1S67L

Crystal structure of heme domain of direct oxygen sensor from e. coli
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
119
structure length
119
Chain Sequence
NAADGIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yddU
publication title Insights into signal transduction involving PAS domain oxygen-sensing heme proteins from the X-ray crystal structure of Escherichia coli Dos heme domain (Ec DosH)
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxygen storage/transport
total genus 23
structure length 119
sequence length 119
chains with identical sequence U
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s67L00
1XJ6A 4JGPA 4BBVA 4I39A 3LI8A 3LICA 5AVFA 2PDRA 3EEHA 1OT9A 1S1YA 2B02A 3MXQA 5HZHA 1T1BA 1DP9A 4I3JA 1UWNX 4KQDA 4GHIB 2INWA 4F3LA 2PYPA 3UB6A 1N9LA 4EXOA 3GECA 4HNBA 4YWZA 3IS2B 3OLOA 3H7WB 2VLGA 3MQQA 4NXFA 3K3CA 5G4YA 2BASA 4R70A 1T19A 4EQ1A 2OOLA 1V9ZA 4H6JA 2H28A 2PYRA 2WKPA 3F1NA 2V1BA 1ODVA 3GDIA 3VE3A 2W27A 1OTEA 5HWWA 2D02A 2WKRA 2PD7A 4JGQA 3MJQA 3HJKA 4NXGA 4EERA 1NWZA 1OTIA 1DP6A 5EFWA 1OJ5A 3F1NB 3VOLA 2VV7A 1KOUA 1XJ2A 4DJ2A 1BYWA 2PR6A 4I38A 3BWLA 4I3IA 2V0UA 2K7SA 5TBMB 3LIFA 5DKLA 2L1MA 2WKQA 1GSVA 4BBTA 1S67L 3UB7A 1VB6A 3D72A 5F68A 3UE6A 2JN7A 3LYXA 3E4PA 5DKKA 2PHYA 2ZBBA 2W0NA 5HDSA 3UMDA 1EW0A 1TS6A 4L9FA 3CLOA 1TS0A 3LIAA 3F1OA 1S66L 2I9VA 4RQ9A 3B33A 3IBRA 1X0OA 4HQAA 3K3DA 4KUKA 1GSWA 5DJTA 4HH2A 1DRMA 5F69A 3RH8B 2QJ7A 3CAXA 1P97A 2YKHA 5HD5A 4R3AA 3LIEA 3PYPA 4HHDA 5HDDA 2D01A 2A24A 1UWPX 1F9IA 4K08A 2OWJA 5DJUA 3UMEA 4R38A 4LRXC 3H82A 4EEPA 2EA9A 4F3LB 1XJ4A 4EESA 3ZQ5A 1OTBA 1LL8A 3KX0X 3EWKA 3T50A 4HI4A 1D7EA 2QWSA 2Z6CA 3H9WA 3BY8A 4PKYG 4HY8A 2QKPA 2L0WA 1F98A 5HWTA 4H6JB 4EEUA 4LPZA 4NXBA 4GS9A 1LSXA 4KUOA 4JGRA 4XT2A 3FG8A 4LRZE 1LSVA 4LRYC 4PKYA 4E04A 4HOIA 4I5SA 4M4XA 3ULFA 3VE4A 3RTYA 2P7JA 2R78A 1S4SA 4GW9A 1XFQA 4NXEA 4L9EA 2V0WA 4LLOB 3LUQA 2CMNA 4HP4A 3NOPC 4WUJA 1T18A 2OWHA 3A0RA 3HJIA 1G28A 3G6OA 1TS8A 3C2WA 4GCZA 3UB9A 4HIAA 1S4RA 5HD3A 3MQOA 2KDKA 1D06A 2V9AA 2ZOHA 1XFNA 2V1AA 3F1OB 2PD8A 1XJ3A 3NOUC 2VV8A 3LIDA 5J7EA 1JNUA 4HP9A 4R6LA 1LSWA 4B9OA 4GHIA 3E4QA 3SW1A 4EW7A 3NOTC 1MZUA 3A0SA 5HDCA 4DJ3A 5I5LA 4HJ4A 4WF0A 2YKFA 3IS2A 3H7WA 3FC7A 3LIBA 3NHQA 3CWFA 1OT6A 1V9YA 3LI9A 5IS1A 2A24B 3NJAA 2GJ3A 4WL9A 1WA9A 4I3AA 5HWVA 2M1CA 5G4ZA 2VEAA 2VV6A 3C8CA 1TS7A 3H82B 3A0VA 4L9GA 5F6AA 2L4RA 1GSXA 1OTDA 5A8BA 2HV1A 2ZOIA 3E4OA 2J80A 5TBMA 1T1AA 5J3WA 3MFXA 3F1PA 4BBUA 2PR5A 4EETB 1N9OA 2QJ5A 1N9NA 4WLAA 2QHKA 4GS9B 5IU1A 4XT2B 1DP8A 2KX6A 1S1ZA 1UGUA 4WN5A 4HJ3A 1T1CA 4HJ6A 3P7NA 3F1PB 5F5YA 3UB8A 5KIZA 2Z6DA 1OJGA 3PHYA 4MN5A 3ICYA 4JGOA 5J4EA 2JHEA 4HH3A 1OTAA 1Y28A 5AVEA 4MN6A 1P0ZA 5HSQA 3MR0A 3BY9A 1LT0A
chains in the Genus database with same CATH superfamily
1VEUA 1PYYA 4K0WA 4KZ3A 3G35A 3O87A 3KSFA 1K4FA 2HDUA 4BBVA 4I39A 4KZ8A 3LI8A 4X69A 3NDGA 4C6YA 4ZAMA 2XFTA 3S7PA 3IXDA 5GLDA 2XA7M 2AVXA 2OV5A 3MXQA 3LEQA 2HP9A 5HZHA 1SZVA 2WGWA 2ZM0A 2WKIA 3N4IA 4PAUA 2INWA 4E3NA 5CGXA 2PYPA 3IF5A 3NI9A 4E3KA 4OH0A 1N9LA 3N8LA 3SZTA 3GECA 3IT9A 4E3LA 2WGVA 4UA9A 4FUWA 3HBRA 4EQIA 3WS1A 3HUMA 2ZJ9A 1V9ZA 2R9WA 4H6JA 5F1FA 2V1BA 1ODVA 3S7NA 4QPRA 1HD8A 3VOZA 1W63Q 3D4FA 4OQIA 5HWWA 2D02A 1IEMA 1YLZA 2WKRA 3QNBA 4KZBA 3MJQA 1NY0A 2EXAA 4WZ4A 3EEAA 1ONGA 1OJ5A 1BLSA 3VMAA 4DJ2A 1BYWA 3CHWP 2JC7A 4CPKA 2DCFA 3HUOA 3HUNA 3W8KA 3TE8A 1S67L 3UB7A 3JPUA 1H5XA 3D72A 2O0YA 1N9BA 2JN7A 5HL6A 4P87A 1RGZA 3E4PA 2DMWA 2GNXA 3V3RA 4LCLA 3D3OA 3OPHA 2X01A 5TGFA 3T1XA 1DY6A 5EVIB 3NY4A 2ZBBA 2W0NA 1EROA 3OCNA 5HDSA 3PBNA 1K54A 4L9FA 2QYBA 2XRNA 4PM6A 1EI5A 2V2FF 5CHMA 5A90A 3BQAA 1KE0A 4RQ9A 2QPNA 3DTIA 3B33A 3DWZA 3IBRA 3G32A 3E2KA 4MBFA 3UPPA 4RYEA 3RXWA 2ZLYA 5E2EA 5TJJA 3G30A 2GDNA 4HH2A 3IQAA 5F69A 3IHBA 2KLIA 3I7JA 1PWGA 5E2FA 3RH8B 4E6WA 4P6BA 3CAXA 4D60A 1GHPA 4ETZA 3L9KA 3PAEA 2YKHA 1L2SA 4R3AA 1NZUA 3LIEA 1ESUA 3PYPA 2HF6A 4E3JA 1WYBA 5HDDA 1KGFA 1YAXA 2D01A 4KENB 3Q7ZA 5EVID 2WGWB 1ZG4A 3MZEA 5DJUA 3ZDJA 4R38A 1OMEA 5FDSA 1XPBA 3GSGA 3T12B 2EA9A 3NC8A 2JKRI 3S7QA 3N8SA 3SH9A 3KX0X 1NXYA 3K2NA 1LHYA 2QWSA 1NYYA 2ZQAA 4N9LA 4PKYG 5HX9A 3WS4A 4AFIA 2QKPA 3LR0A 2A49A 2XK1A 2J9PA 4H6JB 5EOOA 4EEUA 4NG2A 3ZG0A 1FCNA 4JF5A 4KQQA 4JGRA 2X02A 3FG8A 1LSVA 4CLCE 1VQQA 4E04A 2H5SA 3KYEA 2V8CA 4S2NC 4HOIA 1K55A 3TSGA 3RTYA 4Z1WA 2WADA 4GZBA 1IYOA 1XFQA 3KSGA 3CJMA 2WKEA 1PNEA 4LLOB 5FI6A 4CLCB 4OPYA 2VA0A 3GRJA 4N1XA 1K57C 2CMNA 4FOFA 2O9BA 3HVFA 2Y4AA 5FEFA 1T18A 1K0KA 3A0RA 4EBLA 4S2MA 1YLYA 5CECA 2EWWA 3A3IA 1YMSA 5DFXA 1TS8A 4S2PA 4WBGA 1TVFA 1S4RA 3IWQA 1U60A 4ZRRA 2Z2MB 1HZOA 4B88A 1Z09A 1KVMA 3HLGA 2ZD8A 1VM1A 1BUEA 2PD8A 1E25A 2VV8A 5DFYA 4PM8A 5AQBA 5FATA 1LSWA 2LB5A 1K56A 4GHIA 4B9OA 4CLCC 4PM7A 2UV0E 3PBSA 4MLLA 1IELA 1CJFA 1MZUA 2ZQ7A 3IS2A 2IA2A 3H7WA 3OBFA 3FC7A 4NK3A 2P74A 3NECA 4UA7A 4WMCA 3WRTA 3Q81A 5EVLA 4E6XA 3NHQA 2Y2MA 1GA0A 3MZDA 2JKGA 3LR3A 4ARZA 3R7WA 3NJAA 2GJ3A 4OP8A 3N6IA 2M7VA 5G4ZA 4JF6A 1KDWA 4FH2A 1TS7A 3UDFA 2RCXA 3LFVA 3GVBA 4L9GA 3CUEC 3TG9A 3VSKA 1GSXA 