1S67L

Crystal structure of heme domain of direct oxygen sensor from e. coli
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
119
structure length
119
Chain Sequence
NAADGIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxygen storage/transport
molecule keywords Hypothetical protein yddU
publication title Insights into signal transduction involving PAS domain oxygen-sensing heme proteins from the X-ray crystal structure of Escherichia coli Dos heme domain (Ec DosH)
pubmed doi rcsb
source organism Escherichia coli
total genus 23
structure length 119
sequence length 119
chains with identical sequence U
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s67L00
5HSQA 2A24A 3E4QA 4LRXC 3NJAA 1T18A 3UMDA 4GHIA 2D01A 3UB8A 1LSVA 3VE4A 4KUKA 4NXGA 4NXFA 1Y28A 4H6JB 4F3LA 1OT9A 1TS6A 1XFQA 3EWKA 1UWNX 4EESA 4HP9A 3NOUC 3C8CA 2PD7A 5IU1A 3UMEA 4HOIA 4EETB 4HIAA 4L9FA 2HV1A 2V0UA 4K08A 1S1ZA 4NXBA 5DKKA 3VOLA 2PYPA 2Z6CA 3MXQA 3H82A 1XFNA 5HDDA 1DRMA 4GS9B 1T1BA 4LPZA 5J4EA 2WKPA 2WKQA 3BY9A 4JGPA 1P0ZA 5EFWA 3NOTC 2L0WA 4HJ6A 1NWZA 5HWTA 5I5LA 1ODVA 2L1MA 4HH3A 2OOLA 1LSXA 2QHKA 1OTAA 1GSVA 3LYXA 2VV7A 1XJ4A 4MN5A 3VE3A 5F6AA 2QJ7A 1S66L 4PKYA 5HD5A 2VLGA 1N9OA 4YWZA 4R70A 3ICYA 4LRYC 1DP8A 3SW1A 4B9OA 4I3IA 3LIAA 4DJ3A 5TBMB 2KX6A 1TS7A 3F1PB 4MN6A 5J7EA 1S4SA 2VEAA 4I3JA 3UB9A 4EERA 5F69A 2BASA 4HI4A 2V1BA 2ZOIA 3MQQA 2L4RA 3D72A 4HQAA 4R6LA 3E4PA 1LL8A 4I38A 4R38A 5HD3A 1T1CA 4L9EA 1V9ZA 4E04A 3C2WA 4L9GA 5G4YA 4WL9A 4DJ2A 3T50A 3MFXA 3CAXA 5HDSA 1EW0A 1UWPX 3IS2B 3E4OA 1DP6A 5DKLA 5KIZA 2VV6A 4R3AA 3BWLA 4XT2A 1F98A 1X0OA 2INWA 5HWVA 2YKHA 3B33A 3A0SA 1LT0A 4BBVA 2V1AA 4PKYG 3NOPC 2D02A 3H7WB 4HY8A 3IBRA 3LIFA 4HP4A 1KOUA 5HZHA 3F1OA 2A24B 2W0NA 4HJ3A 4HJ4A 2VV8A 3OLOA 3PYPA 2YKFA 3F1NA 3LIDA 4GHIB 2PD8A 4F3LB 1N9NA 4RQ9A 3K3DA 3LIEA 5J3WA 1D06A 2M1CA 3GECA 2KDKA 2WKRA 4JGRA 3UB6A 3ULFA 1S67L 3GDIA 3RTYA 4H6JA 1MZUA 3HJIA 1LSWA 4NXEA 3H82B 2PR5A 4WUJA 4EEUA 3KX0X 4I39A 1P97A 1VB6A 5F5YA 4GCZA 3A0RA 2ZBBA 4KQDA 1OTIA 4HH2A 4GS9A 3PHYA 4EXOA 1XJ3A 1XJ2A 5HDCA 2B02A 3EEHA 4LRZE 2W27A 4I3AA 1TS0A 3NHQA 2R78A 5A8BA 1JNUA 1OTEA 4WN5A 5HWWA 1F9IA 3K3CA 3LICA 5AVEA 1S1YA 2QJ5A 2QKPA 4M4XA 1OT6A 1UGUA 2PDRA 1XJ6A 3CWFA 3HJKA 1T19A 4BBUA 1G28A 3UE6A 3LUQA 3ZQ5A 3LI9A 4WF0A 2K7SA 1S4RA 3CLOA 3MQOA 5AVFA 2ZOHA 3FC7A 4I5SA 3MR0A 5TBMA 2Z6DA 2PHYA 3F1PA 2OWJA 3RH8B 2GJ3A 3UB7A 3P7NA 1BYWA 5IS1A 5DJTA 2JHEA 1GSWA 2OWHA 5F68A 4EQ1A 3MJQA 3FG8A 2PR6A 1D7EA 4KUOA 2I9VA 3G6OA 2JN7A 4JGQA 2CMNA 3BY8A 1OJGA 4JGOA 4XT2B 4EW7A 4HHDA 2P7JA 4BBTA 1V9YA 2V9AA 1OTDA 4LLOB 3IS2A 2J80A 3LI8A 3H9WA 3LIBA 4WLAA 1GSXA 5G4ZA 1N9LA 1T1AA 1TS8A 2PYRA 4HNBA 4GW9A 2EA9A 1DP9A 2QWSA 3F1OB 5DJUA 1WA9A 2H28A 3A0VA 1OTBA 3F1NB 4EEPA 3H7WA 2V0WA 1OJ5A
chains in the Genus database with same CATH superfamily
3MS6A 4NEED 4GDNA 5HAIA 1PWGA 4K0XA 4R4SA 3OOVA 1K4FA 2OAP1 4KZ4A 3WRZA 4OLGA 4LRXC 3HL9A 1ZC2A 2OAQ1 3UMDA 1VQQA 3UB8A 3VE4A 4NXGA 4H6JB 5JYOA 3QP6A 5CHMA 5CGXA 2ZMFA 1AXBA 1YLZA 2P74A 2Y55A 2Y4AA 3C30A 3C8CA 4DE2A 4PMAA 4HOIA 3A3IA 4D2OA 4LCMA 5FATA 1NRJA 1ACFA 2EX9A 4X25A 2Z6CA 3G32A 4JF5A 3RJUA 1DRMA 2ZM0A 4JXVA 2E8JA 4P0MA 4LPZA 4OVDA 2WKQA 4JGPA 1P0ZA 1VHMA 4O7DA 3DTIA 4YNRA 4HJ6A 5I5LA 2XRNA 1BSGA 2L1MA 5EECA 1DJBA 4XXRA 3BRMA 4BWIA 5DFYA 1NLYA 1XA7A 5CRFA 3VE3A 5CEBA 2DCFA 3UPPA 2QMIA 4ZJ3A 3IBJA 2FH5A 3SW1A 4N1XA 1PWCA 1XP4A 5TBMB 4Q0IA 3ZYTA 1TD5A 3KSHA 4OH0A 4B93A 2VEAA 1PI4A 5EM1A 3UB9A 3S7NA 1W63Q 5EVID 5M18A 1L0EA 5HAPA 2K2NA 2BASA 1ALQA 4MLLA 2V1BA 5GHYA 3T1QB 1J9MA 3UDXA 4PAUA 4HQAA 4Y13A 3IHBA 4E04A 4N1HA 2W3FA 3A3JA 4WL9A 3IF6A 3Q7ZA 1TVFA 1UWPX 3D3OA 2J3WA 3E4OA 1XXMA 3RXWA 4ZJ2A 5EOEA 4BMWA 2M7UA 1YT4A 3TW8A 3P09A 3R4KA 1JWZA 4WMCD 3TSGA 4O8GA 4IBRA 3HLFA 2WKEA 2ZJ9A 3S4XA 1MKMA 3B33A 1BLSA 3S7QA 1LT0A 4IHQA 1K54A 4X55A 1ES4A 2V1AA 3NULA 1NYMA 2J9PA 3LCEA 2VJWA 3Q07A 3NOPC 2E8IA 2WZXA 1A0KA 4HY8A 3VSKA 2HGVA 5EUAA 1NY0A 3QP5A 3SS4A 2QYBA 4MBKA 2AVXA 5TR7A 3G34A 2VV8A 4LENA 4MBHA 3PYPA 3EGXC 3F1NA 3LIDA 3D4FA 3N8SA 2PD8A 4F3LB 4OQ0A 4S2IA 3HLDA 3N7WA 1LLBA 2W1TB 4IVIA 3KSFA 3N8LA 3PTEA 3GECA 4O0PA 1FCNA 2KDKA 2WKRA 5KZHA 4WZ5C 1PRQA 1CQAA 4Y15A 3TOIA 4ZDXA 1PI5A 5A92A 1MKIA 1P9WA 3H82B 4Y2FA 2GDNA 4EWFA 2V8FA 1GA0A 1M6KA 1FQGA 1FCMA 1IKGA 4WUJA 4QHCA 1HD8A 3IXHA 3K2NA 2VGLS 3MBZA 1XX2A 4Y5FA 2JKGA 3HUNA 4KQDA 3N6IA 3ZCZA 4DXCA 4GS9A 3UDFA 4EXOA 3BJNA 1H8YA 3TJZC 4P6BA 4LRZE 5FSRA 1TS0A 2WKIA 5TFQA 4P87A 4OLDA 2ZC5B 5A8BA 4OPRA 4WN5A 4P6ZM 3LICA 3PBQA 5DTKA 3W4QA 4ID4A 1UGUA 3DAVA 1K25A 3NCKA 4S2OA 5CEDA 1W5DA 1XJ6A 3Q81A 2EWVA 4CJNA 3PXPA 2JKRI 5KSHA 1L0DA 1G28A 3UE6A 2PBDP 4EBLA 4WF0A 2K7SA 1ESUA 4OPQA 5AVFA 4L0LA 1ES5A 3FC7A 2WGVA 3OBFA 1KE3A 1IOUA 3RH8B 5E2EA 1W8QA 1XKZA 2WGWA 4U3TA 5EV0A 2JKFA 4N9LA 3LY3A 1BYWA 3MXSA 4NG2A 2HP9A 2JHEA 4IEDA 4QPRA 2FFYA 5EPHA 2XD5A 5F68A 4DDSA 1IYPA 3OPRA 3M2KA 5FQKA 1E3UD 3PBOA 1XGIA 3SOIA 1Z09A 5A90A 3HCYA 1PYYA 4BD0A 4UA7A 4HHDA 4FCFA 1FIKA 4MBFA 3OCNA 4NK3A 3T4TA 2R9WA 1MPLA 4LLOB 3E2LA 3IS2A 2PU2A 3S1YA 3H9WA 5G4ZA 