4MMNA

Structural and biochemical analysis of type ii free methionine-r-sulfoxide reductase from thermoplasma acidophilum
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
141
structure length
141
Chain Sequence
b'DLKEFARSQMQAACQYLKEKNPKYDWVGFYVLEHGKLKLEAFVGEKTDHVEINLGDGLCSLAVLKNDIVNEYDVKSNPKYLACFPSTQSEIVVPVRYQGEPIGEIDIDSDKKAAFSKEDEAMLSSIADLMAPLVHEFFVKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein Ta0848
publication title Structural and biochemical analysis of a type II free methionine-R-sulfoxide reductase from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Oxidoreductase
total genus 45
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4mmnA00
4E04A 2XSSA 3G6OA 2M7VA 1YSQA 5LBRA 1TF1A 5HPFA 4MCWA 3KSFA 3NOTC 2W3FA 4YOFA 1STZA 4EUVA 4PAUA 2XRNA 4O0PA 3MF0A 3MQ0A 2W1TA 4IUKA 4ETZA 1ZTUA 2KLIA 2W3EA 2O0YA 1VHMA 4MMNA 4YNRA 3LFVA 3HCYA 3OOVA 4R6LA 5K5BA 1TD5A 1YSPA 4G3KA 5I5LA 4IUHA 4RQ9A 4EU0A 3MMHA 2Y79A 3IBRA 2G7UA 4QPRA 3ZQ5A 2W1TB 4Q0HA 3NOUC 4DN0A 4Q0JA 5DFXA 2QYBA 3VV4A 2XROA 3E0YA 1YKDA 3NOPC 3EEAA 3C2WA 4GLQA 4O8GA 2VEAA 4ZRRA 3KSGA 2O9BA 3RFBA 5HSQA 2VZWA 4Y2FA 3DBAA 3NHQA 3S7NA 5L8MA 4R70A 2W3GA 4Y5FA 2VJWA 4CQHA 4IJGA 2KOIA 4ME4A 4O01A 4Z1WA 3R4KA 3D3OA 2OOLA 2K2NA 1F5MA 2O9AA 3O5YA 4GW9A 4Y3IA 3CITA 4LRXC 3BJNA 2IA2A 2LB9A 2W3HA 5C5KA 2VKSA 4LRZE 4G3WA 4BWIA 3K2NA 5HL6A 3S7PA 4DMZA 3S7QA 4MN7A 2O9CA 2Y8HA 2GX5A 1MC0A 4FOFA 5HPIA 3IBJA 4Q0IA 2W3DA 2ZMFA 2HGVA 3KO6A 3TRCA 4LRYC 3S7OA 3E98A 5AJGA 1MKMA 3CI6A 4ETXA 2W1RA 4G3VA 5TJJA 2O99A 3W2ZA 2LB5A 3OBFA 5DFYA 2K31A 3KSIA 4MDZA 3KSHA 2M7UA 2B18A
chains in the Genus database with same CATH superfamily
2Q9NA 5FQJA 3QP5A 4S2PA 1NLZA 3NC8A 3IXHA 2EXAA 5HPFA 5EV0A 3MKFA 4DRTA 5EPHA 2W3FA 3OPLA 3EWKA 4FSFA 3MF0A 4X53A 4S2NC 5HD3A 2PD7A 4D60A 3Q82A 3ITBA 2W3EA 3BFDA 4R3AA 1NZOA 3FKVA 5J7EA 4ZDXA 2WZXA 1NWZA 4FD8A 5J3WA 3H7WA 3AGFA 3ZQ5A 5CGWA 1LL8A 4RYEA 1S1ZA 2QJ7A 4B4XA 4O8GA 2QKPA 3EEHA 3O86A 3MJQA 3F1PB 3LI9A 4BBTA 4S2KA 2VJWA 4MBHA 4JXSA 4KG6A 2ZQCA 2PU4A 3QP8A 1IYQA 1W8YA 5GL9A 3UE3A 3ULFA 3FV7A 2IA2A 5CGSA 4PM9A 5FI7A 4X25A 1XJ4A 2I72A 3UE1A 3S7PA 5JYPA 1NXYA 3BLSA 4Q0IA 3UN7A 1T1BA 2JKFA 4L9GA 3ZNTA 3U2AA 1GA9A 2BLSA 3IWOA 3GVBA 2V9AA 3C4OA 4EXOA 4EWFA 4QU3A 3LEZA 1IOUA 1KGFA 1ES3A 5F6AA 4B4ZA 4KQDA 3F1NB 2X01A 3JYIA 3ZDJA 1DRMA 4GS9A 5FASA 4OLDA 2Y91A 3MS6A 1TDLA 3RH8B 2RCXA 4YWZA 1OJ5A 3HLEA 3A3DA 5AQ9A 2NUTC 3SH7A 2EX8A 2GZAA 2QYBA 3D72A 1A0KA 1Z09A 2MJ6A 2DCFA 3BWLA 4HBTA 2ZQAA 1F98A 3NJAA 3MXRA 2Y2MA 4OPQA 4PPRA 5TFQA 3UPOA 1OTAA 2ZC6B 2XD1A 4Y0TA 2W3GA 1K56A 1WYCA 1EI5A 1IYOA 2V8FA 1FSWA 3LUQA 3ZG5A 5FQQA 3E4PA 3NDEA 3QHYA 2FH5A 3V67A 4WN5A 1GHIA 1WA9A 5L10A 3R7WB 3HUNA 4KQOA 1P0ZA 4NXFA 3OPHA 4WMCA 5F1GA 4BWIA 3S7QA 4BBVA 3LR3A 3N8RA 2DMWA 5JYOA 4GD8A 4PMAA 5IT5A 4LENA 1JWZA 4DF6A 3GMWA 5CX7A 2G2WA 4LRYC 5HD5A 2XA7M 1PRQA 5EM0A 4QB8A 3T4JA 3IH9A 4S2IA 2PHYA 2HJEA 1XGJA 2P08A 5L2FA 3O3VA 2M7UA 2B18A 4WMCD 4JF5A 1BYWA 2EX2A 2VGJA 3DWKA 3F1PA 3UB8A 3PBSA 5HFOA 5A93A 1RGYA 3BY8A 1N9OA 3AGDA 1FOFA 4UHUA 3Q07A 1YMXA 3S22A 2KLIA 5TBMB 4E6WA 1BUEA 1W7FA 1CK3A 2JCHA 2P04A 3JVUA 1G6AA 4OLGA 2OWHA 3LEQA 2Y79A 1S67L 2G7UA 1TDGA 4YINA 1XA7A 3MKEA 3OLOA 2DRWA 1ES4A 5AQBA 1KE0A 2BTFP 2UWXA 3OZHA 3MZEA 1KOUA 4GD6A 2B02A 3K3DA 2Y2QA 3VP0A 3MXQA 4Z1WA 3F1NA 2HJ9C 3VSKA 3L9KA 2HDRA 1OT6A 3GSGA 4OOMA 2Z2MB 5AVEA 3HBRA 2VV8A 3BEBA 5F82A 1J9MA 5HL1A 2XA7S 4N1XA 1P97A 3T4LA 4G3WA 4ZJ1A 5EVLA 1YLZA 2O9CA 5FA7A 1PI5A 5E2EA 5DTKA 1X0OA 5D3OA 4WZ4A 3SH8A 3TRCA 1KGGA 1OJGA 3IF6B 3SOIA 3HJKA 4CJNA 1LSXA 4LFUA 5CHJA 3M2JA 5G4YA 2E8JA 1I2WA 5GHXA 3KSIA 2ZC7A 3EQUA 1N9NA 5DJTA 4XUZA 5AQAA 5HWWA 1G28A 3G6OA 3NECA 1TF1A 3QP2A 5DKLA 4WZ5A 3C30A 4R3JA 4O7DA 1CEGA 3LY3A 3R7WA 1OTDA 4Q8IA 2VK3A 4CLCD 4R6LA 4L9FA 4EQ1A 5CEDA 3B47A 2ZBBA 3QP4A 4HP4A 5DTTA 3LCEA 5M18A 3W4PA 2CC1A 1K55C 4II7A 2JBFA 4BL2A 3MBZA 4OONA 4Z9QA 2QHKA 4HESA 4NG2A 2W0NA 2ZQ9A 3GECA 3IS2B 4HY8A 2ZQ7A 3LIBA 1H0MA 5MC7A 3Q7ZA 4PM6A 4GHIB 4OQHA 4KZ6A 5AQ7A 2WKEA 5TBMA 3HUMA 3MFDA 2E8IA 4I3IA 5EECA 4NKPA 2XEPA 1Y28A 2Y2GA 3UY6A 1MZUA 4OPYA 1KE4A 4P85A 3KYQA 3WRTA 4DE1A 2L4RA 2VV7A 5FAOA 5GLAA 1KDSA 3MQOA 4GDNA 5HX9A 1HLUP 2EA9A 3NCKA 3TSGA 1FIKA 3C8CA 4BBUA 1CI8A 2Y2LA 2PDRA 4FTXA 4GB7A 2W1TA 4IBXA 2O0YA 2YKFA 1MPLA 2EFXA 5EVIC 3T12B 1TEMA 2FFFB 2PYPA 1RGZA 2JC7A 4EU0A 3O87A 2HF6A 5FQ9A 5CERA 3VOZA 4UA7A 4ZJ3A 2W27A 2PYRA 2Y2JA 3T4TA 5G18A 3TE8A 2I9VA 1G6OA 3LIAA 3NHQA 3IX3A 3LR0A 4ME4A 2GJ3A 1F5MA 3TG9A 2JKRI 4OOLA 3QNCA 4EUZA 4IVKA 4RA7A 1TVFA 1SDEA 3G30A 5HDSA 1WE4A 4Y17A 4QD4A 1C3BA 4S2NA 2INWA 2L1MA 5FI2A 3G4PA 5DF8A 1L0GA 1BLSA 4LLOB 1NY0A 1NLYA 2K31A 2ZLYA 3VMAA 2OWJA 1XJ3A 