4MMNA

Structural and biochemical analysis of type ii free methionine-r-sulfoxide reductase from thermoplasma acidophilum
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
141
structure length
141
Chain Sequence
DLKEFARSQMQAACQYLKEKNPKYDWVGFYVLEHGKLKLEAFVGEKTDHVEINLGDGLCSLAVLKNDIVNEYDVKSNPKYLACFPSTQSEIVVPVRYQGEPIGEIDIDSDKKAAFSKEDEAMLSSIADLMAPLVHEFFVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein Ta0848
publication title Structural and biochemical analysis of a type II free methionine-R-sulfoxide reductase from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Oxidoreductase
total genus 45
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4mmnA00
4O01A 2M7UA 3KSGA 3NOPC 4ZRRA 4LRXC 2KOIA 3NOTC 4DN0A 4MCWA 5HL6A 3OOVA 3CITA 1MC0A 3KO6A 2XRNA 4IUHA 2O99A 2GX5A 2O9AA 4Y2FA 3IBJA 3C2WA 4PAUA 3OBFA 4ETZA 3MQ0A 4GW9A 2HGVA 1VHMA 2W1TA 3NHQA 4IUKA 2O9BA 3G6OA 3LFVA 1TF1A 3HCYA 2W3HA 3W2ZA 4O8GA 5LBRA 4MDZA 4YOFA 4YNRA 4CQHA 2LB5A 2W1TB 5TJJA 3IBRA 3D3OA 4IJGA 2LB9A 5HPIA 2XSSA 5AJGA 2W1RA 4EU0A 3R4KA 2Y79A 4MMNA 1MKMA 3E98A 4R70A 2QYBA 4E04A 2K31A 3MMHA 4G3VA 4Z1WA 5K5BA 4BWIA 4R6LA 5C5KA 4QPRA 5HSQA 1YSQA 1STZA 3S7NA 4Q0HA 5I5LA 3TRCA 1TD5A 4Q0JA 2K2NA 5DFXA 3DBAA 3KSFA 4LRYC 4FOFA 4EUVA 1F5MA 3KSHA 3S7PA 4ME4A 2Y8HA 4LRZE 3E0YA 2O0YA 3O5YA 3ZQ5A 2G7UA 3KSIA 4GLQA 3CI6A 4DMZA 4Y5FA 2M7VA 1YSPA 3S7OA 4Q0IA 5HPFA 4RQ9A 5DFYA 4G3KA 2B18A 2XROA 2W3DA 3S7QA 2KLIA 2O9CA 4G3WA 3BJNA 2VKSA 3MF0A 1ZTUA 5L8MA 2VZWA 3NOUC 3K2NA 2ZMFA 2VEAA 2W3GA 3VV4A 3RFBA 2W3FA 2W3EA 4ETXA 3EEAA 2OOLA 1YKDA 2VJWA 4O0PA 4MN7A 4Y3IA 2IA2A
chains in the Genus database with same CATH superfamily
3FKWA 1IYPA 1ZC2A 5DKKA 3T4LA 4R4RA 4QY5A 1L2SA 4X6TA 3NECA 2PT7A 4ETZA 4UQIS 3IF5A 1ONGA 4MN5A 2Y2GA 1VM1A 1FSWA 3HLBA 1QMFA 1UWPX 5FAPA 4GD8A 3OPPA 4WMCA 2M1CA 2WKRA 1U60A 3QP4A 4E3NA 3HLEA 2K31A 4G3VA 5L10A 4HHDA 1MWUA 1YLPA 1STZA 3ZGAB 3T50A 5GLBA 1ACFA 1JTGA 1K4FA 1XGJA 1GSVA 5CECA 1E25A 1F5MA 5KIZA 2ZMVA 1Y4OA 2FZ0A 1KOUA 1MKIA 2ZQ7A 5HFOA 2VX8A 1CQAA 2X02A 4IVKA 3K3DA 4MEZA 1DRMA 5CERA 5E2FA 2XFTA 2WUQA 1ZTUA 4EBLA 3EOIA 3I7JA 5FAQA 1YLTA 4O0PA 5A93A 3UMEA 2IA2A 4WLAA 4DE3A 4OPQA 4Z9QA 3G35A 3LEZA 4RVAA 1K57A 3BQAA 5HX9A 1LI0A 4MCWA 1SKOA 4JKTA 2J3WA 4IUHA 3FG8A 4HOIA 5M19A 1SDEA 1G6OA 1TS7A 5FI2A 1VB6A 1SKOB 2WKIA 4Y17A 4JGPA 2H5SA 3AGFA 3T4TA 5A92A 1VQQA 1HTZA 3OLOA 1ZG4A 4OLDA 2ZM8A 1MXOA 3D3OA 4A5RA 1OJ5A 1WYBA 4BJPA 3IHBA 1G6AA 4Y0OA 3G4PA 4EETB 1ALQA 5GHZA 3T4JA 4D2OA 4MBKA 5EV0A 5EVIC 3PBTA 1OJGA 1KE0A 1NXYA 4GDNA 4KZ8A 2FH5A 3KSFA 3N8RA 4CJNA 3PBNA 3IXDA 1L0FA 3PXPA 1O7EA 1IELA 1XKZA 4R3AA 4C3QA 3VP0A 1PZPA 3CUEA 5FEFA 5DFYA 3GRJA 2QJ7A 1OT9A 2HV1A 2KLIA 3MQQA 2C6WB 2W3EA 4WZ5C 2XD5A 5FEGA 1K54C 1BLHA 1LL8A 3G2ZA 4BQMA 4S2LA 3V39A 3KSGA 4LRXC 3BY8A 2EX6A 2KOIA 3NOTC 3VSLA 4DN0A 5HL6A 2DNSA 2JN7A 2Q0OA 3T1XA 2ZQ8A 4N1HA 2GX5A 4Y2FA 4JLFA 4CLCA 2JKGA 4H6JA 4FUWA 2Q9MA 3UN7A 2PU4A 3KYZA 5FQMA 1CJFA 1A0KA 4B9OA 4CLCB 3UE0A 3W2ZA 5LBRA 3IQAA 5HWVA 4H6JB 2EX2A 5AQ9A 2LB5A 5CGSA 3BFGA 5TBMA 5EM0A 4QB8A 2EFUA 1IYQA 2EX8A 3A3EA 2D02A 4L9FA 3GVBA 5TBMB 4U0TA 3NY4A 5CXWA 3ZYTA 3G2YA 4DXCA 2W0NA 3IWIA 3MKFA 2HDSA 4S2IA 3GMWA 1NJ4A 3BQ8A 3Q1FA 4E3JA 3IXBA 2WKPA 4GJ4A 4WZ4A 4HIAA 1DP9A 1O07A 1N9BA 5A91A 3F1PA 2VKSA 3SZTA 5M1AA 4BD1A 5L09A 3HJIA 3MJQA 3F1PB 3LR4A 4O7DA 4BMWA 5TR7A 4X56A 5AQAA 2PD8A 1OTBA 4LCMA 3OZHA 3PBRA 1ZHHB 2Y59A 4QU3A 2HP5A 3C30A 4XUZA 3PHYA 1WYCA 2V20A 3LR3A 2J8YA 3WS0A 5A90A 4UHUA 4KZ7A 2A49A 3IHAA 2HJEA 3PBSA 4IUKA 3ZNTA 5HDSA 4DJ2A 5FQIA 2ZMAA 5F1FA 1YAXA 1KE3A 2ZC7A 4CLCD 4YOFA 4S2PA 4KQDA 3HLFA 3HUNA 1NYYA 4II7A 5FL3A 2LB9A 5GLCA 1XFNA 2ZQCA 4S2NA 2VV6A 1H5XA 2V2FF 3S22A 3WWXA 4BWIA 4KZ4A 3W8KA 2XQZA 5HSQA 4I5SA 3HJKA 1JWVA 2ZQAA 1W5DA 3UPNA 1RP5A 4P6ZM 3O87A 3M6BA 3BEBA 3N4IA 3KSHA 4KZ9A 3P98A 3MXQA 4ME4A 3RXXA 3UDFA 3IXHA 1TS0A 1LL9A 4P87A 1GA0A 2VGLM 3UE1A 5FQQA 1YT4A 2DCFA 3DTIA 3GV9A 1H8ZA 4G3KA 3UPPA 2BLSA 3VMAA 1V9YA 5FI7A 1F98A 4JF4A 1E3UA 3NJAA 1PNEA 2Y2NA 1I2WA 2J3TD 2VZWA 4F94A 4NXFA 3GR2A 4OKPA 4X53A 4R0QA 1OMEA 5G4YA 1MWRA 2YKHA 2J3TC 1T1AA 5EECA 3JVUA 4OPYA 4P85A 4X68A 5TFQA 1MWSA 4YINA 3KO6A 3O3VA 2NUPC 2OV5A 3IBJA 1GSWA 5KZHA 4WN5A 5DJTA 5CHMA 2RCXA 1D06A 4HI4A 1FOFA 3SS4A 3MZEA 4YNRA 3UNWA 1L0GA 3HREA 3MKEA 5HPIA 2QWSA 2W1RA 2JCHA 3E4QA 3UE6A 3E4PA 1BYWA 2Y2HA 4EERA 1NZUA 1FCMA 3O86A 2WGIA 4QHCA 3SH7A 2Y91A 4UA7A 4Q0HA 5J3WA 4WEKA 3VP2A 2X01A 4KG5A 4NKPA 4MBFA 1YLJA 3VP4A 1JWPA 1DJAA 1K55C 1Q2QA 3H7WA 3ULFA 4JPMA 1HLUP 4WYYA 5F69A 3PBQA 3VE4A 3H7WB 1DJCA 4KUOA 4GN2A 3LR0A 3BYDA 3BY9A 3R7WA 3K3CA 3JPUA 2IWDA 4OH0A 2B5RA 2GZAA 4PMAA 1JTDA 3NDGA 3EEAA 1XJ6A 3OPRA 5DTTA 4ZJ2A 3BW6A 4ESPA 