1S67L

Crystal structure of heme domain of direct oxygen sensor from e. coli
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
119
structure length
119
Chain Sequence
b'NAADGIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRDAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yddU
publication title Insights into signal transduction involving PAS domain oxygen-sensing heme proteins from the X-ray crystal structure of Escherichia coli Dos heme domain (Ec DosH)
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxygen storage/transport
total genus 23
structure length 119
sequence length 119
chains with identical sequence U
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s67L00
3EWKA 1WA9A 4L9EA 2ZBBA 3H9WA 3MXQA 1D7EA 3B33A 3E4OA 4HJ3A 5TBMA 2A24A 4PKYG 3OLOA 1DP9A 2PYRA 4B9OA 4NXGA 1X0OA 1S66L 3K3CA 4HQAA 4MN5A 4I3IA 2PD8A 3P7NA 2L1MA 1D06A 2QJ5A 1S1ZA 5I5LA 3NJAA 1N9LA 4EQ1A 4XT2B 4BBTA 3UB6A 3LIDA 4NXEA 3CLOA 4HHDA 4I38A 2QJ7A 5AVEA 2QHKA 1LL8A 4GS9A 4EETB 2INWA 3D72A 1GSWA 3MR0A 3ICYA 1P0ZA 4JGPA 2WKQA 1GSVA 4XT2A 2R78A 2EA9A 2P7JA 4R6LA 4EXOA 3IS2B 2I9VA 4DJ2A 2OOLA 1NWZA 1OTDA 5HZHA 1OTBA 4LRXC 3KX0X 5HWWA 2M1CA 2WKRA 1G28A 5EFWA 3IS2A 3NOTC 2VEAA 2V0UA 3VE3A 1KOUA 2Z6CA 3H82A 2L0WA 3BY8A 5HWVA 2H28A 2W27A 3LUQA 3E4PA 1N9NA 4EESA 2VV7A 5A8BA 1N9OA 2PR6A 5J4EA 2CMNA 3LIEA 3MQOA 2VV6A 3LI9A 1TS6A 5DJUA 2KDKA 4I5SA 4L9FA 4PKYA 3A0VA 1XJ4A 2PYPA 1UWPX 1V9ZA 2WKPA 4H6JB 3VE4A 2BASA 3K3DA 2KX6A 2PD7A 1XFNA 4HP9A 3NHQA 4H6JA 4BBUA 1UGUA 4EEUA 4HOIA 5HDSA 4EEPA 1ODVA 4HJ4A 2OWJA 5IS1A 2YKFA 3LICA 2V9AA 4LRYC 2V1BA 5KIZA 2V1AA 4I39A 3BY9A 3F1PB 4E04A 1TS8A 4MN6A 4R38A 4I3AA 1DP6A 1OTAA 5DJTA 5G4YA 5HD5A 4EERA 3E4QA 4R70A 3F1PA 4GHIB 1DRMA 4R3AA 2ZOHA 1LSWA 3G6OA 1OTEA 4WN5A 4HNBA 4LLOB 5F68A 4HP4A 1T19A 3NOPC 1DP8A 2Z6DA 2VV8A 5F5YA 3CAXA 4KUKA 3UB7A 5HSQA 1S4RA 3A0RA 4NXBA 3A0SA 3LYXA 3UB8A 3H7WB 4HI4A 3FC7A 2JHEA 3HJIA 1T1CA 3ZQ5A 1TS7A 4I3JA 4LPZA 3SW1A 1OT6A 4GCZA 1TS0A 1XJ3A 3UMEA 3ULFA 4F3LB 3C8CA 1UWNX 4RQ9A 3F1NB 2ZOIA 3RTYA 1OJ5A 5HD3A 3CWFA 1LSVA 4YWZA 2OWHA 5IU1A 4F3LA 5HDCA 1T1AA 1P97A 3MQQA 1BYWA 1Y28A 1OT9A 3LIBA 4HY8A 1S1YA 1T18A 4K08A 2K7SA 2V0WA 3F1OB 3PYPA 5AVFA 1EW0A 3UB9A 3MJQA 2D02A 4GW9A 1T1BA 1V9YA 3VOLA 4NXFA 1LSXA 4JGQA 2JN7A 3NOUC 2D01A 3FG8A 3RH8B 3F1OA 5J7EA 1VB6A 4WF0A 3BWLA 2QWSA 1XJ6A 5HWTA 4WUJA 3GECA 3LIFA 5DKLA 1OTIA 4GS9B 4JGRA 3LIAA 3PHYA 2QKPA 5F6AA 4GHIA 2J80A 1LT0A 4M4XA 1F98A 3UE6A 5F69A 2PR5A 5HDDA 3EEHA 1MZUA 2HV1A 4HIAA 4HH3A 2PDRA 3GDIA 2W0NA 1JNUA 2L4RA 4L9GA 2PHYA 3UMDA 4HH2A 3MFXA 3T50A 3H82B 4HJ6A 5J3WA 4EW7A 4WLAA 2B02A 2VLGA 5DKKA 4KUOA 3H7WA 1GSXA 1F9IA 4LRZE 2GJ3A 3IBRA 4DJ3A 1OJGA 5G4ZA 3LI8A 4JGOA 1S4SA 3C2WA 4WL9A 4KQDA 2YKHA 3HJKA 4BBVA 1XJ2A 3F1NA 5TBMB 2A24B 1XFQA 1S67L
chains in the Genus database with same CATH superfamily
1PWGA 4IUHA 1EI5A 3H9WA 1H3QA 1FCOA 3OPLA 2QMIA 5DFYA 4YOFA 4F94A 4CJNA 1J9MA 4IHQA 1PNEA 3HLBA 5TBMA 4PKYG 4QJGA 1DP9A 2PYRA 3G30A 5BOHA 4ZJ2A 3BLMA 2O0YA 4UAAA 1MKIA 1S6RA 2UV0E 3OCNA 1FSYA 5F82A 3VSKA 5FA7A 5EECA 1D06A 1K56D 2E8JA 4L0LA 3NI9A 4KG2A 4WM9A 4OQ0A 2G2WA 2O9CA 3D72A 3MR0A 1PZOA 3ICYA 3NIAA 1GSVA 2QYBA 4N9LA 5CRFA 3IWOA 2V2FF 4OQIA 5GLCA 3W4QA 3GVBA 2Y2HA 4DJ2A 1PYYA 1NRJA 1W63Q 3OPPA 5TR7A 2HGVA 1OTBA 4QD4A 1IKIA 5L10A 2EX8A 3IS2A 2JBFA 1CEGA 2V0UA 1KOUA 5EUAA 1FCNA 3KSFA 4E3KA 2H28A 2W27A 2IA2A 4UA7A 3LUQA 1Q2PA 2X02A 1E3UD 5HL1A 3ITBA 4OKPA 1N9OA 5FAPA 2VGLS 4PMAA 1WYBA 1SKOB 4CLCC 1I2WA 3MQOA 3BFCA 3LR0A 4QWOA 1KDSA 1Y54A 2KDKA 5HFOA 1UWPX 1V9ZA 2WGWA 2X71A 1FR6A 5FAQA 2BASA 3AGDA 5CX7A 3LEQA 3VP4A 2KX6A 4P6BA 4EEUA 4E3NA 2ZMVA 3GTCA 1H8YA 2DRWA 5HX9A 1KDWA 2OWJA 2PBYA 1TVFA 4LRYC 4QY6A 5KIZA 3BY9A 4OOMA 3AGFA 1E4DA 3IXBA 3Q1FA 4D60A 1ES5A 5CTNA 2Z2MB 1MPLA 1OTAA 1ESIA 5AJGA 1W79A 4LV2A 2ZM8A 1BLPA 3QP4A 2OLUA 1RP5A 4CLCB 2V8CA 1J3WA 4ARZB 4GNUA 2ZOHA 4PM5A 1LSWA 1JTGA 5K5BA 4E6XA 3ZYTA 3G6OA 2BG1A 5FQ9A 4GKUA 5F68A 3KO6A 3SS5A 1F5MA 1BLSA 2VV8A 2Y4AA 3DTIA 4E3LA 1O07A 5GLDA 4E6WA 3MKFA 1L0DA 5DFXA 5HAQA 5HSQA 1S4RA 3VOZA 3R7WB 2O9AA 5JYOA 3PBRA 2VZWA 1T1CA 1KGGA 2P08A 3S7QA 1CF0A 1SDNA 4OPRA 1K57A 3EQVA 3G32A 1NJ4A 1ZHHB 5HAIA 2RL3A 4KG6A 4DMZA 4DXBA 5HL6A 3ULFA 4F3LB 1BLCA 1UWNX 1XKZA 4H8RA 1I5QA 4KG5A 4RQ9A 1L3LA 1MWRA 1BTLA 2R9WA 3FV7A 4S2PA 4EBNA 4NG2A 2J9PA 2ZQ7A 3VFHA 1PW8A 3S7NA 3ZHHA 1YLWA 5CERA 1P97A 4GDNA 5DTTA 4OP5A 2W1TB 3D3OA 1S1YA 3HVFA 1NYMA 1T18A 3G34A 1GHIA 3QP8A 3PBTA 2ACGA 2JC7A 4N92A 4OLDA 5AVFA 3UB9A 3HCYA 1KE3A 4FD8A 3VP1A 4NXFA 2G2UA 4X55A 4R23A 1Y4OA 2DNSA 2GNXA 1EWZA 2XEPA 3UPOA 3RH8B 3T4OA 3F1OA 4GLQA 2LB5A 3IQAA 4O01A 3HLGA 1MXOA 3JVUA 1PIOA 3GECA 4RYEA 1OTIA 1DY6A 2WK0A 2Q0OA 3SZTA 4P85A 4OP8A 3MS6A 2EFXA 3S22A 1YLYA 4JPMA 5L8MA 4S2JA 3DBAA 1K4EA 2XQZA 4MBFA 1EROA 5HDDA 3VFFA 3EEHA 1GA9A 1MZUA 4A5RA 3BEBA 4G3KA 1MWSA 4WMCA 2OAP1 4ZBEA 4N1HA 4R0QA 4HH2A 1CI8A 3T50A 1JWPA 4HJ6A 4GD6A 4Y7PA 4WLAA 2PT7A 4MDZA 2WZZA 1BUEA 4N9KA 5DKKA 4ETZA 4KUOA 5CECA 1JWVA 3H7WA 2A3UA 4LRZE 4BQMA 2EWWA 4IUKA 4Y17A 3BJNA 1KE4A 