 B;  1NY0 A;  3OZH A;  2HDU A;  2VX8 A;  2Q9M A;  3DWK A;  3MS6 A;  3EQV A;  3KYE A;  2W3G A;  4BL3 A;  3E2L A;  3Q7Z A;  2PHY A;  4A5R A;  2ZM8 A;  4EQI A;  4DJ3 A;  1MWU A;  3QP5 A;  2QJ5 A;  5CRF A;  2IWB A;  4UQI M;  4P0M A;  3FKV A;  2A49 A;  4OQH A;  4DDS A;  4DXC A;  3PR6 A;  2HDQ A;  3G2Y A;  4EBL A;  2QYB A;  3F1P A;  3MXS A;  5HFO A;  3KO6 A;  3V39 A;  4CJN A;  5CHJ A;  1GA0 A;  3E2K A;  4GW9 A;  4JXV A;  2B95 A;  5CTN A;  1NWZ A;  2OLV A;  4NK3 A;  1XJ2 A;  2EX8 A;  4EET B;  2VGL M;  2XA7 S;  3MKE A;  3LCE A;  2VJW A;  3BQA A;  1DP6 A;  3TE8 A;  4YIN A;  5TR7 A;  4HJ6 A;  2ZQ7 A;  1L0F A;  3HL9 A;  3H9W A;  2Y2O A;  4Y5F A;  2Z2L B;  2GX5 A;  5CX7 A;  5E43 A;  5KSC A;  4IVK A;  3JYI A;  4EXO A;  4YFM A;  1OT6 A;  1FSW A;  1S67 L;  3VP3 A;  3BJN A;  4OP5 A;  4UQI S;  1YLP A;  4NKP A;  3QP1 A;  3IS2 A;  3HLB A;  4RVA A;  3PBN A;  5AJG A;  3C38 A;  4QWO A;  4IUH A;  3UB6 A;  3GR2 A;  2WGV A;  5E2E A;  3KSG A;  3MQQ A;  4PAU A;  3T4T A;  3NBL A;  1NJ4 A;  1OTA A;  2Q9N A;  2ZC5 B;  4OLG A;  5IHV A;  3RJU A;  4Y7P A;  1XJ4 A;  3KSF A;  2B02 A;  1N9B A;  5TBM A;  4WF0 A;  4G3W A;  2XD5 A;  2IWD A;  3FYZ A;  3S4X A;  1YLW A;  5FSR A;  2Y2G A;  1P0Z A;  4MN6 A;  4ZJ3 A;  4F3L A;  3DAV A;  5EFW A;  3A3J A;  3G30 A;  4H8R A;  3BFD A;  2VA0 A;  2A3U A;  3NCK A;  4ARZ A;  3RH8 B;  4B4Z A;  1XFQ A;  4BEN A;  5HWT A;  3LEQ A;  3ZYT A;  4DDY A;  5JYO A;  5J3W A;  2XK1 A;  5F69 A;  4HHD A;  2XGN A;  3GVB A;  1IYP A;  4EBN A;  1VEU A;  4KZ6 A;  3SH7 A;  2E8I A;  1IYQ A;  1XX2 A;  4YOF A;  3R4K A;  5HAR A;  4XUZ A;  3DTI A;  4KUK A;  1MXO A;  3MJQ A;  3VE3 A;  2PYP A;  3H82 B;  3CJM A;  3UB5 P;  3HJI A;  5HPF A;  1TVF A;  2P9V A;  1TS6 A;  4KZ7 A;  3VP4 A;  1LI0 A;  2V1Z A;  3IF6 B;  2K7S A;  2OAP 1;  3BLS A;  1YMX A;  4E3K A;  4GCZ A;  2XFS A;  2O9C A;  3UE6 A;  4NET A;  4BJP A;  3FG8 A;  4JGP A;  4JXS A;  5CHM A;  2P08 A;  3VP0 A;  1KDW A;  1A0K A;  1IYS A;  4DE3 A;  3DW0 A;  2XFT A;  3UB9 A;  4BD1 A;  3MQO A;  2P7J A;  5FEF A;  1RCJ A;  2V0W A;  2ZJ9 A;  4NXF A;  3PBQ A;  1JWZ A;  1WYC A;  5TGF A;  2HF6 A;  4HH3 A;  4MMN A;  4R70 A;  1ES3 A;  3LR4 A;  1ZG4 A;  4L9E A;  3T1R A;  2JN7 A;  1N9N A;  3ZVW A;  3MQ0 A;  1BLH A;  5J4E A;  1XGJ A;  4YWZ A;  4WEJ A;  1IEM A;  3R7W A;  2O0Y A;  5G4Z A;  1OTD A;  2O99 A;  