2Z6DA

Crystal structure of lov1 domain of phototropin2 from arabidopsis thaliana
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
118
structure length
118
Chain Sequence
b'ELKTALSTLQQTFVVSDATQPHCPIVYASSGFFTMTGYSSKEIVGRNCRFLQGPDTDKNEVAKIRDCVKNGKSYCGRLLNYKKDGTPFWNLLTVTPIKDDQGNTIKFIGMQVEVSKYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phototropin-2
publication title Structural basis of the LOV1 dimerization of Arabidopsis phototropins 1 and 2
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 37
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2z6dA00
4F3LB 2KDKA 2K7SA 3MQOA 4I39A 3F1OA 5HSQA 3HJIA 4H6JA 2YKHA 4HJ6A 1XJ2A 2PYRA 2OWHA 2QJ5A 3K3DA 2P7JA 2ZBBA 4F3LA 4PKYA 5IU1A 5HDCA 2KX6A 1LT0A 1XJ4A 1OTAA 4HOIA 3ZQ5A 2V0UA 1V9ZA 3NOPC 3T50A 3BWLA 3PHYA 3LIAA 1T1CA 5HDDA 3FC7A 5DJTA 3H82B 4EEUA 4HP4A 4EQ1A 2D02A 2D01A 3EWKA 2WKPA 1TS8A 3NJAA 4EW7A 3MXQA 4R70A 3E4QA 4HH3A 4HH2A 4MN5A 2M1CA 1TS7A 4I3AA 2OOLA 1ODVA 5G4ZA 3LI8A 3H82A 3NOUC 3RTYA 4PKYG 3G6OA 3F1NB 4HHDA 2WKRA 1OTIA 1T18A 3VE4A 2WKQA 3P7NA 5HWVA 3E4OA 4HI4A 4EESA 2L1MA 1N9LA 1OT9A 1OJ5A 3E4PA 1LSXA 3OLOA 1KOUA 3F1NA 2QJ7A 3LIFA 5TBMB 4HP9A 1TS6A 3EEHA 5HDSA 4HJ4A 2INWA 1UWPX 2PD8A 2B02A 4RQ9A 3MQQA 2QHKA 4R3AA 1TS0A 1UWNX 5J7EA 2OWJA 3LIEA 5F69A 4L9GA 4LRYC 5TBMA 3RH8B 4DJ2A 2VEAA 1OJGA 3C8CA 2L0WA 1DRMA 4I3JA 4BBUA 2PDRA 1Y28A 3B33A 4BBTA 2H28A 5J4EA 5DKLA 4XT2B 5F68A 2GJ3A 1N9OA 2V1AA 5AVFA 4NXEA 1NWZA 3CAXA 2HV1A 4KUOA 1UGUA 2ZOIA 4L9EA 4YWZA 1GSXA 3UMEA 1V9YA 4BBVA 1D06A 4GCZA 4XT2A 1LSWA 5J3WA 5I5LA 4I38A 4NXFA 2JN7A 1MZUA 2Z6CA 1T1BA 2VLGA 3LYXA 2JHEA 1XFNA 2W27A 3VOLA 3UB6A 3IS2B 2A24B 2ZOHA 1DP8A 3CLOA 1S67L 2VV8A 4I3IA 5HD3A 2CMNA 4LPZA 1XJ3A 3SW1A 4EEPA 5EFWA 4HNBA 4HIAA 3IS2A 1VB6A 3UB7A 3MR0A 3MFXA 1XJ6A 2A24A 3LI9A 1EW0A 1OTEA 4K08A 3MJQA 4EXOA 4EETB 1XFQA 3UB8A 3BY8A 3LIDA 5DKKA 4B9OA 1BYWA 3F1PB 2Z6DA 3C2WA 4JGRA 2VV6A 1F9IA 2V0WA 1X0OA 3D72A 2I9VA 4R38A 5DJUA 3LIBA 4HY8A 4R6LA 4LRXC 1LL8A 5F5YA 3VE3A 3F1PA 4HJ3A 2PR6A 4WF0A 2EA9A 2PR5A 3KX0X 5IS1A 3IBRA 1G28A 5HWWA 4NXBA 4I5SA 1T1AA 4EERA 2QWSA 4KUKA 1GSVA 3LICA 3ULFA 4M4XA 2QKPA 4GHIB 4WUJA 3UE6A 1OTDA 1DP9A 3NHQA 5F6AA 2V1BA 4L9FA 4WLAA 1S66L 3H9WA 1WA9A 3NOTC 4GHIA 4MN6A 1F98A 3FG8A 4DJ3A 5AVEA 4GW9A 2VV7A 1P0ZA 3GDIA 2W0NA 5KIZA 2L4RA 4NXGA 5HZHA 1T19A 4GS9B 3PYPA 4JGQA 4E04A 2R78A 3CWFA 2YKFA 4JGPA 3A0VA 4LLOB 4GS9A 3UMDA 1DP6A 3A0SA 2J80A 3UB9A 4WN5A 1S1ZA 1OT6A 5A8BA 3K3CA 2PD7A 1LSVA 3HJKA 1JNUA 1S4RA 1S1YA 4KQDA 3A0RA 2PHYA 3H7WB 1OTBA 4LRZE 1D7EA 3BY9A 4WL9A 5G4YA 2PYPA 4HQAA 2BASA 3F1OB 1P97A 4H6JB 1N9NA 1GSWA 2V9AA 3LUQA 1S4SA 4JGOA 3H7WA 5HWTA 5HD5A 3GECA 3ICYA
chains in the Genus database with same CATH superfamily
2Y2HA 4OQHA 2J8YA 1FSWA 4BD0A 4FCFA 2K7SA 5GHZA 3FWLA 4DKIA 4XUZA 5CTMA 2XR0A 1XJ2A 3MZEA 2ACGA 4E3JA 5TJJA 2K2NA 3K3DA 2P7JA 3VP0A 5DTSA 1LLBA 3IF5A 3MFDA 1LT0A 2I72A 3WRTA 4OQGA 2VJWA 1ACFA 3PBOA 3BWLA 1JTGA 5CGSA 5M1AA 3H82B 4EQ1A 2C5WB 3S7QA 4Y2FA 3LY4A 5D3OA 5LBRA 4OP8A 2WKPA 3E4QA 2HGVA 4IBRA 4U0TA 2FH5A 3CPTA 1MKIA 1TS7A 3T1RA 1W5DA 1SHVA 1CQAA 3PAEA 1M6KA 3H82A 3NOUC 1NYYA 1XGIA 4MMNA 4DRTA 3HL9A 3PBTA 4LV3A 2WKRA 4X1LA 3NDGA 4P6ZS 5DF7A 1YMSA 4BMWA 3RXXA 3SS3A 3OLOA 1WYCA 1KOUA 5GLAA 1TS6A 2HJEA 3LR0A 5EVEA 5HL1A 4IUHA 3BQ8A 2E8IA 4RQ9A 3MQQA 4JKTA 1MWRA 1TS0A 1UWNX 3KYZA 2Z2MB 3S7PA 1LHYA 5A90A 1YSPA 5L10A 2GNXA 1Y54A 3FZCA 2Y79A 3PXPA 2WUQA 1OJGA 4CLCD 1BLPA 2Y2IA 1DRMA 5HW3A 1NLYA 4BBUA 2OAP1 1Y28A 1NZOA 1YSQA 1NY0A 5C5KA 3UDXA 3B33A 1W63M 4S2IA 5J4EA 5DKLA 5L8MA 2R9XA 5E2EA 3VV4A 1K54A 1ZTUA 1KE4A 3JVUA 5AVFA 4UAAA 1YT4A 2H5SA 2HV1A 2W3HA 3MKFA 4YWZA 3V39A 1H5XA 4BL2A 1MWUA 4Z1WA 1DJCA 3M6HA 2OSUA 1YLZA 4IBXA 3ZFZA 1HZOA 2XH9A 4C75A 1Q2PA 2HP9A 1LL5A 4N92A 2Y2MA 4ID4A 4R3BA 2O9CA 1BLHA 4OVDA 3UDIA 2XA7S 3VOLA 4HEFA 4S2MA 3SH7A 1NJ4A 3ZDJA 2B18A 3CITA 3IT9A 5BOHA 3TRCA 3ITBA 3N4IA 1KVLA 4Y17A 3Q7VB 2A24B 4S2NA 2HP5A 4DE2A 4EBPA 3GR2A 2VV8A 4I3IA 5HD3A 1MBLA 4EEPA 3IXGA 3VP4A 2EFUA 1K38A 4HIAA 3UB7A 3Q1FA 3MR0A 3Q7VA 3U4LP 3G2YA 2A24A 3DTMA 2VKSA 4BLMA 5AQ7A 1KGGA 1FOFA 3HUNA 2ZQAA 4EETB 5CHUA 2JKRM 3VP3A 3BY8A 4ZTKA 3KO6A 3LR4A 3LIDA 5DKKA 4KZ7A 5FQQA 1BLCA 2Z6DA 4WM9A 4JGRA 4N9LA 4R0QA 3UB5P 4QHCA 2V0WA 1JWVA 2EWVA 1SCWA 3GVBA 4KZAA 3JYIA 2LB9A 2ZD8A 3LIBA 4R6LA 5L2FA 5E2HA 5FAPA 5DTTA 4HJ3A 1A0KA 4WF0A 5IS1A 5I94A 2HDRA 4WMCD 2WYXA 3G34A 1G28A 2RL3A 5HWWA 4I5SA 1RGZA 1PZPA 3VOYA 4OP5A 2J3WA 3NULA 5MC7A 3W8KA 5EVIA 3KYQA 4DE3A 4R3JA 3DWZA 1Z6FA 5FI7A 4WUJA 3KYEA 1JWPA 2XFSA 3C5AA 1OTDA 3KSHA 3QHYA 5CTNA 3LCEA 3NHQA 4KZ8A 1JWZA 2G2UA 4OPZA 3OCNA 3BFCA 1IEMA 4QWOA 3H9WA 3IBJA 4C6YA 1WA9A 4GKUA 2HF6A 4UQIS 3V67A 4GJ4A 5J8XA 5AQAA 3PBRA 1K6RA 2Y2GA 1PFLA 3MKEA 4MN7A 3EQVA 1MWSA 1STZA 4PHTA 1PWCA 4CLCE 1SKFA 4OONA 4JGPA 2FZ0A 4NEED 5FQMA 3IWQA 2W3DA 4E6WA 1WYBA 1QMFA 4KZ9A 2WKEA 4MLLA 1E3UD 3AGFA 4OPYA 3QP2A 4NK3A 1VQQA 1DP6A 3A0SA 2J80A 1IYPA 1OT6A 1G6OA 1ZKJA 4ZDXA 1LSVA 1PZOA 2QYBA 3H7WB 1OTBA 5F1FA 5FQ9A 2WADA 2K31A 1ZG4A 4S2PA 1H8ZA 2BASA 3CZDA 