1JTGA 4ZJ1A 4OPZA 5LBRA 3TE8A 3OPPA 5DFXA 3VP0A 1SKOA 4EQIA 5FQJA 3TG9A 2ZC3B 3N4IA 3OZHA 3VV4A 3VFHA 4EUVA 3A3EA 3Q82A 1W63M 5FAQA 3MZDA 1ES2A 1ZKJA 5E2FA 4K91A 5HSQA 1HLUP 1K6SA 1PZPA 2A24A 3MMHA 2V1ZA 3ZNTA 3CZDA 3KO6A 3UY6A 4WELA 3NJAA 1SDNA 4B88A 4RVAA 4Q0JA 2D01A 5MC7A 4ZRRA 3HLWA 4OKPA 4IUHA 1F5MA 1Y28A 1OT9A 4KZ5A 4DKIA 1KE4A 1XFQA 4PM6A 4EESA 4S2KA 3UE3A 2PD7A 4X56A 1H0MA 5FQIA 3IXDA 4DE0A 4HIAA 3FPWA 2V0UA 1S1ZA 2Y2NA 4Q8IA 3VOLA 2PYPA 3MXQA 5HDDA 3EEAA 3HUMA 3T1XA 4MMNA 5J4EA 3E2KA 2Y59A 2EXBA 4R4RA 1NWZA 2UV0E 5HWTA 2IWBA 1W79A 2OOLA 2EX6A 4P85A 2IWDA 2QHKA 3CPTB 1OTAA 4JLFA 3LYXA 2O99A 2VV7A 5FA7A 3UE0A 2WUQA 2XSSA 5BOHA 1FSWA 2GNXA 2WKHA 3MZFA 4OQIA 4PKYA 2J9OA 5HD5A 2VLGA 2XD1A 2G2WA 1DP8A 4LRYC 3ZVWA 3V3SA 4I3IA 2XEPA 3UB5P 3T1SA 3U4LP 4DJ3A 1TS7A 4MN6A 2HDRA 4EERA 5HL1A 3G4PA 3MSHA 3G35A 3HLEA 3O86A 5F69A 3ZFZA 2O0YA 4IVKA 4QJGA 4XUZA 3WWXA 4WEJA 1NZUA 4HI4A 2ZOIA 1Q2QA 4XUXA 2H0YA 1Y4OA 5M19A 3ZG9B 4II7A 3Q1FA 2W3EA 3DWZA 1LL8A 3M6HA 1T1CA 1MWRA 1ES3A 2EX8A 3SH7A 4DE3A 1MWTA 4WYYA 2P08A 1AWIA 3T50A 4AFIA 4DMZA 2H10A 4KZ6A 3W4OA 3SH8A 2B5RA 3N8RA 3W2ZA 4F94A 5GHZA 1YAXA 1DP6A 4EBNA 4DN0A 3GRJA 1BZAA 1SKFA 2IA2A 4R3AA 2W3HA 1G5UA 2J3TC 1DJAA 3EQUA 2J3TD 5GLDA 4GNUA 1X0OA 2G7UA 4EV4A 5HWVA 2ZD8A 2P9VB 4OQHA 3IX4A 2YKHA 4KENB 1Z6FA 1XA1A 3LEQA 1K0KA 4E3LA 4PKYG 3H7WB 3S7PA 3IBRA 3LIFA 1ZG6A 4Q0HA 3JVVA 1ONHA 2XFTA 1VEUA 4U0TA 3F1OA 4EUZA 2IWCA 2GZAA 1W8YA 2XA7S 2XK1A 4JF6A 4GHIB 1PIOA 3CHWP 5HARA 1BULA 5EVIA 4DF6A 5CTNA 3LY4A 4RX2A 3T1RA 4X6TA 1I5QA 5J8XA 3VSLA 1LHYA 5L8MA 1D06A 2M1CA 1YM1A 5AQBA 3OPHA 4JGRA 2B18A 3RTYA 4H6JA 1HVBA 1MZUA 3QHYA 5EVIC 2ZQCA 3VP3A 4S2PA 3O88A 2PR5A 1K38A 2Z2MB 1G68A 3BLMA 3SZTA 3Q7VB 3JYIA 3KX0X 2XH9A 3T4SA 5FQQA 5DTSA 2Q0OA 2ZBBA 2Y2OA 4GJ4A 2ZQ8A 3LR5A 4JF4A 3PHYA 4X68A 1IELA 1XJ2A 1XJ3A 1FR6A 1NYYA 4MN7A 3EEHA 4WMCA 4I3AA 4HEFA 2Y2KA 3NHQA 3BLSA 2ACGA 3DTEA 5FDHA 4GD6A 5FL3A 1F9IA 2WAFA 3K3CA 4DE1A 3V3RA 5AVEA 3LR0A 3WS5A 4C75A 1J3WA 5AQAA 2QKPA 1OT6A 1CF0A 4X1MA 4KG6A 3L7HA 1T19A 4KZ7A 3LUQA 1XPBA 5CXWA 5CGWA 3CLOA 5HW3A 3MQOA 3FWLA 4QU3A 5HPIA 2ZOHA 1BTLA 3MR0A 5TBMA 3KYEA 5DF8A 2HP5A 2ZLYA 3W4PA 5AJGA 3VFFA 2RCXA 2QZ6A 3UB7A 5CX7A 4WM9A 3UDIA 1MBLA 3KYQA 1MWSA 1GA9A 3DBAA 5DJTA 2HF6A 1GSWA 4WZ5A 2O9CA 1M40A 2HJEA 4EQ1A 5CERA 3WS2A 3QP8A 5CHUA 5KMWA 3G30A 5FAOA 1BLHA 2O9AA 2PR6A 1D7EA 1TEMA 4YINA 2C6WB 3SH9A 1SCWA 1TF1A 4CLCB 2CC1A 1ZHHB 4XT2B 5CHJA 2ZMVA 4BBTA 2ZM2A 1V9YA 3O3VA 2WAEA 5FEGA 3QNBA 2ZQAA 4Y3IA 1OTDA 1N4OA 2J80A 1STZA 1S0WA 4GN2A 1GSXA 3LR3A 3QP4A 1HZOA 1N9LA 2ZQDA 2PYRA 1PW8A 4HNBA 1L3LA 4S2JA 3LFVA 4B4XA 1PZOA 2EA9A 4GOGA 3V67A 3BECA 1OMEA 1KDSA 4UQIM 1WA9A 1CEGA 3CI6A 1SHVA 1KGFA 2WYXA 4UA6A 3UPOA 2DMWA 5GL9A 1YLPA 3HBRA 3JPUA 4MNRA 1H8MA 1L2SA 3G31A 4M3KA 2A3UA 3E4QA 4CQHA 3E98A 2HZ5A 1ZG4A 3C5AA 4G3VA 4KUKA 1K55A 4F3LA 2XF3A 3EWKA 1UWNX 2W1TA 5K5BA 3G2YA 1JWVA 4CLCE 4Y0UA 4EETB 4L9FA 2HV1A 4K08A 5F83A 4RX3A 3DW0A 5DKKA 3S22A 1E3UA 3T4LA 4ARZB 1K55C 3H82A 1L0GA 5TGFA 4GD8A 4KG2A 4BD1A 4PHTA 4C6YA 3BY9A 2ZC6B 4S2LA 4X53A 2VGJA 2MJ6A 3IX8A 3NOTC 4CLCC 4CLCD 5L07A 4LFUA 1PWDA 2XA7M 3T4QA 4IBXA 2I72A 1VETB 1LI0A 1LSXA 3LR4A 1TDLA 1GSVA 5FQ9A 1XJ4A 2A49A 5HPFA 1K56A 1S66L 1GHPA 4OONA 5CTMA 3ITBA 1N9OA 4YWZA 3MXRA 3QNCA 3E0YA 1NRFA 4B9OA 2GX5A 1GHIA 4S2MA 3WS0A 2W3DA 3QP1A 2PT7A 3B47A 3F1PB 1YLJA 4OOYA 4C3QA 3HREA 4KG5A 3MFDA 4WBGA 1K56D 4UA9A 3R7WB 4EBPA 2LB5A 3MQQA 2ZQ7A 2L4RA 1CJFA 1H5XA 4KZ9A 4R6LA 3E4PA 4I38A 4R38A 4OOMA 4L9EA 1V9ZA 3A3FA 3C2WA 5G4YA 3MKFA 1G6AA 3MQ0A 4DJ2A 3MFXA 3CAXA 5AQ9A 5HDSA 4BL3A 1EW0A 2ZL1B 3IWQA 2BG1A 3T4KA 4PM5A 5EOOA 2VV6A 2O9BA 3BYDA 3IHAA 3BWLA 5U47A 5FASA 1P9RA 2VKSA 4QY5A 1F98A 2INWA 3NY4A 2R9XA 3OPLA 2X02A 3A0SA 1KE0A 1C3BA 4ZAMA 4BBVA 4X1LA 3CITA 4LV3A 3NI9A 1BT5A 3U2AA 4GZBA 4E3JA 3W8KA 4UEYA 1JVJA 3VOZA 4HP4A 2UWXA 1O07A 2Y79A 5HZHA 1ZTUA 1YLYA 3EQVA 1FR1A 1QMFA 3ZVTA 4E3IA 4KZ8A 2PBYA 4MCWA 4R3BA 3TRCA 1EI5A 2WADA 4UAAA 2VGKA 2YKFA 2HDSA 3SS3A 1CEFA 4MEZA 2XFSA 1N9NA 2OLUA 2EXAA 2V8CA 2VZWA 1SZVA 2Y2QA 5GLCA 4FOFA 5J3WA 4LV1A 4IUKA 5DF9A 1IEMA 3UB6A 5DF7A 5I94A 1S67L 3GDIA 5AQ7A 3PBRA 2G2UA 1ONGA 3B42A 3HJIA 2HDUA 2VGLM 4EEUA 2EX2A 4KQRA 3GMWA 3PBSA 1RCJA 4OQGA 5TJJA 3T4OA 3DTMA 1VB6A 5F5YA 3A0RA 1OTIA 4LGWA 4DRTA 4HH2A 2JC7A 4Y0OA 2WZZA 2HP6A 1E25A 3UN7A 3VP2A 5HDCA 1U60A 2B02A 3AGDA 4S2NC 2W27A 1FCOA 3OC2A 1TDGA 4FH2A 4IJGA 2EFXA 4GB7A 1JNUA 3IF5A 1OTEA 3ZG7B 1Y54A 1NZOA 1S1YA 2QJ5A 1K57A 1SDEA 1CK3A 4P6ZS 4M4XA 4R0QA 3CPTA 1WYCA 4O01A 2OV5A 3CWFA 4Y0TA 3HJKA 4BBUA 4E3KA 4N9KA 3ZQ5A 2BTFP 1S4RA 3DTKA 1MY8A 1DJCA 1EWZA 4I5SA 1K57C 2Z6DA 4GLQA 2OWJA 3KSGA 2GJ3A 3CUEA 3IWIA 2H0TA 1ERQA 4YOFA 3LEZA 1FOFA 3T4JA 4UHUA 4JXGA 3V50A 2XDMA 2JCHA 3IF6B 2A2LA 4WZ4A 2JBFA 4KUOA 2HDQA 1ERMA 2JN7A 3CUEC 5C5KA 1MC0A 5DTTA 3WRTA 3BY8A 2Y2IA 1KVMA 4JGOA 1YKDA 1PFLA 1IYSA 4G3KA 1QMEA 3LI8A 1E4DA 5FEFA 1T1AA 1TS8A 3HLCA 2BLSA 1LL9A 4G3WA 3GQZA 1FSYA 4ESPA 1PNEA 2HPBA 3A3DA 5L2FA 5A91A 1RP5A 1KGGA 2P9VA 3EOIA 5EE8A 2M7VA 4D60A 3ZHHA 3PAEA 4X69A 2QPNA 