2Z6DA

Crystal structure of lov1 domain of phototropin2 from arabidopsis thaliana
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
118
structure length
118
Chain Sequence
ELKTALSTLQQTFVVSDATQPHCPIVYASSGFFTMTGYSSKEIVGRNCRFLQGPDTDKNEVAKIRDCVKNGKSYCGRLLNYKKDGTPFWNLLTVTPIKDDQGNTIKFIGMQVEVSKYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Phototropin-2
publication title Structural basis of the LOV1 dimerization of Arabidopsis phototropins 1 and 2
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 37
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2z6dA00
3LIEA 5HSQA 2A24B 3LI9A 1OT6A 1OJGA 1OTAA 3LICA 1OJ5A 2PD7A 2WKPA 4H6JB 1UGUA 4E04A 4YWZA 4WUJA 2R78A 2V9AA 4NXFA 1D06A 3H82B 4HJ6A 3A0SA 2VEAA 4HI4A 5HD5A 4EERA 3LYXA 1XFQA 4HH2A 1S4RA 4LRXC 1OTDA 4HIAA 3UB9A 3UB6A 1S1YA 1OTBA 2CMNA 1TS7A 3G6OA 4JGQA 1OTEA 4JGRA 3A0VA 3VOLA 3NOPC 4K08A 2D02A 1DRMA 4GS9B 4HQAA 2V1BA 4WN5A 5HWTA 4EEUA 4NXEA 3IS2B 2PYRA 1GSXA 3GDIA 4GHIB 5AVFA 4R70A 4WL9A 1F9IA 5HD3A 1GSWA 2K7SA 5I5LA 1F98A 2ZBBA 4XT2A 1KOUA 3F1PB 4BBUA 1S1ZA 1WA9A 3E4QA 4HJ4A 2QWSA 3F1NB 2YKHA 3ZQ5A 3EWKA 4HP4A 5F69A 4I39A 4BBTA 5DJUA 3SW1A 2H28A 2WKRA 5IU1A 2PHYA 5HDSA 1T1BA 3LI8A 4R38A 1OT9A 1MZUA 2I9VA 5HDDA 5G4ZA 2PDRA 2Z6CA 3FC7A 3MQQA 1UWNX 1JNUA 4HNBA 4L9FA 5TBMA 4LLOB 1V9YA 2L1MA 3C8CA 1LT0A 5IS1A 3BY9A 1BYWA 1OTIA 5HWWA 5HDCA 1GSVA 2J80A 3T50A 1T1CA 2VV7A 4GCZA 4NXBA 4F3LA 4PKYG 5A8BA 2VV6A 4MN6A 1P0ZA 2V0WA 3CLOA 4HY8A 1VB6A 2KX6A 2YKFA 1S4SA 4JGOA 5F6AA 4HP9A 1N9NA 4I38A 3NOUC 4KUKA 5EFWA 1XJ2A 3NHQA 3BWLA 1XFNA 4NXGA 4XT2B 2W27A 1LSWA 4GW9A 4HH3A 4WLAA 2PR6A 2BASA 4JGPA 1XJ3A 3PHYA 1DP8A 3P7NA 2D01A 1NWZA 1LSXA 2VLGA 2L0WA 3MXQA 4EXOA 5KIZA 3RTYA 4BBVA 3UB7A 1LL8A 5AVEA 1LSVA 2GJ3A 5J4EA 3LIAA 2QJ5A 4I3JA 4RQ9A 5TBMB 3EEHA 1N9LA 3F1OA 3ICYA 4R3AA 3UMEA 2V1AA 4EESA 5G4YA 1S67L 3K3CA 1TS6A 2WKQA 1TS0A 1D7EA 2ZOHA 1N9OA 2OWHA 4LPZA 4KUOA 4F3LB 3LIBA 1X0OA 3IBRA 3MQOA 1G28A 4KQDA 3OLOA 3H7WA 4EEPA 2OOLA 2QKPA 3D72A 1UWPX 1P97A 5HZHA 1V9ZA 1TS8A 4I3IA 4M4XA 3ULFA 4DJ3A 3B33A 4I5SA 3UE6A 4WF0A 1Y28A 4R6LA 2VV8A 3E4PA 3FG8A 3E4OA 2QJ7A 3HJIA 3LIDA 2A24A 1XJ4A 4L9GA 3MR0A 3UB8A 5F5YA 4HOIA 3RH8B 1T18A 5HWVA 2P7JA 4H6JA 3CWFA 3MFXA 2JHEA 4HJ3A 3VE4A 3H9WA 4LRYC 2EA9A 3H82A 2QHKA 5F68A 1DP6A 3PYPA 4B9OA 2M1CA 1S66L 3GECA 3CAXA 4MN5A 3K3DA 1T19A 2KDKA 3NJAA 2B02A 5DKKA 3BY8A 4L9EA 1ODVA 1T1AA 4HHDA 2PYPA 1XJ6A 3F1OB 4GS9A 3NOTC 3HJKA 3UMDA 3IS2A 4LRZE 5J3WA 4EETB 2JN7A 4GHIA 3C2WA 2Z6DA 5DJTA 3MJQA 2W0NA 3KX0X 2L4RA 3LIFA 5DKLA 2HV1A 4PKYA 2ZOIA 3H7WB 2PD8A 4EW7A 3F1PA 2OWJA 4DJ2A 3F1NA 2V0UA 4EQ1A 3LUQA 1EW0A 5J7EA 4I3AA 2INWA 3A0RA 3VE3A 2PR5A 1DP9A
chains in the Genus database with same CATH superfamily
3IF6B 4X69A 1OT6A 1OJGA 5FI6A 2PD7A 3Q1FA 4OQHA 4WUJA 2R78A 4NXFA 4PM6A 3IWOA 2Y91A 3CI6A 4N1XA 1OTDA 4HIAA 2XLNA 5HW3A 3KSHA 3UB6A 4OQGA 1OTBA 5L09A 4DF6A 4MLLA 3PBQA 4G3KA 3RXXA 5IHVA 1ERMA 1F5MA 3A0VA 3FYZA 4O01A 2ZQ9A 1DJCA 1KGFA 2QZ6A 4GS9B 2NUPC 4RYEA 4O0PA 5TFQA 4LCMA 4WN5A 2DNSA 3OPRA 4Y7PA 2V2FF 4GHIB 1L3LA 3G35A 3UDIA 4ZJ1A 5HD3A 5M1AA 3VP0A 2K7SA 4OQIA 1F98A 3ZCZA 3IH9A 2J7VA 1MXOA 5HPIA 3U2AA 4BBUA 1S1ZA 1NZOA 3O87A 1WA9A 1NJ4A 3E4QA 2QWSA 3T1QB 1GHPA 2ZQ8A 3F1NB 1ESIA 4Q0HA 4BBTA 2RL3A 4FCFA 1ES5A 5MC7A 3JPUA 1PYYA 1NZUA 1BSGA 3LI8A 5FASA 4GZBA 2KOIA 3ZG0A 1ESUA 2EXBA 3D3OA 3ZFZA 2I9VA 1XA7A 5HDDA 2PDRA 2Z6CA 4ARZA 2XF3A 1PFLA 3HLCA 4XUXA 3BLSA 4PPRA 2OV5A 4JLFA 3FC7A 3G30A 3MQQA 4HNBA 1K55C 4RX2A 3Q7ZA 1V9YA 3HLFA 4E3JA 1LT0A 5IS1A 3T1RA 5EVEA 1N9BA 1S0WA 4BQMA 4MBFA 1QMEA 5EPHA 1K56D 2ACGA 2Y2MA 4QHCA 2HDUA 4DKIA 3VOYA 4F3LA 4L0LA 5EM0A 4GNUA 3OPHA 3T1XA 2ZMAA 3VP1A 4BLMA 1VB6A 3ZDJA 2KX6A 5K5BA 4JGOA 1W5DA 2ZL1A 3TE8A 1YT4A 4KZ6A 1ZHHB 3NOUC 3FWLA 4KUKA 2EWWA 2R9WA 3CPTA 3ISGA 4X55A 1ES4A 3BWLA 4BL2A 3EQVA 3GTCA 4FH2A 1I2SA 2Y2JA 1WYCA 5F82A 3ZYTA 3EGDC 4WZ5A 4DN0A 3GVBA 2OLUA 3P7NA 2PT7A 2HGVA 3EQUA 4Y0TA 4X25A 3HBRA 4OOLA 2EX2A 2X02A 1MY8A 5GLAA 1PW1A 4UAAA 3IH8A 3RTYA 3BJNA 1W63M 3DAVA 3UNWA 4C6YA 3FKVA 2JKGA 5AVEA 4ARZB 3ZG5A 1YQSA 4NK3A 4PM5A 3AGEA 2X01A 5J4EA 4EBPA 1J3WA 3SS5A 2QJ5A 3DTKA 2HJEA 4LENA 3EEHA 3V5MA 1Y54A 2WUQA 4GB7A 1N9LA 5CHMA 3ICYA 3CMZA 4S2LA 1S67L 5EM1A 2PU2A 3EOIA 2ZOHA 1N9OA 4IVIA 2ZM2A 4F3LB 1C3BA 3S7QA 3RJUA 1A0KA 1FSYA 4QWOA 4WMCD 3MQOA 5JYPA 5HL6A 1CK3A 1YLZA 3H7WA 1MWSA 4EEPA 3ZVTA 3D72A 4E3LA 1UWPX 1P97A 4HBUA 1FCOA 2ZL1B 4F94A 5GHXA 4IBXA 4U0TA 3UE6A 4WF0A 1Y4OA 3CPTB 2H10A 1U60A 3E4PA 3FG8A 1NLYA 4Y0UA 1W7FA 3PBTA 3B47A 3LIDA 3T12B 2A24A 4DMZA 4UA6A 4DDSA 4JXWA 4H6JA 1PWCA 3BYDA 5CTNA 1XGJA 4G3VA 2EX6A 3ITAA 5GLCA 3VV4A 3JYIA 3H82A 2QHKA 5F68A 3WWXA 4BL3A 2XDMA 1DP6A 3QP6A 2QYBA 2XGNA 3UE1A 3QP1A 1JWPA 2KDKA 3WS5A 3OBFA 3PBOA 1W63Q 5D3OA 5EVLA 3QHYA 4OPQA 4G3WA 3HCYA 4E6XA 1ODVA 3SS4A 2K2NA 3MS6A 3A3FA 5FDHA 2HZ5A 2ZC3B 4QB8A 3G34A 1JTGA 5FAOA 3MKFA 1FCNA 4WEJA 5U47A 3UMDA 4Q0JA 5J3WA 3E2KA 4OKPA 1PZPA 3C2WA 5CX7A 3DTIA 3C7VA 3LIFA 3DWKA 1NY0A 5DKLA 2QMIA 5AQ7A 2QPNA 4BD0A 4KG2A 3H7WB 2PD8A 3OZHA 3EGXC 3IXGA 4B88A 