3TJZC 4LFUA 2MJ6A 5F83A 5G4ZA 3FKWA 4JGOA 4WL9A 3HLFA 2YKHA 1C3BA 4CLCD 3RXWA 3GSGA 2J8YA 3N8LA 4Z1WA 4FTXA 1F2KA 2M7VA 1YLZA 2P74A 5C5KA 1LI0A 3T4SA 3MXQA 3DWZA 5KZHA 4BMWA 4LV1A 4MBKA 1NXYA 1YLTA 1D7EA 1SCWA 5CHJA 4HJ3A 3OLOA 2XA7M 3GQZA 2ZM0A 3UE1A 1XA1A 3SS4A 3NC8A 4HQAA 4MN5A 1K57C 4NETA 3EEAA 4WZ5A 4LCLA 3BW6A 3LR3A 3BM6A 3JPUA 4MLLA 4UA6A 2L1MA 5FQMA 1G6AA 5I5LA 3NJAA 4ESPA 4P87A 4Q0JA 3IWIA 5HPIA 1RGZA 3LIDA 2WUQA 3CLOA 3ZCZA 1TDLA 2QJ7A 4ME4A 2QHKA 4EETB 2INWA 3VSLA 1ERQA 1MY8A 2X01A 4Q0HA 3BQ8A 1P0ZA 2WKQA 1SZVA 5GHYA 4XT2A 1XXMA 2R78A 3IF6A 2P7JA 1M40A 3ZG9B 3I7JA 3UB5P 4EBPA 3JVVA 4R6LA 2I9VA 3UDXA 2V1ZA 3T4LA 4GD8A 5HZHA 4XUZA 3IH9A 1KGFA 4UQIS 3KX0X 3QP5A 5CXWA 3ZVWA 5HWWA 4BLMA 2M1CA 3ZG0A 2ZLYA 5EFWA 2VA0A 3C4PA 1MBLA 2PRFA 4K0XA 1YSPA 1K55A 2RCXA 4D2OA 5HWVA 4IBRA 1NRFA 3EOIA 3UE3A 5AQBA 1W7FA 5A8BA 5HARA 3TW8A 1I2SA 4HESA 2PR6A 3OOVA 1CJFA 5J4EA 2EX6A 4KZ6A 3LIEA 4ZRRA 3CHWP 2VV6A 5FI7A 3SH9A 5EVIA 2VGJA 1N9BA 5G18A 4RVAA 3IXGA 3BFEA 4PKYA 2W3GA 2PYPA 2WKPA 4H6JB 4FSFA 1JTDA 2BTFP 2PU4A 2J3TC 5E2FA 5FDHA 4DN0A 3FZCA 1XX2A 3K3DA 3NULA 4X6TA 5A93A 4QHCA 3NHQA 5E2HA 1YLJA 1K4FA 1TEMA 1ODVA 1GA0A 2ZC5B 2VJWA 4B93A 2EXAA 2VGLM 4HJ4A 3QP2A 4OVDA 2WGIA 1L0GA 3V3SA 4MBHA 5F1FA 2EWVA 4EBLA 4KQOA 5AQAA 4I39A 3T12B 4IJGA 1FQGA 1TDGA 3A3JA 5DJTA 3IH8A 4P0MA 3FPVA 4Y0TA 2NUPC 5AQ7A 1PI5A 4EERA 2JKTM 3F1PA 2ZQAA 2C5WB 1WE4A 3CG5A 4R3AA 3CUEA 2DCFA 5FEGA 2OLVA 1OTEA 1ZG4A 1GHPA 4WN5A 3Q82A 2Y91A 1LLBA 1VETA 3NOPC 4BJPA 5F1GA 1W5DA 1DP8A 3QP6A 4B4ZA 4RA7A 5KSCA 3FWLA 3B47A 3V39A 2ZMFA 5A90A 1G5UA 4X53A 5GLBA 4JXGA 4WZ5C 4OOLA 1W8QA 3ZNTA 5JYPA 4CQHA 5FQQA 1VHMA 4KZ7A 3A0RA 4NXBA 2HPBA 1P9WA 3Q81A 3UB8A 3H7WB 4HI4A 4QB8A 1K54C 3V67A 3CI6A 3UN7A 3T4TA 3WWXA 3A3EA 1CK3A 3G2YA 1ERMA 3LY3A 1TS0A 3WRTA 1K56A 2Y2LA 2HF6A 4BWIA 4C3QA 5U47A 1OJ5A 5HD3A 1IYPA 2WKEA 4ID4A 4DRTA 3FKVA 4JLFA 1Z6FA 2HP9A 4RX2A 5IU1A 3MXRA 5DF9A 3G31A 3TOIA 2GDNA 1T1AA 4BL3A 1OT9A 3LIBA 4CLCE 5IHVA 4WEKA 3PBQA 4X1MA 4K08A 1MWUA 5DF7A 3T1RA 2K7SA 1RCJA 3IF5A 3MJQA 1T1BA 5TGFA 1LSXA 1JWZA 3M6BA 2J7VA 2ZJ9A 1IYSA 4QPRA 1W63M 5J7EA 1VB6A 4WF0A 3BWLA 2QWSA 2H10A 3VV4A 1PRQA 4WUJA 3IX8A 3WS4A 2ZC7A 1LL9A 2FZ0A 1ZKJA 2ZQDA 3V5MA 2NUTC 5EVIC 1E3UA 5CHUA 1XA7A 4LCMA 2Y2OA 3LIAA 4FH4A 4DXCA 4EU0A 5CTMA 4GHIA 1SDEA 4M4XA 4AFIA 2HDUA 3Q07A 2PR5A 4CPKA 1H5XA 4HH3A 3M2JA 3VP0A 3UMDA 5KMWA 2OSUA 3IHBA 3MFXA 3NECA 5J3WA 4KZBA 4EW7A 4DE3A 4MNRA 2B02A 2VLGA 3CITA 3OC2A 1L0FA 2Y2KA 2Q9MA 2LB9A 4S2KA 2HP5A 4S2IA 3IBRA 5EVIB 1VEUA 3R4KA 2ZL1B 4OLGA 1CI9A 1Z09A 4DJ3A 3LCEA 2P9VA 1JVJA 1NY0A 5M19A 2Y2GA 2WGVA 3PTEA 2H0YA 3F1NA 5TBMB 1XFQA 2M7UA 1WA9A 4L9EA 5GHXA 2HDSA 3SH8A 1YMXA 2ZBBA 1YSQA 3DWKA 3O86A 3LGOA 3CPTA 4DF6A 2J3TD 3B33A 3E4OA 3OZHA 2A24A 4X1LA 3C38A 2OV5A 4B9OA 4NXGA 3MSHA 1S66L 5E2GA 1YMSA 4BENA 3WS1A 4DE1A 3IBJA 1L2SA 1M6KA 2PD8A 2FFFB 3EGXC 4K91A 1BSGA 1S1ZA 4RX3A 1IYQA 4FOFA 3AGEA 1KGEA 3Q7VA 1N9LA 2HDRA 4R3BA 1D1JA 3GMWA 5FQIA 4BBTA 5E2EA 4HHDA 4I38A 3KYQA 4JXWA 1LL8A 4GS9A 5EVEA 2QPNA 2XLNA 5LBRA 3RFBA 1VETB 4QY5A 2B95A 5DF8A 2C6WB 4LV0A 2PBDP 4BD0A 2EA9A 3ZNYA 3W4OA 3IS2B 3NY4A 2ZMAA 4R1GA 5GLAA 3MFDA 1G6OA 3ITAA 2Y2IA 2ZC6B 4LRXC 4S2OA 1NZOA 3MKEA 4EV4A 2J3WA 2Y2JA 1G28A 1TD5A 1BULA 2XF3A 5FQKA 3GV9A 2Z6CA 2L0WA 3S7PA 3T4KA 4DDSA 4PHTA 3E4PA 2JKGA 4EESA 1IELA 5J8XA 4OH0A 1A0KA 3A3DA 4K0WA 3QNBA 3BFGA 2WGWB 3QP1A 2E8IA 4KENB 4C6YA 1STZA 2WAFA 4MMNA 3LI9A 2WAEA 2J9OA 1TS6A 4Y15A 4L9FA 3ZVTA 4OPQA 5CEDA 1XJ4A 4UQIM 3TRCA 4LV3A 3VE4A 3VMAA 1SKOA 1LI9A 3O87A 3U4LP 3SH7A 1YAXA 4B88A 4BBUA 1UGUA 1H8MA 5HDSA 5EE8A 4EEPA 4KQQA 5IS1A 1XGIA 2YKFA 5CEBA 2V9AA 2V1AA 4P6ZS 4Q8IA 2V20A 2XK1A 4E04A 3PBSA 5L2FA 1DJCA 4MN6A 4NK3A 4EUVA 4R38A 3G4PA 1HD8A 4PM9A 5EOEA 1OMEA 3KYEA 2XROA 4JXSA 4X69A 1FR1A 2W1RA 5HD5A 2BLSA 5L07A 2XGNA 3E4QA 4R70A 4GHIB 5GL9A 1DRMA 2EX2A 2HZ5A 3C4OA 4GOGA 5M18A 3IX3A 3CJMA 4M3KA 1ES4A 3K2NA 4GB7A 4Y0OA 1K25A 5FL3A 3PAGA 4LLOB 4CLCA 4ARZA 4G3VA 5F5YA 2W3DA 3CAXA 2W3HA 4KUKA 2O9BA 3UPNA 2Y8HA 2KLIA 2ZQCA 4DKIA 1HTZA 3BYDA 4MCWA 2EXBA 3BFFA 3MQ0A 1FSWA 3PBNA 3A0SA 3W4PA 3LYXA 1WYCA 3FC7A 3HUOA 3ZQ5A 1TS7A 3DTKA 1IKGA 1VEUB 4I3JA 4LPZA 3SW1A 3S4XA 2Y2MA 3T4QA 1OT6A 5EV0A 4GCZA 2XD5A 3UMEA 2XFSA 3C8CA 3T4JA 3ZG5A 2JKRM 3F1NB 2ZQ8A 3GR2A 3ZDJA 2K31A 3E98A 3CWFA 4PPRA 1QMFA 2HP6A 4YWZA 5EM1A 2OWHA 3DTEA 4F3LA 3IWQA 2WYXA 3GRJA 5HDCA 4FCFA 2W3FA 3MQQA 1BYWA 4XUXA 4LGWA 4HY8A 2XH9A 3MZDA 2V0WA 3F1OB 3PYPA 2K2NA 1LHYA 4PM8A 2D02A 3NDGA 4GW9A 3ZFZA 2JKTI 1V9YA 2W1TA 2JKFA 1YLPA 2JN7A 3NOUC 4X56A 2D01A 4O8GA 4ZJ1A 3OCLA 3Q7VB 3V50A 3LIFA 3KYZA 3BRMA 3E2KA 2XR0A 4E3OA 4GS9B 4OPYA 4OQGA 2Y2QA 4JGRA 4PM6A 5FDSA 1GCEA 1DJAA 1K6RA 3KSGA 4S2NA 4HBUA 3HUNA 2XDMA 3G2ZA 4MEZA 3E0YA 3UDFA 5HW3A 2J80A 1LT0A 1KE0A 4KZ4A 4JF6A 3B3XA 2ZD8A 1QMEA 3HREA 4DE2A 5FEFA 4O0PA 1FILA 1LL5A 2Y79A 2A49A 3M6HA 2ZQ9A 2PDRA 3GDIA 3LR4A 1PW1A 1JNUA 4C75A 1O7EA 2PHYA 2FFYA 3O5YA 4Z9QA 5M1AA 1PZPA 3BQAA 1KVLA 2IWCA 3FPWA 3EGDC 2A2LA 1HVBA 1Q2QA 1PWCA 4WEJA 3N6IA 3PAEA 2XFTA 2KOIA 3MZFA 1ESUA 2EFUA 1BT5A 3UPPA 