5IT5A 1KGEA 1T19A 3R7WB 4LFUA 1E3UD 5CTNA 5F6AA 5GL9A 4O01A 2Y2LA 1GHPA 3CITA 1S4RA 1GHIA 4OOYA 4OQGA 3MFDA 4JF6A 5CEDA 1IOUA 4I38A 3G31A 4EQ1A 2QZ6A 1LHYA 4EXOA 3TOIA 5EE8A 2VA0A 2QKPA 3V3SA 5HD5A 5U47A 2DMWA 4X1LA 3QP6A 4E3OA 2ZC3B 1NY0A 3Q7VA 4IJGA 1LI9A 2BASA 4UQIM 2FFFB 2XH9A 4E3MA 3PYPA 2PRFA 2QYBA 4I3IA 3T4QA 3F1OA 3Q7VB 3ZVTA 1CI9A 4R6LA 1K0KA 3LUQA 3T1QB 3M2JA 3BECA 4OOMA 1SDNA 1YLWA 4HNBA 4KZ3A 3F1OB 5DFXA 1OTEA 4OPZA 2BTFP 3ICYA 2V0UA 1P9RA 3E0YA 2JKTM 2ZBBA 1S6RA 3N6IA 2WKHA 4OPRA 3FWLA 4ZJ3A 3ZCZA 1EROA 4LLOB 5GLDA 4HY8A 4GCZA 3QNBA 2HDUA 1W8YA 4LENA 4EWFA 4JXWA 3GTCA 1W8QA 3DWKA 1RGZA 3NDEA 3RH8B 5AQBA 2Z6DA 1N9LA 4EEUA 1YLZA 3OPHA 4ZRRA 3ZG7B 1SKFA 1J3WA 2G2UA 3MQOA 4NETA 3T1RA 2V0WA 2O9AA 2I9VA 5GLAA 3ZFZA 5I94A 4PM8A 4L0LA 2WZXA 3Q82A 1K6SA 3T4SA 1VHMA 3NHQA 5FAOA 2CC1A 4DE2A 1ODVA 1KVMA 1PWCA 2VV7A 4ZBEA 2PDRA 1HZOA 3VE3A 1W63Q 2ZQ9A 2VLGA 2L1MA 3N8SA 1CEFA 3OCLA 3E98A 4XUXA 3P09A 4GDBA 4GB7A 3L7HA 1J9MA 1KGFA 2XDMA 1YSQA 1Z09A 1K56A 1ZG6A 1ESIA 4GOGA 1XJ4A 3ZG5A 3HLGA 2QPNA 3BLMA 1KE4A 4HBUA 5DF9A 3O88A 1IKGA 5G18A 1YM1A 3LI9A 4WMCD 3BWLA 4B93A 2W3DA 4EV4A 4F3LA 3TJZC 3EEHA 2WGVA 3B33A 3EQVA 1S66L 3A3JA 4F3LB 3S4XA 3NOPC 5FASA 2OWJA 3TSGA 3QP1A 3OC2A 5IU1A 3MBZA 3MZDA 4ZDXA 4KG6A 3C7VA 1FR1A 5KMWA 2OSUA 3UE3A 4EEPA 3EWKA 3RXWA 5EFWA 5F5YA 2UWXA 3UB8A 2H0TA 3C2WA 3BFFA 2PR6A 3U2AA 4JBFA 1HVBA 3LR5A 4X69A 1TF1A 2B02A 2W3HA 3UB6A 4ZJ1A 2J9PA 1BSGA 3T1SA 1T1CA 5TJJA 2JKRM 4BENA 2AVXA 2W27A 3RTYA 4YFMA 1KDSA 1XPBA 4GHIA 3PAEA 1I5QA 4B4ZA 1RGYA 5C5KA 3IWOA 5CHUA 2PYPA 3E2LA 5JYPA 5AQ7A 1K57C 2XR0A 4HP9A 2DRWA 3UDXA 1ES5A 4GHIB 4B4XA 4RA7A 4FOFA 1PFLA 1YMSA 3WRZA 1X0OA 2PHYA 4GZBA 1OPXA 1XGIA 1FCNA 3ZHHA 3UB9A 3AGDA 3A3DA 3CI6A 1BZAA 4KQOA 2ZL1A 3TW8A 5AVFA 3FZCA 5HPFA 3DTMA 5EPHA 1KVLA 4P0MA 2XROA 1IKIA 1SZVA 1W79A 3NOUC 2W3GA 1TEMA 3VV4A 3EGXC 5MC7A 4X55A 2VJWA 1SHVA 4WM9A 2UV0E 4E3LA 1ONHA 3W4OA 3GQZA 3HBRA 3JVVA 2D01A 4KQRA 4Q8IA 5L07A 3TE8A 3G32A 4Y15A 4BD0A 5IHVA 1N9OA 2HDQA 3LIFA 3ISGA 2Y2OA 4Y13A 4K0WA 3Q81A 3LICA 4FH2A 4E6WA 3LY3A 4EUZA 4PM5A 2ZOHA 1VETA 4O8GA 4QJGA 3IWQA 2XD1A 3A3FA 3CUEC 3KYEA 5HW3A 3IBRA 5CRFA 2H0YA 5AJGA 3SW1A 3CAXA 1VETB 2EFXA 3R4KA 3MSHA 3HUOA 4KZAA 4ZTKA 1H8YA 3L9KA 2ZC4B 2P04A 3RJUA 4R1GA 2JKTI 5FA7A 1XFQA 2Y55A 2K2NA 4OONA 4LRYC 5CTMA 2ZM0A 2EX9A 2PAVP 4UA6A 3LYXA 4IBRA 5M18A 4CLCC 4MLLA 4WF0A 3B42A 4KENB 1I2SA 4RQ9A 3U4LP 5EM1A 4G3WA 1K38A 3SOIA 3ZG0A 3K2NA 2ZMFA 3ZNYA 4RX3A 3RFBA 3C7UA 3CZDA 3WS1A 4FD8A 4MN7A 4HESA 4DKIA 4WUJA 5HZHA 4YWZA 3VFHA 4C6YA 4UAAA 1MZUA 5DF8A 4NXBA 2ZC6B 4D60A 3ITBA 1OTIA 2J80A 4K08A 5EUAA 1FCOA 3SH8A 2PR5A 2OWHA 2H28A 5EOOA 2WGWA 3MQ0A 3VOYA 3NIAA 3G34A 2QJ5A 1TDGA 5FQKA 4MN6A 3B47A 2H10A 2CMNA 3LFVA 3HCYA 1BLPA 5F1GA 1ES3A 2XGNA 2VGLS 2WGWB 1DJBA 2HP6A 4GS9A 2V1AA 4EBNA 3TG9A 4PHTA 2R9WA 3E4OA 3QNCA 3LIDA 4GS9B 3CHWP 4DE1A 3A0RA 1M40A 3LI8A 2WAEA 3CPTA 3S7NA 3MFXA 3CG5A 3P01A 2R78A 3NBLA 2IWBA 3P7NA 3DBAA 1GCEA 2QMIA 3AGEA 1DP8A 3S7PA 1SCWA 3CPTB 2EWVA 4QWOA 4OQHA 1L0DA 4FTXA 1VEUA 2B18A 3H9WA 2VGJA 5E43A 4FCFA 4WELA 3FKVA 4CPKA 1YQSA 5L8MA 2C5WB 1K25A 1H8MA 1VEUB 2VEAA 3LEQA 1G68A 4DE0A 1OTDA 3SS5A 4S2NC 4OP8A 2Z2LB 4S2MA 4KUKA 4DDYA 4DDSA 1XA1A 5DTSA 2PBYA 4E6XA 2HP9A 5HDCA 1WE4A 3V5MA 1BTLA 4ARZA 5E2EA 1P97A 3V50A 2XA7M 5F83A 1S0WA 4JGOA 2Y2JA 3HLWA 2JE5A 2JKRI 4NXGA 1ESUA 2IWCA 3MS6A 1TS8A 5DVAA 1NRJA 3ZDJA 4ARZB 2XEPA 4IVIA 1MWTA 1PW8A 1G5UA 2Y2KA 2W1TA 2WZZA 5FDHA 4MDZA 4BLMA 3PR6A 2E8JA 3NCKA 2W1TB 5TGFA 3WS2A 4IHQA 1T1BA 2A24A 1LSVA 3HLDA 2YKFA 2ZOIA 2Y79A 4KG2A 4R70A 2INWA 1TS6A 2P7JA 4Y7PA 2HF6A 3DTEA 5K5BA 2A24B 3WS4A 4FSFA 4H8RA 4LV1A 4ID4A 4OOLA 1CI8A 1XJ3A 3D9YA 1YLYA 1W63M 4N9KA 4QY6A 1MBLA 3FPWA 1EWZA 1K4EA 4LCLA 4LRZE 3H82A 4OQ0A 3T4OA 3IH9A 2OLUA 1PRQA 3SH9A 3VP1A 4K0XA 1OTAA 2ZQDA 3H82B 1Z6FA 4EW7A 3S7QA 5EOEA 3BJNA 3DAVA 2J7VA 4HJ4A 4JF5A 3DWZA 5HDDA 4MNRA 1S67L 4NEED 4P6BA 5IS1A 3C38A 4OVDA 5E2HA 4WEJA 2KX6A 4JXSA 5EVIA 2WKEA 1MC0A 4HBTA 3V3RA 1TVFA 2EWWA 1BLCA 5EVIB 3BLSA 1RCJA 4R38A 4I39A 4DXBA 3IF6C 2JBFA 4OP5A 4HH3A 2B95A 5D3OA 3LO7A 2GDNA 4UA9A 2JHEA 5AVEA 4EU0A 4WZ5A 4MMNA 1MKMA 4I3JA 1K54A 2EA9A 4X1MA 3CWFA 4HP4A 5GHYA 2HZ5A 2A3UA 2GNXA 2QHKA 4QPRA 4M4XA 3FYZA 4EESA 1TD5A 1IEMA 1V9ZA 5CX7A 4WBGA 1ES4A 3UB5P 3BFCA 4KZBA 4FH4A 1LSXA 1Y54A 3C8CA 1K6RA 1QMEA 4E3IA 2OLVA 5DTKA 2M7VA 3S7OA 4PM6A 3T4KA 1JVJA 1CEGA 4GD6A 4DRTA 4ZAMA 3VOZA 1N9NA 2W3FA 3UPOA 3UO9A 5A8BA 4U0XA 3M6HA 5JYOA 4WL9A 4KZ6A 5G4ZA 5J8XA 5GHXA 4EQIA 3LIEA 3MR0A 3ZG8B 5CHJA 1DY6A 1FIKA 4X25A 1M6KA 5EVID 2OAP1 3LIAA 3CMZA 2ZM2A 1UGUA 4S2JA 5HD3A 1GHMA 3UDIA 1PIOA 4N9LA 3T12B 1DP6A 1F2KA 1PWDA 1XP4A 1XJ2A 1BLSA 4CLCE 2XSSA 3S1YA 