4PM6A

Crystal structure of ctx-m-14 s70g beta-lactamase at 1.56 angstroms resolution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase CTX-M-14
publication title Molecular Basis for the Catalytic Specificity of the CTX-M Extended-Spectrum beta-Lactamases.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
total genus 91
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4pm6A00
2J9PA 3MXRA 3LY4A 3Q7VA 4CPKA 4MBFA 4NK3A 4QY6A 5A90A 1SHVA 2XGNA 4OH0A 4ZDXA 1L0GA 5EECA 3IXHA 4S2NA 3O3VA 5TFQA 4S2KA 4ZJ3A 2FFYA 4DDYA 2ZJ9A 2XQZA 4S2NC 1ONGA 4QHCA 3WRZA 4B4XA 5GHZA 1K57A 4N92A 1DY6A 3VSKA 2JE5A 4OLDA 5G18A 2WGWA 1K57C 2XF3A 3HL9A 1O07A 1CK3A 5FSRA 1VQQA 3HLBA 3HREA 4WELA 4BENA 4E3NA 3MZDA 1QMFA 1YT4A 3VOZA 3M6HA 3W4QA 3A3IA 3IWOA 4Y0OA 5FI6A 5HX9A 2Y2QA 4BL2A 3I7JA 4Q8IA 1M40A 2GDNA 4KZ7A 2B5RA 3IQAA 4R4RA 5IHVA 4HBTA 5E2GA 5JYOA 4KZ5A 1S6RA 1WYCA 4OQ0A 3ZNYA 1IEMA 3CJMA 2ZQDA 3S1YA 1MWSA 5FQJA 4KG5A 1H8ZA 3NCKA 4OPYA 4UAAA 1TEMA 5GLCA 5CTMA 3UO9A 1L2SA 4GKUA 4ZBEA 2XR0A 4E3OA 3HLGA 3ZG7B 1ERMA 4R4SA 2ZC3B 3GRJA 2Q9MA 3VP2A 3GTCA 4JXVA 5BOHA 1MKIA 1K55A 5EOEA 3ZG8B 1MWRA 4KZ6A 4NETA 3UPOA 4KZAA 3TG9A 1K55C 3DWKA 4UA9A 3ITAA 5CHMA 2EXBA 2Q9NA 5CGSA 4WEKA 2Z2MB 4Y0TA 1RGZA 3M2KA 5CEBA 4U0XA 4N9LA 4DE3A 4E3MA 1SKFA 4IVKA 3VFFA 3IH8A 2WZXA 4WBGA 4R23A 1PIOA 4GB7A 5EOOA 4ZTKA 1PI5A 1Y54A 2ZD8A 2XFTA 2ZQAA 3VMAA 4BJPA 3MKEA 3FZCA 5DF9A 3SH8A 3Q7ZA 1K56A 1L0EA 4LV0A 1YMXA 1HVBA 4OKPA 1OMEA 3OC2A 4DE2A 1XPBA 4OP5A 3IF5A 1KE0A 1XGJA 3UN7A 4KQQA 1YQSA 1M6KA 1PZPA 4MEZA 5FATA 2XLNA 1MPLA 3ZFZA 5EVIB 4JF5A 1IYQA 2ZC7A 1LI0A 3BFDA 3G35A 4UA7A 1AXBA 3BFGA 2X71A 1KDWA 