3BLM A;  1ERQ A;  4KZ9 A;  4EEP A;  5DTS A;  1MWS A;  2A2L A;  3IXD A;  4M3K A;  4CQH A;  4GJ4 A;  2K31 A;  2BTF P;  3HUM A;  4GD6 A;  5HX9 A;  3HLC A;  4HBT A;  5DVA A;  5FQ9 A;  4MN5 A;  1M40 A;  2DCF A;  1W5D A;  3LGO A;  2W3E A;  2PT7 A;  2G2U A;  4E3J A;  4I39 A;  4ARZ B;  2Y2H A;  1MY8 A;  1O07 A;  5BOH A;  3HLW A;  3KX0 X;  2GZA A;  4BQM A;  4WEK A;  3T4K A;  1KGF A;  2JE5 A;  5EE8 A;  3TJZ C;  1IFQ A;  1NRJ A;  1S4R A;  3HVF A;  4Y15 A;  3T4O A;  1XJ6 A;  2O9A A;  4HEF A;  4PM6 A;  4QJG A;  5M1A A;  1PWC A;  5HPI A;  3Q07 A;  2JKF A;  4EER A;  1ERM A;  1Q2P A;  1SZV A;  2EX6 A;  3PBT A;  2FZ0 A;  4Y0O A;  1DJB A;  4KG5 A;  5FQI A;  4GHI B;  1JVJ A;  3BY8 A;  1W79 A;  3UO9 A;  4WZ4 A;  3DTE A;  5A91 A;  4QY5 A;  3AGD A;  3G6O A;  1BSG A;  4BWI A;  2K2N A;  4MNR A;  3IHA A;  4IJG A;  4LV3 A;  4R6L A;  3LFV A;  1XPB A;  1F9I A;  2ZC3 B;  5GHZ A;  4N1H A;  3KYZ A;  2EXB A;  4WMC D;  1AXB A;  1DJA A;  5C5K A;  2PU2 A;  2X02 A;  4WBG A;  1XFN A;  4I5S A;  1NYY A;  5JYP A;  3UE3 A;  4OQ0 A;  3RXW A;  4LPZ A;  3MXQ A;  3LIC A;  4ZJ1 A;  3T1X A;  2HDR A;  1ZTU A;  4JXG A;  4D60 A;  2WGW A;  1ZG6 A;  3C7U A;  3HJK A;  4HQA A;  2KDK A;  3UE0 A;  3VFF A;  4Y17 A;  5HWV A;  1KE3 A;  2ZD8 A;  4XUX A;  3ZQ5 A;  1OTB A;  4XT2 A;  1LL9 A;  1KOU A;  4G3V A;  4WYY A;  3ZNT A;  3VOY A;  3M2J A;  1LI9 A;  2P04 A;  4P87 A;  2ZL1 A;  3LI8 A;  4OH0 A;  4OKP A;  1I2W A;  4Q0H A;  3VV4 A;  2V8C A;  5E2F A;  2Y55 A;  1L0G A;  2Y2L A;  2HZ5 A;  3HLG A;  1IKI A;  3D9Y A;  5FAP A;  3N8L A;  3SH9 A;  4PM7 A;  2ZMV A;  4B93 A;  5EM1 A;  1SHV A;  4KEN B;  5CXW A;  1PI4 A;  3M6B A;  1YPR A;  3NUL A;  2PD8 A;  4N1X A;  1G6A A;  1ERO A;  2JKR I;  3BFC A;  3HBR A;  4KZ5 A;  4DE0 A;  3E4P A;  1YQS A;  4Y13 A;  2M7V A;  5HL1 A;  3OCL A;  3G35 A;  1DP9 A;  1V9Z A;  4GOG A;  1GCE A;  5FQJ A;  5GLC A;  1GSX A;  1OTI A;  5DTT A;  2FFY A;  1HZO A;  3E98 A;  4G3K A;  4LRY C;  1ESU A;  5LBR A;  4X1L A;  4UA6 A;  3N7W A;  4WM9 A;  1KE4 A;  3H7W B;  1CJF A;  1MPL A;  3OC2 A;  4R4R A;  5CHU A;  5K5B A;  1K57 A;  2Y2I A;  2XH9 A;  4LV0 A;  2HDS A;  3N8S A;  4S2P A;  4KUO A;  4BBU A;  1G68 A;  1ONG A;  3RTY A;  4LLO B;  3RFB A;  2WKR A;  3GSG A;  2WGI A;  1K0K A;  3OBF A;  3WS4 A;  2I72 A;  1XXM A;  1OME A;  3HRE A;  5F1F A;  4GNU A;  3OPH A;  3IHB