1S67L

Crystal structure of heme domain of direct oxygen sensor from e. coli
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
119
structure length
119
Chain Sequence
NAADGIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into signal transduction involving PAS domain oxygen-sensing heme proteins from the X-ray crystal structure of Escherichia coli Dos heme domain (Ec DosH)
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxygen storage/transport
molecule keywords Hypothetical protein yddU
total genus 23
structure length 119
sequence length 119
chains with identical sequence U
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s67L00
3H7WA 2PR6A 2BASA 1XFQA 1S67L 3BY9A 3LICA 4K08A 4RQ9A 2QJ5A 3K3DA 4L9FA 1OTEA 3FC7A 3PYPA 4WN5A 3MJQA 1N9LA 3IBRA 2JHEA 4GW9A 4H6JB 2PHYA 3LIBA 3LI8A 3C2WA 4DJ3A 2VV7A 3E4OA 3NOUC 3MQQA 2I9VA 2V1AA 1G28A 1OTDA 4EQ1A 3VE3A 2QHKA 1UWPX 5HWVA 3E4QA 1ODVA 4KUKA 1GSWA 2V0WA 2KDKA 3B33A 4GCZA 4GHIA 3F1PA 2ZOIA 4HH2A 4JGPA 5EFWA 2D02A 1OJGA 3IS2B 4MN5A 4EETB 1S1YA 1P97A 5J7EA 3UB7A 4L9EA 1LT0A 3F1PB 3LYXA 1DRMA 3NOTC 2CMNA 4GHIB 1KOUA 2VEAA 1MZUA 3EEHA 4PKYA 4I5SA 1S66L 3LUQA 4LRXC 5J4EA 4NXEA 1N9NA 5F6AA 1UWNX 1DP9A 2PR5A 4PKYG 5F69A 1TS7A 3HJKA 4I3IA 1T18A 5J3WA 2W0NA 4WL9A 4EEUA 1F9IA 2OWJA 4KUOA 3C8CA 3RTYA 2D01A 3A0SA 3A0RA 3CWFA 4MN6A 1F98A 4LPZA 4R70A 1NWZA 1V9ZA 4EW7A 1OT9A 4HP9A 2EA9A 2L4RA 2Z6DA 2PDRA 5DJTA 5F5YA 2WKQA 4F3LB 5IS1A 2V9AA 3F1NB 4HJ6A 3NJAA 2R78A 4HJ3A 1T1CA 3NOPC 2YKFA 1S4RA 4HOIA 4LRYC 3IS2A 1OT6A 5F68A 1BYWA 3E4PA 4NXGA 4NXFA 1GSVA 3GDIA 5AVFA 4L9GA 5G4YA 4LRZE 1TS8A 5HWWA 2HV1A 4XT2A 4M4XA 4YWZA 3OLOA 4KQDA 5KIZA 3F1OB 1EW0A 1TS6A 4JGOA 2WKRA 4BBUA 3NHQA 3MR0A 1OTBA 3LIDA 4E04A 2PD8A 2VV8A 1WA9A 2JN7A 1XFNA 2INWA 2GJ3A 3CAXA 4EESA 3H9WA 3F1NA 5DKLA 4HIAA 1XJ3A 4HQAA 5HWTA 2K7SA 3LIAA 4F3LA 1S1ZA 2M1CA 4WLAA 4HP4A 3UB8A 3BY8A 2YKHA 4WF0A 5HD5A 4H6JA 1V9YA 3H7WB 1LSWA 3K3CA 2W27A 3UB6A 3LIEA 5G4ZA 1T19A 1TS0A 3D72A 2J80A 1OJ5A 2L1MA 3RH8B 3VE4A 4EXOA 1LL8A 2QJ7A 2B02A 2QWSA 2QKPA 3ICYA 5TBMA 4BBVA 1P0ZA 4HY8A 1T1BA 3GECA 3VOLA 4HH3A 2KX6A 3LI9A 3ZQ5A 5HDDA 3MQOA 3ULFA 1DP8A 3EWKA 2V0UA 3PHYA 4R38A 1UGUA 4HI4A 3G6OA 3A0VA 1X0OA 5HD3A 2A24B 1OTAA 3KX0X 3UE6A 5HDCA 5DKKA 4DJ2A 2OOLA 1LSXA 3FG8A 1DP6A 4HHDA 4JGRA 4R6LA 4WUJA 1XJ6A 3SW1A 1OTIA 1D7EA 1D06A 2V1BA 3LIFA 4I3JA 5DJUA 5HDSA 5TBMB 1T1AA 4I39A 3H82A 1VB6A 2H28A 1XJ4A 2PYPA 4R3AA 3UMEA 4EERA 5HSQA 3MFXA 1LSVA 1S4SA 2A24A 3UB9A 2ZOHA 2VLGA 2L0WA 3H82B 2P7JA 4LLOB 4XT2B 3HJIA 5I5LA 4BBTA 2Z6CA 4JGQA 4NXBA 1GSXA 2VV6A 3BWLA 4I3AA 5AVEA 2PD7A 2OWHA 2WKPA 3CLOA 2ZBBA 3MXQA 4GS9B 4GS9A 3P7NA 4HJ4A 3UMDA 4B9OA 5A8BA 4EEPA 1XJ2A 1Y28A 3F1OA 5IU1A 4HNBA 3T50A 2PYRA 1N9OA 4I38A 5HZHA 1JNUA
chains in the Genus database with same CATH superfamily
4RQ9A 4L9FA 2GZAA 1STZA 4EQIA 4DDYA 3NDEA 1G28A 1G6OA 4MMNA 1XX2A 2OAP1 3B33A 2KDKA 4EUVA 1PWCA 3A3DA 3L7HA 4EETB 4XUZA 3M2KA 5GHXA 5KMWA 3A3JA 2WYXA 4QY6A 2J8YA 4KZ3A 3LUQA 1N9NA 5F6AA 2VJWA 2EFXA 2BLSA 2E8IA 3ITAA 3C8CA 2FZ0A 2PBDP 1F5MA 4MN6A 3DTKA 1E3UA 5L8MA 2EA9A 2PDRA 2PU2A 4K0WA 1WYCA 2J9OA 1OT6A 2HJEA 4IJGA 1PI4A 3BFFA 5E2EA 3UDXA 1NXYA 2VGKA 4OQ0A 4UHUA 2X71A 1LLBA 4EWFA 3F1NA 5U47A 4D2OA 5HWTA 3VFFA 3AGFA 4KZ8A 3K3CA 3Q07A 5G4ZA 1OPXA 4Y2FA 2B02A 4OQHA 3HUMA 2A24B 1OTAA 3WS0A 3AGDA 1LSXA 5HDSA 1G5UA 3SH8A 5HPFA 3QHYA 2JKGA 3OCLA 1LSVA 3SH9A 4GN2A 1GSXA 3UE0A 3V3SA 4G3KA 4E3IA 4RX3A 4N1HA 3T50A 2ZLYA 5DFYA 1Q2QA 1YMXA 4KQQA 2O9BA 3WS1A 4WN5A 3IF6B 4GD8A 5J8XA 4M3KA 3TOIA 1BLCA 3ZVWA 2XSSA 4MN5A 5F1FA 1P97A 4DKIA 5J7EA 4JXVA 5E43A 1TVFA 3BJNA 5F83A 3T1XA 2W0NA 4P87A 5C5KA 5F5YA 2L4RA 1LI0A 3F1NB 3MKEA 4H8RA 1T1CA 2YKFA 4HOIA 3NC8A 3ZG5A 1IYPA 1TS6A 3FWLA 2ZQDA 4DE2A 1XA7A 4EESA 4HESA 4HIAA 3LIAA 5EOEA 2ZQCA 3C7VA 4WYYA 2EXAA 3SS4A 4E3LA 3SOIA 5CXWA 4EXOA 2J80A 1OJ5A 1ACFA 3IWQA 1ZG6A 4BBVA 1BTLA 1JWVA 1W63M 3CPTB 3V67A 2WAEA 4Y5FA 1IELA 4S2OA 4I39A 1BLHA 4FD8A 5GLBA 1FCNA 4UQIS 2ZMAA 5DVAA 3MZDA 4KZAA 4LLOB 3PBSA 1KE4A 3NCKA 3RXXA 1J9MA 3U4LP 1H8MA 3MXRA 3QP1A 2UV0E 3F1OA 1XGJA 4DXCA 3VV4A 3KSFA 2KOIA 4DJ3A 2VV7A 2Z2LB 3E4OA 4A5RA 2O0YA 3MQQA 4KZ5A 1ONGA 2V0WA 4DMZA 1Q2PA 1S1YA 2XK1A 2OV5A 4L9EA 5CRFA 5AQ7A 4CLCA 2JKRM 2WGVA 2XLNA 5J4EA 3IF6C 5FI2A 4LCMA 5HX9A 3T12B 4Y13A 2ZC6B 2XQZA 3S4XA 3IHAA 4S2NC 5L2FA 1L0DA 2JBFA 1ONHA 1TS8A 4YWZA 1SZVA 2WKRA 2B95A 3IBJA 5DTSA 1HLUP 1GA9A 4BL3A 4X69A 4MBFA 3UB8A 4H6JA 2NUPC 2JKRI 2HDRA 1HVBA 2QKPA 4CLCB 1YSPA 2Y79A 3N8LA 2OOLA 3UNWA 4JGRA 2ZM0A 1D06A 2HJ9C 2EWWA 3T4LA 4CLCD 2PYPA 4EBPA 3WRZA 2VGLS 5L10A 3E2KA 5IHVA 2WKEA 3QP8A 4Y17A 3UMDA 3N4IA 2JCHA 4OH0A 4DXBA 5EV0A 2OLVA 3FC7A 3PYPA 1N9LA 5CX7A 3WRTA 5AQAA 2I9VA 4JKTA 4IEDA 4KUKA 1PI5A 4WZ5A 5FQIA 3UDFA 2VK3A 1OJGA 3C38A 3BM6A 4CJNA 3UB7A 3R7WB 4R23A 2XEPA 2Y55A 1ES5A 1T18A 1YLTA 1NYYA 3MSHA 4WZ5C 5HL1A 5FQJA 1OT9A 1IYOA 1MY8A 3WWXA 3IS2A 4NXGA 2GNXA 3KO6A 5TJJA 5G4YA 5CGXA 4FH2A 4M4XA 5KIZA 1DJAA 1XFNA 3ISGA 5D3OA 3TSGA 4U3TA 4F94A 1ERMA 5FDSA 1LSWA 2W27A 4MEZA 5FA7A 3I7JA 3T4SA 1P0ZA 2GX5A 