3HREA

X-ray crystallographic structure of ctx-m-9 s70g
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CTX-M-9 extended-spectrum beta-lactamase
publication title Structural insights into substrate recognition and product expulsion in CTX-M enzymes.
pubmed doi rcsb
source organism Escherichia coli
total genus 97
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3hreA00
1PIOA 1C3BA 4E3JA 4ZBEA 1IYPA 5G18A 4JLFA 2GDNA 1ES2A 3WS5A 2IWBA 3VP2A 1QMEA 5AQBA 1BUEA 1MWSA 2Y4AA 2EFXA 3FKWA 2OV5A 4Y7PA 2R9WA 3EQUA 1E3UA 3HLFA 1ZG6A 1VQQA 1W79A 2QZ6A 1IKGA 4GDNA 4C3QA 2P74A 4U0XA 4WELA 4OKPA 4KG6A 3VMAA 5A92A 1KVMA 4JPMA 4RX3A 4BJPA 2Q9NA 1S6RA 5D3OA 4GD6A 5FAQA 5GHYA 4E3OA 4E3LA 3HLWA 2Y2JA 4KZ5A 5FI2A 1JWZA 3NBLA 1J9MA 2ZJ9A 3VFFA 3UE3A 4ZJ3A 2EXBA 4R3JA 2J8YA 1VM1A 2R9XA 5FSRA 1HZOA 3Q81A 1JWPA 1SDEA 5FQIA 4E6WA 3HLBA 3MZDA 1ESUA 4BQMA 2FFYA 3P98A 4KZ9A 1BT5A 3GRJA 1K54A 3BEBA 3OC2A 1JTDA 3Q1FA 4OOYA 3Q7VB 3NIAA 4GDBA 1CI9A 3ZNYA 1M6KA 5JYPA 2ZMAA 3DW0A 4YFMA 1QMFA 2HDQA 3CJMA 5M19A 5GHZA 1XA7A 4OPZA 2Y2HA 3GSGA 3M6BA 4BLMA 5E2EA 2ZQDA 3UDFA 5E2HA 5AQAA 4A5RA 4DE0A 1MWRA 1XGIA 3ZHHA 3ZCZA 1XPBA 2DCFA 2XF3A 3V39A 1MPLA 4HBUA 3WS4A 3E2KA 5DTTA 1ESIA 5KSHA 2E8IA 3GV9A 2Y59A 1Q2QA 4LCMA 4HESA 1I2SA 2JC7A 2Y2PA 1GHMA 4Z9QA 5CERA 3TOIA 4XUZA 5FATA 3W8KA 4PM6A 4OLGA 3OPLA 5EOEA 2BLSA 3IHBA 4WMCA 3IWOA 5EPHA 3GTCA 4S2OA 4MBHA 5F82A 5DTKA 1PW1A 4ZJ2A 3WS0A 4IEDA 2H5SA 2J7VA 3IXHA 2ZLYA 4B4ZA 4JF5A 1ERMA 4EUZA 2A3UA 5CXWA 2WUQA 3LCEA 1DJAA 1G6AA 1FSYA 1K6RA 4KQQA 3ZVTA 1M40A 5EVIA 2WGWB 4P6BA 4U0TA 5FI7A 4KG2A 5GLAA 1Z6FA 1KGFA 3W4OA 4OPRA 2ZQ7A 3AGEA 2XD1A 4P0MA 1ERQA 2J9PA 4BD1A 4E3NA 2WADA 4NK3A 4MNRA 3ZFZA 5EOOA 1PWDA 1YT4A 2I72A 4DXBA 1FCMA 4R0QA 2EX2A 1L0EA 4DE1A 5BOHA 2HDUA 4DDYA 1LI9A 5CTNA 2Y91A 1K56D 5CHMA 1K4FA 3UE0A 3NI9A 3OPRA 3ITAA 5JYOA 4S2JA 1MY8A 4UA7A 3V5MA 3GR2A 2C6WB 4LENA 3ZG9B 4LV1A 3S4XA 2OLUA 4S2LA 1Q2PA 5DF9A 1ZC2A 3IF6C 3BLSA 3N8SA 1MBLA 1BSGA 4GN2A 5L2FA 2PBYA 2Z2LB 3G32A 4NETA 2UWXA 1XKZA 2WKIA 5EVLA 2ZQAA 1FQGA 4IBRA 1JVJA 4OQIA 4X53A 4Y0OA 5CGWA 5HARA 2Y2OA 1NYMA 5HAPA 4QHCA 5HL1A 4JXWA 2EX6A 2RCXA 1DJCA 4C75A 3IHAA 2XQZA 1K4EA 3WS1A 2EFUA 4KZ6A 3CG5A 4FD8A 5FAOA 4GB7A 4EBPA 4ZJ1A 3BFFA 5HX9A 5FAPA 5A91A 4R1GA 4IVKA 3C5AA 2WZZA 3ZDJA 1E25A 1NRFA 3V50A 5EE8A 4N1HA 1PWCA 2XFTA 1L0FA 1HVBA 2Y2KA 2ZQCA 3TSGA 3WRTA 1KDSA 2ZQ8A 5CHJA 4QY6A 4IVIA 3HLEA 4UA6A 3G30A 4S2PA 4RVAA 5CGXA 4E3KA 4R23A 2PU2A 3FZCA 4KZ7A 2Y2LA 4KZAA 4UAAA 3HL9A 3JYIA 3Q07A 4GZBA 4RA7A 5DTSA 2ZC5B 3M2JA 5AQ7A 2Y2GA 1I2WA 3G4PA 4WM9A 1W8YA 3BYDA 3VFHA 1KVLA 5FASA 5GHXA 4OP5A 3Q82A 1ES3A 3CMZA 4E6XA 2Y2NA 1PW8A 4XUXA 2QPNA 2ZC6B 3SH7A 1KDWA 2Z2MB 1Y54A 5FQKA 3SS4A 1KE4A 2Y2IA 4IBXA 4MBFA 3V3RA 4X68A 1LLBA 4B88A 4UA9A 1L0DA 4PM5A 4GOGA 3O88A 2Y2QA 3GQZA 5EVIB 4MEZA 4YINA 1AXBA 2JE5A 4KZ3A 1E4DA 1HTZA 4X69A 3NY4A 3V3SA 4DF6A 5TGFA 5EUAA 1NYYA 3VP1A 1PYYA 1L0GA 3O3VA 3MFDA 3G31A 2XDMA 3N8RA 3G2ZA 1U60A 1PZPA 4RX2A 3VP4A 3IWQA 4WZ4A 1XX2A 4X55A 2WKHA 4JF4A 2P9VA 4N1XA 5FQMA 3AGDA 4XXRA 3SS3A 2ZC7A 4KG5A 1TVFA 3C7VA 3NCKA 2V2FF 3N4IA 4QJGA 3I7JA 1FOFA 3PBRA 3UO9A 3FWLA 1FR6A 4E3MA 1EWZA 1PZOA 3SS5A 1K6SA 1YLJA 3BECA 3IXGA 3ITBA 1BULA 3Q7ZA 1PWGA 4OONA 3RXXA 4DE2A 5FQJA 4S2NC 1SDNA 4S2MA 3W4PA 2J9OA 2PU4A 2ZM8A 3A3DA 4PM9A 4Y0UA 3PAGA 4E3IA 4WZ5A 5M18A 1NJ4A 3MXRA 1S0WA 4KZ8A 4PM7A 3IF6A 1K55C 1RGZA 2A49A 3WRZA 1ONGA 5EECA 5CHUA 2H0YA 1RGYA 3LY4A 2XK1A 3A3FA 4S2KA 2WGIA 5HAIA 3ZGAB 1BLHA 1TEMA 1TDLA 3DWKA 5CRFA 4EBNA 3D4FA 4M3KA 1XGJA 2XGNA 1BZAA 3BLMA 4FSFA 1YLZA 2ZD8A 2OSUA 4K0XA 4ZTKA 2VGKA 1ALQA 2WK0A 2XLNA 4O7DA 2EXAA 3MXSA 3PBQA 3OCNA 3BFGA 1NXYA 2FFFB 4QY5A 3UDIA 4L0LA 4GD8A 1K57C 4X6TA 2V20A 3DTMA 3QHYA 3A3IA 3IH9A 4P87A 1SCWA 1IYOA 4HBTA 1K56A 3O87A 2OLVA 1EI5A 5E43A 4DXCA 5DF8A 5HAQA 3FYZA 1WYCA 1BLCA 4JKTA 4CPKA 3BFDA 3PBTA 4JBFA 4OVDA 3ZNTA 2X02A 3LEZA 4P85A 3VP0A 4KQOA 4Y0TA 3UDXA 3NDEA 3FKVA 3UPPA 3HVFA 1IKIA 3MZFA 4BD0A 1H8YA 4ID4A 1W7FA 3MKEA 1DJBA 3C4PA 4WEJA 4ZDXA 2ZC4B 1WE4A 4X56A 1YLTA 3ZVWA 3UN7A 1H8ZA 3HLCA 4N92A 1OMEA 4OP8A 4PMAA 5TFQA 3OPPA 4LV3A 2IWDA 3GVBA 1ZKJA 3MKFA 3W4QA 4PM8A 3BFCA 1LHYA 2V1ZA 1GHPA 2G2WA 2ZQ9A 3IXBA 3RJUA 5F1GA 5CEDA 5CGSA 4C6YA 2X71A 3G35A 2JBFA 5FDHA 3ZG0A 3UPOA 3BFEA 4EWFA 3VOZA 1I5QA 3MZEA 3HREA 1YM1A 3SH9A 2P9VB 4Q8IA 1E3UD 2ZM2A 4LCLA 3C4OA 3MBZA 1L2SA 4JXSA 2WYXA 1YQSA 5FQQA 1ONHA 4QD4A 1TDGA 3SOIA 4FH2A 1N4OA 3ZG5A 4BENA 1IEMA 3S22A 2DNSA 4KENB 4OOLA 4R4RA 2HP6A 1XA1A 3O86A 5KSCA 4OQGA 5U47A 1SHVA 1XXMA 1CK3A 2HPBA 1YMSA 2JCHA 3HBRA 3P09A 3OZHA 2WKEA 1LL5A 4S2NA 1IYQA 4RYEA 4JXVA 3IF6B 3SH8A 2HP5A 2XR0A 3QNCA 3M6HA 1YLWA 1YMXA 4OOMA 2C5WB 2IWCA 3IF5A 5IHVA 3UNWA 3EQVA 4MBKA 4N9LA 3S1YA 3ISGA 1YLYA 1K55A 1HD8A 5CEBA 2Y55A 1NZUA 1K38A 3OPHA 1H5XA 5DF7A 4F94A 3PBSA 2B5RA 3IXDA 2RL3A 1CI8A 1GHIA 1NZOA 2Y2MA 3NC8A 5E2GA 4JXGA 3IT9A 2BG1A 4R4SA 4EV4A 3IWIA 2VGJA 4QU3A 5A93A 3QNBA 3TG9A 1ES5A 3G34A 1O07A 4MLLA 4OQ0A 4UHUA 3ZG8B 2H10A 3PBNA 4BL3A 5GLBA 4OH0A 4K0WA 4OPYA 3IH8A 5FQ9A 2XD5A 2HP9A 3OCLA 2X01A 1IELA 1K57A 3LY3A 5GLCA 3RXWA 3WWXA 2XEPA 3LO7A 1PI4A 2Q9MA 5F1FA 1G68A 1GA9A 3A3EA 1FSWA 5AQ9A 3BM6A 1BLSA 4WMCD 3PTEA 5HFOA 4CJNA 2WZXA 2WGVA 4KQRA 4FH4A 3PBOA 4OQHA 1MKIA 5J8XA 3N8LA 3HUOA 3CZDA 1CEGA 4WEKA 4JF6A 1IYSA 4KZBA 1KGEA 1W8QA 1NY0A 5A90A 3N7WA 4LV2A 3BRMA 4N9KA 4QB8A 1YLPA 2XFSA 5EVID 1K54C 3HUNA 3HUMA 3GMWA 3PAEA 4GNUA 5F83A 1JTGA 1RCJA 5KZHA 3UY6A 5M1AA 3N6IA 1KE0A 1FCNA 3VSLA 5GLDA 1JWVA 1CEFA 1LL9A 3A3JA 2XH9A 2DRWA 4OLDA 3Q7VA 4EQIA 1ZG4A 4H8RA 1GA0A 1MWTA 4FCFA 1ES4A 1KE3A 3HLGA 3ZG7B 5I94A 1O7EA 2QMIA 3B3XA 4PPRA 1WYBA 1BLPA 4R3BA 5FA7A 4GKUA 3UPNA 1MXOA 3IQAA 1XP4A 4WBGA 2ZM0A 4S2IA 3G2YA 1FR1A 1EROA 5CTMA 3NDGA 1GCEA 1RP5A 3VP3A 1N9BA 4OPQA 4WZ5C 1FCOA 2G2UA 1MWUA 3HLDA 1KGGA 3M2KA 5FI6A 5HW3A 1K25A 1BTLA 2HDSA 3DWZA 5EVIC 4BL2A 2EX9A 3E2LA 4DRTA 3VSKA 2CC1A 2WAEA 3C7UA 5E2FA 5KMWA 4WYYA 4B4XA 4D2OA 2WAFA 1SKFA 4ZAMA 4U3TA 5TR7A 3VOYA 2H0TA 2WGWA 3WS2A 4DDSA 5CECA 1PI5A 4LV0A 4HEFA 2HDRA 1DY6A 4KZ4A 1LI0A 5DVAA 3UE1A 3AGFA 4DE3A 3FV7A 4EBLA 2EX8A 4DKIA 4K91A 2ZC3B 1W5DA 5GL9A
chains in the Genus database with same CATH superfamily