3F1OB 4RX2A 1K57A 2W3FA 1W79A 2Y2PA 3PBNA 3KSIA 5EOOA 3CUEA 2V9AA 1BSGA 5FQIA 3LUQA 3LFVA 1S4SA 5FAOA 2V20A 3H7WA 1FQGA 5HD5A 2JC7A 4F3LB 2KDKA 3C7UA 3ZNTA 3F1OA 3T4OA 2OLVA 3Q81A 3FKVA 4OQ0A 2PYRA 5DVAA 2QJ5A 4YINA 2QMIA 5GLDA 4RYEA 1J3WA 2ZBBA 3DAVA 4F3LA 2WK0A 4PKYA 3HUMA 1DJAA 1G5UA 3BECA 3ISGA 4JXSA 2KX6A 4WYYA 1XJ4A 1OTAA 4L0LA 5GHXA 4D2OA 4OOYA 3EQUA 3BFEA 4JBFA 3PR6A 3T50A 3LIAA 5KSCA 3BW6A 4OLDA 3FC7A 3FV7A 2IA2A 2ZQ8A 4DN0A 1I2WA 2D01A 4X25A 1G68A 1ES5A 4EWFA 5E2FA 4R70A 3KSGA 4HH3A 1SDEA 3E98A 2HPBA 3E2LA 3VOZA 4JXGA 2XSSA 5KSHA 3LI8A 3VMAA 1NRJA 5F1GA 4PKYG 5HAQA 1F2KA 5CHJA 3UPPA 2WKQA 2WGVA 1VETB 2JBFA 3P7NA 2J7VA 3E4OA 5GLCA 3W4QA 4P85A 1NYMA 1MWTA 3WS1A 2G7UA 1K4EA 2ZM0A 1E25A 1ONHA 2ZL1B 4DDSA 3ZG9B 2B5RA 4LV2A 3LIFA 1YLWA 3OPRA 3AGDA 1KDWA 1VETA 2J3TD 2INWA 1UWPX 1J9MA 1AWIA 4WBGA 2B02A 5FAQA 5J7EA 1W8QA 2ZL1A 4DE0A 4FUWA 4X53A 2VGJA 3CG5A 4KQQA 5F69A 4L9GA 3RH8B 3Q07A 4Y5FA 4QJGA 2ZC4B 5FQKA 2C6WB 3BFGA 1OMEA 4BWIA 5FDHA 2H10A 4DE1A 2PDRA 3WS4A 4UHUA 4II7A 2JKTI 3IXHA 5EUAA 4KZBA 4O7DA 3RJUA 4CLCB 2DNSA 2ZLYA 4XT2B 4KZ3A 3WS2A 3V50A 3A3EA 1LI0A 3TJZC 4KQOA 2X71A 1XKZA 1GSXA 3MZFA 3QP6A 3VP2A 4CLCA 4S2KA 3VFHA 4XT2A 1LSWA 4I38A 1L0FA 1K6SA 4HBUA 3Q82A 2XK1A 3MXSA 1XA1A 4X55A 2ZMFA 1PWDA 3V5MA 3LYXA 2JHEA 5KMWA 3BYDA 1N4OA 3SH8A 3B47A 2XD1A 2Q0OA 4OPRA 2EWWA 4NKPA 3FPVA 1W7FA 5FQJA 1S67L 4CPKA 4PMAA 5EFWA 3T1XA 1YLPA 2KOIA 3LY3A 4E6XA 4JLFA 4RA7A 4BQMA 3UE3A 3MFXA 1W63Q 4EBNA 4LENA 2DCFA 2XDMA 1EW0A 3MJQA 4OPQA 2XROA 3S22A 1YLJA 3HLDA 4BL3A 4B9OA 3JVVA 1D1JA 4QPRA 1BYWA 4S2OA 3TW8A 3SOIA 3LEQA 3OC2A 1ALQA 3SH9A 2VGKA 4O0PA 1X0OA 3D72A 1YAXA 2I9VA 5DJUA 4LRXC 2V8FA 2VZWA 4Z9QA 4X1MA 2UV0E 3SS5A 2PR6A 3O5YA 2PR5A 3S7OA 2EX2A 3DWKA 1WE4A 3D9YA 5U47A 2P9VB 5IT5A 3SS4A 1FR6A 3BFFA 5FL3A 2QWSA 4KUKA 2Y2OA 2EX6A 2ZQ9A 3LICA 3FPWA 3HVFA 4JF6A 2MJ6A 1IOUA 1GCEA 2R9WA 5FSRA 3O3VA 5HARA 4O01A 3QP1A 1DP9A 1YMXA 2WKHA 5TGFA 4U0XA 2RCXA 3NECA 3IHBA 4WMCA 4WLAA 4IVKA 4MN6A 2IWCA 1CF0A 3UE1A 4ETZA 2FFFB 3FG8A 4KZ4A 4UEYA 3MBZA 3G32A 2WZZA 1PW8A 2W0NA 2L4RA 4NXGA 3EGDC 2OV5A 3PYPA 3IF6B 3BLMA 2EFXA 3MXRA 1IFQA 2R78A 4WZ4A 2YKFA 3T4JA 4NETA 3A0VA 3IX4A 4GLQA 4LLOB 4X56A 3W2ZA 1Q2QA 2ZC6B 5HPFA 2JCHA 3QNCA 3UN7A 4DXBA 4OOLA 1S1ZA 4X6TA 5HPIA 3K3CA 3PBSA 3P09A 4WELA 1JNUA 4PM9A 1FILA 1LL9A 1S1YA 4OOMA 5F82A 4KQDA 3A0RA 1ES4A 1PIOA 3MZDA 4LRZE 4HBTA 3OPPA 1GHMA 5EV0A 1TVFA 3HLFA 5G4YA 1YM1A 5FATA 2H0TA 1CEGA 4H6JB 3CMZA 4MCWA 2DMWA 1N9NA 4PM6A 4WZ5A 1GSWA 5EECA 3WWXA 4IEDA 1W8YA 1BLSA 3N8LA 3DBAA 1N9BA 2Y2KA 4WEKA 1TF1A 2HDSA 3ICYA 5GHYA 4KENB 5HSQA 3HJIA 4H6JA 2YKHA 2PAVP 4E3MA 4HJ6A 1MPLA 3HLBA 4QY5A 3HCYA 5CXWA 3UO9A 5HX9A 5FA7A 5CECA 3FKWA 1AXBA 4MDZA 3GRJA 2WKIA 1K55A 5IU1A 5HDCA 5FEFA 2JKTM 4HOIA 4OQIA 4PAUA 2V0UA 1V9ZA 2IWDA 2W1TB 3NOPC 1RGYA 1QMEA 3PHYA 4Q0JA 4EEUA 4HP4A 3LR5A 5HAPA 2P74A 3T4SA 2XD5A 1TS8A 1O7EA 1K54C 1E4DA 1ZC2A 3GSGA 2HJ9C 2VGLS 4Q0HA 4MN5A 1S0WA 2ZC3B 4Y0TA 1MXOA 3D4FA 2OOLA 5G4ZA 3C4PA 4DDYA 4MEZA 2JE5A 3N6IA 3DTIA 3WRZA 3NCKA 2FFYA 4Y7PA 3QP5A 5DFYA 3VE4A 5GLBA 1JTDA 5HWVA 5CX7A 2L1MA 1N9LA 3HREA 4S2JA 2EXAA 1OJ5A 3GV9A 3E4PA 2PU4A 1XGJA 5TBMB 4HP9A 4GNUA 4AFIA 5DTKA 5CGXA 5HDSA 4HJ4A 1PI4A 2NUPC 4FTXA 2PD8A 2EXBA 3K2NA 3BJNA 3W4OA 2QHKA 2W3EA 4R3AA 4S2NC 3V3SA 1OPXA 3HLEA 1CEFA 1FIKA 5HAIA 2BTFP 1P9RA 5L09A 5TBMA 1Y4OA 4DJ2A 3C8CA 2J9PA 3HUOA 3LO7A 3RFBA 4I3JA 1K56D 2EX9A 3WS5A 1IELA 1O07A 4N9KA 3V3RA 2J9OA 1DY6A 1YPRA 3T4KA 3T1QB 4JXVA 4OKPA 1LI9A 2IWBA 2Y2JA 5EE8A 3ZYTA 4R1GA 5F68A 2X01A 1N9OA 3LR3A 4NXEA 1NWZA 3CAXA 2B95A 2ZOIA 4P6ZM 4K0WA 3UMEA 3TG9A 1V9YA 1XA7A 3OPLA 3B3XA 2Q9NA 2EX8A 2WAFA 1D06A 3ZHHA 5J3WA 1PWGA 4NXFA 5F83A 3IXDA 2JN7A 3NDEA 2Y91A 3ZGAB 3LEZA 5DFXA 2Z6CA 2VLGA 2PBYA 1L0EA 1XFNA 4Q8IA 2ZMVA 3QP4A 3IS2B 3HLGA 3M2KA 1DP8A 3CLOA 3IX3A 5EVIC 4CJNA 4PM5A 2UWXA 2CMNA 1XJ3A 2ZC5B 4E3KA 3UPOA 1Z09A 5E2GA 2ZC7A 2WGIA 3IS2A 1VB6A 4OH0A 5A93A 3A3JA 1XJ6A 4N1XA 3G4PA 3SZTA 3I7JA 4YNRA 1OTEA 4K08A 5JYOA 4EXOA 1K4FA 2W3GA 1XFQA 3UB8A 1YQSA 3OOVA 3F1PB 3S7NA 2O9AA 3C2WA 1BTLA 5CRFA 3G35A 2V8CA 3DW0A 3PBQA 4QU3A 1LL8A 3CI6A 5JYPA 2XA7M 1H8YA 3VE3A 3UPNA 1KE0A 1GHIA 4G3KA 3F1PA 4LCLA 2EA9A 2ZJ9A 5AQBA 3EGXC 3IBRA 2OAQ1 4FD8A 4LFUA 2VX8A 3OPHA 1KGFA 2Q9MA 4FSFA 3ZG0A 4UA7A 4ETXA 4GD8A 1FCMA 5HL6A 3N8SA 4NG2A 4M4XA 2QKPA 1NLZA 4RVAA 4GHIB 3ZVTA 1XP4A 1RP5A 4Y0OA 3UE6A 4BJPA 1K57C 5FDSA 4MNRA 3CUEC 3T4QA 4M3KA 1G6AA 2V1BA 1IKIA 3O88A 4C3QA 4KG6A 3CPTB 1MKMA 1YLTA 1XPBA 4GHIA 4YOFA 3A3DA 4DJ3A 4IHQA 1YLYA 5AVEA 1S6RA 4GW9A 4H8RA 2VV7A 3ZG5A 2J3TC 4JF4A 5KIZA 2ZQCA 3T12B 4YFMA 5HZHA 4K91A 2A49A 1GHPA 3OCLA 1EI5A 4JGQA 4E04A 2XEPA 2ZQDA 2ZMAA 1F5MA 3MF0A 3ZCZA 3UMDA 2CC1A 2GZAA 2BLSA 1IYSA 3W4PA 1JVJA 4IVIA 3HJKA 4B93A 1S4RA 4JPMA 1HLUP 1I2SA 2HZ5A 4ZBEA 3WS0A 2JKFA 1ES3A 3DTKA 2PYPA 4PPRA 4EV4A 3MS6A 4JF5A 1P97A 1GA0A 2M7VA 4UQIM 3IHAA 4ZAMA 4EUVA 3QNBA 4JGOA 4F94A 2VGLM 4U3TA 5CERA 3MQOA 4I39A 2Z2LB 1YKDA 3HBRA 2OWHA 5TFQA 1PW1A 2P9VA 3DTEA 1ZHHB 1H8MA 1HD8A 1L2SA 1CJFA 1PI5A 1CK3A 1TDLA 4G3WA 4EBLA 