3BFCA 2ZC7A 3AGFA 3F1NB 4EEPA 1NJ4A 3H7WA 4Y7PA 5FI7A 1HTZA 3NBLA 4FUWA 3C7VA 3MF0A 4PM9A 1XGJA 3HLGA 2OLVA 3KSIA 2DRWA 1T18A 4KZAA 4ETXA 4BLMA 5GHXA 4GHIA 1LSVA 1IYQA 1LI9A 3IH8A 3FYZA 3DWKA 4NXFA 2W1RA 5EM0A 4U0XA 1TS6A 1H3QA 3ITAA 5E2GA 3GV9A 4QWOA 4HP9A 3NOUC 5IU1A 3UMEA 3CMZA 1IFQA 2KLIA 3NIAA 2NUTC 1FILA 4NXBA 3IF6C 3VMAA 2FFFB 4LV2A 3IXGA 1XFNA 4N92A 4GS9B 1T1BA 5IHVA 3P98A 3Q7VA 1MXOA 2WKPA 5HX9A 5EFWA 3BFFA 2X01A 1YQSA 2L0WA 5EVLA 4KZBA 1ODVA 1RGZA 1YLWA 3C4PA 4FTXA 4OP8A 3HUOA 3QP2A 4HH3A 2J8YA 3MKEA 5E2HA 5FI6A 2XGNA 1K54C 4HESA 4R1GA 3G2ZA 1NLZA 4MN5A 5F6AA 2QJ7A 3C4OA 4K0WA 4RYEA 4ZBEA 5GLAA 4R70A 3GTCA 4GKUA 3ICYA 4R3JA 4HBUA 4Z1WA 4E3NA 3LIAA 3BQ8A 1I2SA 5FQMA 1YMXA 2Y91A 2PRFA 2JE5A 5A93A 5KSCA 3SS5A 2KX6A 2X71A 3EGDC 5J7EA 1S4SA 3CG5A 4I3JA 4BJPA 1ESIA 1WYBA 1BLPA 1YLTA 2WGWB 5DVAA 3GSGA 3RFBA 2W3GA 5JYPA 3IWOA 4R23A 4QD4A 1CI8A 3M2JA 3ZNYA 4E6XA 3IT9A 3D72A 3MZEA 3HVFA 1H8ZA 2Q9NA 5HD3A 4PM8A 3O5YA 4L9GA 2VX8A 2ZC4B 3OCLA 1Q2PA 2FZ0A 4WEKA 2DNSA 4QB8A 3JVUA 4HBTA 3VP1A 1VM1A 4YFMA 5FI2A 3IS2B 4NETA 3UPNA 3IX3A 5DKLA 5KIZA 2EWWA 1JWPA 3FV7A 4CLCA 3PAGA 2ZQ9A 2KOIA 4XT2A 4FSFA 4BENA 3VOYA 3ZGAB 1G6OA 5F1GA 2Y2PA 1SKOB 1BLCA 3NECA 2VK3A 3I7JA 4JXWA 4OOLA 4B4ZA 4BL2A 3LGOA 3VP4A 2PAVP 4OPYA 1N9BA 1L0FA 5FDSA 4BQMA 3FKVA 1IYOA 2V2FF 5E43A 2D02A 4FH4A 1GCEA 5F82A 2XR0A 1KOUA 2LB9A 1CI9A 2Y2HA 1YSQA 2J7VA 2A24B 1DY6A 2W0NA 4HJ3A 4HJ4A 2Y8HA 3OLOA 5CGSA 3ZG5A 2JKTI 4ETZA 4OP5A 2XROA 3S7OA 3BFGA 1MWUA 3GVBA 4RQ9A 3K3DA 2RL3A 4E6WA 3LIEA 2PU4A 3BM6A 3WS4A 2V20A 2WGIA 1K6RA 1IKIA 2K31A 2Q9MA 4MDZA 3ULFA 3GR2A 3B3XA 1LSWA 4NXEA 1KGEA 4DDYA 4NKPA 1NXYA 3NDEA 1D1JA 4ME4A 5HL6A 2C5WB 1LL5A 1RGYA 4JKTA 4I39A 3C7UA 1P97A 3NC8A 5M1AA 1JTDA 4FD8A 3NDGA 2B95A 4GCZA 3IXBA 4PM7A 2P04A 4ARZA 3ISGA 4JXSA 2WK0A 1KDWA 4KZ3A 3FKWA 3UNWA 4A5RA 1W7FA 3L9KA 2R78A 4GDBA 1YMSA 1O7EA 3C38A 4PPRA 4Z9QA 5L09A 5IT5A 5HWWA 1VETA 2PDRA 4JBFA 3RXXA 3BFDA 3LO7A 1S6RA 3LI9A 2HJ9C 2OSUA 3O87A 2NUPC 3BW6A 2PHYA 1F2KA 4JPMA 3F1PA 3IH9A 3ZDJA 2XLNA 1OPXA 2XQZA 4LV0A 3PBNA 3R7WA 3P7NA 5CECA 2Y2MA 1KVLA 5IS1A 3P01A 4H8RA 3M6BA 1EROA 3FPVA 3PR6A 1K4EA 3CJMA 5L10A 3IQAA 5HFOA 2OWHA 4DXBA 3MJQA 3D9YA 4CPKA 3FG8A 3V5MA 2JKRM 4QY6A 3UE1A 2I9VA 4E3MA 3G6OA 1WE4A 4RA7A 4JGQA 2CMNA 4Y17A 2Y2JA 1OJGA 4ZTKA 1YPRA 5D3OA 4LCLA 3AGEA 1I2WA 4E3OA 3BEBA 4EW7A 2P7JA 2V9AA 2Y2LA 3FZCA 2ZL1A 5HAQA 4S2NA 3LIBA 4WLAA 5GLBA 5G18A 4KQQA 2ZM8A 3V39A 2H5SA 2VA0A 1PW1A 1BUEA 2EFUA 3BQAA 3BFEA 4GW9A 4EU0A 2JKTM 2Z2LB 5F1FA 3ZG8B 1YSPA 1DP9A 1GHMA 1VEUB 3PBTA 2QWSA 3ZG0A 3F1OB 5DJUA 2H28A 3A0VA 3UO9A 5EVEA 3WS1A 3KYZA 2Y2GA 4KQOA 4UQIS 1OTBA 2ZMAA 2V0WA 3T12B 3HLBA 5EVIB 1OJ5A 5FAPA
chains in the Genus database with same CATH topology
5HSQA 4NEED 3MF0A 2A24A 3OOVA 3MMHA 3E4QA 4CQHA 2OAP1 3KO6A 3E98A 3KSIA 4LRXC 4WELA 3NJAA 1T18A 4ETXA 2OAQ1 4Q0JA 3UMDA 4GHIA 2D01A 5MC7A 4ZRRA 4G3VA 3UB8A 1LSVA 3VE4A 4IUHA 4KUKA 4NXGA 4NXFA 1F5MA 1Y28A 4H6JB 4F3LA 1OT9A 2W1RA 2ZMFA 1TS6A 1XFQA 1H3QA 3EWKA 1UWNX 2W1TA 5K5BA 3C30A 4EESA 4HP9A 3NOUC 3C8CA 3UE3A 2PD7A 5IU1A 3UMEA 4CLCE 4HOIA 1IFQA 2KLIA 4EETB 4HIAA 3FPWA 2NUTC 4L9FA 2HV1A 2V0UA 4K08A 1S1ZA 1NRJA 4NXBA 5DKKA 3VOLA 2PYPA 2Z6CA 3T4LA 4ARZB 3MXQA 3H82A 1XFNA 3EEAA 5HDDA 1DRMA 4GS9B 1T1BA 4MMNA 4LPZA 5J4EA 4PHTA 2WKPA 2WKQA 3BY9A 4JGPA 1P0ZA 5EFWA 1VHMA 2MJ6A 4CLCC 3NOTC 4CLCD 4YNRA 2L0WA 4HJ6A 1NWZA 5HWTA 5I5LA 1ODVA 2XA7M 3T4QA 2XRNA 2L1MA 4HH3A 2OOLA 1LSXA 2QHKA 3LR4A 4BWIA 1OTAA 5DFYA 1NLYA 1GSVA 3LYXA 2O99A 1XJ4A 2VV7A 5HPFA 2XSSA 1NLZA 4MN5A 3VE3A 5F6AA 2QJ7A 2GNXA 1S66L 4PKYA 5HD5A 3IBJA 2FH5A 2VLGA 1N9OA 4YWZA 4R70A 3ICYA 3E0YA 1DP8A 4LRYC 3SW1A 4B9OA 4Z1WA 4I3IA 3LIAA 3BQ8A 2GX5A 4DJ3A 5TBMB 4Q0IA 2KX6A 1TS7A 3ZYTA 1TD5A 3KSHA 2W3DA 3EGDC 2PT7A 3B47A 3F1PB 4MN6A 4B93A 5J7EA 1S4SA 2VEAA 4I3JA 4BJPA 3UB9A 3S7NA 1W63Q 4EERA 3R7WB 5F69A 3RFBA 2O0YA 2LB5A 2K2NA 2W3GA 2BASA 4WEJA 4HI4A 2V1BA 2ZOIA 3MQQA 2L4RA 4PAUA 3D72A 4HQAA 4II7A 4R6LA 2W3EA 3E4PA 1LL8A 4I38A 4R38A 5HD3A 1T1CA 4OOMA 4L9EA 1V9ZA 4E04A 3O5YA 3C2WA 4L9GA 2VX8A 5G4YA 2W3FA 3OCLA 2FZ0A 2P08A 3MQ0A 4WEKA 4WL9A 4DJ2A 3T50A 4AFIA 4DMZA 3JVUA 3MFXA 3CAXA 5HDSA 1EW0A 3W2ZA 1UWPX 3IS2B 3D3OA 2J3WA 1YAXA 1DP6A 3E4OA 4DN0A 3T4KA 5DKLA 5KIZA 2VV6A 2O9BA 2EWWA 2IA2A 4BMWA 4R3AA 2W3HA 4CLCA 3BWLA 2M7UA 2KOIA 4XT2A 1P9RA 2J3TC 4FSFA 3EQUA 3TW8A 2J3TD 2VKSA 3R4KA 4O8GA 1G6OA 1F98A 1X0OA 2G7UA 2INWA 5HWVA 1MKMA 2YKHA 3B33A 3A0SA 3S7QA 1LT0A 4BBVA 4IHQA 3CITA 4OOLA 2V1AA 3U2AA 2VJWA 4PKYG 3NOPC 2D02A 3H7WB 4HY8A 4UEYA 3S7PA 3IBRA 3LIFA 2HGVA 1KOUA 4HP4A 4Q0HA 2LB9A 3JVVA 2Y79A 5HZHA 1ZTUA 1YSQA 2QYBA 3EQVA 3F1OA 2A24B 2W0NA 4HJ3A 4HJ4A 2GZAA 2Y8HA 2VV8A 4MCWA 3OLOA 3TRCA 2XA7S 3PYPA 3EGXC 2YKFA 3F1NA 2JKTI 3LIDA 4GHIB 4ETZA 2XROA 2PD8A 3S7OA 4F3LB 1N9NA 4RQ9A 3K3DA 2VZWA 2W1TB 4FOFA 3LIEA 5J3WA 5L8MA 1D06A 2M1CA 3KSFA 4IUKA 3GECA 4O0PA 2KDKA 2WKRA 5DF9A 4JGRA 2K31A 3UB6A 4MDZA 3ULFA 1S67L 3GDIA 2B18A 3RTYA 3PBRA 4H6JA 1MZUA 3B42A 3HJIA 1LSWA 4NXEA 1P9WA 3H82B 4Y2FA 2PR5A 2VGLM 4NKPA 4WUJA 5HL6A 4ME4A 