4GDNA 1L0EA 1FR1A 2ZQDA 5CGWA 2J80A 2XSSA 5TBMA 4Y5FA 3QP4A 1T1AA 4H8RA 5GHYA 3A3EA 5L10A 3PXPA 2HP5A 2Y2JA 5CHJA 4BL3A 5CTNA 1N9OA 1N9NA 2FFFB 4WLAA 5HARA 3FKWA 4X53A 1TF1A 4WN5A 4HJ3A 1VHMA 1T1CA 4HJ6A 1PZOA 2Y2PA 2ZMVA 3BEBA 3LY4A 2FFYA 5F5YA 3U4LP 3UB8A 1L0FA 4ZBEA 4D2OA 4BL2A 2RL3A 4MN5A 4BWIA 3ICYA 4JGOA 5D3OA 1K25A 2IWBA 4HH3A 1OTAA 1Y28A 5KMWA 1P9RA 2HPBA 1C3BA 3S7OA 5M19A 3P09A 3VP3A 2PU2A 4BMWA 3MBZA 5KSHA 3T4SA 2ZC6B 1SDEA 4KZ7A 4KZ9A 5KZHA 1FILA 2WAFA 2PDRA 3G4PA 4IUHA 3EEHA 1S1YA 4IVIA 3NDEA 2B02A 4DE3A 4N1HA 2Y2QA 4S2OA 1T1BA 3M2JA 2J3TC 4GHIB 5GHXA 3V5MA 4F3LA 4PMAA 1BULA 5DF9A 5CGSA 4ZJ3A 1SKOA 4DMZA 3QNCA 2KOIA 4YWZA 3IS2B 3OLOA 1A0KA 3H7WB 1QMFA 1SDNA 4B4ZA 3K3CA 5G4YA 4BJPA 2BASA 4R70A 3IHAA 5G18A 2OLUA 2WKPA 1YPRA 5J8XA 3VE3A 2W27A 4YINA 3G31A 5U47A 4JXGA 4MN7A 1MY8A 1D1JA 4B4XA 4WM9A 2Y55A 2ZC7A 1FSYA 4EERA 1OTIA 4Q8IA 5EFWA 4KG2A 3DW0A 3F1NB 3PAGA 3BYDA 2VV7A 2XF3A 1KOUA 3Q07A 5FQ9A 3BJNA 1XJ2A 2VJWA 3GV9A 1F2KA 1MKMA 1PW8A 2K7SA 5TBMB 4Y0OA 4MMNA 1K56D 2WKQA 3BFDA 3O5YA 4ZJ2A 2WZXA 3VP1A 4HESA 5E2HA 5GLCA 3W4OA 5EECA 2VGLS 2ZMFA 3NIAA 3QP5A 4BD0A 2PHYA 2W1RA 2O9CA 3DTMA 3RXXA 3UMDA 4WMCD 4ID4A 4RA7A 4UQIM 2Q9MA 3LIAA 1S66L 1XGJA 5FAQA 4ZTKA 4X68A 1PWCA 2XEPA 3BLMA 4YOFA 4HQAA 1CF0A 3MKFA 1H8YA 1YLJA 1MXOA 4BENA 4KUKA 3BRMA 1GSWA 1FCMA 5DJTA 5EUAA 2GX5A 1DRMA 4K91A 2OSUA 4U0TA 3E2LA 2QJ7A 1QMEA 1P97A 4UAAA 2J7VA 3VP2A 5HD5A 1CEFA 4S2NA 3EQVA 5L2FA 1W8QA 3JVUA 4OP5A 1CK3A 1MWUA 1K4EA 4KZAA 4OQ0A 3VP4A 5BOHA 4ZDXA 1ERQA 1K57A 2OLVA 4LRXC 4F3LB 5HFOA 4X1MA 4R3JA 3ZQ5A 1LL8A 1SKOB 3D9YA 3S4XA 4DKIA 3B42A 4R23A 3GMWA 1D7EA 2XR0A 2W3EA 3UE0A 4N9KA 3BY8A 1STZA 1MWSA 2UWXA 1J3WA 3ZCZA 4XUZA 3CI6A 4R4RA 3LEZA 5TR7A 3DBAA 3T1QB 4LENA 4CLCA 3PTEA 4JF4A 4DE1A 1G68A 1K6RA 2OAP1 4PKYA 1YLTA 4OOLA 4YNRA 4I5SA 4Y3IA 1JWZA 3IX8A 1ONHA 4GB7A 5FAPA 2P7JA 1S4SA 4GW9A 4G3KA 4LGWA 2ZL1A 2V0WA 3IXBA 4DXBA 4QWOA 3PBOA 4Y17A 4HP4A 4GDBA 4DN0A 3FYZA 4WUJA 4O7DA 3QP6A 3KSHA 1G5UA 1O7EA 5HD3A 3CUEA 3OPPA 1BZAA 2Q9NA 2ZQCA 1XFNA 3A3FA 4GOGA 4GKUA 3IX4A 2K31A 3O3VA 3UDIA 3HLBA 3WS2A 3VV4A 4R6LA 5CRFA 3P98A 4KQOA 3E4QA 1NJ4A 4WZ5C 4EW7A 3NOTC 3SS5A 2PT7A 1AWIA 1AXBA 4MNRA 4OPRA 4BD1A 3FWLA 1PI4A 1FSWA 1W7FA 1Q2PA 5AQ9A 5EOEA 4MEZA 3KYQA 3LI9A 2B5RA 4WL9A 1WA9A 4I3AA 1JTDA 4LV2A 3GR2A 3C8CA 1LLBA 4R3BA 5HPFA 3HLWA 1ZTUA 3ZHHA 2EX2A 5F6AA 2WK0A 2L4RA 4E3MA 4JXWA 1PIOA 2XDMA 3S1YA 4RX3A 1LL5A 4KG6A 3MFXA 1GHMA 2HGVA 3CPTA 5EVEA 3UE3A 3UPOA 1SKFA 4Q0IA 1G6OA 3QP2A 5IHVA 4DXCA 3F1PB 1CQAA 4QD4A 5HAIA 2XLNA 4IBXA 5FI2A 2PBYA 3NULA 3ZG5A 1O07A 1OPXA 2B18A 3PBQA 2ZL1B 3W4PA 3CMZA 1BSGA 3TOIA 4MN6A 1P0ZA 2JKRM 5HSQA 3BQ8A 4KG5A 2HZ5A 4UEYA 1ES3A 3BY9A 5A92A 5FQQA 3T4TA 1XJ6A 4JGPA 4O0PA 3C4PA 4GD6A 3BFCA 5GLBA 4BQMA 5HPIA 3MKEA 2K2NA 3LICA 4HBTA 5AVFA 4M3KA 4CQHA 1W5DA 3O86A 3SS4A 1W63M 3P01A 4I3JA 3A3JA 1PW1A 4CLCD 4KQDA 1Y4OA 2OAQ1 4HBUA 4FD8A 1J9MA 3UO9A 1W8YA 4EXOA 2HDQA 5AQAA 4OLGA 2QZ6A 4HNBA 2EFUA 3IF6C 2JCHA 3UB5P 4NXFA 1FCOA 4OKPA 3T4LA 5C5KA 3B3XA 4EQ1A 2H28A 3UY6A 4UHUA 3F1NA 1ZG6A 5EM0A 3GDIA 1ZKJA 3L7HA 4Y15A 3TRCA 2PD7A 4JGQA 4ZJ1A 4CJNA 2A2LA 4UA6A 3T4KA 4X1LA 2ZC3B 3BW6A 4JLFA 3OPLA 2PU4A 4IVKA 4LV1A 1ALQA 3WS5A 3IBJA 1K38A 3MMHA 2PR6A 3BWLA 4I3IA 1VETA 4LV0A 3LIFA 5DKLA 4P6ZS 4R1GA 2JBFA 4BBTA 3FZCA 3N7WA 1VB6A 3UE6A 4R4SA 3LYXA 2EFXA 3CPTB 5DKKA 3HLDA 4OQGA 1M40A 4QJGA 3C7VA 4II7A 3IWOA 4HEFA 2XA7S 4JXVA 3MS6A 2I9VA 3M2KA 1YKDA 4X56A 3K3DA 2W1TA 2VGJA 1EWZA 1Q2QA 5FQJA 4B93A 5JYOA 5GLAA 1RCJA 1XGIA 4X55A 3UE1A 2R9XA 2WAEA 4IUKA 2PRFA 5TFQA 5MC7A 3BLSA 1N4OA 4E3IA 4GJ4A 4IEDA 1GHIA 3CG5A 4KQRA 5CEBA 3AGDA 3G2ZA 4HHDA 1NLZA 4ETXA 2FH5A 4DE2A 4Y0UA 4ME4A 4EUZA 1UWPX 1F9IA 4K08A 1MWRA 1BTLA 1NLYA 3LR4A 2J3TD 1NRFA 3LCEA 3SH7A 3UMEA 4OOMA 4EBPA 3H82A 4EEPA 5LBRA 1ERMA 3CITA 1XJ4A 3MF0A 2VGKA 1OTBA 1YLPA 3EWKA 4HI4A 1P9WA 5GHZA 1FIKA 1KGEA 3VOYA 2PBDP 4EWFA 4HY8A 1F98A 2L0WA 1XX2A 5CHUA 5HWTA 1TEMA 3ITAA 1MKIA 1S0WA 5DVAA 4S2IA 4NXBA 4QY6A 4GS9A 3E0YA 3IH9A 3PBTA 5HAQA 2P08A 4WZ5A 2CC1A 5HW3A 3MZFA 1F5MA 2EX9A 3SH8A 1TD5A 1LL9A 3ZYTA 3Q7VA 3FPVA 3ULFA 3VE4A 1CI8A 4NXEA 3VP0A 3T1RA 1PWDA 1VETB 1YLWA 3LUQA 2V8FA 1WYCA 2J3WA 3HL9A 4MBKA 3HREA 4QY5A 2H10A 2P04A 3HJIA 3VFHA 1ES4A 1G28A 3C2WA 1ES2A 2I72A 4GCZA 2Y2GA 1H0MA 1H8ZA 1KE3A 4FCFA 3MQOA 2KDKA 1D06A 2Y91A 2ZOHA 3HCYA 3UNWA 1FQGA 4WEJA 2HJEA 4OVDA 2P9VA 2Q0OA 2Y2IA 2E8JA 2V1ZA 3NOUC 3LIDA 1JNUA 4HP9A 4IHQA 3B47A 2W1TB 1XXMA 4KZ6A 2Y2KA 4EUVA 5HL1A 1DJAA 3KYZA 3IXGA 5L07A 1IYSA 4PHTA 2BLSA 1YSPA 4NETA 3LIBA 2WYXA 4Y0TA 3CWFA 3ZG8B 1OT6A 1V9YA 3EOIA 4DE0A 2EXBA 3QHYA 1E3UA 5IS1A 1ZHHB 1YQSA 4G3WA 4DRTA 5HWVA 2M1CA 2VV6A 4E3OA 5F82A 3H82B 2IWDA 3UDXA 3Q82A 2ZC4B 1Z6FA 3QP1A 1OTDA 5A8BA 1ESIA 3ZG9B 4PM5A 2Y8HA 4U0XA 2W3HA 1NYMA 3TJZC 3F1PA 4BBUA 3EGDC 1KDSA 1XA7A 4Q0HA 1I2WA 4OPQA 1BLHA 3O88A 2QJ5A 3HLCA 2H0YA 3JVVA 1CI9A 2QHKA 4GS9B 3PR6A 2XH9A 3IX3A 1DP8A 3DTEA 1I5QA 3V67A 3RFBA 5A91A 3IXHA 2Z6DA 4G3VA 2NUTC 4O01A 3PHYA 2J8YA 4EV4A 3Q7VB 3IF6A 4GLQA 1JTGA 1PFLA 2JHEA 2ZC5B 1LI9A 2ZMAA 5I94A 