1ZG6A 3GTCA 3O88A 3NI9A 3FKWA 1PZOA 3NOTC 4LCMA 2PBYA 1PW1A 1CQAA 1KGEA 1AXBA 3IS2A 1S6RA 4PKYG 3MQ0A 3ZG9B 4KZ4A 4OQGA 4WBGA 2HDUA 3NBLA 4EBNA 1ES2A 3HCYA 4KZBA 3GDIA 1UWNX 3WS4A 4A5RA 3ZG7B 5HWTA 1MBLA 2WGVA 4OP5A 1PWCA 5FAQA 3WS2A 4EV4A 3HLBA 1J3WA 2OLVA 1K25A 2ZL1B 1UWPX 2M1CA 3S4XA 3V3SA 3MZFA 3OPPA 3P7NA 1EROA 1BZAA 2EXBA 3KSGA 5FEGA 1VQQA 4XT2B 2J3WA 5HW3A 2A49A 2KOIA 5TGFA 4WF0A 3GQZA 3VP2A 2ZC3B 3IXBA 2O9AA 1XJ2A 3BJNA 4HH2A 1K6RA 1XX2A 3TW8A 5CECA 2VKSA 2JKGA 3FPWA 2Y8HA 2Y2KA 5A91A 1OMEA 1W5DA 1K38A 4EBPA 3CZDA 3MR0A 1VB6A 1ESUA 1KE3A 1H3QA 2CMNA 4ETXA 4G3VA 5G4ZA 3LO7A 3C7UA 4ZAMA 2V1AA 1LSVA 4MDZA 1H5XA 3T1RA 5HAPA 3IX4A 3ZFZA 3U4LP 3VOLA 3RTYA 4H6JB 5J4EA 4NK3A 1XGIA 4MCWA 3ZVTA 3H82A 1JWVA 3ZYTA 1FR6A 4D2OA 3W4OA 5KIZA 5U47A 1S4SA 1YPRA 2WYXA 1G68A 1OTIA 4JF4A 4JGPA 2J8YA 1S66L 1LL5A 1T1CA 4HQAA 5GLBA 5J8XA 2XQZA 3CUEA 2C5WB 2OAQ1 1FQGA 3E2LA 5FQMA 1S0WA 2J9OA 3KYEA 3HREA 2JHEA 4WEKA 3T4KA 4HH3A 2ZD8A 3VOYA 3DTKA 1JWPA 1ZHHB 1DJCA 5EOEA 4EESA 4OKPA 4DE2A 3DTEA 3WS1A 2H28A 2IWBA 4GZBA 2PR6A 1D7EA 3A0SA 5HSQA 2VZWA 2WGIA 2ZQDA 5A90A 4Y5FA 3D3OA 4CLCE 4WEJA 3T4SA 2LB9A 3T1SA 2DNSA 5L09A 2ZMVA 4ID4A 3LR4A 2D01A 1XPBA 3IBJA 3P98A 3PTEA 2JKRM 1I5QA 4H8RA 3HL9A 3PAEA 1JVJA 5FSRA 1IYSA 3W2ZA 1SCWA 4KUKA 5DFYA 4DXBA 2NUPC 1HTZA 2EFUA 4HP9A 5KZHA 5HARA 3ZCZA 5FL3A 4R38A 2M7VA 4KZ7A 5E2GA 4I39A 4XT2A 1K56D 4C75A 3HLGA 3SS5A 4B88A 3BLMA 3G35A 1ZTUA 3LY4A 4MBFA 2A3UA 4U0TA 3K3CA 3OOVA 2QPNA 4KENB 3Q7VB 3ZHHA 4KG2A 2XGNA 4GJ4A 4S2JA 3VFFA 3H9WA 2HDQA 4Q0JA 5DFXA 1GSWA 5EVIB 3C7VA 3WWXA 3EEAA 3C2WA 4GLQA 1Z6FA 4IVIA 1IYPA 2VEAA 2Z6DA 1GSVA 1MWUA 3IXDA 2WUQA 4IJGA 1Q2QA 1EW0A 4DKIA 3C38A 4JKTA 3UDFA 3D9YA 1SDNA 3PBRA 3G31A 3GR2A 4P0MA 1ES5A 1XKZA 4L9EA 5CTMA 3NULA 1WYBA 5FQKA 3SS3A 3FWLA 2PT7A 3WS0A 1PW8A 1K4FA 3PHYA 4DJ2A 4E3MA 3IT9A 5F1FA 5DF9A 5AJGA 4U0XA 5HAQA 2VLGA 1V9ZA 4N1HA 3BFCA 3CJMA 3FPVA 3B42A 2LB5A 1L3LA 5CTNA 3QNBA 3DTMA 3PBQA 1OTBA 1M6KA 1ODVA 4C6YA 3DWZA 5FATA 2XSSA 1AWIA 2VGLM 1YSQA 1FCOA 3HLDA 5HAIA 1K55A 2KX6A 5EM1A 3C5AA 3EQVA 4E3IA 3G32A 1ONGA 4Y0UA 3BM6A 1P9RA 3N7WA 2QWSA 4ZBEA 5IS1A 2EX9A 4PM7A 4IUHA 4MN5A 1PWGA 3CHWP 3DW0A 5CEBA 3LIEA 3SS4A 1VEUB 2XFSA 1MWSA 4Q0HA 4DN0A 1M40A 3PYPA 4M4XA 3LGOA 1YKDA 2P7JA 4EEPA 3VE3A 4FH4A 4R4SA 3V50A 3UMEA 3KX0X 3DBAA 1F9IA 4N92A 4MNRA 3A0VA 2VV6A 1F2KA 3MZDA 4HI4A 2WK0A 3CITA 1K57C 1KDWA 1L0FA 4LRXC 1PNEA 4NETA 1PYYA 2W3HA 2X02A 4GN2A 2ZJ9A 2L0WA 2XFTA 5L07A 2ZC4B 2ZC5B 2OLUA 2PU2A 3N8SA 3Q7VA 1S1YA 1MWRA 4S2OA 3RXWA 1DY6A 1BLPA 2HGVA 3UB7A 4PHTA 3S7OA 1VETB 2OAP1 2VGLS 2Y55A 5EVIA 5TJJA 4IHQA 1H8YA 1FCNA 2J3TD 3VFHA 3S1YA 1U60A 3V3RA 3ISGA 4CPKA 4CLCC 4LV2A 2ZM8A 3G34A 1L0DA 3IWIA 1YM1A 2R9WA 4DE0A 1PFLA 1ESIA 1MKIA 3JPUA 4NXEA 4LV0A 3A0RA 3PBOA 1BULA 1N9BA 2ZM2A 4KZAA 1XJ6A 4BD1A 5CXWA 4X1LA 1DP6A 4OPZA 4HJ3A 4X1MA 4EBLA 4Y7PA 2ACGA 2JN7A 2OV5A 4ARZB 1LL9A 2HZ5A 3E0YA 4HJ6A 2V0UA 4LPZA 5IU1A 2HPBA 3MSHA 4E3NA 3G2YA 3UO9A 1H8MA 1LSWA 4R1GA 1T18A 4GCZA 3S7NA 2X71A 2Q0OA 1W79A 4GW9A 4EW7A 3OC2A 3IF6A 4YFMA 3M6BA 4UQIM 1GA0A 4UA9A 1YLWA 3UE6A 2BG1A 5M19A 4RVAA 1YAXA 2V1ZA 3OCNA 1ONHA 1D1JA 1VEUA 5FAPA 2XK1A 4R23A 4EQIA 3EOIA 1FR1A 3CAXA 3M2KA 5DF7A 2KDKA 2Y4AA 1G5UA 4ESPA 4BJPA 4PKYA 2PR5A 4PAUA 3Q1FA 2XRNA 3HLFA 4LGWA 3SZTA 4R3BA 4K0WA 4BLMA 5GHZA 1LI0A 1RCJA 3VP4A 5K5BA 5DTSA 3LR5A 4LV1A 2HP6A 1GSXA 3UB5P 2BASA 3I7JA 4PM8A 1L0EA 3PXPA 1BSGA 3IBRA 4WUJA 3CLOA 3B33A 1K54C 3FG8A 4JXWA 4HHDA 2B95A 3T4QA 1CI9A 4KQQA 4GHIA 2IWCA 2Z6CA 4U3TA 4ZRRA 4C3QA 4UEYA 3T1XA 3HUOA 4FUWA 4R70A 4UQIS 2V8CA 4QY5A 2EX6A 2JKTM 4HJ4A 3O5YA 4X55A 3ICYA 5TR7A 2PRFA 1TS0A 3CPTB 4RX3A 3BY9A 3A3EA 3N6IA 3GRJA 4LRZE 2R9XA 5M1AA 2GX5A 4E3JA 1FSYA 4JBFA 4KZ5A 1ERQA 2Y2PA 5KSHA 3IWQA 3MXSA 3VSLA 4K91A 4M3KA 4ARZA 3UMDA 3P01A 3PR6A 1VM1A 4OOYA 3T50A 2Y2NA 3LIFA 2VX8A 5EE8A 1E25A 5E2FA 4WM9A 3NDGA 3V39A 3TJZC 1E4DA 3MQQA 4BD0A 1PWDA 1L2SA 1IELA 5FI6A 2RL3A 2XR0A 4MMNA 5EFWA 5BOHA 1FILA 2QMIA 3B3XA 1IKIA 1K6SA 3NY4A 3A3IA 1T19A 5IHVA 4I3JA 4JGRA 3VV4A 4XUXA 4KZ9A 1HVBA 3NOPC 3DTIA 1YQSA 1P9WA 4S2LA 4I5SA 4BQMA 3ITAA 3FYZA 4Y2FA 3UPNA 1ZC2A 5L8MA 4OQ0A 4CQHA 2WKHA 4X68A 4QJGA 1JTDA 2AVXA 3HLCA 4GKUA 4X6TA 1S4RA 4UAAA 3VP3A 5DVAA 1SKFA 3AGEA 1SZVA 2VA0A 1MC0A 4KZ3A 5HPIA 3BYDA 2QJ5A 1XFNA 1LT0A 3DAVA 2VGKA 3L7HA 1I2SA 1TS7A 3ZVWA 1SKOB 4I38A 1MKMA 3UE0A 2W1RA 3LI8A 2UV0E 4EETB 5F69A 2WKQA 4N9LA 3LICA 2IWDA 3OCLA 2C6WB 1JTGA 2P9VB 2J80A 3KSFA 1O7EA 4JGQA 4EUVA 5CHMA 4NXBA 4ZJ2A 4L0LA 1W63Q 3CPTA 5CHUA 4XXRA 4CLCB 3UDIA 5E2HA 4ZTKA 2ZL1A 3FZCA 1Q2PA 4K0XA 4G3KA 4RQ9A 3CUEC 2A24B 1PZPA 4R4RA 1PIOA 3OPRA 3JVVA 5F5YA 1NYYA 1XXMA 3BRMA 4QHCA 3IH8A 2XROA 2H0TA 4S2MA 2V0WA 2PBDP 2WGWB 