4EEUA 3K2NA 3KX0X 2VGLS 3PBSA 4I39A 4Y5FA 3T4SA 1P97A 5TJJA 3T4OA 1VB6A 5F5YA 4GCZA 3A0RA 2ZBBA 4KQDA 1OTIA 2P04A 4GJ4A 4ARZA 4HH2A 3LR5A 4GS9A 3PHYA 4EXOA 3BJNA 1XJ3A 1XJ2A 5HDCA 2B02A 3TJZC 4MN7A 3EEHA 4LRZE 2W27A 4I3AA 1TS0A 3NHQA 3OC2A 4IJGA 2R78A 5A8BA 3C38A 1JNUA 1OTEA 4WN5A 4P6ZM 5FL3A 5IT5A 5HWWA 1F9IA 3K3CA 3LICA 5AVEA 1S1YA 3LR0A 3PBQA 2QJ5A 2QKPA 4P6ZS 4M4XA 1OT6A 1UGUA 4O01A 2PDRA 1XJ6A 3CWFA 2EWVA 3HJKA 1T19A 2JKRI 3PXPA 4BBUA 5KSHA 1G28A 3UE6A 3LUQA 3ZQ5A 3LI9A 4WF0A 2K7SA 1S4RA 2HJ9C 3CLOA 3MQOA 5AVFA 2NUPC 4L0LA 5HPIA 2ZOHA 3FC7A 4I5SA 3BW6A 3MR0A 5TBMA 2Z6DA 3OBFA 4GLQA 2PHYA 3F1PA 2OWJA 1IOUA 3RH8B 3KSGA 2GJ3A 5AJGA 3CUEA 1OPXA 3UB7A 3PBNA 5CX7A 3R7WA 4YOFA 3KYQA 3P7NA 1BYWA 5IS1A 3P01A 3DBAA 5DJTA 2HF6A 3T4JA 2JHEA 3FPVA 3PR6A 1GSWA 4QPRA 2O9CA 2OWHA 2A2LA 2HJEA 5F68A 4EQ1A 3MJQA 3FG8A 2JKRM 2O9AA 2PR6A 1D7EA 4KUOA 2I9VA 3G6OA 2JN7A 3CUEC 5C5KA 4JGQA 1MC0A 2CMNA 3PBOA 3BY8A 1TF1A 1OJGA 4CLCB 3HCYA 4JGOA 1ZHHB 4XT2B 2ZMVA 4EW7A 1YKDA 4HHDA 2P7JA 4BBTA 1V9YA 2V9AA 3OCNA 3T4TA 4Y3IA 1OTDA 4LLOB 3IS2A 2J80A 1STZA 4G3KA 3LI8A 3H9WA 3LIBA 4WLAA 1GSXA 5G4ZA 3LR3A 1N9LA 1T1AA 1TS8A 2VA0A 2PYRA 4G3WA 5LBRA 3TE8A 3BQAA 4HNBA 4GW9A 5DFXA 2JKTM 4EU0A 3LFVA 2EA9A 1YSPA 1DP9A 3EOIA 3V67A 2M7VA 3PBTA 2QWSA 3F1OB 5DJUA 4UQIM 1WA9A 2H28A 3A0VA 3CI6A 3KYZA 4KQOA 3VV4A 4UQIS 1OTBA 3F1NB 4EEPA 4EUVA 2DMWA 1W63M 3H7WA 2V0WA 1OJ5A 1H8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HSQ A;  2A24 A;  3E4Q A;  4LRX C;  3NJA A;  1T18 A;  3UMD A;  4GHI A;  2D01 A;  3UB8 A;  1LSV A;  3VE4 A;  4KUK A;  4NXG A;  4NXF A;  1Y28 A;  4H6J B;  4F3L A;  1OT9 A;  1TS6 A;  1XFQ A;  3EWK A;  1UWN X;  4EES A;  4HP9 A;  3NOU C;  3C8C A;  2PD7 A;  5IU1 A;  3UME A;  4HOI A;  4EET B;  4HIA A;  4L9F A;  2HV1 A;  2V0U A;  4K08 A;  1S1Z A;  4NXB A;  5DKK A;  3VOL A;  2PYP A;  2Z6C A;  3MXQ A;  3H82 A;  1XFN A;  5HDD A;  1DRM A;  4GS9 B;  1T1B A;  4LPZ A;  5J4E A;  2WKP A;  2WKQ A;  3BY9 A;  4JGP A;  1P0Z A;  5EFW A;  3NOT C;  2L0W A;  4HJ6 A;  1NWZ A;  5HWT A;  5I5L A;  1ODV A;  2L1M A;  4HH3 A;  2OOL A;  1LSX A;  2QHK A;  1OTA A;  1GSV A;  3LYX A;  2VV7 A;  1XJ4 A;  4MN5 A;  3VE3 A;  5F6A A;  2QJ7 A;  1S66 L;  4PKY A;  5HD5 A;  2VLG A;  1N9O A;  4YWZ A;  4R70 A;  3ICY A;  4LRY C;  1DP8 A;  3SW1 A;  4B9O A;  4I3I A;  3LIA A;  4DJ3 A;  5TBM B;  2KX6 A;  1TS7 A;  3F1P B;  4MN6 A;  5J7E A;  1S4S A;  2VEA A;  4I3J A;  3UB9 A;  4EER A;  5F69 A;  2BAS A;  4HI4 A;  2V1B A;  2ZOI A;  3MQQ A;  2L4R A;  3D72 A;  4HQA A;  4R6L A;  3E4P A;  1LL8 A;  4I38 A;  4R38 A;  5HD3 A;  1T1C A;  4L9E A;  1V9Z A;  4E04 A;  3C2W A;  4L9G A;  5G4Y A;  4WL9 A;  4DJ2 A;  3T50 A;  3MFX A;  3CAX A;  5HDS A;  1EW0 A;  1UWP X;  3IS2 B;  3E4O A;  1DP6 A;  5DKL A;  5KIZ A;  2VV6 A;  4R3A A;  3BWL A;  4XT2 A;  1F98 A;  1X0O A;  2INW A;  5HWV A;  2YKH A;  3B33 A;  3A0S A;  1LT0 A;  4BBV A;  2V1A A;  4PKY G;  3NOP C;  2D02 A;  3H7W B;  4HY8 A;  3IBR A;  3LIF A;  4HP4 A;  1KOU A;  5HZH A;  3F1O A;  2A24 B;  2W0N A;  4HJ3 A;  4HJ4 A;  2VV8 A;  3OLO A;  3PYP A;  2YKF A;  3F1N A;  3LID A;  4GHI B;  2PD8 A;  4F3L B;  1N9N A;  4RQ9 A;  3K3D A;  3LIE A;  5J3W A;  1D06 A;  2M1C A;  3GEC A;  2KDK A;  2WKR A;  4JGR A;  3UB6 A;  3ULF A;  1S67 L;  3GDI A;  3RTY A;  4H6J A;  1MZU A;  3HJI A;  1LSW A;  4NXE A;  3H82 B;  2PR5 A;  4WUJ A;  4EEU A;  3KX0 X;  4I39 A;  1P97 A;  1VB6 A;  5F5Y A;  4GCZ A;  3A0R A;  2ZBB A;  4KQD A;  1OTI A;  4HH2 A;  4GS9 A;  3PHY A;  4EXO A;  1XJ3 A;  1XJ2 A;  5HDC A;  2B02 A;  3EEH A;  4LRZ E;  2W27 A;  4I3A A;  1TS0 A;  3NHQ A;  2R78 A;  5A8B A;  1JNU A;  1OTE A;  4WN5 A;  5HWW A;  1F9I A;  3K3C A;  3LIC A;  5AVE A;  1S1Y A;  2QJ5 A;  2QKP A;  4M4X A;  1OT6 A;  1UGU A;  2PDR A;  1XJ6 A;  3CWF A;  3HJK A;  1T19 A;  4BBU A;  1G28 A;  3UE6 A;  3LUQ A;  3ZQ5 A;  3LI9 A;  4WF0 A;  2K7S A;  1S4R A;  3CLO A;  3MQO A;  5AVF A;  2ZOH A;  3FC7 A;  4I5S A;  3MR0 A;  5TBM A;  2Z6D A;  2PHY A;  3F1P A;  2OWJ A;  3RH8 B;  2GJ3 A;  3UB7 A;  3P7N A;  1BYW A;  5IS1 A;  5DJT A;  2JHE A;  1GSW A;  2OWH A;  5F68 A;  4EQ1 A;  3MJQ A;  3FG8 A;  2PR6 A;  1D7E A;  4KUO A;  2I9V A;  3G6O A;  2JN7 A;  4JGQ A;  2CMN A;  3BY8 A;  1OJG A;  4JGO A;  4XT2 B;  4EW7 A;  4HHD A;  2P7J A;  4BBT A;  1V9Y A;  2V9A A;  1OTD A;  4LLO B;  3IS2 A;  2J80 A;  3LI8 A;  3H9W A;  3LIB A;  4WLA A;  1GSX A;  5G4Z A;  1N9L A;  1T1A A;  1TS8 A;  2PYR A;  4HNB A;  4GW9 A;  2EA9 A;  1DP9 A;  2QWS A;  3F1O B;  5DJU A;  1WA9 A;  2H28 A;  3A0V A;  1OTB A;  3F1N B;  4EEP A;  3H7W A;  2V0W A;  1OJ5 A; 
#chains in the Genus database with same CATH topology