3EGDC 4PM7A 1G28A 3G30A 4LGWA 1Q2PA 4MBHA 1JNUA 3VOLA 1S1YA 3UMDA 3IS2A 3OCNA 3N8LA 2HJ9C 5FATA 5I5LA 3ZVWA 2NUTC 1GA9A 3IS2B 2Y8HA 2Y2QA 3PAGA 5FSRA 4I3AA 2O0YA 2P9VA 1E4DA 4OQIA 1XX2A 2WKQA 3QP8A 2P9VB 2EXBA 2O9CA 1CF0A 3HLCA 3IH8A 3LCEA 3JYIA 1KGGA 4JGQA 3UB7A 1HD8A 3OPLA 2WYXA 1IYSA 5J4EA 1D7EA 2KDKA 3VSKA 3V67A 3ZG9B 3BFEA 1K56D 4HJ3A 5DJUA 4LPZA 2G2WA 4IBXA 5KSCA 2ZJ9A 4XT2A 5FI6A 2ZL1B 1YMXA 2Q9NA 3VP3A 4BBUA 5F82A 4R4SA 2J9OA 2V8CA 2HGVA 2PD7A 4XT2B 4HJ6A 3G6OA 1S1ZA 4OLGA 2X71A 1NZOA 2P08A 1CK3A 4RX2A 4NG2A 1PI4A 2GJ3A 1AWIA 2ZC5B 4B88A 2L4RA 1F9IA 1TDLA 4E04A 3FPVA 1P9WA 4Z1WA 3IX8A 4IEDA 4HEFA 5FQJA 4BL2A 2XK1A 3IX3A 5HARA 4GNUA 3CLOA 3TRCA 3EQUA 3D72A 3FC7A 2L0WA 3BFDA 3C5AA 3W4QA 3C4PA 3DW0A 5HAPA 1PZOA 2MJ6A 3HVFA 4JGRA 1W7FA 1FSYA 2R9XA 3ZQ5A 2V1BA 5HAIA 4L9EA 5FQ9A 4DMZA 4DF6A 5L2FA 4KQQA 1UWNX 4Q0IA 3IX4A 5FDSA 1ZKJA 2Z6CA 1L3LA 1IFQA 2ZLYA 2VK3A 4PPRA 2A2LA 2VV8A 4JXVA 4JXGA 4Y0UA 4XXRA 2WADA 4ETXA 3W4PA 3C4OA 2OOLA 1YKDA 4AFIA 4Y3IA 4UEYA 2M7UA 1BUEA 3A0SA 1PW1A 1T18A 1GSXA 3OOVA 1NRFA 1BULA 1OT6A 3WS5A 2XRNA 1K55A 2O99A 3E2KA 2RL3A 4PKYG 1XXMA 3N7WA 4LV2A 2Y2PA 3OBFA 2FFYA 2O9BA 1WA9A 1FILA 3CJMA 5HAQA 1LLBA 3F1NA 4QD4A 3QP2A 1NYMA 4BL3A 5HWTA 3HUMA 3MXSA 3PTEA 1KDWA 2Y2IA 3NC8A 4NK3A 3F1NB 2XLNA 4M3KA 1MY8A 3NI9A 4RYEA 4P6ZS 5J7EA 2BG1A 4C75A 1D1JA 3GSGA 1BT5A 1FQGA 1PYYA 4N92A 1LSWA 1EI5A 2V1ZA 2XFSA 4EUVA 2E8IA 3KSIA 5HWWA 1YSPA 5DKLA 2PYRA 3LIBA 2PU2A 1H3QA 3GDIA 4NXEA 1YPRA 2OAQ1 3MF0A 4R3BA 3SS3A 3BRMA 5CEBA 3B3XA 2ZD8A 2WK0A 3M2KA 1IYOA 2PBDP 1NLZA 1PI5A 1LT0A 1L0EA 2P74A 4R3JA 3MZFA 4HQAA 3QHYA 3Q07A 4Y0TA 1PWGA 3PBOA 4N1XA 3FV7A 3UY6A 4PAUA 5EVEA 1N4OA 4GW9A 5EVLA 1AXBA 4L9GA 1ERQA 3Q7ZA 2ACGA 3VFFA 2JC7A 4LV3A 4R23A 4S2OA 4EBPA 3LY4A 2JKFA 4CQHA 1XA7A 3WRTA 3HL9A 1LL5A 2VGKA 2WAFA 1C3BA 4LV0A 3MMHA 3NULA 1EW0A 4PKYA 1S4SA 3IT9A 5HL1A 3IF6A 4S2KA 5BOHA 3GECA 3IXGA 1Y28A 3A0VA 2Z2MB 4PM9A 4K91A 1MPLA 4E3KA 1FR6A 3QP5A 1NWZA 3BM6A 4Q0JA 1NLYA 3IF6B 4BBTA 3LGOA 5E2GA 4HH2A 3A3IA 2HDRA 2XA7S 1ES2A 5DF7A 3D4FA 3MXRA 3KX0X 3KYQA 2K7SA 3O5YA 5CGXA 2G7UA 4GLQA 1H0MA 5KSHA 1JWZA 4Y5FA 2XF3A 5F68A 4U3TA 2HPBA 2V9AA 2EXAA 2V8FA 1ERMA 2I72A 4BBVA 1P0ZA 2Y2MA 2Y4AA 3DTKA 5CGWA 3ITAA 4DJ3A 4GKUA 4KZ5A
chains in the Genus database with same CATH topology
5A8BA 5G4YA 2YKHA 2J3TC 1T1AA 4WL9A 5G4ZA 3JVVA 5DKKA 3T4LA 3LIEA 2D01A 3JVUA 3MR0A 3TE8A 3KO6A 1N9OA 2NUPC 3IBJA 1GSWA 2OAP1 3LIAA 3LIFA 2PT7A 4ETZA 4WN5A 5DJTA 1UGUA 4UQIS 1D06A 4HI4A 3LICA 5HD3A 4MN5A 2ZOHA 4O8GA 1DP6A 3CUEC 4YNRA 3IBRA 1XJ2A 1UWPX 5HPIA 2QWSA 4CLCE 2XSSA 5AJGA 3SW1A 2W1RA 3CAXA 3E4QA 2M1CA 2WKRA 3R4KA 3UE6A 3E4PA 1BYWA 3EGDC 1G28A 2K31A 4G3VA 1JNUA 3VOLA 1S1YA 4EERA 3UMDA 4HHDA 2P04A 3IS2A 3OCNA 2JKTI 1STZA 2HJ9C 3T50A 4Q0HA 5I5LA 5J3WA 4WEKA 1XFQA 4NKPA 2NUTC 2K2NA 1GSVA 3IS2B 4LRYC 1F5MA 5KIZA 2ZMVA 2Y8HA 3LYXA 2FZ0A 1KOUA 3H7WA 4CLCC 4I3AA 2O0YA 3ULFA 4WF0A 3B42A 2VX8A 5F69A 3PBQA 3K3DA 4RQ9A 3VE4A 2WKQA 1DRMA 3H7WB 4KUOA 2O9CA 3LR0A 4G3WA 1ZTUA 3BY9A 3R7WA 4JGQA 3K3CA 3UB7A 3K2NA 2ZMFA 3RFBA 2GZAA 3EOIA 5J4EA 3EEAA 1XJ6A 1D7EA 4O0PA 3BW6A 4MN7A 2KDKA 3UMEA 2IA2A 5IT5A 3V67A 1T19A 3R7WB 4WUJA 4WLAA 5F6AA 5HZHA 4YWZA 4O01A 4HJ3A 5DJUA 4LPZA 1MZUA 3BQAA 4MCWA 2J3WA 4NXBA 3CITA 4IUHA 1OTIA 4XT2A 1S4RA 2J80A 3FG8A 4HOIA 4K08A 1IOUA 1G6OA 1TS7A 4I38A 4BBUA 1VB6A 4EQ1A 2PR5A 2OWHA 4EXOA 2H28A 3MQ0A 2HGVA 2PD7A 4XT2B 2VA0A 2QJ5A 4MN6A 4HJ6A 4JGPA 3B47A 3G6OA 2QKPA 2CMNA 3LFVA 1S1ZA 3T4TA 3HCYA 5HD5A 2DMWA 3OLOA 2VGLS 2P08A 4GS9A 2V1AA 3D3OA 1OJ5A 4IJGA 2GJ3A 4PHTA 2BASA 4UQIM 4BJPA 3PYPA 2L4RA 1F9IA 3E4OA 2QYBA 4E04A 3FPVA 1P9WA 3LIDA 4GS9B 4I3IA 3F1OA 4Z1WA 3T4QA 4EETB 3A0RA 4R6LA 3T4JA 3LUQA 3LI8A 4OOMA 4HNBA 3S7NA 3MFXA 3CLOA 3F1OB 3PBTA 3P01A 1OJGA 3TRCA 2R78A 3EQUA 3D72A 3FC7A 2L0WA 3P7NA 5DFXA 3DBAA 2FH5A 1OTEA 3KSFA 1DP8A 3S7PA 3PBNA 3ICYA 2MJ6A 2V0UA 1P9RA 3E0YA 4JGRA 3ZQ5A 3PXPA 2EWVA 2V1BA 4L9EA 4DMZA 2JKTM 4R3AA 2ZBBA 1UWNX 4Q0IA 3CUEA 5DFYA 2B18A 3H9WA 2QJ7A 1OT9A 2HV1A 2Z6CA 1IFQA 2KLIA 3MQQA 4WELA 4LLOB 5L8MA 4HY8A 2A2LA 2VV8A 1H8MA 4GCZA 2VEAA 2W3EA 4ETXA 1OTDA 2OOLA 1YKDA 4AFIA 4Y3IA 3RH8B 4KUKA 2Z6DA 1LL8A 1N9LA 4UEYA 2M7UA 4EEUA 3A0SA 3KSGA 4ZRRA 4LRXC 3BY8A 2KOIA 3NOTC 5HDCA 1T18A 1GSXA 4ARZA 4DN0A 3MQOA 1P97A 5HL6A 2XA7M 3OOVA 2JN7A 4JGOA 1OT6A 2V0WA 2XRNA 2O99A 2GX5A 2JKRI 2O9AA 4NXGA 2I9VA 4PKYG 4Y2FA 4CLCA 1TS8A 1NRJA 4ARZB 3OBFA 4H6JA 4L0LA 3T4SA 1VHMA 2W1TA 3NHQA 2O9BA 3KYZA 1WA9A 4B9OA 4CLCB 1ODVA 3W2ZA 5LBRA 5HWVA 4MDZA 3F1NA 3PR6A 2VV7A 4H6JB 5HWTA 2LB5A 5TBMA 2W1TB 2PDRA 3VE3A 1W63Q 4IHQA 1T1BA 2A24A 2VLGA 1LSVA 2L1MA 2YKFA 2ZOIA 2Y79A 3F1NB 3OCLA 2D02A 3E98A 4R70A 4L9FA 2INWA 1TS6A 2P7JA 