4GZBA 3ZNYA 4MBKA 3ZQ5A 2GDNA 2ZM8A 1HVBA 1PNEA 1FSYA 4LGWA 4GOGA 4ESPA 3IH8A 4DXCA 1T1CA 5HDDA 5DJTA 4E3NA 4ZRRA 2D02A 3EWKA 3NJAA 4QY6A 4ARZB 4EW7A 3MXQA 3UE0A 3LGOA 2BG1A 4HH2A 2M1CA 1TEMA 3C38A 3BM6A 2Y4AA 2DRWA 4I3AA 1ESIA 1ODVA 3QP8A 3RTYA 3RXWA 3S4XA 3G6OA 1KDSA 4ARZA 3F1NB 4HHDA 3UY6A 1FCOA 4CLCC 1OTIA 1BULA 1T18A 3NC8A 4ZJ3A 3TOIA 1RCJA 3ZG8B 1KVMA 3A3IA 4GDBA 4P87A 4HI4A 3GQZA 3N7WA 5EVLA 4HESA 4EESA 3IF6A 3G31A 4FOFA 3IH9A 3OZHA 1OT9A 3VFFA 1LSXA 4O8GA 2WZXA 3F1NA 2QJ7A 4MBFA 1NRFA 3EEHA 5DF9A 4KG5A 2Y2NA 3S1YA 2PU2A 4BD1A 4UA6A 1ZG6A 3NIAA 5KZHA 2Y55A 3FYZA 2A2LA 2JKGA 5E43A 3UNWA 4R4SA 2OWJA 1BZAA 3NBLA 3LIEA 3O87A 4A5RA 4E3LA 1SKOB 4B4ZA 3GMWA 4LRYC 4R23A 1EROA 1NXYA 2VEAA 1I5QA 1K25A 1E3UA 3D3OA 1SDNA 2Y2QA 2L0WA 3HLWA 3G30A 1K0KA 5HFOA 4LV1A 3UDFA 2Y59A 1FR1A 5A92A 3OBFA 2E8JA 4BBTA 1SZVA 2H28A 3EOIA 1SKOA 5EVIB 5EOEA 1IKGA 1IYOA 2XQZA 2GJ3A 1VEUB 4FH2A 3IXBA 2V1AA 4KUOA 3U2AA 3L7HA 1UGUA 4OLGA 4L9EA 3N8RA 4D60A 2WGWB 1PRQA 4WEJA 4QB8A 1ERMA 4BBVA 1P9WA 3TE8A 2O99A 5TR7A 3CHWP 4LV0A 4GCZA 4XXRA 1VEUA 1K56A 4XUXA 4PM7A 1TDGA 5I5LA 2VA0A 3BEBA 3BQAA 3JPUA 1VHMA 1MZUA 1U60A 2WGWA 1T1BA 2HP6A 4ME4A 5DF8A 2HDUA 2W27A 3UB6A 2KLIA 2W1TA 2VK3A 2P08A 2A3UA 4X69A 5CHMA 4KZ5A 4B88A 1MY8A 3PAGA 1BT5A 3VP1A 3IX8A 2Y8HA 4GB7A 2ZOHA 2OLUA 5M19A 1VM1A 4KQRA 1FCNA 3GTCA 5CEDA 4N1HA 1BUEA 4LPZA 4R4RA 3SW1A 3R7WB 3VSKA 4HNBA 4FH4A 3IWIA 3M2JA 5FASA 5AJGA 1GA9A 3VSLA 4JXWA 3BLSA 5FI2A 1CI9A 3G2ZA 5IHVA 3LI9A 1L0GA 3A3FA 5EPHA 3TSGA 5M18A 3R7WA 5EM1A 4Q0IA 4IJGA 4RX3A 1ONGA 4DMZA 2M7UA 3EEAA 3C7VA 2XF3A 2AVXA 2VV6A 4CQHA 1F9IA 5EVID 1EWZA 2HDQA 3C4OA 4GD6A 4EQIA 1H3QA 3P98A 4B4XA 4R38A 4HY8A 2G2WA 5G18A 5F5YA 2XFTA 3NI9A 2ZQ7A 1CI8A 3MSHA 4EU0A 4IUKA 3KX0X 4X68A 4G3VA 3IF6C 1IYQA 3ITAA 3L9KA 2QPNA 2XGNA 5GL9A 3PTEA 2PRFA 4NXBA 5A91A 4UA9A 1T1AA 1XXMA 2O9BA 4EERA 1GSVA 1ES2A 2XRNA 3ULFA 2GX5A 5CGWA 1KGEA 1H0MA 3E2KA 4K0XA 4WZ5C 4ZJ2A 2XLNA 3E0YA 4GDNA 3BFDA 2V2FF 3T4LA 2V1ZA 5F6AA 3C30A 3HLCA 3O86A 4L9FA 1S66L 4MBHA 3NOTC 1F98A 4Y13A 3AGEA 1NZUA 1C3BA 3IWOA 3B42A 4S2LA 1P0ZA 3GDIA 3NY4A 5CEBA 4Y0UA 5FEGA 3CJMA 4P6BA 1T19A 2JKRI 2ZM2A 4GS9B 2NUTC 5EM0A 1M40A 1K55C 2Y2LA 4KZ6A 4BENA 3T1SA 1ERQA 4E3OA 3CWFA 4LCMA 3P01A 4ZJ1A 3IQAA 3M6BA 4E3IA 1XX2A 1KE3A 3Q7ZA 1ESUA 4GS9A 1L0DA 2WAEA 5AQ9A 4Y3IA 1HTZA 2H0YA 3UB9A 4WN5A 4DF6A 2P04A 5A8BA 2QZ6A 2PD7A 3MMHA 3KSFA 5L07A 2LB5A 1MC0A 4Y15A 1TD5A 4EUZA 2O0YA 3ZVWA 5FI6A 2X02A 2PHYA 3MQ0A 4QD4A 4P0MA 1DJBA 1D7EA 3BY9A 4WL9A 2W1RA 2PBDP 3ZG7B 4HQAA 2PT7A 4PM8A 4KG2A 4GN2A 3T4TA 1PYYA 1L3LA 3BRMA 5K5BA 5HWTA 3R4KA 3GECA
chains in the Genus database with same CATH topology
4F3LB 2VGLM 2KDKA 5HD5A 2K7SA 3MQOA 4I39A 3F1OA 5HSQA 3HJIA 3T4OA 1YKDA 4H6JA 2YKHA 4HJ6A 1XJ2A 3HCYA 2PYRA 5TJJA 2OWHA 2QJ5A 2K2NA 3K3DA 2P7JA 4MDZA 2ZBBA 4F3LA 4PKYA 1ZHHB 5IU1A 5HDCA 1H8MA 2KX6A 1LT0A 1XJ4A 2JKTM 1OTAA 4L0LA 4G3WA 4HOIA 2VJWA 3PBOA 3EQUA 4PAUA 3ZQ5A 2V0UA 1V9ZA 2W1TB 3NOPC 3PR6A 3T50A 3BWLA 3PHYA 3LIAA 4Q0JA 3BW6A 1T1CA 5HDDA 3FC7A 5DJTA 3H82B 4EEUA 4HP4A 4ZRRA 2IA2A 3LR5A 2D02A 4DN0A 4EQ1A 3S7QA 2D01A 4Y2FA 5LBRA 3T4SA 3EWKA 2WKPA 1TS8A 3NJAA 4ARZB 4EW7A 3MXQA 4R70A 3E4QA 3KSGA 2HGVA 2FH5A 2HJ9C 2VGLS 4HH3A 4HH2A 4Q0HA 4MN5A 3E98A 2M1CA 3C38A 1TS7A 4I3AA 2OOLA 2XSSA 1ODVA 5G4ZA 5KSHA 3LI8A 3H82A 3NOUC 1NRJA 3RTYA 4MMNA 3PBTA 3G6OA 4PKYG 4ARZA 3F1NB 4HHDA 2WKRA 1OTIA 4CLCC 1T18A 5DFYA 2WKQA 3VE4A 4P6ZS 3P7NA 5HWVA 3E4OA 4HI4A 5CX7A 2L1MA 4BMWA 4EESA 1N9LA 4FOFA 2G7UA 1OT9A 1OJ5A 3E4PA 1LSXA 4O8GA 3OLOA 1KOUA 3F1NA 2QJ7A 3LIFA 5TBMB 4HP9A 1TS6A 2HJEA 3EEHA 4AFIA 5DF9A 3LR0A 5HDSA 4HJ4A 2J3TD 2INWA 1UWPX 2A2LA 2NUPC 2PD8A 4IUHA 3BQ8A 3K2NA 3BJNA 2B02A 4RQ9A 3MQQA 2QHKA 2W3EA 4R3AA 1TS0A 1OPXA 1UWNX 3KYZA 5J7EA 3S7PA 2OWJA 1YSPA 2GNXA 3LIEA 1P9RA 4L9GA 5F69A 4LRYC 5TBMA 2Y79A 3PXPA 3RH8B 4DJ2A 2VEAA 1OJGA 4CLCD 3C8CA 4Y5FA 3D3OA 2L0WA 1DRMA 3RFBA 1NLYA 4I3JA 4BBUA 4BWIA 2OAP1 2PDRA 1Y28A 1YSQA 5C5KA 3OBFA 4II7A 2JKTI 3B33A 1W63M 4BBTA 2H28A 3EOIA 5J4EA 5DKLA 3T4KA 5L8MA 3VV4A 4CLCB 1ZTUA 3ZYTA 4XT2B 5F68A 2GJ3A 1N9OA 3LR3A 2V1AA 3JVUA 5AVFA 4NXEA 1NWZA 3CAXA 2HV1A 4KUOA 3U2AA 1UGUA 2W3HA 3TJZC 2ZOIA 4L9EA 4KQOA 4P6ZM 4YWZA 1GSXA 4WEJA 3UMEA 1V9YA 4Z1WA 4BBVA 1P9WA 3TE8A 2O99A 4CLCA 1D06A 4GCZA 4XT2A 1LSWA 5J3WA 5I5LA 2VA0A 4I38A 4NXFA 3BQAA 1VHMA 2JN7A 5DFXA 1MZUA 2Z6CA 2ZMFA 1T1BA 2VLGA 3LYXA 2JHEA 4ME4A 2O9CA 1XFNA 2W27A 3VOLA 2XA7S 3UB6A 2KLIA 2W1TA 2ZMVA 3B47A 2P08A 2B18A 3CITA 3IS2B 3TRCA 3R4KA 2Y8HA 2EWWA 2A24B 4NKPA 2ZOHA 1DP8A 3FPVA 3CLOA 1S67L 2VV8A 4I3IA 5HD3A 2CMNA 4LPZA 1XJ3A 3SW1A 4EEPA 3R7WB 5EFWA 4HNBA 4HIAA 3IS2A 2KOIA 1VB6A 5AJGA 3UB7A 3MR0A 3UE3A 3MFXA 1XJ6A 1W63Q 2A24A 3LI9A 2VKSA 1EW0A 4YNRA 1OTEA 4K08A 3MJQA 3R7WA 4EXOA 4EETB 2XROA 2W3GA 2JKRM 1XFQA 3UB8A 3BY8A 4Q0IA 4IJGA 3KO6A 3LR4A 4DMZA 3LIDA 5DKKA 4B9OA 3JVVA 2M7UA 3EEAA 3OOVA 4QPRA 1BYWA 3F1PB 3S7NA 3TW8A 2O9AA 2Z6DA 3C2WA 4JGRA 2VV6A 4CQHA 1F9IA 3OC2A 2V0WA 2EWVA 4O0PA 1X0OA 1H3QA 3D72A 3PBQA 1YAXA 2LB9A 2I9VA 4R38A 5DJUA 3LIBA 4HY8A 