4R1GA 3NBLA 2B95A 4GD6A 1SCWA 2FFFB 3LUQA 3SH7A 5CECA 4S2MA 4Y2FA 5TR7A 2H5SA 2HF6A 3VE3A 2PR5A 2EFXA 4X68A 3FZCA 3HUOA 5EOOA 2A24B 3LICA 3AGFA 4H6JB 4FH4A 4KZAA 4YWZA 2WGIA 4EUVA 2V9AA 3H82B 1K4FA 4HJ6A 4Q0IA 3PBRA 4GD8A 1TDLA 3LYXA 3JVVA 5E2EA 4A5RA 4PM9A 1H5XA 4LRXC 2LB9A 2CMNA 1PWDA 1TS7A 3G6OA 3NC8A 1IELA 5KMWA 5M19A 5FI7A 4R4RA 3NECA 4E3NA 4WZ4A 3KYZA 4ZDXA 1CQAA 3LR0A 1SKFA 3TRCA 1PIOA 2DMWA 1RGYA 4CLCD 4HQAA 5HWTA 4NXEA 4OLGA 4U0XA 3GDIA 3T4OA 2JKTM 2Y2QA 1K4EA 3OOVA 4R70A 2JC7A 4OP5A 1YLJA 4ETXA 4MEZA 4QY5A 5E2HA 2XD5A 3RFBA 3GR2A 1KOUA 3TW8A 1G5UA 4HJ4A 4UHUA 3BFDA 4KQQA 1JVJA 2ZMFA 5EVIC 3CG5A 3EWKA 4HP4A 3T4SA 4I39A 4IUKA 1BLCA 2LB5A 4KZ7A 1MWUA 5DJUA 4EBLA 3SW1A 3O86A 2Y2NA 3C4PA 3VP2A 4EUZA 1T1BA 3ZVWA 5GL9A 1PZOA 1IEMA 3WRTA 1OT9A 3N6IA 1G6OA 2IWCA 4Q8IA 3ZG7B 2Y2HA 3NDEA 5FQQA 3A3EA 2JKRI 3KSIA 2K31A 2HDRA 3MQ0A 5FAPA 2W3GA 4OOYA 2L1MA 2OAQ1 3VFFA 1K55A 2E8IA 5M18A 3QNCA 1I5QA 5HWWA 3VMAA 1ACFA 5HDCA 3O5YA 2J80A 5CGSA 3T50A 1KGEA 4GCZA 4NXBA 3A3DA 2GZAA 1Q2QA 4JKTA 4KG5A 2HJ9C 5FEGA 2V0WA 3UN7A 1E3UD 2VJWA 3BM6A 4ZJ3A 2YKFA 1ONHA 3HLWA 4R4SA 3Q82A 3E2LA 5FQIA 3P98A 1N9NA 1LI0A 3S1YA 5EFWA 5G18A 3QP4A 2PRFA 2DRWA 1XJ2A 2JCHA 3D4FA 3UPNA 3OCLA 4OQ0A 4NXGA 5FDSA 3QP2A 2W27A 3PAGA 1P9RA 3Q7VA 3PAEA 1RCJA 4GW9A 3WRZA 3BFEA 1TF1A 4JGPA 2VK3A 4QD4A 3ITBA 1NXYA 5CRFA 1GA0A 5FQ9A 1LSXA 5L07A 1FILA 4EXOA 4BBVA 2VGJA 3TOIA 3HLGA 2GJ3A 2EX9A 5FQKA 3ZG8B 3GRJA 3IF5A 4QJGA 3LIAA 2Z2LB 4RQ9A 2XFSA 4IVKA 3HVFA 1SHVA 1K38A 1MPLA 1OPXA 1SKOA 1H8YA 3BQAA 4B4XA 2V1AA 1KVLA 5G4YA 3BRMA 3S7OA 2Y2IA 4KENB 4LPZA 5JYOA 4KUOA 2VGLM 3LIBA 4WM9A 1KE3A 1Z09A 3MKEA 3IBRA 2CC1A 3ZG9B 4BMWA 3O3VA 3W4OA 3P09A 2ZM8A 4ZTKA 1KDSA 3HLBA 1LL5A 2OOLA 4K0WA 3IQAA 4YNRA 4OPZA 2H0YA 4FOFA 3S7PA 5KSCA 2O0YA 1K25A 3OC2A 4OH0A 1GCEA 2W3HA 1W8QA 1O07A 2VV8A 3LY4A 2WKIA 2XQZA 3E4OA 4UQIS 4MBKA 1L0FA 4KZBA 3Q7VB 1VM1A 4L9GA 2Y2PA 4WYYA 3MR0A 3UB8A 5C5KA 1CI9A 3RH8B 5HWVA 2P04A 2JHEA 3VE4A 5DF9A 2P08A 4O8GA 2IWBA 3H9WA 2ZC7A 3N8LA 4GOGA 4MBHA 4DXCA 2G7UA 3Q07A 2X71A 3BW6A 5J8XA 3CAXA 5AQAA 1STZA 2C6WB 3MFDA 5AQ9A 4X1MA 5DKKA 5A92A 4QU3A 3CUEC 3BY8A 1KE0A 4L9EA 5KZHA 1T1AA 4XUZA 2WZXA 1Z6FA 1XJ6A 1SKOB 3BECA 1PI4A 3BEBA 1G6AA 2UWXA 3HJKA 3IS2A 4LRZE 4JF4A 2XRNA 2Z6DA 3DTMA 3N8RA 4H8RA 5DFYA 3C5AA 2W0NA 3KX0X 2OSUA 2HV1A 1Q2PA 1SDEA 3NIAA 4PKYA 4YFMA 5HFOA 1IKGA 3SOIA 2G2UA 2ZLYA 2M7VA 2ZOIA 5A90A 4DXBA 1K57C 3F1PA 2VZWA 4DJ2A 3IX8A 4GLQA 2XEPA 3B3XA 2C5WB 1FR6A 3C7UA 1EW0A 1YSPA 5J7EA 4I3AA 2INWA 4JF5A 4HEFA 1YPRA 2VGKA 4MN7A 1YLTA 1BLPA 3BFGA 2EFUA 1DP9A 4EBNA 3LIEA 5HSQA 4QPRA 3TSGA 1LLBA 2WKHA 5E2FA 3SS3A 5L10A 5F83A 1OTAA 2A2LA 1CEFA 2ZQCA 1ZG6A 3S22A 1UGUA 4HESA 2XA7S 3IBJA 4GKUA 1NYMA 3A0SA 1PNEA 2VEAA 1H0MA 4HI4A 1AWIA 3G4PA 5HD5A 2IA2A 3QNBA 4EERA 1XFQA 4X56A 4KZ5A 4HH2A 3P01A 5EE8A 4DRTA 2XK1A 1D1JA 2A3UA 4N9LA 3V50A 1K54C 3SH9A 4JXGA 4K0XA 2WKEA 2ZJ9A 4JGQA 4E3OA 3N8SA 5EUAA 3BQ8A 3VOLA 4EWFA 3NOPC 2J9OA 3BFCA 2J3WA 1DRMA 3ZNYA 4KZ4A 4C75A 4EEUA 3M2KA 3LEZA 3IS2B 4Y3IA 3OPLA 2PYRA 1GSXA 3NULA 4ZJ2A 4Y0OA 2UV0E 4UQIM 5AVFA 2FH5A 4WL9A 1YLWA 1GSWA 1W8YA 1L0DA 2FZ0A 2AVXA 2ZBBA 3IWIA 1ALQA 4XT2A 3F1PB 3WS0A 2JKFA 3QP8A 4JXVA 4S2KA 2YKHA 3ZQ5A 3KSGA 1ONGA 4OPRA 5DVAA 1BT5A 5F69A 2Y2KA 3IX3A 1N4OA 1VQQA 2H28A 5EVIA 5IU1A 4R23A 3FV7A 5HL1A 3FKWA 4KZ9A 1KGGA 1BZAA 3O88A 4N1HA 1MZUA 3C30A 5CHUA 4FTXA 3T4QA 5G4ZA 1OMEA 2ZC5B 3MBZA 2V20A 1UWNX 4JBFA 3HUMA 4PMAA 5HAIA 2HDSA 1BTLA 4LLOB 2A49A 1L0GA 2J3TD 3C8CA 4C3QA 2ZQ7A 4KQOA 3WS1A 2B18A 2WK0A 5CXWA 1BLHA 3G2YA 2W3FA 4OLDA 3LFVA 3IHBA 1BYWA 1OTIA 5IT5A 1KVMA 1IYSA 3T4TA 4WBGA 4YOFA 1I2WA 5FQMA 3R7WA 3NY4A 2EX8A 2WYXA 4PKYG 5A8BA 2XSSA 4MN6A 4OP8A 4E3KA 1IYPA 1TVFA 4ZAMA 4HY8A 3FPVA 2KLIA 2ZM0A 3MXSA 2RCXA 4P85A 4IUHA 1PI5A 4HP9A 4U3TA 3S4XA 3WS2A 4CPKA 2I72A 4R3JA 4IBRA 5FQJA 2HP6A 1VHMA 2MJ6A 1IKIA 4OVDA 1WYBA 3UE3A 1J9MA 4XT2B 1IOUA 2XA7M 1LSWA 3U4LP 3PR6A 4Y5FA 3T4KA 4CJNA 2Q0OA 4HH3A 3C38A 1MWRA 1XJ3A 4KZ8A 1DP8A 2D01A 4R0QA 5AJGA 5EVIB 4IEDA 2XROA 2VLGA 5HPFA 3A3JA 4BJPA 4ID4A 1LL8A 4X53A 1JWZA 2Y79A 3MZEA 1LSVA 3V39A 4PHTA 4E3MA 4ZBEA 4JXSA 3VFHA 4ME4A 4BENA 4P6ZS 4MNRA 4CLCC 3T1SA 5FL3A 2JKTI 1CI8A 1FR1A 1ERQA 3F1OA 1YKDA 3CJMA 4LGWA 2PU4A 5FAQA 2HPBA 4LCLA 1TS6A 2ZMVA 1WE4A 3B42A 2OWHA 3R7WB 3IWQA 2O9AA 3LEQA 5TGFA 5A91A 1XKZA 5HX9A 1X0OA 2W3DA 1NRFA 1G28A 4KQDA 4S2NC 4UA7A 2Q9MA 1ZC2A 3OLOA 1FSWA 1EI5A 2GX5A 3HLEA 3DWZA 2WADA 1V9ZA 1TS8A 2GNXA 4M4XA 1P9WA 3ULFA 3B33A 4MCWA 1TD5A 4I5SA 3IF6C 3PBNA 3NDGA 4UEYA 1Y28A 2FFYA 3PTEA 4AFIA 1XJ4A 5BOHA 5F5YA 2JBFA 2VA0A 2P7JA 4O7DA 5DTSA 3CWFA 3MFXA 4HJ3A 4R3BA 2EA9A 1HLUP 4KZ3A 3PYPA 1S66L 3GECA 3LR5A 3VP4A 4RA7A 4MN5A 5HAPA 1XXMA 1K56A 3HREA 1YSQA 2M7UA 1GHIA 2WGWA 3LCEA 2PBYA 3M6BA 3BLMA 2B02A 3E0YA 4FD8A 2Y8HA 3G2ZA 3UDXA 1IFQA 4N92A 4E6WA 4GN2A 2EWVA 3JVUA 2PYPA 3F1OB 3C4OA 3IT9A 1GHMA 3CUEA 3NOTC 3CITA 3M2JA 3EEAA 5L2FA 4EETB 2JN7A 1SZVA 1H3QA 2WGVA 4WELA 1AXBA 3MJQA 5I94A 3FPWA 3SH8A 2ZD8A 5EECA 1S6RA 4EW7A 2H0TA 2ZC6B 3W4PA 5CGXA 1DY6A 4NETA 1FIKA 