2Z6DA

Crystal structure of lov1 domain of phototropin2 from arabidopsis thaliana
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
118
structure length
118
Chain Sequence
ELKTALSTLQQTFVVSDATQPHCPIVYASSGFFTMTGYSSKEIVGRNCRFLQGPDTDKNEVAKIRDCVKNGKSYCGRLLNYKKDGTPFWNLLTVTPIKDDQGNTIKFIGMQVEVSKYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of the LOV1 dimerization of Arabidopsis phototropins 1 and 2
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
molecule keywords Phototropin-2
total genus 37
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2z6dA00
2PD8A 2VV7A 1OTEA 2OOLA 1S1YA 3NOUC 4EESA 3LIDA 1XFQA 3UMEA 1OTAA 3LI8A 5HWVA 3B33A 5J4EA 2OWHA 1XJ3A 3C2WA 4EETB 2PR6A 4F3LB 1UWNX 3UB8A 2M1CA 3VE3A 3LIAA 4JGQA 5G4ZA 5KIZA 2YKFA 5HWTA 5AVFA 2P7JA 4YWZA 3D72A 1LT0A 4KQDA 4HH2A 3E4OA 4L9FA 5A8BA 1DP9A 3CAXA 1OJ5A 1OTIA 2ZOHA 4L9GA 5HDCA 5HD3A 1T18A 3LI9A 1XJ4A 3UB9A 4HP4A 1UWPX 3HJIA 1S4RA 1D7EA 3C8CA 2V1BA 1GSWA 3HJKA 3RTYA 4I39A 1S66L 1OTBA 2VLGA 3F1PB 3K3DA 4I3AA 1N9LA 4R6LA 3T50A 1P0ZA 1T1CA 3UMDA 4HP9A 5TBMB 3VE4A 1T1AA 2L4RA 2V0UA 3ICYA 4HY8A 4GHIB 3IS2B 1G28A 4XT2B 4LRXC 5DKKA 5TBMA 4LLOB 3UB7A 1TS6A 3FC7A 1N9NA 2D02A 4JGOA 3A0VA 3MJQA 5F69A 2QKPA 2PYPA 5G4YA 2PHYA 1GSVA 2KDKA 2W27A 3CLOA 2A24B 2L1MA 4EQ1A 5HZHA 3NHQA 3EWKA 1Y28A 3NOPC 4MN6A 5J3WA 1JNUA 2WKRA 3F1OA 1OJGA 3BWLA 3F1NB 4E04A 2GJ3A 4GCZA 4GW9A 2V0WA 4GS9B 4LPZA 1TS8A 4I5SA 3CWFA 3KX0X 2PD7A 4HNBA 3UE6A 3BY8A 1S1ZA 3NJAA 4WN5A 2Z6DA 2ZOIA 1DP6A 3H7WB 1NWZA 4BBUA 4BBTA 4XT2A 3IS2A 4DJ2A 5HD5A 3PHYA 4B9OA 4R38A 2W0NA 1N9OA 2KX6A 4NXFA 2EA9A 2V9AA 4EEUA 3MXQA 2QJ5A 4RQ9A 2VV6A 2OWJA 4PKYA 1EW0A 3GDIA 3NOTC 5EFWA 4EXOA 4PKYG 4I38A 4HJ4A 3H7WA 5F68A 4JGRA 2JHEA 3G6OA 2I9VA 3MQQA 5F5YA 4DJ3A 5IU1A 4EEPA 4M4XA 1XFNA 2WKPA 4HJ3A 1T1BA 4LRYC 4GS9A 2PDRA 3H9WA 4R3AA 4HQAA 3F1NA 2INWA 3F1OB 4F3LA 3H82B 1BYWA 3LYXA 3OLOA 1TS7A 3IBRA 4WLAA 1LSXA 3A0SA 4WF0A 3SW1A 5HWWA 5HDSA 5HDDA 1DP8A 1P97A 2HV1A 2BASA 4BBVA 2A24A 3PYPA 1TS0A 1LSWA 1X0OA 4K08A 4NXEA 3VOLA 3LICA 2B02A 3H82A 2L0WA 3MQOA 3F1PA 2QWSA 2R78A 3E4QA 3MFXA 4H6JB 1GSXA 2PYRA 4HI4A 1MZUA 1DRMA 1OTDA 4KUOA 4LRZE 1LL8A 4JGPA 4KUKA 5HSQA 4NXBA 2D01A 3BY9A 4GHIA 4R70A 5DJTA 4EERA 5J7EA 4NXGA 1F98A 1ODVA 3LIEA 1XJ6A 1LSVA 3K3CA 4HHDA 2WKQA 1VB6A 4HOIA 5DJUA 1D06A 2V1AA 1OT9A 1KOUA 1S67L 1V9YA 4L9EA 2PR5A 4HJ6A 4I3IA 4WL9A 1T19A 4EW7A 2YKHA 1V9ZA 1F9IA 1OT6A 1XJ2A 3LIBA 3ULFA 4MN5A 4HH3A 3P7NA 1S4SA 1WA9A 3EEHA 2J80A 3FG8A 3LUQA 2VEAA 2VV8A 2QHKA 2Z6CA 3LIFA 5I5LA 4HIAA 2H28A 3UB6A 3RH8B 3MR0A 2JN7A 2ZBBA 3E4PA 5F6AA 5AVEA 4H6JA 5IS1A 2QJ7A 5DKLA 1UGUA 2CMNA 3A0RA 2K7SA 3GECA 3ZQ5A 4WUJA 4I3JA
chains in the Genus database with same CATH superfamily
1VEUA 4BL3A 5GL9A 3LIDA 3GTCA 1MBLA 1PI4A 1CEFA 1IYOA 2DMWA 2B18A 1D1JA 1AWIA 3BECA 3A3DA 2ZOHA 1GHIA 2ZD8A 5FQ9A 3LI9A 3FZCA 3C8CA 1RP5A 2IWDA 3FKVA 2EXAA 2HDQA 4IVKA 3T4LA 4CJNA 1K56A 5DFYA 4GNUA 1GHMA 4LCMA 1YLYA 2EFUA 2LB9A 2V2FF 4Y7PA 4BJPA 1G6AA 4LPZA 4I5SA 3QP4A 4HNBA 2Y79A 4BBUA 4GKUA 5KZHA 2VV6A 5IU1A 3ZGAB 4HJ3A 4BD1A 4KQOA 2WYXA 4ARZB 4F3LA 3H82B 1HZOA 1TS7A 3IBRA 5FASA 4WF0A 3IX3A 3SS5A 3BW6A 3O88A 3OCNA 3TG9A 4R1GA 3OOVA 3ZG5A 3WRTA 2Y2KA 2JBFA 2B95A 5EECA 1NLZA 1L0DA 4S2JA 3T4OA 3A3IA 3A0RA 4FH4A 3GRJA 1I2SA 3T4SA 3LI8A 1PNEA 2W1TB 3LCEA 3N6IA 1ERQA 2WGWA 4S2NA 3EGXC 2YKFA 4JXSA 2XQZA 5E2EA 3E4OA 2J7VA 1T18A 4OPZA 5FQJA 3BFGA 3E2KA 1YQSA 1BLSA 3OPHA 3RTYA 4I39A 4QB8A 3MZDA 4EUZA 2V0UA 3VP1A 4GHIB 4GD6A 4Q0JA 4JGOA 3TJZC 2WAEA 3ZG9B 3CMZA 5GLDA 2L1MA 3O5YA 3JVUA 4ID4A 5M19A 1L3LA 1O7EA 1YKDA 2WAFA 3F1NB 3G32A 3KYZA 2ZOIA 4BBTA 3CUEC 4X1LA 3IS2A 2P9VA 1EW0A 5CX7A 3LR4A 1WYCA 1YSQA 3H9WA 5C5KA 2INWA 1FSYA 3F1OB 3IWQA 5DF8A 2JC7A 4D2OA 5CGXA 5HWWA 4X56A 4YFMA 2XROA 3NECA 3FPVA 3MQOA 1QMFA 3KSHA 3OPRA 5AVFA 5LBRA 4L0LA 4E3NA 4GJ4A 1ODVA 3BJNA 2A49A 4WL9A 2PR5A 2WGVA 3E0YA 2J80A 4CLCE 1EWZA 5CXWA 2Z6CA 2W3HA 3LIFA 4HIAA 3UB6A 1KDWA 3TSGA 4BL2A 3TOIA 2O99A 4WUJA 2OOLA 3HLFA 3FYZA 1JWZA 5DFXA 2H0YA 3WS1A 5FA7A 4OQ0A 1LLBA 5FAPA 3MZFA 1ONGA 4P85A 1K54C 5A8BA 3FKWA 5HD3A 3T1XA 1XJ4A 3T4JA 4BMWA 4R0QA 4LGWA 3ZG7B 5TBMA 2VGJA 5DVAA 5CECA 3VOZA 2VKSA 2VX8A 4O8GA 4FH2A 1IOUA 5GHYA 3ZYTA 5CRFA 1BLPA 4RA7A 1PFLA 4GCZA 5HL1A 3CWFA 3UY6A 2J8YA 2Y4AA 2EWWA 1CEGA 2QJ5A 2UV0E 4WBGA 2OWJA 1J9MA 4K0WA 4EU0A 4WEJA 3PR6A 5EVLA 4WMCA 4M3KA 4OPQA 4WM9A 2Y2GA 3FV7A 2EX2A 2HZ5A 3UDFA 3V50A 5HDSA 4E3IA 4PPRA 4G3KA 5AQ9A 4MNRA 3NI9A 4IUHA 3T12B 3MFXA 4JGPA 2HP9A 3A3JA 3LIEA 2XA7S 2Z2LB 2LB5A 1PYYA 3IWOA 2WKQA 1L2SA 1OT9A 1KOUA 1TVFA 1HVBA 3UN7A 1K57A 1LI0A 3UE0A 4KZ9A 2J9OA 1IYSA 2V20A 4GDNA 2PBYA 4LFUA 2FZ0A 3EEAA 3UDIA 1CF0A 1W5DA 4QY5A 3G35A 4PMAA 4HBUA 3EQVA 2EWVA 3NOUC 2Q0OA 1HTZA 4O0PA 3UB8A 5G4ZA 4RX2A 2Y2PA 3ITAA 5TJJA 5CTNA 1H8YA 3E2LA 3IXHA 2PBDP 4Y0UA 2Z2MB 4FUWA 1Y54A 3WS2A 4OPRA 3MQ0A 4R6LA 2ZMVA 3SZTA 5CEDA 3IS2B 3UE3A 4IVIA 2ACGA 3IXDA 4MN6A 3BQ8A 4KG5A 4B4XA 2Z6DA 3H7WB 4OQIA 1W79A 1W8YA 1C3BA 2Y2MA 4N9LA 4GS9A 4WZ4A 4HQAA 4B4ZA 1LSXA 3IXBA 4KG2A 1DP8A 1P97A 2A24A 