3WS5A 4HH3A 3LI9A 3MQOA 4GLQA 3HREA 3S22A 1FQGA 4DJ2A 2G2UA 2O9AA 4MDZA 1XJ4A 3D3OA 1BT5A 3FKVA 3SH7A 2UWXA 4ZDXA 2X02A 1FR1A 3G31A 4QPRA 2K2NA 2P9VB 4NEED 2C5WB 3LR0A 4Y3IA 5EM1A 4QWOA 2PHYA 3CMZA 4JXWA 4LCLA 2H0TA 4XUXA 1GA0A 1ZC2A 4YOFA 2BG1A 3W4QA 3LIBA 3LR3A 3IWOA 3HCYA 2ZJ9A 1ODVA 1YLJA 1PZOA 2WUQA 3HLEA 3OPLA 3IHBA 2XH9A 4IBXA 2PR5A 4MLLA 5E2HA 4KG6A 3RTYA 3A0SA 3HLBA 5DJTA 4QD4A 2WKQA 1K4EA 4HJ6A 3NJAA 4LV2A 1S4RA 4LRYC 4OPQA 4GJ4A 5F68A 2Y2QA 1HZOA 5LBRA 2M7UA 1ZTUA 4XT2A 3T4TA 2INWA 1VM1A 1PWDA 4OVDA 3G2ZA 2Y2HA 4Y0TA 5EE8A 4S2NA 1KE0A 2EFUA 2ZQAA 1YT4A 2QYBA 2PT7A 4KZ4A 4ZJ3A 2V0UA 1YSQA 2P04A 3UB6A 5CHUA 2ZC3B 5M19A 4O0PA 3PBTA 2R9XA 1MBLA 1E25A 1MWTA 4XT2B 5CHJA 1RCJA 2H5SA 1CQAA 2OWHA 3TE8A 3CLOA 2ZBBA 4X1LA 1IOUA 4HNBA 3DTIA 2JC7A 3OPPA 2BASA 2FFFB 4E3OA 3OCNA 3L9KA 1OTEA 2WGWA 3UB5P 3S7QA 5HWVA 2QMIA 3CITA 3RXWA 5K5BA 3KSIA 2OAQ1 1YQSA 2WGIA 3VMAA 4DDSA 2G2WA 5KSHA 4GHIB 2X01A 3OOVA 2VEAA 4OKPA 4PKYA 3Q7ZA 3MFDA 1SKOA 2EX6A 1DJBA 4NG2A 4BQMA 3T4OA 4LPZA 1PRQA 5FAOA 4Z1WA 2W3HA 4RA7A 4YFMA 5FDHA 1PYYA 1GSVA 5DTKA 5GLAA 4ZRRA 5EECA 3Q7VB 3HUNA 2Y59A 4KQDA 4JGOA 5FEFA 4JBFA 2PD8A 4FSFA 4WBGA 2DNSA 2Y2MA 3KYEA 1ZG4A 5IT5A 4X68A 1GHIA 2M1CA 3Q81A 4L0LA 4B93A 1TS0A 3ZGAB 2KX6A 5HFOA 3G6OA 1NLYA 4JF6A 1A0KA 4OP8A 3E98A 2V1BA 4LGWA 4YNRA 4YINA 5HPIA 1NYMA 1FR6A 3UMEA 4HBTA 4EERA 3CPTA 1H5XA 2PD7A 1M40A 2VX8A 2V20A 1XJ2A 1Y28A 4S2KA 3LO7A 5IU1A 2GDNA 5JYOA 4K08A 3FYZA 4OLGA 4K0XA 4Y0UA 4PPRA 4G3WA 1LI9A 4E3NA 3GSGA 5HAIA 3S7NA 1JWPA 3VE3A 1FOFA 2V1ZA 1XA1A 4JXGA 2IWBA 2Y2IA 3SW1A 1DRMA 1SDNA 3WS4A 3Q7VA 1NY0A 3HLWA 1S66L 5DF9A 3T4QA 5M18A 3HL9A 4WL9A 4KUOA 3IT9A 3TG9A 3JPUA 1KVMA 3EOIA 1JTDA 3U2AA 4O8GA 4OOYA 4X25A 3GDIA 5AVFA 4P0MA 2WKIA 1NJ4A 3CHWP 3BECA 2C6WB 2GJ3A 2WK0A 1ES4A 1S1ZA 3Q82A 1VQQA 3MZEA 1DY6A 3Q1FA 1CJFA 3P01A 2KLIA 4NKPA 3O87A 5TBMA 3E2LA 3E0YA 4Z9QA 2HPBA 5HD3A 5A91A 4P85A 5HDCA 2XFSA 3NULA 1LL5A 4JF4A 3ZG7B 5TR7A 1VB6A 2W3GA 5FASA 4KG2A 5HSQA 2VLGA 4BBTA 5I5LA 3HJIA 4BD0A 1H8YA 1MWSA 1H0MA 4Q0HA 1KGGA 3ZNTA 3C4OA 3IH8A 3KYQA 1JNUA 5EPHA 3QP4A 1XFQA 4ARZA 1YM1A 3JVUA 3T1SA 3QNCA 1K54A 2NUTC 4MBHA 1UWPX 2PBYA 3E4QA 3IXHA 1W8YA 3G4PA 3IX8A 3VSLA 2Y2KA 2O9CA 1L0FA 3R4KA 3FZCA 1K56D 1LT0A 2CMNA 3PTEA 1J3WA 1MXOA 1K55C 1UWNX 3BLSA 4UQIM 3BFGA 4EEUA 3CWFA 4EW7A 1PZPA 3G34A 3TRCA 1K54C 1N4OA 4WEJA 4QHCA 4GDBA 4EU0A 2ZC5B 1SKFA 3DAVA 3CI6A 2W1TB 2Q9NA 4JXSA 3S7PA 4LENA 4Y7PA 5FSRA 2IWCA 3P98A 1PFLA 4PHTA 1C3BA 2FH5A 3TW8A 2YKHA 3MZFA 2PRFA 3IF6A 3N8SA 3UO9A 1T19A 3HLGA 4N92A 2L1MA 4WELA 1CI8A 2VA0A 3B47A 1FIKA 1H8ZA 3FV7A 3BEBA 3VOLA 3LR5A 1TF1A 5DKKA 3FG8A 4N1XA 2EWVA 3OC2A 4WUJA 4OQGA 4I3JA 4EV4A 4KZ7A 2H10A 2H28A 3W8KA 2W3EA 2Y2JA 3HLDA 3MF0A 2HZ5A 3VFHA 5GL9A 4GS9B 1YPRA 3P7NA 4MNRA 1L0GA 1W8QA 2XD5A 4EBNA 1IEMA 2A49A 3C5AA 3SS3A 4HEFA 3G30A 1VETB 4H6JB 3C2WA 5E2FA 1SDEA 4S2PA 4U0XA 1EROA 2QHKA 4QJGA 3GMWA 1GSWA 4HH2A 3VP2A 3NBLA 3CJMA 2D02A 3ZDJA 2JKTI 4WMCA 2Y4AA 1GHPA 4CLCE 2O99A 2HP6A 3EEHA 1K4FA 2QPNA 4PM8A 1FCOA 4CPKA 5KZHA 4KQRA 2XDMA 4O01A 1K56A 2D01A 5FATA 1V9ZA 4P6ZM 5FQ9A 5HL6A 1MWRA 4II7A 4E3JA 3BFCA 1IYQA 4E6WA 4LRZE 3V3RA 4BBUA 2B18A 3LIDA 3ZVTA 2XRNA 3WS2A 2JN7A 3VOYA 3PBNA 3GQZA 1PWGA 4WLAA 2ZQ7A 3UY6A 4PM7A 4XXRA 3FPVA 4JLFA 1I5QA 3V50A 4NK3A 1PNEA 5DFXA 1LL8A 3ICYA 4MCWA 4RX2A 2XD1A 4OP5A 3IXGA 2HDSA 2LB9A 3PAGA 4R38A 1ERQA 2V8FA 3BYDA 4R6LA 3NI9A 1XJ6A 1SHVA 3H82A 4OPZA 1ZHHB 2L0WA 1JVJA 3BWLA 4I3AA 4GS9A 4E3KA 4CLCC 4U0TA 3N8RA 4LV0A 2ZM8A 4P6BA 3GECA 4I38A 4R3BA 2OLUA 3G2YA 4ETXA 3K3DA 1ALQA 3C30A 3MJQA 5I94A 2K31A 4OPRA 3LI8A 2HF6A 2FFYA 3W2ZA 4S2MA 2V8CA 1OTDA 4PAUA 1S0WA 1QMFA 3F1PA 2ZOIA 4B4ZA 5CGSA 1AXBA 3HLFA 2XA7S 4BL2A 1KOUA 1Z09A 5EOOA 5TGFA 1DP9A 1F9IA 5L09A 3SZTA 3PBOA 1K38A 2WADA 2ZL1B 1CEFA 2HDQA 3MKFA 3PR6A 2WZZA 1BYWA 1YLPA 4PM5A 4JPMA 2JKFA 2JE5A 3OLOA 1ES2A 1U60A 1BULA 3MR0A 3O5YA 3MBZA 3LEZA 4NETA 5DKLA 3KSHA 4FUWA 2HDUA 4G3VA 3VE4A 4D60A 4Y0OA 5HAPA 4OONA 5HDDA 3A0VA 1K6RA 1XKZA 1OTIA 1TEMA 3D9YA 2IWDA 4Q0IA 2A24A 3IWIA 1L2SA 2Q0OA 3DWZA 3BQAA 1QMEA 3IF5A 5A92A 3UN7A 4HJ4A 1L3LA 3LFVA 3ULFA 1N9OA 4O7DA 5FAQA 2BTFP 4KQOA 1S67L 3HLCA 1W63Q 1K0KA 5GLCA 4X56A 3ZNYA 1OMEA 2I72A 1E4DA 4IUHA 4GCZA 3NDGA 2RCXA 5AJGA 2Y2GA 5GHZA 3F1PB 1I2WA 3DWKA 1XXMA 3GRJA 1RGYA 1Y4OA 3HJKA 1SKOB 1ESUA 3A0RA 2ACGA 1XPBA 2J3TC 3LY3A 4WM9A 5FEGA 2DRWA 3OPRA 3R7WA 5HAQA 5FQQA 4FTXA 4E6XA 4AFIA 3MXSA 5DF7A 2ZL1A 2HV1A 1VHMA 5GLDA 1BLPA 1FILA 4QY5A 1OTBA 4CQHA 1JTGA 2P9VA 3CAXA 3RFBA 3H9WA 5FI6A 1MKMA 2HP5A 3OZHA 3KYZA 1VETA 2QWSA 3PBRA 4PM6A 1NRFA 3T1RA 2XROA 3ZQ5A 3EWKA 3UE6A 5E2GA 1P9WA 5AQBA 4MBKA 3ZFZA 1AWIA 2IA2A 4ETZA 5TBMB 3UPPA 5EM0A 5TFQA 4LV1A 3UB9A 3P09A 3LY4A 3VP1A 2EXBA 1S6RA 3CZDA 1BZAA 5A8BA 5GHYA 3C7UA 2ZMFA 3UE3A 4GD6A 1TDLA 3VSKA 4C75A 2QJ5A 3CUEC 3MQ0A 1SCWA 1L0EA 3FPWA 4GZBA 3W4PA 3TJZC 4OOLA 5G18A 4S2JA 4KZ6A 4GHIA 4IVKA 3V39A 2W3DA 2XFTA 1TD5A 3EGXC 2MJ6A 3NOTC 2ZQ9A 4I5SA 3ZG8B 5CGWA 3IX4A 1TS7A 5J3WA 1ZKJA 2J7VA 3MS6A 4R0QA 1VEUA 1Z6FA 4GKUA 1WE4A 1O7EA 4GB7A 3LCEA 5IS1A 4DE0A 