4P6ZS 2HF6A 5TBMB 5J7EA 5K5BA 2A24B 3ZYTA 2W0NA 4FSFA 1YSQA 1LSWA 4OOLA 1XJ3A 3BQ8A 1W63M 4EUVA 3FPWA 1XJ4A 4LRZE 3H82A 2WKPA 4GJ4A 3KSIA 3T4OA 5HWWA 5DF9A 1YSPA 5DKLA 1OTAA 2PYRA 3LIBA 4HIAA 3LI9A 1H3QA 1DP9A 3GDIA 3BWLA 3H82B 4NXEA 4B93A 2W3DA 4EW7A 3S7QA 3F1PA 3BJNA 2VKSA 2OAQ1 3MF0A 4HJ4A 4F3LA 3TJZC 3EEHA 5HDDA 1S67L 3HJIA 3B33A 3MJQA 3F1PB 3LR4A 4NEED 3EQVA 1S66L 5IS1A 3C38A 4BMWA 4WEJA 4F3LB 2KX6A 3NOPC 1NLZA 2PD8A 1OTBA 2OWJA 1LT0A 3PBRA 1ZHHB 3OC2A 5IU1A 4HQAA 1MC0A 3C30A 2EWWA 3PBOA 3PHYA 3UE3A 4EEPA 3EWKA 3LR3A 5EFWA 5F5YA 4R38A 3UB8A 3C2WA 4PAUA 2PR6A 4GW9A 3U2AA 4I39A 2HJEA 3PBSA 4IUKA 4L9GA 3LR5A 5HDSA 1TF1A 2B02A 4DJ2A 2W3HA 1YAXA 4CLCD 4HH3A 3UB6A 4YOFA 4CQHA 1T1CA 4KQDA 5TJJA 4II7A 2JKRM 5FL3A 2LB9A 2JHEA 5AVEA 4EU0A 2W27A 1XFNA 4MMNA 2VV6A 1MKMA 4I3JA 2EA9A 3RTYA 3MMHA 4PKYA 1EW0A 1S4SA 3CWFA 4BWIA 4HP4A 4GHIA 3GECA 2GNXA 2QHKA 1Y28A 5C5KA 4QPRA 3A0VA 5HSQA 4M4XA 4I5SA 2PYPA 3HJKA 4EESA 4HP9A 1TD5A 1NWZA 1NLYA 1V9ZA 4Q0JA 4GHIB 4P6ZM 4BBTA 4HH2A 5CX7A 4FOFA 3KSHA 1X0OA 2PHYA 3MXQA 2XA7S 4ME4A 1LSXA 1OPXA 3KX0X 3UB9A 3KYQA 3C8CA 2K7SA 3O5YA 2G7UA 1TS0A 4GLQA 5KSHA 3CI6A 2VGLM 4Y5FA 2M7VA 4KQOA 3S7OA 5F68A 3TW8A 2V9AA 5AVFA 3T4KA 5HPFA 4G3KA 2XROA 4BBVA 1V9YA 1F98A 3NJAA 1P0ZA 2J3TD 2VZWA 3NOUC 4NXFA 2W3GA 3VV4A 3EGXC 5MC7A 1N9NA 2W3FA 4DJ3A 2VJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O01 A;  2M7U A;  3KSG A;  3NOP C;  4ZRR A;  4LRX C;  2KOI A;  3NOT C;  4DN0 A;  4MCW A;  5HL6 A;  3OOV A;  3CIT A;  1MC0 A;  3KO6 A;  2XRN A;  4IUH A;  2O99 A;  2GX5 A;  2O9A A;  4Y2F A;  3IBJ A;  3C2W A;  4PAU A;  3OBF A;  4ETZ A;  3MQ0 A;  4GW9 A;  2HGV A;  1VHM A;  2W1T A;  3NHQ A;  4IUK A;  2O9B A;  3G6O A;  3LFV A;  1TF1 A;  3HCY A;  2W3H A;  3W2Z A;  4O8G A;  5LBR A;  4MDZ A;  4YOF A;  4YNR A;  4CQH A;  2LB5 A;  2W1T B;  5TJJ A;  3IBR A;  3D3O A;  4IJG A;  2LB9 A;  5HPI A;  2XSS A;  5AJG A;  2W1R A;  4EU0 A;  3R4K A;  2Y79 A;  4MMN A;  1MKM A;  3E98 A;  4R70 A;  2QYB A;  4E04 A;  2K31 A;  3MMH A;  4G3V A;  4Z1W A;  5K5B A;  4BWI A;  4R6L A;  5C5K A;  4QPR A;  5HSQ A;  1YSQ A;  1STZ A;  3S7N A;  4Q0H A;  5I5L A;  3TRC A;  1TD5 A;  4Q0J A;  2K2N A;  5DFX A;  3DBA A;  3KSF A;  4LRY C;  4FOF A;  4EUV A;  1F5M A;  3KSH A;  3S7P A;  4ME4 A;  2Y8H A;  4LRZ E;  3E0Y A;  2O0Y A;  3O5Y A;  3ZQ5 A;  2G7U A;  3KSI A;  4GLQ A;  3CI6 A;  4DMZ A;  4Y5F A;  2M7V A;  1YSP A;  3S7O A;  4Q0I A;  5HPF A;  4RQ9 A;  5DFY A;  4G3K A;  2B18 A;  2XRO A;  2W3D A;  3S7Q A;  2KLI A;  2O9C A;  4G3W A;  3BJN A;  2VKS A;  3MF0 A;  1ZTU A;  5L8M A;  2VZW A;  3NOU C;  3K2N A;  2ZMF A;  2VEA A;  2W3G A;  3VV4 A;  3RFB A;  2W3F A;  2W3E A;  4ETX A;  3EEA A;  2OOL A;  1YKD A;  2VJW A;  4O0P A;  4MN7 A;  4Y3I A;  2IA2 A; 
#chains in the Genus database with same CATH topology
 3FKW A;  1IYP A;  1ZC2 A;  5DKK A;  3T4L A;  4R4R A;  4QY5 A;  1L2S A;  4X6T A;  3NEC A;  2PT7 A;  4ETZ A;  4UQI S;  3IF5 A;  1ONG A;  4MN5 A;  2Y2G A;  1VM1 A;  1FSW A;  3HLB A;  1QMF A;  1UWP X;  5FAP A;  4GD8 A;  3OPP A;  4WMC A;  2M1C A;  2WKR A;  1U60 A;  3QP4 A;  4E3N A;  3HLE A;  2K31 A;  4G3V A;  5L10 A;  4HHD A;  1MWU A;  1YLP A;  1STZ A;  3ZGA B;  3T50 A;  5GLB A;  1ACF A;  1JTG A;  1K4F A;  1XGJ A;  1GSV A;  5CEC A;  1E25 A;  1F5M A;  5KIZ A;  2ZMV A;  1Y4O A;  2FZ0 A;  1KOU A;  1MKI A;  2ZQ7 A;  5HFO A;  2VX8 A;  1CQA A;  2X02 A;  4IVK A;  3K3D A;  4MEZ A;  1DRM A;  5CER A;  5E2F A;  2XFT A;  2WUQ A;  1ZTU A;  4EBL A;  3EOI A;  3I7J A;  5FAQ A;  1YLT A;  4O0P A;  5A93 A;  3UME A;  2IA2 A;  4WLA A;  4DE3 A;  4OPQ A;  4Z9Q A;  3G35 A;  3LEZ A;  4RVA A;  1K57 A;  3BQA A;  5HX9 A;  1LI0 A;  4MCW A;  1SKO A;  4JKT A;  2J3W A;  4IUH A;  3FG8 A;  4HOI A;  5M19 A;  1SDE A;  1G6O A;  1TS7 A;  5FI2 A;  1VB6 A;  1SKO B;  2WKI A;  4Y17 A;  4JGP A;  2H5S A;  3AGF A;  3T4T A;  5A92 A;  1VQQ A;  1HTZ A;  3OLO A;  1ZG4 A;  4OLD A;  2ZM8 A;  1MXO A;  3D3O A;  4A5R A;  1OJ5 A;  1WYB A;  4BJP A;  3IHB A;  1G6A A;  4Y0O A;  3G4P A;  4EET B;  1ALQ A;  5GHZ A;  3T4J A;  4D2O A;  4MBK A;  5EV0 A;  5EVI C;  3PBT A;  1OJG A;  1KE0 A;  1NXY A;  4GDN A;  4KZ8 A;  2FH5 A;  3KSF A;  3N8R A;  4CJN A;  3PBN A;  3IXD A;  1L0F A;  3PXP A;  1O7E A;  1IEL A;  1XKZ A;  4R3A A;  4C3Q A;  3VP0 A;  1PZP A;  3CUE A;  5FEF A;  5DFY A;  3GRJ A;  2QJ7 A;  1OT9 A;  2HV1 A;  2KLI A;  3MQQ A;  2C6W B;  2W3E A;  4WZ5 C;  2XD5 A;  5FEG A;  1K54 C;  1BLH A;  1LL8 A;  3G2Z A;  4BQM A;  4S2L A;  3V39 A;  3KSG A;  4LRX C;  3BY8 A;  2EX6 A;  2KOI A;  3NOT C;  3VSL A;  4DN0 A;  5HL6 A;  2DNS A;  2JN7 A;  2Q0O A;  3T1X A;  2ZQ8 A;  4N1H A;  2GX5 A;  4Y2F A;  4JLF A;  4CLC A;  2JKG A;  4H6J A;  