2Y2QA 1YMXA 3OZHA 2QWSA 3E4QA 4D60A 4CLCC 4RYEA 1YLZA 1F2KA 2Q9MA 2BLSA 1OT6A 3P7NA 3M6BA 4JBFA 2VGLM 1GHPA 1M6KA 5L10A 2W1RA 2JN7A 3V5MA 4OOMA 4UA9A 1WYBA 1S1YA 1XFQA 3BFDA 3G30A 2WKHA 3HUMA 2G2UA 4ZDXA 5KSCA 2Q9NA 1O07A 1MKIA 3NBLA 3OBFA 5FDSA 2P9VB 1NLYA 4NEED 1FOFA 1N9BA 3UMDA 4MN7A 1NXYA 3CJMA 4UEYA 3TE8A 3FC7A 3DBAA 4IHQA 4OONA 5G4YA 2JKRM 3WWXA 4EQ1A 3W2ZA 4E04A 2HJEA 4GS9B 5EVID 2RCXA 3NDEA 4UQIS 3PHYA 1KE3A 2W0NA 2V9AA 1EROA 1H0MA 1SZVA 4KQQA 2VZWA 4C75A 3WRZA 5A90A 3OLOA 3IX8A 5G18A 5TGFA 5A93A 4KG6A 4HI4A 1VETA 2ZQ9A 1ZG6A 1ACFA 3BY9A 1TDLA 2W3GA 4R70A 5IHVA 4NXGA 3HL9A 1K55A 4JKTA 3OC2A 4R4SA 4HHDA 5HL6A 2GZAA 4B88A 2BG1A 1L0FA 3LIBA 4HH3A 4EUVA 3C7UA 3EQUA 4NETA 2I72A 4Y3IA 3CPTB 1VETB 1ZHHB 1L0EA 1XJ3A 3C2WA 1G5UA 1LT0A 1XA1A 3FPWA 3CAXA 4L9GA 4BWIA 1GSWA 3GR2A 3VP4A 3F1PB 2HP6A 1P0ZA 2WZZA 3VE4A 5TR7A 4HY8A 3HVFA 4XT2B 1DY6A 4IEDA 3CG5A 3N8LA 5EVEA 4NKPA 1Y28A 2ZC6B 3IHBA 2X02A 2ZM0A 5FQKA 2QYBA 1CJFA 2UWXA 5HARA 1ONHA 3G31A 3Q7VB 4FTXA 4N1HA 4HJ4A 2I9VA 3N4IA 4LRYC 3B42A 1BULA 3QNCA 3NIAA 4EV4A 4MLLA 3HLDA 4BBVA 4JXGA 1M40A 1PWDA 1TS0A 1XA7A 2B02A 2A2LA 4H6JB 2R78A 5GLCA 4H8RA 4O01A 3NDGA 4MMNA 2OSUA 3Q81A 3C4OA 5I94A 3VSKA 1WE4A 2Y2LA 2J3TD 1VB6A 1BLHA 1IEMA 1SDEA 4JF4A 4A5RA 4PM5A 3SS4A 4MN5A 4DN0A 1KE0A 4WYYA 3SOIA 2H0TA 2VV8A 1PZOA 4HBTA 3PTEA 5HAPA 2WKEA 3RJUA 5DTSA 4ME4A 4YNRA 4H6JA 4O7DA 3ZG0A 5DF9A 2Y2JA 1OTAA 5J4EA 2ZM8A 2PR6A 2PU2A 3D72A 1I2WA 4LCLA 1OTIA 3C5AA 3LGOA 1UWPX 3S7QA 1PW8A 3HLEA 1VM1A 4E3JA 2ZQDA 1T1AA 2HDUA 3L7HA 3PBRA 4F94A 2PHYA 5AQAA 2HDSA 1MC0A 3IQAA 4NK3A 4PHTA 1PIOA 3O3VA 2EX9A 1OJGA 3F1OA 1K54A 3BY8A 1K56D 1SKFA 2PRFA 3VOYA 5EFWA 5M18A 3UPPA 3VSLA 4ZAMA 3VV4A 3F1NA 3GVBA 3PBNA 1BYWA 2EFXA 1ESIA 4X25A 2HGVA 2G7UA 3D4FA 5FI2A 4NXEA 3T50A 1IELA 1OTDA 2K2NA 5HSQA 4GHIA 5IT5A 4Y0OA 3MXSA 1E3UD 4R3BA 3AGFA 3K3CA 2OAP1 3SH9A 4HOIA 5DJUA 2V1AA 5FI6A 1K25A 2ZL1B 4I3IA 1T19A 1V9ZA 4Q8IA 4OPYA 3EEHA 3MFDA 3MXRA 4DRTA 3LO7A 4X55A 5F1GA 2ZMFA 1OPXA 4GZBA 4X1MA 5CGSA 2WKIA 2PD8A 1OTEA 4MBKA 1PZPA 3G2YA 3IXGA 3B33A 4FCFA 5EV0A 4EETB 3LIAA 4JGQA 2XD5A 1K6SA 2XEPA 4KZ8A 4ETZA 3NY4A 1S0WA 2ZMAA 3E98A 3NULA 2V1BA 2JKTI 1PRQA 4I3AA 1SCWA 1RCJA 2ZQCA 2ZJ9A 3KSFA 1G28A 2QZ6A 4PM9A 4OQHA 1LL5A 2PYPA 5FQMA 1HLUP 1BLCA 1JNUA 2WKRA 4OOYA 5J8XA 4G3VA 4GW9A 5FI7A 4JLFA 3PBSA 2Y91A 2KX6A 3KYQA 5HPIA 3QP8A 1XKZA 3AGDA 4DE0A 5F68A 4JGRA 4EEPA 4R3AA 3IF5A 1XGJA 3MKEA 4CLCD 3OPLA 4YOFA 1NRFA 3SH8A 1JTDA 1NY0A 2WZXA 3DTKA 5HDDA 2HV1A 3MKFA 1NRJA 4GB7A 3F1PA 3MMHA 1W63Q 2AVXA 5A91A 4KZ5A 2W3FA 3DTMA 1FCMA 3P98A 4X53A 3Q7VA 5CGWA 4CQHA 1XJ2A 4C3QA 5FQIA 4JXVA 5EE8A 1W63M 1PI5A 3BFFA 1JVJA 1K0KA 4HEFA 2QMIA 3BLSA 4OOLA 1PWGA 3ISGA 5CTMA 4PM6A 4Y5FA 3LR3A 3MS6A 4KZ4A 2JKTM 4WELA 4HH2A 5GLBA 4OLDA 3DW0A 1Q2PA 3UB9A 4HP4A 1KDSA 4RVAA 4ETXA 3HCYA 1K4EA 4QPRA 3P09A 5EVIB 2M7UA 1PWCA 3IT9A 3S4XA 4U0XA 1AXBA 2KDKA 2A24B 1I5QA 2XGNA 3KSIA 4C6YA 2O9BA 2GJ3A 2PU4A 3WS5A 4OP8A 1DP6A 4B9OA 3G2ZA 4E3LA 2M7VA 3MXQA 3H7WA 3CUEA 3MQQA 4QJGA 2K31A 3TW8A 4R3JA 1BSGA 5EM0A 3C4PA 4KQRA 1FCOA 3G4PA 3IH8A 3VOLA 1MZUA 4E6XA 5CHJA 5DJTA 1XPBA 1BT5A 4UA6A 5TFQA 1W8QA 5EUAA 4PM8A 4WEKA 1S67L 2ZL1A 2FH5A 1SKOA 1FILA 2O0YA 2VEAA 2QHKA 4DE1A 3S7OA 1HD8A 3E4PA 1UGUA 4CLCB 3VP2A 4DMZA 3LY4A 3UMEA 5HWVA 4II7A 3RXXA 4F3LB 1JWVA 2M1CA 5EPHA 5KSHA 2HF6A 5HWTA 2WK0A 3B3XA 4JF5A 3ZHHA 1CI8A 5FEFA 1OJ5A 4S2KA 1YMSA 2W3DA 5FSRA 2J3TC 2ZQ8A 4N1XA 3W4OA 3PAEA 1RGYA 4BD0A 2XF3A 3BRMA 3ICYA 4LRXC 5DKKA 3C38A 4LLOB 1VEUB 1P9WA 3A0VA 1YLPA 1W7FA 3R7WA 1Z6FA 5L09A 4EWFA 1PW1A 3KX0X 1P9RA 4P87A 1NWZA 2VA0A 4XUXA 5HD5A 2CC1A 3S7PA 4EBNA 3LR0A 4WMCD 2X71A 3RXWA 4I38A 1BZAA 2IWCA 3A3FA 2PDRA 3Q07A 4ZJ3A 5FL3A 2XD1A 4CPKA 1FR1A 3PYPA 1X0OA 3LICA 1GSXA 5AQ7A 2XLNA 3PBQA 4ZRRA 2Y55A 3QP1A 3V3RA 4AFIA 5EOEA 1ES5A 1MWRA 4RX3A 4K0XA 3U2AA 3S22A 2DCFA 3FG8A 3KSGA 3IH9A 3QP6A 5EVIC 1NYYA 2JKGA 1IKIA 4MBHA 5F6AA 2WGIA 5IS1A 1K57C 4QD4A 4EQIA 2DRWA 3T4QA 5FEGA 3B47A 3ZNYA 2WADA 1ALQA 4BENA 4MBFA 5HFOA 4R4RA 2OV5A 3Q82A 3ZFZA 4S2LA 3HREA 4DE3A 1KGFA 1YAXA 3BLMA 4E3KA 4EBPA 4DDSA 2KOIA 1ES2A 4G3WA 1ERMA 1S4RA 1D7EA 1MKMA 1S66L 1OTBA 5GHZA 2VLGA 3LFVA 1CK3A 2L4RA 3UB5P 5DF7A 5BOHA 3V39A 4U3TA 1N9NA 4FD8A 2Y2OA 1H5XA 1E4DA 4IJGA 3PAGA 1NYMA 3CLOA 5E2HA 3K2NA 4FSFA 1KVLA 1N4OA 4DE2A 5FQQA 2VGKA 4QHCA 4WN5A 4Y13A 4DXCA 4DKIA 2XDMA 3V67A 3T1QB 1ES4A 2EA9A 2XFSA 4RQ9A 1K55C 4HESA 2DNSA 2JHEA 1XFNA 1T1BA 1NJ4A 4P6ZM 3MBZA 1BTLA 1TEMA 3A0SA 2FFYA 3QHYA 4QU3A 2IA2A 3PXPA 5HZHA 2PYRA 2XA7M 2Y2HA 4GDBA 1J3WA 1YSPA 5D3OA 1LSVA 2XSSA 2Y2IA 5L8MA 1V9YA 4GLQA 2V8FA 3ULFA 3D9YA 4KZBA 4BQMA 3WS0A 4R23A 3VP3A 2HDRA 3C30A 3RH8B 4DF6A 2WGWB 2HPBA 3PBOA 2K7SA 3HUNA 2ZC7A 2W3EA 3CZDA 2JE5A 1OMEA 2XFTA 2G2WA 4PM7A 5KMWA 2NUTC 2OLUA 3TRCA 1IFQA 2MJ6A 2J9PA 5CHUA 1IKGA 4OH0A 2R9XA 4S2IA 1K6RA 1H3QA 4KZ7A 1KE4A 3JYIA 2E8JA 4HP9A 1DJCA 1TS6A 2XK1A 2ZLYA 2O9AA 5F69A 2XH9A 4S2PA 3Q1FA 3NHQA 3MZEA 3DWKA 5E43A 5GLAA 1DJBA 1IYQA 1Z09A 4DJ2A 4B93A 1S6RA 3S1YA 4PKYA 5L07A 3GDIA 3NOTC 1L0GA 3G6OA 5F5YA 4CLCA 1ZC2A 