1C3BA 4DJ3A 1ES2A 1P97A 1OPXA 4IHQA 5AQBA 2Y4AA 2EFXA 3EQUA 4YOFA 1ZG6A 1VQQA 5HWVA 2QZ6A 1IKGA 1TS7A 5A92A 4RX3A 2Q9NA 5D3OA 5GHYA 1NLZA 1LSVA 3UE3A 4ESPA 2HZ5A 2J8YA 4JGRA 3KSHA 2G7UA 5FQIA 3HLBA 2DMWA 1ESUA 4BQMA 2FFYA 1BT5A 3ULFA 1K54A 3BEBA 3OC2A 5HPIA 3ZNYA 3T50A 5TBMA 2ZMAA 3CJMA 5M19A 2Y2HA 3GSGA 2ZQDA 5AVEA 4A5RA 4DE0A 1MWRA 1XGIA 2VK3A 5FDSA 2DCFA 1MPLA 5DTTA 2E8IA 3GV9A 1Q2QA 2JC7A 5CERA 3OPLA 5EOEA 3IHBA 4MBHA 5DTKA 1PW1A 3QP6A 2J7VA 3IXHA 3PXPA 5C5KA 2A24B 4KQQA 1OT6A 2J3TC 2VGLM 5GLAA 4KG2A 1Z6FA 3CI6A 3EGDC 1AWIA 4OPRA 2XD1A 1ERQA 4BD1A 1MZUA 2WADA 4NK3A 2KLIA 4DXBA 1FCMA 3S7QA 2EX2A 1L0EA 2HDUA 4DDYA 5CTNA 2Y91A 3CAXA 3E4OA 5CHMA 3MS6A 3OPRA 2E8JA 4S2JA 1S4SA 3V5MA 4F3LA 3UE6A 1S1ZA 2OLUA 3QP1A 3N8SA 1ODVA 4NETA 3G32A 2UWXA 4IBRA 2ZOHA 5HARA 4X53A 1T1CA 4QHCA 3T4KA 2RCXA 1K4EA 2QKPA 4KZ6A 5FAOA 5FEGA 4GB7A 4EBPA 4ZJ1A 3BFFA 4IVKA 4R70A 1JNUA 1NRFA 1TD5A 1PWCA 1J3WA 1HVBA 5CX7A 4EU0A 3FPWA 3B42A 2ZQ8A 4QWOA 4QY6A 5CHJA 3G30A 4HHDA 5CGXA 4R23A 3FZCA 4KZAA 4XT2A 4GZBA 5HL6A 5DTSA 3C8CA 4GJ4A 2ZC5B 5EM0A 1D1JA 3CUEA 3LR4A 2D02A 4I3IA 4OP5A 5GHXA 5FASA 5EVEA 3T12B 1ES3A 3CMZA 1PW8A 3SH7A 1G28A 3T4SA 1KE4A 4MBFA 4X1MA 1L0DA 2Y2QA 1T18A 5EV0A 4DF6A 3HJKA 1NYYA 3G2ZA 3IWQA 4X55A 4JF4A 3C7VA 3N4IA 3MQOA 3PBRA 1T1BA 3IXGA 1YLJA 4OONA 4S2NC 4MN7A 2PYPA 4Y0UA 3LIFA 1X0OA 3U2AA 4WZ5A 4PHTA 1NJ4A 3WRZA 1ONGA 2OWJA 3LY4A 1G6OA 5AVFA 2AVXA 4BBVA 2FH5A 2OSUA 3BJNA 4ZTKA 1ALQA 2XLNA 3ICYA 4O7DA 1STZA 4CLCB 2FFFB 4L0LA 4GD8A 2J3WA 2D01A 3QHYA 1IYOA 2BASA 5HAQA 5DF8A 4NXFA 5AJGA 4CPKA 4P85A 4Y0TA 3HVFA 2QJ5A 4EEPA 4BD0A 2ZL1A 2ACGA 2OOLA 2O99A 4X56A 3T1SA 3UN7A 4OP8A 4N92A 4PMAA 1OMEA 1DP6A 3OPPA 1ZKJA 3MKFA 1GSWA 2OAP1 5FL3A 2G2WA 5F1GA 4R3AA 2X71A 3G35A 3MQ0A 3BFEA 3MZEA 1YM1A 3SH9A 2P9VB 1E3UD 3MBZA 3JPUA 1YQSA 1ONHA 5DKLA 3EGXC 3S22A 3KYQA 2HP6A 3O86A 1P9RA 4Y5FA 1YPRA 4FOFA 2JCHA 3CPTB 3OZHA 1LSXA 1Y28A 1IYQA 4RYEA 1N9LA 3IF6B 3QNCA 2XR0A 3M6HA 1YLWA 4FTXA 2C5WB 3GDIA 3VOLA 3H7WA 4MBKA 1DP9A 4LRYC 3BW6A 1K55A 1K38A 5DF7A 2B5RA 5E2GA 3NC8A 4KUKA 2VGJA 3E0YA 4QU3A 5A93A 4MLLA 2W3FA 4OQ0A 4UHUA 2H10A 3PBNA 4OH0A 3IH8A 3IX4A 4UQIS 5FQ9A 2ZBBA 2MJ6A 4DJ2A 1MC0A 2X01A 3LY3A 1W63Q 3DTEA 2XEPA 3G6OA 3F1OB 5AQ9A 3BM6A 5HFOA 3PTEA 2WGVA 4FH4A 4O0PA 2V0WA 4OQHA 3N7WA 2W1RA 3BRMA 3IS2A 2XROA 2JKGA 4Y17A 5GLDA 3A3JA 3Q7VA 4Y15A 3V67A 3IBJA 2QMIA 4JGQA 1BLPA 5FA7A 4HP9A 4GKUA 1YKDA 1EROA 5CTMA 4R38A 3NDGA 1XFNA 5FI6A 1K25A 4Y2FA 2LB9A 4BL2A 2VGLS 2PR5A 2W1TA 4DRTA 3C7UA 5KMWA 3ZQ5A 5LBRA 3MQQA 4HOIA 1F98A 1PI5A 4LV0A 2EA9A 4HEFA 2HDRA 5DVAA 3UE1A 1F5MA 4EBLA 2EX8A 4K91A 1EW0A 4Y3IA 3H9WA 4KQDA 1VETA 4CLCD 5G18A 4JLFA 5HDDA 3VP2A 2V8FA 4Y7PA 3F1PA 4H6JA 5KIZA 4C3QA 4EETB 3P7NA 3VMAA 1KVMA 1V9ZA 1S6RA 2QJ7A 4GD6A 5FAQA 4E3LA 3NOTC 2Y2JA 1JWZA 2ZJ9A 1IFQA 3VFFA 4ZJ3A 3PR6A 1HZOA 3UB9A 1SDEA 5J7EA 3GRJA 1CI9A 4B93A 4YFMA 3T4LA 3TJZC 1FIKA 5E2EA 1ACFA 3UDFA 3ZHHA 3F1NB 3V39A 3TW8A 5KSHA 2Y8HA 2Y59A 4Z9QA 3TOIA 3W8KA 4WMCA 3IWOA 4S2OA 4ZJ2A 4IEDA 3LIDA 3MSHA 4JF5A 1ERMA 3OBFA 1MKMA 5EVIA 4HP4A 2IA2A 4U0TA 5FI7A 2W3EA 4P0MA 2J9PA 3IBRA 1YSQA 2VJWA 4MNRA 5EOOA 3T1QB 2BTFP 2I72A 2PBDP 4R0QA 4JGPA 4DE1A 3MR0A 1K56D 1MY8A 4UA7A 4BMWA 1OT9A 2C6WB 4LENA 3ZG9B 5DF9A 4GN2A 2PBYA 1XKZA 1OTAA 2ZQAA 4Y0OA 3NOUC 3T4JA 1Z09A 5HL1A 2XQZA 2HF6A 3FG8A 3CG5A 4FD8A 4LRXC 5A91A 4R1GA 2WZZA 1E25A 5TBMB 5EE8A 2ZQCA 1KDSA 1LT0A 3UB6A 4IVIA 4S2PA 4UQIM 4E3KA 2PU2A 2Y2LA 4UAAA 3QP8A 3T1XA 2P04A 4RA7A 5AQ7A 2VX8A 2Y2GA 3BWLA 3BYDA 1KVLA 2JN7A 4X1LA 4XUXA 2QPNA 3LIAA 3NJAA 4IBXA 4B88A 4GOGA 4BBTA 4E04A 3P01A 1VEUA 3V3SA 4LGWA 5EUAA 3VP1A 3G31A 5MC7A 1U60A 3UB5P 3VP4A 5HDCA 4WZ4A 1XX2A 4DN0A 5L07A 2WKHA 4HNBA 1TS8A 4N1XA 5FQMA 3TSGA 3VV4A 3I7JA 2P7JA 1FOFA 1PZOA 3SS5A 4F3LB 3C30A 4ME4A 5FQJA 3W4PA 2J9OA 2PU4A 4HJ4A 5F6AA 5DFYA 4E3IA 4ARZA 3MXRA 4PM7A 1RGZA 2A49A 5CHUA 2XK1A 4S2KA 3DWKA 4EBNA 2I9VA 1BZAA 3BLMA 2HGVA 4FSFA 1YLZA 4G3WA 4K0XA 3KYZA 2VGKA 2WK0A 3BFGA 1K57C 3JVVA 4NXGA 3A0SA 3O87A 2OLVA 1EI5A 4DXCA 3FYZA 3PBTA 4OVDA 4XT2B 3VP0A 2W3HA 1SKOB 2YKHA 1VHMA 2PYRA 4HY8A 3LFVA 1T1AA 3C4PA 4GHIA 4ZDXA 2PRFA 1YLTA 2IWDA 3W4QA 3BFCA 1GHPA 3R7WA 2O9CA 3IXBA 3RJUA 5CGSA 3T4QA 4EWFA 1I5QA 3T4OA 1H8MA 2ZOIA 3C4OA 1L2SA 4JXSA 4II7A 4QD4A 1D7EA 3SOIA 1OJ5A 1SHVA 1XXMA 1TS0A 1YMSA 3P09A 3HBRA 3LR0A 4S2NA 1CJFA 1D06A 4OOMA 3EQVA 1ZHHB 3S1YA 3ISGA 3QP4A 5CEBA 5DJUA 3NULA 1H5XA 1GSVA 2RL3A 3MMHA 2Y2MA 4JXGA 3IT9A 3KSFA 3D72A 4MDZA 2H28A 3DAVA 2Q0OA 3RXWA 1IELA 2Q9MA 1NLYA 1GA9A 1FSWA 2JKTM 1BLSA 4CJNA 3L7HA 5J8XA 3K2NA 3N8LA 1CEGA 1GSXA 2ZL1B 1IYSA 4Z1WA 4KUOA 4LV2A 3D3OA 4QB8A 3HUNA 3HUMA 3C38A 3PAEA 1IOUA 1JTGA 4I38A 3N6IA 1KE0A 1LL9A 1OTBA 3BQ8A 1H3QA 1ES4A 5I94A 4I3JA 3PYPA 5EFWA 1A0KA 3IQAA 4S2IA 3CITA 1XJ2A 1GCEA 1N9BA 4WZ5C 2G2UA 3BQAA 5HW3A 2PR6A 3M2KA 2EX9A 2V9AA 2WAEA 5E2FA 4B4XA 3A0VA 3H7WB 2WAFA 2PHYA 4U3TA 3VOYA 3WS2A 2WGWA 5CECA 2OWHA 5J3WA 1DY6A 1LI0A 5HWWA 1NWZA 4PAUA 4DKIA 5GL9A 1PIOA 4E3JA 3DTIA 1CQAA 1V9YA 2GDNA 1BUEA 2OAQ1 3KO6A 3HLFA 2NUPC 1W79A 2P74A 5DFXA 4WELA 2KOIA 4OKPA 4KG6A 4BJPA 2P08A 3OLOA 4E3OA 2JKRI 5FI2A 4K08A 1J9MA 1G5UA 2O9BA 5TJJA 1PFLA 5HSQA 4R3JA 3IS2B 1VM1A 4E6WA 2HV1A 2CMNA 4KZ9A 4NEED 4CLCC 1JTDA 4X25A 4OOYA 3Q7VB 4GDBA 1M6KA 2HDQA 1F9IA 5GHZA 1XA7A 4BLMA 3TRCA 2ZMFA 4G3KA 4L9FA 3FC7A 3E2KA 1ESIA 4LCMA 2Z6DA 2Y2PA 4XUZA 1W63M 4PM6A 3LI9A 5EPHA 5F82A 1ZTUA 3WS0A 2W1TB 2ZLYA 2A3UA 1TF1A 2WUQA 3LCEA 1DJAA 1G6AA 1FSYA 3ZVTA 1M40A 4GS9A 1F2KA 4JGOA 3W4OA 5L10A 2ZQ7A 4D60A 4E3NA 3LR5A 3ZFZA 1VETB 1PWDA 1WA9A 1LI9A 3NI9A 3F1PB 4H6JB 3ITAA 4EUVA 5JYOA 3ZYTA 4ETXA 4G3VA 2PD7A 3K3CA 3S4XA 4PKYG 4YNRA 4S2LA 3IF6C 3BLSA 1MBLA 1BSGA 4HQAA 2K7SA 2Z2LB 5EVLA 3F1OA 3C2WA 1FQGA 4OQIA 1JVJA 2Y2OA 1NYMA 2EX6A 4Y13A 1DJCA 5G4ZA 4C75A 3IHAA 3WS1A 5HX9A 5FAPA 3ZDJA 3JVUA 3V50A 3RTYA 2XFTA 1L0FA 3H82A 2Y2KA 3WRTA 4QPRA 4UA6A 4RVAA 4KZ7A 3QP2A 4LRZE 3HL9A 2JKFA 3M2JA 4NKPA 2JHEA 1NRJA 3G4PA 4WM9A 1KDWA 2Z2MB 5FQKA 3SS4A 1LLBA 4PM5A 3EWKA 3GQZA 5EVIB 4MEZA 4YINA 2JE5A 1E4DA 4NG2A 3E4PA 4X69A 3S7NA 3L9KA 1PYYA 3DBAA 1KOUA 3MFDA 2XDMA 3N8RA 4RX2A 3BY8A 2VV8A 2O9AA 1LL8A 3KX0X 2QYBA 4EESA 4KG5A 3GECA 2J80A 3BECA 3ITBA 1BULA 4DE2A 3RXXA 1SDNA 4S2MA 4YWZA 2V1BA 2ZM8A 3A3DA 4M4XA 3NECA 3PAGA 5M18A 2KX6A 3T4TA 4Q0JA 2H0YA 3A3FA 5HAIA 1XJ6A 3ZGAB 1BLHA 1TEMA 2ZD8A 3LYXA 2EXAA 3S7PA 3OCNA 4FUWA 1NXYA 3UDIA 2GX5A 1HLUP 4X6TA 2V20A 3A3IA 4P87A 1LSWA 3ZNTA 2X02A 1S4RA 4WLAA 3UDXA 3S7OA 3A0RA 4I3AA 3MZFA 5L8MA 2Y79A 4ID4A 1OTDA 3MKEA 1DJBA 2ZC4B 4EEUA 1WE4A 3ZVWA 2VEAA 1SZVA 5TFQA 1VEUB 3E98A 2K2NA 2JBFA 5FDHA 3ZG0A 3UPOA 1XJ3A 2V1AA 3CLOA 2ZMVA 2PDRA 3VOZA 3HREA 4NXEA 5FQQA 1TDGA 5L09A 3ZG5A 1IEMA 2DNSA 4OOLA 5KSCA 4OQGA 5U47A 1DRMA 1PNEA 1CK3A 4Q0IA 2GJ3A 4ARZB 5IT5A 5K5BA 4JXVA 3SH8A 2HP5A 1YMXA 2XA7S 3IF5A 5IHVA 3UNWA 4N9LA 1YLYA 2Y55A 2L0WA 3OPHA 3PBSA 1CI8A 1NZOA 3UMEA 4R4SA 5F69A 3TG9A 1ES5A 3G34A 1O07A 4WN5A 2HJEA 4BL3A 5HPFA 5GLBA 4OPYA 5A8BA 3OCLA 1K57A 3LO7A 1PI4A 5F1FA 1G68A 1PRQA 4L9EA 4WMCD 3EEHA 3NHQA 2W0NA 1UWPX 4JF6A 1KGEA 1W8QA 5A90A 4GHIB 4N9KA 5EVID 1K54C 4GNUA 1RCJA 3NOPC 3VE3A 3R7WB 1FCNA 3VSLA 2WKRA 1CEFA 3K3DA 2XH9A 4MCWA 5J4EA 4OLDA 4EQIA 5HDSA 4HIAA 4H8RA 2QWSA 4I39A 1KE3A 3ZG7B 3B3XA 1WYBA 3UPNA 3LICA 1MXOA 1XP4A 2HJ9C 4AFIA 2ZM0A 1XJ4A 3G2YA 1FR1A 3VP3A 1N9OA 1FCOA 2LB5A 3KSIA 4I5SA 1BTLA 2HDSA 3DWZA 4BBUA 3VSKA 2A24A 3MF0A 4D2OA 4L9GA 