4FUW A;  2Q9M A;  3UN7 A;  2PU4 A;  3KYZ A;  5FQM A;  1CJF A;  1A0K A;  4B9O A;  4CLC B;  3UE0 A;  3W2Z A;  5LBR A;  3IQA A;  5HWV A;  4H6J B;  2EX2 A;  5AQ9 A;  2LB5 A;  5CGS A;  3BFG A;  5TBM A;  5EM0 A;  4QB8 A;  2EFU A;  1IYQ A;  2EX8 A;  3A3E A;  2D02 A;  4L9F A;  3GVB A;  5TBM B;  4U0T A;  3NY4 A;  5CXW A;  3ZYT A;  3G2Y A;  4DXC A;  2W0N A;  3IWI A;  3MKF A;  2HDS A;  4S2I A;  3GMW A;  1NJ4 A;  3BQ8 A;  3Q1F A;  4E3J A;  3IXB A;  2WKP A;  4GJ4 A;  4WZ4 A;  4HIA A;  1DP9 A;  1O07 A;  1N9B A;  5A91 A;  3F1P A;  2VKS A;  3SZT A;  5M1A A;  4BD1 A;  5L09 A;  3HJI A;  3MJQ A;  3F1P B;  3LR4 A;  4O7D A;  4BMW A;  5TR7 A;  4X56 A;  5AQA A;  2PD8 A;  1OTB A;  4LCM A;  3OZH A;  3PBR A;  1ZHH B;  2Y59 A;  4QU3 A;  2HP5 A;  3C30 A;  4XUZ A;  3PHY A;  1WYC A;  2V20 A;  3LR3 A;  2J8Y A;  3WS0 A;  5A90 A;  4UHU A;  4KZ7 A;  2A49 A;  3IHA A;  2HJE A;  3PBS A;  4IUK A;  3ZNT A;  5HDS A;  4DJ2 A;  5FQI A;  2ZMA A;  5F1F A;  1YAX A;  1KE3 A;  2ZC7 A;  4CLC D;  4YOF A;  4S2P A;  4KQD A;  3HLF A;  3HUN A;  1NYY A;  4II7 A;  5FL3 A;  2LB9 A;  5GLC A;  1XFN A;  2ZQC A;  4S2N A;  2VV6 A;  1H5X A;  2V2F F;  3S22 A;  3WWX A;  4BWI A;  4KZ4 A;  3W8K A;  2XQZ A;  5HSQ A;  4I5S A;  3HJK A;  1JWV A;  2ZQA A;  1W5D A;  3UPN A;  1RP5 A;  4P6Z M;  3O87 A;  3M6B A;  3BEB A;  3N4I A;  3KSH A;  4KZ9 A;  3P98 A;  3MXQ A;  4ME4 A;  3RXX A;  3UDF A;  3IXH A;  1TS0 A;  1LL9 A;  4P87 A;  1GA0 A;  2VGL M;  3UE1 A;  5FQQ A;  1YT4 A;  2DCF A;  3DTI A;  3GV9 A;  1H8Z A;  4G3K A;  3UPP A;  2BLS A;  3VMA A;  1V9Y A;  5FI7 A;  1F98 A;  4JF4 A;  1E3U A;  3NJA A;  1PNE A;  2Y2N A;  1I2W A;  2J3T D;  2VZW A;  4F94 A;  4NXF A;  3GR2 A;  4OKP A;  4X53 A;  4R0Q A;  1OME A;  5G4Y A;  1MWR A;  2YKH A;  2J3T C;  1T1A A;  5EEC A;  3JVU A;  4OPY A;  4P85 A;  4X68 A;  5TFQ A;  1MWS A;  4YIN A;  3KO6 A;  3O3V A;  2NUP C;  2OV5 A;  3IBJ A;  1GSW A;  5KZH A;  4WN5 A;  5DJT A;  5CHM A;  2RCX A;  1D06 A;  4HI4 A;  1FOF A;  3SS4 A;  3MZE A;  4YNR A;  3UNW A;  1L0G A;  3HRE A;  3MKE A;  5HPI A;  2QWS A;  2W1R A;  2JCH A;  3E4Q A;  3UE6 A;  3E4P A;  1BYW A;  2Y2H A;  4EER A;  1NZU A;  1FCM A;  3O86 A;  2WGI A;  4QHC A;  3SH7 A;  2Y91 A;  4UA7 A;  4Q0H A;  5J3W A;  4WEK A;  3VP2 A;  2X01 A;  4KG5 A;  4NKP A;  4MBF A;  1YLJ A;  3VP4 A;  1JWP A;  1DJA A;  1K55 C;  1Q2Q A;  3H7W A;  3ULF A;  4JPM A;  1HLU P;  4WYY A;  5F69 A;  3PBQ A;  3VE4 A;  3H7W B;  1DJC A;  4KUO A;  4GN2 A;  3LR0 A;  3BYD A;  3BY9 A;  3R7W A;  3K3C A;  3JPU A;  2IWD A;  4OH0 A;  2B5R A;  2GZA A;  4PMA A;  1JTD A;  3NDG A;  3EEA A;  1XJ6 A;  3OPR A;  5DTT A;  4ZJ2 A;  3BW6 A;  4ESP A;  5IT5 A;  1KGE A;  1T19 A;  3R7W B;  4LFU A;  1E3U D;  5CTN A;  5F6A A;  5GL9 A;  4O01 A;  2Y2L A;  1GHP A;  3CIT A;  1S4R A;  1GHI A;  4OOY A;  4OQG A;  3MFD A;  4JF6 A;  5CED A;  1IOU A;  4I38 A;  3G31 A;  4EQ1 A;  2QZ6 A;  1LHY A;  4EXO A;  3TOI A;  5EE8 A;  2VA0 A;  2QKP A;  3V3S A;  5HD5 A;  5U47 A;  2DMW A;  4X1L A;  3QP6 A;  4E3O A;  2ZC3 B;  1NY0 A;  3Q7V A;  4IJG A;  1LI9 A;  2BAS A;  4UQI M;  2FFF B;  2XH9 A;  4E3M A;  3PYP A;  2PRF A;  2QYB A;  4I3I A;  3T4Q A;  3F1O A;  3Q7V B;  3ZVT A;  1CI9 A;  4R6L A;  1K0K A;  3LUQ A;  3T1Q B;  3M2J A;  3BEC A;  4OOM A;  1SDN A;  1YLW A;  4HNB A;  4KZ3 A;  3F1O B;  5DFX A;  1OTE A;  4OPZ A;  2BTF P;  3ICY A;  2V0U A;  1P9R A;  3E0Y A;  2JKT M;  2ZBB A;  1S6R A;  3N6I A;  2WKH A;  4OPR A;  3FWL A;  4ZJ3 A;  3ZCZ A;  1ERO A;  4LLO B;  5GLD A;  4HY8 A;  4GCZ A;  3QNB A;  2HDU A;  1W8Y A;  4LEN A;  4EWF A;  4JXW A;  3GTC A;  1W8Q A;  3DWK A;  1RGZ A;  3NDE A;  3RH8 B;  5AQB A;  2Z6D A;  1N9L A;  4EEU A;  1YLZ A;  3OPH A;  4ZRR A;  3ZG7 B;  1SKF A;  1J3W A;  2G2U A;  3MQO A;  4NET A;  3T1R A;  2V0W A;  2O9A A;  2I9V A;  5GLA A;  3ZFZ A;  5I94 A;  4PM8 A;  4L0L A;  2WZX A;  3Q82 A;  1K6S A;  3T4S A;  1VHM A;  3NHQ A;  5FAO A;  2CC1 A;  4DE2 A;  1ODV A;  1KVM A;  1PWC A;  2VV7 A;  4ZBE A;  2PDR A;  1HZO A;  3VE3 A;  1W63 Q;  2ZQ9 A;  2VLG A;  2L1M A;  3N8S A;  1CEF A;  3OCL A;  3E98 A;  4XUX A;  3P09 A;  4GDB A;  4GB7 A;  3L7H A;  1J9M A;  1KGF A;  2XDM A;  1YSQ A;  1Z09 A;  1K56 A;  1ZG6 A;  1ESI A;  4GOG A;  1XJ4 A;  3ZG5 A;  3HLG A;  2QPN A;  3BLM A;  1KE4 A;  4HBU A;  5DF9 A;  3O88 A;  1IKG A;  5G18 A;  1YM1 A;  3LI9 A;  4WMC D;  3BWL A;  4B93 A;  2W3D A;  4EV4 A;  4F3L A;  3TJZ C;  3EEH A;  2WGV A;  3B33 A;  3EQV A;  1S66 L;  3A3J A;  4F3L B;  3S4X A;  3NOP C;  5FAS A;  2OWJ A;  3TSG A;  3QP1 A;  3OC2 A;  5IU1 A;  3MBZ A;  3MZD A;  4ZDX A;  4KG6 A;  3C7V A;  1FR1 A;  5KMW A;  2OSU A;  3UE3 A;  4EEP A;  3EWK A;  3RXW A;  5EFW A;  5F5Y A;  2UWX A;  3UB8 A;  2H0T A;  