2VKSA 5CEDA 2HDSA 3R4KA 1M6KA 4N92A 4OPZA 4PPRA 4F94A 1SCWA 5FAOA 1LT0A 2BTFP 1RP5A 1PRQA 2VGLM 3AGEA 2XD5A 1XKZA 5FQIA 2H0TA 3G2YA 1L0DA 2WGIA 3IH8A 1OT9A 2P9VB 1I2SA 1KGGA 1DP9A 4GN2A 4WEKA 5EVIC 1VEUB 1GA9A 3WWXA 1UWNX 5DTTA 2QMIA 2BG1A 4WELA 4OQHA 2ZM2A 4JKTA 3DWKA 3UB6A 3BFEA 3U2AA 3IWIA 5AJGA 2IWCA 1MWTA 1MBLA 2VX8A 5AQ7A 1MPLA 3V3SA 2VLGA 3MQQA 1ACFA 5GL9A 2JKFA 3C7UA 4YFMA 5DF8A 4OONA 5K5BA 1T19A 2OOLA 1TDGA 1IKIA 2PYRA 2G2WA 4JBFA 4JPMA 1WE4A 1XP4A 3DAVA 3GTCA 1OTEA 5M18A 2XQZA 3ZGAB 2Y2LA 4FTXA 5FDHA 3HJKA 4NXGA 2XROA 3C38A 4Y7PA 5IT5A 1NWZA 5DF7A 1DP6A 3LY3A 3ZG7B 3VOLA 3HLFA 2W3GA 4Z9QA 1Y54A 5DTKA 4RVAA 4X6TA 5M1AA 1RGYA 4I38A 2V0UA 1TDLA 3MXSA 2Y2OA 4NEED 1IYQA 2L1MA 4P85A 1YT4A 1GSVA 4MBHA 1YSQA 2V20A 5F68A 3VSLA 1IOUA 2EX8A 2Y79A 4Q0JA 4XXRA 1IKGA 3W2ZA 4XUXA 3MSHA 2WUQA 1EW0A 1TS6A 3CLOA 3V39A 1TS0A 3ZFZA 4FSFA 3UN7A 3C5AA 3F1OA 4GNUA 4DF6A 4LCMA 2HJ9C 3IF6B 5FASA 1X0OA 4IBRA 4BLMA 1E3UD 1JWVA 2MJ6A 3ZVWA 3MQ0A 3W4QA 3EQUA 5CXWA 3FKVA 4S2JA 2W3DA 5L8MA 1JVJA 4ESPA 1ES5A 2VZWA 3BFGA 3ITBA 2DNSA 3GQZA 5EPHA 1E4DA 4LV3A 3MFDA 1K6SA 1SHVA 3BM6A 1GCEA 4Y13A 5DTSA 4WYYA 2A24A 3E98A 2ACGA 1W79A 2OWJA 4DDYA 2X71A 2B95A 5E43A 3OC2A 1L3LA 2PAVP 1K54C 2E8IA 5CTMA 4EESA 5EV0A 1CEGA 3BFFA 1KE4A 3HLEA 4OOYA 3T50A 1BLCA 3AGFA 5FQKA 2Z6CA 3H9WA 4IJGA 4PM9A 4X25A 5FQMA 3SOIA 1IFQA 4QB8A 1HTZA 2JKTI 3Q1FA 1BT5A 5A93A 3RJUA 1H3QA 4S2KA 4QHCA 4FH4A 3ZNTA 4R0QA 4LPZA 3M6BA 3KSIA 1LSXA 4U3TA 4KUOA 4XT2A 5FA7A 3QP8A 4LRZE 5L09A 4UQIS 4MCWA 4LRYC 5CERA 1MC0A 4M4XA 2R78A 1FOFA 3T1SA 1DJCA 3PBRA 4L9EA 4JXSA 5HAPA 1PI5A 1NZOA 3OOVA 2WZZA 3KO6A 1KVLA 3NOPC 4L0LA 5FL3A 2M7UA 2OWHA 3G34A 3ZNYA 2Y59A 3G6OA 3A3DA 3UB9A 3NBLA 4HIAA 2O9AA 3SS3A 3OCLA 5FI7A 2ZQ9A 2G2UA 2V9AA 4NKPA 1XA1A 3C30A 3CZDA 2V1AA 3F1OB 1YMXA 2ZM8A 1XJ3A 3T4OA 5FEGA 3V50A 5J7EA 5EE8A 1L0GA 4KZ5A 5F83A 4RX2A 4A5RA 3SW1A 1G6AA 2XFSA 2JKTM 2A3UA 2Y2HA 1HVBA 4GD8A 2EX6A 3A0SA 5HDCA 4DJ3A 3S22A 1HLUP 4DDSA 5I5LA 3WRZA 4HJ4A 4WF0A 3DTKA 2YKFA 1K55C 2JE5A 4S2LA 3WS0A 2XGNA 2Y2NA 3ISGA 3FV7A 2C6WB 3T4JA 5EM1A 2EWVA 2FZ0A 4EBNA 3C4OA 3LO7A 4KZ4A 3TW8A 2A24B 2VEAA 4C3QA 1ZC2A 1NRJA 3A0VA 2DRWA 2HP6A 4QU3A 2WKHA 4C75A 2HDRA 2VK3A 3EGXC 4ARZB 5KSCA 2HV1A 3R7WB 2ZOIA 2Z2LB 3NCKA 3E4OA 4LFUA 5J3WA 2C5WB 4P0MA 2G7UA 1JWPA 1S6RA 2PR5A 4Y2FA 4EU0A 3UPNA 3OPRA 4EETB 3VFFA 2XD1A 4MDZA 5EVIA 1PZPA 2GZAA 1H8MA 4OLDA 3JYIA 5IU1A 2O99A 5E2GA 4XT2B 2KX6A 1S1ZA 2NUPC 1IYPA 1UGUA 4O8GA 3LR5A 3P7NA 3N8RA 5KIZA 4K0XA 5FSRA 1DJBA 1OJGA 3M6HA 2LB9A 3FPWA 1FR6A 2W3FA 5F1GA 5J4EA 1BLPA 1LI0A 5JYPA 2J9OA 3T4QA 3LGOA 5AVEA 3BECA 3ZVTA 1YM1A 3MXRA 3MR0A 4P6ZM 5CX7A 2ZQ8A 3OZHA
chains in the Genus database with same CATH topology
3T4TA 1XJ6A 4JGPA 3T4SA 3KSFA 2VGLM 4O0PA 4BBVA 4I39A 5HPIA 3LI8A 2K2NA 3LICA 5AVFA 2PDRA 4IUHA 3EEHA 1OT9A 1S1YA 3S7PA 2XA7M 4CQHA 2B02A 3MXQA 5HZHA 1W63M 1T1BA 1DP9A 4WEKA 3P01A 4I3JA 4CLCD 1UWNX 2J3TC 4KQDA 2OAQ1 4GHIB 2INWA 4PAUA 4F3LA 5DF9A 2PYPA 4WELA 3UB6A 1N9LA 4DMZA 4EXOA 3U2AA 3GECA 5AJGA 2KOIA 4HNBA 4YWZA 3IS2B 3OLOA 2VX8A 3H7WB 2VLGA 3MQQA 4NXFA 3K3CA 5G4YA 3T4LA 2BASA 4BJPA 5C5KA 4R70A 5K5BA 1T19A 4EQ1A 2OOLA 1V9ZA 4H6JA 2H28A 2PYRA 2WKPA 3F1NA 2V1BA 1ODVA 3S7NA 4QPRA 3GDIA 3VE3A 2W27A 1W63Q 1OTEA 4MN7A 5HWWA 2D02A 2WKRA 3TRCA 2PD7A 4JGQA 3MJQA 3HJKA 4NXGA 2A2LA 2XROA 3C38A 3T4KA 4EERA 5IT5A 3BW6A 1NWZA 1OTIA 1DP6A 5EFWA 3EEAA 1OJ5A 3F1NB 3VOLA 2VV7A 2W3GA 1KOUA 3IBJA 3BJNA 3MMHA 1XJ2A 2VJWA 4DJ2A 1BYWA 2PR6A 4I38A 3BWLA 4I3IA 1MKMA 2V0UA 4NEED 2K7SA 5TBMB 3LIFA 4MMNA 2L1MA 4P6ZS 5DKLA 2WKQA 3TE8A 1GSVA 3O5YA 1YSQA 1S67L 3UB7A 4BBTA 1VB6A 3D72A 2O0YA 5F68A 3UE6A 2JN7A 3LYXA 5HL6A 3E4PA 1IOUA 2DMWA 2GNXA 3D3OA 2Y79A 5DKKA 2VGLS 2ZMFA 4Q0JA 2PHYA 2W1RA 2ZBBA 2W0NA 2O9CA 3OCNA 4II7A 3W2ZA 5HDSA 3PBNA 3UMDA 1EW0A 1TS6A 4L9FA 3CLOA 2QYBA 2XRNA 1TS0A 4UQIM 4FSFA 3LIAA 2XA7S 3F1OA 1S66L 3BQAA 2I9VA 4RQ9A 1YKDA 3B33A 2HJ9C 3IBRA 4YOFA 1X0OA 4HQAA 3K3DA 2W1TA 2MJ6A 3MQ0A 4KUKA 1GSWA 3EQUA 5TJJA 5DJTA 4B93A 2GX5A 2W3DA 4HH2A 1DRMA 5F69A 5L8MA 2KLIA 2VZWA 4IUKA 3RH8B 2QJ7A 3CAXA 1P97A 5MC7A 4ETZA 2YKHA 5HD5A 4GJ4A 3EQVA 4R3AA 3LIEA 3JVUA 3PYPA 2HF6A 4HHDA 5HDDA 1NLZA 1YAXA 2D01A 4ETXA 2FH5A 2A24A 3E98A 4ME4A 1UWPX 1F9IA 4K08A 1NLYA 2OWJA 3LR4A 2J3TD 5DJUA 3UMEA 4OOMA 4LRXC 4R38A 3OC2A 3H82A 4EEPA 5LBRA 2EA9A 3CITA 3S7QA 2JKRI 4F3LB 1XJ4A 3MF0A 4EESA 3ZQ5A 1OTBA 1LL8A 3KX0X 3EWKA 3T50A 3B42A 3K2NA 4HI4A 1D7EA 2QWSA 1P9WA 2W3EA 2Z6CA 3H9WA 4IJGA 3BY8A 1STZA 4PKYG 4HY8A 1IFQA 4AFIA 2QKPA 2L0WA 1F98A 3LR0A 2JKTI 5HWTA 3CI6A 4H6JB 1H3QA 4EEUA 4LPZA 4NXBA 3KSIA 4GS9A 1LSXA 3E0YA 3PBTA 3DBAA 4KUOA 4JGRA 4CLCA 4XT2A 3FG8A 4LRZE 1LSVA 4UQIS 2P08A 4MCWA 4CLCE 4LRYC 2OAP1 4PKYA 4E04A 4OOLA 1F5MA 1TD5A 1MC0A 4YNRA 4HOIA 4I5SA 4M4XA 3FPVA 4Y3IA 3ZYTA 3ULFA 3VE4A 3RTYA 2P7JA 2R78A 4Z1WA 1S4SA 4GW9A 4G3KA 1XFQA 4NXEA 3KSGA 3PBRA 4L9EA 2V0WA 4LLOB 4CLCB 3LUQA 3OOVA 2VA0A 3PBOA 2CMNA 4FOFA 2J3WA 2O9BA 3KO6A 4HP4A 3NOPC 4DN0A 4L0LA 5FL3A 2M7UA 4WUJA 1T18A 2OWHA 3A0RA 2P04A 3HJIA 2EWWA 1G28A 3G6OA 5DFXA 