4R6LA 4LRXC 1LL8A 3CI6A 2VZWA 2XA7M 5F5YA 3VE3A 4G3KA 3F1PA 4HJ3A 4EU0A 2PR6A 3O5YA 4WF0A 2EA9A 2PR5A 4IUKA 3KX0X 3S7OA 5IS1A 4G3VA 3EGXC 3IBRA 2OAQ1 1G28A 5IT5A 2VX8A 5HWWA 4FSFA 4NXBA 4I5SA 1T1AA 4ETXA 2O9BA 4EERA 5FL3A 2QWSA 4KUKA 5HL6A 1GSVA 2J3WA 3LICA 3FPWA 2XRNA 3ULFA 5MC7A 4M4XA 2QKPA 2GX5A 3KYQA 2MJ6A 1NLZA 1IOUA 4GHIB 4WUJA 3UE6A 4BJPA 4O01A 1OTDA 3KSHA 1DP9A 3E0YA 3NHQA 3CUEC 3T4LA 3T4QA 5F6AA 2V1BA 3C30A 3OCNA 4L9FA 1MKMA 4WLAA 1S66L 3H9WA 3IBJA 1WA9A 3NOTC 4GHIA 4MN6A 4YOFA 2HF6A 4UQIS 4ETZA 1F98A 4GJ4A 3FG8A 3V67A 4DJ3A 4IHQA 4UEYA 3B42A 5AVEA 3PBRA 4GW9A 2VV7A 1P0ZA 3GDIA 2W0NA 2J3TC 5KIZA 2L4RA 4NXGA 4MN7A 3EGDC 5HZHA 3EQVA 4PHTA 1STZA 1T19A 2JKRI 4GS9B 2NUTC 3PYPA 3OCLA 4CLCE 4JGQA 1IFQA 4E04A 2R78A 3CWFA 2YKFA 3T4JA 4JGPA 2FZ0A 4NEED 3P01A 3A0VA 4GLQA 4LLOB 2W3DA 3W2ZA 1F5MA 3MF0A 5HPFA 4GS9A 3UMDA 4Y3IA 1DP6A 3A0SA 2J80A 4OOLA 4WN5A 1S1ZA 3UB9A 2GZAA 1OT6A 5HPIA 2P04A 5A8BA 1G6OA 3K3CA 3PBSA 2PD7A 3MMHA 3KSFA 1LSVA 2LB5A 1MC0A 4WELA 3HJKA 2QYBA 4B93A 1JNUA 1TD5A 1S4RA 2O0YA 1S1YA 4OOMA 4KQDA 3A0RA 2PHYA 3H7WB 3MQ0A 1OTBA 4LRZE 1D7EA 3BY9A 4WL9A 2W1RA 5G4YA 2K31A 2PYPA 4HQAA 2BASA 3F1OB 1P97A 4H6JB 4MCWA 2DMWA 1N9NA 2M7VA 2W3FA 1GSWA 3PBNA 2PT7A 3KSIA 4UQIM 3CUEA 2V9AA 4EUVA 3T4TA 3DBAA 3LUQA 3LFVA 1S4SA 4JGOA 5K5BA 3H7WA 4WEKA 5HWTA 1TF1A 3GECA 3ICYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F3L B;  2KDK A;  2K7S A;  3MQO A;  4I39 A;  3F1O A;  5HSQ A;  3HJI A;  4H6J A;  2YKH A;  4HJ6 A;  1XJ2 A;  2PYR A;  2OWH A;  2QJ5 A;  3K3D A;  2P7J A;  2ZBB A;  4F3L A;  4PKY A;  5IU1 A;  5HDC A;  2KX6 A;  1LT0 A;  1XJ4 A;  1OTA A;  4HOI A;  3ZQ5 A;  2V0U A;  1V9Z A;  3NOP C;  3T50 A;  3BWL A;  3PHY A;  3LIA A;  1T1C A;  5HDD A;  3FC7 A;  5DJT A;  3H82 B;  4EEU A;  4HP4 A;  4EQ1 A;  2D02 A;  2D01 A;  3EWK A;  2WKP A;  1TS8 A;  3NJA A;  4EW7 A;  3MXQ A;  4R70 A;  3E4Q A;  4HH3 A;  4HH2 A;  4MN5 A;  2M1C A;  1TS7 A;  4I3A A;  2OOL A;  1ODV A;  5G4Z A;  3LI8 A;  3H82 A;  3NOU C;  3RTY A;  4PKY G;  3G6O A;  3F1N B;  4HHD A;  2WKR A;  1OTI A;  1T18 A;  3VE4 A;  2WKQ A;  3P7N A;  5HWV A;  3E4O A;  4HI4 A;  4EES A;  2L1M A;  1N9L A;  1OT9 A;  1OJ5 A;  3E4P A;  1LSX A;  3OLO A;  1KOU A;  3F1N A;  2QJ7 A;  3LIF A;  5TBM B;  4HP9 A;  1TS6 A;  3EEH A;  5HDS A;  4HJ4 A;  2INW A;  1UWP X;  2PD8 A;  2B02 A;  4RQ9 A;  3MQQ A;  2QHK A;  4R3A A;  1TS0 A;  1UWN X;  5J7E A;  2OWJ A;  3LIE A;  5F69 A;  4L9G A;  4LRY C;  5TBM A;  3RH8 B;  4DJ2 A;  2VEA A;  1OJG A;  3C8C A;  2L0W A;  1DRM A;  4I3J A;  4BBU A;  2PDR A;  1Y28 A;  3B33 A;  4BBT A;  2H28 A;  5J4E A;  5DKL A;  4XT2 B;  5F68 A;  2GJ3 A;  1N9O A;  2V1A A;  5AVF A;  4NXE A;  1NWZ A;  3CAX A;  2HV1 A;  4KUO A;  1UGU A;  2ZOI A;  4L9E A;  4YWZ A;  1GSX A;  3UME A;  1V9Y A;  4BBV A;  1D06 A;  4GCZ A;  4XT2 A;  1LSW A;  5J3W A;  5I5L A;  4I38 A;  4NXF A;  2JN7 A;  1MZU A;  2Z6C A;  1T1B A;  2VLG A;  3LYX A;  2JHE A;  1XFN A;  2W27 A;  3VOL A;  3UB6 A;  3IS2 B;  2A24 B;  2ZOH A;  1DP8 A;  3CLO A;  1S67 L;  2VV8 A;  4I3I A;  5HD3 A;  2CMN A;  4LPZ A;  1XJ3 A;  3SW1 A;  4EEP A;  5EFW A;  4HNB A;  4HIA A;  3IS2 A;  1VB6 A;  3UB7 A;  3MR0 A;  3MFX A;  1XJ6 A;  2A24 A;  3LI9 A;  1EW0 A;  1OTE A;  4K08 A;  3MJQ A;  4EXO A;  4EET B;  1XFQ A;  3UB8 A;  3BY8 A;  3LID A;  5DKK A;  4B9O A;  1BYW A;  3F1P B;  2Z6D A;  3C2W A;  4JGR A;  2VV6 A;  1F9I A;  2V0W A;  1X0O A;  3D72 A;  2I9V A;  4R38 A;  5DJU A;  3LIB A;  4HY8 A;  4R6L A;  4LRX C;  1LL8 A;  5F5Y A;  3VE3 A;  3F1P A;  4HJ3 A;  2PR6 A;  4WF0 A;  2EA9 A;  2PR5 A;  3KX0 X;  5IS1 A;  3IBR A;  1G28 A;  5HWW A;  4NXB A;  4I5S A;  1T1A A;  4EER A;  2QWS A;  4KUK A;  1GSV A;  3LIC A;  3ULF A;  4M4X A;  2QKP A;  4GHI B;  4WUJ A;  3UE6 A;  1OTD A;  1DP9 A;  3NHQ A;  5F6A A;  2V1B A;  4L9F A;  4WLA A;  1S66 L;  3H9W A;  1WA9 A;  3NOT C;  4GHI A;  4MN6 A;  1F98 A;  3FG8 A;  4DJ3 A;  5AVE A;  4GW9 A;  2VV7 A;  1P0Z A;  3GDI A;  2W0N A;  5KIZ A;  2L4R A;  4NXG A;  5HZH A;  1T19 A;  4GS9 B;  3PYP A;  4JGQ A;  4E04 A;  2R78 A;  3CWF A;  2YKF A;  4JGP A;  3A0V A;  4LLO B;  4GS9 A;  3UMD A;  1DP6 A;  3A0S A;  2J80 A;  3UB9 A;  4WN5 A;  1S1Z A;  1OT6 A;  5A8B A;  3K3C A;  2PD7 A;  1LSV A;  3HJK A;  1JNU A;  1S4R A;  1S1Y A;  4KQD A;  3A0R A;  2PHY A;  3H7W B;  1OTB A;  4LRZ E;  1D7E A;  3BY9 A;  4WL9 A;  5G4Y A;  2PYP A;  4HQA A;  2BAS A;  3F1O B;  1P97 A;  4H6J B;  1N9N A;  1GSW A;  2V9A A;  3LUQ A;  1S4S A;  4JGO A;  3H7W A;  5HWT A;  5HD5 A;  3GEC A;  3ICY A; 
#chains in the Genus database with same CATH topology