1SKFA 4GW9A 4ZAMA 5HD5A 3VE4A 2H0TA 3TE8A 4DDSA 4P6ZM 2JKTI 4DE3A 3FV7A 4B9OA 3AGEA 3LR3A 2ZC3B 1W5DA 4ZBEA 1YAXA 1IYPA 3WS5A 2IWBA 1QMEA 3SW1A 1MWSA 3FKWA 2OV5A 2R9WA 1E3UA 3W2ZA 2B18A 2W3DA 4GDNA 3LGOA 3BY9A 4U0XA 2L1MA 4JPMA 4EW7A 2VV6A 1P0ZA 3HLWA 2VZWA 1SKOA 4KZ5A 3NBLA 4CLCE 2EXBA 5HWTA 4MN6A 2R9XA 5FSRA 1CF0A 1UGUA 3Q81A 1JWPA 5G4YA 3MZDA 2VV7A 3P98A 4IUHA 4UEYA 2J3TD 4HJ6A 1OJGA 3T1RA 3Q1FA 4EQ1A 3NIAA 3KSGA 5JYPA 3DW0A 1QMFA 4OPZA 3LIEA 3M6BA 5IS1A 5E2HA 5AQAA 3ZCZA 1XPBA 4GCZA 5IU1A 2XF3A 4R6LA 4HBUA 3WS4A 3CUEC 4HESA 1I2SA 2V0UA 2M7UA 1GHMA 3LI8A 5FATA 4OLGA 2BLSA 3GTCA 2H5SA 4B4ZA 4EUZA 5CXWA 1K6RA 4NXBA 2WGWB 4P6BA 1KGFA 5HD3A 3D9YA 4HH2A 4HJ3A 1YT4A 1S66L 4IUKA 3LEQA 5BOHA 1K4FA 2WKPA 3UE0A 2EWWA 3GR2A 4LV1A 1L3LA 3E4QA 1Q2PA 1ZC2A 2KDKA 5L2FA 2WKIA 3UB7A 5F68A 5CGWA 4O8GA 5HAPA 3UB8A 4JXWA 2XA7M 1H0MA 2EFUA 3C5AA 3MXQA 2VA0A 3UMDA 2YKFA 3R4KA 4N1HA 3DTKA 5FEFA 4CLCA 4LPZA 3HLEA 3Q07A 3JYIA 3IX3A 1I2WA 1W8YA 3VFHA 3U4LP 3Q82A 4E6XA 2PAVP 2Y2NA 2ZC6B 4RQ9A 1Y54A 3V3RA 2Y2IA 2FZ0A 4X68A 4UA9A 4GS9B 3O88A 1AXBA 4KZ3A 1HTZA 3NY4A 5TGFA 1K0KA 1L0GA 3O3VA 2Z6CA 4LFUA 1PZPA 3MJQA 3HCYA 2P9VA 3SS3A 3AGDA 1P9WA 3CHWP 2ZC7A 4XXRA 1TVFA 2VLGA 3NCKA 2V2FF 4ETZA 4QJGA 1OTEA 3UO9A 3FWLA 1FR6A 2V8CA 5DJTA 4E3MA 1EWZA 1K6SA 3Q7ZA 5HZHA 1PWGA 2M1CA 5DKKA 4PM9A 2VKSA 3CPTA 1S0WA 4KZ8A 1N9NA 2GZAA 3IF6A 1K55C 1S67L 5EECA 1RGYA 3LIBA 2WGIA 4MN5A 5CRFA 1TDLA 3B33A 3D4FA 4M3KA 1XGJA 2XGNA 4EERA 2PD8A 2B02A 1FILA 3MXSA 5F5YA 2PT7A 3PBQA 3FPVA 4BWIA 4QY5A 3H82B 3DTMA 3IH9A 1SCWA 2R78A 2XSSA 4HBTA 2JKRM 1K56A 5E43A 3RH8B 1WYCA 1BLCA 4JKTA 3BFDA 4JBFA 3LEZA 4KQOA 3NDEA 3FKVA 3UPPA 1IKIA 1H8YA 2A2LA 1W7FA 4WEJA 3EOIA 1H8ZA 3HLCA 4LLOB 4HI4A 4LV3A 3GVBA 5I5LA 1OTIA 4PM8A 4DMZA 2UV0E 1LHYA 2V1ZA 2O0YA 2ZQ9A 5CEDA 4C6YA 4WF0A 4Q8IA 4PKYA 2NUTC 2ZM2A 4LCLA 3OOVA 2WYXA 2B95A 3RFBA 2GNXA 1DP8A 4FH2A 1N4OA 4BENA 5EM1A 4KENB 4R4RA 1XA1A 2HPBA 2W27A 3CWFA 3PHYA 2XRNA 2WKEA 1LL5A 2L4RA 1VB6A 2EWVA 2K31A 4P6ZS 2IWCA 3LUQA 1HD8A 1NZUA 4F94A 1Y4OA 3IXDA 1GHIA 3B47A 1XFQA 2BG1A 4EV4A 1TS6A 3IWIA 3QNBA 3IX8A 4EXOA 3ZG8B 4K0WA 4IJGA 2XD5A 4WL9A 2HP9A 5GLCA 3WWXA 1T19A 3A3EA 2WZXA 2INWA 4MMNA 4KQRA 3PBOA 1MKIA 3HUOA 3CZDA 4WEKA 4KZBA 2M7VA 1NY0A 1S1YA 1YLPA 2XFSA 3GMWA 5F83A 4HH3A 5KZHA 3UY6A 5M1AA 1JWVA 2DRWA 4GLQA 4O01A 1YSPA 3MFXA 1ZG4A 1GA0A 1MWTA 4FCFA 3HLGA 3EEAA 1O7EA 4PPRA 4R3BA 3F1NA 4WBGA 1UWNX 4WUJA 4CQHA 3SZTA 2WKQA 3HJIA 1RP5A 3O5YA 4OPQA 4ZRRA 1MWUA 3HLDA 1KGGA 5EVIC 3E2LA 2CC1A 3KYEA 4WYYA 4Q0HA 5TR7A 2QHKA 3QP5A 1BYWA 2W3GA 4KZ4A 3AGFA
chains in the Genus database with same CATH topology
1PIOA 1C3BA 4E3JA 4ZBEA 1IYPA 5G18A 4JLFA 2GDNA 1ES2A 3WS5A 2IWBA 3VP2A 1QMEA 5AQBA 1BUEA 1MWSA 2Y4AA 2EFXA 3FKWA 2OV5A 4Y7PA 2R9WA 3EQUA 1E3UA 3HLFA 1ZG6A 1VQQA 1W79A 2QZ6A 1IKGA 4GDNA 4C3QA 2P74A 4U0XA 4WELA 4OKPA 4KG6A 3VMAA 5A92A 1KVMA 4JPMA 4RX3A 4BJPA 2Q9NA 1S6RA 5D3OA 4GD6A 5FAQA 5GHYA 4E3OA 4E3LA 3HLWA 2Y2JA 4KZ5A 5FI2A 1JWZA 3NBLA 1J9MA 2ZJ9A 3VFFA 3UE3A 4ZJ3A 2EXBA 4R3JA 2J8YA 1VM1A 2R9XA 5FSRA 1HZOA 3Q81A 1JWPA 1SDEA 5FQIA 4E6WA 3HLBA 3MZDA 1ESUA 4BQMA 2FFYA 3P98A 4KZ9A 1BT5A 3GRJA 1K54A 3BEBA 3OC2A 1JTDA 3Q1FA 4OOYA 3Q7VB 3NIAA 4GDBA 1CI9A 3ZNYA 1M6KA 5JYPA 2ZMAA 3DW0A 4YFMA 1QMFA 2HDQA 3CJMA 5M19A 5GHZA 1XA7A 4OPZA 2Y2HA 3GSGA 3M6BA 4BLMA 5E2EA 2ZQDA 3UDFA 5E2HA 5AQAA 4A5RA 4DE0A 1MWRA 1XGIA 3ZHHA 3ZCZA 1XPBA 2DCFA 2XF3A 3V39A 1MPLA 4HBUA 3WS4A 3E2KA 5DTTA 1ESIA 5KSHA 2E8IA 3GV9A 2Y59A 1Q2QA 4LCMA 4HESA 1I2SA 2JC7A 2Y2PA 1GHMA 4Z9QA 5CERA 3TOIA 4XUZA 5FATA 3W8KA 4PM6A 4OLGA 3OPLA 5EOEA 2BLSA 3IHBA 4WMCA 3IWOA 5EPHA 3GTCA 4S2OA 4MBHA 5F82A 5DTKA 1PW1A 4ZJ2A 3WS0A 4IEDA 2H5SA 2J7VA 3IXHA 2ZLYA 4B4ZA 4JF5A 1ERMA 4EUZA 2A3UA 5CXWA 2WUQA 3LCEA 1DJAA 1G6AA 1FSYA 1K6RA 4KQQA 3ZVTA 1M40A 5EVIA 2WGWB 4P6BA 4U0TA 5FI7A 4KG2A 5GLAA 1Z6FA 1KGFA 3W4OA 4OPRA 2ZQ7A 3AGEA 2XD1A 4P0MA 1ERQA 2J9PA 4BD1A 4E3NA 2WADA 4NK3A 4MNRA 3ZFZA 5EOOA 1PWDA 1YT4A 2I72A 4DXBA 1FCMA 4R0QA 2EX2A 1L0EA 4DE1A 5BOHA 2HDUA 4DDYA 1LI9A 5CTNA 2Y91A 1K56D 5CHMA 1K4FA 3UE0A 3NI9A 3OPRA 3ITAA 5JYOA 4S2JA 1MY8A 4UA7A 3V5MA 3GR2A 2C6WB 4LENA 3ZG9B 4LV1A 3S4XA 2OLUA 4S2LA 1Q2PA 5DF9A 1ZC2A 3IF6C 3BLSA 3N8SA 1MBLA 1BSGA 4GN2A 5L2FA 2PBYA 2Z2LB 3G32A 4NETA 2UWXA 1XKZA 2WKIA 5EVLA 2ZQAA 1FQGA 4IBRA 1JVJA 4OQIA 4X53A 4Y0OA 5CGWA 5HARA 2Y2OA 1NYMA 5HAPA 4QHCA 5HL1A 4JXWA 2EX6A 2RCXA 1DJCA 4C75A 3IHAA 2XQZA 1K4EA 3WS1A 2EFUA 4KZ6A 3CG5A 4FD8A 5FAOA 4GB7A 4EBPA 4ZJ1A 3BFFA 5HX9A 5FAPA 5A91A 4R1GA 4IVKA 3C5AA 2WZZA 3ZDJA 1E25A 1NRFA 3V50A 5EE8A 4N1HA 1PWCA 2XFTA 1L0FA 1HVBA 2Y2KA 2ZQCA 3TSGA 3WRTA 1KDSA 2ZQ8A 5CHJA 4QY6A 4IVIA 3HLEA 4UA6A 3G30A 4S2PA 4RVAA 5CGXA 4E3KA 4R23A 2PU2A 3FZCA 4KZ7A 2Y2LA 4KZAA 4UAAA 3HL9A 3JYIA 3Q07A 4GZBA 4RA7A 5DTSA 2ZC5B 3M2JA 5AQ7A 2Y2GA 1I2WA 3G4PA 4WM9A 1W8YA 3BYDA 3VFHA 1KVLA 5FASA 5GHXA 4OP5A 3Q82A 1ES3A 3CMZA 4E6XA 2Y2NA 1PW8A 4XUXA 2QPNA 2ZC6B 3SH7A 1KDWA 2Z2MB 1Y54A 5FQKA 3SS4A 1KE4A 2Y2IA 4IBXA 4MBFA 3V3RA 4X68A 1LLBA 4B88A 4UA9A 1L0DA 4PM5A 4GOGA 3O88A 2Y2QA 3GQZA 5EVIB 4MEZA 4YINA 1AXBA 2JE5A 4KZ3A 1E4DA 1HTZA 4X69A 3NY4A 3V3SA 4DF6A 5TGFA 5EUAA 1NYYA 3VP1A 1PYYA 1L0GA 3O3VA 3MFDA 3G31A 2XDMA 3N8RA 3G2ZA 1U60A 1PZPA 4RX2A 3VP4A 3IWQA 4WZ4A 1XX2A 4X55A 2WKHA 4JF4A 2P9VA 4N1XA 5FQMA 3AGDA 4XXRA 3SS3A 2ZC7A 4KG5A 1TVFA 3C7VA 3NCKA 2V2FF 3N4IA 4QJGA 3I7JA 1FOFA 3PBRA 3UO9A 3FWLA 1FR6A 4E3MA 1EWZA 1PZOA 3SS5A 1K6SA 1YLJA 3BECA 3IXGA 3ITBA 1BULA 3Q7ZA 1PWGA 4OONA 3RXXA 4DE2A 5FQJA 4S2NC 1SDNA 4S2MA 3W4PA 2J9OA 2PU4A 2ZM8A 3A3DA 4PM9A 4Y0UA 3PAGA 4E3IA 4WZ5A 5M18A 1NJ4A 3MXRA 1S0WA 4KZ8A 4PM7A 3IF6A 1K55C 1RGZA 2A49A 3WRZA 1ONGA 5EECA 5CHUA 2H0YA 1RGYA 3LY4A 2XK1A 3A3FA 4S2KA 2WGIA 5HAIA 3ZGAB 1BLHA 1TEMA 1TDLA 3DWKA 5CRFA 4EBNA 3D4FA 4M3KA 1XGJA 2XGNA 1BZAA 3BLMA 4FSFA 1YLZA 2ZD8A 2OSUA 4K0XA 4ZTKA 2VGKA 1ALQA 2WK0A 2XLNA 4O7DA 2EXAA 3MXSA 3PBQA 3OCNA 3BFGA 1NXYA 2FFFB 4QY5A 3UDIA 4L0LA 4GD8A 1K57C 4X6TA 2V20A 3DTMA 3QHYA 3A3IA 3IH9A 4P87A 1SCWA 1IYOA 4HBTA 1K56A 3O87A 2OLVA 1EI5A 5E43A 4DXCA 5DF8A 5HAQA 3FYZA 1WYCA 1BLCA 4JKTA 4CPKA 3BFDA 3PBTA 4JBFA 4OVDA 3ZNTA 2X02A 3LEZA 4P85A 3VP0A 4KQOA 4Y0TA 3UDXA 3NDEA 3FKVA 3UPPA 3HVFA 1IKIA 3MZFA 4BD0A 1H8YA 4ID4A 1W7FA 3MKEA 1DJBA 3C4PA 4WEJA 4ZDXA 2ZC4B 1WE4A 4X56A 1YLTA 3ZVWA 3UN7A 1H8ZA 3HLCA 4N92A 1OMEA 4OP8A 4PMAA 5TFQA 3OPPA 4LV3A 2IWDA 3GVBA 1ZKJA 3MKFA 3W4QA 4PM8A 3BFCA 1LHYA 2V1ZA 1GHPA 2G2WA 2ZQ9A 3IXBA 3RJUA 5F1GA 5CEDA 5CGSA 4C6YA 2X71A 3G35A 2JBFA 5FDHA 3ZG0A 3UPOA 3BFEA 4EWFA 3VOZA 1I5QA 3MZEA 3HREA 1YM1A 3SH9A 2P9VB 4Q8IA 1E3UD 2ZM2A 4LCLA 3C4OA 3MBZA 1L2SA 4JXSA 2WYXA 1YQSA 5FQQA 1ONHA 4QD4A 1TDGA 3SOIA 4FH2A 1N4OA 3ZG5A 4BENA 1IEMA 3S22A 2DNSA 4KENB 4OOLA 4R4RA 2HP6A 1XA1A 3O86A 5KSCA 4OQGA 5U47A 1SHVA 1XXMA 1CK3A 2HPBA 