 3MS6 A;  4NEE D;  4GDN A;  5HAI A;  1PWG A;  4K0X A;  4R4S A;  3OOV A;  1K4F A;  2OAP 1;  4KZ4 A;  3WRZ A;  4OLG A;  4LRX C;  3HL9 A;  1ZC2 A;  2OAQ 1;  3UMD A;  1VQQ A;  3UB8 A;  3VE4 A;  4NXG A;  4H6J B;  5JYO A;  3QP6 A;  5CHM A;  5CGX A;  2ZMF A;  1AXB A;  1YLZ A;  2P74 A;  2Y55 A;  2Y4A A;  3C30 A;  3C8C A;  4DE2 A;  4PMA A;  4HOI A;  3A3I A;  4D2O A;  4LCM A;  5FAT A;  1NRJ A;  1ACF A;  2EX9 A;  4X25 A;  2Z6C A;  3G32 A;  4JF5 A;  3RJU A;  1DRM A;  2ZM0 A;  4JXV A;  2E8J A;  4P0M A;  4LPZ A;  4OVD A;  2WKQ A;  4JGP A;  1P0Z A;  1VHM A;  4O7D A;  3DTI A;  4YNR A;  4HJ6 A;  5I5L A;  2XRN A;  1BSG A;  2L1M A;  5EEC A;  1DJB A;  4XXR A;  3BRM A;  4BWI A;  5DFY A;  1NLY A;  1XA7 A;  5CRF A;  3VE3 A;  5CEB A;  2DCF A;  3UPP A;  2QMI A;  4ZJ3 A;  3IBJ A;  2FH5 A;  3SW1 A;  4N1X A;  1PWC A;  1XP4 A;  5TBM B;  4Q0I A;  3ZYT A;  1TD5 A;  3KSH A;  4OH0 A;  4B93 A;  2VEA A;  1PI4 A;  5EM1 A;  3UB9 A;  3S7N A;  1W63 Q;  5EVI D;  5M18 A;  1L0E A;  5HAP A;  2K2N A;  2BAS A;  1ALQ A;  4MLL A;  2V1B A;  5GHY A;  3T1Q B;  1J9M A;  3UDX A;  4PAU A;  4HQA A;  4Y13 A;  3IHB A;  4E04 A;  4N1H A;  2W3F A;  3A3J A;  4WL9 A;  3IF6 A;  3Q7Z A;  1TVF A;  1UWP X;  3D3O A;  2J3W A;  3E4O A;  1XXM A;  3RXW A;  4ZJ2 A;  5EOE A;  4BMW A;  2M7U A;  1YT4 A;  3TW8 A;  3P09 A;  3R4K A;  1JWZ A;  4WMC D;  3TSG A;  4O8G A;  4IBR A;  3HLF A;  2WKE A;  2ZJ9 A;  3S4X A;  1MKM A;  3B33 A;  1BLS A;  3S7Q A;  1LT0 A;  4IHQ A;  1K54 A;  4X55 A;  1ES4 A;  2V1A A;  3NUL A;  1NYM A;  2J9P A;  3LCE A;  2VJW A;  3Q07 A;  3NOP C;  2E8I A;  2WZX A;  1A0K A;  4HY8 A;  3VSK A;  2HGV A;  5EUA A;  1NY0 A;  3QP5 A;  3SS4 A;  2QYB A;  4MBK A;  2AVX A;  5TR7 A;  3G34 A;  2VV8 A;  4LEN A;  4MBH A;  3PYP A;  3EGX C;  3F1N A;  3LID A;  3D4F A;  3N8S A;  2PD8 A;  4F3L B;  4OQ0 A;  4S2I A;  3HLD A;  3N7W A;  1LLB A;  2W1T B;  4IVI A;  3KSF A;  3N8L A;  3PTE A;  3GEC A;  4O0P A;  1FCN A;  2KDK A;  2WKR A;  5KZH A;  4WZ5 C;  1PRQ A;  1CQA A;  4Y15 A;  3TOI A;  4ZDX A;  1PI5 A;  5A92 A;  1MKI A;  1P9W A;  3H82 B;  4Y2F A;  2GDN A;  4EWF A;  2V8F A;  1GA0 A;  1M6K A;  1FQG A;  1FCM A;  1IKG A;  4WUJ A;  4QHC A;  1HD8 A;  3IXH A;  3K2N A;  2VGL S;  3MBZ A;  1XX2 A;  4Y5F A;  2JKG A;  3HUN A;  4KQD A;  3N6I A;  3ZCZ A;  4DXC A;  4GS9 A;  3UDF A;  4EXO A;  3BJN A;  1H8Y A;  3TJZ C;  4P6B A;  4LRZ E;  5FSR A;  1TS0 A;  2WKI A;  5TFQ A;  4P87 A;  4OLD A;  2ZC5 B;  5A8B A;  4OPR A;  4WN5 A;  4P6Z M;  3LIC A;  3PBQ A;  5DTK A;  3W4Q A;  4ID4 A;  1UGU A;  3DAV A;  1K25 A;  3NCK A;  4S2O A;  5CED A;  1W5D A;  1XJ6 A;  3Q81 A;  2EWV A;  4CJN A;  3PXP A;  2JKR I;  5KSH A;  1L0D A;  1G28 A;  3UE6 A;  2PBD P;  4EBL A;  4WF0 A;  2K7S A;  1ESU A;  4OPQ A;  5AVF A;  4L0L A;  1ES5 A;  3FC7 A;  2WGV A;  3OBF A;  1KE3 A;  1IOU A;  3RH8 B;  5E2E A;  1W8Q A;  1XKZ A;  2WGW A;  4U3T A;  5EV0 A;  2JKF A;  4N9L A;  3LY3 A;  1BYW A;  3MXS A;  4NG2 A;  2HP9 A;  2JHE A;  4IED A;  4QPR A;  2FFY A;  5EPH A;  2XD5 A;  5F68 A;  4DDS A;  1IYP A;  3OPR A;  3M2K A;  5FQK A;  1E3U D;  3PBO A;  1XGI A;  3SOI A;  1Z09 A;  5A90 A;  3HCY A;  1PYY A;  4BD0 A;  4UA7 A;  4HHD A;  4FCF A;  1FIK A;  4MBF A;  3OCN A;  4NK3 A;  3T4T A;  2R9W A;  1MPL A;  4LLO B;  3E2L A;  3IS2 A;  2PU2 A;  3S1Y A;  3H9W A;  5G4Z A;  1JTG A;  4ZJ1 A;  4OPZ A;  5LBR A;  3TE8 A;  3OPP A;  5DFX A;  3VP0 A;  1SKO A;  4EQI A;  5FQJ A;  3TG9 A;  2ZC3 B;  3N4I A;  3OZH A;  3VV4 A;  3VFH A;  4EUV A;  3A3E A;  3Q82 A;  1W63 M;  5FAQ A;  3MZD A;  1ES2 A;  1ZKJ A;  5E2F A;  4K91 A;  5HSQ A;  1HLU P;  1K6S A;  1PZP A;  2A24 A;  3MMH A;  2V1Z A;  3ZNT A;  3CZD A;  3KO6 A;  3UY6 A;  4WEL A;  3NJA A;  1SDN A;  4B88 A;  4RVA A;  4Q0J A;  2D01 A;  5MC7 A;  4ZRR A;  3HLW A;  4OKP A;  4IUH A;  1F5M A;  1Y28 A;  1OT9 A;  4KZ5 A;  4DKI A;  1KE4 A;  1XFQ A;  4PM6 A;  4EES A;  4S2K A;  3UE3 A;  2PD7 A;  4X56 A;  1H0M A;  5FQI A;  3IXD A;  4DE0 A;  4HIA A;  3FPW A;  2V0U A;  1S1Z A;  2Y2N A;  4Q8I A;  3VOL A;  2PYP A;  3MXQ A;  5HDD A;  3EEA A;  3HUM A;  3T1X A;  4MMN A;  5J4E A;  3E2K A;  2Y59 A;  2EXB A;  4R4R A;  1NWZ A;  2UV0 E;  5HWT A;  2IWB A;  1W79 A;  2OOL A;  2EX6 A;  4P85 A;  2IWD A;  2QHK A;  3CPT B;  1OTA A;  4JLF A;  3LYX A;  2O99 A;  2VV7 A;  5FA7 A;  3UE0 A;  2WUQ A;  2XSS A;  5BOH A;  1FSW A;  2GNX A;  2WKH A;  3MZF A;  4OQI A;  4PKY A;  2J9O A;  5HD5 A;  2VLG A;  2XD1 A;  2G2W A;  1DP8 A;  4LRY C;  3ZVW A;  3V3S A;  4I3I A;  2XEP A;  3UB5 P;  3T1S A;  3U4L P;  4DJ3 A;  1TS7 A;  4MN6 A;  2HDR A;  4EER A;  5HL1 A;  3G4P A;  3MSH A;  3G35 A;  3HLE A;  3O86 A;  5F69 A;  3ZFZ A;  2O0Y A;  4IVK A;  4QJG A;  4XUZ A;  3WWX A;  4WEJ A;  1NZU A;  4HI4 A;  2ZOI A;  1Q2Q A;  4XUX A;  2H0Y A;  1Y4O A;  5M19 A;  3ZG9 B;  4II7 A;  3Q1F A;  2W3E A;  3DWZ A;  1LL8 A;  3M6H A;  1T1C A;  1MWR A;  1ES3 A;  2EX8 A;  3SH7 A;  4DE3 A;  1MWT A;  4WYY A;  2P08 A;  1AWI A;  3T50 A;  4AFI A;  4DMZ A;  2H10 A;  4KZ6 A;  3W4O A;  3SH8 A;  2B5R A;  3N8R A;  3W2Z A;  4F94 A;  5GHZ A;  1YAX A;  1DP6 A;  4EBN A;  4DN0 A;  3GRJ A;  1BZA A;  1SKF A;  2IA2 A;  4R3A A;  2W3H A;  1G5U A;  2J3T C;  1DJA A;  3EQU A;  2J3T D;  5GLD A;  4GNU A;  1X0O A;  2G7U A;  4EV4 A;  5HWV A;  2ZD8 A;  2P9V B;  4OQH A;  3IX4 A;  2YKH A;  4KEN B;  1Z6F A;  1XA1 A;  3LEQ A;  1K0K A;  4E3L A;  4PKY G;  3H7W B;  3S7P A;  3IBR A;  3LIF A;  1ZG6 A;  4Q0H A;  3JVV A;  1ONH A;  2XFT A;  1VEU A;  4U0T A;  3F1O A;  