 2Y2H A;  4OQH A;  2J8Y A;  1FSW A;  4BD0 A;  4FCF A;  2K7S A;  5GHZ A;  3FWL A;  4DKI A;  4XUZ A;  5CTM A;  2XR0 A;  1XJ2 A;  3MZE A;  2ACG A;  4E3J A;  5TJJ A;  2K2N A;  3K3D A;  2P7J A;  3VP0 A;  5DTS A;  1LLB A;  3IF5 A;  3MFD A;  1LT0 A;  2I72 A;  3WRT A;  4OQG A;  2VJW A;  1ACF A;  3PBO A;  3BWL A;  1JTG A;  5CGS A;  5M1A A;  3H82 B;  4EQ1 A;  2C5W B;  3S7Q A;  4Y2F A;  3LY4 A;  5D3O A;  5LBR A;  4OP8 A;  2WKP A;  3E4Q A;  2HGV A;  4IBR A;  4U0T A;  2FH5 A;  3CPT A;  1MKI A;  1TS7 A;  3T1R A;  1W5D A;  1SHV A;  1CQA A;  3PAE A;  1M6K A;  3H82 A;  3NOU C;  1NYY A;  1XGI A;  4MMN A;  4DRT A;  3HL9 A;  3PBT A;  4LV3 A;  2WKR A;  4X1L A;  3NDG A;  4P6Z S;  5DF7 A;  1YMS A;  4BMW A;  3RXX A;  3SS3 A;  3OLO A;  1WYC A;  1KOU A;  5GLA A;  1TS6 A;  2HJE A;  3LR0 A;  5EVE A;  5HL1 A;  4IUH A;  3BQ8 A;  2E8I A;  4RQ9 A;  3MQQ A;  4JKT A;  1MWR A;  1TS0 A;  1UWN X;  3KYZ A;  2Z2M B;  3S7P A;  1LHY A;  5A90 A;  1YSP A;  5L10 A;  2GNX A;  1Y54 A;  3FZC A;  2Y79 A;  3PXP A;  2WUQ A;  1OJG A;  4CLC D;  1BLP A;  2Y2I A;  1DRM A;  5HW3 A;  1NLY A;  4BBU A;  2OAP 1;  1Y28 A;  1NZO A;  1YSQ A;  1NY0 A;  5C5K A;  3UDX A;  3B33 A;  1W63 M;  4S2I A;  5J4E A;  5DKL A;  5L8M A;  2R9X A;  5E2E A;  3VV4 A;  1K54 A;  1ZTU A;  1KE4 A;  3JVU A;  5AVF A;  4UAA A;  1YT4 A;  2H5S A;  2HV1 A;  2W3H A;  3MKF A;  4YWZ A;  3V39 A;  1H5X A;  4BL2 A;  1MWU A;  4Z1W A;  1DJC A;  3M6H A;  2OSU A;  1YLZ A;  4IBX A;  3ZFZ A;  1HZO A;  2XH9 A;  4C75 A;  1Q2P A;  2HP9 A;  1LL5 A;  4N92 A;  2Y2M A;  4ID4 A;  4R3B A;  2O9C A;  1BLH A;  4OVD A;  3UDI A;  2XA7 S;  3VOL A;  4HEF A;  4S2M A;  3SH7 A;  1NJ4 A;  3ZDJ A;  2B18 A;  3CIT A;  3IT9 A;  5BOH A;  3TRC A;  3ITB A;  3N4I A;  1KVL A;  4Y17 A;  3Q7V B;  2A24 B;  4S2N A;  2HP5 A;  4DE2 A;  4EBP A;  3GR2 A;  2VV8 A;  4I3I A;  5HD3 A;  1MBL A;  4EEP A;  3IXG A;  3VP4 A;  2EFU A;  1K38 A;  4HIA A;  3UB7 A;  3Q1F A;  3MR0 A;  3Q7V A;  3U4L P;  3G2Y A;  2A24 A;  3DTM A;  2VKS A;  4BLM A;  5AQ7 A;  1KGG A;  1FOF A;  3HUN A;  2ZQA A;  4EET B;  5CHU A;  2JKR M;  3VP3 A;  3BY8 A;  4ZTK A;  3KO6 A;  3LR4 A;  3LID A;  5DKK A;  4KZ7 A;  5FQQ A;  1BLC A;  2Z6D A;  4WM9 A;  4JGR A;  4N9L A;  4R0Q A;  3UB5 P;  4QHC A;  2V0W A;  1JWV A;  2EWV A;  1SCW A;  3GVB A;  4KZA A;  3JYI A;  2LB9 A;  2ZD8 A;  3LIB A;  4R6L A;  5L2F A;  5E2H A;  5FAP A;  5DTT A;  4HJ3 A;  1A0K A;  4WF0 A;  5IS1 A;  5I94 A;  2HDR A;  4WMC D;  2WYX A;  3G34 A;  1G28 A;  2RL3 A;  5HWW A;  4I5S A;  1RGZ A;  1PZP A;  3VOY A;  4OP5 A;  2J3W A;  3NUL A;  5MC7 A;  3W8K A;  5EVI A;  3KYQ A;  4DE3 A;  4R3J A;  3DWZ A;  1Z6F A;  5FI7 A;  4WUJ A;  3KYE A;  1JWP A;  2XFS A;  3C5A A;  1OTD A;  3KSH A;  3QHY A;  5CTN A;  3LCE A;  3NHQ A;  4KZ8 A;  1JWZ A;  2G2U A;  4OPZ A;  3OCN A;  3BFC A;  1IEM A;  4QWO A;  3H9W A;  3IBJ A;  4C6Y A;  1WA9 A;  4GKU A;  2HF6 A;  4UQI S;  3V67 A;  4GJ4 A;  5J8X A;  5AQA A;  3PBR A;  1K6R A;  2Y2G A;  1PFL A;  3MKE A;  4MN7 A;  3EQV A;  1MWS A;  1STZ A;  4PHT A;  1PWC A;  4CLC E;  1SKF A;  4OON A;  4JGP A;  2FZ0 A;  4NEE D;  5FQM A;  3IWQ A;  2W3D A;  4E6W A;  1WYB A;  1QMF A;  4KZ9 A;  2WKE A;  4MLL A;  1E3U D;  3AGF A;  4OPY A;  3QP2 A;  4NK3 A;  1VQQ A;  1DP6 A;  3A0S A;  2J80 A;  1IYP A;  1OT6 A;  1G6O A;  1ZKJ A;  4ZDX A;  1LSV A;  1PZO A;  2QYB A;  3H7W B;  1OTB A;  5F1F A;  5FQ9 A;  2WAD A;  2K31 A;  1ZG4 A;  4S2P A;  1H8Z A;  2BAS A;  3CZD A;  3F1O B;  4RX2 A;  1K57 A;  2W3F A;  1W79 A;  2Y2P A;  3PBN A;  3KSI A;  5EOO A;  3CUE A;  2V9A A;  1BSG A;  5FQI A;  3LUQ A;  3LFV A;  1S4S A;  5FAO A;  2V20 A;  3H7W A;  1FQG A;  5HD5 A;  2JC7 A;  4F3L B;  2KDK A;  3C7U A;  3ZNT A;  3F1O A;  3T4O A;  2OLV A;  3Q81 A;  3FKV A;  4OQ0 A;  2PYR A;  5DVA A;  2QJ5 A;  4YIN A;  2QMI A;  5GLD A;  4RYE A;  1J3W A;  2ZBB A;  3DAV A;  4F3L A;  2WK0 A;  4PKY A;  3HUM A;  1DJA A;  1G5U A;  3BEC A;  3ISG A;  4JXS A;  2KX6 A;  4WYY A;  1XJ4 A;  1OTA A;  4L0L A;  5GHX A;  4D2O A;  4OOY A;  3EQU A;  3BFE A;  4JBF A;  3PR6 A;  3T50 A;  3LIA A;  5KSC A;  3BW6 A;  4OLD A;  3FC7 A;  3FV7 A;  2IA2 A;  2ZQ8 A;  4DN0 A;  1I2W A;  2D01 A;  4X25 A;  1G68 A;  1ES5 A;  4EWF A;  5E2F A;  4R70 A;  3KSG A;  4HH3 A;  1SDE A;  3E98 A;  2HPB A;  3E2L A;  3VOZ A;  4JXG A;  2XSS A;  5KSH A;  3LI8 A;  3VMA A;  1NRJ A;  5F1G A;  4PKY G;  5HAQ A;  1F2K A;  5CHJ A;  3UPP A;  2WKQ A;  2WGV A;  1VET B;  2JBF A;  3P7N A;  2J7V A;  3E4O A;  5GLC A;  3W4Q A;  4P85 A;  1NYM A;  1MWT A;  3WS1 A;  2G7U A;  1K4E A;  2ZM0 A;  1E25 A;  1ONH A;  2ZL1 B;  4DDS A;  3ZG9 B;  2B5R A;  4LV2 A;  3LIF A;  1YLW A;  3OPR A;  3AGD A;  1KDW A;  1VET A;  2J3T D;  2INW A;  1UWP X;  1J9M A;  1AWI A;  4WBG A;  2B02 A;  5FAQ A;  5J7E A;  1W8Q A;  2ZL1 A;  4DE0 A;  4FUW A;  4X53 A;  2VGJ A;  3CG5 A;  4KQQ A;  5F69 A;  4L9G A;  3RH8 B;  3Q07 A;  4Y5F A;  4QJG A;  2ZC4 B;  5FQK A;  2C6W B;  3BFG A;  1OME A;  4BWI A;  5FDH A;  2H10 A;  4DE1 A;  2PDR A;  3WS4 A;  4UHU A;  4II7 A;  2JKT I;  3IXH A;  5EUA A;  4KZB A;  4O7D A;  3RJU A;  4CLC B;  2DNS A;  2ZLY A;  4XT2 B;  4KZ3 A;  3WS2 A;  3V50 A;  3A3E A;  1LI0 A;  3TJZ C;  4KQO A;  2X71 A;  1XKZ A;  1GSX A;  3MZF A;  3QP6 A;  3VP2 A;  4CLC A;  4S2K A;  3VFH A;  4XT2 A;  1LSW A;  4I38 A;  1L0F A;  1K6S A;  4HBU A;  3Q82 A;  2XK1 A;  3MXS A;  1XA1 A;  4X55 A;  2ZMF A;  1PWD A;  3V5M A;  3LYX A;  2JHE A;  5KMW A;  3BYD A;  1N4O A;  3SH8 A;  3B47 A;  2XD1 A;  2Q0O A;  4OPR A;  2EWW A;  4NKP A;  3FPV A;  1W7F