1YMSA 2JCHA 3HBRA 3P09A 3OZHA 2WKEA 1LL5A 4S2NA 1IYQA 4RYEA 4JXVA 3IF6B 3SH8A 2HP5A 2XR0A 3QNCA 3M6HA 1YLWA 1YMXA 4OOMA 2C5WB 2IWCA 3IF5A 5IHVA 3UNWA 3EQVA 4MBKA 4N9LA 3S1YA 3ISGA 1YLYA 1K55A 1HD8A 5CEBA 2Y55A 1NZUA 1K38A 3OPHA 1H5XA 5DF7A 4F94A 3PBSA 2B5RA 3IXDA 2RL3A 1CI8A 1GHIA 1NZOA 2Y2MA 3NC8A 5E2GA 4JXGA 3IT9A 2BG1A 4R4SA 4EV4A 3IWIA 2VGJA 4QU3A 5A93A 3QNBA 3TG9A 1ES5A 3G34A 1O07A 4MLLA 4OQ0A 4UHUA 3ZG8B 2H10A 3PBNA 4BL3A 5GLBA 4OH0A 4K0WA 4OPYA 3IH8A 5FQ9A 2XD5A 2HP9A 3OCLA 2X01A 1IELA 1K57A 3LY3A 5GLCA 3RXWA 3WWXA 2XEPA 3LO7A 1PI4A 2Q9MA 5F1FA 1G68A 1GA9A 3A3EA 1FSWA 5AQ9A 3BM6A 1BLSA 4WMCD 3PTEA 5HFOA 4CJNA 2WZXA 2WGVA 4KQRA 4FH4A 3PBOA 4OQHA 1MKIA 5J8XA 3N8LA 3HUOA 3CZDA 1CEGA 4WEKA 4JF6A 1IYSA 4KZBA 1KGEA 1W8QA 1NY0A 5A90A 3N7WA 4LV2A 3BRMA 4N9KA 4QB8A 1YLPA 2XFSA 5EVID 1K54C 3HUNA 3HUMA 3GMWA 3PAEA 4GNUA 5F83A 1JTGA 1RCJA 5KZHA 3UY6A 5M1AA 3N6IA 1KE0A 1FCNA 3VSLA 5GLDA 1JWVA 1CEFA 1LL9A 3A3JA 2XH9A 2DRWA 4OLDA 3Q7VA 4EQIA 1ZG4A 4H8RA 1GA0A 1MWTA 4FCFA 1ES4A 1KE3A 3HLGA 3ZG7B 5I94A 1O7EA 2QMIA 3B3XA 4PPRA 1WYBA 1BLPA 4R3BA 5FA7A 4GKUA 3UPNA 1MXOA 3IQAA 1XP4A 4WBGA 2ZM0A 4S2IA 3G2YA 1FR1A 1EROA 5CTMA 3NDGA 1GCEA 1RP5A 3VP3A 1N9BA 4OPQA 4WZ5C 1FCOA 2G2UA 1MWUA 3HLDA 1KGGA 3M2KA 5FI6A 5HW3A 1K25A 1BTLA 2HDSA 3DWZA 5EVIC 4BL2A 2EX9A 3E2LA 4DRTA 3VSKA 2CC1A 2WAEA 3C7UA 5E2FA 5KMWA 4WYYA 4B4XA 4D2OA 2WAFA 1SKFA 4ZAMA 4U3TA 5TR7A 3VOYA 2H0TA 2WGWA 3WS2A 4DDSA 5CECA 1PI5A 4LV0A 4HEFA 2HDRA 1DY6A 4KZ4A 1LI0A 5DVAA 3UE1A 3AGFA 4DE3A 3FV7A 4EBLA 2EX8A 4DKIA 4K91A 2ZC3B 1W5DA 5GL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIO A;  1C3B A;  4E3J A;  4ZBE A;  1IYP A;  5G18 A;  4JLF A;  2GDN A;  1ES2 A;  3WS5 A;  2IWB A;  3VP2 A;  1QME A;  5AQB A;  1BUE A;  1MWS A;  2Y4A A;  2EFX A;  3FKW A;  2OV5 A;  4Y7P A;  2R9W A;  3EQU A;  1E3U A;  3HLF A;  1ZG6 A;  1VQQ A;  1W79 A;  2QZ6 A;  1IKG A;  4GDN A;  4C3Q A;  2P74 A;  4U0X A;  4WEL A;  4OKP A;  4KG6 A;  3VMA A;  5A92 A;  1KVM A;  4JPM A;  4RX3 A;  4BJP A;  2Q9N A;  1S6R A;  5D3O A;  4GD6 A;  5FAQ A;  5GHY A;  4E3O A;  4E3L A;  3HLW A;  2Y2J A;  4KZ5 A;  5FI2 A;  1JWZ A;  3NBL A;  1J9M A;  2ZJ9 A;  3VFF A;  3UE3 A;  4ZJ3 A;  2EXB A;  4R3J A;  2J8Y A;  1VM1 A;  2R9X A;  5FSR A;  1HZO A;  3Q81 A;  1JWP A;  1SDE A;  5FQI A;  4E6W A;  3HLB A;  3MZD A;  1ESU A;  4BQM A;  2FFY A;  3P98 A;  4KZ9 A;  1BT5 A;  3GRJ A;  1K54 A;  3BEB A;  3OC2 A;  1JTD A;  3Q1F A;  4OOY A;  3Q7V B;  3NIA A;  4GDB A;  1CI9 A;  3ZNY A;  1M6K A;  5JYP A;  2ZMA A;  3DW0 A;  4YFM A;  1QMF A;  2HDQ A;  3CJM A;  5M19 A;  5GHZ A;  1XA7 A;  4OPZ A;  2Y2H A;  3GSG A;  3M6B A;  4BLM A;  5E2E A;  2ZQD A;  3UDF A;  5E2H A;  5AQA A;  4A5R A;  4DE0 A;  1MWR A;  1XGI A;  3ZHH A;  3ZCZ A;  1XPB A;  2DCF A;  2XF3 A;  3V39 A;  1MPL A;  4HBU A;  3WS4 A;  3E2K A;  5DTT A;  1ESI A;  5KSH A;  2E8I A;  3GV9 A;  2Y59 A;  1Q2Q A;  4LCM A;  4HES A;  1I2S A;  2JC7 A;  2Y2P A;  1GHM A;  4Z9Q A;  5CER A;  3TOI A;  4XUZ A;  5FAT A;  3W8K A;  4PM6 A;  4OLG A;  3OPL A;  5EOE A;  2BLS A;  3IHB A;  4WMC A;  3IWO A;  5EPH A;  3GTC A;  4S2O A;  4MBH A;  5F82 A;  5DTK A;  1PW1 A;  4ZJ2 A;  3WS0 A;  4IED A;  2H5S A;  2J7V A;  3IXH A;  2ZLY A;  4B4Z A;  4JF5 A;  1ERM A;  4EUZ A;  2A3U A;  5CXW A;  2WUQ A;  3LCE A;  1DJA A;  1G6A A;  1FSY A;  1K6R A;  4KQQ A;  3ZVT A;  1M40 A;  5EVI A;  2WGW B;  4P6B A;  4U0T A;  5FI7 A;  4KG2 A;  5GLA A;  1Z6F A;  1KGF A;  3W4O A;  4OPR A;  2ZQ7 A;  3AGE A;  2XD1 A;  4P0M A;  1ERQ A;  2J9P A;  4BD1 A;  4E3N A;  2WAD A;  4NK3 A;  4MNR A;  3ZFZ A;  5EOO A;  1PWD A;  1YT4 A;  2I72 A;  4DXB A;  1FCM A;  4R0Q A;  2EX2 A;  1L0E A;  4DE1 A;  5BOH A;  2HDU A;  4DDY A;  1LI9 A;  5CTN A;  2Y91 A;  1K56 D;  5CHM A;  1K4F A;  3UE0 A;  3NI9 A;  3OPR A;  3ITA A;  5JYO A;  4S2J A;  1MY8 A;  4UA7 A;  3V5M A;  3GR2 A;  2C6W B;  4LEN A;  3ZG9 B;  4LV1 A;  3S4X A;  2OLU A;  4S2L A;  1Q2P A;  5DF9 A;  1ZC2 A;  3IF6 C;  3BLS A;  3N8S A;  1MBL A;  1BSG A;  4GN2 A;  5L2F A;  2PBY A;  2Z2L B;  3G32 A;  4NET A;  2UWX A;  1XKZ A;  2WKI A;  5EVL A;  2ZQA A;  1FQG A;  4IBR A;  1JVJ A;  4OQI A;  4X53 A;  4Y0O A;  5CGW A;  5HAR A;  2Y2O A;  1NYM A;  5HAP A;  4QHC A;  5HL1 A;  4JXW A;  2EX6 A;  2RCX A;  1DJC A;  4C75 A;  3IHA A;  2XQZ A;  1K4E A;  3WS1 A;  2EFU A;  4KZ6 A;  3CG5 A;  4FD8 A;  5FAO A;  4GB7 A;  4EBP A;  4ZJ1 A;  3BFF A;  5HX9 A;  5FAP A;  5A91 A;  4R1G A;  4IVK A;  3C5A A;  2WZZ A;  3ZDJ A;  1E25 A;  1NRF A;  3V50 A;  5EE8 A;  4N1H A;  1PWC A;  2XFT A;  1L0F A;  1HVB A;  2Y2K A;  2ZQC A;  3TSG A;  3WRT A;  1KDS A;  2ZQ8 A;  5CHJ A;  4QY6 A;  4IVI A;  3HLE A;  4UA6 A;  3G30 A;  4S2P A;  4RVA A;  5CGX A;  4E3K A;  4R23 A;  2PU2 A;  3FZC A;  4KZ7 A;  2Y2L A;  4KZA A;  4UAA A;  3HL9 A;  3JYI A;  3Q07 A;  4GZB A;  4RA7 A;  5DTS A;  2ZC5 B;  3M2J A;  5AQ7 A;  2Y2G A;  1I2W A;  3G4P A;  4WM9 A;  1W8Y A;  3BYD A;  3VFH A;  1KVL A;  5FAS A;  5GHX A;  4OP5 A;  3Q82 A;  1ES3 A;  3CMZ A;  4E6X A;  2Y2N A;  1PW8 A;  4XUX A;  2QPN A;  2ZC6 B;  3SH7 A;  1KDW A;  2Z2M B;  1Y54 A;  5FQK A;  3SS4 A;  1KE4 A;  2Y2I A;  4IBX A;  4MBF A;  3V3R A;  4X68 A;  1LLB A;  4B88 A;  4UA9 A;  1L0D A;  4PM5 A;  4GOG A;  3O88 A;  2Y2Q A;  3GQZ A;  5EVI B;  4MEZ A;  4YIN A;  1AXB A;  2JE5 A;  4KZ3 A;  1E4D A;  1HTZ A;  4X69 A;  3NY4 A;  3V3S A;  4DF6 A;  5TGF A;  5EUA A;  1NYY A;  3VP1 A;  1PYY A;  1L0G A;  3O3V A;  3MFD A;  3G31 A;  2XDM A;  3N8R A;  3G2Z A;  1U60 A;  1PZP A;  4RX2 A;  3VP4 A;  3IWQ A;  4WZ4 A;  1XX2 A;  4X55 A;  2WKH A;  4JF4 A;  2P9V A;  4N1X A;  5FQM A;  3AGD A;  4XXR A;  3SS3 A;  2ZC7 A;  4KG5 A;  1TVF A;  3C7V A;  3NCK A;  2V2F F;  3N4I A;  4QJG A;  3I7J A;  1FOF A;  3PBR A;  3UO9 A;  3FWL A;  1FR6 A;  4E3M A;  1EWZ A;  1PZO A;  3SS5 A;  1K6S A;  1YLJ A;  3BEC A;  3IXG A;  3ITB A;  1BUL A;  3Q7Z A;  1PWG A;  4OON A;  3RXX A;  4DE2 A;  5FQJ A;  4S2N C;  1SDN A;  4S2M A;  3W4P A;  2J9O A;  2PU4 A;  2ZM8 A;  3A3D A;  4PM9 A;  4Y0U A;  3PAG A;  4E3I A;  4WZ5 A;  5M18 A;  1NJ4 A;  3MXR A;  1S0W A;  4KZ8 A;  4PM7 A;  3IF6 A;  1K55 C;  1RGZ A;  2A49 A;  3WRZ A;  1ONG A;  5EEC A;  5CHU A;  2H0Y A;  1RGY A;  3LY4 A;  2XK1 A;  3A3F A;  4S2K A;  2WGI A;  5HAI A;  3ZGA B;  1BLH A;  1TEM A;  1TDL A;  3DWK A;  5CRF A;  4EBN A;  3D4F A;  4M3K A;  1XGJ A;  2XGN A;  1BZA A;  3BLM A;  4FSF A;  1YLZ A;  2ZD8 A;  2OSU A;  4K0X A;  4ZTK A;  2VGK A;  1ALQ A;  2WK0 A;  2XLN A;  4O7D A;  2EXA A;  3MXS A;  3PBQ A;  3OCN A;  3BFG A;  1NXY A;  2FFF B;  4QY5 A;  3UDI A;  4L0L A;  4GD8 A;  1K57 C;  4X6T A;  2V20 A;  3DTM A;  3QHY A;  3A3I A;  3IH9 A;  4P87 A;  1SCW A;  1IYO A;  4HBT A;  1K56 A;  3O87 A;  2OLV A;  1EI5 A;  5E43 A;  4DXC A;  5DF8 A;  5HAQ A;  3FYZ A;  1WYC A;  1BLC A;  