3TSGA 4U3TA 1W8YA 3LY4A 1F9IA 4EUZA 1ZTUA 2GJ3A 3PXPA 4ZJ3A 3VP2A 4GJ4A 3OPRA 1GHMA 3IF6C 2UWXA 4UHUA 3M2KA 3LI8A 1U60A 2QZ6A 2ZC4B 3C30A 4R4SA 3KSIA 2IWBA 3IXDA 3D9YA 2JE5A 3EWKA 3PR6A 5FAOA 4Y2FA 3L7HA 3N8SA 1NLZA 3N8RA 5FI2A 4ETXA 3P98A 4EWFA 2OAQ1 1FCMA 1NLYA 3LEZA 1YM1A 4OOYA 1K55C 3C5AA 3A3IA 4WZ4A 3S7OA 3IX4A 3DW0A 4WYYA 3ZGAB 1X0OA 3WRZA 2XSSA 3TG9A 2Y2PA 3WS2A 2FH5A 4ZTKA 5HAPA 3K3CA 2DMWA 1SKFA 4IBXA 5L09A 3HL9A 4Y3IA 3EQUA 4I3IA 1K6SA 4JXVA 4B4XA 2ZC3B 4FH2A 1ACFA 3P7NA 2EX9A 3KSHA 1YPRA 2QJ5A 2P04A 3ZG7B 3HLWA 1VQQA 4EQ1A 4IVIA 4XT2B 3HLDA 3L9KA 3UB6A 4NXEA 5FATA 4WELA 3IF6B 5AVEA 2HJ9C 2W3EA 1GSWA 4XXRA 3V3RA 3RXXA 3B42A 4JGPA 4N1XA 2PU2A 5FI6A 3C7VA 3P01A 2VK3A 4NEED 3T1SA 4EXOA 2OOLA 2Y2NA 1NYYA 1NWZA 3PBOA 1OTDA 2VGKA 3SOIA 4DDYA 3E2LA 2G7UA 1E25A 5A92A 1K38A 1H8ZA 2WKRA 3NOTC 2VEAA 1SHVA 5D3OA 5AQ9A 3VE3A 3H82A 3BY8A 4JF4A 1BZAA 4Y5FA 1XP4A 1N9NA 3CUEC 2IWDA 2VV7A 3N7WA 4O7DA 4S2NC 3G35A 4JBFA 5EVLA 3HBRA 2CMNA 3UY6A 4KZ8A 1G68A 5DVAA 1CEFA 5DJUA 4I5SA 5KSHA 4GZBA 3W2ZA 1PI4A 3A0VA 3WS0A 4WBGA 3VOYA 4BD1A 5CHMA 2JCHA 4JF5A 4WMCD 4HBTA 1ONGA 2Z2LB 2PD7A 4PM7A 1XFNA 4DE0A 4HP9A 4H6JA 4ZDXA 4HOIA 1MKMA 3CZDA 4X25A 3LO7A 3LICA 2Y55A 2B18A 2AVXA 2V1BA 4OONA 1AWIA 4G3WA 1MC0A 2CC1A 1KVMA 5TJJA 4NKPA 3F1PB 1TS8A 3LFVA 4I3AA 1DP6A 3UNWA 5EM0A 1OPXA 3BFDA 5G4YA 1IFQA 4OQHA 2VX8A 3ZG8B 3U2AA 4R3JA 3HUMA 1PWDA 3S1YA 2GZAA 1MWTA 5CGXA 4HNBA 1IOUA 4OPZA 4HP4A 1IYOA 1T19A 4R4RA 1P9RA 2Z6DA 4P6ZM 1ZC2A 2R9XA 4KZ5A 5FSRA 2H0TA 1XGJA 3UB7A 1PFLA 3BECA 3MBZA 3HLCA 1CQAA 4Y0UA 5CGSA 1NZUA 3Q7ZA 2GX5A 2JHEA 3HJIA 3JYIA 1H0MA 4S2MA 5HPFA 5EPHA 3O88A 1K0KA 4YNRA 2WADA 4KZ3A 3QHYA 2WKHA 1XJ3A 1RGYA 4JKTA 2ZOIA 3RTYA 4BL2A 3O3VA 2V8FA 5E43A 3OPHA 1LSVA 5DTSA 3IHAA 3NBLA 5FASA 4KZ9A 4Q0IA 4U0XA 3HLEA 4KZAA 5EOOA 1Y28A 4GDBA 4UA9A 4KQRA 3N4IA 4II7A 4YFMA 1BLHA 3DTMA 1EW0A 1XPBA 1AXBA 4X68A 5I94A 4MN7A 3VOLA 3UDIA 3CMZA 3FYZA 4JGQA 3UE0A 2VKSA 1S0WA 3RJUA 3TE8A 3FG8A 2I72A 2Q9NA 3ISGA 1YKDA 1ZG6A 1XJ6A 5HWTA 3A3FA 2B5RA 1HLUP 2HDQA 4QU3A 2XRNA 5DKLA 3W8KA 4EQIA 5EVID 2Y59A 3MXSA 4HEFA 3P09A 4E3JA 1K54A 1VM1A 2O99A 3PHYA 2QKPA 4S2LA 5F6AA 3SS3A 4UEYA 1YT4A 5TFQA 1F98A 3UE6A 5F69A 5FQJA 5MC7A 4PAUA 3MZEA 1ES3A 1IEMA 2HV1A 4HIAA 3DAVA 1N4OA 5A91A 3D4FA 2W0NA 3T1QB 2XD1A 3UO9A 1DJBA 3QNCA 4FUWA 3T1XA 1FIKA 2L4RA 4L9GA 5IT5A 5CGWA 4E3IA 4U0TA 4ZAMA 3H82B 1ES2A 3LR5A 4IVKA 5DTKA 1FOFA 2HJEA 2JKRI 2PAVP 3BLSA 3R7WA 4LENA 3OBFA 2P9VB 4Y13A 3MMHA 2XA7S 5GHZA 2H5SA 1GSXA 2ZM2A 3NDEA 4IEDA 4YINA 2WZXA 1ALQA 1ONHA 3MF0A 1OJGA 3WS5A 4E3MA 1S4SA 3C2WA 3IT9A 4KQDA 2WKIA 3C7UA 3VP3A 3HJKA 4BBVA 1XJ2A 1TF1A 3CPTB 2ZL1A 3NCKA 1L0EA 3IXHA 1HZOA 4GN2A 2A24B 1S67L 1YQSA
chains in the Genus database with same CATH topology
3EWKA 2M7UA 1WA9A 3PR6A 4L9EA 2M7VA 4IUHA 4Y2FA 5C5KA 2ZBBA 3H9WA 1H3QA 3T4SA 3MXQA 4BMWA 1YSQA 1NLZA 5DFYA 4ETXA 4YOFA 2OAQ1 1NLYA 1D7EA 2J3TD 3B33A 4IHQA 3E4OA 3S7OA 4HJ3A 5TBMA 2A24A 4PKYG 3OLOA 3C38A 2XA7M 1DP9A 2PYRA 4B9OA 4NXGA 1X0OA 2XSSA 1S66L 2FH5A 2O0YA 3K3CA 4HQAA 4MN5A 2DMWA 3EEAA 3IBJA 4Y3IA 3EQUA 4I3IA 2PD8A 3OCNA 3EGXC 3BW6A 3LR3A 3P7NA 2L1MA 3KSHA 1D06A 2QJ5A 1S1ZA 5I5LA 3NJAA 2P04A 4FOFA 4L0LA 1N9LA 4EQ1A 4XT2B 4Q0JA 5HPIA 4BBTA 3UB6A 3LIDA 4NXEA 3CLOA 4HHDA 4I38A 4WELA 3KYQA 2O9CA 2QJ7A 4ME4A 5AVEA 2QHKA 1LL8A 2HJ9C 4GS9A 2INWA 4EETB 2W3EA 3D72A 5LBRA 3RFBA 1GSWA 3MR0A 4Q0HA 3ICYA 3BQ8A 1P0ZA 3B42A 4JGPA 2WKQA 1GSVA 4XT2A 2QYBA 2R78A 2EA9A 3P01A 4NEED 2P7JA 3JVVA 4R6LA 4EXOA 3IS2B 2I9VA 4DJ2A 2OOLA 1NRJA 1NWZA 3PBOA 1W63Q 3T4LA 1OTDA 5HZHA 1G6OA 2HGVA 2G7UA 1OTBA 4LRXC 4UQIS 3KX0X 5HWWA 2J3WA 2M1CA 2WKRA 1G28A 5EFWA 1TD5A 3IS2A 3NOTC 2VEAA 2V0UA 3VE3A 2VA0A 1KOUA 2Z6CA 3H82A 3KSFA 2L0WA 3BY8A 3S7PA 3T4KA 1YSPA 5HWVA 4PHTA 2H28A 2W27A 2IA2A 4Y5FA 3LUQA 3EOIA 3E4PA 3UE3A 1N9NA 4EESA 3CUEC 2VV7A 5A8BA 3TW8A 1N9OA 2VGLS 2PR6A 3OOVA 5J4EA 2CMNA 3LIEA 4CLCC 3MQOA 4ZRRA 3LR0A 2VV6A 1STZA 4MMNA 3LI9A 1TS6A 5DJUA 2KDKA 4I5SA 4L9FA 5KSHA 3W2ZA 4PKYA 3A0VA 2W3GA 1XJ4A 2PYPA 1UWPX 1V9ZA 2WKPA 4H6JB 4FSFA 4UQIM 3TRCA 3VE4A 2BASA 2J3TC 5CX7A 4DN0A 1YAXA 3K3DA 2KX6A 2PD7A 1XFNA 4HP9A 3NHQA 4H6JA 4BBUA 1UGUA 4EEUA 1H8MA 4HOIA 5HDSA 2ZMVA 4EEPA 1ODVA 2VJWA 1MKMA 4B93A 2VGLM 4HJ4A 2OWJA 5IS1A 2YKFA 3LICA 2V9AA 2B18A 4LRYC 2V1BA 2EWVA 4G3WA 5KIZA 2V1AA 4KQOA 4P6ZS 1MC0A 4I39A 3BY9A 5TJJA 4NKPA 4OOMA 3F1PB 4IJGA 4E04A 3PBSA 1TS8A 4MN6A 4EUVA 3LFVA 4R38A 4I3AA 1DP6A 1OTAA 5DJTA 5AJGA 2XROA 1OPXA 3FPVA 2NUPC 5G4YA 2W1RA 5HD5A 1IFQA 4EERA 2VX8A 2JKTM 3E4QA 4R70A 3F1PA 3U2AA 4GHIB 4CLCB 1DRMA 4ARZB 4R3AA 2ZOHA 3CUEA 1LSWA 3K2NA 5K5BA 3ZYTA 3G6OA 1OTEA 2GZAA 4WN5A 5FL3A 4HNBA 1IOUA 4LLOB 5F68A 3KO6A 4HP4A 4CLCA 4ARZA 1T19A 3NOPC 4BJPA 1F5MA 1DP8A 1P9RA 4G3VA 2Z6DA 4P6ZM 2VV8A 5F5YA 2W3DA 3CAXA 2W3HA 4KUKA 3B47A 2ZMFA 2O9BA 2Y8HA 2KLIA 4OOLA 5DFXA 3UB7A 5HSQA 1S4RA 4CQHA 4MCWA 3R7WB 1VHMA 3A0RA 4NXBA 3MQ0A 3PBNA 3A0SA 3LYXA 1P9WA 2O9AA 3UB8A 3H7WB 3PBRA 4HI4A 3FC7A 2GX5A 2VZWA 2JHEA 3HJIA 1T1CA 3V67A 3CI6A 2P08A 3S7QA 3ZQ5A 1TS7A 3T4TA 5HPFA 4I3JA 4LPZA 3SW1A 