2WKPA 2ZQAA 3P01A 3LYXA 1LL9A 3KO6A 4WLAA 1DJAA 1E25A 1ZG4A 3BFEA 4LV3A 1SKOB 5L2FA 2HJ9C 1LHYA 3GSGA 1Q2QA 3OCLA 1XJ6A 1NZOA 4Z9QA 5JYOA 3IF6C 4JPMA 3UO9A 4EW7A 2Y59A 5GHXA 1ZTUA 1WA9A 3L9KA 1MXOA 2PT7A 5I5LA 3UDXA 2VGLS 4KENB 1XGIA 2WUQA 3GECA 3ZQ5A 4EESA 2V8CA 3M6HA 1SHVA 3IBJA 4ZJ2A 3DTIA 4OQGA 4YWZA 2HP5A 5EVIA 4EBLA 2QPNA 3N7WA 3QP5A 3HJIA 2GX5A 3HJKA 3R4KA 5E2FA 2C5WB 1YLWA 2EX8A 2D02A 3MJQA 4P6BA 2QKPA 4ZTKA 2B5RA 5AQBA 2X01A 3UPOA 2PD7A 3G34A 4R38A 1G6OA 3A3EA 5CERA 4EXOA 4PKYG 4DJ3A 4OVDA 1Y4OA 1F5MA 2OAQ1 2FFFB 3SW1A 3JPUA 4KZ3A 3HLWA 4K08A 3H82A 2L0WA 4BLMA 3IF6A 1LL8A 3CI6A 4NXBA 5F83A 2JKRI 1YT4A 1H8MA 3RFBA 1EI5A 4JXWA 1D06A 4EEUA 1JWPA 2H5SA 2NUPC 2YKHA 4XXRA 4GD8A 5EM1A 3MSHA 5F82A 3EGDC 4X68A 3UE1A 4QWOA 4LENA 2IWBA 2H28A 5AVEA 5DKLA 1FQGA 1MWUA 1XP4A 5HAQA 2OWHA 4PAUA 1TDGA 5F1FA 3O86A 1DP9A 3O87A 2VJWA 2ZQ7A 4OKPA 2Y8HA 2C6WB 1K38A 2PAVP 2OLVA 2P08A 1N9LA 1YLTA 3I7JA 1T1CA 5HX9A 5MC7A 4E6WA 3LR5A 4N92A 3UB7A 4MCWA 2P04A 1VHMA 2EX6A 2XRNA 3VP0A 2W27A 3GV9A 4Z1WA 3NOPC 3DAVA 3Q7ZA 3KYEA 4S2OA 1BUEA 3DWZA 2XR0A 4GOGA 3UE6A 1SDNA 5K5BA 3FWLA 4ZBEA 2E8IA 4YINA 2P74A 4ESPA 2BTFP 3N8RA 2O9CA 4OP5A 4WZ5C 1YLJA 5DTKA 1YPRA 4P6ZS 2J3WA 3CITA 4Q0HA 4Q0IA 1LSWA 1FIKA 3W8KA 4KUOA 1NZUA 4KUKA 2D01A 2GDNA 4EERA 1FSWA 2Y2NA 3ZNTA 1XXMA 5FATA 3HLBA 3C7VA 4Y15A 1KVMA 3HBRA 1MWSA 3IWIA 3GQZA 2A3UA 3T1RA 3BYDA 1ESUA 2ZBBA 3EOIA 3LEQA 4XUZA 5EOOA 4LV0A 3LY3A 1A0KA 4I3JA 2VV7A 3HLGA 3SH7A 3W4QA 4Y0TA 1UWNX 2P7JA 4KQDA 3T4TA 4L9FA 4NG2A 5HDCA 1GA9A 4IUKA 1MWTA 4ZJ1A 4S2NC 1H8ZA 3UNWA 5TBMB 3BFCA 4E3OA 1TF1A 5FAQA 4DDYA 1ES3A 3AGEA 3WS4A 3JVVA 3SS3A 3BWLA 3QP2A 2ZC4B 1TS8A 5HAIA 3ZDJA 3ZVWA 1QMEA 1S1ZA 3NJAA 2JCHA 1IYPA 5AJGA 5HW3A 1MY8A 5A92A 1E3UA 5FDHA 1CI9A 3D3OA 3R7WB 3N8SA 3T4KA 4LRZE 5U47A 1TD5A 1F98A 1MPLA 4UHUA 3DTEA 3VMAA 3CHWP 2ZM2A 3IX4A 3V3SA 3NCKA 3U4LP 1K4FA 2GNXA 3MF0A 5CEBA 3BQAA 3VFHA 1GCEA 2QJ7A 3PBTA 4DXBA 4N9KA 1G68A 4S2MA 4KZ6A 3T1SA 2JKFA 1ZKJA 4U0TA 2H10A 3VE3A 5KIZA 1FCNA 4P0MA 3M2JA 2ZC3B 4E3MA 3QNBA 4IBXA 1U60A 4FOFA 4WZ5A 1KGEA 2RL3A 3K3DA 3LEZA 4X6TA 3BM6A 2V1ZA 3HLCA 3IF6B 2KLIA 2ZC5B 1GSVA 3IHAA 5CHMA 3EWKA 1FR6A 5J3WA 5FAOA 4K91A 5HPFA 1JTGA 3S7NA 2V0WA 3CPTA 4Y17A 3BEBA 4X69A 4XT2A 1KGGA 3ZVTA 1N9OA 4NXFA 4UQIM 5E2GA 4OLGA 4IBRA 4GN2A 4M4XA 4LV1A 3HUOA 3VFFA 3NC8A 3ZCZA 3OPPA 1STZA 2BASA 4UA7A 1XX2A 4MDZA 3UPNA 1DRMA 1RGZA 1YM1A 4JF6A 1VQQA 5J7EA 1LI9A 5M1AA 4L9EA 4HJ6A 3GMWA 3ITBA 4Y2FA 4LV2A 1F9IA 2EXBA 2W1TA 3W4PA 1S4SA 3LUQA 1CQAA 1GA0A 3ZG8B 2VK3A 4KZAA 5DTTA 5JYPA 4QY6A 4MEZA 3MR0A 4UAAA 4ARZA 2R9WA 3M2KA 2CMNA
chains in the Genus database with same CATH topology
4OOLA 1S1YA 4EESA 3LIDA 1XFQA 4Y5FA 3LR3A 3IBJA 2DMWA 2JKTM 2B18A 4WELA 4YWZA 4HH2A 2ZOHA 3LI9A 3UB9A 3OBFA 4HP4A 3HJIA 4ETXA 2GX5A 3HJKA 3C8CA 1NLYA 3HCYA 3R4KA 4QPRA 4NEED 3UMDA 4MN7A 2M7UA 3T4LA 4UEYA 3TE8A 3FC7A 3DBAA 5DFYA 2D02A 4IHQA 3MJQA 2QKPA 5G4YA 2KDKA 2LB9A 2A24B 2JKRM 4EQ1A 3W2ZA 4BJPA 3KSIA 4E04A 2HJEA 2O9BA 2GJ3A 4GS9B 4LPZA 4I5SA 4HNBA 2PD7A 4UQIS 1DP6A 2Y79A 4BBUA 3PHYA 4B9OA 4R38A 2W0NA 1G6OA 2V9AA 2M7VA 3MXQA 2VV6A 4EXOA 4PKYG 4DJ3A 3H7WA 3CUEA 3MQQA 2VZWA 5IU1A 4HJ3A 1F5MA 2OAQ1 2K31A 3TW8A 4KQOA 4ARZB 4F3LA 3H82B 3OLOA 1TS7A 3IBRA 3SW1A 4WF0A 4K08A 3VOLA 3H82A 2L0WA 3BW6A 4HI4A 1MZUA 1LL8A 3CI6A 3BY9A 4NXBA 3OCNA 2W3GA 4R70A 5DJTA 2JKRI 4NXGA 1H8MA 3RFBA 3OC2A 3OOVA 4HHDA 5HL6A 2GZAA 4WEKA 1D06A 4EEUA 1S67L 2NUPC 2YKHA 3LIBA 2FH5A 4HH3A 2O0YA 2VEAA 3EGDC 4EUVA 2QHKA 3EQUA 1NLZA 2H28A 3S7OA 4Y3IA 3E4PA 5AVEA 3T4OA 5DKLA 1UGUA 3A0RA 4CLCB 1ZHHB 4DMZA 3T4SA 3UMEA 3LI8A 5HWVA 2OWHA 4II7A 1XJ3A 3C2WA 2W1TB 4PAUA 4F3LB 2M1CA 5KSHA 3EGXC 2HF6A 2YKFA 5HWTA 1LT0A 3E4OA 3FPWA 1DP9A 3CAXA 1OJ5A 4L9GA 2VJWA 1T18A 2W3DA 2J3TC 4BWIA 2Y8HA 3RTYA 1GSWA 4I39A 2P08A 3F1PB 1N9LA 1P0ZA 1T1CA 3VE4A 5MC7A 2V0UA 3ICYA 4HY8A 3LR5A 4GHIB 4Q0JA 4XT2B 4LRXC 5DKKA 3C38A 4LLOB 4MCWA 3UB7A 2P04A 1VHMA 4JGOA 1P9WA 3A0VA 2XRNA 3TJZC 2W27A 3R7WA 2L1MA 3O5YA 4Z1WA 3JVUA 4NKPA 1Y28A 3NOPC 1YKDA 3F1NB 2QYBA 3UE6A 3KX0X 3KYZA 1P9RA 2ZOIA 4BBTA 1NWZA 3CUEC 3IS2A 2VA0A 5HD5A 5K5BA 3S7PA 3LR0A 1EW0A 5CX7A 3LR4A 4HJ4A 4I38A 2I9VA 4LRYC 2O9CA 1YSQA 3B42A 2PDRA 3H9WA 5C5KA 2INWA 3F1OB 5HWWA 4P6ZS 2J3WA 5FL3A 3CITA 4BBVA 4Q0HA 3PYPA 4Q0IA 1TS0A 1LSWA 1X0OA 2XROA 3LICA 2B02A 3FPVA 3MQOA 2A2LA 4H6JB 2R78A 3KSHA 4KUOA 1GSXA 5AVFA 5LBRA 4O01A 4KUKA 4L0LA 4MMNA 2D01A 4GJ4A 4EERA 1ODVA 3PBQA 4ZRRA 4AFIA 2J3TD 1VB6A 3BJNA 4WL9A 2PR5A 4MN5A 3U2AA 4DN0A 3E0YA 2J80A 3FG8A 3KSGA 4CLCE 2VV8A 2Z6CA 2W3HA 3LIFA 4HIAA 3UB6A 2ZBBA 4ME4A 3EOIA 4YNRA 5F6AA 4H6JA 5IS1A 2O99A 3T4QA 4WUJA 3B47A 4I3JA 2VV7A 2OOLA 5DF9A 1OTAA 5J4EA 5DFXA 2PR6A 1UWNX 1YAXA 2P7JA 3D72A 4KQDA 3T4TA 4L9FA 5A8BA 1OTIA 5HDCA 5HD3A 1XJ4A 2KOIA 4G3WA 1UWPX 4IUKA 1S4RA 3T4JA 3S7QA 1D7EA 1MKMA 1S66L 1OTBA 4BMWA 2VLGA 3LFVA 5TBMB 1T1AA 2L4RA 5TBMA 1TF1A 1N9NA 3PBRA 2PHYA 4IJGA 2VKSA 2VX8A 3CLOA 3K2NA 4O8GA 1IOUA 1MC0A 3ZYTA 4PHTA 3JVVA 4FSFA 3F1OA 1OJGA 3BWLA 4GCZA 1TS8A 3CWFA 3BY8A 1S1ZA 3NJAA 4WN5A 3V67A 