A;  5FQJ A;  1S67 L;  4CPK A;  4PMA A;  5EFW A;  3T1X A;  1YLP A;  2KOI A;  3LY3 A;  4E6X A;  4JLF A;  4RA7 A;  4BQM A;  3UE3 A;  3MFX A;  1W63 Q;  4EBN A;  4LEN A;  2DCF A;  2XDM A;  1EW0 A;  3MJQ A;  4OPQ A;  2XRO A;  3S22 A;  1YLJ A;  3HLD A;  4BL3 A;  4B9O A;  3JVV A;  1D1J A;  4QPR A;  1BYW A;  4S2O A;  3TW8 A;  3SOI A;  3LEQ A;  3OC2 A;  1ALQ A;  3SH9 A;  2VGK A;  4O0P A;  1X0O A;  3D72 A;  1YAX A;  2I9V A;  5DJU A;  4LRX C;  2V8F A;  2VZW A;  4Z9Q A;  4X1M A;  2UV0 E;  3SS5 A;  2PR6 A;  3O5Y A;  2PR5 A;  3S7O A;  2EX2 A;  3DWK A;  1WE4 A;  3D9Y A;  5U47 A;  2P9V B;  5IT5 A;  3SS4 A;  1FR6 A;  3BFF A;  5FL3 A;  2QWS A;  4KUK A;  2Y2O A;  2EX6 A;  2ZQ9 A;  3LIC A;  3FPW A;  3HVF A;  4JF6 A;  2MJ6 A;  1IOU A;  1GCE A;  2R9W A;  5FSR A;  3O3V A;  5HAR A;  4O01 A;  3QP1 A;  1DP9 A;  1YMX A;  2WKH A;  5TGF A;  4U0X A;  2RCX A;  3NEC A;  3IHB A;  4WMC A;  4WLA A;  4IVK A;  4MN6 A;  2IWC A;  1CF0 A;  3UE1 A;  4ETZ A;  2FFF B;  3FG8 A;  4KZ4 A;  4UEY A;  3MBZ A;  3G32 A;  2WZZ A;  1PW8 A;  2W0N A;  2L4R A;  4NXG A;  3EGD C;  2OV5 A;  3PYP A;  3IF6 B;  3BLM A;  2EFX A;  3MXR A;  1IFQ A;  2R78 A;  4WZ4 A;  2YKF A;  3T4J A;  4NET A;  3A0V A;  3IX4 A;  4GLQ A;  4LLO B;  4X56 A;  3W2Z A;  1Q2Q A;  2ZC6 B;  5HPF A;  2JCH A;  3QNC A;  3UN7 A;  4DXB A;  4OOL A;  1S1Z A;  4X6T A;  5HPI A;  3K3C A;  3PBS A;  3P09 A;  4WEL A;  1JNU A;  4PM9 A;  1FIL A;  1LL9 A;  1S1Y A;  4OOM A;  5F82 A;  4KQD A;  3A0R A;  1ES4 A;  1PIO A;  3MZD A;  4LRZ E;  4HBT A;  3OPP A;  1GHM A;  5EV0 A;  1TVF A;  3HLF A;  5G4Y A;  1YM1 A;  5FAT A;  2H0T A;  1CEG A;  4H6J B;  3CMZ A;  4MCW A;  2DMW A;  1N9N A;  4PM6 A;  4WZ5 A;  1GSW A;  5EEC A;  3WWX A;  4IED A;  1W8Y A;  1BLS A;  3N8L A;  3DBA A;  1N9B A;  2Y2K A;  4WEK A;  1TF1 A;  2HDS A;  3ICY A;  5GHY A;  4KEN B;  5HSQ A;  3HJI A;  4H6J A;  2YKH A;  2PAV P;  4E3M A;  4HJ6 A;  1MPL A;  3HLB A;  4QY5 A;  3HCY A;  5CXW A;  3UO9 A;  5HX9 A;  5FA7 A;  5CEC A;  3FKW A;  1AXB A;  4MDZ A;  3GRJ A;  2WKI A;  1K55 A;  5IU1 A;  5HDC A;  5FEF A;  2JKT M;  4HOI A;  4OQI A;  4PAU A;  2V0U A;  1V9Z A;  2IWD A;  2W1T B;  3NOP C;  1RGY A;  1QME A;  3PHY A;  4Q0J A;  4EEU A;  4HP4 A;  3LR5 A;  5HAP A;  2P74 A;  3T4S A;  2XD5 A;  1TS8 A;  1O7E A;  1K54 C;  1E4D A;  1ZC2 A;  3GSG A;  2HJ9 C;  2VGL S;  4Q0H A;  4MN5 A;  1S0W A;  2ZC3 B;  4Y0T A;  1MXO A;  3D4F A;  2OOL A;  5G4Z A;  3C4P A;  4DDY A;  4MEZ A;  2JE5 A;  3N6I A;  3DTI A;  3WRZ A;  3NCK A;  2FFY A;  4Y7P A;  3QP5 A;  5DFY A;  3VE4 A;  5GLB A;  1JTD A;  5HWV A;  5CX7 A;  2L1M A;  1N9L A;  3HRE A;  4S2J A;  2EXA A;  1OJ5 A;  3GV9 A;  3E4P A;  2PU4 A;  1XGJ A;  5TBM B;  4HP9 A;  4GNU A;  4AFI A;  5DTK A;  5CGX A;  5HDS A;  4HJ4 A;  1PI4 A;  2NUP C;  4FTX A;  2PD8 A;  2EXB A;  3K2N A;  3BJN A;  3W4O A;  2QHK A;  2W3E A;  4R3A A;  4S2N C;  3V3S A;  1OPX A;  3HLE A;  1CEF A;  1FIK A;  5HAI A;  2BTF P;  1P9R A;  5L09 A;  5TBM A;  1Y4O A;  4DJ2 A;  3C8C A;  2J9P A;  3HUO A;  3LO7 A;  3RFB A;  4I3J A;  1K56 D;  2EX9 A;  3WS5 A;  1IEL A;  1O07 A;  4N9K A;  3V3R A;  2J9O A;  1DY6 A;  1YPR A;  3T4K A;  3T1Q B;  4JXV A;  4OKP A;  1LI9 A;  2IWB A;  2Y2J A;  5EE8 A;  3ZYT A;  4R1G A;  5F68 A;  2X01 A;  1N9O A;  3LR3 A;  4NXE A;  1NWZ A;  3CAX A;  2B95 A;  2ZOI A;  4P6Z M;  4K0W A;  3UME A;  3TG9 A;  1V9Y A;  1XA7 A;  3OPL A;  3B3X A;  2Q9N A;  2EX8 A;  2WAF A;  1D06 A;  3ZHH A;  5J3W A;  1PWG A;  4NXF A;  5F83 A;  3IXD A;  2JN7 A;  3NDE A;  2Y91 A;  3ZGA B;  3LEZ A;  5DFX A;  2Z6C A;  2VLG A;  2PBY A;  1L0E A;  1XFN A;  4Q8I A;  2ZMV A;  3QP4 A;  3IS2 B;  3HLG A;  3M2K A;  1DP8 A;  3CLO A;  3IX3 A;  5EVI C;  4CJN A;  4PM5 A;  2UWX A;  2CMN A;  1XJ3 A;  2ZC5 B;  4E3K A;  3UPO A;  1Z09 A;  5E2G A;  2ZC7 A;  2WGI A;  3IS2 A;  1VB6 A;  4OH0 A;  5A93 A;  3A3J A;  1XJ6 A;  4N1X A;  3G4P A;  3SZT A;  3I7J A;  4YNR A;  1OTE A;  4K08 A;  5JYO A;  4EXO A;  1K4F A;  2W3G A;  1XFQ A;  3UB8 A;  1YQS A;  3OOV A;  3F1P B;  3S7N A;  2O9A A;  3C2W A;  1BTL A;  5CRF A;  3G35 A;  2V8C A;  3DW0 A;  3PBQ A;  4QU3 A;  1LL8 A;  3CI6 A;  5JYP A;  2XA7 M;  1H8Y A;  3VE3 A;  3UPN A;  1KE0 A;  1GHI A;  4G3K A;  3F1P A;  4LCL A;  2EA9 A;  2ZJ9 A;  5AQB A;  3EGX C;  3IBR A;  2OAQ 1;  4FD8 A;  4LFU A;  2VX8 A;  3OPH A;  1KGF A;  2Q9M A;  4FSF A;  3ZG0 A;  4UA7 A;  4ETX A;  4GD8 A;  1FCM A;  5HL6 A;  3N8S A;  4NG2 A;  4M4X A;  2QKP A;  1NLZ A;  4RVA A;  4GHI B;  3ZVT A;  1XP4 A;  1RP5 A;  4Y0O A;  3UE6 A;  4BJP A;  1K57 C;  5FDS A;  4MNR A;  3CUE C;  3T4Q A;  4M3K A;  1G6A A;  2V1B A;  1IKI A;  3O88 A;  4C3Q A;  4KG6 A;  3CPT B;  1MKM A;  1YLT A;  1XPB A;  4GHI A;  4YOF A;  3A3D A;  4DJ3 A;  4IHQ A;  1YLY A;  5AVE A;  1S6R A;  4GW9 A;  4H8R A;  2VV7 A;  3ZG5 A;  2J3T C;  4JF4 A;  5KIZ A;  2ZQC A;  3T12 B;  4YFM A;  5HZH A;  4K91 A;  2A49 A;  1GHP A;  3OCL A;  1EI5 A;  4JGQ A;  4E04 A;  2XEP A;  2ZQD A;  2ZMA A;  1F5M A;  3MF0 A;  3ZCZ A;  3UMD A;  2CC1 A;  2GZA A;  2BLS A;  1IYS A;  3W4P A;  1JVJ A;  4IVI A;  3HJK