4Q8IA 3DBAA 1O07A 4S2IA 3AGEA 3OPHA 5HARA 3QP2A 1IYSA 3LGOA 3BFEA 4C6YA 5CHMA 4GDNA 4HP4A 5HD5A 3S1YA 2ZQ8A 5CTNA 4UEYA 3BFDA 4N9LA 3UDIA 2QZ6A 2R9WA 5FI7A 1T1BA 4UA6A 3RJUA 4EBLA 1D1JA 4E3MA 2PAVP 4DF6A 3EQUA 2V2FF 1K25A 3KSGA 1BSGA 2Y91A 1M6KA 4KG5A 4FH4A 4RVAA 4DRTA 4B4XA 1W5DA 2W1TA 5EVIC 1HD8A 1Y54A 2ZMVA 3VP4A 1H3QA 3LEQA 2G7UA 3HBRA 4Y15A 5HW3A 3IH9A 5CECA 3IBRA 2JHEA 4QB8A 3IQAA 3PBQA 4OOMA 4IUKA 2WZXA 4EQ1A 3FKWA 5L07A 1NZOA 5EFWA 3BLMA 4GOGA 1K57C 3IS2B 4P6ZS 2A3UA 2JKTM 3LYXA 1MZUA 3IX3A 4NXEA 3BQ8A 1FSYA 1FCMA 3A3EA 3A3FA 3T4KA 1VEUB 4Q0JA 2Z6DA 3T4JA 5FL3A 4R4RA 2ZD8A 4HJ3A 3NOPC 3S7OA 4IHQA 2DCFA 4L9GA 2Y2PA 2E8JA 1PW1A 1YLZA 4DE1A 5EVIB 1EWZA 3F1OB 3EQVA 3NHQA 1IKGA 2VV8A 1WA9A 4C3QA 2VGJA 4X55A 5BOHA 1NRJA 2Y2NA 4WF0A 1F2KA 3H7WB 1KE3A 3RH8B 3VOZA 2ZC7A 1EI5A 2QJ7A 1RGZA 2VKSA 1DP8A 3PHYA 1UGUA 5F82A 3D4FA 1BUEA 2XGNA 4IBRA 1D7EA 5FAPA 1ES3A 2W3FA 4WEKA 4X53A 1RP5A 4IVIA 4UAAA 2ZM2A 1G6AA 2WKPA 2VZWA 2J3WA 2P08A 1IFQA 3DW0A 4ZTKA 2PR6A 5DTTA 4MN7A 1NLZA 3UPNA 3NOUC 4X6TA 1YLWA 3K2NA 4RYEA 3ZG0A 3NECA 4WZ4A 2RL3A 4DE3A 4PM9A 4N9KA 3B42A 4LRXC 3CUEA 1DJCA 3PXPA 3JYIA 4I3IA 3EEAA 4LV3A 3N6IA 1NWZA 2WAFA 3M6BA 4HBUA 1XGIA 3LR4A 3B3XA 3T1QB 3E4PA 4ZJ1A 4UA9A 1YKDA 2EX2A 3O86A 4S2LA 3QP5A 4FOFA 2WGWB 1XP4A 2Y2OA 4F3LA 4OLDA 4ZBEA 1V9YA 4FCFA 1KGEA 3D72A 2M7VA 2W1RA 1YLYA 4HY8A 2HGVA 3G35A 1X0OA 3O3VA 4WMCD 3IXBA 5DJUA 1T1AA 2Q9MA 4KZBA 2CC1A 1MPLA 3BRMA 1CEGA 3MFXA 1S4SA 1W79A 2ZOHA 2P7JA 2Z6CA 4JGQA 4NXBA 1W7FA 1KDWA 2VV6A 3BW6A 4ARZB 2B5RA 3MXQA 5MC7A 4BWIA 3EGDC 3OBFA 4R4SA 1KVLA 4EUZA 1IKIA 1MC0A 4UA7A 3H7WA 1LHYA 4KZ9A 3VP3A 4DN0A 4ID4A 2V1AA 4R1GA 4KENB 5EUAA 2PU4A 5EVIA 3PAEA 4X1MA 1LL9A 5F69A 3SS5A 4R70A 2Z2MB 4HP9A 4F3LB 2V9AA 2R78A 1MWUA 3GV9A 4PMAA 2EX8A 2Y2LA 1ESIA 1K57A 3A3IA 1WYBA 5HWWA 2H0YA 1YMSA 1PW8A 3ZCZA 1EW0A 3C4PA 3ZHHA 2ZC4B 4E04A 2WKHA 5A90A 5JYPA 1XJ3A 1YAXA 1JWZA 3BY8A 5M1AA 5EVLA 1NZUA 2J9PA 3QNBA 1K6SA 4HI4A 2HP9A 3LIFA 3ITBA 4BLMA 1I2SA 4R3AA 3M6HA 3H82B 2VGLM 5AVEA 4OQIA 3W4OA 3JVVA 3O88A 1N9BA 2XA7M 3VP0A 2OSUA 2PYRA 1GCEA 4ZJ2A 3BY9A 3LICA 3HVFA 3CG5A 4LFUA 1G68A 1K55A 5CEDA 4GW9A 5CEBA 3NY4A 1MKIA 3IXDA 3M2JA 2LB5A 4JGPA 1CI9A 3GR2A 3ZYTA 3HUOA 1E3UD 3ZG9B 4BENA 2XF3A 4PKYG 4BJPA 2OWJA 3DTEA 1GHMA 1F98A 1P9RA 2AVXA 1KGFA 1FSWA 3UPOA 5A93A 4OPYA 3N7WA 4NXFA 5CTMA 4BMWA 1CF0A 2P74A 3GTCA 2Y8HA 5DF8A 3V5MA 4R3JA 5EVEA 4B88A 4JF5A 4HQAA 2K7SA 3G32A 3GVBA 3LIEA 3QP6A 1KDSA 1BLSA 5AQ9A 3MMHA 3KX0X 4BD1A 5CERA 4HHDA 1DP6A 4GNUA 4ESPA 4QU3A 3UE1A 4K91A 5KSCA 2EX9A 4ME4A 1PIOA 5EVID 2XR0A 2DMWA 2J3TD 4ZAMA 1TDGA 1CK3A 4B9OA 5FQKA 5FQMA 2A2LA 4EEPA 5F1GA 1HTZA 3DTMA 3NIAA 5HZHA
chains in the Genus database with same CATH topology
4RQ9A 4L9FA 2GZAA 1STZA 4YOFA 3IBRA 2JHEA 4H6JB 3LIBA 3C2WA 4OOMA 3PBQA 3LR3A 4IUKA 3HCYA 1G28A 1G6OA 4EQ1A 2QHKA 4MMNA 1ODVA 1GSWA 2OAP1 2KDKA 3B33A 4HH2A 5EFWA 4EUVA 2D02A 2JKTI 3IS2B 4EETB 4P6ZS 4CLCE 2O99A 2JKTM 3LYXA 1MZUA 3EEHA 3LUQA 4NXEA 3BQ8A 1N9NA 5F6AA 2VJWA 2PR5A 4O01A 3T4KA 3RTYA 3C8CA 2D01A 2FZ0A 3A0SA 1F5MA 4MN6A 1V9ZA 4Q0JA 4P6ZM 5L8MA 2EA9A 5DJTA 2Z6DA 2PDRA 3T4JA 2WKQA 5FL3A 5HL6A 4HJ6A 3NJAA 4HJ3A 3NOPC 1S4RA 4LRYC 3S7OA 4II7A 1OT6A 4GJ4A 5F68A 5LBRA 4IHQA 4L9GA 2HJEA 4IJGA 4LRZE 2M7UA 1ZTUA 4XT2A 3F1OB 3EQVA 4BBUA 3NHQA 3T4TA 2B18A 3LIDA 2XRNA 2VV8A 1WA9A 2JN7A 2INWA 3PBNA 3F1NA 5HWTA 1NRJA 4WLAA 4WF0A 3H7WB 3K3CA 3FPVA 5G4ZA 1OPXA 3RH8B 5DFXA 4Y2FA 1LL8A 2QJ7A 2B02A 3ICYA 4MCWA 2QYBA 2PT7A 2VKSA 2LB9A 1DP8A 2V0UA 3PHYA 4R38A 1YSQA 1UGUA 2P04A 2A24B 1OTAA 1LSXA 4R6LA 1XJ6A 3UB6A 1D7EA 5HDSA 3H82A 4O0PA 3PBTA 2W3FA 5HPFA 1ZHHB 3OCLA 1LSVA 4WEKA 2L0WA 4XT2B 1GSXA 3BWLA 4I3AA 3TE8A 2OWHA 2WKPA 3CLOA 2ZBBA 4GS9A 4G3KA 4CLCC 2VZWA 1IOUA 2J3WA 4HNBA 3T50A 2P08A 3GECA 4I38A 5DFYA 1IFQA 2PR6A 2BASA 2O9BA 4ETXA 3OCNA 3K3DA 1OTEA 3C30A 4WN5A 3MJQA 2K31A 4MN7A 3S7QA 1NLZA 3LI8A 2HF6A 3NOUC 3W2ZA 1OTDA 4PAUA 5HWVA 3CITA 3K2NA 3F1PA 2ZOIA 5K5BA 3KSIA 2OAQ1 2XSSA 4MN5A 1P97A 5KSHA 5J7EA 2XA7S 4GHIB 3OOVA 1KOUA 2VEAA 4PKYA 3B42A 3BJNA 4LRXC 3CUEA 3PXPA 1DP9A 4I3IA 2W0NA 3EEAA 1F9IA 3T4OA 5C5KA 4LPZA 1NWZA 3PBOA 5F5YA 2L4RA 3F1NB 3LR4A 1T1CA 4Z1WA 2W3HA 2YKFA 4HOIA 3PR6A 1BYWA 3E4PA 1GSVA 1YKDA 4ZRRA 3OLOA 4KQDA 4JGOA 1TS6A 3MR0A 4FOFA 3O5YA 2PD8A 4FSFA 4EESA 5DKLA 5IT5A 4HIAA 3KSHA 3LIAA 4F3LA 2M1CA 4L0LA 1V9YA 4G3VA 4B93A 1TS0A 3D72A 2J80A 1OJ5A 2M7VA 3VE4A 4EXOA 2W1RA 4BBVA 4HY8A 2KX6A 2HGVA 5HDDA 1W63M 3G6OA 3A0VA 1NLYA 1X0OA 3V67A 4Y5FA 3E98A 1OTIA 2V1BA 5HPIA 4YNRA 5DJUA 1T1AA 4I39A 4UQIS 3UMEA 4Q0IA 4EERA 3MFXA 1S4SA 2A24A 2ZOHA 4LLOB 2P7JA 2Z6CA 4JGQA 4NXBA 3BQAA 2VV6A 3BW6A 2PD7A 4ARZB 3PBSA 3MXQA 5MC7A 4HJ4A 1H8MA 2VX8A 4BWIA 3OBFA 3EGDC 3LFVA 1XJ2A 1Y28A 3F1OA 5IU1A 3ULFA 1N9OA 1MC0A 3H7WA 4KQOA 1S67L 4K08A 3VV4A 1W63Q 3KSFA 2KOIA 4G3WA 4DJ3A 2VV7A 3E4OA 4DN0A 2O0YA 3MQQA 2V1AA 3S7NA 3VE3A 4IUHA 2V0WA 4GCZA 4DMZA 5AJGA 1S1YA 4L9EA 3F1PB 3SW1A 1DRMA 4CLCA 2JKRM 1S66L 5DF9A 5J4EA 3T4QA 5F69A 3HJKA 4WL9A 4KUOA 3A0RA 4R70A 4HP9A 4F3LB 2J3TC 2V9AA 3EOIA 2R78A 3R7WA 3U2AA 