2EA9A 2EWWA 5AJGA 4RQ9A 2QJ5A 2OWJA 5EFWA 4EU0A 4WEJA 3PR6A 2JHEA 1XFNA 1T1BA 4P6ZM 3VV4A 3F1NA 3PBNA 1BYWA 3A0SA 5HDSA 2HGVA 3D3OA 2G7UA 4G3KA 3R7WB 2IA2A 4NXEA 3PXPA 4IUHA 3T50A 3MFXA 5HZHA 3T4KA 2PYRA 1OTDA 4LRZE 2K2NA 2XA7M 4JGPA 5HSQA 1TD5A 4GHIA 5IT5A 1YSPA 1F98A 3LIEA 2XA7S 2LB5A 1LSVA 2OAP1 3K3CA 2WKQA 2XSSA 4HOIA 5DJUA 2V1AA 1OT9A 1KOUA 5L8MA 1V9YA 4I3IA 4GLQA 1T19A 1V9ZA 3ULFA 3EEHA 2GNXA 3MF0A 2ZMFA 3BQAA 3C30A 3RH8B 2FZ0A 1OPXA 3EEAA 2QJ7A 3PBTA 3PBOA 2K7SA 2PD8A 1OTEA 3EQVA 2EWVA 3NOUC 3B33A 2W3EA 4EETB 4O0PA 3UB8A 3VE3A 3LIAA 4JGQA 5G4ZA 2NUTC 5KIZA 5TJJA 3TRCA 1IFQA 2MJ6A 4ETZA 4FOFA 3E98A 1H3QA 2V1BA 3MQ0A 2JKTI 3K3DA 4I3AA 4R6LA 4HP9A 2ZMVA 3KSFA 3IS2B 1G28A 1TS6A 3UE3A 2O9AA 5F69A 2KLIA 2PYPA 1GSVA 3NHQA 3EWKA 4MN6A 5J3WA 1JNUA 2WKRA 3BQ8A 5HPFA 4G3VA 3S7NA 4GW9A 2V0WA 3PBSA 2Z6DA 3H7WB 4XT2A 4DJ2A 4B93A 1N9OA 2KX6A 3KYQA 4NXFA 4UQIM 5HPIA 4PKYA 3GDIA 3NOTC 5F68A 4JGRA 3G6OA 5F5YA 4EEPA 4CLCA 4M4XA 2WKPA 4GS9A 4R3AA 3P01A 4HQAA 4CLCD 3LYXA 4YOFA 3KO6A 4WLAA 1LSXA 1STZA 5HDDA 1DP8A 1P97A 2HV1A 2BASA 2A24A 1NRJA 4MDZA 3MMHA 3F1PA 2HJ9C 2QWSA 1W63Q 3E4QA 1DRMA 3OCLA 2W3FA 4CLCC 5J7EA 1XJ6A 4L9EA 4HJ6A 4CQHA 4EW7A 4Y2FA 1ZTUA 1F9IA 1OT6A 1XJ2A 2W1TA 3P7NA 1S4SA 3LUQA 1WA9A 1W63M 2PT7A 2VGLM 5I5LA 2W1RA 3MR0A 2JN7A 4ARZA 2VGLS 4OOMA 2CMNA 3GECA 3ZQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PD8 A;  2VV7 A;  1OTE A;  2OOL A;  1S1Y A;  3NOU C;  4EES A;  3LID A;  1XFQ A;  3UME A;  1OTA A;  3LI8 A;  5HWV A;  3B33 A;  5J4E A;  2OWH A;  1XJ3 A;  3C2W A;  4EET B;  2PR6 A;  4F3L B;  1UWN X;  3UB8 A;  2M1C A;  3VE3 A;  3LIA A;  4JGQ A;  5G4Z A;  5KIZ A;  2YKF A;  5HWT A;  5AVF A;  2P7J A;  4YWZ A;  3D72 A;  1LT0 A;  4KQD A;  4HH2 A;  3E4O A;  4L9F A;  5A8B A;  1DP9 A;  3CAX A;  1OJ5 A;  1OTI A;  2ZOH A;  4L9G A;  5HDC A;  5HD3 A;  1T18 A;  3LI9 A;  1XJ4 A;  3UB9 A;  4HP4 A;  1UWP X;  3HJI A;  1S4R A;  1D7E A;  3C8C A;  2V1B A;  1GSW A;  3HJK A;  3RTY A;  4I39 A;  1S66 L;  1OTB A;  2VLG A;  3F1P B;  3K3D A;  4I3A A;  1N9L A;  4R6L A;  3T50 A;  1P0Z A;  1T1C A;  3UMD A;  4HP9 A;  5TBM B;  3VE4 A;  1T1A A;  2L4R A;  2V0U A;  3ICY A;  4HY8 A;  4GHI B;  3IS2 B;  1G28 A;  4XT2 B;  4LRX C;  5DKK A;  5TBM A;  4LLO B;  3UB7 A;  1TS6 A;  3FC7 A;  1N9N A;  2D02 A;  4JGO A;  3A0V A;  3MJQ A;  5F69 A;  2QKP A;  2PYP A;  5G4Y A;  2PHY A;  1GSV A;  2KDK A;  2W27 A;  3CLO A;  2A24 B;  2L1M A;  4EQ1 A;  5HZH A;  3NHQ A;  3EWK A;  1Y28 A;  3NOP C;  4MN6 A;  5J3W A;  1JNU A;  2WKR A;  3F1O A;  1OJG A;  3BWL A;  3F1N B;  4E04 A;  2GJ3 A;  4GCZ A;  4GW9 A;  2V0W A;  4GS9 B;  4LPZ A;  1TS8 A;  4I5S A;  3CWF A;  3KX0 X;  2PD7 A;  4HNB A;  3UE6 A;  3BY8 A;  1S1Z A;  3NJA A;  4WN5 A;  2Z6D A;  2ZOI A;  1DP6 A;  3H7W B;  1NWZ A;  4BBU A;  4BBT A;  4XT2 A;  3IS2 A;  4DJ2 A;  5HD5 A;  3PHY A;  4B9O A;  4R38 A;  2W0N A;  1N9O A;  2KX6 A;  4NXF A;  2EA9 A;  2V9A A;  4EEU A;  3MXQ A;  2QJ5 A;  4RQ9 A;  2VV6 A;  2OWJ A;  4PKY A;  1EW0 A;  3GDI A;  3NOT C;  5EFW A;  4EXO A;  4PKY G;  4I38 A;  4HJ4 A;  3H7W A;  5F68 A;  4JGR A;  2JHE A;  3G6O A;  2I9V A;  3MQQ A;  5F5Y A;  4DJ3 A;  5IU1 A;  4EEP A;  4M4X A;  1XFN A;  2WKP A;  4HJ3 A;  1T1B A;  4LRY C;  4GS9 A;  2PDR A;  3H9W A;  4R3A A;  4HQA A;  3F1N A;  2INW A;  3F1O B;  4F3L A;  3H82 B;  1BYW A;  3LYX A;  3OLO A;  1TS7 A;  3IBR A;  4WLA A;  1LSX A;  3A0S A;  4WF0 A;  3SW1 A;  5HWW A;  5HDS A;  5HDD A;  1DP8 A;  1P97 A;  2HV1 A;  2BAS A;  4BBV A;  2A24 A;  3PYP A;  1TS0 A;  1LSW A;  1X0O A;  4K08 A;  4NXE A;  3VOL A;  3LIC A;  2B02 A;  3H82 A;  2L0W A;  3MQO A;  3F1P A;  2QWS A;  2R78 A;  3E4Q A;  3MFX A;  4H6J B;  1GSX A;  2PYR A;  4HI4 A;  1MZU A;  1DRM A;  1OTD A;  4KUO A;  4LRZ E;  1LL8 A;  4JGP A;  4KUK A;  5HSQ A;  4NXB A;  2D01 A;  3BY9 A;  4GHI A;  4R70 A;  5DJT A;  4EER A;  5J7E A;  4NXG A;  1F98 A;  1ODV A;  3LIE A;  1XJ6 A;  1LSV A;  3K3C A;  4HHD A;  2WKQ A;  1VB6 A;  4HOI A;  5DJU A;  1D06 A;  2V1A A;  1OT9 A;  1KOU A;  1S67 L;  1V9Y A;  4L9E A;  2PR5 A;  4HJ6 A;  4I3I A;  4WL9 A;  1T19 A;  4EW7 A;  2YKH A;  1V9Z A;  1F9I A;  1OT6 A;  1XJ2 A;  3LIB A;  3ULF A;  4MN5 A;  4HH3 A;  3P7N A;  1S4S A;  1WA9 A;  3EEH A;  2J80 A;  3FG8 A;  3LUQ A;  2VEA A;  2VV8 A;  2QHK A;  2Z6C A;  3LIF A;  5I5L A;  4HIA A;  2H28 A;  3UB6 A;  3RH8 B;  3MR0 A;  2JN7 A;  2ZBB A;  3E4P A;  5F6A A;  5AVE A;  4H6J A;  5IS1 A;  2QJ7 A;  5DKL A;  1UGU A;  2CMN A;  3A0R A;  2K7S A;  3GEC A;  3ZQ5 A;  4WUJ A;  4I3J A; 
#chains in the Genus database with same CATH topology