3T4QA 4YNRA 1OT6A 3EQVA 4GCZA 1ZHHB 1TS0A 1XJ3A 4DMZA 5HL6A 3UMEA 3ULFA 2HF6A 4F3LB 4BWIA 3C8CA 3T4JA 1UWNX 4RQ9A 2JKRM 3F1NB 2ZOIA 3RTYA 1OJ5A 5HD3A 2K31A 3E98A 3CWFA 1LSVA 4YWZA 2OWHA 5IU1A 4F3LA 5DF9A 3S7NA 4Q0IA 5HDCA 1T1AA 2W3FA 1P97A 3MQQA 1BYWA 2W1TB 3D3OA 1Y28A 1OT9A 3LIBA 4CLCE 4HY8A 1S1YA 4WEKA 3PBQA 1T18A 4II7A 4K08A 3PBTA 2K7SA 2V0WA 3F1OB 3PYPA 2K2NA 5AVFA 1EW0A 3UB9A 3MJQA 2D02A 3HCYA 4GW9A 1T1BA 2JKTI 4MN7A 1V9YA 2W1TA 3VOLA 4NXFA 1LSXA 4JGQA 2GNXA 2JN7A 2VKSA 3NOUC 3TE8A 2D01A 3FG8A 4O8GA 4QPRA 1W63M 3RH8B 3T4OA 3F1OA 5J7EA 1VB6A 4WF0A 4GLQA 3OCLA 2LB5A 3BWLA 2QWSA 1XJ6A 3VV4A 5HWTA 4O01A 4WUJA 2FZ0A 2NUTC 3JVUA 3GECA 3LIFA 3KYZA 2XRNA 5DKLA 1OTIA 4GS9B 4JGRA 3LIAA 4EU0A 2O99A 3PHYA 2QKPA 3KSGA 3E0YA 5F6AA 5L8MA 4UEYA 3DBAA 4GHIA 2J80A 1LT0A 4M4XA 4AFIA 1F98A 3UE6A 5F69A 2PR5A 5HDDA 5MC7A 4PAUA 4O0PA 3EEHA 1MZUA 2HV1A 4HIAA 2Y79A 4HH3A 4G3KA 2PDRA 3GDIA 2W0NA 3LR4A 1JNUA 2OAP1 2L4RA 4L9GA 2PHYA 5IT5A 3UMDA 3O5YA 4HH2A 3MFXA 3T50A 3BQAA 3H82B 3LR5A 4HJ6A 5J3WA 4EW7A 3FPWA 2HJEA 2JKRI 3EGDC 2A2LA 4WLAA 2PT7A 4MDZA 4WEJA 3R7WA 2B02A 2VLGA 3CITA 3OC2A 3OBFA 5DKKA 2KOIA 4ETZA 4KUOA 3MMHA 3H7WA 2XA7S 2LB9A 1GSXA 1F9IA 4LRZE 2EWWA 1ZTUA 2GJ3A 3IBRA 4IUKA 3BJNA 3PXPA 3R4KA 4GJ4A 3TJZC 3MF0A 4DJ3A 1OJGA 2MJ6A 5G4ZA 3LI8A 4JGOA 3C30A 1S4SA 3C2WA 4WL9A 4KQDA 2YKHA 3HJKA 4CLCD 4BBVA 1XJ2A 3F1NA 3KSIA 1TF1A 5TBMB 2A24B 4Z1WA 1XFQA 1S67L 1YKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EWK A;  1WA9 A;  4L9E A;  2ZBB A;  3H9W A;  3MXQ A;  1D7E A;  3B33 A;  3E4O A;  4HJ3 A;  5TBM A;  2A24 A;  4PKY G;  3OLO A;  1DP9 A;  2PYR A;  4B9O A;  4NXG A;  1X0O A;  1S66 L;  3K3C A;  4HQA A;  4MN5 A;  4I3I A;  2PD8 A;  3P7N A;  2L1M A;  1D06 A;  2QJ5 A;  1S1Z A;  5I5L A;  3NJA A;  1N9L A;  4EQ1 A;  4XT2 B;  4BBT A;  3UB6 A;  3LID A;  4NXE A;  3CLO A;  4HHD A;  4I38 A;  2QJ7 A;  5AVE A;  2QHK A;  1LL8 A;  4GS9 A;  4EET B;  2INW A;  3D72 A;  1GSW A;  3MR0 A;  3ICY A;  1P0Z A;  4JGP A;  2WKQ A;  1GSV A;  4XT2 A;  2R78 A;  2EA9 A;  2P7J A;  4R6L A;  4EXO A;  3IS2 B;  2I9V A;  4DJ2 A;  2OOL A;  1NWZ A;  1OTD A;  5HZH A;  1OTB A;  4LRX C;  3KX0 X;  5HWW A;  2M1C A;  2WKR A;  1G28 A;  5EFW A;  3IS2 A;  3NOT C;  2VEA A;  2V0U A;  3VE3 A;  1KOU A;  2Z6C A;  3H82 A;  2L0W A;  3BY8 A;  5HWV A;  2H28 A;  2W27 A;  3LUQ A;  3E4P A;  1N9N A;  4EES A;  2VV7 A;  5A8B A;  1N9O A;  2PR6 A;  5J4E A;  2CMN A;  3LIE A;  3MQO A;  2VV6 A;  3LI9 A;  1TS6 A;  5DJU A;  2KDK A;  4I5S A;  4L9F A;  4PKY A;  3A0V A;  1XJ4 A;  2PYP A;  1UWP X;  1V9Z A;  2WKP A;  4H6J B;  3VE4 A;  2BAS A;  3K3D A;  2KX6 A;  2PD7 A;  1XFN A;  4HP9 A;  3NHQ A;  4H6J A;  4BBU A;  1UGU A;  4EEU A;  4HOI A;  5HDS A;  4EEP A;  1ODV A;  4HJ4 A;  2OWJ A;  5IS1 A;  2YKF A;  3LIC A;  2V9A A;  4LRY C;  2V1B A;  5KIZ A;  2V1A A;  4I39 A;  3BY9 A;  3F1P B;  4E04 A;  1TS8 A;  4MN6 A;  4R38 A;  4I3A A;  1DP6 A;  1OTA A;  5DJT A;  5G4Y A;  5HD5 A;  4EER A;  3E4Q A;  4R70 A;  3F1P A;  4GHI B;  1DRM A;  4R3A A;  2ZOH A;  1LSW A;  3G6O A;  1OTE A;  4WN5 A;  4HNB A;  4LLO B;  5F68 A;  4HP4 A;  1T19 A;  3NOP C;  1DP8 A;  2Z6D A;  2VV8 A;  5F5Y A;  3CAX A;  4KUK A;  3UB7 A;  5HSQ A;  1S4R A;  3A0R A;  4NXB A;  3A0S A;  3LYX A;  3UB8 A;  3H7W B;  4HI4 A;  3FC7 A;  2JHE A;  3HJI A;  1T1C A;  3ZQ5 A;  1TS7 A;  4I3J A;  4LPZ A;  3SW1 A;  1OT6 A;  4GCZ A;  1TS0 A;  1XJ3 A;  3UME A;  3ULF A;  4F3L B;  3C8C A;  1UWN X;  4RQ9 A;  3F1N B;  2ZOI A;  3RTY A;  1OJ5 A;  5HD3 A;  3CWF A;  1LSV A;  4YWZ A;  2OWH A;  5IU1 A;  4F3L A;  5HDC A;  1T1A A;  1P97 A;  3MQQ A;  1BYW A;  1Y28 A;  1OT9 A;  3LIB A;  4HY8 A;  1S1Y A;  1T18 A;  4K08 A;  2K7S A;  2V0W A;  3F1O B;  3PYP A;  5AVF A;  1EW0 A;  3UB9 A;  3MJQ A;  2D02 A;  4GW9 A;  1T1B A;  1V9Y A;  3VOL A;  4NXF A;  1LSX A;  4JGQ A;  2JN7 A;  3NOU C;  2D01 A;  3FG8 A;  3RH8 B;  3F1O A;  5J7E A;  1VB6 A;  4WF0 A;  3BWL A;  2QWS A;  1XJ6 A;  5HWT A;  4WUJ A;  3GEC A;  3LIF A;  5DKL A;  1OTI A;  4GS9 B;  4JGR A;  3LIA A;  3PHY A;  2QKP A;  5F6A A;  4GHI A;  2J80 A;  1LT0 A;  4M4X A;  1F98 A;  3UE6 A;  5F69 A;  2PR5 A;  5HDD A;  3EEH A;  1MZU A;  2HV1 A;  4HIA A;  4HH3 A;  2PDR A;  3GDI A;  2W0N A;  1JNU A;  2L4R A;  4L9G A;  2PHY A;  3UMD A;  4HH2 A;  3MFX A;  3T50 A;  3H82 B;  4HJ6 A;  5J3W A;  4EW7 A;  4WLA A;  2B02 A;  2VLG A;  5DKK A;  4KUO A;  3H7W A;  1GSX A;  1F9I A;  4LRZ E;  2GJ3 A;  3IBR A;  4DJ3 A;  1OJG A;  5G4Z A;  3LI8 A;  4JGO A;  1S4S A;  3C2W A;  4WL9 A;  4KQD A;  2YKH A;  3HJK A;  4BBV A;  1XJ2 A;  3F1N A;  5TBM B;  2A24 B;  1XFQ A;  1S67 L; 
#chains in the Genus database with same CATH topology