3ITBA 2HDQA 4PM6A 5HL1A 2HP5A 4Z9QA 2Y55A 3N4IA 4LENA 2WADA 3NDGA 3N6IA 3G2ZA 1BT5A 1IYSA 4PM7A 2V2FF 4BD1A 4H8RA 2A3UA 1KGGA 2ZQ9A 3S22A 3AGFA 4QY5A 1QMEA 3G31A 1BLSA 5A91A 3ZHHA 2Y2KA 5F82A 5KSHA 4GNUA 4ZJ2A 1K6RA 5CGWA 4D2OA 1SDNA 3HLWA 3V3RA 4KZ9A 5KMWA 3V50A 5D3OA 1LI9A 4HESA 4JXWA 1O7EA 2G2WA 1WE4A 2EX8A 4LV1A 2XFSA 5FASA 1BLPA 3PBTA 3M6BA 4EBLA 1K54A 1Q2PA 2WGIA 4FH2A 1MBLA 4JLFA 1W7FA 1NZOA 2G2UA 5CHJA 4UA6A 1DJAA 3SS4A 2JBFA 2WKIA 4E3KA 3LY3A 1ZC2A 3A3JA 3W4OA 2ZQCA 3HLFA 3BEBA 3GR2A 2HDRA 5EVIA 3NC8A 4BLMA 3MZEA 1BUEA 1GHMA 3WRTA 3OCLA 4E6WA 3MBZA 4WYYA 2BLSA 3IH9A 5EVIC 3VP0A 1YLWA 2OV5A 1RGYA 1I5QA 4KG2A 5I94A 5FAQA 2WKHA 4JF6A 5KZHA 3HBRA 1PYYA 1YM1A 3G30A 4PM5A 5M18A 4OOMA 5HW3A 5DF7A 4KQOA 3IWIA 5FQ9A 4R3JA 2WGVA 3E2LA 3ZG0A 2ZQ8A 5CGXA 1MWUA 1CI9A 3AGEA 4QJGA 3TOIA 2UWXA 2Y2MA 1ZG6A 3Q82A 5E2EA 3NDEA 1KE3A 3S4XA 4MBKA 3BM6A 2Y2HA 3HLEA 4A5RA 3DWZA 4R0QA 1K4EA 2IWCA 4BQMA 5DTKA 1PW8A 1FQGA 3A3EA 3HUNA 4LCLA 4FD8A 3A3DA 4OVDA 4KZ3A 4GZBA 1H5XA 3AGDA 4ID4A 2H0YA 4IEDA 3Q81A 1JWVA 4K0XA 5DTSA 1N9BA 1XGIA 3BECA 5E2FA 3MFDA 3SS3A 3EQUA 2QPNA 3MKFA 3ISGA 4EUZA 1K56D 3QHYA 5FQKA 4IBRA 1PZOA 1YLYA 3A3FA 5CHUA 4O7DA 2EX9A 4EWFA 3EQVA 3DW0A 4F94A 3WS2A 2XK1A 4OP8A 4L0LA 5CRFA 4E3LA 5E2HA 3G2YA 2XD1A 1EWZA 2RL3A 2DCFA 4WZ4A 5EE8A 1C3BA 1E25A 3V39A 3Q07A 5GHXA 4S2LA 3GV9A 2PU2A 5GLDA 2IWBA 1YLPA 4PMAA 4U0TA 1Z6FA 4C3QA 4DDSA 4PM9A 3QNBA 4OLGA 3C4PA 3IHBA 2QZ6A 4KZ4A 4EBPA 4YFMA 3NI9A 1HZOA 5F83A 2Y59A 2H10A 1LL5A 2OLUA 3O88A 4IBXA 3OZHA 3VOYA 3W8KA 4DXBA 3UE3A 2OSUA 4JF4A 1JTDA 3UNWA 1LHYA 5E43A 1FSWA 2HP6A 2EFUA 1E3UA 2OLVA 4OQGA 5GL9A 3PAEA 1EI5A 1FR1A 4DE1A 