 1VEU A;  4BL3 A;  5GL9 A;  3LID A;  3GTC A;  1MBL A;  1PI4 A;  1CEF A;  1IYO A;  2DMW A;  2B18 A;  1D1J A;  1AWI A;  3BEC A;  3A3D A;  2ZOH A;  1GHI A;  2ZD8 A;  5FQ9 A;  3LI9 A;  3FZC A;  3C8C A;  1RP5 A;  2IWD A;  3FKV A;  2EXA A;  2HDQ A;  4IVK A;  3T4L A;  4CJN A;  1K56 A;  5DFY A;  4GNU A;  1GHM A;  4LCM A;  1YLY A;  2EFU A;  2LB9 A;  2V2F F;  4Y7P A;  4BJP A;  1G6A A;  4LPZ A;  4I5S A;  3QP4 A;  4HNB A;  2Y79 A;  4BBU A;  4GKU A;  5KZH A;  2VV6 A;  5IU1 A;  3ZGA B;  4HJ3 A;  4BD1 A;  4KQO A;  2WYX A;  4ARZ B;  4F3L A;  3H82 B;  1HZO A;  1TS7 A;  3IBR A;  5FAS A;  4WF0 A;  3IX3 A;  3SS5 A;  3BW6 A;  3O88 A;  3OCN A;  3TG9 A;  4R1G A;  3OOV A;  3ZG5 A;  3WRT A;  2Y2K A;  2JBF A;  2B95 A;  5EEC A;  1NLZ A;  1L0D A;  4S2J A;  3T4O A;  3A3I A;  3A0R A;  4FH4 A;  3GRJ A;  1I2S A;  3T4S A;  3LI8 A;  1PNE A;  2W1T B;  3LCE A;  3N6I A;  1ERQ A;  2WGW A;  4S2N A;  3EGX C;  2YKF A;  4JXS A;  2XQZ A;  5E2E A;  3E4O A;  2J7V A;  1T18 A;  4OPZ A;  5FQJ A;  3BFG A;  3E2K A;  1YQS A;  1BLS A;  3OPH A;  3RTY A;  4I39 A;  4QB8 A;  3MZD A;  4EUZ A;  2V0U A;  3VP1 A;  4GHI B;  4GD6 A;  4Q0J A;  4JGO A;  3TJZ C;  2WAE A;  3ZG9 B;  3CMZ A;  5GLD A;  2L1M A;  3O5Y A;  3JVU A;  4ID4 A;  5M19 A;  1L3L A;  1O7E A;  1YKD A;  2WAF A;  3F1N B;  3G32 A;  3KYZ A;  2ZOI A;  4BBT A;  3CUE C;  4X1L A;  3IS2 A;  2P9V A;  1EW0 A;  5CX7 A;  3LR4 A;  1WYC A;  1YSQ A;  3H9W A;  5C5K A;  2INW A;  1FSY A;  3F1O B;  3IWQ A;  5DF8 A;  2JC7 A;  4D2O A;  5CGX A;  5HWW A;  4X56 A;  4YFM A;  2XRO A;  3NEC A;  3FPV A;  3MQO A;  1QMF A;  3KSH A;  3OPR A;  5AVF A;  5LBR A;  4L0L A;  4E3N A;  4GJ4 A;  1ODV A;  3BJN A;  2A49 A;  4WL9 A;  2PR5 A;  2WGV A;  3E0Y A;  2J80 A;  4CLC E;  1EWZ A;  5CXW A;  2Z6C A;  2W3H A;  3LIF A;  4HIA A;  3UB6 A;  1KDW A;  3TSG A;  4BL2 A;  3TOI A;  2O99 A;  4WUJ A;  2OOL A;  3HLF A;  3FYZ A;  1JWZ A;  5DFX A;  2H0Y A;  3WS1 A;  5FA7 A;  4OQ0 A;  1LLB A;  5FAP A;  3MZF A;  1ONG A;  4P85 A;  1K54 C;  5A8B A;  3FKW A;  5HD3 A;  3T1X A;  1XJ4 A;  3T4J A;  4BMW A;  4R0Q A;  4LGW A;  3ZG7 B;  5TBM A;  2VGJ A;  5DVA A;  5CEC A;  3VOZ A;  2VKS A;  2VX8 A;  4O8G A;  4FH2 A;  1IOU A;  5GHY A;  3ZYT A;  5CRF A;  1BLP A;  4RA7 A;  1PFL A;  4GCZ A;  5HL1 A;  3CWF A;  3UY6 A;  2J8Y A;  2Y4A A;  2EWW A;  1CEG A;  2QJ5 A;  2UV0 E;  4WBG A;  2OWJ A;  1J9M A;  4K0W A;  4EU0 A;  4WEJ A;  3PR6 A;  5EVL A;  4WMC A;  4M3K A;  4OPQ A;  4WM9 A;  2Y2G A;  3FV7 A;  2EX2 A;  2HZ5 A;  3UDF A;  3V50 A;  5HDS A;  4E3I A;  4PPR A;  4G3K A;  5AQ9 A;  4MNR A;  3NI9 A;  4IUH A;  3T12 B;  3MFX A;  4JGP A;  2HP9 A;  3A3J A;  3LIE A;  2XA7 S;  2Z2L B;  2LB5 A;  1PYY A;  3IWO A;  2WKQ A;  1L2S A;  1OT9 A;  1KOU A;  1TVF A;  1HVB A;  3UN7 A;  1K57 A;  1LI0 A;  3UE0 A;  4KZ9 A;  2J9O A;  1IYS A;  2V20 A;  4GDN A;  2PBY A;  4LFU A;  2FZ0 A;  3EEA A;  3UDI A;  1CF0 A;  1W5D A;  4QY5 A;  3G35 A;  4PMA A;  4HBU A;  3EQV A;  2EWV A;  3NOU C;  2Q0O A;  1HTZ A;  4O0P A;  3UB8 A;  5G4Z A;  4RX2 A;  2Y2P A;  3ITA A;  5TJJ A;  5CTN A;  1H8Y A;  3E2L A;  3IXH A;  2PBD P;  4Y0U A;  2Z2M B;  4FUW A;  1Y54 A;  3WS2 A;  4OPR A;  3MQ0 A;  4R6L A;  2ZMV A;  3SZT A;  5CED A;  3IS2 B;  3UE3 A;  4IVI A;  2ACG A;  3IXD A;  4MN6 A;  3BQ8 A;  4KG5 A;  4B4X A;  2Z6D A;  3H7W B;  4OQI A;  1W79 A;  1W8Y A;  1C3B A;  2Y2M A;  4N9L A;  4GS9 A;  4WZ4 A;  4HQA A;  4B4Z A;  1LSX A;  3IXB A;  4KG2 A;  1DP8 A;  1P97 A;  2A24 A;  2Y2Q A;  1YMX A;  3OZH A;  2QWS A;  3E4Q A;  4D60 A;  4CLC C;  4RYE A;  1YLZ A;  1F2K A;  2Q9M A;  2BLS A;  1OT6 A;  3P7N A;  3M6B A;  4JBF A;  2VGL M;  1GHP A;  1M6K A;  5L10 A;  2W1R A;  2JN7 A;  3V5M A;  4OOM A;  4UA9 A;  1WYB A;  1S1Y A;  1XFQ A;  3BFD A;  3G30 A;  2WKH A;  3HUM A;  2G2U A;  4ZDX A;  5KSC A;  2Q9N A;  1O07 A;  1MKI A;  3NBL A;  3OBF A;  5FDS A;  2P9V B;  1NLY A;  4NEE D;  1FOF A;  1N9B A;  3UMD A;  4MN7 A;  1NXY A;  3CJM A;  4UEY A;  3TE8 A;  3FC7 A;  3DBA A;  4IHQ A;  4OON A;  5G4Y A;  2JKR M;  3WWX A;  4EQ1 A;  3W2Z A;  4E04 A;  2HJE A;  4GS9 B;  5EVI D;  2RCX A;  3NDE A;  4UQI S;  3PHY A;  1KE3 A;  2W0N A;  2V9A A;  1ERO A;  1H0M A;  1SZV A;  4KQQ A;  2VZW A;  4C75 A;  3WRZ A;  5A90 A;  3OLO A;  3IX8 A;  5G18 A;  5TGF A;  5A93 A;  4KG6 A;  4HI4 A;  1VET A;  2ZQ9 A;  1ZG6 A;  1ACF A;  3BY9 A;  1TDL A;  2W3G A;  4R70 A;  5IHV A;  4NXG A;  3HL9 A;  1K55 A;  4JKT A;  3OC2 A;  4R4S A;  4HHD A;  5HL6 A;  2GZA A;  4B88 A;  2BG1 A;  1L0F A;  3LIB A;  4HH3 A;  4EUV A;  3C7U A;  3EQU A;  4NET A;  2I72 A;  4Y3I A;  3CPT B;  1VET B;  1ZHH B;  1L0E A;  1XJ3 A;  3C2W A;  1G5U A;  1LT0 A;  1XA1 A;  3FPW A;  3CAX A;  4L9G A;  4BWI A;  1GSW A;  3GR2 A;  3VP4 A;  3F1P B;  2HP6 A;  1P0Z A;  2WZZ A;  3VE4 A;  5TR7 A;  4HY8 A;  3HVF A;  4XT2 B;  1DY6 A;  4IED A;  3CG5 A;  3N8L A;  5EVE A;  4NKP A;  1Y28 A;  2ZC6 B;  3IHB A;  2X02 A;  2ZM0 A;  5FQK A;  2QYB A;  1CJF A;  2UWX A;  5HAR A;  1ONH A;  3G31 A;  3Q7V B;  4FTX A;  4N1H A;  4HJ4 A;  2I9V A;  3N4I A;  4LRY C;  3B42 A;  1BUL A;  3QNC A;  3NIA A;  4EV4 A;  4MLL A;  3HLD A;  4BBV A;  4JXG A;  1M40 A;  1PWD A;  1TS0 A;  1XA7 A;  2B02 A;  2A2L A;  4H6J B;  2R78 A;  5GLC A;  4H8R A;  4O01 A;  3NDG A;  4MMN A;  2OSU A;  3Q81 A;  3C4O A;  5I94 A;  3VSK A;  1WE4 A;  2Y2L A;  2J3T D;  1VB6 A;  1BLH A;  1IEM A;  1SDE A;  4JF4 A;  4A5R A;  4PM5 A;  3SS4 A;  4MN5 A;  4DN0 A;  1KE0 A;  4WYY A;  3SOI A;  2H0T A;  2VV8 A;  1PZO A;  4HBT A;  3PTE A;  5HAP A;  2WKE A;  3RJU A;  5DTS