3C2W A;  3BFF A;  2PR6 A;  3U2A A;  4JBF A;  1HVB A;  3LR5 A;  4X69 A;  1TF1 A;  2B02 A;  2W3H A;  3UB6 A;  4ZJ1 A;  2J9P A;  1BSG A;  3T1S A;  1T1C A;  5TJJ A;  2JKR M;  4BEN A;  2AVX A;  2W27 A;  3RTY A;  4YFM A;  1KDS A;  1XPB A;  4GHI A;  3PAE A;  1I5Q A;  4B4Z A;  1RGY A;  5C5K A;  3IWO A;  5CHU A;  2PYP A;  3E2L A;  5JYP A;  5AQ7 A;  1K57 C;  2XR0 A;  4HP9 A;  2DRW A;  3UDX A;  1ES5 A;  4GHI B;  4B4X A;  4RA7 A;  4FOF A;  1PFL A;  1YMS A;  3WRZ A;  1X0O A;  2PHY A;  4GZB A;  1OPX A;  1XGI A;  1FCN A;  3ZHH A;  3UB9 A;  3AGD A;  3A3D A;  3CI6 A;  1BZA A;  4KQO A;  2ZL1 A;  3TW8 A;  5AVF A;  3FZC A;  5HPF A;  3DTM A;  5EPH A;  1KVL A;  4P0M A;  2XRO A;  1IKI A;  1SZV A;  1W79 A;  3NOU C;  2W3G A;  1TEM A;  3VV4 A;  3EGX C;  5MC7 A;  4X55 A;  2VJW A;  1SHV A;  4WM9 A;  2UV0 E;  4E3L A;  1ONH A;  3W4O A;  3GQZ A;  3HBR A;  3JVV A;  2D01 A;  4KQR A;  4Q8I A;  5L07 A;  3TE8 A;  3G32 A;  4Y15 A;  4BD0 A;  5IHV A;  1N9O A;  2HDQ A;  3LIF A;  3ISG A;  2Y2O A;  4Y13 A;  4K0W A;  3Q81 A;  3LIC A;  4FH2 A;  4E6W A;  3LY3 A;  4EUZ A;  4PM5 A;  2ZOH A;  1VET A;  4O8G A;  4QJG A;  3IWQ A;  2XD1 A;  3A3F A;  3CUE C;  3KYE A;  5HW3 A;  3IBR A;  5CRF A;  2H0Y A;  5AJG A;  3SW1 A;  3CAX A;  1VET B;  2EFX A;  3R4K A;  3MSH A;  3HUO A;  4KZA A;  4ZTK A;  1H8Y A;  3L9K A;  2ZC4 B;  2P04 A;  3RJU A;  4R1G A;  2JKT I;  5FA7 A;  1XFQ A;  2Y55 A;  2K2N A;  4OON A;  4LRY C;  5CTM A;  2ZM0 A;  2EX9 A;  2PAV P;  4UA6 A;  3LYX A;  4IBR A;  5M18 A;  4CLC C;  4MLL A;  4WF0 A;  3B42 A;  4KEN B;  1I2S A;  4RQ9 A;  3U4L P;  5EM1 A;  4G3W A;  1K38 A;  3SOI A;  3ZG0 A;  3K2N A;  2ZMF A;  3ZNY A;  4RX3 A;  3RFB A;  3C7U A;  3CZD A;  3WS1 A;  4FD8 A;  4MN7 A;  4HES A;  4DKI A;  4WUJ A;  5HZH A;  4YWZ A;  3VFH A;  4C6Y A;  4UAA A;  1MZU A;  5DF8 A;  4NXB A;  2ZC6 B;  4D60 A;  3ITB A;  1OTI A;  2J80 A;  4K08 A;  5EUA A;  1FCO A;  3SH8 A;  2PR5 A;  2OWH A;  2H28 A;  5EOO A;  2WGW A;  3MQ0 A;  3VOY A;  3NIA A;  3G34 A;  2QJ5 A;  1TDG A;  5FQK A;  4MN6 A;  3B47 A;  2H10 A;  2CMN A;  3LFV A;  3HCY A;  1BLP A;  5F1G A;  1ES3 A;  2XGN A;  2VGL S;  2WGW B;  1DJB A;  2HP6 A;  4GS9 A;  2V1A A;  4EBN A;  3TG9 A;  4PHT A;  2R9W A;  3E4O A;  3QNC A;  3LID A;  4GS9 B;  3CHW P;  4DE1 A;  3A0R A;  1M40 A;  3LI8 A;  2WAE A;  3CPT A;  3S7N A;  3MFX A;  3CG5 A;  3P01 A;  2R78 A;  3NBL A;  2IWB A;  3P7N A;  3DBA A;  1GCE A;  2QMI A;  3AGE A;  1DP8 A;  3S7P A;  1SCW A;  3CPT B;  2EWV A;  4QWO A;  4OQH A;  1L0D A;  4FTX A;  1VEU A;  2B18 A;  3H9W A;  2VGJ A;  5E43 A;  4FCF A;  4WEL A;  3FKV A;  4CPK A;  1YQS A;  5L8M A;  2C5W B;  1K25 A;  1H8M A;  1VEU B;  2VEA A;  3LEQ A;  1G68 A;  4DE0 A;  1OTD A;  3SS5 A;  4S2N C;  4OP8 A;  2Z2L B;  4S2M A;  4KUK A;  4DDY A;  4DDS A;  1XA1 A;  5DTS A;  2PBY A;  4E6X A;  2HP9 A;  5HDC A;  1WE4 A;  3V5M A;  1BTL A;  4ARZ A;  5E2E A;  1P97 A;  3V50 A;  2XA7 M;  5F83 A;  1S0W A;  4JGO A;  2Y2J A;  3HLW A;  2JE5 A;  2JKR I;  4NXG A;  1ESU A;  2IWC A;  3MS6 A;  1TS8 A;  5DVA A;  1NRJ A;  3ZDJ A;  4ARZ B;  2XEP A;  4IVI A;  1MWT A;  1PW8 A;  1G5U A;  2Y2K A;  2W1T A;  2WZZ A;  5FDH A;  4MDZ A;  4BLM A;  3PR6 A;  2E8J A;  3NCK A;  2W1T B;  5TGF A;  3WS2 A;  4IHQ A;  1T1B A;  2A24 A;  1LSV A;  3HLD A;  2YKF A;  2ZOI A;  2Y79 A;  4KG2 A;  4R70 A;  2INW A;  1TS6 A;  2P7J A;  4Y7P A;  2HF6 A;  3DTE A;  5K5B A;  2A24 B;  3WS4 A;  4FSF A;  4H8R A;  4LV1 A;  4ID4 A;  4OOL A;  1CI8 A;  1XJ3 A;  3D9Y A;  1YLY A;  1W63 M;  4N9K A;  4QY6 A;  1MBL A;  3FPW A;  1EWZ A;  1K4E A;  4LCL A;  4LRZ E;  3H82 A;  4OQ0 A;  3T4O A;  3IH9 A;  2OLU A;  1PRQ A;  3SH9 A;  3VP1 A;  4K0X A;  1OTA A;  2ZQD A;  3H82 B;  1Z6F A;  4EW7 A;  3S7Q A;  5EOE A;  3BJN A;  3DAV A;  2J7V A;  4HJ4 A;  4JF5 A;  3DWZ A;  5HDD A;  4MNR A;  1S67 L;  4NEE D;  4P6B A;  5IS1 A;  3C38 A;  4OVD A;  5E2H A;  4WEJ A;  2KX6 A;  4JXS A;  5EVI A;  2WKE A;  1MC0 A;  4HBT A;  3V3R A;  1TVF A;  2EWW A;  1BLC A;  5EVI B;  3BLS A;  1RCJ A;  4R38 A;  4I39 A;  4DXB A;  3IF6 C;  2JBF A;  4OP5 A;  4HH3 A;  2B95 A;  5D3O A;  3LO7 A;  2GDN A;  4UA9 A;  2JHE A;  5AVE A;  4EU0 A;  4WZ5 A;  4MMN A;  1MKM A;  4I3J A;  1K54 A;  2EA9 A;  4X1M A;  3CWF A;  4HP4 A;  5GHY A;  2HZ5 A;  2A3U A;  2GNX A;  2QHK A;  4QPR A;  4M4X A;  3FYZ A;  4EES A;  1TD5 A;  1IEM A;  1V9Z A;  5CX7 A;  4WBG A;  1ES4 A;  3UB5 P;  3BFC A;  4KZB A;  4FH4 A;  1LSX A;  1Y54 A;  3C8C A;  1K6R A;  1QME A;  4E3I A;  2OLV A;  5DTK A;  2M7V A;  3S7O A;  4PM6 A;  3T4K A;  1JVJ A;  1CEG A;  4GD6 A;  4DRT A;  4ZAM A;  3VOZ A;  1N9N A;  2W3F A;  3UPO A;  3UO9 A;  5A8B A;  4U0X A;  3M6H A;  5JYO A;  4WL9 A;  4KZ6 A;  5G4Z A;  5J8X A;  