1IFQA 3HJIA 3TOIA 3ZGAB 5EOOA 3IHAA 2YKHA 3RFBA 4KZ8A 2WKPA 2H10A 4KQRA 4OP8A 2OOLA 4N9KA 4E6XA 4Y3IA 1IEMA 4OVDA 3SW1A 1YT4A 3E4OA 4NXGA 5HL6A 4DMZA 5KSCA 4MN7A 5HWVA 1K0KA 2W3DA 1QMEA 4GNUA 4AFIA 1KVMA 2GDNA 3KO6A 4H6JA 4NEED 3E98A 2XH9A 3WRZA 1CF0A 2PAVP 1V9YA 2O99A 2K7SA 3N8LA 4F3LB 3PAGA 1HD8A 4WELA 5E43A 1GHPA 5DKKA 3FC7A 3M6HA 2FFYA 2HV1A 2WZZA 1HZOA 1NJ4A 3BFEA 1CJFA 3RXXA 1DP9A 4Y15A 1W8QA 5F83A 3BQ8A 1T1AA 3Q81A 1RP5A 4BL3A 1BTLA 3CMZA 3T1QB 1EWZA 5FDHA 4P6ZM 4B9OA 4BMWA 4K08A 2P74A 2W1TB 1K57A 3CWFA 2WAFA 4P6BA 4RX2A 1SKOA 1MWTA 1ZKJA 2Y2HA 5AVFA 3BECA 1DJAA 2O9BA 1YLJA 3D4FA 5I94A 2PD8A 1D06A 2P9VA 2XDMA 4O01A 4GOGA 4Y13A 1SHVA 1LI9A 3WS5A 4DDSA 2JKTI 4FH2A 5GLDA 5DJUA 3BFFA 4CLCA 4BENA 3LIDA 3SH9A 4FOFA 3MFXA 3IQAA 5FQIA 1QMFA 3QP1A 2ZOIA 4DDYA 3BW6A 2A24A 2OSUA 5FDSA 4QY6A 1MY8A 2D02A 2Z2LB 3CI6A 3UNWA 3F1OB 2EWVA 2WGWA 1Y54A 2ZMAA 4B93A 1CEFA 3ZG8B 4MBKA 2HP5A 4E04A 3PBNA 1ZG4A 1BLHA 5CRFA 4YOFA 4WL9A 3UB9A 3C4PA 4Y0OA 2EWWA 1W63M 4P6ZS 4ETZA 2XD5A 2ZM0A 3N4IA 1VHMA 3HLWA 1KVLA 4YNRA 3LFVA 3IXGA 2ZQ8A 1TD5A 1YSPA 3LYXA 2J7VA 1OT9A 5EUAA 5KMWA 3IF5A 1NRJA 3T4OA 4HEFA 4E3LA 4QPRA 4WZ5C 4DXCA 4DJ3A 1DP8A 3UB6A 4JXGA 5EVID 1PI4A 3NIAA 4F3LA 4DE3A 4MLLA 1MXOA 2WKIA 3IHBA 5GHYA 1GHMA 3PBTA 1LLBA 4P87A 3VP1A 2HDSA 3P09A 3BQAA 5A92A 4MEZA 1XA1A 4QWOA 4F94A 5HZHA 1K4EA 4I3AA 5C5KA 2WKRA 1FCMA 4FCFA 2J3TC 3ZG0A 3K2NA 4HNBA 4E3KA 1ALQA 3E4QA 3H7WB 1NYMA 1BT5A 2ZMFA 1YLTA 1N4OA 2V20A 1NZUA 2G2UA 2ZOHA 5CGXA 3V5MA 2J9PA 4R0QA 5A8BA 3OBFA 4HOIA 4IEDA 3A3JA 2Y2OA 1UGUA 1BLCA 1O07A 4JF6A 4EEUA 1IKGA 3W8KA 2FZ0A 3E2KA 5LBRA 1GCEA 3KYZA 1K54A 1STZA 4OPRA 4GDBA 3G2ZA 4O0PA 4IUKA 1DJBA 3GV9A 3BFGA 4X56A 3CG5A 4IBRA 2WAEA 4OQIA 1NRFA 4KG5A 2XLNA 5HDCA 5I5LA 4HBUA 3H82B 2XF3A 4LV3A 3MMHA 3NOUC 4X69A 1E3UA 5EVEA 2V2FF 3HVFA 4HIAA 2B5RA 5HDDA 1TS6A 3F1OA 3ZNYA 1OPXA 1YMSA 2GNXA 1ERMA 1XP4A 2H0YA 4JXVA 4LCLA 1YLPA 3VE4A 1H8ZA 1TS8A 3EGXC 4OH0A 4GS9B 3R4KA 2V1BA 3RJUA 4WYYA 1E3UD 1OTEA 2K2NA 4PM5A 1JNUA 1VETA 5GLCA 4EERA 3A3FA 3IX8A 3UDXA 2Y2IA 4JPMA 3IF6C 1YLYA 3W4QA 2Q9MA 3QP6A 2H5SA 3EGDC 5FEFA 2WADA 5F68A 4WLAA 2R78A 1N9LA 1XFQA 4JGOA 4JLFA 2A2LA 2JE5A 1LHYA 2Y59A 4UA6A 2HP9A 3UPPA 4MN6A 4E3OA 2QZ6A 1ACFA 4KUOA 3KSHA 1Y4OA
chains in the Genus database with same CATH topology
3OCLA 1ODVA 2XSSA 2VGLM 1YSQA 1NLZA 5HPFA 2J80A 3KSFA 3C8CA 4BBUA 2W3FA 2KX6A 2PDRA 3EWKA 4JGQA 4FSFA 4EUVA 3EQVA 3MF0A 5HD3A 2PD7A 2W1TA 4NXBA 4L0LA 1W63Q 2W3EA 2O0YA 4R3AA 4CLCB 2YKFA 1P9RA 2QWSA 5IS1A 2PYPA 5J7EA 4G3KA 4IUHA 4RQ9A 4MN5A 4EU0A 1NWZA 5J3WA 3CUEC 2A24B 3H7WA 3LIEA 2HF6A 3ZQ5A 3JVVA 5F5YA 4Q0HA 4DN0A 1LL8A 1S1ZA 2QJ7A 2XROA 2W27A 3PYPA 4M4XA 2V0WA 3HJIA 2PYRA 1IFQA 3T4TA 1YKDA 3TE8A 2I9VA 1G6OA 2P7JA 4EEPA 4O8GA 3VE3A 2QKPA 3EEHA 3MJQA 3F1PB 2YKHA 3LI9A 3RFBA 2WKPA 3UMEA 3KX0X 3DBAA 3LIAA 3NHQA 1F9IA 4BBTA 2VJWA 3A0VA 3LR0A 4ME4A 2VV6A 2GJ3A 2OOLA 1F5MA 4HI4A 4Y3IA 2JKRI 4OOLA 3CITA 4LRXC 3UE3A 3SW1A 3ULFA 2IA2A 2W3HA 3E4OA 4NXGA 2L0WA 1XJ4A 3S7PA 5HL6A 4DMZA 4MN7A 5HWVA 5HDSA 1S1YA 4Q0IA 2W3DA 1T1BA 4AFIA 4L9GA 2HGVA 3KO6A 3UB7A 4H6JA 4PHTA 3U2AA 2INWA 4NEED 3S7OA 3E98A 2L1MA 2OAP1 2VGLS 1V9YA 5TJJA 4IHQA 2O99A 2K7SA 4F3LB 4LLOB 2V9AA 1NLYA 2K31A 4EXOA 2J3TD 2OWJA 1XJ3A 5F6AA 4WELA 4CLCC 5DKKA 3FC7A 4KQDA 3F1NB 3NOTC 2HV1A 1DRMA 3IS2A 4GS9A 4PKYG 3MQ0A 1DP9A 4NXEA 3A0RA 3PBOA 3PBQA 3BQ8A 3HCYA 1T1AA 1XJ6A 3GDIA 1DP6A 3RH8B 4HJ3A 1UWNX 4YWZA 1OJ5A 5HWTA 4P6ZM 4B9OA 2NUTC 4BMWA 4K08A 2JN7A 2GZAA 2W1TB 2QYBA 3CWFA 4ARZB 3D72A 3E0YA 5AVFA 4HJ6A 2V0UA 2MJ6A 4LPZA 1UWPX 2M1CA 5IU1A 3BWLA 3P7NA 1F98A 3NJAA 3KSGA 2O9BA 1H8MA 1LSWA 1OTAA 2PD8A 1T18A 4XT2B 4GCZA 3S7NA 2J3WA 1D06A 2W3GA 2KOIA 4O01A 4WF0A 3LUQA 2O9AA 4GW9A 3E4PA 4EW7A 2FH5A 3V67A 3OC2A 1XJ2A 4WN5A 1WA9A 3R7WB 3BJNA 4HH2A 4KQOA 2JKTI 1P0ZA 4NXFA 3TW8A 4UQIM 5DJUA 4CLCA 2VKSA 4BWIA 3UE6A 3LIDA 3FPWA 3S7QA 2Y8HA 3LR3A 4BBVA 4FOFA 2DMWA 3MFXA 5IT5A 1YAXA 2ZOIA 5CX7A 3BW6A 2A24A 4LRYC 5HD5A 2XA7M 3MR0A 3OCNA 1VB6A 2D02A 3CI6A 1H3QA 3T4JA 2CMNA 4ETXA 2PHYA 4G3VA 2HJEA 3EOIA 2EWVA 3F1OB 5G4ZA 2P08A 2V1AA 1LSVA 3CAXA 4MDZA 4B93A 2M7UA 2B18A 2KDKA 1BYWA 3VOLA 4E04A 3F1PA 3PBNA 3RTYA 3UB8A 4H6JB 3PBSA 5J4EA 4MCWA 3BY8A 1N9OA 3H82A 4BJPA 4YOFA 4PKYA 4WL9A 3ZYTA 5KIZA 2PR5A 4PAUA 3UB9A 2XRNA 1S4SA 2EWWA 1W63M 4P6ZS 4ETZA 1OTIA 2KLIA 4JGPA 5TBMB 1VHMA 1S66L 4YNRA 3LFVA 1T1CA 2P04A 3JVUA 4HQAA 5K5BA 3LR5A 1TD5A 2OWHA 1YSPA 3LYXA 1GSXA 3CUEA 2OAQ1 1OT9A 2BASA 1NRJA 3T4OA 2Y79A 3PXPA 1S67L 2G7UA 3IBRA 2JHEA 4WEKA 4WUJA 4QPRA 3T4KA 4HH3A 3CLOA 3B33A 3OLOA 4DJ3A 1DP8A 3FG8A 3UB6A 1ZHHB 4HHDA 3T4QA 4EESA 4GHIA 2Z6CA 4F3LA 2H28A 4ZRRA 4UEYA 2PR6A 1D7EA 3A0SA 5HSQA 2VZWA 1KOUA 2B02A 