4EUZ A;  2IWC A;  2GZA A;  1W8Y A;  2XA7 S;  2XK1 A;  4JF6 A;  4GHI B;  1PIO A;  3CHW P;  5HAR A;  1BUL A;  5EVI A;  4DF6 A;  5CTN A;  3LY4 A;  4RX2 A;  3T1R A;  4X6T A;  1I5Q A;  5J8X A;  3VSL A;  1LHY A;  5L8M A;  1D06 A;  2M1C A;  1YM1 A;  5AQB A;  3OPH A;  4JGR A;  2B18 A;  3RTY A;  4H6J A;  1HVB A;  1MZU A;  3QHY A;  5EVI C;  2ZQC A;  3VP3 A;  4S2P A;  3O88 A;  2PR5 A;  1K38 A;  2Z2M B;  1G68 A;  3BLM A;  3SZT A;  3Q7V B;  3JYI A;  3KX0 X;  2XH9 A;  3T4S A;  5FQQ A;  5DTS A;  2Q0O A;  2ZBB A;  2Y2O A;  4GJ4 A;  2ZQ8 A;  3LR5 A;  4JF4 A;  3PHY A;  4X68 A;  1IEL A;  1XJ2 A;  1XJ3 A;  1FR6 A;  1NYY A;  4MN7 A;  3EEH A;  4WMC A;  4I3A A;  4HEF A;  2Y2K A;  3NHQ A;  3BLS A;  2ACG A;  3DTE A;  5FDH A;  4GD6 A;  5FL3 A;  1F9I A;  2WAF A;  3K3C A;  4DE1 A;  3V3R A;  5AVE A;  3LR0 A;  3WS5 A;  4C75 A;  1J3W A;  5AQA A;  2QKP A;  1OT6 A;  1CF0 A;  4X1M A;  4KG6 A;  3L7H A;  1T19 A;  4KZ7 A;  3LUQ A;  1XPB A;  5CXW A;  5CGW A;  3CLO A;  5HW3 A;  3MQO A;  3FWL A;  4QU3 A;  5HPI A;  2ZOH A;  1BTL A;  3MR0 A;  5TBM A;  3KYE A;  5DF8 A;  2HP5 A;  2ZLY A;  3W4P A;  5AJG A;  3VFF A;  2RCX A;  2QZ6 A;  3UB7 A;  5CX7 A;  4WM9 A;  3UDI A;  1MBL A;  3KYQ A;  1MWS A;  1GA9 A;  3DBA A;  5DJT A;  2HF6 A;  1GSW A;  4WZ5 A;  2O9C A;  1M40 A;  2HJE A;  4EQ1 A;  5CER A;  3WS2 A;  3QP8 A;  5CHU A;  5KMW A;  3G30 A;  5FAO A;  1BLH A;  2O9A A;  2PR6 A;  1D7E A;  1TEM A;  4YIN A;  2C6W B;  3SH9 A;  1SCW A;  1TF1 A;  4CLC B;  2CC1 A;  1ZHH B;  4XT2 B;  5CHJ A;  2ZMV A;  4BBT A;  2ZM2 A;  1V9Y A;  3O3V A;  2WAE A;  5FEG A;  3QNB A;  2ZQA A;  4Y3I A;  1OTD A;  1N4O A;  2J80 A;  1STZ A;  1S0W A;  4GN2 A;  1GSX A;  3LR3 A;  3QP4 A;  1HZO A;  1N9L A;  2ZQD A;  2PYR A;  1PW8 A;  4HNB A;  1L3L A;  4S2J A;  3LFV A;  4B4X A;  1PZO A;  2EA9 A;  4GOG A;  3V67 A;  3BEC A;  1OME A;  1KDS A;  4UQI M;  1WA9 A;  1CEG A;  3CI6 A;  1SHV A;  1KGF A;  2WYX A;  4UA6 A;  3UPO A;  2DMW A;  5GL9 A;  1YLP A;  3HBR A;  3JPU A;  4MNR A;  1H8M A;  1L2S A;  3G31 A;  4M3K A;  2A3U A;  3E4Q A;  4CQH A;  3E98 A;  2HZ5 A;  1ZG4 A;  3C5A A;  4G3V A;  4KUK A;  1K55 A;  4F3L A;  2XF3 A;  3EWK A;  1UWN X;  2W1T A;  5K5B A;  3G2Y A;  1JWV A;  4CLC E;  4Y0U A;  4EET B;  4L9F A;  2HV1 A;  4K08 A;  5F83 A;  4RX3 A;  3DW0 A;  5DKK A;  3S22 A;  1E3U A;  3T4L A;  4ARZ B;  1K55 C;  3H82 A;  1L0G A;  5TGF A;  4GD8 A;  4KG2 A;  4BD1 A;  4PHT A;  4C6Y A;  3BY9 A;  2ZC6 B;  4S2L A;  4X53 A;  2VGJ A;  2MJ6 A;  3IX8 A;  3NOT C;  4CLC C;  4CLC D;  5L07 A;  4LFU A;  1PWD A;  2XA7 M;  3T4Q A;  4IBX A;  2I72 A;  1VET B;  1LI0 A;  1LSX A;  3LR4 A;  1TDL A;  1GSV A;  5FQ9 A;  1XJ4 A;  2A49 A;  5HPF A;  1K56 A;  1S66 L;  1GHP A;  4OON A;  5CTM A;  3ITB A;  1N9O A;  4YWZ A;  3MXR A;  3QNC A;  3E0Y A;  1NRF A;  4B9O A;  2GX5 A;  1GHI A;  4S2M A;  3WS0 A;  2W3D A;  3QP1 A;  2PT7 A;  3B47 A;  3F1P B;  1YLJ A;  4OOY A;  4C3Q A;  3HRE A;  4KG5 A;  3MFD A;  4WBG A;  1K56 D;  4UA9 A;  3R7W B;  4EBP A;  2LB5 A;  3MQQ A;  2ZQ7 A;  2L4R A;  1CJF A;  1H5X A;  4KZ9 A;  4R6L A;  3E4P A;  4I38 A;  4R38 A;  4OOM A;  4L9E A;  1V9Z A;  3A3F A;  3C2W A;  5G4Y A;  3MKF A;  1G6A A;  3MQ0 A;  4DJ2 A;  3MFX A;  3CAX A;  5AQ9 A;  5HDS A;  4BL3 A;  1EW0 A;  2ZL1 B;  3IWQ A;  2BG1 A;  3T4K A;  4PM5 A;  5EOO A;  2VV6 A;  2O9B A;  3BYD A;  3IHA A;  3BWL A;  5U47 A;  5FAS A;  1P9R A;  2VKS A;  4QY5 A;  1F98 A;  2INW A;  3NY4 A;  2R9X A;  3OPL A;  2X02 A;  3A0S A;  1KE0 A;  1C3B A;  4ZAM A;  4BBV A;  4X1L A;  3CIT A;  4LV3 A;  3NI9 A;  1BT5 A;  3U2A A;  4GZB A;  4E3J A;  3W8K A;  4UEY A;  1JVJ A;  3VOZ A;  4HP4 A;  2UWX A;  1O07 A;  2Y79 A;  5HZH A;  1ZTU A;  1YLY A;  3EQV A;  1FR1 A;  1QMF A;  3ZVT A;  4E3I A;  4KZ8 A;  2PBY A;  4MCW A;  4R3B A;  3TRC A;  1EI5 A;  2WAD A;  4UAA A;  2VGK A;  2YKF A;  2HDS A;  3SS3 A;  1CEF A;  4MEZ A;  2XFS A;  1N9N A;  2OLU A;  2EXA A;  2V8C A;  2VZW A;  1SZV A;  2Y2Q A;  5GLC A;  4FOF A;  5J3W A;  4LV1 A;  4IUK A;  5DF9 A;  1IEM A;  3UB6 A;  5DF7 A;  5I94 A;  1S67 L;  3GDI A;  5AQ7 A;  3PBR A;  2G2U A;  1ONG A;  3B42 A;  3HJI A;  2HDU A;  2VGL M;  4EEU A;  2EX2 A;  4KQR A;  3GMW A;  3PBS A;  1RCJ A;  4OQG A;  5TJJ A;  3T4O A;  3DTM A;  1VB6 A;  5F5Y A;  3A0R A;  1OTI A;  4LGW A;  4DRT A;  4HH2 A;  2JC7 A;  4Y0O A;  2WZZ A;  2HP6 A;  1E25 A;  3UN7 A;  3VP2 A;  5HDC A;  1U60 A;  2B02 A;  3AGD A;  4S2N C;  2W27 A;  1FCO A;  3OC2 A;  1TDG A;  4FH2 A;  4IJG A;  2EFX A;  4GB7 A;  1JNU A;  3IF5 A;  1OTE A;  3ZG7 B;  1Y54 A;  1NZO A;  1S1Y A;  2QJ5 A;  1K57 A;  1SDE A;  1CK3 A;  4P6Z S;  4M4X A;  4R0Q A;  3CPT A;  1WYC A;  4O01 A;  2OV5 A;  3CWF A;  4Y0T A;  3HJK A;  4BBU A;  4E3K A;  4N9K A;  3ZQ5 A;  2BTF P;  1S4R A;  3DTK A;  1MY8 A;  1DJC A;  1EWZ A;  4I5S A;  1K57 C;  2Z6D A;  4GLQ A;  2OWJ A;  3KSG A;  2GJ3 A;  3CUE A;  3IWI A;  2H0T A;  1ERQ A;  4YOF A;  3LEZ A;  1FOF A;  3T4J A;  4UHU A;  4JXG A;  3V50 A;  2XDM A;  2JCH A;  3IF6 B;  2A2L A;  4WZ4 A;  2JBF A;  4KUO A;  2HDQ A;  1ERM A;  2JN7 A;  3CUE C;  5C5K A;  1MC0 