1TS8A 3C2WA 4GCZA 3KSHA 3UB9A 4HIAA 2O9AA 1S4RA 3OCLA 5HD3A 3MQOA 2KDKA 3CUEA 4ZRRA 1D06A 2V9AA 4NKPA 2ZOHA 3C30A 3HCYA 1XFNA 2V1AA 3F1OB 4WEJA 2HJEA 2PD8A 2K31A 1XJ3A 3NOUC 2VV8A 3T4OA 5DFYA 3LIDA 5J7EA 1JNUA 4HP9A 4IHQA 3B47A 3VV4A 4R6LA 1LSWA 2LB5A 4B9OA 4GHIA 2W1TB 4CLCC 4KQOA 3E4QA 3PBSA 4EUVA 3SW1A 4EW7A 2JKTM 3NOTC 1MZUA 3A0SA 5HDCA 4DJ3A 2PT7A 5I5LA 4HJ4A 4WF0A 2YKFA 3IS2A 3KYZA 2IA2A 3H7WA 3OBFA 3FC7A 4PHTA 1YSPA 3T4JA 2EWVA 3LIBA 3NHQA 2FZ0A 3CWFA 1OT6A 1V9YA 3KYQA 3LR3A 3EOIA 4ARZA 3LI9A 3TW8A 2A24B 5IS1A 3R7WA 3NJAA 2GJ3A 1ZHHB 4WL9A 1WA9A 4G3WA 4I3AA 5HWVA 2M7VA 2M1CA 5G4ZA 2VEAA 2VV6A 3C8CA 5HPFA 1TS7A 3H82B 3LFVA 1NRJA 3A0VA 1ZTUA 4L9GA 3CUEC 5F6AA 2L4RA 1GSXA 3EGXC 1OTDA 5A8BA 4ARZB 2HV1A 2Y8HA 3R7WB 2ZOIA 2W3HA 3E4OA 2J80A 2XSSA 5TBMA 4Y5FA 1T1AA 5J3WA 3TJZC 3MFXA 3F1PA 4BBUA 3EGDC 3PXPA 2G7UA 2PR5A 4Y2FA 4EU0A 4Q0HA 2HGVA 4EETB 1N9OA 3UE3A 2QJ5A 1N9NA 3JVVA 4MDZA 4WLAA 2QHKA 2GZAA 1H8MA 4Q0IA 4GS9B 1G6OA 5IU1A 2O99A 3PR6A 4XT2B 1DP8A 2KX6A 1S1ZA 2NUPC 1TF1A 1UGUA 4O8GA 3LR5A 4WN5A 4HJ3A 1VHMA 1T1CA 4HJ6A 3P7NA 3V67A 3F1PB 3RFBA 2ZMVA 5F5YA 3UB8A 4G3VA 2Z6DA 5KIZA 2NUTC 1OJGA 4O01A 3PHYA 4GLQA 2LB9A 3FPWA 4MN5A 4BWIA 3ICYA 2W3FA 4JGOA 5J4EA 1OPXA 2JHEA 4HH3A 2B18A 3PBQA 1OTAA 1Y28A 1P9RA 3T4QA 3S7OA 2VKSA 5AVEA 4MN6A 1P0ZA 2JKRM 3R4KA 5HSQA 3BQ8A 3MR0A 4P6ZM 5CX7A 4UEYA 3BY9A 4BMWA 5KSHA 1LT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJ6 A;  4JGP A;  4BBV A;  4I39 A;  3LI8 A;  3LIC A;  5AVF A;  2PDR A;  3EEH A;  1OT9 A;  1S1Y A;  2B02 A;  3MXQ A;  5HZH A;  1T1B A;  1DP9 A;  4I3J A;  1UWN X;  4KQD A;  4GHI B;  2INW A;  4F3L A;  2PYP A;  3UB6 A;  1N9L A;  4EXO A;  3GEC A;  4HNB A;  4YWZ A;  3IS2 B;  3OLO A;  3H7W B;  2VLG A;  3MQQ A;  4NXF A;  3K3C A;  5G4Y A;  2BAS A;  4R70 A;  1T19 A;  4EQ1 A;  2OOL A;  1V9Z A;  4H6J A;  2H28 A;  2PYR A;  2WKP A;  3F1N A;  2V1B A;  1ODV A;  3GDI A;  3VE3 A;  2W27 A;  1OTE A;  5HWW A;  2D02 A;  2WKR A;  2PD7 A;  4JGQ A;  3MJQ A;  3HJK A;  4NXG A;  4EER A;  1NWZ A;  1OTI A;  1DP6 A;  5EFW A;  1OJ5 A;  3F1N B;  3VOL A;  2VV7 A;  1KOU A;  1XJ2 A;  4DJ2 A;  1BYW A;  2PR6 A;  4I38 A;  3BWL A;  4I3I A;  2V0U A;  2K7S A;  5TBM B;  3LIF A;  5DKL A;  2L1M A;  2WKQ A;  1GSV A;  4BBT A;  1S67 L;  3UB7 A;  1VB6 A;  3D72 A;  5F68 A;  3UE6 A;  2JN7 A;  3LYX A;  3E4P A;  5DKK A;  2PHY A;  2ZBB A;  2W0N A;  5HDS A;  3UMD A;  1EW0 A;  1TS6 A;  4L9F A;  3CLO A;  1TS0 A;  3LIA A;  3F1O A;  1S66 L;  2I9V A;  4RQ9 A;  3B33 A;  3IBR A;  1X0O A;  4HQA A;  3K3D A;  4KUK A;  1GSW A;  5DJT A;  4HH2 A;  1DRM A;  5F69 A;  3RH8 B;  2QJ7 A;  3CAX A;  1P97 A;  2YKH A;  5HD5 A;  4R3A A;  3LIE A;  3PYP A;  4HHD A;  5HDD A;  2D01 A;  2A24 A;  1UWP X;  1F9I A;  4K08 A;  2OWJ A;  5DJU A;  3UME A;  4R38 A;  4LRX C;  3H82 A;  4EEP A;  2EA9 A;  4F3L B;  1XJ4 A;  4EES A;  3ZQ5 A;  1OTB A;  1LL8 A;  3KX0 X;  3EWK A;  3T50 A;  4HI4 A;  1D7E A;  2QWS A;  2Z6C A;  3H9W A;  3BY8 A;  4PKY G;  4HY8 A;  2QKP A;  2L0W A;  1F98 A;  5HWT A;  4H6J B;  4EEU A;  4LPZ A;  4NXB A;  4GS9 A;  1LSX A;  4KUO A;  4JGR A;  4XT2 A;  3FG8 A;  4LRZ E;  1LSV A;  4LRY C;  4PKY A;  4E04 A;  4HOI A;  4I5S A;  4M4X A;  3ULF A;  3VE4 A;  3RTY A;  2P7J A;  2R78 A;  1S4S A;  4GW9 A;  1XFQ A;  4NXE A;  4L9E A;  2V0W A;  4LLO B;  3LUQ A;  2CMN A;  4HP4 A;  3NOP C;  4WUJ A;  1T18 A;  2OWH A;  3A0R A;  3HJI A;  1G28 A;  3G6O A;  1TS8 A;  3C2W A;  4GCZ A;  3UB9 A;  4HIA A;  1S4R A;  5HD3 A;  3MQO A;  2KDK A;  1D06 A;  2V9A A;  2ZOH A;  1XFN A;  2V1A A;  3F1O B;  2PD8 A;  1XJ3 A;  3NOU C;  2VV8 A;  3LID A;  5J7E A;  1JNU A;  4HP9 A;  4R6L A;  1LSW A;  4B9O A;  4GHI A;  3E4Q A;  3SW1 A;  4EW7 A;  3NOT C;  1MZU A;  3A0S A;  5HDC A;  4DJ3 A;  5I5L A;  4HJ4 A;  4WF0 A;  2YKF A;  3IS2 A;  3H7W A;  3FC7 A;  3LIB A;  3NHQ A;  3CWF A;  1OT6 A;  1V9Y A;  3LI9 A;  5IS1 A;  2A24 B;  3NJA A;  2GJ3 A;  4WL9 A;  1WA9 A;  4I3A A;  5HWV A;  2M1C A;  5G4Z A;  2VEA A;  2VV6 A;  3C8C A;  1TS7 A;  3H82 B;  3A0V A;  4L9G A;  5F6A A;  2L4R A;  1GSX A;  1OTD A;  5A8B A;  2HV1 A;  2ZOI A;  3E4O A;  2J80 A;  5TBM A;  1T1A A;  5J3W A;  3MFX A;  3F1P A;  4BBU A;  2PR5 A;  4EET B;  1N9O A;  2QJ5 A;  1N9N A;  4WLA A;  2QHK A;  4GS9 B;  5IU1 A;  4XT2 B;  1DP8 A;  2KX6 A;  1S1Z A;  1UGU A;  4WN5 A;  4HJ3 A;  1T1C A;  4HJ6 A;  3P7N A;  3F1P B;  5F5Y A;  3UB8 A;  5KIZ A;  2Z6D A;  1OJG A;  3PHY A;  4MN5 A;  3ICY A;  4JGO A;  5J4E A;  2JHE A;  4HH3 A;  1OTA A;  1Y28 A;  5AVE A;  4MN6 A;  1P0Z A;  5HSQ A;  3MR0 A;  3BY9 A;  1LT0 A; 
#chains in the Genus database with same CATH topology