3B3XA 5FDHA 5M19A 3IWQA 3ZDJA 4EV4A 3RXXA 3IF6B 4X53A 1K38A 1KDSA 3N8SA 1NJ4A 1KGFA 2DNSA 2JC7A 1ES4A 1GHPA 2XEPA 2Y2OA 4FSFA 5HAPA 5FAPA 2HDUA 3UY6A 1CEGA 3HVFA 2WK0A 1Q2QA 5EVID 5AQAA 2C6WB 2Y2JA 4WM9A 3D4FA 1FSYA 1ALQA 3C7VA 4JPMA 3WS4A 5F1GA 1U60A 1H8YA 3HLCA 1PWDA 2C5WB 3UPPA 3OPPA 3IT9A 4P6BA 2JCHA 3G4PA 3PBQA 5CTNA 5HAIA 1PW1A 3BFFA 3BYDA 1NY0A 3N8RA 2ZQ7A 4DRTA 4OONA 5FQIA 2Y2PA 4DF6A 4N9KA 3WS1A 3OPRA 4BL3A 1XA1A 1HD8A 2PU4A 2WAFA 4RA7A 1LLBA 2Y4AA 3V3SA 2ZC4B 3ZG5A 4FH4A 3G34A 2X01A 3N7WA 4KG6A 2R9XA 2RCXA 1G68A 2ZLYA 3ZVWA 3ZNTA 3N8LA 5EPHA 1YLZA 4LV2A 3IXGA 4IVIA 4R3BA 2ZC5B 2WAEA 2WKEA 4GDBA 4OOYA 1I2WA 3FV7A 1TDLA 3C7UA 5CERA 3WS5A 1HTZA 3ZG9B 3IF6A 4K91A 3WWXA 3BFCA 1ES2A 4X6TA 3IF6C 1I2SA 2ZMAA 1MWTA 1YLJA 2X02A 1ZG4A 4S2PA 1YMSA 3M2JA 1L0DA 1GHIA 4JBFA 1ESIA 1EROA 1VM1A 2Y2GA 5CECA 1FR6A 1ES5A 5AQ9A 1CEFA 2ZC6B 1TDGA 2R9WA 4JXGA 4WMCD 4X55A 4S2MA 4RX2A 2E8IA 3HUOA 1JWZA 1ONHA 2H5SA 4R1GA 1FCMA 4LCMA 4S2JA 1KVLA 5GLAA 2XH9A 4RYEA 3OCNA 2EX6A 4X69A 4GN2A 4P85A 1E4DA 3IHAA 1JVJA 5L2FA 5GHYA 4E6XA 4HEFA 2EX2A 1BULA 1W79A 3OPHA 1L0FA 4KQRA 1GA9A 4E3JA 1IKIA 1NYYA 3GVBA 2ZM0A 1GA0A 1ES3A 1TVFA 3HLDA 4KENB 5JYPA 1XXMA 1IYPA 4GOGA 3SH7A 5EUAA 5CXWA 1DJBA 3NY4A 4Y0UA 3OPLA 5FI7A 3C4OA 1E3UD 1MY8A 4MNRA 4YINA 5HAQA 4X56A 2J8YA 5J8XA 3P09A 5U47A 4WMCA 4WZ5A 2HDSA 3UDIA 2V1ZA 3CMZA 3NBLA 5CEDA 4OQHA 3BLSA 1DJCA 2VGJA 2WZZA 3FYZA 4WZ5C 4ZAMA 2FFFB 1MXOA 1PI4A 2CC1A 4K0WA 3IXBA 3RJUA 2XD5A 4MBHA 4N1HA 5M1AA 4QB8A 3GQZA 5HARA 2Y2LA 4KZBA 4S2OA 4CJNA 2P74A 3G32A 3IXDA 4HBUA 1BLCA 4X68A 5DVAA 1NRFA 4XUZA 4JXSA 3VFHA 2Y91A 3PBOA 3SS5A 3UE0A 2EFXA 3CZDA 3FWLA 