A;  5DTT A;  3WRT A;  3BY8 A;  2Y2I A;  1KVM A;  4JGO A;  1YKD A;  1PFL A;  1IYS A;  4G3K A;  1QME A;  3LI8 A;  1E4D A;  5FEF A;  1T1A A;  1TS8 A;  3HLC A;  2BLS A;  1LL9 A;  4G3W A;  3GQZ A;  1FSY A;  4ESP A;  1PNE A;  2HPB A;  3A3D A;  5L2F A;  5A91 A;  1RP5 A;  1KGG A;  2P9V A;  3EOI A;  5EE8 A;  2M7V A;  4D60 A;  3ZHH A;  3PAE A;  4X69 A;  2QPN A;  3BFC A;  2ZC7 A;  3AGF A;  3F1N B;  4EEP A;  1NJ4 A;  3H7W A;  4Y7P A;  5FI7 A;  1HTZ A;  3NBL A;  4FUW A;  3C7V A;  3MF0 A;  4PM9 A;  1XGJ A;  3HLG A;  2OLV A;  3KSI A;  2DRW A;  1T18 A;  4KZA A;  4ETX A;  4BLM A;  5GHX A;  4GHI A;  1LSV A;  1IYQ A;  1LI9 A;  3IH8 A;  3FYZ A;  3DWK A;  4NXF A;  2W1R A;  5EM0 A;  4U0X A;  1TS6 A;  1H3Q A;  3ITA A;  5E2G A;  3GV9 A;  4QWO A;  4HP9 A;  3NOU C;  5IU1 A;  3UME A;  3CMZ A;  1IFQ A;  2KLI A;  3NIA A;  2NUT C;  1FIL A;  4NXB A;  3IF6 C;  3VMA A;  2FFF B;  4LV2 A;  3IXG A;  1XFN A;  4N92 A;  4GS9 B;  1T1B A;  5IHV A;  3P98 A;  3Q7V A;  1MXO A;  2WKP A;  5HX9 A;  5EFW A;  3BFF A;  2X01 A;  1YQS A;  2L0W A;  5EVL A;  4KZB A;  1ODV A;  1RGZ A;  1YLW A;  3C4P A;  4FTX A;  4OP8 A;  3HUO A;  3QP2 A;  4HH3 A;  2J8Y A;  3MKE A;  5E2H A;  5FI6 A;  2XGN A;  1K54 C;  4HES A;  4R1G A;  3G2Z A;  1NLZ A;  4MN5 A;  5F6A A;  2QJ7 A;  3C4O A;  4K0W A;  4RYE A;  4ZBE A;  5GLA A;  4R70 A;  3GTC A;  4GKU A;  3ICY A;  4R3J A;  4HBU A;  4Z1W A;  4E3N A;  3LIA A;  3BQ8 A;  1I2S A;  5FQM A;  1YMX A;  2Y91 A;  2PRF A;  2JE5 A;  5A93 A;  5KSC A;  3SS5 A;  2KX6 A;  2X71 A;  3EGD C;  5J7E A;  1S4S A;  3CG5 A;  4I3J A;  4BJP A;  1ESI A;  1WYB A;  1BLP A;  1YLT A;  2WGW B;  5DVA A;  3GSG A;  3RFB A;  2W3G A;  5JYP A;  3IWO A;  4R23 A;  4QD4 A;  1CI8 A;  3M2J A;  3ZNY A;  4E6X A;  3IT9 A;  3D72 A;  3MZE A;  3HVF A;  1H8Z A;  2Q9N A;  5HD3 A;  4PM8 A;  3O5Y A;  4L9G A;  2VX8 A;  2ZC4 B;  3OCL A;  1Q2P A;  2FZ0 A;  4WEK A;  2DNS A;  4QB8 A;  3JVU A;  4HBT A;  3VP1 A;  1VM1 A;  4YFM A;  5FI2 A;  3IS2 B;  4NET A;  3UPN A;  3IX3 A;  5DKL A;  5KIZ A;  2EWW A;  1JWP A;  3FV7 A;  4CLC A;  3PAG A;  2ZQ9 A;  2KOI A;  4XT2 A;  4FSF A;  4BEN A;  3VOY A;  3ZGA B;  1G6O A;  5F1G A;  2Y2P A;  1SKO B;  1BLC A;  3NEC A;  2VK3 A;  3I7J A;  4JXW A;  4OOL A;  4B4Z A;  4BL2 A;  3LGO A;  3VP4 A;  2PAV P;  4OPY A;  1N9B A;  1L0F A;  5FDS A;  4BQM A;  3FKV A;  1IYO A;  2V2F F;  5E43 A;  2D02 A;  4FH4 A;  1GCE A;  5F82 A;  2XR0 A;  1KOU A;  2LB9 A;  1CI9 A;  2Y2H A;  1YSQ A;  2J7V A;  2A24 B;  1DY6 A;  2W0N A;  4HJ3 A;  4HJ4 A;  2Y8H A;  3OLO A;  5CGS A;  3ZG5 A;  2JKT I;  4ETZ A;  4OP5 A;  2XRO A;  3S7O A;  3BFG A;  1MWU A;  3GVB A;  4RQ9 A;  3K3D A;  2RL3 A;  4E6W A;  3LIE A;  2PU4 A;  3BM6 A;  3WS4 A;  2V20 A;  2WGI A;  1K6R A;  1IKI A;  2K31 A;  2Q9M A;  4MDZ A;  3ULF A;  3GR2 A;  3B3X A;  1LSW A;  4NXE A;  1KGE A;  4DDY A;  4NKP A;  1NXY A;  3NDE A;  1D1J A;  4ME4 A;  5HL6 A;  2C5W B;  1LL5 A;  1RGY A;  4JKT A;  4I39 A;  3C7U A;  1P97 A;  3NC8 A;  5M1A A;  1JTD A;  4FD8 A;  3NDG A;  2B95 A;  4GCZ A;  3IXB A;  4PM7 A;  2P04 A;  4ARZ A;  3ISG A;  4JXS A;  2WK0 A;  1KDW A;  4KZ3 A;  3FKW A;  3UNW A;  4A5R A;  1W7F A;  3L9K A;  2R78 A;  4GDB A;  1YMS A;  1O7E A;  3C38 A;  4PPR A;  4Z9Q A;  5L09 A;  5IT5 A;  5HWW A;  1VET A;  2PDR A;  4JBF A;  3RXX A;  3BFD A;  3LO7 A;  1S6R A;  3LI9 A;  2HJ9 C;  2OSU A;  3O87 A;  2NUP C;  3BW6 A;  2PHY A;  1F2K A;  4JPM A;  3F1P A;  3IH9 A;  3ZDJ A;  2XLN A;  1OPX A;  2XQZ A;  4LV0 A;  3PBN A;  3R7W A;  3P7N A;  5CEC A;  2Y2M A;  1KVL A;  5IS1 A;  3P01 A;  4H8R A;  3M6B A;  1ERO A;  3FPV A;  3PR6 A;  1K4E A;  3CJM A;  5L10 A;  3IQA A;  5HFO A;  2OWH A;  4DXB A;  3MJQ A;  3D9Y A;  4CPK A;  3FG8 A;  3V5M A;  2JKR M;  4QY6 A;  3UE1 A;  2I9V A;  4E3M A;  3G6O A;  1WE4 A;  4RA7 A;  4JGQ A;  2CMN A;  4Y17 A;  2Y2J A;  1OJG A;  4ZTK A;  1YPR A;  5D3O A;  4LCL A;  3AGE A;  1I2W A;  4E3O A;  3BEB A;  4EW7 A;  2P7J A;  2V9A A;  2Y2L A;  3FZC A;  2ZL1 A;  5HAQ A;  4S2N A;  3LIB A;  4WLA A;  5GLB A;  5G18 A;  4KQQ A;  2ZM8 A;  3V39 A;  2H5S A;  2VA0 A;  1PW1 A;  1BUE A;  2EFU A;  3BQA A;  3BFE A;  4GW9 A;  4EU0 A;  2JKT M;  2Z2L B;  5F1F A;  3ZG8 B;  1YSP A;  1DP9 A;  1GHM A;  1VEU B;  3PBT A;  2QWS A;  3ZG0 A;  3F1O B;  5DJU A;  2H28 A;  3A0V A;  3UO9 A;  5EVE A;  3WS1 A;  3KYZ A;  2Y2G A;  4KQO A;  4UQI S;  1OTB A;  2ZMA A;  2V0W A;  3T12 B;  3HLB A;  5EVI B;  1OJ5 A;  5FAP A; 
#chains in the Genus database with same CATH homology