4R70A 4UQIS 3K3DA 3PBTA 4Y5FA 3MXQA 4Z1WA 3F1NA 2JKTM 2HJ9C 3D3OA 4HJ4A 3O5YA 3BQAA 1OT6A 3ICYA 1TS0A 4OOMA 3BY9A 4CLCE 5AVEA 4WEJA 2VV8A 5HZHA 3T4SA 2LB9A 4I3AA 2XA7S 5C5KA 2WKRA 1P97A 3T4LA 2ZMVA 4LRZE 2J3TC 4G3WA 3K2NA 4HNBA 3LR4A 2O9CA 2D01A 2GX5A 3E4QA 3H7WB 3IBJA 1X0OA 2JKRM 2ZMFA 5KSHA 3TRCA 2ZOHA 1OJGA 3HJKA 1LSXA 4ARZA 3W2ZA 5G4YA 4KUKA 3UMDA 5DFYA 3OBFA 5A8BA 3KSIA 3P01A 3PR6A 2NUPC 4HOIA 1UGUA 3T50A 3EQUA 1N9NA 4HP9A 5DJTA 4EEUA 5HWWA 1G28A 2FZ0A 3G6OA 5FL3A 4R38A 2M7VA 3LIFA 5LBRA 1TF1A 4I39A 5DKLA 2EA9A 2VX8A 3KYZA 4XT2A 3C30A 1STZA 3TJZC 4O0PA 4IUKA 3MQQA 1ZTUA 3R7WA 4MMNA 3K3CA 3OOVA 1OTDA 4CLCD 4R6LA 5EFWA 4L9FA 4EQ1A 5HDCA 5I5LA 3H82B 3B47A 2ZBBA 3MMHA 4GJ4A 4HP4A 1T19A 4I3JA 3H9WA 3NOUC 4Q0JA 5DFXA 4JGRA 4II7A 1GSWA 3VV4A 4HIAA 3NOPC 3EEAA 3C2WA 4GLQA 5HDDA 1TS6A 3F1OA 1OPXA 2GNXA 1P9WA 2VEAA 2Z6DA 4I5SA 1GSVA 2QHKA 4Y2FA 3VE4A 5L8MA 1TS8A 2W0NA 3EGXC 3GECA 3IS2B 4GS9B 4IJGA 4CQHA 4HY8A 3R4KA 2V1BA 1EW0A 3LIBA 2K2NA 1OTEA 1JNUA 3C38A 5MC7A 3PBRA 4EERA 4GHIB 4L9EA 1S4RA 5TBMA 4I3IA 4NKPA 3EGDC 2VA0A 1MC0A 2PT7A 5HPIA 1Y28A 5F68A 3PHYA 4DJ2A 4WLAA 2QJ5A 2R78A 1LT0A 1N9LA 1XFNA 1MZUA 1XFQA 4JGOA 1TS7A 2A2LA 5DF9A 5AJGA 4I38A 1MKMA 2VLGA 3KYQA 2W1RA 1V9ZA 4MN6A 3LI8A 2L4RA 3B42A 3FPVA 2LB5A 2VV7A 4KUOA 3KSHA 3MQOA 4EETB 5F69A 2WKQA 3LICA 1OTBA 1IOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E04 A;  2XSS A;  3G6O A;  2M7V A;  1YSQ A;  5LBR A;  1TF1 A;  5HPF A;  4MCW A;  3KSF A;  3NOT C;  2W3F A;  4YOF A;  1STZ A;  4EUV A;  4PAU A;  2XRN A;  4O0P A;  3MF0 A;  3MQ0 A;  2W1T A;  4IUK A;  4ETZ A;  1ZTU A;  2KLI A;  2W3E A;  2O0Y A;  1VHM A;  4MMN A;  4YNR A;  3LFV A;  3HCY A;  3OOV A;  4R6L A;  5K5B A;  1TD5 A;  1YSP A;  4G3K A;  5I5L A;  4IUH A;  4RQ9 A;  4EU0 A;  3MMH A;  2Y79 A;  3IBR A;  2G7U A;  4QPR A;  3ZQ5 A;  2W1T B;  4Q0H A;  3NOU C;  4DN0 A;  4Q0J A;  5DFX A;  2QYB A;  3VV4 A;  2XRO A;  3E0Y A;  1YKD A;  3NOP C;  3EEA A;  3C2W A;  4GLQ A;  4O8G A;  2VEA A;  4ZRR A;  3KSG A;  2O9B A;  3RFB A;  5HSQ A;  2VZW A;  4Y2F A;  3DBA A;  3NHQ A;  3S7N A;  5L8M A;  4R70 A;  2W3G A;  4Y5F A;  2VJW A;  4CQH A;  4IJG A;  2KOI A;  4ME4 A;  4O01 A;  4Z1W A;  3R4K A;  3D3O A;  2OOL A;  2K2N A;  1F5M A;  2O9A A;  3O5Y A;  4GW9 A;  4Y3I A;  3CIT A;  4LRX C;  3BJN A;  2IA2 A;  2LB9 A;  2W3H A;  5C5K A;  2VKS A;  4LRZ E;  4G3W A;  4BWI A;  3K2N A;  5HL6 A;  3S7P A;  4DMZ A;  3S7Q A;  4MN7 A;  2O9C A;  2Y8H A;  2GX5 A;  1MC0 A;  4FOF A;  5HPI A;  3IBJ A;  4Q0I A;  2W3D A;  2ZMF A;  2HGV A;  3KO6 A;  3TRC A;  4LRY C;  3S7O A;  3E98 A;  5AJG A;  1MKM A;  3CI6 A;  4ETX A;  2W1R A;  4G3V A;  5TJJ A;  2O99 A;  3W2Z A;  2LB5 A;  3OBF A;  5DFY A;  2K31 A;  3KSI A;  4MDZ A;  3KSH A;  2M7U A;  2B18 A; 
#chains in the Genus database with same CATH topology
 2Q9N A;  5FQJ A;  3QP5 A;  4S2P A;  1NLZ A;  3NC8 A;  3IXH A;  2EXA A;  5HPF A;  5EV0 A;  3MKF A;  4DRT A;  5EPH A;  2W3F A;  3OPL A;  3EWK A;  4FSF A;  3MF0 A;  4X53 A;  4S2N C;  5HD3 A;  2PD7 A;  4D60 A;  3Q82 A;  3ITB A;  2W3E A;  3BFD A;  4R3A A;  1NZO A;  3FKV A;  5J7E A;  4ZDX A;  2WZX A;  1NWZ A;  4FD8 A;  5J3W A;  3H7W A;  3AGF A;  3ZQ5 A;  5CGW A;  1LL8 A;  4RYE A;  1S1Z A;  2QJ7 A;  4B4X A;  4O8G A;  2QKP A;  3EEH A;  3O86 A;  3MJQ A;  3F1P B;  3LI9 A;  4BBT A;  4S2K A;  2VJW A;  4MBH A;  4JXS A;  4KG6 A;  2ZQC A;  2PU4 A;  3QP8 A;  1IYQ A;  1W8Y A;  5GL9 A;  3UE3 A;  3ULF A;  3FV7 A;  2IA2 A;  5CGS A;  4PM9 A;  5FI7 A;  4X25 A;  1XJ4 A;  2I72 A;  3UE1 A;  3S7P A;  5JYP A;  1NXY A;  3BLS A;  4Q0I A;  3UN7 A;  1T1B A;  2JKF A;  4L9G A;  3ZNT A;  3U2A A;  1GA9 A;  2BLS A;  3IWO A;  3GVB A;  2V9A A;  3C4O A;  4EXO A;  4EWF A;  4QU3 A;  3LEZ A;  1IOU A;  1KGF A;  1ES3 A;  5F6A A;  4B4Z A;  4KQD A;  3F1N B;  2X01 A;  3JYI A;  3ZDJ A;  1DRM A;  4GS9 A;  5FAS A;  4OLD A;  2Y91 A;  3MS6 A;  1TDL A;  3RH8 B;  2RCX A;  4YWZ A;  1OJ5 A;  3HLE A;  3A3D A;  5AQ9 A;  2NUT C;  3SH7 A;  2EX8 A;  2GZA A;  2QYB A;  3D72 A;  1A0K A;  1Z09 A;  2MJ6 A;  2DCF A;  3BWL A;  4HBT A;  2ZQA A;  1F98 A;  3NJA A;  3MXR A;  2Y2M A;  4OPQ A;  4PPR A;  5TFQ A;  3UPO A;  1OTA A;  2ZC6 B;  2XD1 A;  4Y0T A;  2W3G A;  1K56 A;  1WYC A;  1EI5 A;  1IYO A;  2V8F A;  1FSW A;  3LUQ A;  3ZG5 A;  5FQQ A;  3E4P A;  3NDE A;  3QHY A;  2FH5 A;  3V67 A;  4WN5 A;  1GHI A;  1WA9 A;  5L10 A;  3R7W B;  3HUN A;  4KQO A;  1P0Z A;  4NXF A;  3OPH A;  4WMC A;  5F1G A;  4BWI A;  3S7Q A;  4BBV A;  3LR3 A;  3N8R A;  2DMW A;  5JYO A;  4GD8 A;  4PMA A;  5IT5 A;  4LEN A;  1JWZ A;  4DF6 A;  3GMW A;  5CX7 A;  2G2W A;  4LRY C;  5HD5 A;  2XA7 M;  1PRQ A;  5EM0 A;  4QB8 A;  3T4J A;  3IH9 A;  4S2I A;  2PHY A;  