1W5DA 1NYMA 3MXSA 1JTGA 4P0MA 1ZKJA 3PBSA 3O86A 4GDNA 4C75A 1IYOA 4WEJA 1KGEA 3LEZA 2DRWA 3MZFA 3SOIA 4Y7PA 2P9VB 3GMWA 3FKVA 4C6YA 2PBYA 3VP4A 1XKZA 1WYBA 2HPBA 4PPRA 5AQ7A 2XDMA 4N1XA 1RCJA 2V20A 4OPZA 2IWDA 4OQIA 3Q1FA 4QU3A 3LCEA 5FQQA 5F1FA 3QNCA 1BTLA 1G6AA 1BZAA 4PM8A 3P98A 1NZUA 5FAOA 2QMIA 2ZM8A 3GSGA 2WYXA 4JKTA 3V5MA 3WS0A 3HUMA 3BFEA 4QD4A 1N4OA 3ZGAB 1K4FA 2EXAA 2J7VA 4M3KA 4E3IA 1PWCA 3JYIA 5FA7A 4B4ZA 1W8YA 3PAGA 4U3TA 2WUQA 1FOFA 4OPRA 3ZVTA 5KSCA 1FCOA 2J9OA 4B88A 1KE4A 3UPNA 1ESUA 2BG1A 3PBRA 2HP9A 4BD0A 2H0TA 3FKWA 1IKGA 4FCFA 4P87A 4DXCA 3C5AA 3Q7VB 3BLMA 1W8QA 3CG5A 3BRMA 3RXWA 3SH9A 1J9MA 1K6SA 3VP1A 3VSLA 3VP3A 4OPQA 2P9VA 1RP5A 2I72A 4KZ8A 4XUXA 1K25A 3PBNA 3TSGA 1FCNA 1GCEA 1SDEA 3DTMA 5A93A 3PTEA 4EBNA 1ERQA 2Y2IA 1KVMA 1PWGA 2Y2NA 4OOLA 3O87A 4ZJ1A 2VGKA 5AQBA 2WGWB 5DTTA 5A92A 2ZM2A 3UE1A 1SCWA 4DKIA 3W4PA 1NXYA 5FI2A 2A49A 5HFOA 1LL9A 4LV3A 4UHUA 3ZCZA 1BSGA 3LO7A 5TGFA 4DE0A 4MLLA 1S0WA 4EQIA 1K54C 4S2IA 1CI8A 5TR7A 1XX2A 1XP4A 5FQMA 4GD6A 1XA7A 1BLHA 5GLBA 1IELA 3NIAA 5EVLA 3UDFA 2Z2LB 3E2KA 4GD8A 4RX3A 1JWPA 4RVAA 4XXRA 1YLTA 3UDXA 5DF8A
chains in the Genus database with same CATH superfamily
2WKRA 3A0SA 4MDZA 2XGNA 4L9GA 3IXHA 3O3VA 2M7UA 4DDYA 1ONGA 4QHCA 4MN6A 1DY6A 4OLDA 1O07A 1CK3A 1LSVA 2V0UA 1VQQA 4E3NA 4I3IA 2KOIA 3M6HA 3IWOA 4Y0OA 2Y2QA 4Q8IA 4KZ7A 3LIAA 3HJKA 5JYOA 4KZ5A 1MWSA 1K0KA 4UAAA 3UO9A 5CTMA 4EEPA 4PAUA 1F9IA 4CLCA 3HLGA 3IBJA 3ZG7B 4R4SA 3BQAA 2ZC3B 3UB8A 3PR6A 4II7A 5IU1A 5BOHA 4KZ6A 3TG9A 1VB6A 2HZ5A 5L07A 4UA9A 3ITAA 4Q0IA 2EXBA 2Q9NA 2Z2MB 1RGZA 5CEBA 1SKFA 3IH8A 1PI5A 2ZL1A 3VMAA 5AVEA 5DF9A 4GHIA 2I9VA 