2XH9A 1K6RA 1QMFA 2V0UA 1H8ZA 1K57A 4EU0A 3OPPA 1XA1A 3UE0A 5A93A 2HP5A 3V67A 1EWZA 4GDBA 3UB5P 1TEMA 4DJ3A 2DCFA 3MSHA 3LI9A 4NKPA 4P6ZM 2ZQAA 1MKMA 3A3IA 1OJ5A 4RX3A 2WKPA 2W1TA 1KE4A 4E04A 3LR3A 1L2SA 1MKIA 1D06A 3LGOA 5DF8A 1W79A 2Y59A 4KG6A 4IJGA 1SDNA 1S4RA 3KYEA 4DE3A 1PRQA 3G31A 2Y2OA 2PAVP 3UB9A 4Y13A 1S1YA 2WGWB 2P9VA 3RXWA 4EV4A 1BUEA 1OTEA 3AGDA 3HL9A 3VSLA 3UPOA 4JGRA 5CERA 3T4LA 1K54A 3LR4A 4OONA 4WMCA 4K08A 2O9CA 1L0EA 2D02A 5GHZA 5GHYA 2V8FA 3T4JA 5GLDA 2V1BA 1RP5A 1EROA 5TJJA 4LV0A 1BULA 1IYQA 5E43A 3N7WA 1F9IA 5I5LA 2WAFA 1FCMA 3IHAA 4JF6A 5FEFA 5CHJA 4D2OA 4P0MA 4BD1A 5FI2A 1F2KA 1JWVA 2WKRA 2PHYA 1ZTUA 5HDSA 2B5RA 2W3EA 3W8KA 1MC0A 3NI9A 4XXRA 3GV9A 4PM7A 4R38A 4S2IA 3N4IA 1LHYA 5FA7A 1PWGA 2W1TB 3TG9A 2Y55A 2ZC4B 3E98A 2NUTC 3UPPA 1JNUA 1HTZA 4OOMA 4L9FA 5TBMA 3LY3A 1YMSA 4KQRA 4HBTA 3ZNTA 1DJBA 3VSKA 4Z9QA 3R4KA 4IHQA 3BY9A 5HAQA 1JTDA 1YLPA 2P9VB 3BFFA 2Y2LA 5HARA 1GSVA 4Z1WA 1T1CA 2VV7A 3V3RA 4P6BA 3S7NA 1NRJA 2VV6A 2WZZA 2IWDA 1KDWA 2O99A 1FOFA 2BLSA 2VX8A 1P0ZA 4DE1A 1NLZA 3CLOA 1XX2A 2VKSA 3MXRA 1S4SA 1XPBA 4DDYA 3IXHA 4X1LA 3KSFA 2R9XA 1M6KA 3OCNA 1LL9A 5F6AA 4BWIA 4I38A 4Y17A 4B4ZA 5CEDA 3ZGAB 1FQGA 3NHQA 1XFNA 4WZ5C 2BG1A 3GQZA 4PM8A 4ESPA 4WLAA 2PR6A 5CTMA 2BASA 2OLVA 3SZTA 1K0KA 1ES3A 3PHYA 4GDNA 4NG2A 1M40A 3ZHHA 1NWZA 1CF0A 2L0WA 3MXQA 4FUWA 5KIZA 1VETA 1G68A 3IXDA 1PW8A 3UB7A 3TJZC 2XFTA 4MDZA 1LI9A 3NCKA 3GSGA 3DTEA 2G2WA 4MMNA 2Y4AA 4LV3A 3W4QA 1BLSA 1HZOA 3PXPA 4S2OA 1VEUA 4D60A 2Z2MB 4I3JA 4PAUA 5TBMB 2J9PA 2ZQDA 5F1FA 4R3AA 3UMEA 4CLCA 3I7JA 4EESA 5DF7A 2V8CA 4CQHA 3K3CA 5KSHA 5CEBA 2WKQA 1TS0A 3L7HA 1D7EA 3L9KA 4NEED 3MMHA 1E25A 3IX4A 4LV2A 2JE5A 3KO6A 3QP5A 3VP3A 3PBSA 2OAP1 4K91A 2QKPA 5L8MA 2Q9NA 2W1RA 4S2NA 4Y15A 5HZHA 1ZKJA 3K2NA 4I3IA 2J8YA 1NYYA 1XGIA 4S2PA 4X6TA 4R6LA 3V3SA 4JPMA 4OPYA 4ZRRA 2QJ7A 2HP9A 3HJIA 1ES2A 2HDQA 3IF6A 3LO7A 4EQIA 4YINA 4HOIA 5EOEA 1T18A 1XP4A 3MZDA 1HD8A 1CEGA 1YMXA 2E8JA 3CZDA 2Y2GA 3D9YA 3MF0A 3MZFA 2J3TC 1TDGA 4LRYC 5DTTA 5EV0A 4B9OA 2M1CA 5EVID 5CGWA 3HLDA 4FSFA 1VETB 2XR0A 3G32A 3HUNA 2V1ZA 3K3DA 1H8MA 4E3IA 2O9BA 4B93A 1GA9A 1ZG4A 1T19A 4UA9A 5FSRA 3NJAA 4QY6A 5FATA 1HVBA 1MWTA 4S2JA 3W2ZA 3UDFA 2WAEA 1VEUB 5GLBA 1O7EA 4N9KA 1CJFA 1YLYA 4HHDA 4CLCE 1E3UA 3Q81A 3KYQA 1YAXA 4DE2A 2BTFP 4CLCB 4GS9A 2GDNA 1IYOA 2XD1A 2JKRM 4LV1A 5DFXA 1K6SA 2VGLS 4II7A 1RGZA 4RVAA 3VOZA 4WEKA 4GHIA 2P74A 3CHWP 2PBDP 5DJTA 3DW0A 3WS4A 3DBAA 2L4RA 3UO9A 5DTKA 5F1GA 1E4DA 4LFUA 5AQBA 1DJAA 2OWJA 4M3KA 3IXBA 3UY6A 5LBRA 1MBLA 3F1NA 4ETZA 3GMWA 4EQ1A 1YM1A 3M6HA 5E2GA 4P87A 4GJ4A 3A0RA 2EXAA 4DE0A
chains in the Genus database with same CATH topology
3LIEA 5HSQA 4QPRA 2A24B 3LI9A 4NKPA 1OT6A 4P6ZM 1OJGA 1OTAA 3LICA 1MKMA 1OJ5A 2PD7A 2A2LA 2WKPA 2W1TA 4H6JB 1UGUA 4E04A 2XA7S 3IBJA 3LR3A 4YWZA 4EUVA 4WUJA 2R78A 2V9AA 4NXFA 1D06A 3H82B 4HJ6A 3A0SA 4Q0IA 3PBRA 2VEAA 4HI4A 3CI6A 5HD5A 4IJGA 2IA2A 4EERA 3LYXA 1XFQA 3JVVA 4HH2A 3P01A 1S4RA 4LRXC 1OTDA 4HIAA 3UB9A 2LB9A 3KSHA 3UB6A 1S1YA 1OTBA 2CMNA 1TS7A 3G6OA 4JGQA 1OTEA 3PBQA 4G3KA 4JGRA 1F5MA 3BQ8A 3A0VA 3T4LA 3VOLA 3NOPC 3LR4A 4O01A 3KYZA 4K08A 2O9CA 2J3WA 2D02A 1DRMA 3LR0A 3TRCA 2DMWA 4GS9B 2NUPC 3T4JA 4O0PA 4CLCD 4HQAA 2V1BA 4WN5A 5HWTA 4EEUA 4NXEA 5TJJA 3IS2B 4Y3IA 2PYRA 1GSXA 3GDIA 4GHIB 3T4OA 2JKTM 4UQIM 5AVFA 2FH5A 3OOVA 4R70A 4WL9A 1F9IA 5HD3A 1GSWA 2K7SA 5I5LA 1F98A 4ETXA 2FZ0A 2ZBBA 4XT2A 3RFBA 5HPIA 3U2AA 1KOUA 3F1PB 3TW8A 4BBUA 1S1ZA 1WA9A 3E4QA 4HJ4A 2QWSA 3F1NB 2ZMFA 2YKHA 3ZQ5A 3EWKA 4HP4A 3KSGA 4Q0HA 5F69A 3T4SA 4I39A 4BBTA 4IUKA 2LB5A 5DJUA 3SW1A 5MC7A 2H28A 2WKRA 5IU1A 2PHYA 1ZTUA 5HDSA 2W3EA 1MC0A 1T1BA 3LI8A 2KOIA 4R38A 1OT9A 1MZUA 3C30A 3D3OA 2I9VA 3T4QA 1G6OA 5HDDA 5G4ZA 2PDRA 2Z6CA 4ARZA 2W1TB 2JKRI 3KSIA 2K31A 3FC7A 3MQQA 3E98A 2NUTC 3MQ0A 1UWNX 1JNUA 4HNBA 4OOMA 2W3GA 4L9FA 5TBMA 4LLOB 1V9YA 2J3TD 2L1MA 2OAQ1 3C8CA 4KQOA 1LT0A 5IS1A 2B18A 3R4KA 2W3FA 4IHQA 3LFVA 3BY9A 1BYWA 1OTIA 5HWWA 5IT5A 3T4TA 5HDCA 1GSVA 4Z1WA 3O5YA 2J80A 3T50A 1T1CA 4YOFA 2VV7A 4GCZA 4L0LA 4NXBA 3R7WA 3S7NA 4F3LA 1NRJA 2GZAA 4PKYG 5A8BA 2VV6A 2XSSA 4MN6A 2O99A 2HJ9C 2VX8A 1P0ZA 2V0WA 2VJWA 1NLZA 3CLOA 4HY8A 1VB6A 2VKSA 3FPVA 2KLIA 2KX6A 2YKFA 1S4SA 5K5BA 3KSFA 4JGOA 4IUHA 3OCNA 5F6AA 4HP9A 1N9NA 3TE8A 4BWIA 1ZHHB 3NOUC 4I38A 4KUKA 2EWWA 5EFWA 1VHMA 2MJ6A 1XJ2A 3NHQA 3BWLA 3OCLA 1XFNA 4NXGA 3EQVA 3UE3A 4XT2B 1IOUA 2XA7M 2W27A 1LSWA 1P9RA 3PR6A 3ZYTA 4Y5FA 3T4KA 3EGDC 4GW9A 4HH3A 4WLAA 1TF1A 2PR6A 3C38A 2BASA 4JGPA 1XJ3A 4DN0A 3PHYA 1DP8A 3P7NA 2D01A 2PT7A 5AJGA 2HGVA 3EQUA 1NWZA 4OOLA 1LSXA 2XROA 2VLGA 2L0WA 5HPFA 3MXQA 4EXOA 5KIZA 3RTYA 4BJPA 3BJNA 1W63M 4BBVA 3UB7A 3TJZC 1LL8A 4MDZA 5AVEA 2Y79A 4ARZB 1LSVA 2GJ3A 4MMNA 4PHTA 3PXPA 4ME4A 5J4EA 3LIAA 4P6ZS 2QJ5A 4CLCC 2HJEA 4I3JA 2JKTI 4PAUA 4RQ9A 5FL3A 5TBMB 3EEHA 1N9LA 3F1OA 1OPXA 1YKDA 3ICYA 3BQAA 4R3AA 3UMEA 4CLCA 2V1AA 4EESA 5G4YA 3S7OA 1S67L 4CQHA 3K3CA 1TS6A 5KSHA 2WKQA 3EOIA 1TS0A 2ZMVA 1D7EA 2ZOHA 1N9OA 3B42A 2OWHA 4LPZA 4KUOA 4F3LB 3R7WB 2VGLM 2O9AA 4NEED 3MMHA 3LIBA 3S7QA 