2HJE A;  1XGJ A;  2P08 A;  5L2F A;  3O3V A;  2M7U A;  2B18 A;  4WMC D;  4JF5 A;  1BYW A;  2EX2 A;  2VGJ A;  3DWK A;  3F1P A;  3UB8 A;  3PBS A;  5HFO A;  5A93 A;  1RGY A;  3BY8 A;  1N9O A;  3AGD A;  1FOF A;  4UHU A;  3Q07 A;  1YMX A;  3S22 A;  2KLI A;  5TBM B;  4E6W A;  1BUE A;  1W7F A;  1CK3 A;  2JCH A;  2P04 A;  3JVU A;  1G6A A;  4OLG A;  2OWH A;  3LEQ A;  2Y79 A;  1S67 L;  2G7U A;  1TDG A;  4YIN A;  1XA7 A;  3MKE A;  3OLO A;  2DRW A;  1ES4 A;  5AQB A;  1KE0 A;  2BTF P;  2UWX A;  3OZH A;  3MZE A;  1KOU A;  4GD6 A;  2B02 A;  3K3D A;  2Y2Q A;  3VP0 A;  3MXQ A;  4Z1W A;  3F1N A;  2HJ9 C;  3VSK A;  3L9K A;  2HDR A;  1OT6 A;  3GSG A;  4OOM A;  2Z2M B;  5AVE A;  3HBR A;  2VV8 A;  3BEB A;  5F82 A;  1J9M A;  5HL1 A;  2XA7 S;  4N1X A;  1P97 A;  3T4L A;  4G3W A;  4ZJ1 A;  5EVL A;  1YLZ A;  2O9C A;  5FA7 A;  1PI5 A;  5E2E A;  5DTK A;  1X0O A;  5D3O A;  4WZ4 A;  3SH8 A;  3TRC A;  1KGG A;  1OJG A;  3IF6 B;  3SOI A;  3HJK A;  4CJN A;  1LSX A;  4LFU A;  5CHJ A;  3M2J A;  5G4Y A;  2E8J A;  1I2W A;  5GHX A;  3KSI A;  2ZC7 A;  3EQU A;  1N9N A;  5DJT A;  4XUZ A;  5AQA A;  5HWW A;  1G28 A;  3G6O A;  3NEC A;  1TF1 A;  3QP2 A;  5DKL A;  4WZ5 A;  3C30 A;  4R3J A;  4O7D A;  1CEG A;  3LY3 A;  3R7W A;  1OTD A;  4Q8I A;  2VK3 A;  4CLC D;  4R6L A;  4L9F A;  4EQ1 A;  5CED A;  3B47 A;  2ZBB A;  3QP4 A;  4HP4 A;  5DTT A;  3LCE A;  5M18 A;  3W4P A;  2CC1 A;  1K55 C;  4II7 A;  2JBF A;  4BL2 A;  3MBZ A;  4OON A;  4Z9Q A;  2QHK A;  4HES A;  4NG2 A;  2W0N A;  2ZQ9 A;  3GEC A;  3IS2 B;  4HY8 A;  2ZQ7 A;  3LIB A;  1H0M A;  5MC7 A;  3Q7Z A;  4PM6 A;  4GHI B;  4OQH A;  4KZ6 A;  5AQ7 A;  2WKE A;  5TBM A;  3HUM A;  3MFD A;  2E8I A;  4I3I A;  5EEC A;  4NKP A;  2XEP A;  1Y28 A;  2Y2G A;  3UY6 A;  1MZU A;  4OPY A;  1KE4 A;  4P85 A;  3KYQ A;  3WRT A;  4DE1 A;  2L4R A;  2VV7 A;  5FAO A;  5GLA A;  1KDS A;  3MQO A;  4GDN A;  5HX9 A;  1HLU P;  2EA9 A;  3NCK A;  3TSG A;  1FIK A;  3C8C A;  4BBU A;  1CI8 A;  2Y2L A;  2PDR A;  4FTX A;  4GB7 A;  2W1T A;  4IBX A;  2O0Y A;  2YKF A;  1MPL A;  2EFX A;  5EVI C;  3T12 B;  1TEM A;  2FFF B;  2PYP A;  1RGZ A;  2JC7 A;  4EU0 A;  3O87 A;  2HF6 A;  5FQ9 A;  5CER A;  3VOZ A;  4UA7 A;  4ZJ3 A;  2W27 A;  2PYR A;  2Y2J A;  3T4T A;  5G18 A;  3TE8 A;  2I9V A;  1G6O A;  3LIA A;  3NHQ A;  3IX3 A;  3LR0 A;  4ME4 A;  2GJ3 A;  1F5M A;  3TG9 A;  2JKR I;  4OOL A;  3QNC A;  4EUZ A;  4IVK A;  4RA7 A;  1TVF A;  1SDE A;  3G30 A;  5HDS A;  1WE4 A;  4Y17 A;  4QD4 A;  1C3B A;  4S2N A;  2INW A;  2L1M A;  5FI2 A;  3G4P A;  5DF8 A;  1L0G A;  1BLS A;  4LLO B;  1NY0 A;  1NLY A;  2K31 A;  2ZLY A;  3VMA A;  2OWJ A;  1XJ3 A;  1ZG6 A;  3GTC A;  3O88 A;  3NI9 A;  3FKW A;  1PZO A;  3NOT C;  4LCM A;  2PBY A;  1PW1 A;  1CQA A;  1KGE A;  1AXB A;  3IS2 A;  1S6R A;  4PKY G;  3MQ0 A;  3ZG9 B;  4KZ4 A;  4OQG A;  4WBG A;  2HDU A;  3NBL A;  4EBN A;  1ES2 A;  3HCY A;  4KZB A;  3GDI A;  1UWN X;  3WS4 A;  4A5R A;  3ZG7 B;  5HWT A;  1MBL A;  2WGV A;  4OP5 A;  1PWC A;  5FAQ A;  3WS2 A;  4EV4 A;  3HLB A;  1J3W A;  2OLV A;  1K25 A;  2ZL1 B;  1UWP X;  2M1C A;  3S4X A;  3V3S A;  3MZF A;  3OPP A;  3P7N A;  1ERO A;  1BZA A;  2EXB A;  3KSG A;  5FEG A;  1VQQ A;  4XT2 B;  2J3W A;  5HW3 A;  2A49 A;  2KOI A;  5TGF A;  4WF0 A;  3GQZ A;  3VP2 A;  2ZC3 B;  3IXB A;  2O9A A;  1XJ2 A;  3BJN A;  4HH2 A;  1K6R A;  1XX2 A;  3TW8 A;  5CEC A;  2VKS A;  2JKG A;  3FPW A;  2Y8H A;  2Y2K A;  5A91 A;  1OME A;  1W5D A;  1K38 A;  4EBP A;  3CZD A;  3MR0 A;  1VB6 A;  1ESU A;  1KE3 A;  1H3Q A;  2CMN A;  4ETX A;  4G3V A;  5G4Z A;  3LO7 A;  3C7U A;  4ZAM A;  2V1A A;  1LSV A;  4MDZ A;  1H5X A;  3T1R A;  5HAP A;  3IX4 A;  3ZFZ A;  3U4L P;  3VOL A;  3RTY A;  4H6J B;  5J4E A;  4NK3 A;  1XGI A;  4MCW A;  3ZVT A;  3H82 A;  1JWV A;  3ZYT A;  1FR6 A;  4D2O A;  3W4O A;  5KIZ A;  5U47 A;  1S4S A;  1YPR A;  2WYX A;  1G68 A;  1OTI A;  4JF4 A;  4JGP A;  2J8Y A;  1S66 L;  1LL5 A;  1T1C A;  4HQA A;  5GLB A;  5J8X A;  2XQZ A;  3CUE A;  2C5W B;  2OAQ 1;  1FQG A;  3E2L A;  5FQM A;  1S0W A;  2J9O A;  3KYE A;  3HRE A;  2JHE A;  4WEK A;  3T4K A;  4HH3 A;  2ZD8 A;  3VOY A;  3DTK A;  1JWP A;  1ZHH B;  1DJC A;  5EOE A;  4EES A;  4OKP A;  4DE2 A;  3DTE A;  3WS1 A;  2H28 A;  2IWB A;  4GZB A;  2PR6 A;  1D7E A;  3A0S A;  5HSQ A;  2VZW A;  2WGI A;  2ZQD A;  5A90 A;  4Y5F A;  3D3O A;  4CLC E;  4WEJ A;  3T4S A;  2LB9 A;  3T1S A;  2DNS A;  5L09 A;  2ZMV A;  4ID4 A;  3LR4 A;  2D01 A;  1XPB A;  3IBJ A;  3P98 A;  3PTE A;  2JKR M;  1I5Q A;  4H8R A;  3HL9 A;  3PAE A;  1JVJ A;  5FSR A;  1IYS A;  3W2Z A;  1SCW A;  4KUK A;  5DFY A;  4DXB A;  2NUP C;  1HTZ A;  2EFU A;  4HP9 A;  5KZH A;  5HAR A;  3ZCZ A;  5FL3 A;  4R38 A;  2M7V A;  