 5HSQ A;  4NEE D;  3MF0 A;  2A24 A;  3OOV A;  3MMH A;  3E4Q A;  4CQH A;  2OAP 1;  3KO6 A;  3E98 A;  3KSI A;  4LRX C;  4WEL A;  3NJA A;  1T18 A;  4ETX A;  2OAQ 1;  4Q0J A;  3UMD A;  4GHI A;  2D01 A;  5MC7 A;  4ZRR A;  4G3V A;  3UB8 A;  1LSV A;  3VE4 A;  4IUH A;  4KUK A;  4NXG A;  4NXF A;  1F5M A;  1Y28 A;  4H6J B;  4F3L A;  1OT9 A;  2W1R A;  2ZMF A;  1TS6 A;  1XFQ A;  1H3Q A;  3EWK A;  1UWN X;  2W1T A;  5K5B A;  3C30 A;  4EES A;  4HP9 A;  3NOU C;  3C8C A;  3UE3 A;  2PD7 A;  5IU1 A;  3UME A;  4CLC E;  4HOI A;  1IFQ A;  2KLI A;  4EET B;  4HIA A;  3FPW A;  2NUT C;  4L9F A;  2HV1 A;  2V0U A;  4K08 A;  1S1Z A;  1NRJ A;  4NXB A;  5DKK A;  3VOL A;  2PYP A;  2Z6C A;  3T4L A;  4ARZ B;  3MXQ A;  3H82 A;  1XFN A;  3EEA A;  5HDD A;  1DRM A;  4GS9 B;  1T1B A;  4MMN A;  4LPZ A;  5J4E A;  4PHT A;  2WKP A;  2WKQ A;  3BY9 A;  4JGP A;  1P0Z A;  5EFW A;  1VHM A;  2MJ6 A;  4CLC C;  3NOT C;  4CLC D;  4YNR A;  2L0W A;  4HJ6 A;  1NWZ A;  5HWT A;  5I5L A;  1ODV A;  2XA7 M;  3T4Q A;  2XRN A;  2L1M A;  4HH3 A;  2OOL A;  1LSX A;  2QHK A;  3LR4 A;  4BWI A;  1OTA A;  5DFY A;  1NLY A;  1GSV A;  3LYX A;  2O99 A;  1XJ4 A;  2VV7 A;  5HPF A;  2XSS A;  1NLZ A;  4MN5 A;  3VE3 A;  5F6A A;  2QJ7 A;  2GNX A;  1S66 L;  4PKY A;  5HD5 A;  3IBJ A;  2FH5 A;  2VLG A;  1N9O A;  4YWZ A;  4R70 A;  3ICY A;  3E0Y A;  1DP8 A;  4LRY C;  3SW1 A;  4B9O A;  4Z1W A;  4I3I A;  3LIA A;  3BQ8 A;  2GX5 A;  4DJ3 A;  5TBM B;  4Q0I A;  2KX6 A;  1TS7 A;  3ZYT A;  1TD5 A;  3KSH A;  2W3D A;  3EGD C;  2PT7 A;  3B47 A;  3F1P B;  4MN6 A;  4B93 A;  5J7E A;  1S4S A;  2VEA A;  4I3J A;  4BJP A;  3UB9 A;  3S7N A;  1W63 Q;  4EER A;  3R7W B;  5F69 A;  3RFB A;  2O0Y A;  2LB5 A;  2K2N A;  2W3G A;  2BAS A;  4WEJ A;  4HI4 A;  2V1B A;  2ZOI A;  3MQQ A;  2L4R A;  4PAU A;  3D72 A;  4HQA A;  4II7 A;  4R6L A;  2W3E A;  3E4P A;  1LL8 A;  4I38 A;  4R38 A;  5HD3 A;  1T1C A;  4OOM A;  4L9E A;  1V9Z A;  4E04 A;  3O5Y A;  3C2W A;  4L9G A;  2VX8 A;  5G4Y A;  2W3F A;  3OCL A;  2FZ0 A;  2P08 A;  3MQ0 A;  4WEK A;  4WL9 A;  4DJ2 A;  3T50 A;  4AFI A;  4DMZ A;  3JVU A;  3MFX A;  3CAX A;  5HDS A;  1EW0 A;  3W2Z A;  1UWP X;  3IS2 B;  3D3O A;  2J3W A;  1YAX A;  1DP6 A;  3E4O A;  4DN0 A;  3T4K A;  5DKL A;  5KIZ A;  2VV6 A;  2O9B A;  2EWW A;  2IA2 A;  4BMW A;  4R3A A;  2W3H A;  4CLC A;  3BWL A;  2M7U A;  2KOI A;  4XT2 A;  1P9R A;  2J3T C;  4FSF A;  3EQU A;  3TW8 A;  2J3T D;  2VKS A;  3R4K A;  4O8G A;  1G6O A;  1F98 A;  1X0O A;  2G7U A;  2INW A;  5HWV A;  1MKM A;  2YKH A;  3B33 A;  3A0S A;  3S7Q A;  1LT0 A;  4BBV A;  4IHQ A;  3CIT A;  4OOL A;  2V1A A;  3U2A A;  2VJW A;  4PKY G;  3NOP C;  2D02 A;  3H7W B;  4HY8 A;  4UEY A;  3S7P A;  3IBR A;  3LIF A;  2HGV A;  1KOU A;  4HP4 A;  4Q0H A;  2LB9 A;  3JVV A;  2Y79 A;  5HZH A;  1ZTU A;  1YSQ A;  2QYB A;  3EQV A;  3F1O A;  2A24 B;  2W0N A;  4HJ3 A;  4HJ4 A;  2GZA A;  2Y8H A;  2VV8 A;  4MCW A;  3OLO A;  3TRC A;  2XA7 S;  3PYP A;  3EGX C;  2YKF A;  3F1N A;  2JKT I;  3LID A;  4GHI B;  4ETZ A;  2XRO A;  2PD8 A;  3S7O A;  4F3L B;  1N9N A;  4RQ9 A;  3K3D A;  2VZW A;  2W1T B;  4FOF A;  3LIE A;  5J3W A;  5L8M A;  1D06 A;  2M1C A;  3KSF A;  4IUK A;  3GEC A;  4O0P A;  2KDK A;  2WKR A;  5DF9 A;  4JGR A;  2K31 A;  3UB6 A;  4MDZ A;  3ULF A;  1S67 L;  3GDI A;  2B18 A;  3RTY A;  3PBR A;  4H6J A;  1MZU A;  3B42 A;  3HJI A;  1LSW A;  4NXE A;  1P9W A;  3H82 B;  4Y2F A;  2PR5 A;  2VGL M;  4NKP A;  4WUJ A;  5HL6 A;  4ME4 A;  4EEU A;  3K2N A;  3KX0 X;  2VGL S;  3PBS A;  4I39 A;  4Y5F A;  3T4S A;  1P97 A;  5TJJ A;  3T4O A;  1VB6 A;  5F5Y A;  4GCZ A;  3A0R A;  2ZBB A;  4KQD A;  1OTI A;  2P04 A;  4GJ4 A;  4ARZ A;  4HH2 A;  3LR5 A;  4GS9 A;  3PHY A;  4EXO A;  3BJN A;  1XJ3 A;  1XJ2 A;  5HDC A;  2B02 A;  3TJZ C;  4MN7 A;  3EEH A;  4LRZ E;  2W27 A;  4I3A A;  1TS0 A;  3NHQ A;  3OC2 A;  4IJG A;  2R78 A;  5A8B A;  3C38 A;  1JNU A;  1OTE A;  4WN5 A;  4P6Z M;  5FL3 A;  5IT5 A;  5HWW A;  1F9I A;  3K3C A;  3LIC A;  5AVE A;  1S1Y A;  3LR0 A;  3PBQ A;  2QJ5 A;  2QKP A;  4P6Z S;  4M4X A;  1OT6 A;  1UGU A;  4O01 A;  2PDR A;  1XJ6 A;  3CWF A;  2EWV A;  3HJK A;  1T19 A;  2JKR I;  3PXP A;  4BBU A;  5KSH A;  1G28 A;  3UE6 A;  3LUQ A;  3ZQ5 A;  3LI9 A;  4WF0 A;  2K7S A;  1S4R A;  2HJ9 C;  3CLO A;  3MQO A;  5AVF A;  2NUP C;  4L0L A;  5HPI A;  2ZOH A;  3FC7 A;  4I5S A;  3BW6 A;  3MR0 A;  5TBM A;  2Z6D A;  3OBF A;  4GLQ A;  2PHY A;  3F1P A;  2OWJ A;  1IOU A;  3RH8 B;  3KSG A;  2GJ3 A;  5AJG A;  3CUE A;  1OPX A;  3UB7 A;  3PBN A;  5CX7 A;  3R7W A;  4YOF A;  3KYQ A;  3P7N A;  1BYW A;  5IS1 A;  3P01 A;  3DBA A;  5DJT A;  2HF6 A;  3T4J A;  2JHE A;  3FPV A;  3PR6 A;  1GSW A;  4QPR A;  2O9C A;  2OWH A;  2A2L A;  2HJE A;  5F68 A;  4EQ1 A;  3MJQ A;  3FG8 A;  2JKR M;  2O9A A;  2PR6 A;  1D7E A;  4KUO A;  2I9V A;  3G6O A;  2JN7 A;  3CUE C;  5C5K A;  4JGQ A;  1MC0 A;  2CMN A;  3PBO A;  3BY8 A;  1TF1 A;  1OJG A;  4CLC B;  3HCY A;  4JGO A;  1ZHH B;  4XT2 B;  2ZMV A;  4EW7 A;  1YKD A;  4HHD A;  2P7J A;  4BBT A;  1V9Y A;  2V9A A;  3OCN A;  3T4T A;  4Y3I A;  1OTD A;  4LLO B;  3IS2 A;  2J80 A;  1STZ A;  4G3K A;  3LI8 A;  3H9W A;  3LIB A;  4WLA A;  1GSX A;  5G4Z A;  3LR3 A;  1N9L A;  1T1A A;  1TS8 A;  2VA0 A;  2PYR A;  4G3W A;  5LBR A;  3TE8 A;  3BQA A;  4HNB A;  4GW9 A;  5DFX A;  2JKT M;  4EU0 A;  3LFV A;  2EA9 A;  1YSP A;  1DP9 A;  3EOI A;  3V67 A;  2M7V A;  3PBT A;  2QWS A;  3F1O B;  5DJU A;  4UQI M;  1WA9 A;  2H28 A;  3A0V A;  3CI6 A;  3KYZ A;  4KQO A;  3VV4 A;  4UQI S;  1OTB A;  3F1N B;  4EEP A;  4EUV A;  2DMW A;  1W63 M;  3H7W A;  2V0W A;  1OJ5 A;  1H8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...