4O8GA 4AFIA 3GDIA 5AVFA 5HWWA 1TS8A 2HV1A 1VHMA 4YWZA 1EW0A 2WKRA 1OTBA 3IBJA 4CQHA 4E04A 3CAXA 2GJ3A 3RFBA 3H9WA 1MKMA 1XJ3A 1S1ZA 1YAXA 3UB8A 3BY8A 4H6JA 2NUPC 2JKRI 3P01A 2KLIA 4NKPA 3KYZA 5TBMA 2QWSA 2QKPA 3PBRA 2XROA 3E0YA 3ZQ5A 4CLCB 3EWKA 1YSPA 2Y79A 4HI4A 5HD3A 3UE6A 5HDCA 2OOLA 1P9WA 4JGRA 2IA2A 3LIFA 1D06A 2HJ9C 5TBMB 4ETZA 2EWWA 3T4LA 1VB6A 2W3GA 4CLCD 2PYPA 4R3AA 2VGLS 5HSQA 3UB9A 2VLGA 4BBTA 3H82B 5I5LA 3HJIA 2VGLM 5AVEA 3JVVA 3UMDA 5A8BA 4Q0HA 2XA7M 2PYRA 3KYQA 1JNUA 2ZMFA 3UE3A 1XFQA 3BY9A 3LICA 2QJ5A 4ARZA 3CUEC 3MQ0A 3FC7A 3PYPA 1N9LA 3JVUA 4GW9A 5CX7A 3FPWA 2I9VA 3TJZC 2NUTC 4OOLA 1UWPX 3E4QA 4KUKA 2LB5A 4GHIA 4JGPA 1OJGA 2W3DA 1TD5A 3R4KA 2O9CA 3C38A 3EGXC 3ZYTA 2MJ6A 3UB7A 1LT0A 3NOTC 3R7WB 2CMNA 4I5SA 1UWNX 4PKYG 1TS7A 4BJPA 1T18A 4UQIM 5J3WA 4EEUA 2OWJA 3CWFA 4EW7A 1F98A 1P9RA 1OT9A 5IS1A 3TRCA 4WEJA 3IS2A 4EU0A 4NXGA 3DBAA 4NXFA 2GNXA 3KO6A 5TJJA 5G4YA 3CI6A 4BMWA 2W1TB 2Y8HA 4M4XA 5KIZA 3S7PA 4PHTA 1XFNA 4HQAA 2K7SA 2FH5A 4HP4A 3TW8A 5HD5A 2YKHA 1LSWA 2W27A 4UEYA 3LIEA 1T19A 2L1MA 4WELA 2VA0A 3B47A 1P0ZA 2GX5A 3T4SA 1T1BA 3VOLA 3LR5A 4HH3A 3LI9A 3MQOA 4GLQA 1TF1A 3MMHA 3KX0X 5DKKA 4DJ2A 3FG8A 4HHDA 1DP6A 2EWVA 3OC2A 4WUJA 4I3JA 2O9AA 3EQUA 3KSGA 2H28A 4MDZA 1XJ4A 3D3OA 4ME4A 2W3EA 2DMWA 2J3TD 2W1TA 4QPRA 3MF0A 2K2NA 4GS9B 4NEED 2ZMVA 4B9OA 3P7NA 2A2LA 1H3QA 4EEPA 2G7UA 3LR0A 4Y3IA 5HZHA 2PHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H7W A;  2PR6 A;  2BAS A;  1XFQ A;  1S67 L;  3BY9 A;  3LIC A;  4K08 A;  4RQ9 A;  2QJ5 A;  3K3D A;  4L9F A;  1OTE A;  3FC7 A;  3PYP A;  4WN5 A;  3MJQ A;  1N9L A;  3IBR A;  2JHE A;  4GW9 A;  4H6J B;  2PHY A;  3LIB A;  3LI8 A;  3C2W A;  4DJ3 A;  2VV7 A;  3E4O A;  3NOU C;  3MQQ A;  2I9V A;  2V1A A;  1G28 A;  1OTD A;  4EQ1 A;  3VE3 A;  2QHK A;  1UWP X;  5HWV A;  3E4Q A;  1ODV A;  4KUK A;  1GSW A;  2V0W A;  2KDK A;  3B33 A;  4GCZ A;  4GHI A;  3F1P A;  2ZOI A;  4HH2 A;  4JGP A;  5EFW A;  2D02 A;  1OJG A;  3IS2 B;  4MN5 A;  4EET B;  1S1Y A;  1P97 A;  5J7E A;  3UB7 A;  4L9E A;  1LT0 A;  3F1P B;  3LYX A;  1DRM A;  3NOT C;  2CMN A;  4GHI B;  1KOU A;  2VEA A;  1MZU A;  3EEH A;  4PKY A;  4I5S A;  1S66 L;  3LUQ A;  4LRX C;  5J4E A;  4NXE A;  1N9N A;  5F6A A;  1UWN X;  1DP9 A;  2PR5 A;  4PKY G;  5F69 A;  1TS7 A;  3HJK A;  4I3I A;  1T18 A;  5J3W A;  2W0N A;  4WL9 A;  4EEU A;  1F9I A;  2OWJ A;  4KUO A;  3C8C A;  3RTY A;  2D01 A;  3A0S A;  3A0R A;  3CWF A;  4MN6 A;  1F98 A;  4LPZ A;  4R70 A;  1NWZ A;  1V9Z A;  4EW7 A;  1OT9 A;  4HP9 A;  2EA9 A;  2L4R A;  2Z6D A;  2PDR A;  5DJT A;  5F5Y A;  2WKQ A;  4F3L B;  5IS1 A;  2V9A A;  3F1N B;  4HJ6 A;  3NJA A;  2R78 A;  4HJ3 A;  1T1C A;  3NOP C;  2YKF A;  1S4R A;  4HOI A;  4LRY C;  3IS2 A;  1OT6 A;  5F68 A;  1BYW A;  3E4P A;  4NXG A;  4NXF A;  1GSV A;  3GDI A;  5AVF A;  4L9G A;  5G4Y A;  4LRZ E;  1TS8 A;  5HWW A;  2HV1 A;  4XT2 A;  4M4X A;  4YWZ A;  3OLO A;  4KQD A;  5KIZ A;  3F1O B;  1EW0 A;  1TS6 A;  4JGO A;  2WKR A;  4BBU A;  3NHQ A;  3MR0 A;  1OTB A;  3LID A;  4E04 A;  2PD8 A;  2VV8 A;  1WA9 A;  2JN7 A;  1XFN A;  2INW A;  2GJ3 A;  3CAX A;  4EES A;  3H9W A;  3F1N A;  5DKL A;  4HIA A;  1XJ3 A;  4HQA A;  5HWT A;  2K7S A;  3LIA A;  4F3L A;  1S1Z A;  2M1C A;  4WLA A;  4HP4 A;  3UB8 A;  3BY8 A;  2YKH A;  4WF0 A;  5HD5 A;  4H6J A;  1V9Y A;  3H7W B;  1LSW A;  3K3C A;  2W27 A;  3UB6 A;  3LIE A;  5G4Z A;  1T19 A;  1TS0 A;  3D72 A;  2J80 A;  1OJ5 A;  2L1M A;  3RH8 B;  3VE4 A;  4EXO A;  1LL8 A;  2QJ7 A;  2B02 A;  2QWS A;  2QKP A;  3ICY A;  5TBM A;  4BBV A;  1P0Z A;  4HY8 A;  1T1B A;  3GEC A;  3VOL A;  4HH3 A;  2KX6 A;  3LI9 A;  3ZQ5 A;  5HDD A;  3MQO A;  3ULF A;  1DP8 A;  3EWK A;  2V0U A;  3PHY A;  4R38 A;  1UGU A;  4HI4 A;  3G6O A;  3A0V A;  1X0O A;  5HD3 A;  2A24 B;  1OTA A;  3KX0 X;  3UE6 A;  5HDC A;  5DKK A;  4DJ2 A;  2OOL A;  1LSX A;  3FG8 A;  1DP6 A;  4HHD A;  4JGR A;  4R6L A;  4WUJ A;  1XJ6 A;  3SW1 A;  1OTI A;  1D7E A;  1D06 A;  2V1B A;  3LIF A;  4I3J A;  5DJU A;  5HDS A;  5TBM B;  1T1A A;  4I39 A;  3H82 A;  1VB6 A;  2H28 A;  1XJ4 A;  2PYP A;  4R3A A;  3UME A;  4EER A;  5HSQ A;  3MFX A;  1LSV A;  1S4S A;  2A24 A;  3UB9 A;  2ZOH A;  2VLG A;  2L0W A;  3H82 B;  2P7J A;  4LLO B;  4XT2 B;  3HJI A;  5I5L A;  4BBT A;  2Z6C A;  4JGQ A;  4NXB A;  1GSX A;  2VV6 A;  3BWL A;  4I3A A;  5AVE A;  2PD7 A;  2OWH A;  2WKP A;  3CLO A;  2ZBB A;  3MXQ A;  4GS9 B;  4GS9 A;  3P7N A;  4HJ4 A;  3UMD A;  4B9O A;  5A8B A;  4EEP A;  1XJ2 A;  1Y28 A;  3F1O A;  5IU1 A;  4HNB A;  3T50 A;  2PYR A;  1N9O A;  4I38 A;  5HZH A;  1JNU A; 
#chains in the Genus database with same CATH topology