A;  4ME4 A;  4YNR A;  4H6J A;  4O7D A;  3ZG0 A;  5DF9 A;  2Y2J A;  1OTA A;  5J4E A;  2ZM8 A;  2PR6 A;  2PU2 A;  3D72 A;  1I2W A;  4LCL A;  1OTI A;  3C5A A;  3LGO A;  1UWP X;  3S7Q A;  1PW8 A;  3HLE A;  1VM1 A;  4E3J A;  2ZQD A;  1T1A A;  2HDU A;  3L7H A;  3PBR A;  4F94 A;  2PHY A;  5AQA A;  2HDS A;  1MC0 A;  3IQA A;  4NK3 A;  4PHT A;  1PIO A;  3O3V A;  2EX9 A;  1OJG A;  3F1O A;  1K54 A;  3BY8 A;  1K56 D;  1SKF A;  2PRF A;  3VOY A;  5EFW A;  5M18 A;  3UPP A;  3VSL A;  4ZAM A;  3VV4 A;  3F1N A;  3GVB A;  3PBN A;  1BYW A;  2EFX A;  1ESI A;  4X25 A;  2HGV A;  2G7U A;  3D4F A;  5FI2 A;  4NXE A;  3T50 A;  1IEL A;  1OTD A;  2K2N A;  5HSQ A;  4GHI A;  5IT5 A;  4Y0O A;  3MXS A;  1E3U D;  4R3B A;  3AGF A;  3K3C A;  2OAP 1;  3SH9 A;  4HOI A;  5DJU A;  2V1A A;  5FI6 A;  1K25 A;  2ZL1 B;  4I3I A;  1T19 A;  1V9Z A;  4Q8I A;  4OPY A;  3EEH A;  3MFD A;  3MXR A;  4DRT A;  3LO7 A;  4X55 A;  5F1G A;  2ZMF A;  1OPX A;  4GZB A;  4X1M A;  5CGS A;  2WKI A;  2PD8 A;  1OTE A;  4MBK A;  1PZP A;  3G2Y A;  3IXG A;  3B33 A;  4FCF A;  5EV0 A;  4EET B;  3LIA A;  4JGQ A;  2XD5 A;  1K6S A;  2XEP A;  4KZ8 A;  4ETZ A;  3NY4 A;  1S0W A;  2ZMA A;  3E98 A;  3NUL A;  2V1B A;  2JKT I;  1PRQ A;  4I3A A;  1SCW A;  1RCJ A;  2ZQC A;  2ZJ9 A;  3KSF A;  1G28 A;  2QZ6 A;  4PM9 A;  4OQH A;  1LL5 A;  2PYP A;  5FQM A;  1HLU P;  1BLC A;  1JNU A;  2WKR A;  4OOY A;  5J8X A;  4G3V A;  4GW9 A;  5FI7 A;  4JLF A;  3PBS A;  2Y91 A;  2KX6 A;  3KYQ A;  5HPI A;  3QP8 A;  1XKZ A;  3AGD A;  4DE0 A;  5F68 A;  4JGR A;  4EEP A;  4R3A A;  3IF5 A;  1XGJ A;  3MKE A;  4CLC D;  3OPL A;  4YOF A;  1NRF A;  3SH8 A;  1JTD A;  1NY0 A;  2WZX A;  3DTK A;  5HDD A;  2HV1 A;  3MKF A;  1NRJ A;  4GB7 A;  3F1P A;  3MMH A;  1W63 Q;  2AVX A;  5A91 A;  4KZ5 A;  2W3F A;  3DTM A;  1FCM A;  3P98 A;  4X53 A;  3Q7V A;  5CGW A;  4CQH A;  1XJ2 A;  4C3Q A;  5FQI A;  4JXV A;  5EE8 A;  1W63 M;  1PI5 A;  3BFF A;  1JVJ A;  1K0K A;  4HEF A;  2QMI A;  3BLS A;  4OOL A;  1PWG A;  3ISG A;  5CTM A;  4PM6 A;  4Y5F A;  3LR3 A;  3MS6 A;  4KZ4 A;  2JKT M;  4WEL A;  4HH2 A;  5GLB A;  4OLD A;  3DW0 A;  1Q2P A;  3UB9 A;  4HP4 A;  1KDS A;  4RVA A;  4ETX A;  3HCY A;  1K4E A;  4QPR A;  3P09 A;  5EVI B;  2M7U A;  1PWC A;  3IT9 A;  3S4X A;  4U0X A;  1AXB A;  2KDK A;  2A24 B;  1I5Q A;  2XGN A;  3KSI A;  4C6Y A;  2O9B A;  2GJ3 A;  2PU4 A;  3WS5 A;  4OP8 A;  1DP6 A;  4B9O A;  3G2Z A;  4E3L A;  2M7V A;  3MXQ A;  3H7W A;  3CUE A;  3MQQ A;  4QJG A;  2K31 A;  3TW8 A;  4R3J A;  1BSG A;  5EM0 A;  3C4P A;  4KQR A;  1FCO A;  3G4P A;  3IH8 A;  3VOL A;  1MZU A;  4E6X A;  5CHJ A;  5DJT A;  1XPB A;  1BT5 A;  4UA6 A;  5TFQ A;  1W8Q A;  5EUA A;  4PM8 A;  4WEK A;  1S67 L;  2ZL1 A;  2FH5 A;  1SKO A;  1FIL A;  2O0Y A;  2VEA A;  2QHK A;  4DE1 A;  3S7O A;  1HD8 A;  3E4P A;  1UGU A;  4CLC B;  3VP2 A;  4DMZ A;  3LY4 A;  3UME A;  5HWV A;  4II7 A;  3RXX A;  4F3L B;  1JWV A;  2M1C A;  5EPH A;  5KSH A;  2HF6 A;  5HWT A;  2WK0 A;  3B3X A;  4JF5 A;  3ZHH A;  1CI8 A;  5FEF A;  1OJ5 A;  4S2K A;  1YMS A;  2W3D A;  5FSR A;  2J3T C;  2ZQ8 A;  4N1X A;  3W4O A;  3PAE A;  1RGY A;  4BD0 A;  2XF3 A;  3BRM A;  3ICY A;  4LRX C;  5DKK A;  3C38 A;  4LLO B;  1VEU B;  1P9W A;  3A0V A;  1YLP A;  1W7F A;  3R7W A;  1Z6F A;  5L09 A;  4EWF A;  1PW1 A;  3KX0 X;  1P9R A;  4P87 A;  1NWZ A;  2VA0 A;  4XUX A;  5HD5 A;  2CC1 A;  3S7P A;  4EBN A;  3LR0 A;  4WMC D;  2X71 A;  3RXW A;  4I38 A;  1BZA A;  2IWC A;  3A3F A;  2PDR A;  3Q07 A;  4ZJ3 A;  5FL3 A;  2XD1 A;  4CPK A;  1FR1 A;  3PYP A;  1X0O A;  3LIC A;  1GSX A;  5AQ7 A;  2XLN A;  3PBQ A;  4ZRR A;  2Y55 A;  3QP1 A;  3V3R A;  4AFI A;  5EOE A;  1ES5 A;  1MWR A;  4RX3 A;  4K0X A;  3U2A A;  3S22 A;  2DCF A;  3FG8 A;  3KSG A;  3IH9 A;  3QP6 A;  5EVI C;  1NYY A;  2JKG A;  1IKI A;  4MBH A;  5F6A A;  2WGI A;  5IS1 A;  1K57 C;  4QD4 A;  4EQI A;  2DRW A;  3T4Q A;  5FEG A;  3B47 A;  3ZNY A;  2WAD A;  1ALQ A;  4BEN A;  4MBF A;  5HFO A;  4R4R A;  2OV5 A;  3Q82 A;  3ZFZ A;  4S2L A;  3HRE A;  4DE3 A;  1KGF A;  1YAX A;  3BLM A;  4E3K A;  4EBP A;  4DDS A;  2KOI A;  1ES2 A;  4G3W A;  1ERM A;  1S4R A;  1D7E A;  1MKM A;  1S66 L;  1OTB A;  5GHZ A;  2VLG A;  3LFV A;  1CK3 A;  2L4R A;  3UB5 P;  5DF7 A;  5BOH A;  3V39 A;  4U3T A;  1N9N A;  4FD8 A;  2Y2O A;  1H5X A;  1E4D A;  4IJG A;  3PAG A;  1NYM A;  3CLO A;  5E2H A;  3K2N A;  4FSF A;  1KVL A;  1N4O A;  4DE2 A;  5FQQ A;  2VGK A;  4QHC A;  4WN5 A;  4Y13 A;  4DXC A;  4DKI A;  2XDM A;  3V67 A;  3T1Q B;  1ES4 A;  2EA9 A;  2XFS A;  4RQ9 A;  1K55 C;  4HES A;  2DNS A;  2JHE A;  1XFN A;  1T1B A;  1NJ4 A;  4P6Z M;  3MBZ A;  1BTL A;  1TEM A;  3A0S A;  2FFY A;  3QHY A;  4QU3 A;  2IA2 A;  3PXP A;  5HZH A;  2PYR A;  2XA7 M;  2Y2H A;  4GDB A;  1J3W A;  1YSP A;  5D3O A;  1LSV A;  2XSS A;  2Y2I A;  5L8M A;  1V9Y A;  4GLQ A;  2V8F A;  3ULF A;  3D9Y A;  4KZB A;  4BQM A;  3WS0 A;  4R23 A;  3VP3 A;  2HDR A;  3C30 A;  3RH8 B;  4DF6 A;  2WGW B;  2HPB A;  3PBO A;  2K7S A;  3HUN A;  2ZC7 A;  2W3E A;  3CZD A;  2JE5 A;  1OME A;  2XFT A;  2G2W