2V1BA 3W2ZA 1KE0A 4KQQA 1YQSA 1M6KA 1CF0A 3E98A 3MF0A 3NOTC 3EGXC 4JF5A 3BFDA 4UA7A 1KDWA 4X1MA 3FPVA 1WA9A 1G28A 1IYSA 3JVUA 4Z1WA 3LUQA 2PD8A 4H8RA 1G5UA 2ACGA 4QY5A 3G31A 4HJ4A 1BLSA 2QKPA 1STZA 4GNUA 5CGWA 3HLWA 4KZ9A 1LI9A 4MN7A 2W27A 1WE4A 5FASA 2XRNA 3M6BA 1K54A 3DTKA 4FH2A 1NZOA 2G2UA 3T1SA 3SZTA 3MS6A 3NOUC 1UWNX 3W4OA 5EVIA 3OCLA 3VP0A 3OOVA 1RGYA 1T19A 2JKTI 3ICYA 3E2LA 3IX8A 4XT2A 3ZG0A 2ZQ8A 3FC7A 4QJGA 2UWXA 2Y2MA 3S4XA 3QP6A 1L3LA 3HLEA 4HQAA 4BQMA 5EFWA 3IX3A 1GSXA 1DP6A 4KZ3A 5EM0A 1H5XA 3NJAA 2H0YA 4G3KA 3Q81A 1JWVA 5E2FA 3BECA 3SS3A 3MKFA 1LSWA 1K56D 5FQKA 4FUWA 3LIEA 1PZOA 2EX9A 2Q0OA 3DW0A 3WS2A 3T4OA 4OP8A 1Y28A 5CRFA 1NLYA 4NKPA 2M1CA 1C3BA 3LYXA 3V39A 5GHXA 3GV9A 2IWBA 1YLPA 4OLGA 1BYWA 1NLZA 2H10A 2OLUA 4R38A 4DXBA 4DJ2A 1VHMA 4JF4A 3E0YA 4ARZA 2OLVA 4OQGA 1E3UA 4X1LA 1FR1A 5M19A 3IF6B 3MQ0A 3QP5A 1KGFA 2XEPA 5HAPA 4FSFA 2Y2OA 4IUHA 2PDRA 3UY6A 1CEGA 3HVFA 2WK0A 5AQAA 1OJGA 4Y2FA 3WS4A 3UPPA 4CQHA 3LIFA 1S66L 2JHEA 2EWWA 3BYDA 4DRTA 4OONA 5FQIA 4N9KA 2O99A 4R3AA 1XA1A 2PU4A 3V3SA 3L9KA 4FH4A 4HP4A 3N7WA 3E4OA 1G68A 2ZLYA 4P6ZS 2ZOIA 3N8LA 1YLZA 4IVIA 2ZC5B 2L4RA 2GX5A 1TDLA 3C7UA 3ZG9B 3DAVA 1MWTA 1S4RA 2X02A 1XFQA 1GHIA 4LLOB 3B33A 1ESIA 4WN5A 1JWZA 2PBDP 1FCMA 1DRMA 4RYEA 3F1NB 4GN2A 3MQOA 2W0NA 4E3JA 2GJ3A 5IS1A 3H9WA 3HLDA 1IYPA 2V8FA 3OPLA 5FI7A 3C4OA 2WKPA 2O9BA 4LPZA 4B93A 5CEDA 4OQHA 1MXOA 1PI4A 2XD5A 5IT5A 3C30A 5M1AA 4QB8A 5HARA 4KZBA 3UB6A 4HBUA 5DVAA 2INWA 3UE0A 2EFXA 1W5DA 2J3TC 2QYBA 4GCZA 4NXEA 2VV7A 1PRQA 5DKKA 4H6JA 3GMWA 2PBYA 4RQ9A 1WYBA 4LFUA 4N1XA 5F1FA 3LCEA 2PAVP 4EESA 1BTLA 1G6AA 3H82B 4HY8A 5FAOA 1NZUA 3GSGA 