 1PWG A;  4IUH A;  1EI5 A;  3H9W A;  1H3Q A;  1FCO A;  3OPL A;  2QMI A;  5DFY A;  4YOF A;  4F94 A;  4CJN A;  1J9M A;  4IHQ A;  1PNE A;  3HLB A;  5TBM A;  4PKY G;  4QJG A;  1DP9 A;  2PYR A;  3G30 A;  5BOH A;  4ZJ2 A;  3BLM A;  2O0Y A;  4UAA A;  1MKI A;  1S6R A;  2UV0 E;  3OCN A;  1FSY A;  5F82 A;  3VSK A;  5FA7 A;  5EEC A;  1D06 A;  1K56 D;  2E8J A;  4L0L A;  3NI9 A;  4KG2 A;  4WM9 A;  4OQ0 A;  2G2W A;  2O9C A;  3D72 A;  3MR0 A;  1PZO A;  3ICY A;  3NIA A;  1GSV A;  2QYB A;  4N9L A;  5CRF A;  3IWO A;  2V2F F;  4OQI A;  5GLC A;  3W4Q A;  3GVB A;  2Y2H A;  4DJ2 A;  1PYY A;  1NRJ A;  1W63 Q;  3OPP A;  5TR7 A;  2HGV A;  1OTB A;  4QD4 A;  1IKI A;  5L10 A;  2EX8 A;  3IS2 A;  2JBF A;  1CEG A;  2V0U A;  1KOU A;  5EUA A;  1FCN A;  3KSF A;  4E3K A;  2H28 A;  2W27 A;  2IA2 A;  4UA7 A;  3LUQ A;  1Q2P A;  2X02 A;  1E3U D;  5HL1 A;  3ITB A;  4OKP A;  1N9O A;  5FAP A;  2VGL S;  4PMA A;  1WYB A;  1SKO B;  4CLC C;  1I2W A;  3MQO A;  3BFC A;  3LR0 A;  4QWO A;  1KDS A;  1Y54 A;  2KDK A;  5HFO A;  1UWP X;  1V9Z A;  2WGW A;  2X71 A;  1FR6 A;  5FAQ A;  2BAS A;  3AGD A;  5CX7 A;  3LEQ A;  3VP4 A;  2KX6 A;  4P6B A;  4EEU A;  4E3N A;  2ZMV A;  3GTC A;  1H8Y A;  2DRW A;  5HX9 A;  1KDW A;  2OWJ A;  2PBY A;  1TVF A;  4LRY C;  4QY6 A;  5KIZ A;  3BY9 A;  4OOM A;  3AGF A;  1E4D A;  3IXB A;  3Q1F A;  4D60 A;  1ES5 A;  5CTN A;  2Z2M B;  1MPL A;  1OTA A;  1ESI A;  5AJG A;  1W79 A;  4LV2 A;  2ZM8 A;  1BLP A;  3QP4 A;  2OLU A;  1RP5 A;  4CLC B;  2V8C A;  1J3W A;  4ARZ B;  4GNU A;  2ZOH A;  4PM5 A;  1LSW A;  1JTG A;  5K5B A;  4E6X A;  3ZYT A;  3G6O A;  2BG1 A;  5FQ9 A;  4GKU A;  5F68 A;  3KO6 A;  3SS5 A;  1F5M A;  1BLS A;  2VV8 A;  2Y4A A;  3DTI A;  4E3L A;  1O07 A;  5GLD A;  4E6W A;  3MKF A;  1L0D A;  5DFX A;  5HAQ A;  5HSQ A;  1S4R A;  3VOZ A;  3R7W B;  2O9A A;  5JYO A;  3PBR A;  2VZW A;  1T1C A;  1KGG A;  2P08 A;  3S7Q A;  1CF0 A;  1SDN A;  4OPR A;  1K57 A;  3EQV A;  3G32 A;  1NJ4 A;  1ZHH B;  5HAI A;  2RL3 A;  4KG6 A;  4DMZ A;  4DXB A;  5HL6 A;  3ULF A;  4F3L B;  1BLC A;  1UWN X;  1XKZ A;  4H8R A;  1I5Q A;  4KG5 A;  4RQ9 A;  1L3L A;  1MWR A;  1BTL A;  2R9W A;  3FV7 A;  4S2P A;  4EBN A;  4NG2 A;  2J9P A;  2ZQ7 A;  3VFH A;  1PW8 A;  3S7N A;  3ZHH A;  1YLW A;  5CER A;  1P97 A;  4GDN A;  5DTT A;  4OP5 A;  2W1T B;  3D3O A;  1S1Y A;  3HVF A;  1NYM A;  1T18 A;  3G34 A;  1GHI A;  3QP8 A;  3PBT A;  2ACG A;  2JC7 A;  4N92 A;  4OLD A;  5AVF A;  3UB9 A;  3HCY A;  1KE3 A;  4FD8 A;  3VP1 A;  4NXF A;  2G2U A;  4X55 A;  4R23 A;  1Y4O A;  2DNS A;  2GNX A;  1EWZ A;  2XEP A;  3UPO A;  3RH8 B;  3T4O A;  3F1O A;  4GLQ A;  2LB5 A;  3IQA A;  4O01 A;  3HLG A;  1MXO A;  3JVU A;  1PIO A;  3GEC A;  4RYE A;  1OTI A;  1DY6 A;  2WK0 A;  2Q0O A;  3SZT A;  4P85 A;  4OP8 A;  3MS6 A;  2EFX A;  3S22 A;  1YLY A;  4JPM A;  5L8M A;  4S2J A;  3DBA A;  1K4E A;  2XQZ A;  4MBF A;  1ERO A;  5HDD A;  3VFF A;  3EEH A;  1GA9 A;  1MZU A;  4A5R A;  3BEB A;  4G3K A;  1MWS A;  4WMC A;  2OAP 1;  4ZBE A;  4N1H A;  4R0Q A;  4HH2 A;  1CI8 A;  3T50 A;  1JWP A;  4HJ6 A;  4GD6 A;  4Y7P A;  4WLA A;  2PT7 A;  4MDZ A;  2WZZ A;  1BUE A;  4N9K A;  5DKK A;  4ETZ A;  4KUO A;  5CEC A;  1JWV A;  3H7W A;  2A3U A;  4LRZ E;  4BQM A;  2EWW A;  4IUK A;  4Y17 A;  3BJN A;  1KE4 A;  3TJZ C;  4LFU A;  2MJ6 A;  5F83 A;  5G4Z A;  3FKW A;  4JGO A;  4WL9 A;  3HLF A;  2YKH A;  1C3B A;  4CLC D;  3RXW A;  3GSG A;  2J8Y A;  3N8L A;  4Z1W A;  4FTX A;  1F2K A;  2M7V A;  1YLZ A;  2P74 A;  5C5K A;  1LI0 A;  3T4S A;  3MXQ A;  3DWZ A;  5KZH A;  4BMW A;  4LV1 A;  4MBK A;  1NXY A;  1YLT A;  1D7E A;  1SCW A;  5CHJ A;  4HJ3 A;  3OLO A;  2XA7 M;  3GQZ A;  2ZM0 A;  3UE1 A;  1XA1 A;  3SS4 A;  3NC8 A;  4HQA A;  4MN5 A;  1K57 C;  4NET A;  3EEA A;  4WZ5 A;  4LCL A;  3BW6 A;  3LR3 A;  3BM6 A;  3JPU A;  4MLL A;  4UA6 A;  2L1M A;  5FQM A;  1G6A A;  5I5L A;  3NJA A;  4ESP A;  4P87 A;  4Q0J A;  3IWI A;  5HPI A;  1RGZ A;  3LID A;  2WUQ A;  3CLO A;  3ZCZ A;  1TDL A;  2QJ7 A;  4ME4 A;  2QHK A;  4EET B;  2INW A;  3VSL A;  1ERQ A;  1MY8 A;  2X01 A;  4Q0H A;  3BQ8 A;  1P0Z A;  2WKQ A;  1SZV A;  5GHY A;  4XT2 A;  1XXM A;  2R78 A;  3IF6 A;  2P7J A;  1M40 A;  3ZG9 B;  3I7J A;  3UB5 P;  4EBP A;  3JVV A;  4R6L A;  2I9V A;  3UDX A;  2V1Z A;  3T4L A;  4GD8 A;  5HZH A;  4XUZ A;  3IH9 A;  1KGF A;  4UQI S;  3KX0 X;  3QP5 A;  5CXW A;  3ZVW A;  5HWW A;  4BLM A;  2M1C A;  3ZG0 A;  2ZLY A;  5EFW A;  2VA0 A;  3C4P A;  1MBL A;  2PRF A;  4K0X A;  1YSP A;  1K55 A;  2RCX A;  4D2O A;  5HWV A;  4IBR A;  1NRF A;  3EOI A;  3UE3 A;  5AQB A;  1W7F A;  5A8B A;  5HAR A;  3TW8 A;  1I2S A;  4HES A;  2PR6 A;  3OOV A;  1CJF A;  5J4E A;  2EX6 A;  4KZ6 A;  3LIE A;  4ZRR A;  3CHW P;  2VV6 A;  5FI7 A;  3SH9 A;  5EVI A;  2VGJ A;  1N9B A;  5G18 A;  4RVA A;  3IXG A;  3BFE A;  4PKY A;  2W3G A;  2PYP A;  2WKP A;  4H6J B;  4FSF A;  1JTD A;  2BTF P;  2PU4 A;  2J3T C;  5E2F A;  5FDH A;  4DN0 A;  3FZC A;  1XX2 A;  3K3D A;  3NUL A;  4X6T A;  5A93 A;  4QHC A;  3NHQ A;  5E2H A;  1YLJ A;  1K4F A;  1TEM A;  1ODV A;  1GA0 A;  2ZC5 B;  2VJW A;  4B93 A;  2EXA A;  2VGL M;  4HJ4 A;  3QP2 A;  4OVD A;  2WGI A;  1L0G A;  3V3S A;  4MBH A;  5F1F A;  2EWV A;  4EBL A;  4KQO A;  5AQA A;  4I39 A;  3T12 B;  4IJG A;  1FQG A;  1TDG A;  3A3J A;  5DJT A;  3IH8 A;  4P0M A;  3FPV A;  4Y0T A;  2NUP C;  5AQ7 A;  1PI5 A;  4EER A;  2JKT M;  3F1P A;  2ZQA A;  2C5W B;  1WE4 A;  3CG5 A;  4R3A A;  3CUE A;  2DCF A;  5FEG A;  2OLV A;  