A;  2H28 A;  2Y91 A;  5CER A;  3T4S A;  2HGV A;  2WGW B;  3OPR A;  2DNS A;  4EUZ A;  4M4X A;  4ID4 A;  1QMF A;  1NLZ A;  3EEH A;  3UPP A;  3F1O A;  5F82 A;  4E3I A;  4GS9 A;  3ITA A;  4UA9 A;  3QP8 A;  2XA7 M;  3CPT A;  2EFU A;  3GEC A;  2WUQ A;  5FAQ A;  1MKI A;  4QPR A;  2JCH A;  3NDG A;  2CMN A;  4UA7 A;  2ZL1 B;  3BRM A;  4RX3 A;  3A3F A;  4X56 A;  2NUT C;  1K57 C;  3OOV A;  1NZU A;  3V3R A;  4BBV A;  3UDF A;  4DN0 A;  3FPV A;  3MR0 A;  5FEG A;  2HP5 A;  1UWP X;  1TDG A;  4MBH A;  1FR6 A;  3OPL A;  2ZLY A;  5CGX A;  4HES A;  1XA1 A;  2W0N A;  1FOF A;  2BAS A;  5AQA A;  4MCW A;  4IVI A;  1OTE A;  5FAT A;  3NY4 A;  3H82 A;  3NEC A;  3ZG7 B;  4UHU A;  3W2Z A;  2KOI A;  5L07 A;  1UWN X;  1NXY A;  4ETX A;  1PI5 A;  3Q82 A;  5E2H A;  3T1Q B;  2Y2P A;  3IF6 A;  1P9W A;  5FDS A;  1K55 A;  2BG1 A;  3LIA A;  1YLY A;  3MF0 A;  4BBT A;  2ZMF A;  2ZC6 B;  1PW1 A;  1GHM A;  3VP2 A;  4WUJ A;  2H10 A;  3IBR A;  3K3C A;  3NOT C;  1YM1 A;  1S6R A;  5F68 A;  1LL5 A;  2EXA A;  2X01 A;  4E3O A;  3C4P A;  4I3A A;  2QWS A;  2HJ9 C;  3WS5 A;  1ZKJ A;  1CF0 A;  3JVU A;  4IBX A;  4Z9Q A;  1H8M A;  3D3O A;  1TF1 A;  4Z1W A;  1I2S A;  3ZCZ A;  3T12 B;  4NXG A;  4F94 A;  3FKW A;  4R23 A;  3L7H A;  3DTM A;  3WS0 A;  3F1O B;  3B33 A;  1YLT A;  4GS9 B;  4Q0J A;  2VGK A;  1OPX A;  1YAX A;  2E8J A;  3PBO A;  3IF6 C;  4R0Q A;  3CPT B;  4O7D A;  4H6J B;  1K55 C;  3VFH A;  1IOU A;  2VGJ A;  5EVI B;  3QHY A;  5J7E A;  1FCM A;  2EX2 A;  4S2L A;  5EVI D;  2H5S A;  2L1M A;  4NG2 A;  1FIL A;  3EEA A;  1CI9 A;  2ZQA A;  3PBS A;  4WL9 A;  4EES A;  4N9K A;  1U60 A;  4OPQ A;  2OWH A;  3CLO A;  3IF5 A;  4LV2 A;  1EW0 A;  3PAG A;  5EUA A;  2G2W A;  2OAQ 1;  4OLD A;  3QP2 A;  3ZNY A;  2V1A A;  3HLD A;  1L0E A;  4GHI A;  3WRT A;  1IEL A;  4MN7 A;  3T4Q A;  4EW7 A;  1S1Z A;  1SCW A;  5M18 A;  4GKU A;  4MBF A;  3P01 A;  2M1C A;  1S66 L;  4L9G A;  1RP5 A;  1MC0 A;  1VHM A;  1E3U D;  2ZC7 A;  5U47 A;  3C30 A;  4GN2 A;  4EEU A;  1TDL A;  4BMW A;  2JKT M;  3WWX A;  3P98 A;  2ZBB A;  1Y28 A;  4WMC A;  2VLG A;  2EFX A;  4R1G A;  1S1Y A;  2WKQ A;  1J3W A;  2QKP A;  4BD0 A;  5HD5 A;  4OOL A;  3UB8 A;  5HW3 A;  1FCO A;  3LIE A;  2YKH A;  3BYD A;  3S7O A;  3BQ8 A;  2ZC4 B;  3HUN A;  4JGR A;  2GNX A;  4MBK A;  2VV8 A;  2ZOI A;  3AGF A;  4S2N A;  4KQD A;  4HP4 A;  3W8K