5GHX A;  4EQI A;  3LIE A;  3MR0 A;  3ZG8 B;  5CHJ A;  1DY6 A;  1FIK A;  4X25 A;  1M6K A;  5EVI D;  2OAP 1;  3LIA A;  3CMZ A;  2ZM2 A;  1UGU A;  4S2J A;  5HD3 A;  1GHM A;  3UDI A;  1PIO A;  4N9L A;  3T12 B;  1DP6 A;  1F2K A;  1PWD A;  1XP4 A;  1XJ2 A;  1BLS A;  4CLC E;  2XSS A;  3S1Y A;  3EGD C;  4PM7 A;  1G28 A;  3G30 A;  4LGW A;  1Q2P A;  4MBH A;  1JNU A;  3VOL A;  1S1Y A;  3UMD A;  3IS2 A;  3OCN A;  3N8L A;  2HJ9 C;  5FAT A;  5I5L A;  3ZVW A;  2NUT C;  1GA9 A;  3IS2 B;  2Y8H A;  2Y2Q A;  3PAG A;  5FSR A;  4I3A A;  2O0Y A;  2P9V A;  1E4D A;  4OQI A;  1XX2 A;  2WKQ A;  3QP8 A;  2P9V B;  2EXB A;  2O9C A;  1CF0 A;  3HLC A;  3IH8 A;  3LCE A;  3JYI A;  1KGG A;  4JGQ A;  3UB7 A;  1HD8 A;  3OPL A;  2WYX A;  1IYS A;  5J4E A;  1D7E A;  2KDK A;  3VSK A;  3V67 A;  3ZG9 B;  3BFE A;  1K56 D;  4HJ3 A;  5DJU A;  4LPZ A;  2G2W A;  4IBX A;  5KSC A;  2ZJ9 A;  4XT2 A;  5FI6 A;  2ZL1 B;  1YMX A;  2Q9N A;  3VP3 A;  4BBU A;  5F82 A;  4R4S A;  2J9O A;  2V8C A;  2HGV A;  2PD7 A;  4XT2 B;  4HJ6 A;  3G6O A;  1S1Z A;  4OLG A;  2X71 A;  1NZO A;  2P08 A;  1CK3 A;  4RX2 A;  4NG2 A;  1PI4 A;  2GJ3 A;  1AWI A;  2ZC5 B;  4B88 A;  2L4R A;  1F9I A;  1TDL A;  4E04 A;  3FPV A;  1P9W A;  4Z1W A;  3IX8 A;  4IED A;  4HEF A;  5FQJ A;  4BL2 A;  2XK1 A;  3IX3 A;  5HAR A;  4GNU A;  3CLO A;  3TRC A;  3EQU A;  3D72 A;  3FC7 A;  2L0W A;  3BFD A;  3C5A A;  3W4Q A;  3C4P A;  3DW0 A;  5HAP A;  1PZO A;  2MJ6 A;  3HVF A;  4JGR A;  1W7F A;  1FSY A;  2R9X A;  3ZQ5 A;  2V1B A;  5HAI A;  4L9E A;  5FQ9 A;  4DMZ A;  4DF6 A;  5L2F A;  4KQQ A;  1UWN X;  4Q0I A;  3IX4 A;  5FDS A;  1ZKJ A;  2Z6C A;  1L3L A;  1IFQ A;  2ZLY A;  2VK3 A;  4PPR A;  2A2L A;  2VV8 A;  4JXV A;  4JXG A;  4Y0U A;  4XXR A;  2WAD A;  4ETX A;  3W4P A;  3C4O A;  2OOL A;  1YKD A;  4AFI A;  4Y3I A;  4UEY A;  2M7U A;  1BUE A;  3A0S A;  1PW1 A;  1T18 A;  1GSX A;  3OOV A;  1NRF A;  1BUL A;  1OT6 A;  3WS5 A;  2XRN A;  1K55 A;  2O99 A;  3E2K A;  2RL3 A;  4PKY G;  1XXM A;  3N7W A;  4LV2 A;  2Y2P A;  3OBF A;  2FFY A;  2O9B A;  1WA9 A;  1FIL A;  3CJM A;  5HAQ A;  1LLB A;  3F1N A;  4QD4 A;  3QP2 A;  1NYM A;  4BL3 A;  5HWT A;  3HUM A;  3MXS A;  3PTE A;  1KDW A;  2Y2I A;  3NC8 A;  4NK3 A;  3F1N B;  2XLN A;  4M3K A;  1MY8 A;  3NI9 A;  4RYE A;  4P6Z S;  5J7E A;  2BG1 A;  4C75 A;  1D1J A;  3GSG A;  1BT5 A;  1FQG A;  1PYY A;  4N92 A;  1LSW A;  1EI5 A;  2V1Z A;  2XFS A;  4EUV A;  2E8I A;  3KSI A;  5HWW A;  1YSP A;  5DKL A;  2PYR A;  3LIB A;  2PU2 A;  1H3Q A;  3GDI A;  4NXE A;  1YPR A;  2OAQ 1;  3MF0 A;  4R3B A;  3SS3 A;  3BRM A;  5CEB A;  3B3X A;  2ZD8 A;  2WK0 A;  3M2K A;  1IYO A;  2PBD P;  1NLZ A;  1PI5 A;  1LT0 A;  1L0E A;  2P74 A;  4R3J A;  3MZF A;  4HQA A;  3QHY A;  3Q07 A;  4Y0T A;  1PWG A;  3PBO A;  4N1X A;  3FV7 A;  3UY6 A;  4PAU A;  5EVE A;  1N4O A;  4GW9 A;  5EVL A;  1AXB A;  4L9G A;  1ERQ A;  3Q7Z A;  2ACG A;  3VFF A;  2JC7 A;  4LV3 A;  4R23 A;  4S2O A;  4EBP A;  3LY4 A;  2JKF A;  4CQH A;  1XA7 A;  3WRT A;  3HL9 A;  1LL5 A;  2VGK A;  2WAF A;  1C3B A;  4LV0 A;  3MMH A;  3NUL A;  1EW0 A;  4PKY A;  1S4S A;  3IT9 A;  5HL1 A;  3IF6 A;  4S2K A;  5BOH A;  3GEC A;  3IXG A;  1Y28 A;  3A0V A;  2Z2M B;  4PM9 A;  4K91 A;  1MPL A;  4E3K A;  1FR6 A;  3QP5 A;  1NWZ A;  3BM6 A;  4Q0J A;  1NLY A;  3IF6 B;  4BBT A;  3LGO A;  5E2G A;  4HH2 A;  3A3I A;  2HDR A;  2XA7 S;  1ES2 A;  5DF7 A;  3D4F A;  3MXR A;  3KX0 X;  3KYQ A;  2K7S A;  3O5Y A;  5CGX A;  2G7U A;  4GLQ A;  1H0M A;  5KSH A;  1JWZ A;  4Y5F A;  2XF3 A;  5F68 A;  4U3T A;  2HPB A;  2V9A A;  2EXA A;  2V8F A;  1ERM A;  2I72 A;  4BBV A;  1P0Z A;  2Y2M A;  2Y4A A;  3DTK A;  5CGW A;  3ITA A;  4DJ3 A;  4GKU A;  4KZ5 A; 
#chains in the Genus database with same CATH homology
 5A8B A;  5G4Y A;  2YKH A;  2J3T C;  1T1A A;  4WL9 A;  5G4Z A;  3JVV A;  5DKK A;  3T4L A;  3LIE A;  2D01 A;  3JVU A;  3MR0 A;  3TE8 A;  3KO6 A;  1N9O A;  2NUP C;  3IBJ A;  1GSW A;  2OAP 1;  3LIA A;  3LIF A;  2PT7 A;  4ETZ A;  4WN5 A;  5DJT A;  1UGU A;  4UQI S;  1D06 A;  4HI4 A;  3LIC A;  5HD3 A;  4MN5 A;  2ZOH A;  4O8G A;  1DP6 A;  3CUE C;  4YNR A;  3IBR A;  1XJ2 A;  1UWP X;  5HPI A;  2QWS A;  4CLC E;  2XSS A;  5AJG A;  3SW1 A;  2W1R A;  3CAX A;  3E4Q A;  2M1C A;  2WKR A;  3R4K A;  3UE6 A;  3E4P A;  1BYW A;  3EGD C;  1G28 A;  2K31 A;  4G3V A;  1JNU A;  3VOL A;  1S1Y A;  4EER A;  3UMD A;  4HHD A;  2P04 A;  3IS2 A;  3OCN A;  2JKT I;  1STZ A;  2HJ9 C;  3T50 A;  4Q0H A;  5I5L A;  5J3W A;  4WEK A;  1XFQ A;  4NKP A;  2NUT C;  2K2N A;  1GSV A;  3IS2 B;  4LRY C;  1F5M A;  5KIZ A;  2ZMV A;  2Y8H A;  3LYX A;  2FZ0 A;  1KOU A;  3H7W A;  4CLC C;  4I3A A;  2O0Y A;  3ULF A;  4WF0 A;  3B42 A;  2VX8 A;  5F69 