A;  4B93 A;  1S4R A;  4JPM A;  1HLU P;  1I2S A;  2HZ5 A;  4ZBE A;  3WS0 A;  2JKF A;  1ES3 A;  3DTK A;  2PYP A;  4PPR A;  4EV4 A;  3MS6 A;  4JF5 A;  1P97 A;  1GA0 A;  2M7V A;  4UQI M;  3IHA A;  4ZAM A;  4EUV A;  3QNB A;  4JGO A;  4F94 A;  2VGL M;  4U3T A;  5CER A;  3MQO A;  4I39 A;  2Z2L B;  1YKD A;  3HBR A;  2OWH A;  5TFQ A;  1PW1 A;  2P9V A;  3DTE A;  1ZHH B;  1H8M A;  1HD8 A;  1L2S A;  1CJF A;  1PI5 A;  1CK3 A;  1TDL A;  4G3W A;  4EBL A;  4GZB A;  3ZNY A;  4MBK A;  3ZQ5 A;  2GDN A;  2ZM8 A;  1HVB A;  1PNE A;  1FSY A;  4LGW A;  4GOG A;  4ESP A;  3IH8 A;  4DXC A;  1T1C A;  5HDD A;  5DJT A;  4E3N A;  4ZRR A;  2D02 A;  3EWK A;  3NJA A;  4QY6 A;  4ARZ B;  4EW7 A;  3MXQ A;  3UE0 A;  3LGO A;  2BG1 A;  4HH2 A;  2M1C A;  1TEM A;  3C38 A;  3BM6 A;  2Y4A A;  2DRW A;  4I3A A;  1ESI A;  1ODV A;  3QP8 A;  3RTY A;  3RXW A;  3S4X A;  3G6O A;  1KDS A;  4ARZ A;  3F1N B;  4HHD A;  3UY6 A;  1FCO A;  4CLC C;  1OTI A;  1BUL A;  1T18 A;  3NC8 A;  4ZJ3 A;  3TOI A;  1RCJ A;  3ZG8 B;  1KVM A;  3A3I A;  4GDB A;  4P87 A;  4HI4 A;  3GQZ A;  3N7W A;  5EVL A;  4HES A;  4EES A;  3IF6 A;  3G31 A;  4FOF A;  3IH9 A;  3OZH A;  1OT9 A;  3VFF A;  1LSX A;  4O8G A;  2WZX A;  3F1N A;  2QJ7 A;  4MBF A;  1NRF A;  3EEH A;  5DF9 A;  4KG5 A;  2Y2N A;  3S1Y A;  2PU2 A;  4BD1 A;  4UA6 A;  1ZG6 A;  3NIA A;  5KZH A;  2Y55 A;  3FYZ A;  2A2L A;  2JKG A;  5E43 A;  3UNW A;  4R4S A;  2OWJ A;  1BZA A;  3NBL A;  3LIE A;  3O87 A;  4A5R A;  4E3L A;  1SKO B;  4B4Z A;  3GMW A;  4LRY C;  4R23 A;  1ERO A;  1NXY A;  2VEA A;  1I5Q A;  1K25 A;  1E3U A;  3D3O A;  1SDN A;  2Y2Q A;  2L0W A;  3HLW A;  3G30 A;  1K0K A;  5HFO A;  4LV1 A;  3UDF A;  2Y59 A;  1FR1 A;  5A92 A;  3OBF A;  2E8J A;  4BBT A;  1SZV A;  2H28 A;  3EOI A;  1SKO A;  5EVI B;  5EOE A;  1IKG A;  1IYO A;  2XQZ A;  2GJ3 A;  1VEU B;  4FH2 A;  3IXB A;  2V1A A;  4KUO A;  3U2A A;  3L7H A;  1UGU A;  4OLG A;  4L9E A;  3N8R A;  4D60 A;  2WGW B;  1PRQ A;  4WEJ A;  4QB8 A;  1ERM A;  4BBV A;  1P9W A;  3TE8 A;  2O99 A;  5TR7 A;  3CHW P;  4LV0 A;  4GCZ A;  4XXR A;  1VEU A;  1K56 A;  4XUX A;  4PM7 A;  1TDG A;  5I5L A;  2VA0 A;  3BEB A;  3BQA A;  3JPU A;  1VHM A;  1MZU A;  1U60 A;  2WGW A;  1T1B A;  2HP6 A;  4ME4 A;  5DF8 A;  2HDU A;  2W27 A;  3UB6 A;  2KLI A;  2W1T A;  2VK3 A;  2P08 A;  2A3U A;  4X69 A;  5CHM A;  4KZ5 A;  4B88 A;  1MY8 A;  3PAG A;  1BT5 A;  3VP1 A;  3IX8 A;  2Y8H A;  4GB7 A;  2ZOH A;  2OLU A;  5M19 A;  1VM1 A;  4KQR A;  1FCN A;  3GTC A;  5CED A;  4N1H A;  1BUE A;  4LPZ A;  4R4R A;  3SW1 A;  3R7W B;  3VSK A;  4HNB A;  4FH4 A;  3IWI A;  3M2J A;  5FAS A;  5AJG A;  1GA9 A;  3VSL A;  4JXW A;  3BLS A;  5FI2 A;  1CI9 A;  3G2Z A;  5IHV A;  3LI9 A;  1L0G A;  3A3F A;  5EPH A;  3TSG A;  5M18 A;  3R7W A;  5EM1 A;  4Q0I A;  4IJG A;  4RX3 A;  1ONG A;  4DMZ A;  2M7U A;  3EEA A;  3C7V A;  2XF3 A;  2AVX A;  2VV6 A;  4CQH A;  1F9I A;  5EVI D;  1EWZ A;  2HDQ A;  3C4O A;  4GD6 A;  4EQI A;  1H3Q A;  3P98 A;  4B4X A;  4R38 A;  4HY8 A;  2G2W A;  5G18 A;  5F5Y A;  2XFT A;  3NI9 A;  2ZQ7 A;  1CI8 A;  3MSH A;  4EU0 A;  4IUK A;  3KX0 X;  4X68 A;  4G3V A;  3IF6 C;  1IYQ A;  3ITA A;  3L9K A;  2QPN A;  2XGN A;  5GL9 A;  3PTE A;  2PRF A;  4NXB A;  5A91 A;  4UA9 A;  1T1A A;  1XXM A;  2O9B A;  4EER A;  1GSV A;  1ES2 A;  2XRN A;  3ULF A;  2GX5 A;  5CGW A;  1KGE A;  1H0M A;  3E2K A;  4K0X A;  4WZ5 C;  4ZJ2 A;  2XLN A;  3E0Y A;  4GDN A;  3BFD A;  2V2F F;  3T4L A;  2V1Z A;  5F6A A;  3C30 A;  3HLC A;  3O86 A;  4L9F A;  1S66 L;  4MBH A;  3NOT C;  1F98 A;  4Y13 A;  3AGE A;  1NZU A;  1C3B A;  3IWO A;  3B42 A;  4S2L A;  1P0Z A;  3GDI A;  3NY4 A;  5CEB A;  4Y0U A;  5FEG A;  3CJM A;  4P6B A;  1T19 A;  2JKR I;  2ZM2 A;  4GS9 B;  2NUT C;  5EM0 A;  1M40 A;  1K55 C;  2Y2L A;  4KZ6 A;  4BEN A;  3T1S A;  1ERQ A;  4E3O A;  3CWF A;  4LCM A;  3P01 A;  4ZJ1 A;  3IQA A;  3M6B A;  4E3I A;  1XX2 A;  1KE3 A;  3Q7Z A;  1ESU A;  4GS9 A;  1L0D A;  2WAE A;  5AQ9 A;  4Y3I A;  1HTZ A;  2H0Y A;  3UB9 A;  4WN5 A;  4DF6 A;  2P04 A;  5A8B A;  2QZ6 A;  2PD7 A;  3MMH A;  3KSF A;  5L07 A;  2LB5 A;  1MC0 A;  4Y15 A;  1TD5 A;  4EUZ A;  2O0Y A;  3ZVW A;  5FI6 A;  2X02 A;  2PHY A;  3MQ0 A;  4QD4 A;  4P0M A;  1DJB A;  1D7E A;  3BY9 A;  4WL9 A;  2W1R A;  2PBD P;  3ZG7 B;  4HQA A;  2PT7 A;  4PM8 A;  4KG2 A;  4GN2 A;  3T4T A;  1PYY A;  1L3L A;  3BRM A;  5K5B A;  5HWT A;  3R4K A;  3GEC A; 
#chains in the Genus database with same CATH homology