4JKT A;  4CPK A;  3BFD A;  3PBT A;  4JBF A;  4OVD A;  3ZNT A;  2X02 A;  3LEZ A;  4P85 A;  3VP0 A;  4KQO A;  4Y0T A;  3UDX A;  3NDE A;  3FKV A;  3UPP A;  3HVF A;  1IKI A;  3MZF A;  4BD0 A;  1H8Y A;  4ID4 A;  1W7F A;  3MKE A;  1DJB A;  3C4P A;  4WEJ A;  4ZDX A;  2ZC4 B;  1WE4 A;  4X56 A;  1YLT A;  3ZVW A;  3UN7 A;  1H8Z A;  3HLC A;  4N92 A;  1OME A;  4OP8 A;  4PMA A;  5TFQ A;  3OPP A;  4LV3 A;  2IWD A;  3GVB A;  1ZKJ A;  3MKF A;  3W4Q A;  4PM8 A;  3BFC A;  1LHY A;  2V1Z A;  1GHP A;  2G2W A;  2ZQ9 A;  3IXB A;  3RJU A;  5F1G A;  5CED A;  5CGS A;  4C6Y A;  2X71 A;  3G35 A;  2JBF A;  5FDH A;  3ZG0 A;  3UPO A;  3BFE A;  4EWF A;  3VOZ A;  1I5Q A;  3MZE A;  3HRE A;  1YM1 A;  3SH9 A;  2P9V B;  4Q8I A;  1E3U D;  2ZM2 A;  4LCL A;  3C4O A;  3MBZ A;  1L2S A;  4JXS A;  2WYX A;  1YQS A;  5FQQ A;  1ONH A;  4QD4 A;  1TDG A;  3SOI A;  4FH2 A;  1N4O A;  3ZG5 A;  4BEN A;  1IEM A;  3S22 A;  2DNS A;  4KEN B;  4OOL A;  4R4R A;  2HP6 A;  1XA1 A;  3O86 A;  5KSC A;  4OQG A;  5U47 A;  1SHV A;  1XXM A;  1CK3 A;  2HPB A;  1YMS A;  2JCH A;  3HBR A;  3P09 A;  3OZH A;  2WKE A;  1LL5 A;  4S2N A;  1IYQ A;  4RYE A;  4JXV A;  3IF6 B;  3SH8 A;  2HP5 A;  2XR0 A;  3QNC A;  3M6H A;  1YLW A;  1YMX A;  4OOM A;  2C5W B;  2IWC A;  3IF5 A;  5IHV A;  3UNW A;  3EQV A;  4MBK A;  4N9L A;  3S1Y A;  3ISG A;  1YLY A;  1K55 A;  1HD8 A;  5CEB A;  2Y55 A;  1NZU A;  1K38 A;  3OPH A;  1H5X A;  5DF7 A;  4F94 A;  3PBS A;  2B5R A;  3IXD A;  2RL3 A;  1CI8 A;  1GHI A;  1NZO A;  2Y2M A;  3NC8 A;  5E2G A;  4JXG A;  3IT9 A;  2BG1 A;  4R4S A;  4EV4 A;  3IWI A;  2VGJ A;  4QU3 A;  5A93 A;  3QNB A;  3TG9 A;  1ES5 A;  3G34 A;  1O07 A;  4MLL A;  4OQ0 A;  4UHU A;  3ZG8 B;  2H10 A;  3PBN A;  4BL3 A;  5GLB A;  4OH0 A;  4K0W A;  4OPY A;  3IH8 A;  5FQ9 A;  2XD5 A;  2HP9 A;  3OCL A;  2X01 A;  1IEL A;  1K57 A;  3LY3 A;  5GLC A;  3RXW A;  3WWX A;  2XEP A;  3LO7 A;  1PI4 A;  2Q9M A;  5F1F A;  1G68 A;  1GA9 A;  3A3E A;  1FSW A;  5AQ9 A;  3BM6 A;  1BLS A;  4WMC D;  3PTE A;  5HFO A;  4CJN A;  2WZX A;  2WGV A;  4KQR A;  4FH4 A;  3PBO A;  4OQH A;  1MKI A;  5J8X A;  3N8L A;  3HUO A;  3CZD A;  1CEG A;  4WEK A;  4JF6 A;  1IYS A;  4KZB A;  1KGE A;  1W8Q A;  1NY0 A;  5A90 A;  3N7W A;  4LV2 A;  3BRM A;  4N9K A;  4QB8 A;  1YLP A;  2XFS A;  5EVI D;  1K54 C;  3HUN A;  3HUM A;  3GMW A;  3PAE A;  4GNU A;  5F83 A;  1JTG A;  1RCJ A;  5KZH A;  3UY6 A;  5M1A A;  3N6I A;  1KE0 A;  1FCN A;  3VSL A;  5GLD A;  1JWV A;  1CEF A;  1LL9 A;  3A3J A;  2XH9 A;  2DRW A;  4OLD A;  3Q7V A;  4EQI A;  1ZG4 A;  4H8R A;  1GA0 A;  1MWT A;  4FCF A;  1ES4 A;  1KE3 A;  3HLG A;  3ZG7 B;  5I94 A;  1O7E A;  2QMI A;  3B3X A;  4PPR A;  1WYB A;  1BLP A;  4R3B A;  5FA7 A;  4GKU A;  3UPN A;  1MXO A;  3IQA A;  1XP4 A;  4WBG A;  2ZM0 A;  4S2I A;  3G2Y A;  1FR1 A;  1ERO A;  5CTM A;  3NDG A;  1GCE A;  1RP5 A;  3VP3 A;  1N9B A;  4OPQ A;  4WZ5 C;  1FCO A;  2G2U A;  1MWU A;  3HLD A;  1KGG A;  3M2K A;  5FI6 A;  5HW3 A;  1K25 A;  1BTL A;  2HDS A;  3DWZ A;  5EVI C;  4BL2 A;  2EX9 A;  3E2L A;  4DRT A;  3VSK A;  2CC1 A;  2WAE A;  3C7U A;  5E2F A;  5KMW A;  4WYY A;  4B4X A;  4D2O A;  2WAF A;  1SKF A;  4ZAM A;  4U3T A;  5TR7 A;  3VOY A;  2H0T A;  2WGW A;  3WS2 A;  4DDS A;  5CEC A;  1PI5 A;  4LV0 A;  4HEF A;  2HDR A;  1DY6 A;  4KZ4 A;  1LI0 A;  5DVA A;  3UE1 A;  3AGF A;  4DE3 A;  3FV7 A;  4EBL A;  2EX8 A;  4DKI A;  4K91 A;  2ZC3 B;  1W5D A;  5GL9 A; 
#chains in the Genus database with same CATH topology
 1C3B A;  4DJ3 A;  1ES2 A;  1P97 A;  1OPX A;  4IHQ A;  5AQB A;  2Y4A A;  2EFX A;  3EQU A;  4YOF A;  1ZG6 A;  1VQQ A;  5HWV A;  2QZ6 A;  1IKG A;  1TS7 A;  5A92 A;  4RX3 A;  2Q9N A;  5D3O A;  5GHY A;  1NLZ A;  1LSV A;  3UE3 A;  4ESP A;  2HZ5 A;  2J8Y A;  4JGR A;  3KSH A;  2G7U A;  5FQI A;  3HLB A;  2DMW A;  1ESU A;  4BQM A;  2FFY A;  1BT5 A;  3ULF A;  1K54 A;  3BEB A;  3OC2 A;  5HPI A;  3ZNY A;  3T50 A;  5TBM A;  2ZMA A;  3CJM A;  5M19 A;  2Y2H A;  3GSG A;  2ZQD A;  5AVE A;  4A5R A;  4DE0 A;  1MWR A;  1XGI A;  2VK3 A;  5FDS A;  2DCF A;  1MPL A;  5DTT A;  2E8I A;  3GV9 A;  1Q2Q A;  2JC7 A;  5CER A;  3OPL A;  5EOE A;  3IHB A;  4MBH A;  5DTK A;  1PW1 A;  3QP6 A;  2J7V A;  3IXH A;  3PXP A;  5C5K A;  2A24 B;  4KQQ A;  1OT6 A;  2J3T C;  2VGL M;  5GLA A;  4KG2 A;  1Z6F A;  3CI6 A;  3EGD C;  1AWI A;  4OPR A;  2XD1 A;  1ERQ A;  4BD1 A;  1MZU A;  2WAD A;  4NK3 A;  2KLI A;  4DXB A;  1FCM A;  3S7Q A;  2EX2 A;  1L0E A;  2HDU A;  4DDY A;  5CTN A;  2Y91 A;  3CAX A;  3E4O A;  5CHM A;  3MS6 A;  3OPR A;  2E8J A;  4S2J A;  1S4S A;  3V5M A;  4F3L A;  3UE6 A;  1S1Z A;  2OLU A;  3QP1 A;  3N8S A;  1ODV A;  4NET A;  3G32 A;  2UWX A;  4IBR A;  2ZOH A;  5HAR A;  4X53 A;  1T1C A;  4QHC A;  3T4K A;  2RCX A;  1K4E A;  2QKP A;  4KZ6 A;  5FAO A;  5FEG A;  4GB7 A;  4EBP A;  4ZJ1 A;  3BFF A;  4IVK A;  4R70 A;  1JNU A;  1NRF A;  1TD5 A;  1PWC A;  1J3W A;  1HVB A;  5CX7 A;  4EU0 A;  3FPW A;  3B42 A;  2ZQ8 A;  4QWO A;  4QY6 A;  5CHJ A;  3G30 A;  4HHD A;  5CGX A;  4R23 A;  3FZC A;  4KZA A;  4XT2 A;  4GZB A;  5HL6 A;  5DTS A;  3C8C A;  4GJ4 A;  2ZC5 B;  5EM0 A;  1D1J A;  3CUE A;  3LR4 A;  2D02 A;  4I3I A;  4OP5 A;  5GHX A;  5FAS A;  5EVE A;  3T12 B;  1ES3 A;  3CMZ A;  1PW8 A;  3SH7 A;  1G28 A;  3T4S A;  1KE4 A;  4MBF A;  4X1M A;  1L0D A;  2Y2Q A;  1T18 A;  5EV0 A;  4DF6 A;  3HJK A;  1NYY A;  3G2Z A;  3IWQ A;  4X55 A;  4JF4 A;  3C7V A;  3N4I A;  3MQO A;  3PBR A;  1T1B A;  3IXG A;  1YLJ A;  4OON A;  4S2N C;  4MN7 A;  2PYP A;  4Y0U A;  3LIF A;  1X0O A;  3U2A A;  4WZ5 A;  4PHT A;  1NJ4 A;  3WRZ A;  1ONG A;  2OWJ A;  3LY4 A;  1G6O A;  5AVF A;  2AVX A;  4BBV A;  2FH5 A;  2OSU A;  3BJN A;  4ZTK A;  1ALQ A;  2XLN A;  3ICY A;  4O7D A;  1STZ A;  4CLC B;  2FFF B;  4L0L A;  4GD8 A;  2J3W A;  2D01 A;  3QHY A;  1IYO A;  2BAS A;  5HAQ A;  5DF8 A;  4NXF A;  5AJG A;  4CPK A;  4P85 A;  4Y0T A;  3HVF A;  2QJ5 A;  4EEP A;  4BD0 A;  2ZL1 A;  2ACG A;  2OOL A;  2O99 A;  4X56 A;  3T1S A;  3UN7 A;  4OP8 A;  4N92 A;  4PMA A;  1OME A;  1DP6 A;  3OPP A;  1ZKJ A;  3MKF A;  1GSW A;  2OAP 1;  5FL3 A;  2G2W A;  5F1G A;  4R3A A;  2X71 A;  3G35 A;  3MQ0 A;  3BFE A;  3MZE A;  1YM1 A;  3SH9 A;  2P9V B;  1E3U D;  3MBZ A;  3JPU A;  1YQS A;  1ONH A;  5DKL A;  3EGX C;  3S22 A;  3KYQ A;  2HP6 A;  3O86 A;  1P9R A;  4Y5F A;  1YPR A;  4FOF A;  2JCH A;  3CPT B;  3OZH A;  1LSX A;  1Y28 A;  1IYQ A;  4RYE A;  1N9L A;  3IF6 B;  3QNC A;  2XR0 A;  3M6H A;  1YLW A;  4FTX A;  2C5W B;  3GDI A;  3VOL A;  3H7W A;  4MBK A;  1DP9 A;  4LRY C;  3BW6 A;  1K55 A;  1K38 A;  5DF7 A;  2B5R A;  5E2G A;  3NC8 A;  4KUK A;  2VGJ A;  3E0Y A;  4QU3 A;  5A93 A;  4MLL A;  2W3F A;  4OQ0 A;  4UHU A;  2H10 A;  3PBN A;  4OH0 A;  3IH8 A;  3IX4 A;  4UQI S;  5FQ9 A;  2ZBB A;  2MJ6 A;  4DJ2 A;  1MC0 A;  2X01 