 4RQ9 A;  4L9F A;  2GZA A;  1STZ A;  4EQI A;  4DDY A;  3NDE A;  1G28 A;  1G6O A;  4MMN A;  1XX2 A;  2OAP 1;  3B33 A;  2KDK A;  4EUV A;  1PWC A;  3A3D A;  3L7H A;  4EET B;  4XUZ A;  3M2K A;  5GHX A;  5KMW A;  3A3J A;  2WYX A;  4QY6 A;  2J8Y A;  4KZ3 A;  3LUQ A;  1N9N A;  5F6A A;  2VJW A;  2EFX A;  2BLS A;  2E8I A;  3ITA A;  3C8C A;  2FZ0 A;  2PBD P;  1F5M A;  4MN6 A;  3DTK A;  1E3U A;  5L8M A;  2EA9 A;  2PDR A;  2PU2 A;  4K0W A;  1WYC A;  2J9O A;  1OT6 A;  2HJE A;  4IJG A;  1PI4 A;  3BFF A;  5E2E A;  3UDX A;  1NXY A;  2VGK A;  4OQ0 A;  4UHU A;  2X71 A;  1LLB A;  4EWF A;  3F1N A;  5U47 A;  4D2O A;  5HWT A;  3VFF A;  3AGF A;  4KZ8 A;  3K3C A;  3Q07 A;  5G4Z A;  1OPX A;  4Y2F A;  2B02 A;  4OQH A;  3HUM A;  2A24 B;  1OTA A;  3WS0 A;  3AGD A;  1LSX A;  5HDS A;  1G5U A;  3SH8 A;  5HPF A;  3QHY A;  2JKG A;  3OCL A;  1LSV A;  3SH9 A;  4GN2 A;  1GSX A;  3UE0 A;  3V3S A;  4G3K A;  4E3I A;  4RX3 A;  4N1H A;  3T50 A;  2ZLY A;  5DFY A;  1Q2Q A;  1YMX A;  4KQQ A;  2O9B A;  3WS1 A;  4WN5 A;  3IF6 B;  4GD8 A;  5J8X A;  4M3K A;  3TOI A;  1BLC A;  3ZVW A;  2XSS A;  4MN5 A;  5F1F A;  1P97 A;  4DKI A;  5J7E A;  4JXV A;  5E43 A;  1TVF A;  3BJN A;  5F83 A;  3T1X A;  2W0N A;  4P87 A;  5C5K A;  5F5Y A;  2L4R A;  1LI0 A;  3F1N B;  3MKE A;  4H8R A;  1T1C A;  2YKF A;  4HOI A;  3NC8 A;  3ZG5 A;  1IYP A;  1TS6 A;  3FWL A;  2ZQD A;  4DE2 A;  1XA7 A;  4EES A;  4HES A;  4HIA A;  3LIA A;  5EOE A;  2ZQC A;  3C7V A;  4WYY A;  2EXA A;  3SS4 A;  4E3L A;  3SOI A;  5CXW A;  4EXO A;  2J80 A;  1OJ5 A;  1ACF A;  3IWQ A;  1ZG6 A;  4BBV A;  1BTL A;  1JWV A;  1W63 M;  3CPT B;  3V67 A;  2WAE A;  4Y5F A;  1IEL A;  4S2O A;  4I39 A;  1BLH A;  4FD8 A;  5GLB A;  1FCN A;  4UQI S;  2ZMA A;  5DVA A;  3MZD A;  4KZA A;  4LLO B;  3PBS A;  1KE4 A;  3NCK A;  3RXX A;  1J9M A;  3U4L P;  1H8M A;  3MXR A;  3QP1 A;  2UV0 E;  3F1O A;  1XGJ A;  4DXC A;  3VV4 A;  3KSF A;  2KOI A;  4DJ3 A;  2VV7 A;  2Z2L B;  3E4O A;  4A5R A;  2O0Y A;  3MQQ A;  4KZ5 A;  1ONG A;  2V0W A;  4DMZ A;  1Q2P A;  1S1Y A;  2XK1 A;  2OV5 A;  4L9E A;  5CRF A;  5AQ7 A;  4CLC A;  2JKR M;  2WGV A;  2XLN A;  5J4E A;  3IF6 C;  5FI2 A;  4LCM A;  5HX9 A;  3T12 B;  4Y13 A;  2ZC6 B;  2XQZ A;  3S4X A;  3IHA A;  4S2N C;  5L2F A;  1L0D A;  2JBF A;  1ONH A;  1TS8 A;  4YWZ A;  1SZV A;  2WKR A;  2B95 A;  3IBJ A;  5DTS A;  1HLU P;  1GA9 A;  4BL3 A;  4X69 A;  4MBF A;  3UB8 A;  4H6J A;  2NUP C;  2JKR I;  2HDR A;  1HVB A;  2QKP A;  4CLC B;  1YSP A;  2Y79 A;  3N8L A;  2OOL A;  3UNW A;  4JGR A;  2ZM0 A;  1D06 A;  2HJ9 C;  2EWW A;  3T4L A;  4CLC D;  2PYP A;  4EBP A;  3WRZ A;  2VGL S;  5L10 A;  3E2K A;  5IHV A;  2WKE A;  3QP8 A;  4Y17 A;  3UMD A;  3N4I A;  2JCH A;  4OH0 A;  4DXB A;  5EV0 A;  2OLV A;  3FC7 A;  3PYP A;  1N9L A;  5CX7 A;  3WRT A;  5AQA A;  2I9V A;  4JKT A;  4IED A;  4KUK A;  1PI5 A;  4WZ5 A;  5FQI A;  3UDF A;  2VK3 A;  1OJG A;  3C38 A;  3BM6 A;  4CJN A;  3UB7 A;  3R7W B;  4R23 A;  2XEP A;  2Y55 A;  1ES5 A;  1T18 A;  1YLT A;  1NYY A;  3MSH A;  4WZ5 C;  5HL1 A;  5FQJ A;  1OT9 A;  1IYO A;  1MY8 A;  3WWX A;  3IS2 A;  4NXG A;  2GNX A;  3KO6 A;  5TJJ A;  5G4Y A;  5CGX A;  4FH2 A;  4M4X A;  5KIZ A;  1DJA A;  1XFN A;  3ISG A;  5D3O A;  3TSG A;  4U3T A;  4F94 A;  1ERM A;  5FDS A;  1LSW A;  2W27 A;  4MEZ A;  5FA7 A;  3I7J A;  3T4S A;  1P0Z A;  2GX5 A;  3WS5 A;  4HH3 A;  3LI9 A;  3MQO A;  4GLQ A;  3HRE A;  3S22 A;  1FQG A;  4DJ2 A;  2G2U A;  2O9A A;  4MDZ A;  1XJ4 A;  3D3O A;  1BT5 A;  3FKV A;  3SH7 A;  2UWX A;  4ZDX A;  2X02 A;  1FR1 A;  3G31 A;  4QPR A;  2K2N A;  2P9V B;  4NEE D;  2C5W B;  3LR0 A;  4Y3I A;  5EM1 A;  4QWO A;  2PHY A;  3CMZ A;  4JXW A;  4LCL A;  2H0T A;  4XUX A;  1GA0 A;  1ZC2 A;  4YOF A;  2BG1 A;  3W4Q A;  3LIB A;  3LR3 A;  3IWO A;  3HCY A;  2ZJ9 A;  1ODV A;  1YLJ A;  1PZO A;  2WUQ A;  3HLE A;  3OPL A;  3IHB A;  2XH9 A;  4IBX A;  2PR5 A;  4MLL A;  5E2H A;  4KG6 A;  3RTY A;  3A0S A;  3HLB A;  5DJT A;  4QD4 A;  2WKQ A;  1K4E A;  4HJ6 A;  3NJA A;  4LV2 A;  1S4R A;  4LRY C;  4OPQ A;  4GJ4 A;  5F68 A;  2Y2Q A;  1HZO A;  5LBR A;  2M7U A;  1ZTU A;  4XT2 A;  3T4T A;  2INW A;  1VM1 A;  1PWD A;  4OVD A;  3G2Z A;  2Y2H A;  4Y0T A;  5EE8 A;  4S2N A;  1KE0 A;  2EFU A;  2ZQA A;  1YT4 A;  2QYB A;  2PT7 A;  4KZ4 A;  4ZJ3 A;  2V0U A;  1YSQ A;  2P04 A;  3UB6 A;  5CHU A;  2ZC3 B;  5M19 A;  4O0P A;  3PBT A;  2R9X A;  1MBL A;  1E25 A;  1MWT A;  4XT2 B;  5CHJ A;  1RCJ A;  2H5S A;  1CQA A;  2OWH A;  3TE8 A;  3CLO A;  2ZBB A;  4X1L A;  1IOU A;  4HNB A;  3DTI A;  2JC7 A;  3OPP A;  2BAS A;  2FFF B;  4E3O A;  3OCN A;  3L9K A;  1OTE A;  2WGW A;  3UB5 P;  3S7Q A;  5HWV A;  2QMI A;  3CIT A;  3RXW A;  5K5B A;  3KSI A;  2OAQ 1;  1YQS A;  2WGI A;  3VMA A;  4DDS A;  2G2W A;  5KSH A;  4GHI B;  2X01 A;  3OOV A;  2VEA A;  4OKP A;  4PKY A;  3Q7Z A;  3MFD A;  1SKO A;  2EX6 A;  1DJB A;  4NG2 A;  4BQM A;  3T4O A;  4LPZ A;  1PRQ A;  5FAO A;  4Z1W A;  2W3H A;  4RA7 A;  4YFM A;  5FDH A;  1PYY A;  1GSV A;  5DTK A;  5GLA A;  4ZRR A;  5EEC A;  3Q7V B;  3HUN A;  2Y59 A;  4KQD A;  4JGO A;  5FEF A;  4JBF A;  2PD8 A;  4FSF A;  4WBG A;  2DNS A;  2Y2M A;  3KYE A;  1ZG4 A;  5IT5 A;  4X68 A;  1GHI A;  2M1C A;  3Q81 A;  4L0L A;  4B93 A;  1TS0 A;  3ZGA B;  2KX6 A;  5HFO A;  3G6O A;  1NLY A;  4JF6 A;  1A0K A;  4OP8 A;  3E98 A;  2V1B A;  4LGW A;  4YNR A;  4YIN A;  5HPI A;  1NYM A;  1FR6 A;  3UME A;  4HBT A;  4EER A;  3CPT A;  1H5X A;  2PD7 A;  1M40 A;  2VX8 A;  2V20 A;  1XJ2 A;  1Y28 A;  