 4F3L B;  2VGL M;  2KDK A;  5HD5 A;  2K7S A;  3MQO A;  4I39 A;  3F1O A;  5HSQ A;  3HJI A;  3T4O A;  1YKD A;  4H6J A;  2YKH A;  4HJ6 A;  1XJ2 A;  3HCY A;  2PYR A;  5TJJ A;  2OWH A;  2QJ5 A;  2K2N A;  3K3D A;  2P7J A;  4MDZ A;  2ZBB A;  4F3L A;  4PKY A;  1ZHH B;  5IU1 A;  5HDC A;  1H8M A;  2KX6 A;  1LT0 A;  1XJ4 A;  2JKT M;  1OTA A;  4L0L A;  4G3W A;  4HOI A;  2VJW A;  3PBO A;  3EQU A;  4PAU A;  3ZQ5 A;  2V0U A;  1V9Z A;  2W1T B;  3NOP C;  3PR6 A;  3T50 A;  3BWL A;  3PHY A;  3LIA A;  4Q0J A;  3BW6 A;  1T1C A;  5HDD A;  3FC7 A;  5DJT A;  3H82 B;  4EEU A;  4HP4 A;  4ZRR A;  2IA2 A;  3LR5 A;  2D02 A;  4DN0 A;  4EQ1 A;  3S7Q A;  2D01 A;  4Y2F A;  5LBR A;  3T4S A;  3EWK A;  2WKP A;  1TS8 A;  3NJA A;  4ARZ B;  4EW7 A;  3MXQ A;  4R70 A;  3E4Q A;  3KSG A;  2HGV A;  2FH5 A;  2HJ9 C;  2VGL S;  4HH3 A;  4HH2 A;  4Q0H A;  4MN5 A;  3E98 A;  2M1C A;  3C38 A;  1TS7 A;  4I3A A;  2OOL A;  2XSS A;  1ODV A;  5G4Z A;  5KSH A;  3LI8 A;  3H82 A;  3NOU C;  1NRJ A;  3RTY A;  4MMN A;  3PBT A;  3G6O A;  4PKY G;  4ARZ A;  3F1N B;  4HHD A;  2WKR A;  1OTI A;  4CLC C;  1T18 A;  5DFY A;  2WKQ A;  3VE4 A;  4P6Z S;  3P7N A;  5HWV A;  3E4O A;  4HI4 A;  5CX7 A;  2L1M A;  4BMW A;  4EES A;  1N9L A;  4FOF A;  2G7U A;  1OT9 A;  1OJ5 A;  3E4P A;  1LSX A;  4O8G A;  3OLO A;  1KOU A;  3F1N A;  2QJ7 A;  3LIF A;  5TBM B;  4HP9 A;  1TS6 A;  2HJE A;  3EEH A;  4AFI A;  5DF9 A;  3LR0 A;  5HDS A;  4HJ4 A;  2J3T D;  2INW A;  1UWP X;  2A2L A;  2NUP C;  2PD8 A;  4IUH A;  3BQ8 A;  3K2N A;  3BJN A;  2B02 A;  4RQ9 A;  3MQQ A;  2QHK A;  2W3E A;  4R3A A;  1TS0 A;  1OPX A;  1UWN X;  3KYZ A;  5J7E A;  3S7P A;  2OWJ A;  1YSP A;  2GNX A;  3LIE A;  1P9R A;  4L9G A;  5F69 A;  4LRY C;  5TBM A;  2Y79 A;  3PXP A;  3RH8 B;  4DJ2 A;  2VEA A;  1OJG A;  4CLC D;  3C8C A;  4Y5F A;  3D3O A;  2L0W A;  1DRM A;  3RFB A;  1NLY A;  4I3J A;  4BBU A;  4BWI A;  2OAP 1;  2PDR A;  1Y28 A;  1YSQ A;  5C5K A;  3OBF A;  4II7 A;  2JKT I;  3B33 A;  1W63 M;  4BBT A;  2H28 A;  3EOI A;  5J4E A;  5DKL A;  3T4K A;  5L8M A;  3VV4 A;  4CLC B;  1ZTU A;  3ZYT A;  4XT2 B;  5F68 A;  2GJ3 A;  1N9O A;  3LR3 A;  2V1A A;  3JVU A;  5AVF A;  4NXE A;  1NWZ A;  3CAX A;  2HV1 A;  4KUO A;  3U2A A;  1UGU A;  2W3H A;  3TJZ C;  2ZOI A;  4L9E A;  4KQO A;  4P6Z M;  4YWZ A;  1GSX A;  4WEJ A;  3UME A;  1V9Y A;  4Z1W A;  4BBV A;  1P9W A;  3TE8 A;  2O99 A;  4CLC A;  1D06 A;  4GCZ A;  4XT2 A;  1LSW A;  5J3W A;  5I5L A;  2VA0 A;  4I38 A;  4NXF A;  3BQA A;  1VHM A;  2JN7 A;  5DFX A;  1MZU A;  2Z6C A;  2ZMF A;  1T1B A;  2VLG A;  3LYX A;  2JHE A;  4ME4 A;  2O9C A;  1XFN A;  2W27 A;  3VOL A;  2XA7 S;  3UB6 A;  2KLI A;  2W1T A;  2ZMV A;  3B47 A;  2P08 A;  2B18 A;  3CIT A;  3IS2 B;  3TRC A;  3R4K A;  2Y8H A;  2EWW A;  2A24 B;  4NKP A;  2ZOH A;  1DP8 A;  3FPV A;  3CLO A;  1S67 L;  2VV8 A;  4I3I A;  5HD3 A;  2CMN A;  4LPZ A;  1XJ3 A;  3SW1 A;  4EEP A;  3R7W B;  5EFW A;  4HNB A;  4HIA A;  3IS2 A;  2KOI A;  1VB6 A;  5AJG A;  3UB7 A;  3MR0 A;  3UE3 A;  3MFX A;  1XJ6 A;  1W63 Q;  2A24 A;  3LI9 A;  2VKS A;  1EW0 A;  4YNR A;  1OTE A;  4K08 A;  3MJQ A;  3R7W A;  4EXO A;  4EET B;  2XRO A;  2W3G A;  2JKR M;  1XFQ A;  3UB8 A;  3BY8 A;  4Q0I A;  4IJG A;  3KO6 A;  3LR4 A;  4DMZ A;  3LID A;  5DKK A;  4B9O A;  3JVV A;  2M7U A;  3EEA A;  3OOV A;  4QPR A;  1BYW A;  3F1P B;  3S7N A;  3TW8 A;  2O9A A;  2Z6D A;  3C2W A;  4JGR A;  2VV6 A;  4CQH A;  1F9I A;  3OC2 A;  2V0W A;  2EWV A;  4O0P A;  1X0O A;  1H3Q A;  3D72 A;  3PBQ A;  1YAX A;  2LB9 A;  2I9V A;  4R38 A;  5DJU A;  3LIB A;  4HY8 A;  4R6L A;  4LRX C;  1LL8 A;  3CI6 A;  2VZW A;  2XA7 M;  5F5Y A;  3VE3 A;  4G3K A;  3F1P A;  4HJ3 A;  4EU0 A;  2PR6 A;  3O5Y A;  4WF0 A;  2EA9 A;  2PR5 A;  4IUK A;  3KX0 X;  3S7O A;  5IS1 A;  4G3V A;  3EGX C;  3IBR A;  2OAQ 1;  1G28 A;  5IT5 A;  2VX8 A;  5HWW A;  4FSF A;  4NXB A;  4I5S A;  1T1A A;  4ETX A;  2O9B A;  4EER A;  5FL3 A;  2QWS A;  4KUK A;  5HL6 A;  1GSV A;  2J3W A;  3LIC A;  3FPW A;  2XRN A;  3ULF A;  5MC7 A;  4M4X A;  2QKP A;  2GX5 A;  3KYQ A;  2MJ6 A;  1NLZ A;  1IOU A;  4GHI B;  4WUJ A;  3UE6 A;  4BJP A;  4O01 A;  1OTD A;  3KSH A;  1DP9 A;  3E0Y A;  3NHQ A;  3CUE C;  3T4L A;  3T4Q A;  5F6A A;  2V1B A;  3C30 A;  3OCN A;  4L9F A;  1MKM A;  4WLA A;  1S66 L;  3H9W A;  3IBJ A;  1WA9 A;  3NOT C;  4GHI A;  4MN6 A;  4YOF A;  2HF6 A;  4UQI S;  4ETZ A;  1F98 A;  4GJ4 A;  3FG8 A;  3V67 A;  4DJ3 A;  4IHQ A;  4UEY A;  3B42 A;  5AVE A;  3PBR A;  4GW9 A;  2VV7 A;  1P0Z A;  3GDI A;  2W0N A;  2J3T C;  5KIZ A;  2L4R A;  4NXG A;  4MN7 A;  3EGD C;  5HZH A;  3EQV A;  4PHT A;  1STZ A;  1T19 A;  2JKR I;  4GS9 B;  2NUT C;  3PYP A;  3OCL A;  4CLC E;  4JGQ A;  1IFQ A;  4E04 A;  2R78 A;  3CWF A;  2YKF A;  3T4J A;  4JGP A;  2FZ0 A;  4NEE D;  3P01 A;  3A0V A;  4GLQ A;  4LLO B;  2W3D A;  3W2Z A;  1F5M A;  3MF0 A;  5HPF A;  4GS9 A;  3UMD A;  4Y3I A;  1DP6 A;  3A0S A;  2J80 A;  4OOL A;  4WN5 A;  1S1Z A;  3UB9 A;  2GZA A;  1OT6 A;  5HPI A;  2P04 A;  5A8B A;  1G6O A;  3K3C A;  3PBS A;  2PD7 A;  3MMH A;  3KSF A;  1LSV A;  2LB5 A;  1MC0 A;  4WEL A;  3HJK A;  2QYB A;  4B93 A;  1JNU A;  1TD5 A;  1S4R A;  2O0Y A;  1S1Y A;  4OOM A;  4KQD A;  3A0R A;  2PHY A;  3H7W B;  3MQ0 A;  1OTB A;  4LRZ E;  1D7E A;  3BY9 A;  4WL9 A;  2W1R A;  5G4Y A;  2K31 A;  2PYP A;  4HQA A;  2BAS A;  3F1O B;  1P97 A;  4H6J B;  4MCW A;  2DMW A;  1N9N A;  2M7V A;  2W3F A;  1GSW A;  3PBN A;  2PT7 A;  3KSI A;  4UQI M;  3CUE A;  2V9A A;  4EUV A;  3T4T A;  3DBA A;  3LUQ A;  3LFV A;  1S4S A;  4JGO A;  5K5B A;  3H7W A;  4WEK A;  5HWT A;  1TF1 A;  3GEC A;  3ICY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...