A;  4PM7 A;  5KMW A;  2NUT C;  2OLU A;  3TRC A;  1IFQ A;  2MJ6 A;  2J9P A;  5CHU A;  1IKG A;  4OH0 A;  2R9X A;  4S2I A;  1K6R A;  1H3Q A;  4KZ7 A;  1KE4 A;  3JYI A;  2E8J A;  4HP9 A;  1DJC A;  1TS6 A;  2XK1 A;  2ZLY A;  2O9A A;  5F69 A;  2XH9 A;  4S2P A;  3Q1F A;  3NHQ A;  3MZE A;  3DWK A;  5E43 A;  5GLA A;  1DJB A;  1IYQ A;  1Z09 A;  4DJ2 A;  4B93 A;  1S6R A;  3S1Y A;  4PKY A;  5L07 A;  3GDI A;  3NOT C;  1L0G A;  3G6O A;  5F5Y A;  4CLC A;  1ZC2 A;  2WKP A;  2ZQA A;  3P01 A;  3LYX A;  1LL9 A;  3KO6 A;  4WLA A;  1DJA A;  1E25 A;  1ZG4 A;  3BFE A;  4LV3 A;  1SKO B;  5L2F A;  2HJ9 C;  1LHY A;  3GSG A;  1Q2Q A;  3OCL A;  1XJ6 A;  1NZO A;  4Z9Q A;  5JYO A;  3IF6 C;  4JPM A;  3UO9 A;  4EW7 A;  2Y59 A;  5GHX A;  1ZTU A;  1WA9 A;  3L9K A;  1MXO A;  2PT7 A;  5I5L A;  3UDX A;  2VGL S;  4KEN B;  1XGI A;  2WUQ A;  3GEC A;  3ZQ5 A;  4EES A;  2V8C A;  3M6H A;  1SHV A;  3IBJ A;  4ZJ2 A;  3DTI A;  4OQG A;  4YWZ A;  2HP5 A;  5EVI A;  4EBL A;  2QPN A;  3N7W A;  3QP5 A;  3HJI A;  2GX5 A;  3HJK A;  3R4K A;  5E2F A;  2C5W B;  1YLW A;  2EX8 A;  2D02 A;  3MJQ A;  4P6B A;  2QKP A;  4ZTK A;  2B5R A;  5AQB A;  2X01 A;  3UPO A;  2PD7 A;  3G34 A;  4R38 A;  1G6O A;  3A3E A;  5CER A;  4EXO A;  4PKY G;  4DJ3 A;  4OVD A;  1Y4O A;  1F5M A;  2OAQ 1;  2FFF B;  3SW1 A;  3JPU A;  4KZ3 A;  3HLW A;  4K08 A;  3H82 A;  2L0W A;  4BLM A;  3IF6 A;  1LL8 A;  3CI6 A;  4NXB A;  5F83 A;  2JKR I;  1YT4 A;  1H8M A;  3RFB A;  1EI5 A;  4JXW A;  1D06 A;  4EEU A;  1JWP A;  2H5S A;  2NUP C;  2YKH A;  4XXR A;  4GD8 A;  5EM1 A;  3MSH A;  5F82 A;  3EGD C;  4X68 A;  3UE1 A;  4QWO A;  4LEN A;  2IWB A;  2H28 A;  5AVE A;  5DKL A;  1FQG A;  1MWU A;  1XP4 A;  5HAQ A;  2OWH A;  4PAU A;  1TDG A;  5F1F A;  3O86 A;  1DP9 A;  3O87 A;  2VJW A;  2ZQ7 A;  4OKP A;  2Y8H A;  2C6W B;  1K38 A;  2PAV P;  2OLV A;  2P08 A;  1N9L A;  1YLT A;  3I7J A;  1T1C A;  5HX9 A;  5MC7 A;  4E6W A;  3LR5 A;  4N92 A;  3UB7 A;  4MCW A;  2P04 A;  1VHM A;  2EX6 A;  2XRN A;  3VP0 A;  2W27 A;  3GV9 A;  4Z1W A;  3NOP C;  3DAV A;  3Q7Z A;  3KYE A;  4S2O A;  1BUE A;  3DWZ A;  2XR0 A;  4GOG A;  3UE6 A;  1SDN A;  5K5B A;  3FWL A;  4ZBE A;  2E8I A;  4YIN A;  2P74 A;  4ESP A;  2BTF P;  3N8R A;  2O9C A;  4OP5 A;  4WZ5 C;  1YLJ A;  5DTK A;  1YPR A;  4P6Z S;  2J3W A;  3CIT A;  4Q0H A;  4Q0I A;  1LSW A;  1FIK A;  3W8K A;  4KUO A;  1NZU A;  4KUK A;  2D01 A;  2GDN A;  4EER A;  1FSW A;  2Y2N A;  3ZNT A;  1XXM A;  5FAT A;  3HLB A;  3C7V A;  4Y15 A;  1KVM A;  3HBR A;  1MWS A;  3IWI A;  3GQZ A;  2A3U A;  3T1R A;  3BYD A;  1ESU A;  2ZBB A;  3EOI A;  3LEQ A;  4XUZ A;  5EOO A;  4LV0 A;  3LY3 A;  1A0K A;  4I3J A;  2VV7 A;  3HLG A;  3SH7 A;  3W4Q A;  4Y0T A;  1UWN X;  2P7J A;  4KQD A;  3T4T A;  4L9F A;  4NG2 A;  5HDC A;  1GA9 A;  4IUK A;  1MWT A;  4ZJ1 A;  4S2N C;  1H8Z A;  3UNW A;  5TBM B;  3BFC A;  4E3O A;  1TF1 A;  5FAQ A;  4DDY A;  1ES3 A;  3AGE A;  3WS4 A;  3JVV A;  3SS3 A;  3BWL A;  3QP2 A;  2ZC4 B;  1TS8 A;  5HAI A;  3ZDJ A;  3ZVW A;  1QME A;  1S1Z A;  3NJA A;  2JCH A;  1IYP A;  5AJG A;  5HW3 A;  1MY8 A;  5A92 A;  1E3U A;  5FDH A;  1CI9 A;  3D3O A;  3R7W B;  3N8S A;  3T4K A;  4LRZ E;  5U47 A;  1TD5 A;  1F98 A;  1MPL A;  4UHU A;  3DTE A;  3VMA A;  3CHW P;  2ZM2 A;  3IX4 A;  3V3S A;  3NCK A;  3U4L P;  1K4F A;  2GNX A;  3MF0 A;  5CEB A;  3BQA A;  3VFH A;  1GCE A;  2QJ7 A;  3PBT A;  4DXB A;  4N9K A;  1G68 A;  4S2M A;  4KZ6 A;  3T1S A;  2JKF A;  1ZKJ A;  4U0T A;  2H10 A;  3VE3 A;  5KIZ A;  1FCN A;  4P0M A;  3M2J A;  2ZC3 B;  4E3M A;  3QNB A;  4IBX A;  1U60 A;  4FOF A;  4WZ5 A;  1KGE A;  2RL3 A;  3K3D A;  3LEZ A;  4X6T A;  3BM6 A;  2V1Z A;  3HLC A;  3IF6 B;  2KLI A;  2ZC5 B;  1GSV A;  3IHA A;  5CHM A;  3EWK A;  1FR6 A;  5J3W A;  5FAO A;  4K91 A;  5HPF A;  1JTG A;  3S7N A;  2V0W A;  3CPT A;  4Y17 A;  3BEB A;  4X69 A;  4XT2 A;  1KGG A;  3ZVT A;  1N9O A;  4NXF A;  4UQI M;  5E2G A;  4OLG A;  4IBR A;  4GN2 A;  4M4X A;  4LV1 A;  3HUO A;  3VFF A;  3NC8 A;  3ZCZ A;  3OPP A;  1STZ A;  2BAS A;  4UA7 A;  1XX2 A;  4MDZ A;  3UPN A;  1DRM A;  1RGZ A;  1YM1 A;  4JF6 A;  1VQQ A;  5J7E A;  1LI9 A;  5M1A A;  4L9E A;  4HJ6 A;  3GMW A;  3ITB A;  4Y2F A;  4LV2 A;  1F9I A;  2EXB A;  2W1T A;  3W4P A;  1S4S A;  3LUQ A;  1CQA A;  1GA0 A;  3ZG8 B;  2VK3 A;  4KZA A;  5DTT A;  5JYP A;  4QY6 A;  4MEZ A;  3MR0 A;  4UAA A;  4ARZ A;  2R9W A;  3M2K A;  2CMN A; 
#chains in the Genus database with same CATH homology