A;  3LY3 A;  1W63 Q;  3DTE A;  2XEP A;  3G6O A;  3F1O B;  5AQ9 A;  3BM6 A;  5HFO A;  3PTE A;  2WGV A;  4FH4 A;  4O0P A;  2V0W A;  4OQH A;  3N7W A;  2W1R A;  3BRM A;  3IS2 A;  2XRO A;  2JKG A;  4Y17 A;  5GLD A;  3A3J A;  3Q7V A;  4Y15 A;  3V67 A;  3IBJ A;  2QMI A;  4JGQ A;  1BLP A;  5FA7 A;  4HP9 A;  4GKU A;  1YKD A;  1ERO A;  5CTM A;  4R38 A;  3NDG A;  1XFN A;  5FI6 A;  1K25 A;  4Y2F A;  2LB9 A;  4BL2 A;  2VGL S;  2PR5 A;  2W1T A;  4DRT A;  3C7U A;  5KMW A;  3ZQ5 A;  5LBR A;  3MQQ A;  4HOI A;  1F98 A;  1PI5 A;  4LV0 A;  2EA9 A;  4HEF A;  2HDR A;  5DVA A;  3UE1 A;  1F5M A;  4EBL A;  2EX8 A;  4K91 A;  1EW0 A;  4Y3I A;  3H9W A;  4KQD A;  1VET A;  4CLC D;  5G18 A;  4JLF A;  5HDD A;  3VP2 A;  2V8F A;  4Y7P A;  3F1P A;  4H6J A;  5KIZ A;  4C3Q A;  4EET B;  3P7N A;  3VMA A;  1KVM A;  1V9Z A;  1S6R A;  2QJ7 A;  4GD6 A;  5FAQ A;  4E3L A;  3NOT C;  2Y2J A;  1JWZ A;  2ZJ9 A;  1IFQ A;  3VFF A;  4ZJ3 A;  3PR6 A;  1HZO A;  3UB9 A;  1SDE A;  5J7E A;  3GRJ A;  1CI9 A;  4B93 A;  4YFM A;  3T4L A;  3TJZ C;  1FIK A;  5E2E A;  1ACF A;  3UDF A;  3ZHH A;  3F1N B;  3V39 A;  3TW8 A;  5KSH A;  2Y8H A;  2Y59 A;  4Z9Q A;  3TOI A;  3W8K A;  4WMC A;  3IWO A;  4S2O A;  4ZJ2 A;  4IED A;  3LID A;  3MSH A;  4JF5 A;  1ERM A;  3OBF A;  1MKM A;  5EVI A;  4HP4 A;  2IA2 A;  4U0T A;  5FI7 A;  2W3E A;  4P0M A;  2J9P A;  3IBR A;  1YSQ A;  2VJW A;  4MNR A;  5EOO A;  3T1Q B;  2BTF P;  2I72 A;  2PBD P;  4R0Q A;  4JGP A;  4DE1 A;  3MR0 A;  1K56 D;  1MY8 A;  4UA7 A;  4BMW A;  1OT9 A;  2C6W B;  4LEN A;  3ZG9 B;  5DF9 A;  4GN2 A;  2PBY A;  1XKZ A;  1OTA A;  2ZQA A;  4Y0O A;  3NOU C;  3T4J A;  1Z09 A;  5HL1 A;  2XQZ A;  2HF6 A;  3FG8 A;  3CG5 A;  4FD8 A;  4LRX C;  5A91 A;  4R1G A;  2WZZ A;  1E25 A;  5TBM B;  5EE8 A;  2ZQC A;  1KDS A;  1LT0 A;  3UB6 A;  4IVI A;  4S2P A;  4UQI M;  4E3K A;  2PU2 A;  2Y2L A;  4UAA A;  3QP8 A;  3T1X A;  2P04 A;  4RA7 A;  5AQ7 A;  2VX8 A;  2Y2G A;  3BWL A;  3BYD A;  1KVL A;  2JN7 A;  4X1L A;  4XUX A;  2QPN A;  3LIA A;  3NJA A;  4IBX A;  4B88 A;  4GOG A;  4BBT A;  4E04 A;  3P01 A;  1VEU A;  3V3S A;  4LGW A;  5EUA A;  3VP1 A;  3G31 A;  5MC7 A;  1U60 A;  3UB5 P;  3VP4 A;  5HDC A;  4WZ4 A;  1XX2 A;  4DN0 A;  5L07 A;  2WKH A;  4HNB A;  1TS8 A;  4N1X A;  5FQM A;  3TSG A;  3VV4 A;  3I7J A;  2P7J A;  1FOF A;  1PZO A;  3SS5 A;  4F3L B;  3C30 A;  4ME4 A;  5FQJ A;  3W4P A;  2J9O A;  2PU4 A;  4HJ4 A;  5F6A A;  5DFY A;  4E3I A;  4ARZ A;  3MXR A;  4PM7 A;  1RGZ A;  2A49 A;  5CHU A;  2XK1 A;  4S2K A;  3DWK A;  4EBN A;  2I9V A;  1BZA A;  3BLM A;  2HGV A;  4FSF A;  1YLZ A;  4G3W A;  4K0X A;  3KYZ A;  2VGK A;  2WK0 A;  3BFG A;  1K57 C;  3JVV A;  4NXG A;  3A0S A;  3O87 A;  2OLV A;  1EI5 A;  4DXC A;  3FYZ A;  3PBT A;  4OVD A;  4XT2 B;  3VP0 A;  2W3H A;  1SKO B;  2YKH A;  1VHM A;  2PYR A;  4HY8 A;  3LFV A;  1T1A A;  3C4P A;  4GHI A;  4ZDX A;  2PRF A;  1YLT A;  2IWD A;  3W4Q A;  3BFC A;  1GHP A;  3R7W A;  2O9C A;  3IXB A;  3RJU A;  5CGS A;  3T4Q A;  4EWF A;  1I5Q A;  3T4O A;  1H8M A;  2ZOI A;  3C4O A;  1L2S A;  4JXS A;  4II7 A;  4QD4 A;  1D7E A;  3SOI A;  1OJ5 A;  1SHV A;  1XXM A;  1TS0 A;  1YMS A;  3P09 A;  3HBR A;  3LR0 A;  4S2N A;  1CJF A;  1D06 A;  4OOM A;  3EQV A;  1ZHH B;  3S1Y A;  3ISG A;  3QP4 A;  5CEB A;  5DJU A;  3NUL A;  1H5X A;  1GSV A;  2RL3 A;  3MMH A;  2Y2M A;  4JXG A;  3IT9 A;  3KSF A;  3D72 A;  4MDZ A;  2H28 A;  3DAV A;  2Q0O A;  3RXW A;  1IEL A;  2Q9M A;  1NLY A;  1GA9 A;  1FSW A;  2JKT M;  1BLS A;  4CJN A;  3L7H A;  5J8X A;  3K2N A;  3N8L A;  1CEG A;  1GSX A;  2ZL1 B;  1IYS A;  4Z1W A;  4KUO A;  4LV2 A;  3D3O A;  4QB8 A;  3HUN A;  3HUM A;  3C38 A;  3PAE A;  1IOU A;  1JTG A;  4I38 A;  3N6I A;  1KE0 A;  1LL9 A;  1OTB A;  3BQ8 A;  1H3Q A;  1ES4 A;  5I94 A;  4I3J A;  3PYP A;  5EFW A;  1A0K A;  3IQA A;  4S2I A;  3CIT A;  1XJ2 A;  1GCE A;  1N9B A;  4WZ5 C;  2G2U A;  3BQA A;  5HW3 A;  2PR6 A;  3M2K A;  2EX9 A;  2V9A A;  2WAE A;  5E2F A;  4B4X A;  3A0V A;  3H7W B;  2WAF A;  2PHY A;  4U3T A;  3VOY A;  3WS2 A;  2WGW A;  5CEC A;  2OWH A;  5J3W A;  1DY6 A;  1LI0 A;  5HWW A;  1NWZ A;  4PAU A;  4DKI A;  5GL9 A;  1PIO A;  4E3J A;  3DTI A;  1CQA A;  1V9Y A;  2GDN A;  1BUE A;  2OAQ 1;  3KO6 A;  3HLF A;  2NUP C;  1W79 A;  2P74 A;  5DFX A;  4WEL A;  2KOI A;  4OKP A;  4KG6 A;  4BJP A;  2P08 A;  3OLO A;  4E3O A;  2JKR I;  5FI2 A;  4K08 A;  1J9M A;  1G5U A;  2O9B A;  5TJJ A;  1PFL A;  5HSQ A;  4R3J A;  3IS2 B;  1VM1 A;  4E6W A;  2HV1 A;  2CMN A;  4KZ9 A;  4NEE D;  4CLC C;  1JTD A;  4X25 A;  4OOY A;  3Q7V B;  4GDB A;  1M6K A;  2HDQ A;  1F9I A;  5GHZ A;  1XA7 A;  4BLM A;  3TRC A;  2ZMF A;  4G3K A;  4L9F A;  3FC7 A;  3E2K A;  1ESI A;  4LCM A;  2Z6D A;  2Y2P A;  4XUZ A;  1W63 M;  4PM6 A;  3LI9 A;  5EPH A;  5F82 A;  1ZTU A;  3WS0 A;  2W1T B;  2ZLY A;  2A3U A;  1TF1 A;  2WUQ A;  3LCE A;  1DJA A;  1G6A A;  1FSY A;  3ZVT A;  1M40 A;  4GS9 A;  1F2K A;  4JGO A;  3W4O A;  5L10 A;  2ZQ7 A;  4D60 A;  4E3N A;  3LR5 A;  3ZFZ A;  1VET B;  1PWD A;  1WA9 A;  1LI9 A;  3NI9 A;  3F1P B;  4H6J B;  3ITA A;  4EUV A;  5JYO A;  3ZYT A;  4ETX A;  4G3V A;  2PD7 A;  3K3C A;  3S4X A;  4PKY G;  4YNR A;  4S2L A;  3IF6 C;  3BLS A;  1MBL A;  1BSG A;  4HQA A;  2K7S A;  2Z2L B;  5EVL A;  3F1O A;  3C2W A;  1FQG A;  4OQI A;  1JVJ A;  2Y2O A;  1NYM A;  2EX6 A;  4Y13 A;  1DJC A;  5G4Z A;  4C75 A;  3IHA A;  3WS1 A;  5HX9 A;  5FAP A;  3ZDJ A;  3JVU A;  3V50 A;  3RTY A;  2XFT A;  1L0F A;  3H82 A;  2Y2K A;  3WRT A;  4QPR A;  4UA6 A;  4RVA A;  4KZ7 A;  3QP2 A;  4LRZ E;  3HL9 A;  2JKF A;  3M2J A;  4NKP A;  2JHE A;  1NRJ A;  3G4P A;  4WM9 A;  1KDW A;  2Z2M B;  5FQK A;  3SS4 A;  1LLB A;  4PM5 A;  3EWK A;  3GQZ A;  5EVI B;  4MEZ A;  4YIN A;  2JE5 A;  1E4D A;  4NG2 A;  3E4P A;  4X69 A;  3S7N A;  3L9K A;  1PYY A;  3DBA A;  1KOU A;  3MFD A;  2XDM A;  3N8R A;  4RX2 A;  3BY8 A;  2VV8 A;  2O9A A;  1LL8 A;  3KX0 X;  2QYB A;  4EES A;  4KG5 A;  3GEC A;  2J80 A;  3BEC A;  3ITB A;  1BUL A;  4DE2 A;  3RXX A;  1SDN A;  4S2M A;  4YWZ A;  2V1B A;  2ZM8 A;  3A3D A;  4M4X A;  3NEC A;  3PAG A;  5M18 A;  2KX6 A;  3T4T A;  4Q0J A;  2H0Y A;  3A3F A;  5HAI A;  1XJ6 A;  3ZGA B;  1BLH A;  1TEM A;  2ZD8 A;  3LYX A;  2EXA A;  3S7P A;  3OCN A;  4FUW A;  1NXY A;  3UDI A;  2GX5 A;  1HLU P;  4X6T A;  2V20 A;  3A3I A;  4P87 A;  1LSW A;  3ZNT A;  2X02 A;  1S4R A;  4WLA A;  3UDX A;  3S7O A;  3A0R A;  4I3A A;  3MZF A;  5L8M A;  2Y79 A;  4ID4 A;  1OTD A;  3MKE A;  1DJB A;  2ZC4 B;  4EEU A;  1WE4 A;  3ZVW A;  2VEA A;  1SZV A;  5TFQ A;  1VEU B;  3E98 A;  2K2N A;  2JBF A;  5FDH A;  3ZG0 A;  3UPO A;  1XJ3 A;  2V1A A;  3CLO A;  2ZMV A;  2PDR A;  3VOZ A;  3HRE A;  4NXE A;  5FQQ A;  1TDG A;  5L09 A;  3ZG5 A;  1IEM A;  2DNS A;  4OOL A;  5KSC A;  4OQG A;  5U47 A;  1DRM A;  1PNE A;  1CK3 