4KZ7 A;  5E2G A;  4I39 A;  4XT2 A;  1K56 D;  4C75 A;  3HLG A;  3SS5 A;  4B88 A;  3BLM A;  3G35 A;  1ZTU A;  3LY4 A;  4MBF A;  2A3U A;  4U0T A;  3K3C A;  3OOV A;  2QPN A;  4KEN B;  3Q7V B;  3ZHH A;  4KG2 A;  2XGN A;  4GJ4 A;  4S2J A;  3VFF A;  3H9W A;  2HDQ A;  4Q0J A;  5DFX A;  1GSW A;  5EVI B;  3C7V A;  3WWX A;  3EEA A;  3C2W A;  4GLQ A;  1Z6F A;  4IVI A;  1IYP A;  2VEA A;  2Z6D A;  1GSV A;  1MWU A;  3IXD A;  2WUQ A;  4IJG A;  1Q2Q A;  1EW0 A;  4DKI A;  3C38 A;  4JKT A;  3UDF A;  3D9Y A;  1SDN A;  3PBR A;  3G31 A;  3GR2 A;  4P0M A;  1ES5 A;  1XKZ A;  4L9E A;  5CTM A;  3NUL A;  1WYB A;  5FQK A;  3SS3 A;  3FWL A;  2PT7 A;  3WS0 A;  1PW8 A;  1K4F A;  3PHY A;  4DJ2 A;  4E3M A;  3IT9 A;  5F1F A;  5DF9 A;  5AJG A;  4U0X A;  5HAQ A;  2VLG A;  1V9Z A;  4N1H A;  3BFC A;  3CJM A;  3FPV A;  3B42 A;  2LB5 A;  1L3L A;  5CTN A;  3QNB A;  3DTM A;  3PBQ A;  1OTB A;  1M6K A;  1ODV A;  4C6Y A;  3DWZ A;  5FAT A;  2XSS A;  1AWI A;  2VGL M;  1YSQ A;  1FCO A;  3HLD A;  5HAI A;  1K55 A;  2KX6 A;  5EM1 A;  3C5A A;  3EQV A;  4E3I A;  3G32 A;  1ONG A;  4Y0U A;  3BM6 A;  1P9R A;  3N7W A;  2QWS A;  4ZBE A;  5IS1 A;  2EX9 A;  4PM7 A;  4IUH A;  4MN5 A;  1PWG A;  3CHW P;  3DW0 A;  5CEB A;  3LIE A;  3SS4 A;  1VEU B;  2XFS A;  1MWS A;  4Q0H A;  4DN0 A;  1M40 A;  3PYP A;  4M4X A;  3LGO A;  1YKD A;  2P7J A;  4EEP A;  3VE3 A;  4FH4 A;  4R4S A;  3V50 A;  3UME A;  3KX0 X;  3DBA A;  1F9I A;  4N92 A;  4MNR A;  3A0V A;  2VV6 A;  1F2K A;  3MZD A;  4HI4 A;  2WK0 A;  3CIT A;  1K57 C;  1KDW A;  1L0F A;  4LRX C;  1PNE A;  4NET A;  1PYY A;  2W3H A;  2X02 A;  4GN2 A;  2ZJ9 A;  2L0W A;  2XFT A;  5L07 A;  2ZC4 B;  2ZC5 B;  2OLU A;  2PU2 A;  3N8S A;  3Q7V A;  1S1Y A;  1MWR A;  4S2O A;  3RXW A;  1DY6 A;  1BLP A;  2HGV A;  3UB7 A;  4PHT A;  3S7O A;  1VET B;  2OAP 1;  2VGL S;  2Y55 A;  5EVI A;  5TJJ A;  4IHQ A;  1H8Y A;  1FCN A;  2J3T D;  3VFH A;  3S1Y A;  1U60 A;  3V3R A;  3ISG A;  4CPK A;  4CLC C;  4LV2 A;  2ZM8 A;  3G34 A;  1L0D A;  3IWI A;  1YM1 A;  2R9W A;  4DE0 A;  1PFL A;  1ESI A;  1MKI A;  3JPU A;  4NXE A;  4LV0 A;  3A0R A;  3PBO A;  1BUL A;  1N9B A;  2ZM2 A;  4KZA A;  1XJ6 A;  4BD1 A;  5CXW A;  4X1L A;  1DP6 A;  4OPZ A;  4HJ3 A;  4X1M A;  4EBL A;  4Y7P A;  2ACG A;  2JN7 A;  2OV5 A;  4ARZ B;  1LL9 A;  2HZ5 A;  3E0Y A;  4HJ6 A;  2V0U A;  4LPZ A;  5IU1 A;  2HPB A;  3MSH A;  4E3N A;  3G2Y A;  3UO9 A;  1H8M A;  1LSW A;  4R1G A;  1T18 A;  4GCZ A;  3S7N A;  2X71 A;  2Q0O A;  1W79 A;  4GW9 A;  4EW7 A;  3OC2 A;  3IF6 A;  4YFM A;  3M6B A;  4UQI M;  1GA0 A;  4UA9 A;  1YLW A;  3UE6 A;  2BG1 A;  5M19 A;  4RVA A;  1YAX A;  2V1Z A;  3OCN A;  1ONH A;  1D1J A;  1VEU A;  5FAP A;  2XK1 A;  4R23 A;  4EQI A;  3EOI A;  1FR1 A;  3CAX A;  3M2K A;  5DF7 A;  2KDK A;  2Y4A A;  1G5U A;  4ESP A;  4BJP A;  4PKY A;  2PR5 A;  4PAU A;  3Q1F A;  2XRN A;  3HLF A;  4LGW A;  3SZT A;  4R3B A;  4K0W A;  4BLM A;  5GHZ A;  1LI0 A;  1RCJ A;  3VP4 A;  5K5B A;  5DTS A;  3LR5 A;  4LV1 A;  2HP6 A;  1GSX A;  3UB5 P;  2BAS A;  3I7J A;  4PM8 A;  1L0E A;  3PXP A;  1BSG A;  3IBR A;  4WUJ A;  3CLO A;  3B33 A;  1K54 C;  3FG8 A;  4JXW A;  4HHD A;  2B95 A;  3T4Q A;  1CI9 A;  4KQQ A;  4GHI A;  2IWC A;  2Z6C A;  4U3T A;  4ZRR A;  4C3Q A;  4UEY A;  3T1X A;  3HUO A;  4FUW A;  4R70 A;  4UQI S;  2V8C A;  4QY5 A;  2EX6 A;  2JKT M;  4HJ4 A;  3O5Y A;  4X55 A;  3ICY A;  5TR7 A;  2PRF A;  1TS0 A;  3CPT B;  4RX3 A;  3BY9 A;  3A3E A;  3N6I A;  3GRJ A;  4LRZ E;  2R9X A;  5M1A A;  2GX5 A;  4E3J A;  1FSY A;  4JBF A;  4KZ5 A;  1ERQ A;  2Y2P A;  5KSH A;  3IWQ A;  3MXS A;  3VSL A;  4K91 A;  4M3K A;  4ARZ A;  3UMD A;  3P01 A;  3PR6 A;  1VM1 A;  4OOY A;  3T50 A;  2Y2N A;  3LIF A;  2VX8 A;  5EE8 A;  1E25 A;  5E2F A;  4WM9 A;  3NDG A;  3V39 A;  3TJZ C;  1E4D A;  3MQQ A;  4BD0 A;  1PWD A;  1L2S A;  1IEL A;  5FI6 A;  2RL3 A;  2XR0 A;  4MMN A;  5EFW A;  5BOH A;  1FIL A;  2QMI A;  3B3X A;  1IKI A;  1K6S A;  3NY4 A;  3A3I A;  1T19 A;  5IHV A;  4I3J A;  4JGR A;  3VV4 A;  4XUX A;  4KZ9 A;  1HVB A;  3NOP C;  3DTI A;  1YQS A;  1P9W A;  4S2L A;  4I5S A;  4BQM A;  3ITA A;  3FYZ A;  4Y2F A;  3UPN A;  1ZC2 A;  5L8M A;  4OQ0 A;  4CQH A;  2WKH A;  4X68 A;  4QJG A;  1JTD A;  2AVX A;  3HLC A;  4GKU A;  4X6T A;  1S4R A;  4UAA A;  3VP3 A;  5DVA A;  1SKF A;  3AGE A;  1SZV A;  2VA0 A;  1MC0 A;  4KZ3 A;  5HPI A;  3BYD A;  2QJ5 A;  1XFN A;  1LT0 A;  3DAV A;  2VGK A;  3L7H A;  1I2S A;  1TS7 A;  3ZVW A;  1SKO B;  4I38 A;  1MKM A;  3UE0 A;  2W1R A;  3LI8 A;  2UV0 E;  4EET B;  5F69 A;  2WKQ A;  4N9L A;  3LIC A;  2IWD A;  3OCL A;  2C6W B;  1JTG A;  2P9V B;  2J80 A;  3KSF A;  1O7E A;  4JGQ A;  4EUV A;  5CHM A;  4NXB A;  4ZJ2 A;  4L0L A;  1W63 