 4OOL A;  1S1Y A;  4EES A;  3LID A;  1XFQ A;  4Y5F A;  3LR3 A;  3IBJ A;  2DMW A;  2JKT M;  2B18 A;  4WEL A;  4YWZ A;  4HH2 A;  2ZOH A;  3LI9 A;  3UB9 A;  3OBF A;  4HP4 A;  3HJI A;  4ETX A;  2GX5 A;  3HJK A;  3C8C A;  1NLY A;  3HCY A;  3R4K A;  4QPR A;  4NEE D;  3UMD A;  4MN7 A;  2M7U A;  3T4L A;  4UEY A;  3TE8 A;  3FC7 A;  3DBA A;  5DFY A;  2D02 A;  4IHQ A;  3MJQ A;  2QKP A;  5G4Y A;  2KDK A;  2LB9 A;  2A24 B;  2JKR M;  4EQ1 A;  3W2Z A;  4BJP A;  3KSI A;  4E04 A;  2HJE A;  2O9B A;  2GJ3 A;  4GS9 B;  4LPZ A;  4I5S A;  4HNB A;  2PD7 A;  4UQI S;  1DP6 A;  2Y79 A;  4BBU A;  3PHY A;  4B9O A;  4R38 A;  2W0N A;  1G6O A;  2V9A A;  2M7V A;  3MXQ A;  2VV6 A;  4EXO A;  4PKY G;  4DJ3 A;  3H7W A;  3CUE A;  3MQQ A;  2VZW A;  5IU1 A;  4HJ3 A;  1F5M A;  2OAQ 1;  2K31 A;  3TW8 A;  4KQO A;  4ARZ B;  4F3L A;  3H82 B;  3OLO A;  1TS7 A;  3IBR A;  3SW1 A;  4WF0 A;  4K08 A;  3VOL A;  3H82 A;  2L0W A;  3BW6 A;  4HI4 A;  1MZU A;  1LL8 A;  3CI6 A;  3BY9 A;  4NXB A;  3OCN A;  2W3G A;  4R70 A;  5DJT A;  2JKR I;  4NXG A;  1H8M A;  3RFB A;  3OC2 A;  3OOV A;  4HHD A;  5HL6 A;  2GZA A;  4WEK A;  1D06 A;  4EEU A;  1S67 L;  2NUP C;  2YKH A;  3LIB A;  2FH5 A;  4HH3 A;  2O0Y A;  2VEA A;  3EGD C;  4EUV A;  2QHK A;  3EQU A;  1NLZ A;  2H28 A;  3S7O A;  4Y3I A;  3E4P A;  5AVE A;  3T4O A;  5DKL A;  1UGU A;  3A0R A;  4CLC B;  1ZHH B;  4DMZ A;  3T4S A;  3UME A;  3LI8 A;  5HWV A;  2OWH A;  4II7 A;  1XJ3 A;  3C2W A;  2W1T B;  4PAU A;  4F3L B;  2M1C A;  5KSH A;  3EGX C;  2HF6 A;  2YKF A;  5HWT A;  1LT0 A;  3E4O A;  3FPW A;  1DP9 A;  3CAX A;  1OJ5 A;  4L9G A;  2VJW A;  1T18 A;  2W3D A;  2J3T C;  4BWI A;  2Y8H A;  3RTY A;  1GSW A;  4I39 A;  2P08 A;  3F1P B;  1N9L A;  1P0Z A;  1T1C A;  3VE4 A;  5MC7 A;  2V0U A;  3ICY A;  4HY8 A;  3LR5 A;  4GHI B;  4Q0J A;  4XT2 B;  4LRX C;  5DKK A;  3C38 A;  4LLO B;  4MCW A;  3UB7 A;  2P04 A;  1VHM A;  4JGO A;  1P9W A;  3A0V A;  2XRN A;  3TJZ C;  2W27 A;  3R7W A;  2L1M A;  3O5Y A;  4Z1W A;  3JVU A;  4NKP A;  1Y28 A;  3NOP C;  1YKD A;  3F1N B;  2QYB A;  3UE6 A;  3KX0 X;  3KYZ A;  1P9R A;  2ZOI A;  4BBT A;  1NWZ A;  3CUE C;  3IS2 A;  2VA0 A;  5HD5 A;  5K5B A;  3S7P A;  3LR0 A;  1EW0 A;  5CX7 A;  3LR4 A;  4HJ4 A;  4I38 A;  2I9V A;  4LRY C;  2O9C A;  1YSQ A;  3B42 A;  2PDR A;  3H9W A;  5C5K A;  2INW A;  3F1O B;  5HWW A;  4P6Z S;  2J3W A;  5FL3 A;  3CIT A;  4BBV A;  4Q0H A;  3PYP A;  4Q0I A;  1TS0 A;  1LSW A;  1X0O A;  2XRO A;  3LIC A;  2B02 A;  3FPV A;  3MQO A;  2A2L A;  4H6J B;  2R78 A;  3KSH A;  4KUO A;  1GSX A;  5AVF A;  5LBR A;  4O01 A;  4KUK A;  4L0L A;  4MMN A;  2D01 A;  4GJ4 A;  4EER A;  1ODV A;  3PBQ A;  4ZRR A;  4AFI A;  2J3T D;  1VB6 A;  3BJN A;  4WL9 A;  2PR5 A;  4MN5 A;  3U2A A;  4DN0 A;  3E0Y A;  2J80 A;  3FG8 A;  3KSG A;  4CLC E;  2VV8 A;  2Z6C A;  2W3H A;  3LIF A;  4HIA A;  3UB6 A;  2ZBB A;  4ME4 A;  3EOI A;  4YNR A;  5F6A A;  4H6J A;  5IS1 A;  2O99 A;  3T4Q A;  4WUJ A;  3B47 A;  4I3J A;  2VV7 A;  2OOL A;  5DF9 A;  1OTA A;  5J4E A;  5DFX A;  2PR6 A;  1UWN X;  1YAX A;  2P7J A;  3D72 A;  4KQD A;  3T4T A;  4L9F A;  5A8B A;  1OTI A;  5HDC A;  5HD3 A;  1XJ4 A;  2KOI A;  4G3W A;  1UWP X;  4IUK A;  1S4R A;  3T4J A;  3S7Q A;  1D7E A;  1MKM A;  1S66 L;  1OTB A;  4BMW A;  2VLG A;  3LFV A;  5TBM B;  1T1A A;  2L4R A;  5TBM A;  1TF1 A;  1N9N A;  3PBR A;  2PHY A;  4IJG A;  2VKS A;  2VX8 A;  3CLO A;  3K2N A;  4O8G A;  1IOU A;  1MC0 A;  3ZYT A;  4PHT A;  3JVV A;  4FSF A;  3F1O A;  1OJG A;  3BWL A;  4GCZ A;  1TS8 A;  3CWF A;  3BY8 A;  1S1Z A;  3NJA A;  4WN5 A;  3V67 A;  2EA9 A;  2EWW A;  5AJG A;  4RQ9 A;  2QJ5 A;  2OWJ A;  5EFW A;  4EU0 A;  4WEJ A;  3PR6 A;  2JHE A;  1XFN A;  1T1B A;  4P6Z M;  3VV4 A;  3F1N A;  3PBN A;  1BYW A;  3A0S A;  5HDS A;  2HGV A;  3D3O A;  2G7U A;  4G3K A;  3R7W B;  2IA2 A;  4NXE A;  3PXP A;  4IUH A;  3T50 A;  3MFX A;  5HZH A;  3T4K A;  2PYR A;  1OTD A;  4LRZ E;  2K2N A;  2XA7 M;  4JGP A;  5HSQ A;  1TD5 A;  4GHI A;  5IT5 A;  1YSP A;  1F98 A;  3LIE A;  2XA7 S;  2LB5 A;  1LSV A;  2OAP 1;  3K3C A;  2WKQ A;  2XSS A;  4HOI A;  5DJU A;  2V1A A;  1OT9 A;  1KOU A;  5L8M A;  1V9Y A;  4I3I A;  4GLQ A;  1T19 A;  1V9Z A;  3ULF A;  3EEH A;  2GNX A;  3MF0 A;  2ZMF A;  3BQA A;  3C30 A;  3RH8 B;  2FZ0 A;  1OPX A;  3EEA A;  2QJ7 A;  3PBT A;  3PBO A;  2K7S A;  2PD8 A;  1OTE A;  3EQV A;  2EWV A;  3NOU C;  3B33 A;  2W3E A;  4EET B;  4O0P A;  3UB8 A;  3VE3 A;  3LIA A;  4JGQ A;  5G4Z A;  2NUT C;  5KIZ A;  5TJJ A;  3TRC A;  1IFQ A;  2MJ6 A;  4ETZ A;  4FOF A;  3E98 A;  1H3Q A;  2V1B A;  3MQ0 A;  2JKT I;  3K3D A;  4I3A A;  4R6L A;  4HP9 A;  2ZMV A;  3KSF A;  3IS2 B;  1G28 A;  1TS6 A;  3UE3 A;  2O9A A;  5F69 A;  2KLI A;  2PYP A;  1GSV A;  3NHQ A;  3EWK A;  4MN6 A;  5J3W A;  1JNU A;  2WKR A;  3BQ8 A;  5HPF A;  4G3V A;  3S7N A;  4GW9 A;  2V0W A;  3PBS A;  2Z6D A;  3H7W B;  4XT2 A;  4DJ2 A;  4B93 A;  1N9O A;  2KX6 A;  3KYQ A;  4NXF A;  4UQI M;  5HPI A;  4PKY A;  3GDI A;  3NOT C;  5F68 A;  4JGR A;  3G6O A;  5F5Y A;  4EEP A;  4CLC A;  4M4X A;  2WKP A;  4GS9 A;  4R3A A;  3P01 A;  4HQA A;  4CLC D;  3LYX A;  4YOF A;  3KO6 A;  4WLA A;  1LSX A;  1STZ A;  5HDD A;  1DP8 A;  1P97 A;  2HV1 A;  2BAS A;  2A24 A;  1NRJ A;  4MDZ A;  3MMH A;  3F1P A;  2HJ9 C;  2QWS A;  1W63 Q;  3E4Q A;  1DRM A;  3OCL A;  2W3F A;  4CLC C;  5J7E A;  1XJ6 A;  4L9E A;  4HJ6 A;  4CQH A;  4EW7 A;  4Y2F A;  1ZTU A;  1F9I A;  1OT6 A;  1XJ2 A;  2W1T A;  3P7N A;  1S4S A;  3LUQ A;  1WA9 A;  1W63 M;  2PT7 A;  2VGL M;  5I5L A;  2W1R A;  3MR0 A;  2JN7 A;  4ARZ A;  2VGL S;  4OOM A;  2CMN A;  3GEC A;  3ZQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...