1X0OA 2W3DA 3IBRA 3MQOA 1G28A 4KQDA 3KO6A 5HL6A 4BMWA 3OLOA 3PBSA 3H7WA 2GX5A 4EEPA 2OAP1 2OOLA 2QKPA 4YNRA 3D72A 5L8MA 4FOFA 3S7PA 1UWPX 2O0YA 2W1RA 1P97A 3OC2A 5HZHA 1V9ZA 3K2NA 1TS8A 2GNXA 4I3IA 4M4XA 1P9WA 3ULFA 4DJ3A 3B33A 4MCWA 1TD5A 4I5SA 3UE6A 3PBNA 4WF0A 4UEYA 1Y28A 2W3HA 4R6LA 4ZRRA 2VV8A 3E4PA 3FG8A 1NLYA 3E4OA 2QJ7A 3HJIA 4UQIS 3PBTA 3B47A 3LIDA 2A24A 4AFIA 1XJ4A 4DMZA 4L9GA 3MR0A 3UB8A 5F5YA 5C5KA 4HOIA 3RH8B 1T18A 5HWVA 2VA0A 2P7JA 2P04A 4H6JA 3CWFA 3MFXA 3MF0A 2JHEA 2J3TC 4G3VA 2P08A 4HJ3A 4O8GA 5DF9A 3H9WA 3VE4A 4LRYC 2EA9A 3VV4A 3H82A 2QHKA 5F68A 1DP6A 3PYPA 4B9OA 2M1CA 2G7UA 1S66L 3GECA 3BW6A 3LR5A 2QYBA 3CAXA 4MN5A 4FSFA 1STZA 3K3DA 1H8MA 2O9BA 4B93A 1YSQA 2M7UA 1T19A 2KDKA 3NJAA 3OBFA 3PBOA 1W63Q 2B02A 5DKKA 3W2ZA 3E0YA 2Y8HA 3CUEC 3BY8A 4L9EA 4G3WA 1IFQA 3HCYA 1ODVA 1T1AA 2K2NA 4HHDA 4CLCE 2EWVA 3JVUA 2PYPA 1XJ6A 3KYQA 1YAXA 3F1OB 3CUEA 4CLCB 4GS9A 3NOTC 3CITA 2JKRM 3HJKA 3EEAA 5DFXA 2VGLS 4II7A 4WEJA 3UMDA 3IS2A 4Q0JA 4LRZE 5J3WA 4EETB 4WEKA 2JN7A 4GHIA 2XRNA 3C2WA 2Z6DA 5DJTA 1H3QA 4WELA 5CX7A 3MJQA 5DFYA 2W0NA 3DBAA 3KX0X 2L4RA 3LIFA 3FPWA 5DKLA 2HV1A 4PKYA 2M7VA 2ZOIA 3H7WB 2PD8A 4EW7A 3F1PA 2OWJA 2VZWA 4DJ2A 3EGXC 4GLQA 5LBRA 3F1NA 2V0UA 4ETZA 4EQ1A 3LUQA 1EW0A 4EU0A 1YSPA 5J7EA 4I3AA 2INWA 4Y2FA 4GJ4A 4MN7A 3V67A 3A0RA 2HF6A 3VE3A 2PR5A 1DP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIE A;  5HSQ A;  2A24 B;  3LI9 A;  1OT6 A;  1OJG A;  1OTA A;  3LIC A;  1OJ5 A;  2PD7 A;  2WKP A;  4H6J B;  1UGU A;  4E04 A;  4YWZ A;  4WUJ A;  2R78 A;  2V9A A;  4NXF A;  1D06 A;  3H82 B;  4HJ6 A;  3A0S A;  2VEA A;  4HI4 A;  5HD5 A;  4EER A;  3LYX A;  1XFQ A;  4HH2 A;  1S4R A;  4LRX C;  1OTD A;  4HIA A;  3UB9 A;  3UB6 A;  1S1Y A;  1OTB A;  2CMN A;  1TS7 A;  3G6O A;  4JGQ A;  1OTE A;  4JGR A;  3A0V A;  3VOL A;  3NOP C;  4K08 A;  2D02 A;  1DRM A;  4GS9 B;  4HQA A;  2V1B A;  4WN5 A;  5HWT A;  4EEU A;  4NXE A;  3IS2 B;  2PYR A;  1GSX A;  3GDI A;  4GHI B;  5AVF A;  4R70 A;  4WL9 A;  1F9I A;  5HD3 A;  1GSW A;  2K7S A;  5I5L A;  1F98 A;  2ZBB A;  4XT2 A;  1KOU A;  3F1P B;  4BBU A;  1S1Z A;  1WA9 A;  3E4Q A;  4HJ4 A;  2QWS A;  3F1N B;  2YKH A;  3ZQ5 A;  3EWK A;  4HP4 A;  5F69 A;  4I39 A;  4BBT A;  5DJU A;  3SW1 A;  2H28 A;  2WKR A;  5IU1 A;  2PHY A;  5HDS A;  1T1B A;  3LI8 A;  4R38 A;  1OT9 A;  1MZU A;  2I9V A;  5HDD A;  5G4Z A;  2PDR A;  2Z6C A;  3FC7 A;  3MQQ A;  1UWN X;  1JNU A;  4HNB A;  4L9F A;  5TBM A;  4LLO B;  1V9Y A;  2L1M A;  3C8C A;  1LT0 A;  5IS1 A;  3BY9 A;  1BYW A;  1OTI A;  5HWW A;  5HDC A;  1GSV A;  2J80 A;  3T50 A;  1T1C A;  2VV7 A;  4GCZ A;  4NXB A;  4F3L A;  4PKY G;  5A8B A;  2VV6 A;  4MN6 A;  1P0Z A;  2V0W A;  3CLO A;  4HY8 A;  1VB6 A;  2KX6 A;  2YKF A;  1S4S A;  4JGO A;  5F6A A;  4HP9 A;  1N9N A;  4I38 A;  3NOU C;  4KUK A;  5EFW A;  1XJ2 A;  3NHQ A;  3BWL A;  1XFN A;  4NXG A;  4XT2 B;  2W27 A;  1LSW A;  4GW9 A;  4HH3 A;  4WLA A;  2PR6 A;  2BAS A;  4JGP A;  1XJ3 A;  3PHY A;  1DP8 A;  3P7N A;  2D01 A;  1NWZ A;  1LSX A;  2VLG A;  2L0W A;  3MXQ A;  4EXO A;  5KIZ A;  3RTY A;  4BBV A;  3UB7 A;  1LL8 A;  5AVE A;  1LSV A;  2GJ3 A;  5J4E A;  3LIA A;  2QJ5 A;  4I3J A;  4RQ9 A;  5TBM B;  3EEH A;  1N9L A;  3F1O A;  3ICY A;  4R3A A;  3UME A;  2V1A A;  4EES A;  5G4Y A;  1S67 L;  3K3C A;  1TS6 A;  2WKQ A;  1TS0 A;  1D7E A;  2ZOH A;  1N9O A;  2OWH A;  4LPZ A;  4KUO A;  4F3L B;  3LIB A;  1X0O A;  3IBR A;  3MQO A;  1G28 A;  4KQD A;  3OLO A;  3H7W A;  4EEP A;  2OOL A;  2QKP A;  3D72 A;  1UWP X;  1P97 A;  5HZH A;  1V9Z A;  1TS8 A;  4I3I A;  4M4X A;  3ULF A;  4DJ3 A;  3B33 A;  4I5S A;  3UE6 A;  4WF0 A;  1Y28 A;  4R6L A;  2VV8 A;  3E4P A;  3FG8 A;  3E4O A;  2QJ7 A;  3HJI A;  3LID A;  2A24 A;  1XJ4 A;  4L9G A;  3MR0 A;  3UB8 A;  5F5Y A;  4HOI A;  3RH8 B;  1T18 A;  5HWV A;  2P7J A;  4H6J A;  3CWF A;  3MFX A;  2JHE A;  4HJ3 A;  3VE4 A;  3H9W A;  4LRY C;  2EA9 A;  3H82 A;  2QHK A;  5F68 A;  1DP6 A;  3PYP A;  4B9O A;  2M1C A;  1S66 L;  3GEC A;  3CAX A;  4MN5 A;  3K3D A;  1T19 A;  2KDK A;  3NJA A;  2B02 A;  5DKK A;  3BY8 A;  4L9E A;  1ODV A;  1T1A A;  4HHD A;  2PYP A;  1XJ6 A;  3F1O B;  4GS9 A;  3NOT C;  3HJK A;  3UMD A;  3IS2 A;  4LRZ E;  5J3W A;  4EET B;  2JN7 A;  4GHI A;  3C2W A;  2Z6D A;  5DJT A;  3MJQ A;  2W0N A;  3KX0 X;  2L4R A;  3LIF A;  5DKL A;  2HV1 A;  4PKY A;  2ZOI A;  3H7W B;  2PD8 A;  4EW7 A;  3F1P A;  2OWJ A;  4DJ2 A;  3F1N A;  2V0U A;  4EQ1 A;  3LUQ A;  1EW0 A;  5J7E A;  4I3A A;  2INW A;  3A0R A;  3VE3 A;  2PR5 A;  1DP9 A; 
#chains in the Genus database with same CATH topology