A;  3PBQ A;  3K3D A;  4RQ9 A;  3VE4 A;  2WKQ A;  1DRM A;  3H7W B;  4KUO A;  2O9C A;  3LR0 A;  4G3W A;  1ZTU A;  3BY9 A;  3R7W A;  4JGQ A;  3K3C A;  3UB7 A;  3K2N A;  2ZMF A;  3RFB A;  2GZA A;  3EOI A;  5J4E A;  3EEA A;  1XJ6 A;  1D7E A;  4O0P A;  3BW6 A;  4MN7 A;  2KDK A;  3UME A;  2IA2 A;  5IT5 A;  3V67 A;  1T19 A;  3R7W B;  4WUJ A;  4WLA A;  5F6A A;  5HZH A;  4YWZ A;  4O01 A;  4HJ3 A;  5DJU A;  4LPZ A;  1MZU A;  3BQA A;  4MCW A;  2J3W A;  4NXB A;  3CIT A;  4IUH A;  1OTI A;  4XT2 A;  1S4R A;  2J80 A;  3FG8 A;  4HOI A;  4K08 A;  1IOU A;  1G6O A;  1TS7 A;  4I38 A;  4BBU A;  1VB6 A;  4EQ1 A;  2PR5 A;  2OWH A;  4EXO A;  2H28 A;  3MQ0 A;  2HGV A;  2PD7 A;  4XT2 B;  2VA0 A;  2QJ5 A;  4MN6 A;  4HJ6 A;  4JGP A;  3B47 A;  3G6O A;  2QKP A;  2CMN A;  3LFV A;  1S1Z A;  3T4T A;  3HCY A;  5HD5 A;  2DMW A;  3OLO A;  2VGL S;  2P08 A;  4GS9 A;  2V1A A;  3D3O A;  1OJ5 A;  4IJG A;  2GJ3 A;  4PHT A;  2BAS A;  4UQI M;  4BJP A;  3PYP A;  2L4R A;  1F9I A;  3E4O A;  2QYB A;  4E04 A;  3FPV A;  1P9W A;  3LID A;  4GS9 B;  4I3I A;  3F1O A;  4Z1W A;  3T4Q A;  4EET B;  3A0R A;  4R6L A;  3T4J A;  3LUQ A;  3LI8 A;  4OOM A;  4HNB A;  3S7N A;  3MFX A;  3CLO A;  3F1O B;  3PBT A;  3P01 A;  1OJG A;  3TRC A;  2R78 A;  3EQU A;  3D72 A;  3FC7 A;  2L0W A;  3P7N A;  5DFX A;  3DBA A;  2FH5 A;  1OTE A;  3KSF A;  1DP8 A;  3S7P A;  3PBN A;  3ICY A;  2MJ6 A;  2V0U A;  1P9R A;  3E0Y A;  4JGR A;  3ZQ5 A;  3PXP A;  2EWV A;  2V1B A;  4L9E A;  4DMZ A;  2JKT M;  4R3A A;  2ZBB A;  1UWN X;  4Q0I A;  3CUE A;  5DFY A;  2B18 A;  3H9W A;  2QJ7 A;  1OT9 A;  2HV1 A;  2Z6C A;  1IFQ A;  2KLI A;  3MQQ A;  4WEL A;  4LLO B;  5L8M A;  4HY8 A;  2A2L A;  2VV8 A;  1H8M A;  4GCZ A;  2VEA A;  2W3E A;  4ETX A;  1OTD A;  2OOL A;  1YKD A;  4AFI A;  4Y3I A;  3RH8 B;  4KUK A;  2Z6D A;  1LL8 A;  1N9L A;  4UEY A;  2M7U A;  4EEU A;  3A0S A;  3KSG A;  4ZRR A;  4LRX C;  3BY8 A;  2KOI A;  3NOT C;  5HDC A;  1T18 A;  1GSX A;  4ARZ A;  4DN0 A;  3MQO A;  1P97 A;  5HL6 A;  2XA7 M;  3OOV A;  2JN7 A;  4JGO A;  1OT6 A;  2V0W A;  2XRN A;  2O99 A;  2GX5 A;  2JKR I;  2O9A A;  4NXG A;  2I9V A;  4PKY G;  4Y2F A;  4CLC A;  1TS8 A;  1NRJ A;  4ARZ B;  3OBF A;  4H6J A;  4L0L A;  3T4S A;  1VHM A;  2W1T A;  3NHQ A;  2O9B A;  3KYZ A;  1WA9 A;  4B9O A;  4CLC B;  1ODV A;  3W2Z A;  5LBR A;  5HWV A;  4MDZ A;  3F1N A;  3PR6 A;  2VV7 A;  4H6J B;  5HWT A;  2LB5 A;  5TBM A;  2W1T B;  2PDR A;  3VE3 A;  1W63 Q;  4IHQ A;  1T1B A;  2A24 A;  2VLG A;  1LSV A;  2L1M A;  2YKF A;  2ZOI A;  2Y79 A;  3F1N B;  3OCL A;  2D02 A;  3E98 A;  4R70 A;  4L9F A;  2INW A;  1TS6 A;  2P7J A;  4P6Z S;  2HF6 A;  5TBM B;  5J7E A;  5K5B A;  2A24 B;  3ZYT A;  2W0N A;  4FSF A;  1YSQ A;  1LSW A;  4OOL A;  1XJ3 A;  3BQ8 A;  1W63 M;  4EUV A;  3FPW A;  1XJ4 A;  4LRZ E;  3H82 A;  2WKP A;  4GJ4 A;  3KSI A;  3T4O A;  5HWW A;  5DF9 A;  1YSP A;  5DKL A;  1OTA A;  2PYR A;  3LIB A;  4HIA A;  3LI9 A;  1H3Q A;  1DP9 A;  3GDI A;  3BWL A;  3H82 B;  4NXE A;  4B93 A;  2W3D A;  4EW7 A;  3S7Q A;  3F1P A;  3BJN A;  2VKS A;  2OAQ 1;  3MF0 A;  4HJ4 A;  4F3L A;  3TJZ C;  3EEH A;  5HDD A;  1S67 L;  3HJI A;  3B33 A;  3MJQ A;  3F1P B;  3LR4 A;  4NEE D;  3EQV A;  1S66 L;  5IS1 A;  3C38 A;  4BMW A;  4WEJ A;  4F3L B;  2KX6 A;  3NOP C;  1NLZ A;  2PD8 A;  1OTB A;  2OWJ A;  1LT0 A;  3PBR A;  1ZHH B;  3OC2 A;  5IU1 A;  4HQA A;  1MC0 A;  3C30 A;  2EWW A;  3PBO A;  3PHY A;  3UE3 A;  4EEP A;  3EWK A;  3LR3 A;  5EFW A;  5F5Y A;  4R38 A;  3UB8 A;  3C2W A;  4PAU A;  2PR6 A;  4GW9 A;  3U2A A;  4I39 A;  2HJE A;  3PBS A;  4IUK A;  4L9G A;  3LR5 A;  5HDS A;  1TF1 A;  2B02 A;  4DJ2 A;  2W3H A;  1YAX A;  4CLC D;  4HH3 A;  3UB6 A;  4YOF A;  4CQH A;  1T1C A;  4KQD A;  5TJJ A;  4II7 A;  2JKR M;  5FL3 A;  2LB9 A;  2JHE A;  5AVE A;  4EU0 A;  2W27 A;  1XFN A;  4MMN A;  2VV6 A;  1MKM A;  4I3J A;  2EA9 A;  3RTY A;  3MMH A;  4PKY A;  1EW0 A;  1S4S A;  3CWF A;  4BWI A;  4HP4 A;  4GHI A;  3GEC A;  2GNX A;  2QHK A;  1Y28 A;  5C5K A;  4QPR A;  3A0V A;  5HSQ A;  4M4X A;  4I5S A;  2PYP A;  3HJK A;  4EES A;  4HP9 A;  1TD5 A;  1NWZ A;  1NLY A;  1V9Z A;  4Q0J A;  4GHI B;  4P6Z M;  4BBT A;  4HH2 A;  5CX7 A;  4FOF A;  3KSH A;  1X0O A;  2PHY A;  3MXQ A;  2XA7 S;  4ME4 A;  1LSX A;  1OPX A;  3KX0 X;  3UB9 A;  3KYQ A;  3C8C A;  2K7S A;  3O5Y A;  2G7U A;  1TS0 A;  4GLQ A;  5KSH A;  3CI6 A;  2VGL M;  4Y5F A;  2M7V A;  4KQO A;  3S7O A;  5F68 A;  3TW8 A;  2V9A A;  5AVF A;  3T4K A;  5HPF A;  4G3K A;  2XRO A;  4BBV A;  1V9Y A;  1F98 A;  3NJA A;  1P0Z A;  2J3T D;  2VZW A;  3NOU C;  4NXF A;  2W3G A;  3VV4 A;  3EGX C;  5MC7 A;  1N9N A;  2W3F A;  4DJ3 A;  2VJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...