 1VEU A;  1PYY A;  4K0W A;  4KZ3 A;  3G35 A;  3O87 A;  3KSF A;  1K4F A;  2HDU A;  4BBV A;  4I39 A;  4KZ8 A;  3LI8 A;  4X69 A;  3NDG A;  4C6Y A;  4ZAM A;  2XFT A;  3S7P A;  3IXD A;  5GLD A;  2XA7 M;  2AVX A;  2OV5 A;  3MXQ A;  3LEQ A;  2HP9 A;  5HZH A;  1SZV A;  2WGW A;  2ZM0 A;  2WKI A;  3N4I A;  4PAU A;  2INW A;  4E3N A;  5CGX A;  2PYP A;  3IF5 A;  3NI9 A;  4E3K A;  4OH0 A;  1N9L A;  3N8L A;  3SZT A;  3GEC A;  3IT9 A;  4E3L A;  2WGV A;  4UA9 A;  4FUW A;  3HBR A;  4EQI A;  3WS1 A;  3HUM A;  2ZJ9 A;  1V9Z A;  2R9W A;  4H6J A;  5F1F A;  2V1B A;  1ODV A;  3S7N A;  4QPR A;  1HD8 A;  3VOZ A;  1W63 Q;  3D4F A;  4OQI A;  5HWW A;  2D02 A;  1IEM A;  1YLZ A;  2WKR A;  3QNB A;  4KZB A;  3MJQ A;  1NY0 A;  2EXA A;  4WZ4 A;  3EEA A;  1ONG A;  1OJ5 A;  1BLS A;  3VMA A;  4DJ2 A;  1BYW A;  3CHW P;  2JC7 A;  4CPK A;  2DCF A;  3HUO A;  3HUN A;  3W8K A;  3TE8 A;  1S67 L;  3UB7 A;  3JPU A;  1H5X A;  3D72 A;  2O0Y A;  1N9B A;  2JN7 A;  5HL6 A;  4P87 A;  1RGZ A;  3E4P A;  2DMW A;  2GNX A;  3V3R A;  4LCL A;  3D3O A;  3OPH A;  2X01 A;  5TGF A;  3T1X A;  1DY6 A;  5EVI B;  3NY4 A;  2ZBB A;  2W0N A;  1ERO A;  3OCN A;  5HDS A;  3PBN A;  1K54 A;  4L9F A;  2QYB A;  2XRN A;  4PM6 A;  1EI5 A;  2V2F F;  5CHM A;  5A90 A;  3BQA A;  1KE0 A;  4RQ9 A;  2QPN A;  3DTI A;  3B33 A;  3DWZ A;  3IBR A;  3G32 A;  3E2K A;  4MBF A;  3UPP A;  4RYE A;  3RXW A;  2ZLY A;  5E2E A;  5TJJ A;  3G30 A;  2GDN A;  4HH2 A;  3IQA A;  5F69 A;  3IHB A;  2KLI A;  3I7J A;  1PWG A;  5E2F A;  3RH8 B;  4E6W A;  4P6B A;  3CAX A;  4D60 A;  1GHP A;  4ETZ A;  3L9K A;  3PAE A;  2YKH A;  1L2S A;  4R3A A;  1NZU A;  3LIE A;  1ESU A;  3PYP A;  2HF6 A;  4E3J A;  1WYB A;  5HDD A;  1KGF A;  1YAX A;  2D01 A;  4KEN B;  3Q7Z A;  5EVI D;  2WGW B;  1ZG4 A;  3MZE A;  5DJU A;  3ZDJ A;  4R38 A;  1OME A;  5FDS A;  1XPB A;  3GSG A;  3T12 B;  2EA9 A;  3NC8 A;  2JKR I;  3S7Q A;  3N8S A;  3SH9 A;  3KX0 X;  1NXY A;  3K2N A;  1LHY A;  2QWS A;  1NYY A;  2ZQA A;  4N9L A;  4PKY G;  5HX9 A;  3WS4 A;  4AFI A;  2QKP A;  3LR0 A;  2A49 A;  2XK1 A;  2J9P A;  4H6J B;  5EOO A;  4EEU A;  4NG2 A;  3ZG0 A;  1FCN A;  4JF5 A;  4KQQ A;  4JGR A;  2X02 A;  3FG8 A;  1LSV A;  4CLC E;  1VQQ A;  4E04 A;  2H5S A;  3KYE A;  2V8C A;  4S2N C;  4HOI A;  1K55 A;  3TSG A;  3RTY A;  4Z1W A;  2WAD A;  4GZB A;  1IYO A;  1XFQ A;  3KSG A;  3CJM A;  2WKE A;  1PNE A;  4LLO B;  5FI6 A;  4CLC B;  4OPY A;  2VA0 A;  3GRJ A;  4N1X A;  1K57 C;  2CMN A;  4FOF A;  2O9B A;  3HVF A;  2Y4A A;  5FEF A;  1T18 A;  1K0K A;  3A0R A;  4EBL A;  4S2M A;  1YLY A;  5CEC A;  2EWW A;  3A3I A;  1YMS A;  5DFX A;  1TS8 A;  4S2P A;  4WBG A;  1TVF A;  1S4R A;  3IWQ A;  1U60 A;  4ZRR A;  2Z2M B;  1HZO A;  4B88 A;  1Z09 A;  1KVM A;  3HLG A;  2ZD8 A;  1VM1 A;  1BUE A;  2PD8 A;  1E25 A;  2VV8 A;  5DFY A;  4PM8 A;  5AQB A;  5FAT A;  1LSW A;  2LB5 A;  1K56 A;  4GHI A;  4B9O A;  4CLC C;  4PM7 A;  2UV0 E;  3PBS A;  4MLL A;  1IEL A;  1CJF A;  1MZU A;  2ZQ7 A;  3IS2 A;  2IA2 A;  3H7W A;  3OBF A;  3FC7 A;  4NK3 A;  2P74 A;  3NEC A;  4UA7 A;  4WMC A;  3WRT A;  3Q81 A;  5EVL A;  4E6X A;  3NHQ A;  2Y2M A;  1GA0 A;  3MZD A;  2JKG A;  3LR3 A;  4ARZ A;  3R7W A;  3NJA A;  2GJ3 A;  4OP8 A;  3N6I A;  2M7V A;  5G4Z A;  4JF6 A;  1KDW A;  4FH2 A;  1TS7 A;  3UDF A;  2RCX A;  3LFV A;  3GVB A;  4L9G A;  3CUE C;  3TG9 A;  3VSK A;  1GSX A;  4GDN A;  1L0E A;  1FR1 A;  2ZQD A;  5CGW A;  2J80 A;  2XSS A;  5TBM A;  4Y5F A;  3QP4 A;  1T1A A;  4H8R A;  5GHY A;  3A3E A;  5L10 A;  3PXP A;  2HP5 A;  2Y2J A;  5CHJ A;  4BL3 A;  5CTN A;  1N9O A;  1N9N A;  2FFF B;  4WLA A;  5HAR A;  3FKW A;  4X53 A;  1TF1 A;  4WN5 A;  4HJ3 A;  1VHM A;  1T1C A;  4HJ6 A;  1PZO A;  2Y2P A;  2ZMV A;  3BEB A;  3LY4 A;  2FFY A;  5F5Y A;  3U4L P;  3UB8 A;  1L0F A;  4ZBE A;  4D2O A;  4BL2 A;  2RL3 A;  4MN5 A;  4BWI A;  3ICY A;  4JGO A;  5D3O A;  1K25 A;  2IWB A;  4HH3 A;  1OTA A;  1Y28 A;  5KMW A;  1P9R A;  2HPB A;  1C3B A;  3S7O A;  5M19 A;  3P09 A;  3VP3 A;  2PU2 A;  4BMW A;  3MBZ A;  5KSH A;  3T4S A;  2ZC6 B;  1SDE A;  4KZ7 A;  4KZ9 A;  5KZH A;  1FIL A;  2WAF A;  2PDR A;  3G4P A;  4IUH A;  3EEH A;  1S1Y A;  4IVI A;  3NDE A;  2B02 A;  4DE3 A;  4N1H A;  2Y2Q A;  4S2O A;  1T1B A;  3M2J A;  2J3T C;  4GHI B;  5GHX A;  3V5M A;  4F3L A;  4PMA A;  1BUL A;  5DF9 A;  5CGS A;  4ZJ3 A;  1SKO A;  4DMZ A;  3QNC A;  2KOI A;  4YWZ A;  3IS2 B;  3OLO A;  1A0K A;  3H7W B;  1QMF A;  1SDN A;  4B4Z A;  3K3C A;  5G4Y A;  4BJP A;  2BAS A;  4R70 A;  3IHA A;  5G18 A;  2OLU A;  2WKP A;  1YPR A;  5J8X A;  3VE3 A;  2W27 A;  4YIN A;  3G31 A;  5U47 A;  4JXG A;  4MN7 A;  1MY8 A;  1D1J A;  4B4X A;  4WM9 A;  2Y55 A;  2ZC7 A;  1FSY A;  4EER A;  1OTI A;  4Q8I A;  5EFW A;  4KG2 A;  3DW0 A;  3F1N B;  3PAG A;  3BYD A;  2VV7 A;  2XF3 A;  1KOU A;  3Q07 A;  5FQ9 A;  3BJN A;  1XJ2 A;  2VJW A;  3GV9 A;  1F2K A;  1MKM A;  1PW8 A;  2K7S A;  5TBM B;  4Y0O A;  4MMN A;  1K56 D;  2WKQ A;  3BFD A;  3O5Y A;  4ZJ2 A;  2WZX A;  3VP1 A;  4HES A;  5E2H A;  5GLC A;  3W4O A;  5EEC A;  2VGL S;  2ZMF A;  3NIA A;  3QP5 A;  4BD0 A;  2PHY A;  2W1R A;  2O9C A;  3DTM A;  3RXX A;  3UMD A;  4WMC D;  4ID4 A;  4RA7 A;  4UQI M;  2Q9M A;  3LIA A;  1S66 L;  1XGJ A;  5FAQ A;  4ZTK A;  4X68 A;  1PWC A;  2XEP A;  3BLM A;  4YOF A;  4HQA A;  1CF0 A;  3MKF A;  1H8Y A;  1YLJ A;  1MXO A;  4BEN A;  4KUK A;  3BRM A;  1GSW A;  1FCM A;  5DJT A;  5EUA A;  2GX5 A;  1DRM A;  4K91 A;  2OSU A;  4U0T A;  3E2L A;  2QJ7 A;  1QME A;  1P97 A;  4UAA