 3IF6 B;  4X69 A;  1OT6 A;  1OJG A;  5FI6 A;  2PD7 A;  3Q1F A;  4OQH A;  4WUJ A;  2R78 A;  4NXF A;  4PM6 A;  3IWO A;  2Y91 A;  3CI6 A;  4N1X A;  1OTD A;  4HIA A;  2XLN A;  5HW3 A;  3KSH A;  3UB6 A;  4OQG A;  1OTB A;  5L09 A;  4DF6 A;  4MLL A;  3PBQ A;  4G3K A;  3RXX A;  5IHV A;  1ERM A;  1F5M A;  3A0V A;  3FYZ A;  4O01 A;  2ZQ9 A;  1DJC A;  1KGF A;  2QZ6 A;  4GS9 B;  2NUP C;  4RYE A;  4O0P A;  5TFQ A;  4LCM A;  4WN5 A;  2DNS A;  3OPR A;  4Y7P A;  2V2F F;  4GHI B;  1L3L A;  3G35 A;  3UDI A;  4ZJ1 A;  5HD3 A;  5M1A A;  3VP0 A;  2K7S A;  4OQI A;  1F98 A;  3ZCZ A;  3IH9 A;  2J7V A;  1MXO A;  5HPI A;  3U2A A;  4BBU A;  1S1Z A;  1NZO A;  3O87 A;  1WA9 A;  1NJ4 A;  3E4Q A;  2QWS A;  3T1Q B;  1GHP A;  2ZQ8 A;  3F1N B;  1ESI A;  4Q0H A;  4BBT A;  2RL3 A;  4FCF A;  1ES5 A;  5MC7 A;  3JPU A;  1PYY A;  1NZU A;  1BSG A;  3LI8 A;  5FAS A;  4GZB A;  2KOI A;  3ZG0 A;  1ESU A;  2EXB A;  3D3O A;  3ZFZ A;  2I9V A;  1XA7 A;  5HDD A;  2PDR A;  2Z6C A;  4ARZ A;  2XF3 A;  1PFL A;  3HLC A;  4XUX A;  3BLS A;  4PPR A;  2OV5 A;  4JLF A;  3FC7 A;  3G30 A;  3MQQ A;  4HNB A;  1K55 C;  4RX2 A;  3Q7Z A;  1V9Y A;  3HLF A;  4E3J A;  1LT0 A;  5IS1 A;  3T1R A;  5EVE A;  1N9B A;  1S0W A;  4BQM A;  4MBF A;  1QME A;  5EPH A;  1K56 D;  2ACG A;  2Y2M A;  4QHC A;  2HDU A;  4DKI A;  3VOY A;  4F3L A;  4L0L A;  5EM0 A;  4GNU A;  3OPH A;  3T1X A;  2ZMA A;  3VP1 A;  4BLM A;  1VB6 A;  3ZDJ A;  2KX6 A;  5K5B A;  4JGO A;  1W5D A;  2ZL1 A;  3TE8 A;  1YT4 A;  4KZ6 A;  1ZHH B;  3NOU C;  3FWL A;  4KUK A;  2EWW A;  2R9W A;  3CPT A;  3ISG A;  4X55 A;  1ES4 A;  3BWL A;  4BL2 A;  3EQV A;  3GTC A;  4FH2 A;  1I2S A;  2Y2J A;  1WYC A;  5F82 A;  3ZYT A;  3EGD C;  4WZ5 A;  4DN0 A;  3GVB A;  2OLU A;  3P7N A;  2PT7 A;  2HGV A;  3EQU A;  4Y0T A;  4X25 A;  3HBR A;  4OOL A;  2EX2 A;  2X02 A;  1MY8 A;  5GLA A;  1PW1 A;  4UAA A;  3IH8 A;  3RTY A;  3BJN A;  1W63 M;  3DAV A;  3UNW A;  4C6Y A;  3FKV A;  2JKG A;  5AVE A;  4ARZ B;  3ZG5 A;  1YQS A;  4NK3 A;  4PM5 A;  3AGE A;  2X01 A;  5J4E A;  4EBP A;  1J3W A;  3SS5 A;  2QJ5 A;  3DTK A;  2HJE A;  4LEN A;  3EEH A;  3V5M A;  1Y54 A;  2WUQ A;  4GB7 A;  1N9L A;  5CHM A;  3ICY A;  3CMZ A;  4S2L A;  1S67 L;  5EM1 A;  2PU2 A;  3EOI A;  2ZOH A;  1N9O A;  4IVI A;  2ZM2 A;  4F3L B;  1C3B A;  3S7Q A;  3RJU A;  1A0K A;  1FSY A;  4QWO A;  4WMC D;  3MQO A;  5JYP A;  5HL6 A;  1CK3 A;  1YLZ A;  3H7W A;  1MWS A;  4EEP A;  3ZVT A;  3D72 A;  4E3L A;  1UWP X;  1P97 A;  4HBU A;  1FCO A;  2ZL1 B;  4F94 A;  5GHX A;  4IBX A;  4U0T A;  3UE6 A;  4WF0 A;  1Y4O A;  3CPT B;  2H10 A;  1U60 A;  3E4P A;  3FG8 A;  1NLY A;  4Y0U A;  1W7F A;  3PBT A;  3B47 A;  3LID A;  3T12 B;  2A24 A;  4DMZ A;  4UA6 A;  4DDS A;  4JXW A;  4H6J A;  1PWC A;  3BYD A;  5CTN A;  1XGJ A;  4G3V A;  2EX6 A;  3ITA A;  5GLC A;  3VV4 A;  3JYI A;  3H82 A;  2QHK A;  5F68 A;  3WWX A;  4BL3 A;  2XDM A;  1DP6 A;  3QP6 A;  2QYB A;  2XGN A;  3UE1 A;  3QP1 A;  1JWP A;  2KDK A;  3WS5 A;  3OBF A;  3PBO A;  1W63 Q;  5D3O A;  5EVL A;  3QHY A;  4OPQ A;  4G3W A;  3HCY A;  4E6X A;  1ODV A;  3SS4 A;  2K2N A;  3MS6 A;  3A3F A;  5FDH A;  2HZ5 A;  2ZC3 B;  4QB8 A;  3G34 A;  1JTG A;  5FAO A;  3MKF A;  1FCN A;  4WEJ A;  5U47 A;  3UMD A;  4Q0J A;  5J3W A;  3E2K A;  4OKP A;  1PZP A;  3C2W A;  5CX7 A;  3DTI A;  3C7V A;  3LIF A;  3DWK A;  1NY0 A;  5DKL A;  2QMI A;  5AQ7 A;  2QPN A;  4BD0 A;  4KG2 A;  3H7W B;  2PD8 A;  3OZH A;  3EGX C;  3IXG A;  4B88 A;  4R1G A;  3NBL A;  2B95 A;  4GD6 A;  1SCW A;  2FFF B;  3LUQ A;  3SH7 A;  5CEC A;  4S2M A;  4Y2F A;  5TR7 A;  2H5S A;  2HF6 A;  3VE3 A;  2PR5 A;  2EFX A;  4X68 A;  3FZC A;  3HUO A;  5EOO A;  2A24 B;  3LIC A;  3AGF A;  4H6J B;  4FH4 A;  4KZA A;  4YWZ A;  2WGI A;  4EUV A;  2V9A A;  3H82 B;  1K4F A;  4HJ6 A;  4Q0I A;  3PBR A;  4GD8 A;  1TDL A;  3LYX A;  3JVV A;  5E2E A;  4A5R A;  4PM9 A;  1H5X A;  4LRX C;  2LB9 A;  2CMN A;  1PWD A;  1TS7 A;  3G6O A;  3NC8 A;  1IEL A;  5KMW A;  5M19 A;  5FI7 A;  4R4R A;  3NEC A;  4E3N A;  4WZ4 A;  3KYZ A;  4ZDX A;  1CQA A;  3LR0 A;  1SKF A;  3TRC A;  1PIO A;  2DMW A;  1RGY A;  4CLC D;  4HQA A;  5HWT A;  4NXE A;  4OLG A;  4U0X A;  3GDI A;  3T4O A;  2JKT M;  2Y2Q A;  1K4E A;  3OOV A;  4R70 A;  2JC7 A;  4OP5 A;  1YLJ A;  4ETX A;  4MEZ A;  4QY5 A;  5E2H A;  2XD5 A;  3RFB A;  3GR2 A;  1KOU A;  3TW8 A;  1G5U A;  4HJ4 A;  4UHU A;  3BFD A;  4KQQ A;  1JVJ A;  2ZMF A;  5EVI C;  3CG5 A;  3EWK A;  4HP4 A;  3T4S A;  4I39 A;  4IUK A;  1BLC A;  2LB5 A;  4KZ7 A;  1MWU A;  5DJU A;  4EBL A;  3SW1 A;  3O86 A;  2Y2N A;  3C4P A;  3VP2 A;  4EUZ A;  1T1B A;  3ZVW A;  5GL9 A;  1PZO A;  1IEM A;  3WRT A;  1OT9 A;  3N6I A;  1G6O A;  2IWC A;  4Q8I A;  3ZG7 B;  2Y2H A;  3NDE A;  5FQQ A;  3A3E A;  2JKR I;  3KSI A;  2K31 A;  2HDR A;  3MQ0 A;  5FAP A;  2W3G A;  4OOY A;  2L1M A;  2OAQ 1;  3VFF A;  1K55 A;  2E8I A;  5M18 A;  3QNC A;  1I5Q A;  5HWW A;  3VMA A;  1ACF A;  5HDC A;  3O5Y A;  2J80 A;  5CGS A;  3T50 A;  1KGE A;  4GCZ A;  4NXB A;  3A3D A;  2GZA A;  1Q2Q A;  4JKT A;  4KG5 A;  2HJ9 C;  5FEG A;  2V0W A;  3UN7 A;  1E3U D;  2VJW A;  3BM6 A;  4ZJ3 A;  2YKF A;  1ONH A;  3HLW A;  4R4S A;  3Q82 A;  3E2L A;  5FQI A;  3P98 A;  1N9N A;  1LI0 A;  3S1Y A;  5EFW A;  5G18 A;  3QP4 A;  2PRF A;  2DRW A;  1XJ2 A;  2JCH A;  3D4F A;  3UPN A;  3OCL A;  4OQ0 A;  4NXG A;  5FDS A;  3QP2 A;  2W27 A;  3PAG A;  1P9R A;  3Q7V A;  3PAE A;  1RCJ A;  4GW9 A;  3WRZ A;  3BFE A;  1TF1 A;  4JGP A;  2VK3 A;  4QD4 A;  3ITB A;  1NXY A;  5CRF A;  1GA0 A;  5FQ9 