4S2K A;  3LO7 A;  5IU1 A;  2GDN A;  5JYO A;  4K08 A;  3FYZ A;  4OLG A;  4K0X A;  4Y0U A;  4PPR A;  4G3W A;  1LI9 A;  4E3N A;  3GSG A;  5HAI A;  3S7N A;  1JWP A;  3VE3 A;  1FOF A;  2V1Z A;  1XA1 A;  4JXG A;  2IWB A;  2Y2I A;  3SW1 A;  1DRM A;  1SDN A;  3WS4 A;  3Q7V A;  1NY0 A;  3HLW A;  1S66 L;  5DF9 A;  3T4Q A;  5M18 A;  3HL9 A;  4WL9 A;  4KUO A;  3IT9 A;  3TG9 A;  3JPU A;  1KVM A;  3EOI A;  1JTD A;  3U2A A;  4O8G A;  4OOY A;  4X25 A;  3GDI A;  5AVF A;  4P0M A;  2WKI A;  1NJ4 A;  3CHW P;  3BEC A;  2C6W B;  2GJ3 A;  2WK0 A;  1ES4 A;  1S1Z A;  3Q82 A;  1VQQ A;  3MZE A;  1DY6 A;  3Q1F A;  1CJF A;  3P01 A;  2KLI A;  4NKP A;  3O87 A;  5TBM A;  3E2L A;  3E0Y A;  4Z9Q A;  2HPB A;  5HD3 A;  5A91 A;  4P85 A;  5HDC A;  2XFS A;  3NUL A;  1LL5 A;  4JF4 A;  3ZG7 B;  5TR7 A;  1VB6 A;  2W3G A;  5FAS A;  4KG2 A;  5HSQ A;  2VLG A;  4BBT A;  5I5L A;  3HJI A;  4BD0 A;  1H8Y A;  1MWS A;  1H0M A;  4Q0H A;  1KGG A;  3ZNT A;  3C4O A;  3IH8 A;  3KYQ A;  1JNU A;  5EPH A;  3QP4 A;  1XFQ A;  4ARZ A;  1YM1 A;  3JVU A;  3T1S A;  3QNC A;  1K54 A;  2NUT C;  4MBH A;  1UWP X;  2PBY A;  3E4Q A;  3IXH A;  1W8Y A;  3G4P A;  3IX8 A;  3VSL A;  2Y2K A;  2O9C A;  1L0F A;  3R4K A;  3FZC A;  1K56 D;  1LT0 A;  2CMN A;  3PTE A;  1J3W A;  1MXO A;  1K55 C;  1UWN X;  3BLS A;  4UQI M;  3BFG A;  4EEU A;  3CWF A;  4EW7 A;  1PZP A;  3G34 A;  3TRC A;  1K54 C;  1N4O A;  4WEJ A;  4QHC A;  4GDB A;  4EU0 A;  2ZC5 B;  1SKF A;  3DAV A;  3CI6 A;  2W1T B;  2Q9N A;  4JXS A;  3S7P A;  4LEN A;  4Y7P A;  5FSR A;  2IWC A;  3P98 A;  1PFL A;  4PHT A;  1C3B A;  2FH5 A;  3TW8 A;  2YKH A;  3MZF A;  2PRF A;  3IF6 A;  3N8S A;  3UO9 A;  1T19 A;  3HLG A;  4N92 A;  2L1M A;  4WEL A;  1CI8 A;  2VA0 A;  3B47 A;  1FIK A;  1H8Z A;  3FV7 A;  3BEB A;  3VOL A;  3LR5 A;  1TF1 A;  5DKK A;  3FG8 A;  4N1X A;  2EWV A;  3OC2 A;  4WUJ A;  4OQG A;  4I3J A;  4EV4 A;  4KZ7 A;  2H10 A;  2H28 A;  3W8K A;  2W3E A;  2Y2J A;  3HLD A;  3MF0 A;  2HZ5 A;  3VFH A;  5GL9 A;  4GS9 B;  1YPR A;  3P7N A;  4MNR A;  1L0G A;  1W8Q A;  2XD5 A;  4EBN A;  1IEM A;  2A49 A;  3C5A A;  3SS3 A;  4HEF A;  3G30 A;  1VET B;  4H6J B;  3C2W A;  5E2F A;  1SDE A;  4S2P A;  4U0X A;  1ERO A;  2QHK A;  4QJG A;  3GMW A;  1GSW A;  4HH2 A;  3VP2 A;  3NBL A;  3CJM A;  2D02 A;  3ZDJ A;  2JKT I;  4WMC A;  2Y4A A;  1GHP A;  4CLC E;  2O99 A;  2HP6 A;  3EEH A;  1K4F A;  2QPN A;  4PM8 A;  1FCO A;  4CPK A;  5KZH A;  4KQR A;  2XDM A;  4O01 A;  1K56 A;  2D01 A;  5FAT A;  1V9Z A;  4P6Z M;  5FQ9 A;  5HL6 A;  1MWR A;  4II7 A;  4E3J A;  3BFC A;  1IYQ A;  4E6W A;  4LRZ E;  3V3R A;  4BBU A;  2B18 A;  3LID A;  3ZVT A;  2XRN A;  3WS2 A;  2JN7 A;  3VOY A;  3PBN A;  3GQZ A;  1PWG A;  4WLA A;  2ZQ7 A;  3UY6 A;  4PM7 A;  4XXR A;  3FPV A;  4JLF A;  1I5Q A;  3V50 A;  4NK3 A;  1PNE A;  5DFX A;  1LL8 A;  3ICY A;  4MCW A;  4RX2 A;  2XD1 A;  4OP5 A;  3IXG A;  2HDS A;  2LB9 A;  3PAG A;  4R38 A;  1ERQ A;  2V8F A;  3BYD A;  4R6L A;  3NI9 A;  1XJ6 A;  1SHV A;  3H82 A;  4OPZ A;  1ZHH B;  2L0W A;  1JVJ A;  3BWL A;  4I3A A;  4GS9 A;  4E3K A;  4CLC C;  4U0T A;  3N8R A;  4LV0 A;  2ZM8 A;  4P6B A;  3GEC A;  4I38 A;  4R3B A;  2OLU A;  3G2Y A;  4ETX A;  3K3D A;  1ALQ A;  3C30 A;  3MJQ A;  5I94 A;  2K31 A;  4OPR A;  3LI8 A;  2HF6 A;  2FFY A;  3W2Z A;  4S2M A;  2V8C A;  1OTD A;  4PAU A;  1S0W A;  1QMF A;  3F1P A;  2ZOI A;  4B4Z A;  5CGS A;  1AXB A;  3HLF A;  2XA7 S;  4BL2 A;  1KOU A;  1Z09 A;  5EOO A;  5TGF A;  1DP9 A;  1F9I A;  5L09 A;  3SZT A;  3PBO A;  1K38 A;  2WAD A;  2ZL1 B;  1CEF A;  2HDQ A;  3MKF A;  3PR6 A;  2WZZ A;  1BYW A;  1YLP A;  4PM5 A;  4JPM A;  2JKF A;  2JE5 A;  3OLO A;  1ES2 A;  1U60 A;  1BUL A;  3MR0 A;  3O5Y A;  3MBZ A;  3LEZ A;  4NET A;  5DKL A;  3KSH A;  4FUW A;  2HDU A;  4G3V A;  3VE4 A;  4D60 A;  4Y0O A;  5HAP A;  4OON A;  5HDD A;  3A0V A;  1K6R A;  1XKZ A;  1OTI A;  1TEM A;  3D9Y A;  2IWD A;  4Q0I A;  2A24 A;  3IWI A;  1L2S A;  2Q0O A;  3DWZ A;  3BQA A;  1QME A;  3IF5 A;  5A92 A;  3UN7 A;  4HJ4 A;  1L3L A;  3LFV A;  3ULF A;  1N9O A;  4O7D A;  5FAQ A;  2BTF P;  4KQO A;  1S67 L;  3HLC A;  1W63 Q;  1K0K A;  5GLC A;  4X56 A;  3ZNY A;  1OME A;  2I72 A;  1E4D A;  4IUH A;  4GCZ A;  3NDG A;  2RCX A;  5AJG A;  2Y2G A;  5GHZ A;  3F1P B;  1I2W A;  3DWK A;  1XXM A;  3GRJ A;  1RGY A;  1Y4O A;  3HJK A;  1SKO B;  1ESU A;  3A0R A;  2ACG A;  1XPB A;  2J3T C;  3LY3 A;  4WM9 A;  5FEG A;  2DRW A;  3OPR A;  3R7W A;  5HAQ A;  5FQQ A;  4FTX A;  4E6X A;  4AFI A;  3MXS A;  5DF7 A;  2ZL1 A;  2HV1 A;  1VHM A;  5GLD A;  1BLP A;  1FIL A;  4QY5 A;  1OTB A;  4CQH A;  1JTG A;  2P9V A;  3CAX A;  3RFB A;  3H9W A;  5FI6 A;  1MKM A;  2HP5 A;  3OZH A;  3KYZ A;  1VET A;  2QWS A;  3PBR A;  4PM6 A;  1NRF A;  3T1R A;  2XRO A;  3ZQ5 A;  3EWK A;  3UE6 A;  5E2G A;  1P9W A;  5AQB A;  4MBK A;  3ZFZ A;  1AWI A;  2IA2 A;  4ETZ A;  5TBM B;  3UPP A;  5EM0 A;  5TFQ A;  4LV1 A;  3UB9 A;  3P09 A;  3LY4 A;  3VP1 A;  2EXB A;  1S6R A;  3CZD A;  1BZA A;  5A8B A;  5GHY A;  3C7U A;  2ZMF A;  3UE3 A;  4GD6 A;  1TDL A;  3VSK A;  4C75 A;  