A;  2J7V A;  3VP2 A;  5HD5 A;  1CEF A;  4S2N A;  3EQV A;  5L2F A;  1W8Q A;  3JVU A;  4OP5 A;  1CK3 A;  1MWU A;  1K4E A;  4KZA A;  4OQ0 A;  3VP4 A;  5BOH A;  4ZDX A;  1ERQ A;  1K57 A;  2OLV A;  4LRX C;  4F3L B;  5HFO A;  4X1M A;  4R3J A;  3ZQ5 A;  1LL8 A;  1SKO B;  3D9Y A;  3S4X A;  4DKI A;  3B42 A;  4R23 A;  3GMW A;  1D7E A;  2XR0 A;  2W3E A;  3UE0 A;  4N9K A;  3BY8 A;  1STZ A;  1MWS A;  2UWX A;  1J3W A;  3ZCZ A;  4XUZ A;  3CI6 A;  4R4R A;  3LEZ A;  5TR7 A;  3DBA A;  3T1Q B;  4LEN A;  4CLC A;  3PTE A;  4JF4 A;  4DE1 A;  1G68 A;  1K6R A;  2OAP 1;  4PKY A;  1YLT A;  4OOL A;  4YNR A;  4I5S A;  4Y3I A;  1JWZ A;  3IX8 A;  1ONH A;  4GB7 A;  5FAP A;  2P7J A;  1S4S A;  4GW9 A;  4G3K A;  4LGW A;  2ZL1 A;  2V0W A;  3IXB A;  4DXB A;  4QWO A;  3PBO A;  4Y17 A;  4HP4 A;  4GDB A;  4DN0 A;  3FYZ A;  4WUJ A;  4O7D A;  3QP6 A;  3KSH A;  1G5U A;  1O7E A;  5HD3 A;  3CUE A;  3OPP A;  1BZA A;  2Q9N A;  2ZQC A;  1XFN A;  3A3F A;  4GOG A;  4GKU A;  3IX4 A;  2K31 A;  3O3V A;  3UDI A;  3HLB A;  3WS2 A;  3VV4 A;  4R6L A;  5CRF A;  3P98 A;  4KQO A;  3E4Q A;  1NJ4 A;  4WZ5 C;  4EW7 A;  3NOT C;  3SS5 A;  2PT7 A;  1AWI A;  1AXB A;  4MNR A;  4OPR A;  4BD1 A;  3FWL A;  1PI4 A;  1FSW A;  1W7F A;  1Q2P A;  5AQ9 A;  5EOE A;  4MEZ A;  3KYQ A;  3LI9 A;  2B5R A;  4WL9 A;  1WA9 A;  4I3A A;  1JTD A;  4LV2 A;  3GR2 A;  3C8C A;  1LLB A;  4R3B A;  5HPF A;  3HLW A;  1ZTU A;  3ZHH A;  2EX2 A;  5F6A A;  2WK0 A;  2L4R A;  4E3M A;  4JXW A;  1PIO A;  2XDM A;  3S1Y A;  4RX3 A;  1LL5 A;  4KG6 A;  3MFX A;  1GHM A;  2HGV A;  3CPT A;  5EVE A;  3UE3 A;  3UPO A;  1SKF A;  4Q0I A;  1G6O A;  3QP2 A;  5IHV A;  4DXC A;  3F1P B;  1CQA A;  4QD4 A;  5HAI A;  2XLN A;  4IBX A;  5FI2 A;  2PBY A;  3NUL A;  3ZG5 A;  1O07 A;  1OPX A;  2B18 A;  3PBQ A;  2ZL1 B;  3W4P A;  3CMZ A;  1BSG A;  3TOI A;  4MN6 A;  1P0Z A;  2JKR M;  5HSQ A;  3BQ8 A;  4KG5 A;  2HZ5 A;  4UEY A;  1ES3 A;  3BY9 A;  5A92 A;  5FQQ A;  3T4T A;  1XJ6 A;  4JGP A;  4O0P A;  3C4P A;  4GD6 A;  3BFC A;  5GLB A;  4BQM A;  5HPI A;  3MKE A;  2K2N A;  3LIC A;  4HBT A;  5AVF A;  4M3K A;  4CQH A;  1W5D A;  3O86 A;  3SS4 A;  1W63 M;  3P01 A;  4I3J A;  3A3J A;  1PW1 A;  4CLC D;  4KQD A;  1Y4O A;  2OAQ 1;  4HBU A;  4FD8 A;  1J9M A;  3UO9 A;  1W8Y A;  4EXO A;  2HDQ A;  5AQA A;  4OLG A;  2QZ6 A;  4HNB A;  2EFU A;  3IF6 C;  2JCH A;  3UB5 P;  4NXF A;  1FCO A;  4OKP A;  3T4L A;  5C5K A;  3B3X A;  4EQ1 A;  2H28 A;  3UY6 A;  4UHU A;  3F1N A;  1ZG6 A;  5EM0 A;  3GDI A;  1ZKJ A;  3L7H A;  4Y15 A;  3TRC A;  2PD7 A;  4JGQ A;  4ZJ1 A;  4CJN A;  2A2L A;  4UA6 A;  3T4K A;  4X1L A;  2ZC3 B;  3BW6 A;  4JLF A;  3OPL A;  2PU4 A;  4IVK A;  4LV1 A;  1ALQ A;  3WS5 A;  3IBJ A;  1K38 A;  3MMH A;  2PR6 A;  3BWL A;  4I3I A;  1VET A;  4LV0 A;  3LIF A;  5DKL A;  4P6Z S;  4R1G A;  2JBF A;  4BBT A;  3FZC A;  3N7W A;  1VB6 A;  3UE6 A;  4R4S A;  3LYX A;  2EFX A;  3CPT B;  5DKK A;  3HLD A;  4OQG A;  1M40 A;  4QJG A;  3C7V A;  4II7 A;  3IWO A;  4HEF A;  2XA7 S;  4JXV A;  3MS6 A;  2I9V A;  3M2K A;  1YKD A;  4X56 A;  3K3D A;  2W1T A;  2VGJ A;  1EWZ A;  1Q2Q A;  5FQJ A;  4B93 A;  5JYO A;  5GLA A;  1RCJ A;  1XGI A;  4X55 A;  3UE1 A;  2R9X A;  2WAE A;  4IUK A;  2PRF A;  5TFQ A;  5MC7 A;  3BLS A;  1N4O A;  4E3I A;  4GJ4 A;  4IED A;  1GHI A;  3CG5 A;  4KQR A;  5CEB A;  3AGD A;  3G2Z A;  4HHD A;  1NLZ A;  4ETX A;  2FH5 A;  4DE2 A;  4Y0U A;  4ME4 A;  4EUZ A;  1UWP X;  1F9I A;  4K08 A;  1MWR A;  1BTL A;  1NLY A;  3LR4 A;  2J3T D;  1NRF A;  3LCE A;  3SH7 A;  3UME A;  4OOM A;  4EBP A;  3H82 A;  4EEP A;  5LBR A;  1ERM A;  3CIT A;  1XJ4 A;  3MF0 A;  2VGK A;  1OTB A;  1YLP A;  3EWK A;  4HI4 A;  1P9W A;  5GHZ A;  1FIK A;  1KGE A;  3VOY A;  2PBD P;  4EWF A;  4HY8 A;  1F98 A;  2L0W A;  1XX2 A;  5CHU A;  5HWT A;  1TEM A;  3ITA A;  1MKI A;  1S0W A;  5DVA A;  4S2I A;  4NXB A;  4QY6 A;  4GS9 A;  3E0Y A;  3IH9 A;  3PBT A;  5HAQ A;  2P08 A;  4WZ5 A;  2CC1 A;  5HW3 A;  3MZF A;  1F5M A;  2EX9 A;  3SH8 A;  1TD5 A;  1LL9 A;  3ZYT A;  3Q7V A;  3FPV A;  3ULF A;  3VE4 A;  1CI8 A;  4NXE A;  3VP0 A;  3T1R A;  1PWD A;  1VET B;  1YLW A;  3LUQ A;  2V8F A;  1WYC A;  2J3W A;  3HL9 A;  4MBK A;  3HRE A;  4QY5 A;  2H10 A;  2P04 A;  3HJI A;  3VFH A;  1ES4 A;  1G28 A;  3C2W A;  1ES2 A;  2I72 A;  4GCZ A;  2Y2G A;  1H0M A;  1H8Z A;  1KE3 A;  4FCF A;  3MQO A;  2KDK A;  1D06 A;  2Y91 A;  2ZOH A;  3HCY A;  3UNW A;  1FQG A;  4WEJ A;  2HJE A;  4OVD A;  2P9V A;  2Q0O A;  2Y2I A;  2E8J A;  2V1Z A;  3NOU C;  3LID A;  1JNU A;  4HP9 A;  4IHQ A;  3B47 A;  2W1T B;  1XXM A;  4KZ6 A;  2Y2K A;  4EUV A;  5HL1 A;  1DJA A;  3KYZ A;  3IXG A;  5L07 A;  1IYS A;  4PHT A;  2BLS A;  1YSP A;  4NET A;  3LIB A;  2WYX A;  4Y0T A;  3CWF A;  3ZG8 B;  1OT6 A;  1V9Y A;  3EOI A;  4DE0 A;  2EXB A;  3QHY A;  1E3U A;  5IS1 A;  1ZHH B;  1YQS A;  4G3W A;  4DRT A;  5HWV A;  2M1C A;  2VV6 A;  4E3O A;  5F82 A;  3H82 B;  2IWD A;  3UDX A;  3Q82 A;  2ZC4 B;  1Z6F A;  3QP1 A;  1OTD A;  5A8B A;  1ESI A;  3ZG9 B;  4PM5 A;  2Y8H A;  4U0X A;  2W3H A;  1NYM A;  3TJZ C;  3F1P