A;  1LSX A;  5L07 A;  1FIL A;  4EXO A;  4BBV A;  2VGJ A;  3TOI A;  3HLG A;  2GJ3 A;  2EX9 A;  5FQK A;  3ZG8 B;  3GRJ A;  3IF5 A;  4QJG A;  3LIA A;  2Z2L B;  4RQ9 A;  2XFS A;  4IVK A;  3HVF A;  1SHV A;  1K38 A;  1MPL A;  1OPX A;  1SKO A;  1H8Y A;  3BQA A;  4B4X A;  2V1A A;  1KVL A;  5G4Y A;  3BRM A;  3S7O A;  2Y2I A;  4KEN B;  4LPZ A;  5JYO A;  4KUO A;  2VGL M;  3LIB A;  4WM9 A;  1KE3 A;  1Z09 A;  3MKE A;  3IBR A;  2CC1 A;  3ZG9 B;  4BMW A;  3O3V A;  3W4O A;  3P09 A;  2ZM8 A;  4ZTK A;  1KDS A;  3HLB A;  1LL5 A;  2OOL A;  4K0W A;  3IQA A;  4YNR A;  4OPZ A;  2H0Y A;  4FOF A;  3S7P A;  5KSC A;  2O0Y A;  1K25 A;  3OC2 A;  4OH0 A;  1GCE A;  2W3H A;  1W8Q A;  1O07 A;  2VV8 A;  3LY4 A;  2WKI A;  2XQZ A;  3E4O A;  4UQI S;  4MBK A;  1L0F A;  4KZB A;  3Q7V B;  1VM1 A;  4L9G A;  2Y2P A;  4WYY A;  3MR0 A;  3UB8 A;  5C5K A;  1CI9 A;  3RH8 B;  5HWV A;  2P04 A;  2JHE A;  3VE4 A;  5DF9 A;  2P08 A;  4O8G A;  2IWB A;  3H9W A;  2ZC7 A;  3N8L A;  4GOG A;  4MBH A;  4DXC A;  2G7U A;  3Q07 A;  2X71 A;  3BW6 A;  5J8X A;  3CAX A;  5AQA A;  1STZ A;  2C6W B;  3MFD A;  5AQ9 A;  4X1M A;  5DKK A;  5A92 A;  4QU3 A;  3CUE C;  3BY8 A;  1KE0 A;  4L9E A;  5KZH A;  1T1A A;  4XUZ A;  2WZX A;  1Z6F A;  1XJ6 A;  1SKO B;  3BEC A;  1PI4 A;  3BEB A;  1G6A A;  2UWX A;  3HJK A;  3IS2 A;  4LRZ E;  4JF4 A;  2XRN A;  2Z6D A;  3DTM A;  3N8R A;  4H8R A;  5DFY A;  3C5A A;  2W0N A;  3KX0 X;  2OSU A;  2HV1 A;  1Q2P A;  1SDE A;  3NIA A;  4PKY A;  4YFM A;  5HFO A;  1IKG A;  3SOI A;  2G2U A;  2ZLY A;  2M7V A;  2ZOI A;  5A90 A;  4DXB A;  1K57 C;  3F1P A;  2VZW A;  4DJ2 A;  3IX8 A;  4GLQ A;  2XEP A;  3B3X A;  2C5W B;  1FR6 A;  3C7U A;  1EW0 A;  1YSP A;  5J7E A;  4I3A A;  2INW A;  4JF5 A;  4HEF A;  1YPR A;  2VGK A;  4MN7 A;  1YLT A;  1BLP A;  3BFG A;  2EFU A;  1DP9 A;  4EBN A;  3LIE A;  5HSQ A;  4QPR A;  3TSG A;  1LLB A;  2WKH A;  5E2F A;  3SS3 A;  5L10 A;  5F83 A;  1OTA A;  2A2L A;  1CEF A;  2ZQC A;  1ZG6 A;  3S22 A;  1UGU A;  4HES A;  2XA7 S;  3IBJ A;  4GKU A;  1NYM A;  3A0S A;  1PNE A;  2VEA A;  1H0M A;  4HI4 A;  1AWI A;  3G4P A;  5HD5 A;  2IA2 A;  3QNB A;  4EER A;  1XFQ A;  4X56 A;  4KZ5 A;  4HH2 A;  3P01 A;  5EE8 A;  4DRT A;  2XK1 A;  1D1J A;  2A3U A;  4N9L A;  3V50 A;  1K54 C;  3SH9 A;  4JXG A;  4K0X A;  2WKE A;  2ZJ9 A;  4JGQ A;  4E3O A;  3N8S A;  5EUA A;  3BQ8 A;  3VOL A;  4EWF A;  3NOP C;  2J9O A;  3BFC A;  2J3W A;  1DRM A;  3ZNY A;  4KZ4 A;  4C75 A;  4EEU A;  3M2K A;  3LEZ A;  3IS2 B;  4Y3I A;  3OPL A;  2PYR A;  1GSX A;  3NUL A;  4ZJ2 A;  4Y0O A;  2UV0 E;  4UQI M;  5AVF A;  2FH5 A;  4WL9 A;  1YLW A;  1GSW A;  1W8Y A;  1L0D A;  2FZ0 A;  2AVX A;  2ZBB A;  3IWI A;  1ALQ A;  4XT2 A;  3F1P B;  3WS0 A;  2JKF A;  3QP8 A;  4JXV A;  4S2K A;  2YKH A;  3ZQ5 A;  3KSG A;  1ONG A;  4OPR A;  5DVA A;  1BT5 A;  5F69 A;  2Y2K A;  3IX3 A;  1N4O A;  1VQQ A;  2H28 A;  5EVI A;  5IU1 A;  4R23 A;  3FV7 A;  5HL1 A;  3FKW A;  4KZ9 A;  1KGG A;  1BZA A;  3O88 A;  4N1H A;  1MZU A;  3C30 A;  5CHU A;  4FTX A;  3T4Q A;  5G4Z A;  1OME A;  2ZC5 B;  3MBZ A;  2V20 A;  1UWN X;  4JBF A;  3HUM A;  4PMA A;  5HAI A;  2HDS A;  1BTL A;  4LLO B;  2A49 A;  1L0G A;  2J3T D;  3C8C A;  4C3Q A;  2ZQ7 A;  4KQO A;  3WS1 A;  2B18 A;  2WK0 A;  5CXW A;  1BLH A;  3G2Y A;  2W3F A;  4OLD A;  3LFV A;  3IHB A;  1BYW A;  1OTI A;  5IT5 A;  1KVM A;  1IYS A;  3T4T A;  4WBG A;  4YOF A;  1I2W A;  5FQM A;  3R7W A;  3NY4 A;  2EX8 A;  2WYX A;  4PKY G;  5A8B A;  2XSS A;  4MN6 A;  4OP8 A;  4E3K A;  1IYP A;  1TVF A;  4ZAM A;  4HY8 A;  3FPV A;  2KLI A;  2ZM0 A;  3MXS A;  2RCX A;  4P85 A;  4IUH A;  1PI5 A;  4HP9 A;  4U3T A;  3S4X A;  3WS2 A;  4CPK A;  2I72 A;  4R3J A;  4IBR A;  5FQJ A;  2HP6 A;  1VHM A;  2MJ6 A;  1IKI A;  4OVD A;  1WYB A;  3UE3 A;  1J9M A;  4XT2 B;  1IOU A;  2XA7 M;  1LSW A;  3U4L P;  3PR6 A;  4Y5F A;  3T4K A;  4CJN A;  2Q0O A;  4HH3 A;  3C38 A;  1MWR A;  1XJ3 A;  4KZ8 A;  1DP8 A;  2D01 A;  4R0Q A;  5AJG A;  5EVI B;  4IED A;  2XRO A;  2VLG A;  5HPF A;  3A3J A;  4BJP A;  4ID4 A;  1LL8 A;  4X53 A;  1JWZ A;  2Y79 A;  3MZE A;  1LSV A;  3V39 A;  4PHT A;  4E3M A;  4ZBE A;  4JXS A;  3VFH A;  4ME4 A;  4BEN A;  4P6Z S;  4MNR A;  4CLC C;  3T1S A;  5FL3 A;  2JKT I;  1CI8 A;  1FR1 A;  1ERQ A;  3F1O A;  1YKD A;  3CJM A;  4LGW A;  2PU4 A;  5FAQ A;  2HPB A;  4LCL A;  1TS6 A;  2ZMV A;  1WE4 A;  3B42 A;  2OWH A;  3R7W B;  3IWQ A;  2O9A A;  3LEQ A;  5TGF A;  5A91 A;  1XKZ A;  5HX9 A;  1X0O A;  2W3D A;  1NRF A;  1G28 A;  4KQD A;  4S2N C;  4UA7 A;  2Q9M A;  1ZC2 A;  3OLO A;  1FSW A;  1EI5 A;  2GX5 A;  3HLE A;  3DWZ A;  2WAD A;  1V9Z A;  1TS8 A;  2GNX A;  4M4X A;  1P9W A;  3ULF A;  3B33 A;  4MCW A;  1TD5 A;  4I5S A;  3IF6 C;  3PBN A;  3NDG A;  4UEY A;  1Y28 A;  2FFY A;  3PTE A;  4AFI A;  1XJ4 A;  5BOH A;  5F5Y A;  2JBF A;  2VA0 A;  2P7J A;  4O7D A;  5DTS A;  3CWF A;  3MFX A;  4HJ3 A;  4R3B A;  2EA9 A;  1HLU P;  4KZ3 A;  3PYP A;  1S66 L;  3GEC A;  3LR5 A;  3VP4 A;  4RA7 A;  4MN5 A;  5HAP A;  1XXM A;  1K56 A;  3HRE A;  1YSQ A;  2M7U A;  1GHI A;  2WGW