2YKFA 3PYPA 3O5YA 1PWCA 2HF6A 1W8YA 1TS7A 1FCOA 1ESUA 4BWIA 3PBRA 2EWVA 3B42A 3OLOA 5AVFA 5HL6A 3BLMA 3RXWA 2VX8A 1J9MA 1K6SA 2P9VA 3CPTA 4KZ8A 1K25A 3PBNA 2Y2NA 5TBMA 4OOLA 3O87A 2VGKA 5AQBA 3TRCA 1SCWA 3W4PA 5HFOA 1LL9A 4MLLA 1K54C 1XX2A 1XP4A 5GLBA 3T1XA 3VV4A 2Z2LB 4RX3A 4XXRA 3UDXA 3Q7VA 4MBFA 4NK3A 4G3VA 4OH0A 4CLCB 5EECA 1S4SA 4S2NA 4CLCD 4EETB 4ZJ3A 4IJGA 3LR5A 2GZAA 1K57A 2DMWA 3HL9A 5FSRA 3HLBA 4PKYG 3MZDA 1YT4A 3VOZA 3A3IA 5I5LA 4ETXA 4BL2A 2ZL1B 2GDNA 1D1JA 2ZOHA 3S7PA 5G4YA 4OQ0A 1WYCA 4UQIS 3ZNYA 4GHIB 2J3WA 2ZMFA 1D06A 1H8ZA 2VEAA 2W1TB 1L2SA 4GKUA 2XROA 2XR0A 3ZQ5A 1ERMA 2PR5A 3GRJA 2HJ9C 1K55A 3E4QA 3UPOA 5CHMA 2WZXA 5DJTA 3L7HA 4WBGA 2JN7A 2PRFA 2XA7S 4F3LA 3MKEA 3KX0X 1HVBA 4DE2A 5HPFA 4OP5A 4BBUA 3D3OA 1PZPA 4MEZA 5FATA 5LBRA 4L9FA 5EVIB 1IYQA 3G35A 1AXBA 1ZHHB 3ITBA 4PM6A 4Q0HA 4LENA 2WADA 2V1AA 3N6IA 3LI8A 5G4ZA 5DKLA 4D60A 4XT2B 1KGGA 2ZQ9A 2VA0A 3AGFA 1QMEA 5A91A 3T4KA 3ZHHA 3TW8A 5D3OA 1O7EA 2G2WA 2XFSA 3PBTA 4EBLA 2Z6CA 1MBLA 1W7FA 2KLIA 3KSGA 2JBFA 2OAQ1 2ZQCA 3BEBA 3GR2A 2HDRA 4BLMA 3MZEA 1BUEA 3MBZA 4WYYA 2OV5A 1I5QA 5I94A 5FAQA 4JF6A 5KZHA 3HBRA 4NXGA 3G30A 2W3HA 5DF7A 3IWIA 3T4SA 1UGUA 2UV0E 5CGXA 1CI9A 1ZG6A 3Q82A 3NDEA 1KE3A 2Y2HA 4A5RA 3DWZA 2IWCA 2QHKA 1PW8A 1FQGA 5J7EA 3HUNA 3T4JA 3CI6A 4LCLA 3A3DA 4OVDA 4DMZA 3CUEC 2FH5A 4ARZB 3MXQA 1ACFA 3E4PA 2QPNA 4M4XA 2Z6DA 3QHYA 3UMEA 4JGOA 1YLYA 4ME4A 4O7DA 1OT6A 4EWFA 4F94A 3S7QA 1ODVA 1X0OA 2RL3A 2DCFA 4WZ4A 1E25A 4LRYC 3Q07A 4S2LA 4PMAA 4U0TA 3MSHA 4C3QA 3IHBA 4KZ4A 1HZOA 3K2NA 3KYEA 1HLUP 2OSUA 1FSWA 2W1RA 3EEHA 5GL9A 1EI5A 3B3XA 1S67L 2W1TA 3ZDJA 1K38A 4Y15A 3QP4A 5FAPA 2IA2A 2HDUA 