A;  4BBU A;  3EGD C;  1KDS A;  1XA7 A;  4Q0H A;  1I2W A;  4OPQ A;  1BLH A;  3O88 A;  2QJ5 A;  3HLC A;  2H0Y A;  3JVV A;  1CI9 A;  2QHK A;  4GS9 B;  3PR6 A;  2XH9 A;  3IX3 A;  1DP8 A;  3DTE A;  1I5Q A;  3V67 A;  3RFB A;  5A91 A;  3IXH A;  2Z6D A;  4G3V A;  2NUT C;  4O01 A;  3PHY A;  2J8Y A;  4EV4 A;  3Q7V B;  3IF6 A;  4GLQ A;  1JTG A;  1PFL A;  2JHE A;  2ZC5 B;  1LI9 A;  2ZMA A;  5I94 A;  2VKS A;  5CED A;  2HDS A;  3R4K A;  1M6K A;  4N92 A;  4OPZ A;  4PPR A;  4F94 A;  1SCW A;  5FAO A;  1LT0 A;  2BTF P;  1RP5 A;  1PRQ A;  2VGL M;  3AGE A;  2XD5 A;  1XKZ A;  5FQI A;  2H0T A;  3G2Y A;  1L0D A;  2WGI A;  3IH8 A;  1OT9 A;  2P9V B;  1I2S A;  1KGG A;  1DP9 A;  4GN2 A;  4WEK A;  5EVI C;  1VEU B;  1GA9 A;  3WWX A;  1UWN X;  5DTT A;  2QMI A;  2BG1 A;  4WEL A;  4OQH A;  2ZM2 A;  4JKT A;  3DWK A;  3UB6 A;  3BFE A;  3U2A A;  3IWI A;  5AJG A;  2IWC A;  1MWT A;  1MBL A;  2VX8 A;  5AQ7 A;  1MPL A;  3V3S A;  2VLG A;  3MQQ A;  1ACF A;  5GL9 A;  2JKF A;  3C7U A;  4YFM A;  5DF8 A;  4OON A;  5K5B A;  1T19 A;  2OOL A;  1TDG A;  1IKI A;  2PYR A;  2G2W A;  4JBF A;  4JPM A;  1WE4 A;  1XP4 A;  3DAV A;  3GTC A;  1OTE A;  5M18 A;  2XQZ A;  3ZGA B;  2Y2L A;  4FTX A;  5FDH A;  3HJK A;  4NXG A;  2XRO A;  3C38 A;  4Y7P A;  5IT5 A;  1NWZ A;  5DF7 A;  1DP6 A;  3LY3 A;  3ZG7 B;  3VOL A;  3HLF A;  2W3G A;  4Z9Q A;  1Y54 A;  5DTK A;  4RVA A;  4X6T A;  5M1A A;  1RGY A;  4I38 A;  2V0U A;  1TDL A;  3MXS A;  2Y2O A;  4NEE D;  1IYQ A;  2L1M A;  4P85 A;  1YT4 A;  1GSV A;  4MBH A;  1YSQ A;  2V20 A;  5F68 A;  3VSL A;  1IOU A;  2EX8 A;  2Y79 A;  4Q0J A;  4XXR A;  1IKG A;  3W2Z A;  4XUX A;  3MSH A;  2WUQ A;  1EW0 A;  1TS6 A;  3CLO A;  3V39 A;  1TS0 A;  3ZFZ A;  4FSF A;  3UN7 A;  3C5A A;  3F1O A;  4GNU A;  4DF6 A;  4LCM A;  2HJ9 C;  3IF6 B;  5FAS A;  1X0O A;  4IBR A;  4BLM A;  1E3U D;  1JWV A;  2MJ6 A;  3ZVW A;  3MQ0 A;  3W4Q A;  3EQU A;  5CXW A;  3FKV A;  4S2J A;  2W3D A;  5L8M A;  1JVJ A;  4ESP A;  1ES5 A;  2VZW A;  3BFG A;  3ITB A;  2DNS A;  3GQZ A;  5EPH A;  1E4D A;  4LV3 A;  3MFD A;  1K6S A;  1SHV A;  3BM6 A;  1GCE A;  4Y13 A;  5DTS A;  4WYY A;  2A24 A;  3E98 A;  2ACG A;  1W79 A;  2OWJ A;  4DDY A;  2X71 A;  2B95 A;  5E43 A;  3OC2 A;  1L3L A;  2PAV P;  1K54 C;  2E8I A;  5CTM A;  4EES A;  5EV0 A;  1CEG A;  3BFF A;  1KE4 A;  3HLE A;  4OOY A;  3T50 A;  1BLC A;  3AGF A;  5FQK A;  2Z6C A;  3H9W A;  4IJG A;  4PM9 A;  4X25 A;  5FQM A;  3SOI A;  1IFQ A;  4QB8 A;  1HTZ A;  2JKT I;  3Q1F A;  1BT5 A;  5A93 A;  3RJU A;  1H3Q A;  4S2K A;  4QHC A;  4FH4 A;  3ZNT A;  4R0Q A;  4LPZ A;  3M6B A;  3KSI A;  1LSX A;  4U3T A;  4KUO A;  4XT2 A;  5FA7 A;  3QP8 A;  4LRZ E;  5L09 A;  4UQI S;  4MCW A;  4LRY C;  5CER A;  1MC0 A;  4M4X A;  2R78 A;  1FOF A;  3T1S A;  1DJC A;  3PBR A;  4L9E A;  4JXS A;  5HAP A;  1PI5 A;  1NZO A;  3OOV A;  2WZZ A;  3KO6 A;  1KVL A;  3NOP C;  4L0L A;  5FL3 A;  2M7U A;  2OWH A;  3G34 A;  3ZNY A;  2Y59 A;  3G6O A;  3A3D A;  3UB9 A;  3NBL A;  4HIA A;  2O9A A;  3SS3 A;  3OCL A;  5FI7 A;  2ZQ9 A;  2G2U A;  2V9A A;  4NKP A;  1XA1 A;  3C30 A;  3CZD A;  2V1A A;  3F1O B;  1YMX A;  2ZM8 A;  1XJ3 A;  3T4O A;  5FEG A;  3V50 A;  5J7E A;  5EE8 A;  1L0G A;  4KZ5 A;  5F83 A;  4RX2 A;  4A5R A;  3SW1 A;  1G6A A;  2XFS A;  2JKT M;  2A3U A;  2Y2H A;  1HVB A;  4GD8 A;  2EX6 A;  3A0S A;  5HDC A;  4DJ3 A;  3S22 A;  1HLU P;  4DDS A;  5I5L A;  3WRZ A;  4HJ4 A;  4WF0 A;  3DTK A;  2YKF A;  1K55 C;  2JE5 A;  4S2L A;  3WS0 A;  2XGN A;  2Y2N A;  3ISG A;  3FV7 A;  2C6W B;  3T4J A;  5EM1 A;  2EWV A;  2FZ0 A;  4EBN A;  3C4O A;  3LO7 A;  4KZ4 A;  3TW8 A;  2A24 B;  2VEA A;  4C3Q A;  1ZC2 A;  1NRJ A;  3A0V A;  2DRW A;  2HP6 A;  4QU3 A;  2WKH A;  4C75 A;  2HDR A;  2VK3 A;  3EGX C;  4ARZ B;  5KSC A;  2HV1 A;  3R7W B;  2ZOI A;  2Z2L B;  3NCK A;  3E4O A;  4LFU A;  5J3W A;  2C5W B;  4P0M A;  2G7U A;  1JWP A;  1S6R A;  2PR5 A;  4Y2F A;  4EU0 A;  3UPN A;  3OPR A;  4EET B;  3VFF A;  2XD1 A;  4MDZ A;  5EVI A;  1PZP A;  2GZA A;  1H8M A;  4OLD A;  3JYI A;  5IU1 A;  2O99 A;  5E2G A;  4XT2 B;  2KX6 A;  1S1Z A;  2NUP C;  1IYP A;  1UGU A;  4O8G A;  3LR5 A;  3P7N A;  3N8R A;  5KIZ A;  4K0X A;  5FSR A;  1DJB A;  1OJG A;  3M6H A;  2LB9 A;  3FPW A;  1FR6 A;  2W3F A;  5F1G A;  5J4E A;  1BLP A;  1LI0 A;  5JYP A;  2J9O A;  3T4Q A;  3LGO A;  5AVE A;  3BEC A;  3ZVT A;  1YM1 A;  3MXR A;  3MR0 A;  4P6Z M;  5CX7 A;  2ZQ8 A;  3OZH A; 
#chains in the Genus database with same CATH homology