1OTE A;  1ZG4 A;  1GHP A;  4WN5 A;  3Q82 A;  2Y91 A;  1LLB A;  1VET A;  3NOP C;  4BJP A;  5F1G A;  1W5D A;  1DP8 A;  3QP6 A;  4B4Z A;  4RA7 A;  5KSC A;  3FWL A;  3B47 A;  3V39 A;  2ZMF A;  5A90 A;  1G5U A;  4X53 A;  5GLB A;  4JXG A;  4WZ5 C;  4OOL A;  1W8Q A;  3ZNT A;  5JYP A;  4CQH A;  5FQQ A;  1VHM A;  4KZ7 A;  3A0R A;  4NXB A;  2HPB A;  1P9W A;  3Q81 A;  3UB8 A;  3H7W B;  4HI4 A;  4QB8 A;  1K54 C;  3V67 A;  3CI6 A;  3UN7 A;  3T4T A;  3WWX A;  3A3E A;  1CK3 A;  3G2Y A;  1ERM A;  3LY3 A;  1TS0 A;  3WRT A;  1K56 A;  2Y2L A;  2HF6 A;  4BWI A;  4C3Q A;  5U47 A;  1OJ5 A;  5HD3 A;  1IYP A;  2WKE A;  4ID4 A;  4DRT A;  3FKV A;  4JLF A;  1Z6F A;  2HP9 A;  4RX2 A;  5IU1 A;  3MXR A;  5DF9 A;  3G31 A;  3TOI A;  2GDN A;  1T1A A;  4BL3 A;  1OT9 A;  3LIB A;  4CLC E;  5IHV A;  4WEK A;  3PBQ A;  4X1M A;  4K08 A;  1MWU A;  5DF7 A;  3T1R A;  2K7S A;  1RCJ A;  3IF5 A;  3MJQ A;  1T1B A;  5TGF A;  1LSX A;  1JWZ A;  3M6B A;  2J7V A;  2ZJ9 A;  1IYS A;  4QPR A;  1W63 M;  5J7E A;  1VB6 A;  4WF0 A;  3BWL A;  2QWS A;  2H10 A;  3VV4 A;  1PRQ A;  4WUJ A;  3IX8 A;  3WS4 A;  2ZC7 A;  1LL9 A;  2FZ0 A;  1ZKJ A;  2ZQD A;  3V5M A;  2NUT C;  5EVI C;  1E3U A;  5CHU A;  1XA7 A;  4LCM A;  2Y2O A;  3LIA A;  4FH4 A;  4DXC A;  4EU0 A;  5CTM A;  4GHI A;  1SDE A;  4M4X A;  4AFI A;  2HDU A;  3Q07 A;  2PR5 A;  4CPK A;  1H5X A;  4HH3 A;  3M2J A;  3VP0 A;  3UMD A;  5KMW A;  2OSU A;  3IHB A;  3MFX A;  3NEC A;  5J3W A;  4KZB A;  4EW7 A;  4DE3 A;  4MNR A;  2B02 A;  2VLG A;  3CIT A;  3OC2 A;  1L0F A;  2Y2K A;  2Q9M A;  2LB9 A;  4S2K A;  2HP5 A;  4S2I A;  3IBR A;  5EVI B;  1VEU A;  3R4K A;  2ZL1 B;  4OLG A;  1CI9 A;  1Z09 A;  4DJ3 A;  3LCE A;  2P9V A;  1JVJ A;  1NY0 A;  5M19 A;  2Y2G A;  2WGV A;  3PTE A;  2H0Y A;  3F1N A;  5TBM B;  1XFQ A;  2M7U A;  1WA9 A;  4L9E A;  5GHX A;  2HDS A;  3SH8 A;  1YMX A;  2ZBB A;  1YSQ A;  3DWK A;  3O86 A;  3LGO A;  3CPT A;  4DF6 A;  2J3T D;  3B33 A;  3E4O A;  3OZH A;  2A24 A;  4X1L A;  3C38 A;  2OV5 A;  4B9O A;  4NXG A;  3MSH A;  1S66 L;  5E2G A;  1YMS A;  4BEN A;  3WS1 A;  4DE1 A;  3IBJ A;  1L2S A;  1M6K A;  2PD8 A;  2FFF B;  3EGX C;  4K91 A;  1BSG A;  1S1Z A;  4RX3 A;  1IYQ A;  4FOF A;  3AGE A;  1KGE A;  3Q7V A;  1N9L A;  2HDR A;  4R3B A;  1D1J A;  3GMW A;  5FQI A;  4BBT A;  5E2E A;  4HHD A;  4I38 A;  3KYQ A;  4JXW A;  1LL8 A;  4GS9 A;  5EVE A;  2QPN A;  2XLN A;  5LBR A;  3RFB A;  1VET B;  4QY5 A;  2B95 A;  5DF8 A;  2C6W B;  4LV0 A;  2PBD P;  4BD0 A;  2EA9 A;  3ZNY A;  3W4O A;  3IS2 B;  3NY4 A;  2ZMA A;  4R1G A;  5GLA A;  3MFD A;  1G6O A;  3ITA A;  2Y2I A;  2ZC6 B;  4LRX C;  4S2O A;  1NZO A;  3MKE A;  4EV4 A;  2J3W A;  2Y2J A;  1G28 A;  1TD5 A;  1BUL A;  2XF3 A;  5FQK A;  3GV9 A;  2Z6C A;  2L0W A;  3S7P A;  3T4K A;  4DDS A;  4PHT A;  3E4P A;  2JKG A;  4EES A;  1IEL A;  5J8X A;  4OH0 A;  1A0K A;  3A3D A;  4K0W A;  3QNB A;  3BFG A;  2WGW B;  3QP1 A;  2E8I A;  4KEN B;  4C6Y A;  1STZ A;  2WAF A;  4MMN A;  3LI9 A;  2WAE A;  2J9O A;  1TS6 A;  4Y15 A;  4L9F A;  3ZVT A;  4OPQ A;  5CED A;  1XJ4 A;  4UQI M;  3TRC A;  4LV3 A;  3VE4 A;  3VMA A;  1SKO A;  1LI9 A;  3O87 A;  3U4L P;  3SH7 A;  1YAX A;  4B88 A;  4BBU A;  1UGU A;  1H8M A;  5HDS A;  5EE8 A;  4EEP A;  4KQQ A;  5IS1 A;  1XGI A;  2YKF A;  5CEB A;  2V9A A;  2V1A A;  4P6Z S;  4Q8I A;  2V20 A;  2XK1 A;  4E04 A;  3PBS A;  5L2F A;  1DJC A;  4MN6 A;  4NK3 A;  4EUV A;  4R38 A;  3G4P A;  1HD8 A;  4PM9 A;  5EOE A;  1OME A;  3KYE A;  2XRO A;  4JXS A;  4X69 A;  1FR1 A;  2W1R A;  5HD5 A;  2BLS A;  5L07 A;  2XGN A;  3E4Q A;  4R70 A;  4GHI B;  5GL9 A;  1DRM A;  2EX2 A;  2HZ5 A;  3C4O A;  4GOG A;  5M18 A;  3IX3 A;  3CJM A;  4M3K A;  1ES4 A;  3K2N A;  4GB7 A;  4Y0O A;  1K25 A;  5FL3 A;  3PAG A;  4LLO B;  4CLC A;  4ARZ A;  4G3V A;  5F5Y A;  2W3D A;  3CAX A;  2W3H A;  4KUK A;  2O9B A;  3UPN A;  2Y8H A;  2KLI A;  2ZQC A;  4DKI A;  1HTZ A;  3BYD A;  4MCW A;  2EXB A;  3BFF A;  3MQ0 A;  1FSW A;  3PBN A;  3A0S A;  3W4P A;  3LYX A;  1WYC A;  3FC7 A;  3HUO A;  3ZQ5 A;  1TS7 A;  3DTK A;  1IKG A;  1VEU B;  4I3J A;  4LPZ A;  3SW1 A;  3S4X A;  2Y2M A;  3T4Q A;  1OT6 A;  5EV0 A;  4GCZ A;  2XD5 A;  3UME A;  2XFS A;  3C8C A;  3T4J A;  3ZG5 A;  2JKR M;  3F1N B;  2ZQ8 A;  3GR2 A;  3ZDJ A;  2K31 A;  3E98 A;  3CWF A;  4PPR A;  1QMF A;  2HP6 A;  4YWZ A;  5EM1 A;  2OWH A;  3DTE A;  4F3L A;  3IWQ A;  2WYX A;  3GRJ A;  5HDC A;  4FCF A;  2W3F A;  3MQQ A;  1BYW A;  4XUX A;  4LGW A;  4HY8 A;  2XH9 A;  3MZD A;  2V0W A;  3F1O B;  3PYP A;  2K2N A;  1LHY A;  4PM8 A;  2D02 A;  3NDG A;  4GW9 A;  3ZFZ A;  2JKT I;  1V9Y A;  2W1T A;  2JKF A;  1YLP A;  2JN7 A;  3NOU C;  4X56 A;  2D01 A;  4O8G A;  4ZJ1 A;  3OCL A;  3Q7V B;  3V50 A;  3LIF A;  3KYZ A;  3BRM A;  3E2K A;  2XR0 A;  4E3O A;  4GS9 B;  4OPY A;  4OQG A;  2Y2Q A;  4JGR A;  4PM6 A;  5FDS A;  1GCE A;  1DJA A;  1K6R A;  3KSG A;  4S2N A;  4HBU A;  3HUN A;  2XDM A;  3G2Z A;  4MEZ A;  3E0Y A;  3UDF A;  5HW3 A;  2J80 A;  1LT0 A;  1KE0 A;  4KZ4 A;  4JF6 A;  3B3X A;  2ZD8 A;  1QME A;  3HRE A;  4DE2 A;  5FEF A;  4O0P A;  