A;  1W8Q A;  3NDE A;  2XLN A;  3E4O A;  2QPN A;  3FZC A;  2AVX A;  3PTE A;  1AWI A;  5CGS A;  1VQQ A;  5IS1 A;  3IQA A;  1VET B;  2L0W A;  5HSQ A;  4S2K A;  4U0X A;  2PBY A;  4X69 A;  4AFI A;  4UEY A;  1GA9 A;  1KGE A;  3OLO A;  3ZGA B;  2XRO A;  4O0P A;  2P74 A;  1H5X A;  5I94 A;  3FPW A;  4PM9 A;  1VM1 A;  1MWR A;  1J9M A;  4EWF A;  1SKO A;  1H8Y A;  3IWI A;  1G28 A;  4Q8I A;  4WEL A;  3BEB A;  3UN7 A;  4E6W A;  2VZW A;  4L9F A;  2PU4 A;  1PWD A;  3G2Z A;  4OQG A;  5DFX A;  1S0W A;  1Y4O A;  3P7N A;  2X71 A;  3FV7 A;  3AGE A;  3HLE A;  3LY4 A;  5M19 A;  2LB5 A;  3LR0 A;  3G31 A;  4S2N C;  5E2G A;  3E4Q A;  4E3M A;  3UDX A;  1DRM A;  5A93 A;  5HAP A;  4YNR A;  4B88 A;  2FFF B;  1T1A A;  3V67 A;  4KZ8 A;  4E3N A;  3EQU A;  2VEA A;  1RGZ A;  5DKL A;  4FUW A;  4ZJ2 A;  2I9V A;  1UGU A;  5IU1 A;  5FI2 A;  1DY6 A;  3H7W A;  3PXP A;  4O8G A;  5GL9 A;  3DTK A;  4E6X A;  3Q1F A;  4CPK A;  3IX8 A;  1C3B A;  4JF6 A;  4FD8 A;  3IWQ A;  5TFQ A;  1QME A;  3S22 A;  1T19 A;  5CGW A;  4LRZ E;  4X1M A;  5DJT A;  4I38 A;  1V9Y A;  4HH2 A;  5EOO A;  1ODV A;  5G4Y A;  3GRJ A;  2O9B A;  4QD4 A;  1ESI A;  1P9R A;  4RA7 A;  3MMH A;  3LYX A;  2L4R A;  2NUP C;  1BT5 A;  3NJA A;  5FI7 A;  1CI8 A;  3IH9 A;  3T1S A;  3IXB A;  4HOI A;  3MFX A;  4DE2 A;  2HJE A;  1K56 D;  1BUL A;  2D02 A;  2R9W A;  5DJU A;  1NZO A;  3JPU A;  2PYR A;  4KZA A;  1N4O A;  3K3D A;  3BW6 A;  4DF6 A;  2V0U A;  4GZB A;  3C2W A;  4Y3I A;  2OLU A;  3LUQ A;  3UY6 A;  3O5Y A;  4MDZ A;  4L0L A;  5FQQ A;  5IT5 A;  3IX4 A;  1FSY A;  5EVL A;  3EGX C;  1SKO B;  3ZG8 B;  3SS4 A;  3UDI A;  2DMW A;  1O7E A;  1D06 A;  2ACG A;  4EBP A;  5FAO A;  1Z6F A;  2J3W A;  2W27 A;  3SOI A;  1OJ5 A;  2RCX A;  2XSS A;  1HD8 A;  2V2F F;  2ZMA A;  2W1T B;  4OPZ A;  2BLS A;  5FQM A;  4LGW A;  5GLB A;  4P6Z S;  3BY9 A;  5G18 A;  4ZBE A;  2OWJ A;  4Y0U A;  2M7U A;  1H3Q A;  5HDC A;  1KE0 A;  4K08 A;  2QJ7 A;  1E4D A;  3O3V A;  4PHT A;  3V50 A;  3LIB A;  5AVF A;  5HL6 A;  2G7U A;  3P09 A;  4NXE A;  4WN5 A;  5TJJ A;  2YKF A;  3IT9 A;  3N4I A;  3QP4 A;  3MKF A;  2PDR A;  1YLJ A;  4ZTK A;  5KZH A;  2B18 A;  1WE4 A;  3CG5 A;  2J3T C;  4KZ4 A;  1RGY A;  1FCN A;  2WK0 A;  2ZQD A;  4CLC E;  5AVE A;  3QNB A;  2QZ6 A;  1LLB A;  1JTD A;  1BLC A;  3MBZ A;  2WKI A;  2Y79 A;  1FR1 A;  2WYX A;  4CLC B;  