 3T4T A;  1XJ6 A;  4JGP A;  3T4S A;  3KSF A;  2VGL M;  4O0P A;  4BBV A;  4I39 A;  5HPI A;  3LI8 A;  2K2N A;  3LIC A;  5AVF A;  2PDR A;  4IUH A;  3EEH A;  1OT9 A;  1S1Y A;  3S7P A;  2XA7 M;  4CQH A;  2B02 A;  3MXQ A;  5HZH A;  1W63 M;  1T1B A;  1DP9 A;  4WEK A;  3P01 A;  4I3J A;  4CLC D;  1UWN X;  2J3T C;  4KQD A;  2OAQ 1;  4GHI B;  2INW A;  4PAU A;  4F3L A;  5DF9 A;  2PYP A;  4WEL A;  3UB6 A;  1N9L A;  4DMZ A;  4EXO A;  3U2A A;  3GEC A;  5AJG A;  2KOI A;  4HNB A;  4YWZ A;  3IS2 B;  3OLO A;  2VX8 A;  3H7W B;  2VLG A;  3MQQ A;  4NXF A;  3K3C A;  5G4Y A;  3T4L A;  2BAS A;  4BJP A;  5C5K A;  4R70 A;  5K5B A;  1T19 A;  4EQ1 A;  2OOL A;  1V9Z A;  4H6J A;  2H28 A;  2PYR A;  2WKP A;  3F1N A;  2V1B A;  1ODV A;  3S7N A;  4QPR A;  3GDI A;  3VE3 A;  2W27 A;  1W63 Q;  1OTE A;  4MN7 A;  5HWW A;  2D02 A;  2WKR A;  3TRC A;  2PD7 A;  4JGQ A;  3MJQ A;  3HJK A;  4NXG A;  2A2L A;  2XRO A;  3C38 A;  3T4K A;  4EER A;  5IT5 A;  3BW6 A;  1NWZ A;  1OTI A;  1DP6 A;  5EFW A;  3EEA A;  1OJ5 A;  3F1N B;  3VOL A;  2VV7 A;  2W3G A;  1KOU A;  3IBJ A;  3BJN A;  3MMH A;  1XJ2 A;  2VJW A;  4DJ2 A;  1BYW A;  2PR6 A;  4I38 A;  3BWL A;  4I3I A;  1MKM A;  2V0U A;  4NEE D;  2K7S A;  5TBM B;  3LIF A;  4MMN A;  2L1M A;  4P6Z S;  5DKL A;  2WKQ A;  3TE8 A;  1GSV A;  3O5Y A;  1YSQ A;  1S67 L;  3UB7 A;  4BBT A;  1VB6 A;  3D72 A;  2O0Y A;  5F68 A;  3UE6 A;  2JN7 A;  3LYX A;  5HL6 A;  3E4P A;  1IOU A;  2DMW A;  2GNX A;  3D3O A;  2Y79 A;  5DKK A;  2VGL S;  2ZMF A;  4Q0J A;  2PHY A;  2W1R A;  2ZBB A;  2W0N A;  2O9C A;  3OCN A;  4II7 A;  3W2Z A;  5HDS A;  3PBN A;  3UMD A;  1EW0 A;  1TS6 A;  4L9F A;  3CLO A;  2QYB A;  2XRN A;  1TS0 A;  4UQI M;  4FSF A;  3LIA A;  2XA7 S;  3F1O A;  1S66 L;  3BQA A;  2I9V A;  4RQ9 A;  1YKD A;  3B33 A;  2HJ9 C;  3IBR A;  4YOF A;  1X0O A;  4HQA A;  3K3D A;  2W1T A;  2MJ6 A;  3MQ0 A;  4KUK A;  1GSW A;  3EQU A;  5TJJ A;  5DJT A;  4B93 A;  2GX5 A;  2W3D A;  4HH2 A;  1DRM A;  5F69 A;  5L8M A;  2KLI A;  2VZW A;  4IUK A;  3RH8 B;  2QJ7 A;  3CAX A;  1P97 A;  5MC7 A;  4ETZ A;  2YKH A;  5HD5 A;  4GJ4 A;  3EQV A;  4R3A A;  3LIE A;  3JVU A;  3PYP A;  2HF6 A;  4HHD A;  5HDD A;  1NLZ A;  1YAX A;  2D01 A;  4ETX A;  2FH5 A;  2A24 A;  3E98 A;  4ME4 A;  1UWP X;  1F9I A;  4K08 A;  1NLY A;  2OWJ A;  3LR4 A;  2J3T D;  5DJU A;  3UME A;  4OOM A;  4LRX C;  4R38 A;  3OC2 A;  3H82 A;  4EEP A;  5LBR A;  2EA9 A;  3CIT A;  3S7Q A;  2JKR I;  4F3L B;  1XJ4 A;  3MF0 A;  4EES A;  3ZQ5 A;  1OTB A;  1LL8 A;  3KX0 X;  3EWK A;  3T50 A;  3B42 A;  3K2N A;  4HI4 A;  1D7E A;  2QWS A;  1P9W A;  2W3E A;  2Z6C A;  3H9W A;  4IJG A;  3BY8 A;  1STZ A;  4PKY G;  4HY8 A;  1IFQ A;  4AFI A;  2QKP A;  2L0W A;  1F98 A;  3LR0 A;  2JKT I;  5HWT A;  3CI6 A;  4H6J B;  1H3Q A;  4EEU A;  4LPZ A;  4NXB A;  3KSI A;  4GS9 A;  1LSX A;  3E0Y A;  3PBT A;  3DBA A;  4KUO A;  4JGR A;  4CLC A;  4XT2 A;  3FG8 A;  4LRZ E;  1LSV A;  4UQI S;  2P08 A;  4MCW A;  4CLC E;  4LRY C;  2OAP 1;  4PKY A;  4E04 A;  4OOL A;  1F5M A;  1TD5 A;  1MC0 A;  4YNR A;  4HOI A;  4I5S A;  4M4X A;  3FPV A;  4Y3I A;  3ZYT A;  3ULF A;  3VE4 A;  3RTY A;  2P7J A;  2R78 A;  4Z1W A;  1S4S A;  4GW9 A;  4G3K A;  1XFQ A;  4NXE A;  3KSG A;  3PBR A;  4L9E A;  2V0W A;  4LLO B;  4CLC B;  3LUQ A;  3OOV A;  2VA0 A;  3PBO A;  2CMN A;  4FOF A;  2J3W A;  2O9B A;  3KO6 A;  4HP4 A;  3NOP C;  4DN0 A;  4L0L A;  5FL3 A;  2M7U A;  4WUJ A;  1T18 A;  2OWH A;  3A0R A;  2P04 A;  3HJI A;  2EWW A;  1G28 A;  3G6O A;  5DFX A;  1TS8 A;  3C2W A;  4GCZ A;  3KSH A;  3UB9 A;  4HIA A;  2O9A A;  1S4R A;  3OCL A;  5HD3 A;  3MQO A;  2KDK A;  3CUE A;  4ZRR A;  1D06 A;  2V9A A;  4NKP A;  2ZOH A;  3C30 A;  3HCY A;  1XFN A;  2V1A A;  3F1O B;  4WEJ A;  2HJE A;  2PD8 A;  2K31 A;  1XJ3 A;  3NOU C;  2VV8 A;  3T4O A;  5DFY A;  3LID A;  5J7E A;  1JNU A;  4HP9 A;  4IHQ A;  3B47 A;  3VV4 A;  4R6L A;  1LSW A;  2LB5 A;  4B9O A;  4GHI A;  2W1T B;  4CLC C;  4KQO A;  3E4Q A;  3PBS A;  4EUV A;  3SW1 A;  4EW7 A;  2JKT M;  3NOT C;  1MZU A;  3A0S A;  5HDC A;  4DJ3 A;  2PT7 A;  5I5L A;  4HJ4 A;  4WF0 A;  2YKF A;  3IS2 A;  3KYZ A;  2IA2 A;  3H7W A;  3OBF A;  3FC7 A;  4PHT A;  1YSP A;  3T4J A;  2EWV A;  3LIB A;  3NHQ A;  2FZ0 A;  3CWF A;  1OT6 A;  1V9Y A;  3KYQ A;  3LR3 A;  3EOI A;  4ARZ A;  3LI9 A;  3TW8 A;  2A24 B;  5IS1 A;  3R7W A;  3NJA A;  2GJ3 A;  1ZHH B;  4WL9 A;  1WA9 A;  4G3W A;  4I3A A;  5HWV A;  2M7V A;  2M1C A;  5G4Z A;  2VEA A;  2VV6 A;  3C8C A;  5HPF A;  1TS7 A;  3H82 B;  3LFV A;  1NRJ A;  3A0V A;  1ZTU A;  4L9G A;  3CUE C;  5F6A A;  2L4R A;  1GSX A;  3EGX C;  1OTD A;  5A8B A;  4ARZ B;  2HV1 A;  2Y8H A;  3R7W B;  2ZOI A;  2W3H A;  3E4O A;  2J80 A;  2XSS A;  5TBM A;  4Y5F A;  1T1A A;  5J3W A;  3TJZ C;  3MFX A;  3F1P A;  4BBU A;  3EGD C;  3PXP A;  2G7U A;  2PR5 A;  4Y2F A;  4EU0 A;  4Q0H A;  2HGV A;  4EET B;  1N9O A;  3UE3 A;  2QJ5 A;  1N9N A;  3JVV A;  4MDZ A;  4WLA A;  2QHK A;  2GZA A;  1H8M A;  4Q0I A;  4GS9 B;  1G6O A;  5IU1 A;  2O99 A;  3PR6 A;  4XT2 B;  1DP8 A;  2KX6 A;  1S1Z A;  2NUP C;  1TF1 A;  1UGU A;  4O8G A;  3LR5 A;  4WN5 A;  4HJ3 A;  1VHM A;  1T1C A;  4HJ6 A;  3P7N A;  3V67 A;  3F1P B;  3RFB A;  2ZMV A;  5F5Y A;  3UB8 A;  4G3V A;  2Z6D A;  5KIZ A;  2NUT C;  1OJG A;  4O01 A;  3PHY A;  4GLQ A;  2LB9 A;  3FPW A;  4MN5 A;  4BWI A;  3ICY A;  2W3F A;  4JGO A;  5J4E A;  1OPX A;  2JHE A;  4HH3 A;  2B18 A;  3PBQ A;  1OTA A;  1Y28 A;  1P9R A;  3T4Q A;  3S7O A;  2VKS A;  5AVE A;  4MN6 A;  1P0Z A;  2JKR M;  3R4K A;  5HSQ A;  3BQ8 A;  3MR0 A;  4P6Z M;  5CX7 A;  4UEY A;  3BY9 A;  4BMW A;  5KSH A;  1LT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...