A;  3LCE A;  2PBY A;  3M6B A;  3BLM A;  2B02 A;  3E0Y A;  4FD8 A;  2Y8H A;  3G2Z A;  3UDX A;  1IFQ A;  4N92 A;  4E6W A;  4GN2 A;  2EWV A;  3JVU A;  2PYP A;  3F1O B;  3C4O A;  3IT9 A;  1GHM A;  3CUE A;  3NOT C;  3CIT A;  3M2J A;  3EEA A;  5L2F A;  4EET B;  2JN7 A;  1SZV A;  1H3Q A;  2WGV A;  4WEL A;  1AXB A;  3MJQ A;  5I94 A;  3FPW A;  3SH8 A;  2ZD8 A;  5EEC A;  1S6R A;  4EW7 A;  2H0T A;  2ZC6 B;  3W4P A;  5CGX A;  1DY6 A;  4NET A;  1FIK A;  2XH9 A;  1K6R A;  1QMF A;  2V0U A;  1H8Z A;  1K57 A;  4EU0 A;  3OPP A;  1XA1 A;  3UE0 A;  5A93 A;  2HP5 A;  3V67 A;  1EWZ A;  4GDB A;  3UB5 P;  1TEM A;  4DJ3 A;  2DCF A;  3MSH A;  3LI9 A;  4NKP A;  4P6Z M;  2ZQA A;  1MKM A;  3A3I A;  1OJ5 A;  4RX3 A;  2WKP A;  2W1T A;  1KE4 A;  4E04 A;  3LR3 A;  1L2S A;  1MKI A;  1D06 A;  3LGO A;  5DF8 A;  1W79 A;  2Y59 A;  4KG6 A;  4IJG A;  1SDN A;  1S4R A;  3KYE A;  4DE3 A;  1PRQ A;  3G31 A;  2Y2O A;  2PAV P;  3UB9 A;  4Y13 A;  1S1Y A;  2WGW B;  2P9V A;  3RXW A;  4EV4 A;  1BUE A;  1OTE A;  3AGD A;  3HL9 A;  3VSL A;  3UPO A;  4JGR A;  5CER A;  3T4L A;  1K54 A;  3LR4 A;  4OON A;  4WMC A;  4K08 A;  2O9C A;  1L0E A;  2D02 A;  5GHZ A;  5GHY A;  2V8F A;  3T4J A;  5GLD A;  2V1B A;  1RP5 A;  1ERO A;  5TJJ A;  4LV0 A;  1BUL A;  1IYQ A;  5E43 A;  3N7W A;  1F9I A;  5I5L A;  2WAF A;  1FCM A;  3IHA A;  4JF6 A;  5FEF A;  5CHJ A;  4D2O A;  4P0M A;  4BD1 A;  5FI2 A;  1F2K A;  1JWV A;  2WKR A;  2PHY A;  1ZTU A;  5HDS A;  2B5R A;  2W3E A;  3W8K A;  1MC0 A;  3NI9 A;  4XXR A;  3GV9 A;  4PM7 A;  4R38 A;  4S2I A;  3N4I A;  1LHY A;  5FA7 A;  1PWG A;  2W1T B;  3TG9 A;  2Y55 A;  2ZC4 B;  3E98 A;  2NUT C;  3UPP A;  1JNU A;  1HTZ A;  4OOM A;  4L9F A;  5TBM A;  3LY3 A;  1YMS A;  4KQR A;  4HBT A;  3ZNT A;  1DJB A;  3VSK A;  4Z9Q A;  3R4K A;  4IHQ A;  3BY9 A;  5HAQ A;  1JTD A;  1YLP A;  2P9V B;  3BFF A;  2Y2L A;  5HAR A;  1GSV A;  4Z1W A;  1T1C A;  2VV7 A;  3V3R A;  4P6B A;  3S7N A;  1NRJ A;  2VV6 A;  2WZZ A;  2IWD A;  1KDW A;  2O99 A;  1FOF A;  2BLS A;  2VX8 A;  1P0Z A;  4DE1 A;  1NLZ A;  3CLO A;  1XX2 A;  2VKS A;  3MXR A;  1S4S A;  1XPB A;  4DDY A;  3IXH A;  4X1L A;  3KSF A;  2R9X A;  1M6K A;  3OCN A;  1LL9 A;  5F6A A;  4BWI A;  4I38 A;  4Y17 A;  4B4Z A;  5CED A;  3ZGA B;  1FQG A;  3NHQ A;  1XFN A;  4WZ5 C;  2BG1 A;  3GQZ A;  4PM8 A;  4ESP A;  4WLA A;  2PR6 A;  5CTM A;  2BAS A;  2OLV A;  3SZT A;  1K0K A;  1ES3 A;  3PHY A;  4GDN A;  4NG2 A;  1M40 A;  3ZHH A;  1NWZ A;  1CF0 A;  2L0W A;  3MXQ A;  4FUW A;  5KIZ A;  1VET A;  1G68 A;  3IXD A;  1PW8 A;  3UB7 A;  3TJZ C;  2XFT A;  4MDZ A;  1LI9 A;  3NCK A;  3GSG A;  3DTE A;  2G2W A;  4MMN A;  2Y4A A;  4LV3 A;  3W4Q A;  1BLS A;  1HZO A;  3PXP A;  4S2O A;  1VEU A;  4D60 A;  2Z2M B;  4I3J A;  4PAU A;  5TBM B;  2J9P A;  2ZQD A;  5F1F A;  4R3A A;  3UME A;  4CLC A;  3I7J A;  4EES A;  5DF7 A;  2V8C A;  4CQH A;  3K3C A;  5KSH A;  5CEB A;  2WKQ A;  1TS0 A;  3L7H A;  1D7E A;  3L9K A;  4NEE D;  3MMH A;  1E25 A;  3IX4 A;  4LV2 A;  2JE5 A;  3KO6 A;  3QP5 A;  3VP3 A;  3PBS A;  2OAP 1;  4K91 A;  2QKP A;  5L8M A;  2Q9N A;  2W1R A;  4S2N A;  4Y15 A;  5HZH A;  1ZKJ A;  3K2N A;  4I3I A;  2J8Y A;  1NYY A;  1XGI A;  4S2P A;  4X6T A;  4R6L A;  3V3S A;  4JPM A;  4OPY A;  4ZRR A;  2QJ7 A;  2HP9 A;  3HJI A;  1ES2 A;  2HDQ A;  3IF6 A;  3LO7 A;  4EQI A;  4YIN A;  4HOI A;  5EOE A;  1T18 A;  1XP4 A;  3MZD A;  1HD8 A;  1CEG A;  1YMX A;  2E8J A;  3CZD A;  2Y2G A;  3D9Y A;  3MF0 A;  3MZF A;  2J3T C;  1TDG A;  4LRY C;  5DTT A;  5EV0 A;  4B9O A;  2M1C A;  5EVI D;  5CGW A;  3HLD A;  4FSF A;  1VET B;  2XR0 A;  3G32 A;  3HUN A;  2V1Z A;  3K3D A;  1H8M A;  4E3I A;  2O9B A;  4B93 A;  1GA9 A;  1ZG4 A;  1T19 A;  4UA9 A;  5FSR A;  3NJA A;  4QY6 A;  5FAT A;  1HVB A;  1MWT A;  4S2J A;  3W2Z A;  3UDF A;  2WAE A;  1VEU B;  5GLB A;  1O7E A;  4N9K A;  1CJF A;  1YLY A;  4HHD A;  4CLC E;  1E3U A;  3Q81 A;  3KYQ A;  1YAX A;  4DE2 A;  2BTF P;  4CLC B;  4GS9 A;  2GDN A;  1IYO A;  2XD1 A;  2JKR M;  4LV1 A;  5DFX A;  1K6S A;  2VGL S;  4II7 A;  1RGZ A;  4RVA A;  3VOZ A;  4WEK A;  4GHI A;  2P74 A;  3CHW P;  2PBD P;  5DJT A;  3DW0 A;  3WS4 A;  3DBA A;  2L4R A;  3UO9 A;  5DTK A;  5F1G A;  1E4D A;  4LFU A;  5AQB A;  1DJA A;  2OWJ A;  4M3K A;  3IXB A;  3UY6 A;  5LBR A;  1MBL A;  3F1N A;  4ETZ A;  3GMW A;  4EQ1 A;  1YM1 A;  3M6H A;  5E2G A;  4P87 A;  4GJ4 A;  3A0R A;  2EXA A;  4DE0 A; 
#chains in the Genus database with same CATH homology