1LT0 A;  3ZFZ A;  3A0V A;  2QMI A;  4CLC D;  2JKG A;  4P6B A;  4E04 A;  4IED A;  1JWV A;  4N92 A;  3IBJ A;  3WS2 A;  2VK3 A;  2UWX A;  2Y2N A;  3BWL A;  5EEC A;  1PYY A;  5DF8 A;  1PFL A;  3VSK A;  3UME A;  2ZM0 A;  4JLF A;  5F83 A;  4RX2 A;  5GHY A;  4H6J A;  4HJ4 A;  2EA9 A;  2WZZ A;  3FC7 A;  5EVI A;  5L2F A;  3VSL A;  4Y0T A;  2WAD A;  3SW1 A;  4R3J A;  5KIZ A;  1NLY A;  1N9O A;  3GMW A;  3LEZ A;  5FI6 A;  2XF3 A;  4X6T A;  5CTM A;  1PIO A;  4X68 A;  3DWZ A;  1SDN A;  3GDI A;  5L10 A;  5HAI A;  4X53 A;  3VE4 A;  2J3T D;  4GB7 A;  5DF7 A;  1X0O A;  2QHK A;  3PHY A;  4NXB A;  3NHQ A;  4FTX A;  4MLL A;  1MKM A;  1ES4 A;  2Z6D A;  2OSU A;  4D2O A;  1E3U A;  1TEM A;  4BLM A;  3M6H A;  4U0T A;  2VKS A;  3FWL A;  3GQZ A;  3UNW A;  4S2J A;  2D01 A;  4ZRR A;  4DXB A;  2IA2 A;  1LSX A;  3CZD A;  2B5R A;  4E3L A;  5EVI C;  1PW8 A;  2W3F A;  3C8C A;  2WAF A;  2A24 B;  2Y4A A;  5DKK A;  2H0T A;  2W1R A;  3N6I A;  4P85 A;  3S7Q A;  1HVB A;  3BEC A;  1WA9 A;  5KMW A;  5FQK A;  3HLF A;  4R38 A;  4ESP A;  2GDN A;  2PD7 A;  3F1N B;  4OOM A;  1PNE A;  4WZ5 A;  3IXH A;  1ZC2 A;  4HP9 A;  3NOP C;  2ZM2 A;  2WKP A;  3MZE A;  2WAE A;  3KYQ A;  3T50 A;  3W4O A;  3ZG0 A;  4KQR A;  1VET A;  1BLS A;  1LHY A;  3VP1 A;  5HAQ A;  1L3L A;  1L2S A;  1TD5 A;  2UV0 E;  4NEE D;  4U3T A;  4JF5 A;  1OJG A;  5KSH A;  2XEP A;  1D7E A;  1D1J A;  2V20 A;  4RQ9 A;  2RL3 A;  1F5M A;  3WRZ A;  2HP6 A;  4B9O A;  4LCM A;  4PKY A;  1GHP A;  3O86 A;  3DBA A;  4C6Y A;  1GHI A;  3LR5 A;  2KLI A;  4QB8 A;  1OT9 A;  1W7F A;  4JXW A;  5HDS A;  1JNU A;  4LV1 A;  5AQ7 A;  1LL8 A;  3ZDJ A;  4ZAM A;  1P97 A;  2VGL S;  1BYW A;  3O88 A;  5J8X A;  1EI5 A;  1F98 A;  3A0S A;  3SS3 A;  3C5A A;  1KGG A;  2WZX A;  3D72 A;  1GSW A;  2V8F A;  1K6R A;  3OCN A;  2C6W B;  3NOU C;  3VOL A;  4WZ5 C;  4FH4 A;  1KVM A;  5HD3 A;  5AQ9 A;  3PYP A;  1PWG A;  4R3A A;  5D3O A;  3TOI A;  3TSG A;  4OPY A;  1SKF A;  2EWV A;  5A92 A;  1K54 A;  4HJ3 A;  1MWT A;  4FH2 A;  1CEF A;  4LRX C;  2ZQC A;  2Y2M A;  4QU3 A;  5FA7 A;  3OPP A;  1ACF A;  4OON A;  2OOL A;  2V9A A;  3HCY A;  3VMA A;  3SH8 A;  2ZQ8 A;  1VB6 A;  5L8M A;  1YMS A;  4K91 A;  2J80 A;  3F1P B;  1T1B A;  4JKT A;  3BFE A;  4FCF A;  3SS5 A;  1EWZ A;  3LI9 A;  1DJC A;  1ALQ A;  2PAV P;  2VV7 A;  1STZ A;  1N9L A;  1FIK A;  1LSW