A;  4Q0I A;  2GJ3 A;  4ARZ B;  5IT5 A;  5K5B A;  4JXV A;  3SH8 A;  2HP5 A;  1YMX A;  2XA7 S;  3IF5 A;  5IHV A;  3UNW A;  4N9L A;  1YLY A;  2Y55 A;  2L0W A;  3OPH A;  3PBS A;  1CI8 A;  1NZO A;  3UME A;  4R4S A;  5F69 A;  3TG9 A;  1ES5 A;  3G34 A;  1O07 A;  4WN5 A;  2HJE A;  4BL3 A;  5HPF A;  5GLB A;  4OPY A;  5A8B A;  3OCL A;  1K57 A;  3LO7 A;  1PI4 A;  5F1F A;  1G68 A;  1PRQ A;  4L9E A;  4WMC D;  3EEH A;  3NHQ A;  2W0N A;  1UWP X;  4JF6 A;  1KGE A;  1W8Q A;  5A90 A;  4GHI B;  4N9K A;  5EVI D;  1K54 C;  4GNU A;  1RCJ A;  3NOP C;  3VE3 A;  3R7W B;  1FCN A;  3VSL A;  2WKR A;  1CEF A;  3K3D A;  2XH9 A;  4MCW A;  5J4E A;  4OLD A;  4EQI A;  5HDS A;  4HIA A;  4H8R A;  2QWS A;  4I39 A;  1KE3 A;  3ZG7 B;  3B3X A;  1WYB A;  3UPN A;  3LIC A;  1MXO A;  1XP4 A;  2HJ9 C;  4AFI A;  2ZM0 A;  1XJ4 A;  3G2Y A;  1FR1 A;  3VP3 A;  1N9O A;  1FCO A;  2LB5 A;  3KSI A;  4I5S A;  1BTL A;  2HDS A;  3DWZ A;  4BBU A;  3VSK A;  2A24 A;  3MF0 A;  4D2O A;  4L9G A;  1SKF A;  4GW9 A;  4ZAM A;  5HD5 A;  3VE4 A;  2H0T A;  3TE8 A;  4DDS A;  4P6Z M;  2JKT I;  4DE3 A;  3FV7 A;  4B9O A;  3AGE A;  3LR3 A;  2ZC3 B;  1W5D A;  4ZBE A;  1YAX A;  1IYP A;  3WS5 A;  2IWB A;  1QME A;  3SW1 A;  1MWS A;  3FKW A;  2OV5 A;  2R9W A;  1E3U A;  3W2Z A;  2B18 A;  2W3D A;  4GDN A;  3LGO A;  3BY9 A;  4U0X A;  2L1M A;  4JPM A;  4EW7 A;  2VV6 A;  1P0Z A;  3HLW A;  2VZW A;  1SKO A;  4KZ5 A;  3NBL A;  4CLC E;  2EXB A;  5HWT A;  4MN6 A;  2R9X A;  5FSR A;  1CF0 A;  1UGU A;  3Q81 A;  1JWP A;  5G4Y A;  3MZD A;  2VV7 A;  3P98 A;  4IUH A;  4UEY A;  2J3T D;  4HJ6 A;  1OJG A;  3T1R A;  3Q1F A;  4EQ1 A;  3NIA A;  3KSG A;  5JYP A;  3DW0 A;  1QMF A;  4OPZ A;  3LIE A;  3M6B A;  5IS1 A;  5E2H A;  5AQA A;  3ZCZ A;  1XPB A;  4GCZ A;  5IU1 A;  2XF3 A;  4R6L A;  4HBU A;  3WS4 A;  3CUE C;  4HES A;  1I2S A;  2V0U A;  2M7U A;  1GHM A;  3LI8 A;  5FAT A;  4OLG A;  2BLS A;  3GTC A;  2H5S A;  4B4Z A;  4EUZ A;  5CXW A;  1K6R A;  4NXB A;  2WGW B;  4P6B A;  1KGF A;  5HD3 A;  3D9Y A;  4HH2 A;  4HJ3 A;  1YT4 A;  1S66 L;  4IUK A;  3LEQ A;  5BOH A;  1K4F A;  2WKP A;  3UE0 A;  2EWW A;  3GR2 A;  4LV1 A;  1L3L A;  3E4Q A;  1Q2P A;  1ZC2 A;  2KDK A;  5L2F A;  2WKI A;  3UB7 A;  5F68 A;  5CGW A;  4O8G A;  5HAP A;  3UB8 A;  4JXW A;  2XA7 M;  1H0M A;  2EFU A;  3C5A A;  3MXQ A;  2VA0 A;  3UMD A;  2YKF A;  3R4K A;  4N1H A;  3DTK A;  5FEF A;  4CLC A;  4LPZ A;  3HLE A;  3Q07 A;  3JYI A;  3IX3 A;  1I2W A;  1W8Y A;  3VFH A;  3U4L P;  3Q82 A;  4E6X A;  2PAV P;  2Y2N A;  2ZC6 B;  4RQ9 A;  1Y54 A;  3V3R A;  2Y2I A;  2FZ0 A;  4X68 A;  4UA9 A;  4GS9 B;  3O88 A;  1AXB A;  4KZ3 A;  1HTZ A;  3NY4 A;  5TGF A;  1K0K A;  1L0G A;  3O3V A;  2Z6C A;  4LFU A;  1PZP A;  3MJQ A;  3HCY A;  2P9V A;  3SS3 A;  3AGD A;  1P9W A;  3CHW P;  2ZC7 A;  4XXR A;  1TVF A;  2VLG A;  3NCK A;  2V2F F;  4ETZ A;  4QJG A;  1OTE A;  3UO9 A;  3FWL A;  1FR6 A;  2V8C A;  5DJT A;  4E3M A;  1EWZ A;  1K6S A;  3Q7Z A;  5HZH A;  1PWG A;  2M1C A;  5DKK A;  4PM9 A;  2VKS A;  3CPT A;  1S0W A;  4KZ8 A;  1N9N A;  2GZA A;  3IF6 A;  1K55 C;  1S67 L;  5EEC A;  1RGY A;  3LIB A;  2WGI A;  4MN5 A;  5CRF A;  1TDL A;  3B33 A;  3D4F A;  4M3K A;  1XGJ A;  2XGN A;  4EER A;  2PD8 A;  2B02 A;  1FIL A;  3MXS A;  5F5Y A;  2PT7 A;  3PBQ A;  3FPV A;  4BWI A;  4QY5 A;  3H82 B;  3DTM A;  3IH9 A;  1SCW A;  2R78 A;  2XSS A;  4HBT A;  2JKR M;  1K56 A;  5E43 A;  3RH8 B;  1WYC A;  1BLC A;  4JKT A;  3BFD A;  4JBF A;  3LEZ A;  4KQO A;  3NDE A;  3FKV A;  3UPP A;  1IKI A;  1H8Y A;  2A2L A;  1W7F A;  4WEJ A;  3EOI A;  1H8Z A;  3HLC A;  4LLO B;  4HI4 A;  4LV3 A;  3GVB A;  5I5L A;  1OTI A;  4PM8 A;  4DMZ A;  2UV0 E;  1LHY A;  2V1Z A;  2O0Y A;  2ZQ9 A;  5CED A;  4C6Y A;  4WF0 A;  4Q8I A;  4PKY A;  2NUT C;  2ZM2 A;  4LCL A;  3OOV A;  2WYX A;  2B95 A;  3RFB A;  2GNX A;  1DP8 A;  4FH2 A;  1N4O A;  4BEN A;  5EM1 A;  4KEN B;  4R4R A;  1XA1 A;  2HPB A;  2W27 A;  3CWF A;  3PHY A;  2XRN A;  2WKE A;  1LL5 A;  2L4R A;  1VB6 A;  2EWV A;  2K31 A;  4P6Z S;  2IWC A;  3LUQ A;  1HD8 A;  1NZU A;  4F94 A;  1Y4O A;  3IXD A;  1GHI A;  3B47 A;  1XFQ A;  2BG1 A;  4EV4 A;  1TS6 A;  3IWI A;  3QNB A;  3IX8 A;  4EXO A;  3ZG8 B;  4K0W A;  4IJG A;  2XD5 A;  4WL9 A;  2HP9 A;  5GLC A;  3WWX A;  1T19 A;  3A3E A;  2WZX A;  2INW A;  4MMN A;  4KQR A;  3PBO A;  1MKI A;  3HUO A;  3CZD A;  4WEK A;  4KZB A;  2M7V A;  1NY0 A;  1S1Y A;  1YLP A;  2XFS A;  3GMW A;  5F83 A;  4HH3 A;  5KZH A;  3UY6 A;  5M1A A;  1JWV A;  2DRW A;  4GLQ A;  4O01 A;  1YSP A;  3MFX A;  1ZG4 A;  1GA0 A;  1MWT A;  4FCF A;  3HLG A;  3EEA A;  1O7E A;  4PPR A;  4R3B A;  3F1N A;  4WBG A;  1UWN X;  4WUJ A;  4CQH A;  3SZT A;  2WKQ A;  3HJI A;  1RP5 A;  3O5Y A;  4OPQ A;  4ZRR A;  1MWU A;  3HLD A;  1KGG A;  5EVI C;  3E2L A;  2CC1 A;  3KYE A;  4WYY A;  4Q0H A;  5TR7 A;  2QHK A;  3QP5 A;  1BYW A;  2W3G A;  4KZ4 A;  3AGF A; 
#chains in the Genus database with same CATH homology
 1PIO A;  1C3B A;  4E3J A;  4ZBE A;  1IYP A;  5G18 A;  4JLF A;  2GDN A;  1ES2 A;  3WS5 A;  2IWB A;  3VP2 A;  1QME A;  5AQB A;  1BUE A;  1MWS A;  2Y4A A;  2EFX A;  3FKW A;  2OV5 A;  4Y7P A;  2R9W A;  3EQU A;  1E3U A;  3HLF A;  1ZG6 A;  1VQQ A;  1W79 A;  2QZ6 A;  1IKG A;  4GDN A;  4C3Q A;  2P74 A;  4U0X A;  4WEL A;  4OKP A;  4KG6 A;  3VMA A;  5A92 A;  1KVM A;  4JPM A;  4RX3 A;  4BJP A;  2Q9N A;  1S6R A;  5D3O A;  4GD6 A;  5FAQ A;  5GHY A;  4E3O A;  4E3L A;  3HLW A;  2Y2J A;  4KZ5 A;  5FI2 A;  1JWZ A;  3NBL A;  1J9M A;  2ZJ9 A;  3VFF A;  3UE3 A;  4ZJ3 A;  2EXB A;  4R3J A;  2J8Y A;  1VM1 A;  2R9X A;  5FSR A;  1HZO A;  3Q81 A;  1JWP A;  1SDE A;  5FQI A;  4E6W A;  3HLB A;  3MZD A;  1ESU A;  4BQM A;  2FFY A;  3P98 A;  4KZ9 A;  1BT5 A;  3GRJ A;  1K54 A;  3BEB A;  3OC2 A;  1JTD A;  3Q1F A;  4OOY A;  3Q7V B;  3NIA A;  4GDB A;  1CI9 A;  3ZNY A;  1M6K A;  5JYP A;  2ZMA A;  3DW0 A;  4YFM A;  1QMF A;  2HDQ A;  3CJM A;  5M19 A;  5GHZ A;  1XA7 A;  4OPZ A;  2Y2H A;  3GSG A;  3M6B A;  4BLM A;  5E2E A;  2ZQD A;  3UDF A;  5E2H A;  5AQA A;  4A5R A;  4DE0 A;  1MWR A;  1XGI A;  3ZHH A;  3ZCZ A;  1XPB A;  2DCF A;  2XF3 A;  3V39 A;  1MPL A;  4HBU A;  3WS4 A;  3E2K A;  5DTT A;  1ESI A;  5KSH A;  2E8I A;  3GV9 A;  2Y59 A;  1Q2Q A;  4LCM A;  4HES A;  1I2S A;  2JC7 A;  2Y2P A;  1GHM A;  4Z9Q A;  5CER A;  3TOI A;  4XUZ A;  5FAT A;  3W8K A;  4PM6 A;  4OLG A;  3OPL A;  5EOE A;  2BLS A;  3IHB A;  4WMC A;  3IWO A;  5EPH A;  3GTC A;  4S2O A;  4MBH A;  5F82 A;  5DTK A;  1PW1 A;  4ZJ2 A;  3WS0 A;  4IED A;  2H5S A;  2J7V A;  3IXH A;  2ZLY A;  4B4Z A;  4JF5 A;  1ERM A;  4EUZ A;  2A3U A;  5CXW A;  2WUQ A;  3LCE A;  1DJA A;  1G6A A;  1FSY A;  1K6R A;  4KQQ A;  3ZVT A;  1M40 A;  5EVI A;  2WGW B;  4P6B A;  4U0T A;  5FI7 A;  4KG2 A;  5GLA A;  1Z6F A;  1KGF A;  3W4O A;  4OPR A;  