2QJ5 A;  3CUE C;  3MQ0 A;  1SCW A;  1L0E A;  3FPW A;  4GZB A;  3W4P A;  3TJZ C;  4OOL A;  5G18 A;  4S2J A;  4KZ6 A;  4GHI A;  4IVK A;  3V39 A;  2W3D A;  2XFT A;  1TD5 A;  3EGX C;  2MJ6 A;  3NOT C;  2ZQ9 A;  4I5S A;  3ZG8 B;  5CGW A;  3IX4 A;  1TS7 A;  5J3W A;  1ZKJ A;  2J7V A;  3MS6 A;  4R0Q A;  1VEU A;  1Z6F A;  4GKU A;  1WE4 A;  1O7E A;  4GB7 A;  3LCE A;  5IS1 A;  4DE0 A;  4Q8I A;  3DBA A;  1O07 A;  4S2I A;  3AGE A;  3OPH A;  5HAR A;  3QP2 A;  1IYS A;  3LGO A;  3BFE A;  4C6Y A;  5CHM A;  4GDN A;  4HP4 A;  5HD5 A;  3S1Y A;  2ZQ8 A;  5CTN A;  4UEY A;  3BFD A;  4N9L A;  3UDI A;  2QZ6 A;  2R9W A;  5FI7 A;  1T1B A;  4UA6 A;  3RJU A;  4EBL A;  1D1J A;  4E3M A;  2PAV P;  4DF6 A;  3EQU A;  2V2F F;  1K25 A;  3KSG A;  1BSG A;  2Y91 A;  1M6K A;  4KG5 A;  4FH4 A;  4RVA A;  4DRT A;  4B4X A;  1W5D A;  2W1T A;  5EVI C;  1HD8 A;  1Y54 A;  2ZMV A;  3VP4 A;  1H3Q A;  3LEQ A;  2G7U A;  3HBR A;  4Y15 A;  5HW3 A;  3IH9 A;  5CEC A;  3IBR A;  2JHE A;  4QB8 A;  3IQA A;  3PBQ A;  4OOM A;  4IUK A;  2WZX A;  4EQ1 A;  3FKW A;  5L07 A;  1NZO A;  5EFW A;  3BLM A;  4GOG A;  1K57 C;  3IS2 B;  4P6Z S;  2A3U A;  2JKT M;  3LYX A;  1MZU A;  3IX3 A;  4NXE A;  3BQ8 A;  1FSY A;  1FCM A;  3A3E A;  3A3F A;  3T4K A;  1VEU B;  4Q0J A;  2Z6D A;  3T4J A;  5FL3 A;  4R4R A;  2ZD8 A;  4HJ3 A;  3NOP C;  3S7O A;  4IHQ A;  2DCF A;  4L9G A;  2Y2P A;  2E8J A;  1PW1 A;  1YLZ A;  4DE1 A;  5EVI B;  1EWZ A;  3F1O B;  3EQV A;  3NHQ A;  1IKG A;  2VV8 A;  1WA9 A;  4C3Q A;  2VGJ A;  4X55 A;  5BOH A;  1NRJ A;  2Y2N A;  4WF0 A;  1F2K A;  3H7W B;  1KE3 A;  3RH8 B;  3VOZ A;  2ZC7 A;  1EI5 A;  2QJ7 A;  1RGZ A;  2VKS A;  1DP8 A;  3PHY A;  1UGU A;  5F82 A;  3D4F A;  1BUE A;  2XGN A;  4IBR A;  1D7E A;  5FAP A;  1ES3 A;  2W3F A;  4WEK A;  4X53 A;  1RP5 A;  4IVI A;  4UAA A;  2ZM2 A;  1G6A A;  2WKP A;  2VZW A;  2J3W A;  2P08 A;  1IFQ A;  3DW0 A;  4ZTK A;  2PR6 A;  5DTT A;  4MN7 A;  1NLZ A;  3UPN A;  3NOU C;  4X6T A;  1YLW A;  3K2N A;  4RYE A;  3ZG0 A;  3NEC A;  4WZ4 A;  2RL3 A;  4DE3 A;  4PM9 A;  4N9K A;  3B42 A;  4LRX C;  3CUE A;  1DJC A;  3PXP A;  3JYI A;  4I3I A;  3EEA A;  4LV3 A;  3N6I A;  1NWZ A;  2WAF A;  3M6B A;  4HBU A;  1XGI A;  3LR4 A;  3B3X A;  3T1Q B;  3E4P A;  4ZJ1 A;  4UA9 A;  1YKD A;  2EX2 A;  3O86 A;  4S2L A;  3QP5 A;  4FOF A;  2WGW B;  1XP4 A;  2Y2O A;  4F3L A;  4OLD A;  4ZBE A;  1V9Y A;  4FCF A;  1KGE A;  3D72 A;  2M7V A;  2W1R A;  1YLY A;  4HY8 A;  2HGV A;  3G35 A;  1X0O A;  3O3V A;  4WMC D;  3IXB A;  5DJU A;  1T1A A;  2Q9M A;  4KZB A;  2CC1 A;  1MPL A;  3BRM A;  1CEG A;  3MFX A;  1S4S A;  1W79 A;  2ZOH A;  2P7J A;  2Z6C A;  4JGQ A;  4NXB A;  1W7F A;  1KDW A;  2VV6 A;  3BW6 A;  4ARZ B;  2B5R A;  3MXQ A;  5MC7 A;  4BWI A;  3EGD C;  3OBF A;  4R4S A;  1KVL A;  4EUZ A;  1IKI A;  1MC0 A;  4UA7 A;  3H7W A;  1LHY A;  4KZ9 A;  3VP3 A;  4DN0 A;  4ID4 A;  2V1A A;  4R1G A;  4KEN B;  5EUA A;  2PU4 A;  5EVI A;  3PAE A;  4X1M A;  1LL9 A;  5F69 A;  3SS5 A;  4R70 A;  2Z2M B;  4HP9 A;  4F3L B;  2V9A A;  2R78 A;  1MWU A;  3GV9 A;  4PMA A;  2EX8 A;  2Y2L A;  1ESI A;  1K57 A;  3A3I A;  1WYB A;  5HWW A;  2H0Y A;  1YMS A;  1PW8 A;  3ZCZ A;  1EW0 A;  3C4P A;  3ZHH A;  2ZC4 B;  4E04 A;  2WKH A;  5A90 A;  5JYP A;  1XJ3 A;  1YAX A;  1JWZ A;  3BY8 A;  5M1A A;  5EVL A;  1NZU A;  2J9P A;  3QNB A;  1K6S A;  4HI4 A;  2HP9 A;  3LIF A;  3ITB A;  4BLM A;  1I2S A;  4R3A A;  3M6H A;  3H82 B;  2VGL M;  5AVE A;  4OQI A;  3W4O A;  3JVV A;  3O88 A;  1N9B A;  2XA7 M;  3VP0 A;  2OSU A;  2PYR A;  1GCE A;  4ZJ2 A;  3BY9 A;  3LIC A;  3HVF A;  3CG5 A;  4LFU A;  1G68 A;  1K55 A;  5CED A;  4GW9 A;  5CEB A;  3NY4 A;  1MKI A;  3IXD A;  3M2J A;  2LB5 A;  4JGP A;  1CI9 A;  3GR2 A;  3ZYT A;  3HUO A;  1E3U D;  3ZG9 B;  4BEN A;  2XF3 A;  4PKY G;  4BJP A;  2OWJ A;  3DTE A;  1GHM A;  1F98 A;  1P9R A;  2AVX A;  1KGF A;  1FSW A;  3UPO A;  5A93 A;  4OPY A;  3N7W A;  4NXF A;  5CTM A;  4BMW A;  1CF0 A;  2P74 A;  3GTC A;  2Y8H A;  5DF8 A;  3V5M A;  4R3J A;  5EVE A;  4B88 A;  4JF5 A;  4HQA A;  2K7S A;  3G32 A;  3GVB A;  3LIE A;  3QP6 A;  1KDS A;  1BLS A;  5AQ9 A;  3MMH A;  3KX0 X;  4BD1 A;  5CER A;  4HHD A;  1DP6 A;  4GNU A;  4ESP A;  4QU3 A;  3UE1 A;  4K91 A;  5KSC A;  2EX9 A;  4ME4 A;  1PIO A;  5EVI D;  2XR0 A;  2DMW A;  2J3T D;  4ZAM A;  1TDG A;  1CK3 A;  4B9O A;  5FQK A;  5FQM A;  2A2L A;  4EEP A;  5F1G A;  1HTZ A;  3DTM A;  3NIA A;  5HZH A; 
#chains in the Genus database with same CATH homology