A;  4B4X A;  3EGD C;  3PAE A;  5EOE A;  2J8Y A;  2JBF A;  1IKG A;  1G6O A;  1KVL A;  5GLD A;  4K0W A;  3IH8 A;  4HY8 A;  3ZG9 B;  3GV9 A;  4JF4 A;  4ZDX A;  4OPR A;  1ES2 A;  1K54 C;  1XKZ A;  2CC1 A;  1BZA A;  4KZ3 A;  4Q0I A;  3V5M A;  4JBF A;  4PM8 A;  4LCL A;  3ZVT A;  2ZQ9 A;  4GD8 A;  5DTK A;  1K56 A;  3MXR A;  4S2I A;  4O01 A;  3BM6 A;  1PRQ A;  5I5L A;  5EVE A;  2XD1 A;  4EU0 A;  3ITB A;  1WYB A;  3IS2 B;  4DE1 A;  1NYM A;  3QNC A;  4LFU A;  3CUE A;  1MZU A;  2JKT I;  1T18 A;  4OVD A;  1IYO A;  1XJ3 A;  2LB9 A;  3LIF A;  4PMA A;  1T1C A;  1XP4 A;  5F6A A;  3A3D A;  3W4Q A;  1TS7 A;  4QY6 A;  1LSV A;  3CI6 A;  1MBL A;  1YKD A;  5HZH A;  4C3Q A;  1NRF A;  4EV4 A;  2Z6C A;  5TBM B;  2Y2J A;  2GJ3 A;  4JGQ A;  4C75 A;  2J9O A;  3UPN A;  4MEZ A;  3C7V A;  4F3L B;  3B42 A;  2PR6 A;  4R4S A;  3NI9 A;  4PM5 A;  2W1T A;  3UE1 A;  1Y54 A;  4Y2F A;  4PPR A;  3HUO A;  3JVV A;  2JC7 A;  1F2K A;  4OP8 A;  3KSH A;  4DRT A;  5A90 A;  2WKH A;  4I3J A;  4JPM A;  3CUE C;  2W3H A;  1K25 A;  5CED A;  2OV5 A;  4IHQ A;  2C5W B;  5L09 A;  1VEU B;  3G4P A;  2Y2K A;  3Q7V A;  1BTL A;  2XR0 A;  3I7J A;  2Y59 A;  3B3X A;  3S7P A;  5FAS A;  3C4O A;  3T4L A;  3O87 A;  3L9K A;  1XA7 A;  4N9L A;  1I5Q A;  5EPH A;  2MJ6 A;  1FQG A;  2W3D A;  3S1Y A;  2Q0O A;  4IUK A;  4WLA A;  2IWC A;  3EWK A;  4XXR A; 
#chains in the Genus database with same CATH homology
 2HV1 A;  2B18 A;  2FH5 A;  2K7S A;  2OAP 1;  2J3T C;  4WUJ A;  4CLC A;  1GSV A;  4CLC E;  4GCZ A;  5AVE A;  2O9C A;  3IBR A;  3UE6 A;  3K3C A;  4BJP A;  2PR5 A;  1W63 Q;  3NOT C;  3FG8 A;  4JGP A;  5HWW A;  2P08 A;  2Y79 A;  2V1B A;  4CLC B;  1LT0 A;  4DJ2 A;  3A0V A;  5F68 A;  3UB9 A;  4I3A A;  3ULF A;  3MQO A;  2P7J A;  2QWS A;  4CLC D;  4E04 A;  2HJ9 C;  2V0W A;  3IBJ A;  3PBQ A;  4NXF A;  4P6Z M;  3JVU A;  2HF6 A;  4HH3 A;  1H8M A;  4MMN A;  4FSF A;  3D3O A;  3BWL A;  4HI4 A;  4R70 A;  1TF1 A;  1DP8 A;  3LR4 A;  4Z1W A;  2JKR M;  4L9E A;  3UME A;  4NXG A;  2JN7 A;  5A8B A;  2Y8H A;  1N9N A;  3MQ0 A;  2JHE A;  4H6J A;  5J4E A;  4HJ4 A;  4YWZ A;  4WEJ A;  3R7W A;  2EA9 A;  2O0Y A;  3F1O B;  3FC7 A;  5DF9 A;  5G4Z A;  1OTD A;  3B33 A;  2O99 A;  4GS9 B;  4Q0J A;  1OPX A;  1YAX A;  4JGO A;  4EEP A;  3PBO A;  2A2L A;  3SW1 A;  4CQH A;  4H6J B;  4GJ4 A;  2K31 A;  3B47 A;  3R7W B;  