2ZQ7 A;  3AGE A;  2XD1 A;  4P0M A;  1ERQ A;  2J9P A;  4BD1 A;  4E3N A;  2WAD A;  4NK3 A;  4MNR A;  3ZFZ A;  5EOO A;  1PWD A;  1YT4 A;  2I72 A;  4DXB A;  1FCM A;  4R0Q A;  2EX2 A;  1L0E A;  4DE1 A;  5BOH A;  2HDU A;  4DDY A;  1LI9 A;  5CTN A;  2Y91 A;  1K56 D;  5CHM A;  1K4F A;  3UE0 A;  3NI9 A;  3OPR A;  3ITA A;  5JYO A;  4S2J A;  1MY8 A;  4UA7 A;  3V5M A;  3GR2 A;  2C6W B;  4LEN A;  3ZG9 B;  4LV1 A;  3S4X A;  2OLU A;  4S2L A;  1Q2P A;  5DF9 A;  1ZC2 A;  3IF6 C;  3BLS A;  3N8S A;  1MBL A;  1BSG A;  4GN2 A;  5L2F A;  2PBY A;  2Z2L B;  3G32 A;  4NET A;  2UWX A;  1XKZ A;  2WKI A;  5EVL A;  2ZQA A;  1FQG A;  4IBR A;  1JVJ A;  4OQI A;  4X53 A;  4Y0O A;  5CGW A;  5HAR A;  2Y2O A;  1NYM A;  5HAP A;  4QHC A;  5HL1 A;  4JXW A;  2EX6 A;  2RCX A;  1DJC A;  4C75 A;  3IHA A;  2XQZ A;  1K4E A;  3WS1 A;  2EFU A;  4KZ6 A;  3CG5 A;  4FD8 A;  5FAO A;  4GB7 A;  4EBP A;  4ZJ1 A;  3BFF A;  5HX9 A;  5FAP A;  5A91 A;  4R1G A;  4IVK A;  3C5A A;  2WZZ A;  3ZDJ A;  1E25 A;  1NRF A;  3V50 A;  5EE8 A;  4N1H A;  1PWC A;  2XFT A;  1L0F A;  1HVB A;  2Y2K A;  2ZQC A;  3TSG A;  3WRT A;  1KDS A;  2ZQ8 A;  5CHJ A;  4QY6 A;  4IVI A;  3HLE A;  4UA6 A;  3G30 A;  4S2P A;  4RVA A;  5CGX A;  4E3K A;  4R23 A;  2PU2 A;  3FZC A;  4KZ7 A;  2Y2L A;  4KZA A;  4UAA A;  3HL9 A;  3JYI A;  3Q07 A;  4GZB A;  4RA7 A;  5DTS A;  2ZC5 B;  3M2J A;  5AQ7 A;  2Y2G A;  1I2W A;  3G4P A;  4WM9 A;  1W8Y A;  3BYD A;  3VFH A;  1KVL A;  5FAS A;  5GHX A;  4OP5 A;  3Q82 A;  1ES3 A;  3CMZ A;  4E6X A;  2Y2N A;  1PW8 A;  4XUX A;  2QPN A;  2ZC6 B;  3SH7 A;  1KDW A;  2Z2M B;  1Y54 A;  5FQK A;  3SS4 A;  1KE4 A;  2Y2I A;  4IBX A;  4MBF A;  3V3R A;  4X68 A;  1LLB A;  4B88 A;  4UA9 A;  1L0D A;  4PM5 A;  4GOG A;  3O88 A;  2Y2Q A;  3GQZ A;  5EVI B;  4MEZ A;  4YIN A;  1AXB A;  2JE5 A;  4KZ3 A;  1E4D A;  1HTZ A;  4X69 A;  3NY4 A;  3V3S A;  4DF6 A;  5TGF A;  5EUA A;  1NYY A;  3VP1 A;  1PYY A;  1L0G A;  3O3V A;  3MFD A;  3G31 A;  2XDM A;  3N8R A;  3G2Z A;  1U60 A;  1PZP A;  4RX2 A;  3VP4 A;  3IWQ A;  4WZ4 A;  1XX2 A;  4X55 A;  2WKH A;  4JF4 A;  2P9V A;  4N1X A;  5FQM A;  3AGD A;  4XXR A;  3SS3 A;  2ZC7 A;  4KG5 A;  1TVF A;  3C7V A;  3NCK A;  2V2F F;  3N4I A;  4QJG A;  3I7J A;  1FOF A;  3PBR A;  3UO9 A;  3FWL A;  1FR6 A;  4E3M A;  1EWZ A;  1PZO A;  3SS5 A;  1K6S A;  1YLJ A;  3BEC A;  3IXG A;  3ITB A;  1BUL A;  3Q7Z A;  1PWG A;  4OON A;  3RXX A;  4DE2 A;  5FQJ A;  4S2N C;  1SDN A;  4S2M A;  3W4P A;  2J9O A;  2PU4 A;  2ZM8 A;  3A3D A;  4PM9 A;  4Y0U A;  3PAG A;  4E3I A;  4WZ5 A;  5M18 A;  1NJ4 A;  3MXR A;  1S0W A;  4KZ8 A;  4PM7 A;  3IF6 A;  1K55 C;  1RGZ A;  2A49 A;  3WRZ A;  1ONG A;  5EEC A;  5CHU A;  2H0Y A;  1RGY A;  3LY4 A;  2XK1 A;  3A3F A;  4S2K A;  2WGI A;  5HAI A;  3ZGA B;  1BLH A;  1TEM A;  1TDL A;  3DWK A;  5CRF A;  4EBN A;  3D4F A;  4M3K A;  1XGJ A;  2XGN A;  1BZA A;  3BLM A;  4FSF A;  1YLZ A;  2ZD8 A;  2OSU A;  4K0X A;  4ZTK A;  2VGK A;  1ALQ A;  2WK0 A;  2XLN A;  4O7D A;  2EXA A;  3MXS A;  3PBQ A;  3OCN A;  3BFG A;  1NXY A;  2FFF B;  4QY5 A;  3UDI A;  4L0L A;  4GD8 A;  1K57 C;  4X6T A;  2V20 A;  3DTM A;  3QHY A;  3A3I A;  3IH9 A;  4P87 A;  1SCW A;  1IYO A;  4HBT A;  1K56 A;  3O87 A;  2OLV A;  1EI5 A;  5E43 A;  4DXC A;  5DF8 A;  5HAQ A;  3FYZ A;  1WYC A;  1BLC A;  4JKT A;  4CPK A;  3BFD A;  3PBT A;  4JBF A;  4OVD A;  3ZNT A;  2X02 A;  3LEZ A;  4P85 A;  3VP0 A;  4KQO A;  4Y0T A;  3UDX A;  3NDE A;  3FKV A;  3UPP A;  3HVF A;  1IKI A;  3MZF A;  4BD0 A;  1H8Y A;  4ID4 A;  1W7F A;  3MKE A;  1DJB A;  3C4P A;  4WEJ A;  4ZDX A;  2ZC4 B;  1WE4 A;  4X56 A;  1YLT A;  3ZVW A;  3UN7 A;  1H8Z A;  3HLC A;  4N92 A;  1OME A;  4OP8 A;  4PMA A;  5TFQ A;  3OPP A;  4LV3 A;  2IWD A;  3GVB A;  1ZKJ A;  3MKF A;  3W4Q A;  4PM8 A;  3BFC A;  1LHY A;  2V1Z A;  1GHP A;  2G2W A;  2ZQ9 A;  3IXB A;  3RJU A;  5F1G A;  5CED A;  5CGS A;  4C6Y A;  2X71 A;  3G35 A;  2JBF A;  5FDH A;  3ZG0 A;  3UPO A;  3BFE A;  4EWF A;  3VOZ A;  1I5Q A;  3MZE A;  3HRE A;  1YM1 A;  3SH9 A;  2P9V B;  4Q8I A;  1E3U D;  2ZM2 A;  4LCL A;  3C4O A;  3MBZ A;  1L2S A;  4JXS A;  2WYX A;  1YQS A;  5FQQ A;  1ONH A;  4QD4 A;  1TDG A;  3SOI A;  4FH2 A;  1N4O A;  3ZG5 A;  4BEN A;  1IEM A;  3S22 A;  2DNS A;  4KEN B;  4OOL A;  4R4R A;  2HP6 A;  1XA1 A;  3O86 A;  5KSC A;  4OQG A;  5U47 A;  1SHV A;  1XXM A;  1CK3 A;  2HPB A;  1YMS A;  2JCH A;  3HBR A;  3P09 A;  3OZH A;  2WKE A;  1LL5 A;  4S2N A;  1IYQ A;  4RYE A;  4JXV A;  3IF6 B;  3SH8 A;  2HP5 A;  2XR0 A;  3QNC A;  3M6H A;  1YLW A;  1YMX A;  4OOM A;  2C5W B;  2IWC A;  3IF5 A;  5IHV A;  3UNW A;  3EQV A;  4MBK A;  4N9L A;  3S1Y A;  3ISG A;  1YLY A;  1K55 A;  1HD8 A;  5CEB A;  2Y55 A;  1NZU A;  1K38 A;  3OPH A;  1H5X A;  5DF7 A;  4F94 A;  3PBS A;  2B5R A;  3IXD A;  2RL3 A;  1CI8 A;  1GHI A;  1NZO A;  2Y2M A;  3NC8 A;  5E2G A;  4JXG A;  3IT9 A;  2BG1 A;  4R4S A;  4EV4 A;  3IWI A;  2VGJ A;  4QU3 A;  5A93 A;  3QNB A;  3TG9 A;  1ES5 A;  3G34 A;  1O07 A;  4MLL A;  4OQ0 A;  4UHU A;  3ZG8 B;  2H10 A;  3PBN A;  4BL3 A;  5GLB A;  4OH0 A;  4K0W A;  4OPY A;  3IH8 A;  5FQ9 A;  2XD5 A;  2HP9 A;  3OCL A;  2X01 A;  1IEL A;  1K57 A;  3LY3 A;  5GLC A;  3RXW A;  3WWX A;  2XEP A;  3LO7 A;  1PI4 A;  2Q9M A;  5F1F A;  1G68 A;  1GA9 A;  3A3E A;  1FSW A;  5AQ9 A;  3BM6 A;  1BLS A;  4WMC D;  3PTE A;  5HFO A;  4CJN A;  2WZX A;  2WGV A;  4KQR A;  4FH4 A;  3PBO A;  4OQH A;  1MKI A;  5J8X A;  3N8L A;  3HUO A;  3CZD A;  1CEG A;  4WEK A;  4JF6 A;  1IYS A;  4KZB A;  1KGE A;  1W8Q A;  1NY0 A;  5A90 A;  3N7W A;  4LV2 A;  3BRM A;  4N9K A;  4QB8 A;  1YLP A;  2XFS A;  5EVI D;  1K54 C;  3HUN A;  3HUM A;  3GMW A;  3PAE A;  4GNU A;  5F83 A;  1JTG A;  1RCJ A;  5KZH A;  3UY6 A;  5M1A A;  3N6I A;  1KE0 A;  1FCN A;  3VSL A;  5GLD A;  1JWV A;  1CEF A;  1LL9 A;  3A3J A;  2XH9 A;  2DRW A;  4OLD A;  3Q7V A;  4EQI A;  1ZG4 A;  4H8R A;  1GA0 A;  1MWT A;  4FCF A;  1ES4 A;  1KE3 A;  3HLG A;  3ZG7 B;  5I94 A;  1O7E A;  2QMI A;  3B3X A;  4PPR A;  1WYB A;  1BLP A;  4R3B A;  5FA7 A;  4GKU A;  3UPN A;  1MXO A;  3IQA A;  1XP4 A;  4WBG A;  2ZM0 A;  4S2I A;  3G2Y A;  1FR1 A;  1ERO A;  5CTM A;  3NDG A;  1GCE A;  1RP5 A;  3VP3 A;  1N9B A;  4OPQ A;  4WZ5 C;  1FCO A;  2G2U A;  1MWU A;  3HLD A;  1KGG A;  3M2K A;  5FI6 A;  5HW3 A;  1K25 A;  1BTL A;  2HDS A;  3DWZ A;  5EVI C;  4BL2 A;  2EX9 A;  3E2L A;  4DRT A;  3VSK A;  2CC1 A;  2WAE A;  3C7U A;  5E2F A;  5KMW A;  4WYY A;  4B4X A;  4D2O A;  2WAF A;  1SKF A;  4ZAM A;  4U3T A;  5TR7 A;  3VOY A;  2H0T A;  2WGW A;  3WS2 A;  4DDS A;  5CEC A;  1PI5 A;  4LV0 A;  4HEF A;  2HDR A;  1DY6 A;  4KZ4 A;  1LI0 A;  5DVA A;  3UE1 A;  3AGF A;  4DE3 A;  3FV7 A;  4EBL A;  2EX8 A;  4DKI A;  4K91 A;  2ZC3 B;  1W5D A;  5GL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...