 4RQ9 A;  4L9F A;  2GZA A;  1STZ A;  4YOF A;  3IBR A;  2JHE A;  4H6J B;  3LIB A;  3C2W A;  4OOM A;  3PBQ A;  3LR3 A;  4IUK A;  3HCY A;  1G28 A;  1G6O A;  4EQ1 A;  2QHK A;  4MMN A;  1ODV A;  1GSW A;  2OAP 1;  2KDK A;  3B33 A;  4HH2 A;  5EFW A;  4EUV A;  2D02 A;  2JKT I;  3IS2 B;  4EET B;  4P6Z S;  4CLC E;  2O99 A;  2JKT M;  3LYX A;  1MZU A;  3EEH A;  3LUQ A;  4NXE A;  3BQ8 A;  1N9N A;  5F6A A;  2VJW A;  2PR5 A;  4O01 A;  3T4K A;  3RTY A;  3C8C A;  2D01 A;  2FZ0 A;  3A0S A;  1F5M A;  4MN6 A;  1V9Z A;  4Q0J A;  4P6Z M;  5L8M A;  2EA9 A;  5DJT A;  2Z6D A;  2PDR A;  3T4J A;  2WKQ A;  5FL3 A;  5HL6 A;  4HJ6 A;  3NJA A;  4HJ3 A;  3NOP C;  1S4R A;  4LRY C;  3S7O A;  4II7 A;  1OT6 A;  4GJ4 A;  5F68 A;  5LBR A;  4IHQ A;  4L9G A;  2HJE A;  4IJG A;  4LRZ E;  2M7U A;  1ZTU A;  4XT2 A;  3F1O B;  3EQV A;  4BBU A;  3NHQ A;  3T4T A;  2B18 A;  3LID A;  2XRN A;  2VV8 A;  1WA9 A;  2JN7 A;  2INW A;  3PBN A;  3F1N A;  5HWT A;  1NRJ A;  4WLA A;  4WF0 A;  3H7W B;  3K3C A;  3FPV A;  5G4Z A;  1OPX A;  3RH8 B;  5DFX A;  4Y2F A;  1LL8 A;  2QJ7 A;  2B02 A;  3ICY A;  4MCW A;  2QYB A;  2PT7 A;  2VKS A;  2LB9 A;  1DP8 A;  2V0U A;  3PHY A;  4R38 A;  1YSQ A;  1UGU A;  2P04 A;  2A24 B;  1OTA A;  1LSX A;  4R6L A;  1XJ6 A;  3UB6 A;  1D7E A;  5HDS A;  3H82 A;  4O0P A;  3PBT A;  2W3F A;  5HPF A;  1ZHH B;  3OCL A;  1LSV A;  4WEK A;  2L0W A;  4XT2 B;  1GSX A;  3BWL A;  4I3A A;  3TE8 A;  2OWH A;  2WKP A;  3CLO A;  2ZBB A;  4GS9 A;  4G3K A;  4CLC C;  2VZW A;  1IOU A;  2J3W A;  4HNB A;  3T50 A;  2P08 A;  3GEC A;  4I38 A;  5DFY A;  1IFQ A;  2PR6 A;  2BAS A;  2O9B A;  4ETX A;  3OCN A;  3K3D A;  1OTE A;  3C30 A;  4WN5 A;  3MJQ A;  2K31 A;  4MN7 A;  3S7Q A;  1NLZ A;  3LI8 A;  2HF6 A;  3NOU C;  3W2Z A;  1OTD A;  4PAU A;  5HWV A;  3CIT A;  3K2N A;  3F1P A;  2ZOI A;  5K5B A;  3KSI A;  2OAQ 1;  2XSS A;  4MN5 A;  1P97 A;  5KSH A;  5J7E A;  2XA7 S;  4GHI B;  3OOV A;  1KOU A;  2VEA A;  4PKY A;  3B42 A;  3BJN A;  4LRX C;  3CUE A;  3PXP A;  1DP9 A;  4I3I A;  2W0N A;  3EEA A;  1F9I A;  3T4O A;  5C5K A;  4LPZ A;  1NWZ A;  3PBO A;  5F5Y A;  2L4R A;  3F1N B;  3LR4 A;  1T1C A;  4Z1W A;  2W3H A;  2YKF A;  4HOI A;  3PR6 A;  1BYW A;  3E4P A;  1GSV A;  1YKD A;  4ZRR A;  3OLO A;  4KQD A;  4JGO A;  1TS6 A;  3MR0 A;  4FOF A;  3O5Y A;  2PD8 A;  4FSF A;  4EES A;  5DKL A;  5IT5 A;  4HIA A;  3KSH A;  3LIA A;  4F3L A;  2M1C A;  4L0L A;  1V9Y A;  4G3V A;  4B93 A;  1TS0 A;  3D72 A;  2J80 A;  1OJ5 A;  2M7V A;  3VE4 A;  4EXO A;  2W1R A;  4BBV A;  4HY8 A;  2KX6 A;  2HGV A;  5HDD A;  1W63 M;  3G6O A;  3A0V A;  1NLY A;  1X0O A;  3V67 A;  4Y5F A;  3E98 A;  1OTI A;  2V1B A;  5HPI A;  4YNR A;  5DJU A;  1T1A A;  4I39 A;  4UQI S;  3UME A;  4Q0I A;  4EER A;  3MFX A;  1S4S A;  2A24 A;  2ZOH A;  4LLO B;  2P7J A;  2Z6C A;  4JGQ A;  4NXB A;  3BQA A;  2VV6 A;  3BW6 A;  2PD7 A;  4ARZ B;  3PBS A;  3MXQ A;  5MC7 A;  4HJ4 A;  1H8M A;  2VX8 A;  4BWI A;  3OBF A;  3EGD C;  3LFV A;  1XJ2 A;  1Y28 A;  3F1O A;  5IU1 A;  3ULF A;  1N9O A;  1MC0 A;  3H7W A;  4KQO A;  1S67 L;  4K08 A;  3VV4 A;  1W63 Q;  3KSF A;  2KOI A;  4G3W A;  4DJ3 A;  2VV7 A;  3E4O A;  4DN0 A;  2O0Y A;  3MQQ A;  2V1A A;  3S7N A;  3VE3 A;  4IUH A;  2V0W A;  4GCZ A;  4DMZ A;  5AJG A;  1S1Y A;  4L9E A;  3F1P B;  3SW1 A;  1DRM A;  4CLC A;  2JKR M;  1S66 L;  5DF9 A;  5J4E A;  3T4Q A;  5F69 A;  3HJK A;  4WL9 A;  4KUO A;  3A0R A;  4R70 A;  4HP9 A;  4F3L B;  2J3T C;  2V9A A;  3EOI A;  2R78 A;  3R7W A;  3U2A A;  4O8G A;  4AFI A;  3GDI A;  5AVF A;  5HWW A;  1TS8 A;  2HV1 A;  1VHM A;  4YWZ A;  1EW0 A;  2WKR A;  1OTB A;  3IBJ A;  4CQH A;  4E04 A;  3CAX A;  2GJ3 A;  3RFB A;  3H9W A;  1MKM A;  1XJ3 A;  1S1Z A;  1YAX A;  3UB8 A;  3BY8 A;  4H6J A;  2NUP C;  2JKR I;  3P01 A;  2KLI A;  4NKP A;  3KYZ A;  5TBM A;  2QWS A;  2QKP A;  3PBR A;  2XRO A;  3E0Y A;  3ZQ5 A;  4CLC B;  3EWK A;  1YSP A;  2Y79 A;  4HI4 A;  5HD3 A;  3UE6 A;  5HDC A;  2OOL A;  1P9W A;  4JGR A;  2IA2 A;  3LIF A;  1D06 A;  2HJ9 C;  5TBM B;  4ETZ A;  2EWW A;  3T4L A;  1VB6 A;  2W3G A;  4CLC D;  2PYP A;  4R3A A;  2VGL S;  5HSQ A;  3UB9 A;  2VLG A;  4BBT A;  3H82 B;  5I5L A;  3HJI A;  2VGL M;  5AVE A;  3JVV A;  3UMD A;  5A8B A;  4Q0H A;  2XA7 M;  2PYR A;  3KYQ A;  1JNU A;  2ZMF A;  3UE3 A;  1XFQ A;  3BY9 A;  3LIC A;  2QJ5 A;  4ARZ A;  3CUE C;  3MQ0 A;  3FC7 A;  3PYP A;  1N9L A;  3JVU A;  4GW9 A;  5CX7 A;  3FPW A;  2I9V A;  3TJZ C;  2NUT C;  4OOL A;  1UWP X;  3E4Q A;  4KUK A;  2LB5 A;  4GHI A;  4JGP A;  1OJG A;  2W3D A;  1TD5 A;  3R4K A;  2O9C A;  3C38 A;  3EGX C;  3ZYT A;  2MJ6 A;  3UB7 A;  1LT0 A;  3NOT C;  3R7W B;  2CMN A;  4I5S A;  1UWN X;  4PKY G;  1TS7 A;  4BJP A;  1T18 A;  4UQI M;  5J3W A;  4EEU A;  2OWJ A;  3CWF A;  4EW7 A;  1F98 A;  1P9R A;  1OT9 A;  5IS1 A;  3TRC A;  4WEJ A;  3IS2 A;  4EU0 A;  4NXG A;  3DBA A;  4NXF A;  2GNX A;  3KO6 A;  5TJJ A;  5G4Y A;  3CI6 A;  4BMW A;  2W1T B;  2Y8H A;  4M4X A;  5KIZ A;  3S7P A;  4PHT A;  1XFN A;  4HQA A;  2K7S A;  2FH5 A;  4HP4 A;  3TW8 A;  5HD5 A;  2YKH A;  1LSW A;  2W27 A;  4UEY A;  3LIE A;  1T19 A;  2L1M A;  4WEL A;  2VA0 A;  3B47 A;  1P0Z A;  2GX5 A;  3T4S A;  1T1B A;  3VOL A;  3LR5 A;  4HH3 A;  3LI9 A;  3MQO A;  4GLQ A;  1TF1 A;  3MMH A;  3KX0 X;  5DKK A;  4DJ2 A;  3FG8 A;  4HHD A;  1DP6 A;  2EWV A;  3OC2 A;  4WUJ A;  4I3J A;  2O9A A;  3EQU A;  3KSG A;  2H28 A;  4MDZ A;  1XJ4 A;  3D3O A;  4ME4 A;  2W3E A;  2DMW A;  2J3T D;  2W1T A;  4QPR A;  3MF0 A;  2K2N A;  4GS9 B;  4NEE D;  2ZMV A;  4B9O A;  3P7N A;  2A2L A;  1H3Q A;  4EEP A;  2G7U A;  3LR0 A;  4Y3I A;  5HZH A;  2PHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...