5KIZ A;  1NLY A;  5DFY A;  1IOU A;  1N9O A;  5J7E A;  3TRC A;  4FOF A;  2L1M A;  4MN5 A;  5F5Y A;  4CLC C;  3EEA A;  4HIA A;  1YSQ A;  5MC7 A;  3PBS A;  4WL9 A;  2W3E A;  2PT7 A;  1W63 M;  4EES A;  3GDI A;  2OWH A;  4I39 A;  3VE4 A;  4ARZ B;  3CLO A;  2J3T D;  1X0O A;  1EW0 A;  2QHK A;  3PHY A;  3KX0 X;  4NXB A;  3NHQ A;  2GZA A;  4WEK A;  2OAQ 1;  2VV6 A;  3T4K A;  3TJZ C;  1IFQ A;  1NRJ A;  1MKM A;  1S4R A;  2Z6D A;  3T4O A;  1XJ6 A;  2O9A A;  2V1A A;  2VKS A;  5HPI A;  4EER A;  2A24 A;  4GHI A;  2D01 A;  4EQ1 A;  4MN7 A;  4ZRR A;  3T4Q A;  1S1Z A;  4EW7 A;  2ZOH A;  3CAX A;  2IA2 A;  1LSX A;  2R78 A;  2M1C A;  3P01 A;  1S66 L;  4L9G A;  1S4S A;  3PBT A;  2FZ0 A;  3K2N A;  1MC0 A;  1VHM A;  1YSP A;  2W3F A;  3C8C A;  3S7N A;  2A24 B;  4GHI B;  3C30 A;  5DKK A;  3BY8 A;  3A0R A;  2W1R A;  4EEU A;  4DMZ A;  3S7Q A;  4BMW A;  3F1N A;  2JKT M;  1WA9 A;  3T4J A;  4R38 A;  2ZBB A;  3G6O A;  1Y28 A;  3E0Y A;  2PD7 A;  2VLG A;  4HNB A;  4BWI A;  2K2N A;  1S1Y A;  3F1N B;  3PBR A;  3CWF A;  4OOM A;  2WKQ A;  2QKP A;  4IJG A;  2EWW A;  5FL3 A;  4R6L A;  3LFV A;  5HD5 A;  4OOL A;  3UB8 A;  3CIT A;  4HP9 A;  3NOP C;  1F9I A;  3LIE A;  3KYZ A;  4ME4 A;  2WKP A;  2YKH A;  3KYQ A;  3T50 A;  3S7O A;  4EUV A;  5C5K A;  3BQ8 A;  3KSI A;  4GLQ A;  4PKY G;  4JGR A;  2GNX A;  3TW8 A;  1XFN A;  4I5S A;  2VV8 A;  2ZOI A;  3UE3 A;  4KQD A;  4ETZ A;  4I3I A;  4LPZ A;  3MXQ A;  4HP4 A;  3LIC A;  3UB7 A;  4II7 A;  1TD5 A;  1ZTU A;  1TS8 A;  4KQO A;  4NEE D;  2INW A;  3E4O A;  4HQA A;  3HJK A;  3ICY A;  1OJG A;  2KDK A;  5KSH A;  1TS0 A;  1D7E A;  1ZHH B;  4RQ9 A;  3U2A A;  1F5M A;  5IS1 A;  4B9O A;  4PKY A;  2L0W A;  5HWV A;  3LR3 A;  5HSQ A;  3DBA A;  3ZQ5 A;  2KX6 A;  3LR5 A;  2KLI A;  1OTB A;  4XT2 A;  4AFI A;  1OT9 A;  4UEY A;  1KOU A;  3OLO A;  4G3V A;  5HDD A;  1JNU A;  5HDS A;  2XRO A;  4O0P A;  1LL8 A;  3EOI A;  3UMD A;  1P97 A;  3FPW A;  2VGL S;  3LID A;  2P04 A;  1BYW A;  2XRN A;  4XT2 B;  1F98 A;  3A0S A;  3LI8 A;  2VX8 A;  3D72 A;  1GSW A;  3EQV A;  3OCN A;  2W3G A;  4Q0H A;  3VV4 A;  1G28 A;  4WEL A;  3NOU C;  3VOL A;  2VZW A;  5HD3 A;  2PHY A;  4L9F A;  3PYP A;  4R3A A;  5DFX A;  2ZMV A;  4B93 A;  3P7N A;  2EWV A;  4DJ3 A;  4HJ3 A;  2QJ5 A;  4LRX C;  2LB5 A;  3LR0 A;  4UQI M;  3E4Q A;  1DRM A;  2PD8 A;  3PR6 A;  4YNR A;  