 3LIE A;  5HSQ A;  4QPR A;  2A24 B;  3LI9 A;  4NKP A;  1OT6 A;  4P6Z M;  1OJG A;  1OTA A;  3LIC A;  1MKM A;  1OJ5 A;  2PD7 A;  2A2L A;  2WKP A;  2W1T A;  4H6J B;  1UGU A;  4E04 A;  2XA7 S;  3IBJ A;  3LR3 A;  4YWZ A;  4EUV A;  4WUJ A;  2R78 A;  2V9A A;  4NXF A;  1D06 A;  3H82 B;  4HJ6 A;  3A0S A;  4Q0I A;  3PBR A;  2VEA A;  4HI4 A;  3CI6 A;  5HD5 A;  4IJG A;  2IA2 A;  4EER A;  3LYX A;  1XFQ A;  3JVV A;  4HH2 A;  3P01 A;  1S4R A;  4LRX C;  1OTD A;  4HIA A;  3UB9 A;  2LB9 A;  3KSH A;  3UB6 A;  1S1Y A;  1OTB A;  2CMN A;  1TS7 A;  3G6O A;  4JGQ A;  1OTE A;  3PBQ A;  4G3K A;  4JGR A;  1F5M A;  3BQ8 A;  3A0V A;  3T4L A;  3VOL A;  3NOP C;  3LR4 A;  4O01 A;  3KYZ A;  4K08 A;  2O9C A;  2J3W A;  2D02 A;  1DRM A;  3LR0 A;  3TRC A;  2DMW A;  4GS9 B;  2NUP C;  3T4J A;  4O0P A;  4CLC D;  4HQA A;  2V1B A;  4WN5 A;  5HWT A;  4EEU A;  4NXE A;  5TJJ A;  3IS2 B;  4Y3I A;  2PYR A;  1GSX A;  3GDI A;  4GHI B;  3T4O A;  2JKT M;  4UQI M;  5AVF A;  2FH5 A;  3OOV A;  4R70 A;  4WL9 A;  1F9I A;  5HD3 A;  1GSW A;  2K7S A;  5I5L A;  1F98 A;  4ETX A;  2FZ0 A;  2ZBB A;  4XT2 A;  3RFB A;  5HPI A;  3U2A A;  1KOU A;  3F1P B;  3TW8 A;  4BBU A;  1S1Z A;  1WA9 A;  3E4Q A;  4HJ4 A;  2QWS A;  3F1N B;  2ZMF A;  2YKH A;  3ZQ5 A;  3EWK A;  4HP4 A;  3KSG A;  4Q0H A;  5F69 A;  3T4S A;  4I39 A;  4BBT A;  4IUK A;  2LB5 A;  5DJU A;  3SW1 A;  5MC7 A;  2H28 A;  2WKR A;  5IU1 A;  2PHY A;  1ZTU A;  5HDS A;  2W3E A;  1MC0 A;  1T1B A;  3LI8 A;  2KOI A;  4R38 A;  1OT9 A;  1MZU A;  3C30 A;  3D3O A;  2I9V A;  3T4Q A;  1G6O A;  5HDD A;  5G4Z A;  2PDR A;  2Z6C A;  4ARZ A;  2W1T B;  2JKR I;  3KSI A;  2K31 A;  3FC7 A;  3MQQ A;  3E98 A;  2NUT C;  3MQ0 A;  1UWN X;  1JNU A;  4HNB A;  4OOM A;  2W3G A;  4L9F A;  5TBM A;  4LLO B;  1V9Y A;  2J3T D;  2L1M A;  2OAQ 1;  3C8C A;  4KQO A;  1LT0 A;  5IS1 A;  2B18 A;  3R4K A;  2W3F A;  4IHQ A;  3LFV A;  3BY9 A;  1BYW A;  1OTI A;  5HWW A;  5IT5 A;  3T4T A;  5HDC A;  1GSV A;  4Z1W A;  3O5Y A;  2J80 A;  3T50 A;  1T1C A;  4YOF A;  2VV7 A;  4GCZ A;  4L0L A;  4NXB A;  3R7W A;  3S7N A;  4F3L A;  1NRJ A;  2GZA A;  4PKY G;  5A8B A;  2VV6 A;  2XSS A;  4MN6 A;  2O99 A;  2HJ9 C;  2VX8 A;  1P0Z A;  2V0W A;  2VJW A;  1NLZ A;  3CLO A;  4HY8 A;  1VB6 A;  2VKS A;  3FPV A;  2KLI A;  2KX6 A;  2YKF A;  1S4S A;  5K5B A;  3KSF A;  4JGO A;  4IUH A;  3OCN A;  5F6A A;  4HP9 A;  1N9N A;  3TE8 A;  4BWI A;  1ZHH B;  3NOU C;  4I38 A;  4KUK A;  2EWW A;  5EFW A;  1VHM A;  2MJ6 A;  1XJ2 A;  3NHQ A;  3BWL A;  3OCL A;  1XFN A;  4NXG A;  3EQV A;  3UE3 A;  4XT2 B;  1IOU A;  2XA7 M;  2W27 A;  1LSW A;  1P9R A;  3PR6 A;  3ZYT A;  4Y5F A;  3T4K A;  3EGD C;  4GW9 A;  4HH3 A;  4WLA A;  1TF1 A;  2PR6 A;  3C38 A;  2BAS A;  4JGP A;  1XJ3 A;  4DN0 A;  3PHY A;  1DP8 A;  3P7N A;  2D01 A;  2PT7 A;  5AJG A;  2HGV A;  3EQU A;  1NWZ A;  4OOL A;  1LSX A;  2XRO A;  2VLG A;  2L0W A;  5HPF A;  3MXQ A;  4EXO A;  5KIZ A;  3RTY A;  4BJP A;  3BJN A;  1W63 M;  4BBV A;  3UB7 A;  3TJZ C;  1LL8 A;  4MDZ A;  5AVE A;  2Y79 A;  4ARZ B;  1LSV A;  2GJ3 A;  4MMN A;  4PHT A;  3PXP A;  4ME4 A;  5J4E A;  3LIA A;  4P6Z S;  2QJ5 A;  4CLC C;  2HJE A;  4I3J A;  2JKT I;  4PAU A;  4RQ9 A;  5FL3 A;  5TBM B;  3EEH A;  1N9L A;  3F1O A;  1OPX A;  1YKD A;  3ICY A;  3BQA A;  4R3A A;  3UME A;  4CLC A;  2V1A A;  4EES A;  5G4Y A;  3S7O A;  1S67 L;  4CQH A;  3K3C A;  1TS6 A;  5KSH A;  2WKQ A;  3EOI A;  1TS0 A;  2ZMV A;  1D7E A;  2ZOH A;  1N9O A;  3B42 A;  2OWH A;  4LPZ A;  4KUO A;  4F3L B;  3R7W B;  2VGL M;  2O9A A;  4NEE D;  3MMH A;  3LIB A;  3S7Q A;  1X0O A;  2W3D A;  3IBR A;  3MQO A;  1G28 A;  4KQD A;  3KO6 A;  5HL6 A;  4BMW A;  3OLO A;  3PBS A;  3H7W A;  2GX5 A;  4EEP A;  2OAP 1;  2OOL A;  2QKP A;  4YNR A;  3D72 A;  5L8M A;  4FOF A;  3S7P A;  1UWP X;  2O0Y A;  2W1R A;  1P97 A;  3OC2 A;  5HZH A;  1V9Z A;  3K2N A;  1TS8 A;  2GNX A;  4I3I A;  4M4X A;  1P9W A;  3ULF A;  4DJ3 A;  3B33 A;  4MCW A;  1TD5 A;  4I5S A;  3UE6 A;  3PBN A;  4WF0 A;  4UEY A;  1Y28 A;  2W3H A;  4R6L A;  4ZRR A;  2VV8 A;  3E4P A;  3FG8 A;  1NLY A;  3E4O A;  2QJ7 A;  3HJI A;  4UQI S;  3PBT A;  3B47 A;  3LID A;  2A24 A;  4AFI A;  1XJ4 A;  4DMZ A;  4L9G A;  3MR0 A;  3UB8 A;  5F5Y A;  5C5K A;  4HOI A;  3RH8 B;  1T18 A;  5HWV A;  2VA0 A;  2P7J A;  2P04 A;  4H6J A;  3CWF A;  3MFX A;  3MF0 A;  2JHE A;  2J3T C;  4G3V A;  2P08 A;  4HJ3 A;  4O8G A;  5DF9 A;  3H9W A;  3VE4 A;  4LRY C;  2EA9 A;  3VV4 A;  3H82 A;  2QHK A;  5F68 A;  1DP6 A;  3PYP A;  4B9O A;  2M1C A;  2G7U A;  1S66 L;  3GEC A;  3BW6 A;  3LR5 A;  2QYB A;  3CAX A;  4MN5 A;  4FSF A;  1STZ A;  3K3D A;  1H8M A;  2O9B A;  4B93 A;  1YSQ A;  2M7U A;  1T19 A;  2KDK A;  3NJA A;  3OBF A;  3PBO A;  1W63 Q;  2B02 A;  5DKK A;  3W2Z A;  3E0Y A;  2Y8H A;  3CUE C;  3BY8 A;  4L9E A;  4G3W A;  1IFQ A;  3HCY A;  1ODV A;  1T1A A;  2K2N A;  4HHD A;  4CLC E;  2EWV A;  3JVU A;  2PYP A;  1XJ6 A;  3KYQ A;  1YAX A;  3F1O B;  3CUE A;  4CLC B;  4GS9 A;  3NOT C;  3CIT A;  2JKR M;  3HJK A;  3EEA A;  5DFX A;  2VGL S;  4II7 A;  4WEJ A;  3UMD A;  3IS2 A;  4Q0J A;  4LRZ E;  5J3W A;  4EET B;  4WEK A;  2JN7 A;  4GHI A;  2XRN A;  3C2W A;  2Z6D A;  5DJT A;  1H3Q A;  4WEL A;  5CX7 A;  3MJQ A;  5DFY A;  2W0N A;  3DBA A;  3KX0 X;  2L4R A;  3LIF A;  3FPW A;  5DKL A;  2HV1 A;  4PKY A;  2M7V A;  2ZOI A;  3H7W B;  2PD8 A;  4EW7 A;  3F1P A;  2OWJ A;  2VZW A;  4DJ2 A;  3EGX C;  4GLQ A;  5LBR A;  3F1N A;  2V0U A;  4ETZ A;  4EQ1 A;  3LUQ A;  1EW0 A;  4EU0 A;  1YSP A;  5J7E A;  4I3A A;  2INW A;  4Y2F A;  4GJ4 A;  4MN7 A;  3V67 A;  3A0R A;  2HF6 A;  3VE3 A;  2PR5 A;  1DP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...