1FIL A;  1LL5 A;  2Y79 A;  2A49 A;  3M6H A;  2ZQ9 A;  2PDR A;  3GDI A;  3LR4 A;  1PW1 A;  1JNU A;  4C75 A;  1O7E A;  2PHY A;  2FFY A;  3O5Y A;  4Z9Q A;  5M1A A;  1PZP A;  3BQA A;  1KVL A;  2IWC A;  3FPW A;  3EGD C;  2A2L A;  1HVB A;  1Q2Q A;  1PWC A;  4WEJ A;  3N6I A;  3PAE A;  2XFT A;  2KOI A;  3MZF A;  1ESU A;  2EFU A;  1BT5 A;  3UPP A;  3TSG A;  4U3T A;  1W8Y A;  3LY4 A;  1F9I A;  4EUZ A;  1ZTU A;  2GJ3 A;  3PXP A;  4ZJ3 A;  3VP2 A;  4GJ4 A;  3OPR A;  1GHM A;  3IF6 C;  2UWX A;  4UHU A;  3M2K A;  3LI8 A;  1U60 A;  2QZ6 A;  2ZC4 B;  3C30 A;  4R4S A;  3KSI A;  2IWB A;  3IXD A;  3D9Y A;  2JE5 A;  3EWK A;  3PR6 A;  5FAO A;  4Y2F A;  3L7H A;  3N8S A;  1NLZ A;  3N8R A;  5FI2 A;  4ETX A;  3P98 A;  4EWF A;  2OAQ 1;  1FCM A;  1NLY A;  3LEZ A;  1YM1 A;  4OOY A;  1K55 C;  3C5A A;  3A3I A;  4WZ4 A;  3S7O A;  3IX4 A;  3DW0 A;  4WYY A;  3ZGA B;  1X0O A;  3WRZ A;  2XSS A;  3TG9 A;  2Y2P A;  3WS2 A;  2FH5 A;  4ZTK A;  5HAP A;  3K3C A;  2DMW A;  1SKF A;  4IBX A;  5L09 A;  3HL9 A;  4Y3I A;  3EQU A;  4I3I A;  1K6S A;  4JXV A;  4B4X A;  2ZC3 B;  4FH2 A;  1ACF A;  3P7N A;  2EX9 A;  3KSH A;  1YPR A;  2QJ5 A;  2P04 A;  3ZG7 B;  3HLW A;  1VQQ A;  4EQ1 A;  4IVI A;  4XT2 B;  3HLD A;  3L9K A;  3UB6 A;  4NXE A;  5FAT A;  4WEL A;  3IF6 B;  5AVE A;  2HJ9 C;  2W3E A;  1GSW A;  4XXR A;  3V3R A;  3RXX A;  3B42 A;  4JGP A;  4N1X A;  2PU2 A;  5FI6 A;  3C7V A;  3P01 A;  2VK3 A;  4NEE D;  3T1S A;  4EXO A;  2OOL A;  2Y2N A;  1NYY A;  1NWZ A;  3PBO A;  1OTD A;  2VGK A;  3SOI A;  4DDY A;  3E2L A;  2G7U A;  1E25 A;  5A92 A;  1K38 A;  1H8Z A;  2WKR A;  3NOT C;  2VEA A;  1SHV A;  5D3O A;  5AQ9 A;  3VE3 A;  3H82 A;  3BY8 A;  4JF4 A;  1BZA A;  4Y5F A;  1XP4 A;  1N9N A;  3CUE C;  2IWD A;  2VV7 A;  3N7W A;  4O7D A;  4S2N C;  3G35 A;  4JBF A;  5EVL A;  3HBR A;  2CMN A;  3UY6 A;  4KZ8 A;  1G68 A;  5DVA A;  1CEF A;  5DJU A;  4I5S A;  5KSH A;  4GZB A;  3W2Z A;  1PI4 A;  3A0V A;  3WS0 A;  4WBG A;  3VOY A;  4BD1 A;  5CHM A;  2JCH A;  4JF5 A;  4WMC D;  4HBT A;  1ONG A;  2Z2L B;  2PD7 A;  4PM7 A;  1XFN A;  4DE0 A;  4HP9 A;  4H6J A;  4ZDX A;  4HOI A;  1MKM A;  3CZD A;  4X25 A;  3LO7 A;  3LIC A;  2Y55 A;  2B18 A;  2AVX A;  2V1B A;  4OON A;  1AWI A;  4G3W A;  1MC0 A;  2CC1 A;  1KVM A;  5TJJ A;  4NKP A;  3F1P B;  1TS8 A;  3LFV A;  4I3A A;  1DP6 A;  3UNW A;  5EM0 A;  1OPX A;  3BFD A;  5G4Y A;  1IFQ A;  4OQH A;  2VX8 A;  3ZG8 B;  3U2A A;  4R3J A;  3HUM A;  1PWD A;  3S1Y A;  2GZA A;  1MWT A;  5CGX A;  4HNB A;  1IOU A;  4OPZ A;  4HP4 A;  1IYO A;  1T19 A;  4R4R A;  1P9R A;  2Z6D A;  4P6Z M;  1ZC2 A;  2R9X A;  4KZ5 A;  5FSR A;  2H0T A;  1XGJ A;  3UB7 A;  1PFL A;  3BEC A;  3MBZ A;  3HLC A;  1CQA A;  4Y0U A;  5CGS A;  1NZU A;  3Q7Z A;  2GX5 A;  2JHE A;  3HJI A;  3JYI A;  1H0M A;  4S2M A;  5HPF A;  5EPH A;  3O88 A;  1K0K A;  4YNR A;  2WAD A;  4KZ3 A;  3QHY A;  2WKH A;  1XJ3 A;  1RGY A;  4JKT A;  2ZOI A;  3RTY A;  4BL2 A;  3O3V A;  2V8F A;  5E43 A;  3OPH A;  1LSV A;  5DTS A;  3IHA A;  3NBL A;  5FAS A;  4KZ9 A;  4Q0I A;  4U0X A;  3HLE A;  4KZA A;  5EOO A;  1Y28 A;  4GDB A;  4UA9 A;  4KQR A;  3N4I A;  4II7 A;  4YFM A;  1BLH A;  3DTM A;  1EW0 A;  1XPB A;  1AXB A;  4X68 A;  5I94 A;  4MN7 A;  3VOL A;  3UDI A;  3CMZ A;  3FYZ A;  4JGQ A;  3UE0 A;  2VKS A;  1S0W A;  3RJU A;  3TE8 A;  3FG8 A;  2I72 A;  2Q9N A;  3ISG A;  1YKD A;  1ZG6 A;  1XJ6 A;  5HWT A;  3A3F A;  2B5R A;  1HLU P;  2HDQ A;  4QU3 A;  2XRN A;  5DKL A;  3W8K A;  4EQI A;  5EVI D;  2Y59 A;  3MXS A;  4HEF A;  3P09 A;  4E3J A;  1K54 A;  1VM1 A;  2O99 A;  3PHY A;  2QKP A;  4S2L A;  5F6A A;  3SS3 A;  4UEY A;  1YT4 A;  5TFQ A;  1F98 A;  3UE6 A;  5F69 A;  5FQJ A;  5MC7 A;  4PAU A;  3MZE A;  1ES3 A;  1IEM A;  2HV1 A;  4HIA A;  3DAV A;  1N4O A;  5A91 A;  3D4F A;  2W0N A;  3T1Q B;  2XD1 A;  3UO9 A;  1DJB A;  3QNC A;  4FUW A;  3T1X A;  1FIK A;  2L4R A;  4L9G A;  5IT5 A;  5CGW A;  4E3I A;  4U0T A;  4ZAM A;  3H82 B;  1ES2 A;  3LR5 A;  4IVK A;  5DTK A;  1FOF A;  2HJE A;  2JKR I;  2PAV P;  3BLS A;  3R7W A;  4LEN A;  3OBF A;  2P9V B;  4Y13 A;  3MMH A;  2XA7 S;  5GHZ A;  2H5S A;  1GSX A;  2ZM2 A;  3NDE A;  4IED A;  4YIN A;  2WZX A;  1ALQ A;  1ONH A;  3MF0 A;  1OJG A;  3WS5 A;  4E3M A;  1S4S A;  3C2W A;  3IT9 A;  4KQD A;  2WKI A;  3C7U A;  3VP3 A;  3HJK A;  4BBV A;  1XJ2 A;  1TF1 A;  3CPT B;  2ZL1 A;  3NCK A;  1L0E A;  3IXH A;  1HZO A;  4GN2 A;  2A24 B;  1S67 L;  1YQS A; 
#chains in the Genus database with same CATH homology