2JKR I;  1T1A A;  3V67 A;  2QYB A;  3F1P A;  2OOL A;  3E4P A;  3KO6 A;  2V9A A;  3EQU A;  3HCY A;  2M7V A;  3OCL A;  1VB6 A;  5L8M A;  1DP9 A;  1V9Z A;  2VEA A;  4GW9 A;  2J80 A;  3F1P B;  5DKL A;  1NWZ A;  1T1B A;  1GSX A;  1OTI A;  3LI9 A;  2I9V A;  1UGU A;  1XJ2 A;  4EET B;  2VGL M;  2VV7 A;  5IU1 A;  2XA7 S;  3E98 A;  1STZ A;  3H7W A;  4G3K A;  4LRY C;  1N9L A;  3PXP A;  1LSW A;  3EGD C;  4O8G A;  5LBR A;  2VJW A;  3BQA A;  1DP6 A;  3TE8 A;  1G6O A;  3H7W B;  4HJ6 A;  3OC2 A;  5K5B A;  4HY8 A;  3H9W A;  1T19 A;  4Y5F A;  4LRZ E;  2GX5 A;  5CX7 A;  5DJT A;  4I38 A;  1V9Y A;  4EXO A;  1OT6 A;  4HH2 A;  4KUO A;  1S67 L;  4BBU A;  1ODV A;  5G4Y A;  3BJN A;  4UQI S;  3RTY A;  4LLO B;  2O9B A;  3RFB A;  4Q0I A;  2WKR A;  1P9R A;  3MMH A;  3LYX A;  4NKP A;  2L4R A;  3IS2 A;  3PBN A;  2NUP C;  3NJA A;  5AJG A;  3C38 A;  3OBF A;  4O01 A;  5I5L A;  4IUH A;  3UB6 A;  3KSG A;  4EU0 A;  2H28 A;  3MQQ A;  4PAU A;  3IS2 B;  3T4T A;  4HOI A;  3T4S A;  1OTA A;  2HGV A;  3MFX A;  2HJE A;  3CUE A;  4M4X A;  2D02 A;  1NLZ A;  3EEH A;  3F1O A;  5DJU A;  1MZU A;  2PYR A;  4GS9 A;  3K3D A;  2JKT I;  3BW6 A;  2V0U A;  1T18 A;  1XJ3 A;  2LB9 A;  3LIF A;  3C2W A;  4Y3I A;  1T1C A;  2XA7 M;  3GEC A;  5F6A A;  3LUQ A;  1TS7 A;  1XJ4 A;  3KSF A;  3O5Y A;  2B02 A;  4QPR A;  4MDZ A;  4L0L A;  1LSV A;  2CMN A;  3CI6 A;  4G3W A;  4WF0 A;  5TBM A;  1YKD A;  5IT5 A;  5HZH A;  1P0Z A;  2NUT C;  3EGX C;  4MN6 A;  4F3L A;  3OOV A;  5EFW A;  2Z6C A;  5TBM B;  2VA0 A;  2GJ3 A;  4JGQ A;  4ARZ A;  4BBV A;  4DN0 A;  3FPV A;  4F3L B;  3B42 A;  2DMW A;  2PR6 A;  3MR0 A;  3RH8 B;  1XFQ A;  2W1T A;  1D06 A;  4Y2F A;  1UWP X;  5HWT A;  2J3W A;  3JVV A;  2W27 A;  3ZYT A;  1OJ5 A;  2XSS A;  2W0N A;  5J3W A;  5F69 A;  2W1T B;  2BAS A;  4HHD A;  3KSH A;  4MCW A;  3BY9 A;  4P6Z S;  4I3J A;  2OWJ A;  3CUE C;  4YOF A;  2W3H A;  2M7U A;  3R4K A;  1OTE A;  4IHQ A;  1H3Q A;  5HDC A;  3H82 A;  4K08 A;  2QJ7 A;  4KUK A;  3W2Z A;  2KOI A;  1UWN X;  3MJQ A;  4PHT A;  3VE3 A;  4ETX A;  2PYP A;  3S7P A;  3H82 B;  3LIB A;  3T4L A;  5AVF A;  5HL6 A;  2G7U A;  1P9W A;  3HJI A;  5HPF A;  2MJ6 A;  4NXE A;  3LIA A;  2W3D A;  4WN5 A;  5TJJ A;  2YKF A;  4IUK A;  1TS6 A;  3MF0 A;  4WLA A;  4BBT A;  2ZMF A;  2PDR A;  3EWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...