Q;  3CPT A;  5CHU A;  4XXR A;  4CLC B;  3UDI A;  5E2H A;  4ZTK A;  2ZL1 A;  3FZC A;  1Q2P A;  4K0X A;  4G3K A;  4RQ9 A;  3CUE C;  2A24 B;  1PZP A;  4R4R A;  1PIO A;  3OPR A;  3JVV A;  5F5Y A;  1NYY A;  1XXM A;  3BRM A;  4QHC A;  3IH8 A;  2XRO A;  2H0T A;  4S2M A;  2V0W A;  2PBD P;  2WGW B;  1IFQ A;  3HJI A;  3TOI A;  3ZGA B;  5EOO A;  3IHA A;  2YKH A;  3RFB A;  4KZ8 A;  2WKP A;  2H10 A;  4KQR A;  4OP8 A;  2OOL A;  4N9K A;  4E6X A;  4Y3I A;  1IEM A;  4OVD A;  3SW1 A;  1YT4 A;  3E4O A;  4NXG A;  5HL6 A;  4DMZ A;  5KSC A;  4MN7 A;  5HWV A;  1K0K A;  2W3D A;  1QME A;  4GNU A;  4AFI A;  1KVM A;  2GDN A;  3KO6 A;  4H6J A;  4NEE D;  3E98 A;  2XH9 A;  3WRZ A;  1CF0 A;  2PAV P;  1V9Y A;  2O99 A;  2K7S A;  3N8L A;  4F3L B;  3PAG A;  1HD8 A;  4WEL A;  5E43 A;  1GHP A;  5DKK A;  3FC7 A;  3M6H A;  2FFY A;  2HV1 A;  2WZZ A;  1HZO A;  1NJ4 A;  3BFE A;  1CJF A;  3RXX A;  1DP9 A;  4Y15 A;  1W8Q A;  5F83 A;  3BQ8 A;  1T1A A;  3Q81 A;  1RP5 A;  4BL3 A;  1BTL A;  3CMZ A;  3T1Q B;  1EWZ A;  5FDH A;  4P6Z M;  4B9O A;  4BMW A;  4K08 A;  2P74 A;  2W1T B;  1K57 A;  3CWF A;  2WAF A;  4P6B A;  4RX2 A;  1SKO A;  1MWT A;  1ZKJ A;  2Y2H A;  5AVF A;  3BEC A;  1DJA A;  2O9B A;  1YLJ A;  3D4F A;  5I94 A;  2PD8 A;  1D06 A;  2P9V A;  2XDM A;  4O01 A;  4GOG A;  4Y13 A;  1SHV A;  1LI9 A;  3WS5 A;  4DDS A;  2JKT I;  4FH2 A;  5GLD A;  5DJU A;  3BFF A;  4CLC A;  4BEN A;  3LID A;  3SH9 A;  4FOF A;  3MFX A;  3IQA A;  5FQI A;  1QMF A;  3QP1 A;  2ZOI A;  4DDY A;  3BW6 A;  2A24 A;  2OSU A;  5FDS A;  4QY6 A;  1MY8 A;  2D02 A;  2Z2L B;  3CI6 A;  3UNW A;  3F1O B;  2EWV A;  2WGW A;  1Y54 A;  2ZMA A;  4B93 A;  1CEF A;  3ZG8 B;  4MBK A;  2HP5 A;  4E04 A;  3PBN A;  1ZG4 A;  1BLH A;  5CRF A;  4YOF A;  4WL9 A;  3UB9 A;  3C4P A;  4Y0O A;  2EWW A;  1W63 M;  4P6Z S;  4ETZ A;  2XD5 A;  2ZM0 A;  3N4I A;  1VHM A;  3HLW A;  1KVL A;  4YNR A;  3LFV A;  3IXG A;  2ZQ8 A;  1TD5 A;  1YSP A;  3LYX A;  2J7V A;  1OT9 A;  5EUA A;  5KMW A;  3IF5 A;  1NRJ A;  3T4O A;  4HEF A;  4E3L A;  4QPR A;  4WZ5 C;  4DXC A;  4DJ3 A;  1DP8 A;  3UB6 A;  4JXG A;  5EVI D;  1PI4 A;  3NIA A;  4F3L A;  4DE3 A;  4MLL A;  1MXO A;  2WKI A;  3IHB A;  5GHY A;  1GHM A;  3PBT A;  1LLB A;  4P87 A;  3VP1 A;  2HDS A;  3P09 A;  3BQA A;  5A92 A;  4MEZ A;  1XA1 A;  4QWO A;  4F94 A;  5HZH A;  1K4E A;  4I3A A;  5C5K A;  2WKR A;  1FCM A;  4FCF A;  2J3T C;  3ZG0 A;  3K2N A;  4HNB A;  4E3K A;  1ALQ A;  3E4Q A;  3H7W B;  1NYM A;  1BT5 A;  2ZMF A;  1YLT A;  1N4O A;  2V20 A;  1NZU A;  2G2U A;  2ZOH A;  5CGX A;  3V5M A;  2J9P A;  4R0Q A;  5A8B A;  3OBF A;  4HOI A;  4IED A;  3A3J A;  2Y2O A;  1UGU A;  1BLC A;  1O07 A;  4JF6 A;  4EEU A;  1IKG A;  3W8K A;  2FZ0 A;  3E2K A;  5LBR A;  1GCE A;  3KYZ A;  1K54 A;  1STZ A;  4OPR A;  4GDB A;  3G2Z A;  4O0P A;  4IUK A;  1DJB A;  3GV9 A;  3BFG A;  4X56 A;  3CG5 A;  4IBR A;  2WAE A;  4OQI A;  1NRF A;  4KG5 A;  2XLN A;  5HDC A;  5I5L A;  4HBU A;  3H82 B;  2XF3 A;  4LV3 A;  3MMH A;  3NOU C;  4X69 A;  1E3U A;  5EVE A;  2V2F F;  3HVF A;  4HIA A;  2B5R A;  5HDD A;  1TS6 A;  3F1O A;  3ZNY A;  1OPX A;  1YMS A;  2GNX A;  1ERM A;  1XP4 A;  2H0Y A;  4JXV A;  4LCL A;  1YLP A;  3VE4 A;  1H8Z A;  1TS8 A;  3EGX C;  4OH0 A;  4GS9 B;  3R4K A;  2V1B A;  3RJU A;  4WYY A;  1E3U D;  1OTE A;  2K2N A;  4PM5 A;  1JNU A;  1VET A;  5GLC A;  4EER A;  3A3F A;  3IX8 A;  3UDX A;  2Y2I A;  4JPM A;  3IF6 C;  1YLY A;  3W4Q A;  2Q9M A;  3QP6 A;  2H5S A;  3EGD C;  5FEF A;  2WAD A;  5F68 A;  4WLA A;  2R78 A;  1N9L A;  1XFQ A;  4JGO A;  4JLF A;  2A2L A;  2JE5 A;  1LHY A;  2Y59 A;  4UA6 A;  2HP9 A;  3UPP A;  4MN6 A;  4E3O A;  2QZ6 A;  1ACF A;  4KUO A;  3KSH A;  1Y4O A; 
#chains in the Genus database with same CATH homology
 3OCL A;  1ODV A;  2XSS A;  2VGL M;  1YSQ A;  1NLZ A;  5HPF A;  2J80 A;  3KSF A;  3C8C A;  4BBU A;  2W3F A;  2KX6 A;  2PDR A;  3EWK A;  4JGQ A;  4FSF A;  4EUV A;  3EQV A;  3MF0 A;  5HD3 A;  2PD7 A;  2W1T A;  4NXB A;  4L0L A;  1W63 Q;  2W3E A;  2O0Y A;  4R3A A;  4CLC B;  2YKF A;  1P9R A;  2QWS A;  5IS1 A;  2PYP A;  5J7E A;  4G3K A;  4IUH A;  4RQ9 A;  4MN5 A;  4EU0 A;  1NWZ A;  5J3W A;  3CUE C;  2A24 B;  3H7W A;  3LIE A;  2HF6 A;  3ZQ5 A;  3JVV A;  5F5Y A;  4Q0H A;  4DN0 A;  1LL8 A;  1S1Z A;  2QJ7 A;  2XRO A;  2W27 A;  3PYP A;  4M4X A;  2V0W A;  3HJI A;  2PYR A;  1IFQ A;  3T4T A;  1YKD A;  3TE8 A;  2I9V A;  1G6O A;  2P7J A;  4EEP A;  4O8G A;  3VE3 A;  2QKP A;  3EEH A;  3MJQ A;  3F1P B;  2YKH A;  3LI9 A;  3RFB A;  2WKP A;  3UME A;  3KX0 X;  3DBA A;  3LIA A;  3NHQ A;  1F9I A;  4BBT A;  2VJW A;  3A0V A;  3LR0 A;  4ME4 A;  2VV6 A;  2GJ3 A;  2OOL A;  1F5M A;  4HI4 A;  4Y3I A;  2JKR I;  4OOL A;  3CIT