 3EWK A;  2M7U A;  1WA9 A;  3PR6 A;  4L9E A;  2M7V A;  4IUH A;  4Y2F A;  5C5K A;  2ZBB A;  3H9W A;  1H3Q A;  3T4S A;  3MXQ A;  4BMW A;  1YSQ A;  1NLZ A;  5DFY A;  4ETX A;  4YOF A;  2OAQ 1;  1NLY A;  1D7E A;  2J3T D;  3B33 A;  4IHQ A;  3E4O A;  3S7O A;  4HJ3 A;  5TBM A;  2A24 A;  4PKY G;  3OLO A;  3C38 A;  2XA7 M;  1DP9 A;  2PYR A;  4B9O A;  4NXG A;  1X0O A;  2XSS A;  1S66 L;  2FH5 A;  2O0Y A;  3K3C A;  4HQA A;  4MN5 A;  2DMW A;  3EEA A;  3IBJ A;  4Y3I A;  3EQU A;  4I3I A;  2PD8 A;  3OCN A;  3EGX C;  3BW6 A;  3LR3 A;  3P7N A;  2L1M A;  3KSH A;  1D06 A;  2QJ5 A;  1S1Z A;  5I5L A;  3NJA A;  2P04 A;  4FOF A;  4L0L A;  1N9L A;  4EQ1 A;  4XT2 B;  4Q0J A;  5HPI A;  4BBT A;  3UB6 A;  3LID A;  4NXE A;  3CLO A;  4HHD A;  4I38 A;  4WEL A;  3KYQ A;  2O9C A;  2QJ7 A;  4ME4 A;  5AVE A;  2QHK A;  1LL8 A;  2HJ9 C;  4GS9 A;  2INW A;  4EET B;  2W3E A;  3D72 A;  5LBR A;  3RFB A;  1GSW A;  3MR0 A;  4Q0H A;  3ICY A;  3BQ8 A;  1P0Z A;  3B42 A;  4JGP A;  2WKQ A;  1GSV A;  4XT2 A;  2QYB A;  2R78 A;  2EA9 A;  3P01 A;  4NEE D;  2P7J A;  3JVV A;  4R6L A;  4EXO A;  3IS2 B;  2I9V A;  4DJ2 A;  2OOL A;  1NRJ A;  1NWZ A;  3PBO A;  1W63 Q;  3T4L A;  1OTD A;  5HZH A;  1G6O A;  2HGV A;  2G7U A;  1OTB A;  4LRX C;  4UQI S;  3KX0 X;  5HWW A;  2J3W A;  2M1C A;  2WKR A;  1G28 A;  5EFW A;  1TD5 A;  3IS2 A;  3NOT C;  2VEA A;  2V0U A;  3VE3 A;  2VA0 A;  1KOU A;  2Z6C A;  3H82 A;  3KSF A;  2L0W A;  3BY8 A;  3S7P A;  3T4K A;  1YSP A;  5HWV A;  4PHT A;  2H28 A;  2W27 A;  2IA2 A;  4Y5F A;  3LUQ A;  3EOI A;  3E4P A;  3UE3 A;  1N9N A;  4EES A;  3CUE C;  2VV7 A;  5A8B A;  3TW8 A;  1N9O A;  2VGL S;  2PR6 A;  3OOV A;  5J4E A;  2CMN A;  3LIE A;  4CLC C;  3MQO A;  4ZRR A;  3LR0 A;  2VV6 A;  1STZ A;  4MMN A;  3LI9 A;  1TS6 A;  5DJU A;  2KDK A;  4I5S A;  4L9F A;  5KSH A;  3W2Z A;  4PKY A;  3A0V A;  2W3G A;  1XJ4 A;  2PYP A;  1UWP X;  1V9Z A;  2WKP A;  4H6J B;  4FSF A;  4UQI M;  3TRC A;  3VE4 A;  2BAS A;  2J3T C;  5CX7 A;  4DN0 A;  1YAX A;  3K3D A;  2KX6 A;  2PD7 A;  1XFN A;  4HP9 A;  3NHQ A;  4H6J A;  4BBU A;  1UGU A;  4EEU A;  1H8M A;  4HOI A;  5HDS A;  2ZMV A;  4EEP A;  1ODV A;  2VJW A;  1MKM A;  4B93 A;  2VGL M;  4HJ4 A;  2OWJ A;  5IS1 A;  2YKF A;  3LIC A;  2V9A A;  2B18 A;  4LRY C;  2V1B A;  2EWV A;  4G3W A;  5KIZ A;  2V1A A;  4KQO A;  4P6Z S;  1MC0 A;  4I39 A;  3BY9 A;  5TJJ A;  4NKP A;  4OOM A;  3F1P B;  4IJG A;  4E04 A;  3PBS A;  1TS8 A;  4MN6 A;  4EUV A;  3LFV A;  4R38 A;  4I3A A;  1DP6 A;  1OTA A;  5DJT A;  5AJG A;  2XRO A;  1OPX A;  3FPV A;  2NUP C;  5G4Y A;  2W1R A;  5HD5 A;  1IFQ A;  4EER A;  2VX8 A;  2JKT M;  3E4Q A;  4R70 A;  3F1P A;  3U2A A;  4GHI B;  4CLC B;  1DRM A;  4ARZ B;  4R3A A;  2ZOH A;  3CUE A;  1LSW A;  3K2N A;  5K5B A;  3ZYT A;  3G6O A;  1OTE A;  2GZA A;  4WN5 A;  5FL3 A;  4HNB A;  1IOU A;  4LLO B;  5F68 A;  3KO6 A;  4HP4 A;  4CLC A;  4ARZ A;  1T19 A;  3NOP C;  4BJP A;  1F5M A;  1DP8 A;  1P9R A;  4G3V A;  2Z6D A;  4P6Z M;  2VV8 A;  5F5Y A;  2W3D A;  3CAX A;  2W3H A;  4KUK A;  3B47 A;  2ZMF A;  2O9B A;  2Y8H A;  2KLI A;  4OOL A;  5DFX A;  3UB7 A;  5HSQ A;  1S4R A;  4CQH A;  4MCW A;  3R7W B;  1VHM A;  3A0R A;  4NXB A;  3MQ0 A;  3PBN A;  3A0S A;  3LYX A;  1P9W A;  2O9A A;  3UB8 A;  3H7W B;  3PBR A;  4HI4 A;  3FC7 A;  2GX5 A;  2VZW A;  2JHE A;  3HJI A;  1T1C A;  3V67 A;  3CI6 A;  2P08 A;  3S7Q A;  3ZQ5 A;  1TS7 A;  3T4T A;  5HPF A;  4I3J A;  4LPZ A;  3SW1 A;  3T4Q A;  4YNR A;  1OT6 A;  3EQV A;  4GCZ A;  1ZHH B;  1TS0 A;  1XJ3 A;  4DMZ A;  5HL6 A;  3UME A;  3ULF A;  2HF6 A;  4F3L B;  4BWI A;  3C8C A;  3T4J A;  1UWN X;  4RQ9 A;  2JKR M;  3F1N B;  2ZOI A;  3RTY A;  1OJ5 A;  5HD3 A;  2K31 A;  3E98 A;  3CWF A;  1LSV A;  4YWZ A;  2OWH A;  5IU1 A;  4F3L A;  5DF9 A;  3S7N A;  4Q0I A;  5HDC A;  1T1A A;  2W3F A;  1P97 A;  3MQQ A;  1BYW A;  2W1T B;  3D3O A;  1Y28 A;  1OT9 A;  3LIB A;  4CLC E;  4HY8 A;  1S1Y A;  4WEK A;  3PBQ A;  1T18 A;  4II7 A;  4K08 A;  3PBT A;  2K7S A;  2V0W A;  3F1O B;  3PYP A;  2K2N A;  5AVF A;  1EW0 A;  3UB9 A;  3MJQ A;  2D02 A;  3HCY A;  4GW9 A;  1T1B A;  2JKT I;  4MN7 A;  1V9Y A;  2W1T A;  3VOL A;  4NXF A;  1LSX A;  4JGQ A;  2GNX A;  2JN7 A;  2VKS A;  3NOU C;  3TE8 A;  2D01 A;  3FG8 A;  4O8G A;  4QPR A;  1W63 M;  3RH8 B;  3T4O A;  3F1O A;  5J7E A;  1VB6 A;  4WF0 A;  4GLQ A;  3OCL A;  2LB5 A;  3BWL A;  2QWS A;  1XJ6 A;  3VV4 A;  5HWT A;  4O01 A;  4WUJ A;  2FZ0 A;  2NUT C;  3JVU A;  3GEC A;  3LIF A;  3KYZ A;  2XRN A;  5DKL A;  1OTI A;  4GS9 B;  4JGR A;  3LIA A;  4EU0 A;  2O99 A;  3PHY A;  2QKP A;  3KSG A;  3E0Y A;  5F6A A;  5L8M A;  4UEY A;  3DBA A;  4GHI A;  2J80 A;  1LT0 A;  4M4X A;  4AFI A;  1F98 A;  3UE6 A;  5F69 A;  2PR5 A;  5HDD A;  5MC7 A;  4PAU A;  4O0P A;  3EEH A;  1MZU A;  2HV1 A;  4HIA A;  2Y79 A;  4HH3 A;  4G3K A;  2PDR A;  3GDI A;  2W0N A;  3LR4 A;  1JNU A;  2OAP 1;  2L4R A;  4L9G A;  2PHY A;  5IT5 A;  3UMD A;  3O5Y A;  4HH2 A;  3MFX A;  3T50 A;  3BQA A;  3H82 B;  3LR5 A;  4HJ6 A;  5J3W A;  4EW7 A;  3FPW A;  2HJE A;  2JKR I;  3EGD C;  2A2L A;  4WLA A;  2PT7 A;  4MDZ A;  4WEJ A;  3R7W A;  2B02 A;  2VLG A;  3CIT A;  3OC2 A;  3OBF A;  5DKK A;  2KOI A;  4ETZ A;  4KUO A;  3MMH A;  3H7W A;  2XA7 S;  2LB9 A;  1GSX A;  1F9I A;  4LRZ E;  2EWW A;  1ZTU A;  2GJ3 A;  3IBR A;  4IUK A;  3BJN A;  3PXP A;  3R4K A;  4GJ4 A;  3TJZ C;  3MF0 A;  4DJ3 A;  1OJG A;  2MJ6 A;  5G4Z A;  3LI8 A;  4JGO A;  3C30 A;  1S4S A;  3C2W A;  4WL9 A;  4KQD A;  2YKH A;  3HJK A;  4CLC D;  4BBV A;  1XJ2 A;  3F1N A;  3KSI A;  1TF1 A;  5TBM B;  2A24 B;  4Z1W A;  1XFQ A;  1S67 L;  1YKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...