A;  4LRX C;  3UE3 A;  3SW1 A;  3ULF A;  2IA2 A;  2W3H A;  3E4O A;  4NXG A;  2L0W A;  1XJ4 A;  3S7P A;  5HL6 A;  4DMZ A;  4MN7 A;  5HWV A;  5HDS A;  1S1Y A;  4Q0I A;  2W3D A;  1T1B A;  4AFI A;  4L9G A;  2HGV A;  3KO6 A;  3UB7 A;  4H6J A;  4PHT A;  3U2A A;  2INW A;  4NEE D;  3S7O A;  3E98 A;  2L1M A;  2OAP 1;  2VGL S;  1V9Y A;  5TJJ A;  4IHQ A;  2O99 A;  2K7S A;  4F3L B;  4LLO B;  2V9A A;  1NLY A;  2K31 A;  4EXO A;  2J3T D;  2OWJ A;  1XJ3 A;  5F6A A;  4WEL A;  4CLC C;  5DKK A;  3FC7 A;  4KQD A;  3F1N B;  3NOT C;  2HV1 A;  1DRM A;  3IS2 A;  4GS9 A;  4PKY G;  3MQ0 A;  1DP9 A;  4NXE A;  3A0R A;  3PBO A;  3PBQ A;  3BQ8 A;  3HCY A;  1T1A A;  1XJ6 A;  3GDI A;  1DP6 A;  3RH8 B;  4HJ3 A;  1UWN X;  4YWZ A;  1OJ5 A;  5HWT A;  4P6Z M;  4B9O A;  2NUT C;  4BMW A;  4K08 A;  2JN7 A;  2GZA A;  2W1T B;  2QYB A;  3CWF A;  4ARZ B;  3D72 A;  3E0Y A;  5AVF A;  4HJ6 A;  2V0U A;  2MJ6 A;  4LPZ A;  1UWP X;  2M1C A;  5IU1 A;  3BWL A;  3P7N A;  1F98 A;  3NJA A;  3KSG A;  2O9B A;  1H8M A;  1LSW A;  1OTA A;  2PD8 A;  1T18 A;  4XT2 B;  4GCZ A;  3S7N A;  2J3W A;  1D06 A;  2W3G A;  2KOI A;  4O01 A;  4WF0 A;  3LUQ A;  2O9A A;  4GW9 A;  3E4P A;  4EW7 A;  2FH5 A;  3V67 A;  3OC2 A;  1XJ2 A;  4WN5 A;  1WA9 A;  3R7W B;  3BJN A;  4HH2 A;  4KQO A;  2JKT I;  1P0Z A;  4NXF A;  3TW8 A;  4UQI M;  5DJU A;  4CLC A;  2VKS A;  4BWI A;  3UE6 A;  3LID A;  3FPW A;  3S7Q A;  2Y8H A;  3LR3 A;  4BBV A;  4FOF A;  2DMW A;  3MFX A;  5IT5 A;  1YAX A;  2ZOI A;  5CX7 A;  3BW6 A;  2A24 A;  4LRY C;  5HD5 A;  2XA7 M;  3MR0 A;  3OCN A;  1VB6 A;  2D02 A;  3CI6 A;  1H3Q A;  3T4J A;  2CMN A;  4ETX A;  2PHY A;  4G3V A;  2HJE A;  3EOI A;  2EWV A;  3F1O B;  5G4Z A;  2P08 A;  2V1A A;  1LSV A;  3CAX A;  4MDZ A;  4B93 A;  2M7U A;  2B18 A;  2KDK A;  1BYW A;  3VOL A;  4E04 A;  3F1P A;  3PBN A;  3RTY A;  3UB8 A;  4H6J B;  3PBS A;  5J4E A;  4MCW A;  3BY8 A;  1N9O A;  3H82 A;  4BJP A;  4YOF A;  4PKY A;  4WL9 A;  3ZYT A;  5KIZ A;  2PR5 A;  4PAU A;  3UB9 A;  2XRN A;  1S4S A;  2EWW A;  1W63 M;  4P6Z S;  4ETZ A;  1OTI A;  2KLI A;  4JGP A;  5TBM B;  1VHM A;  1S66 L;  4YNR A;  3LFV A;  1T1C A;  2P04 A;  3JVU A;  4HQA A;  5K5B A;  3LR5 A;  1TD5 A;  2OWH A;  1YSP A;  3LYX A;  1GSX A;  3CUE A;  2OAQ 1;  1OT9 A;  2BAS A;  1NRJ A;  3T4O A;  2Y79 A;  3PXP A;  1S67 L;  2G7U A;  3IBR A;  2JHE A;  4WEK A;  4WUJ A;  4QPR A;  3T4K A;  4HH3 A;  3CLO A;  3B33 A;  3OLO A;  4DJ3 A;  1DP8 A;  3FG8 A;  3UB6 A;  1ZHH B;  4HHD A;  3T4Q A;  4EES A;  4GHI A;  2Z6C A;  4F3L A;  2H28 A;  4ZRR A;  4UEY A;  2PR6 A;  1D7E A;  3A0S A;  5HSQ A;  2VZW A;  1KOU A;  2B02 A;  4R70 A;  4UQI S;  3K3D A;  3PBT A;  4Y5F A;  3MXQ A;  4Z1W A;  3F1N A;  2JKT M;  2HJ9 C;  3D3O A;  4HJ4 A;  3O5Y A;  3BQA A;  1OT6 A;  3ICY A;  1TS0 A;  4OOM A;  3BY9 A;  4CLC E;  5AVE A;  4WEJ A;  2VV8 A;  5HZH A;  3T4S A;  2LB9 A;  4I3A A;  2XA7 S;  5C5K A;  2WKR A;  1P97 A;  3T4L A;  2ZMV A;  4LRZ E;  2J3T C;  4G3W A;  3K2N A;  4HNB A;  3LR4 A;  2O9C A;  2D01 A;  2GX5 A;  3E4Q A;  3H7W B;  3IBJ A;  1X0O A;  2JKR M;  2ZMF A;  5KSH A;  3TRC A;  2ZOH A;  1OJG A;  3HJK A;  1LSX A;  4ARZ A;  3W2Z A;  5G4Y A;  4KUK A;  3UMD A;  5DFY A;  3OBF A;  5A8B A;  3KSI A;  3P01 A;  3PR6 A;  2NUP C;  4HOI A;  1UGU A;  3T50 A;  3EQU A;  1N9N A;  4HP9 A;  5DJT A;  4EEU A;  5HWW A;  1G28 A;  2FZ0 A;  3G6O A;  5FL3 A;  4R38 A;  2M7V A;  3LIF A;  5LBR A;  1TF1 A;  4I39 A;  5DKL A;  2EA9 A;  2VX8 A;  3KYZ A;  4XT2 A;  3C30 A;  1STZ A;  3TJZ C;  4O0P A;  4IUK A;  3MQQ A;  1ZTU A;  3R7W A;  4MMN A;  3K3C A;  3OOV A;  1OTD A;  4CLC D;  4R6L A;  5EFW A;  4L9F A;  4EQ1 A;  5HDC A;  5I5L A;  3H82 B;  3B47 A;  2ZBB A;  3MMH A;  4GJ4 A;  4HP4 A;  1T19 A;  4I3J A;  3H9W A;  3NOU C;  4Q0J A;  5DFX A;  4JGR A;  4II7 A;  1GSW A;  3VV4 A;  4HIA A;  3NOP C;  3EEA A;  3C2W A;  4GLQ A;  5HDD A;  1TS6 A;  3F1O A;  1OPX A;  2GNX A;  1P9W A;  2VEA A;  2Z6D A;  4I5S A;  1GSV A;  2QHK A;  4Y2F A;  3VE4 A;  5L8M A;  1TS8 A;  2W0N A;  3EGX C;  3GEC A;  3IS2 B;  4GS9 B;  4IJG A;  4CQH A;  4HY8 A;  3R4K A;  2V1B A;  1EW0 A;  3LIB A;  2K2N A;  1OTE A;  1JNU A;  3C38 A;  5MC7 A;  3PBR A;  4EER A;  4GHI B;  4L9E A;  1S4R A;  5TBM A;  4I3I A;  4NKP A;  3EGD C;  2VA0 A;  1MC0 A;  2PT7 A;  5HPI A;  1Y28 A;  5F68 A;  3PHY A;  4DJ2 A;  4WLA A;  2QJ5 A;  2R78 A;  1LT0 A;  1N9L A;  1XFN A;  1MZU A;  1XFQ A;  4JGO A;  1TS7 A;  2A2L A;  5DF9 A;  5AJG A;  4I38 A;  1MKM A;  2VLG A;  3KYQ A;  2W1R A;  1V9Z A;  4MN6 A;  3LI8 A;  2L4R A;  3B42 A;  3FPV A;  2LB5 A;  2VV7 A;  4KUO A;  3KSH A;  3MQO A;  4EET B;  5F69 A;  2WKQ A;  3LIC A;  1OTB A;  1IOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...