2Y2JA 2VK3A 5F1GA 3HLCA 4HI4A 4P6BA 2JCHA 3LI9A 3OBFA 1T18A 5HAIA 1PW1A 2CMNA 3BFFA 3N8RA 2ZQ7A 4DF6A 4BMWA 1HD8A 1XFNA 3SW1A 3G34A 2X01A 2RCXA 3ZVWA 5EPHA 4LV2A 5DFYA 1I2WA 3FV7A 3WS5A 3A0VA 1HTZA 2VGLM 1MZUA 3WWXA 3IF6C 2ZMAA 1ZG4A 1YMSA 1MKMA 1YKDA 2A24A 3M2JA 1L0DA 4JBFA 1GSWA 1FR6A 3NOPC 5AQ9A 1OTDA 4S2MA 3HUOA 3IS2A 4R1GA 4LCMA 4S2JA 5GLAA 2XH9A 3OCNA 2EX6A 4X69A 4E6XA 4HEFA 2EX2A 1BULA 1W79A 3OPHA 1L0FA 1GA9A 3K3DA 1IKIA 3GVBA 2ZM0A 2Y8HA 1ES3A 4H6JB 1XXMA 2OWHA 5CXWA 1DJBA 2GNXA 2VV8A 5CX7A 4WZ5A 2HDSA 2V1ZA 3NBLA 1IFQA 3R7WA 1F98A 5HSQA 3F1OA 3RJUA 4MBHA 4N1HA 4S2OA 3RH8B 1NRFA 3KSFA 4WUJA 4XUZA 3VFHA 2P04A 3FWLA 1NYMA 1ZTUA 2WKQA 4P0MA 1UWPX 5HWWA 4GDNA 4G3WA 1IYOA 4WEJA 1N9OA 3SOIA 4Y7PA 2P9VB 3CPTB 3VP4A 2XDMA 2V20A 2IWDA 1W63Q 2ZBBA 3Q1FA 1FIKA 5TBMB 3MJQA 3V5MA 3WS0A 2QMIA 2ZM8A 2V8CA 4O0PA 3ZGAB 2J7VA 4B4ZA 3PAGA 2QJ7A 5DFXA 2O9AA 2E8JA 3U4LP 5KSCA 4PHTA 3UPNA 2BG1A 2HP9A 4MCWA 2H0TA 4MN5A 4P87A 4DXCA 5F5YA 3Q7VB 3S7OA 3VP1A 3VSLA 3K3CA 4JGPA 3VP3A 2H28A 1GCEA 4Y5FA 4EBNA 1ERQA 3V67A 1KVMA 4ZJ1A 2O0YA 4EUVA 3LR0A 3U2AA 4DKIA 5FI2A 2A49A 4HNBA 3LO7A 1XJ6A 4S2IA 5FQMA 4HIAA 1IELA 2D01A 3NIAA 5EVLA 3E2KA 2NUPC 1Y4OA 1JWPA 1YLTA 5F69A 1MC0A 3LY4A 4CPKA 3HCYA 2AVXA 4QY6A 5A90A 5FEGA 1L0GA 2OWJA 4AFIA 2FFYA 3BW6A 3GECA 5GHZA 4N92A 5HZHA 3VSKA 2XF3A 4B9OA 2LB9A 5A8BA 4WELA 2PHYA 3W4QA 5HX9A 3C8CA 2JKTM 1NRJA 2K31A 3DTIA 4F3LB 5IHVA 4HBTA 5E2GA 1S6RA 4FOFA 2ZQDA 5FQJA 1A0KA 1JNUA 3VE3A 4E3OA 2FZ0A 2G7UA 3MQQA 4WF0A 4CLCC 3GTCA 4GW9A 2K7SA 4JXVA 1MKIA 2HV1A 4NETA 3KYZA 2PR6A 1LL8A 2VLGA 3IX4A 5CGSA 4WEKA 4Y0TA 4U0XA 4DE3A 4E3MA 4IVKA 4R23A 1PIOA 5EOOA 2B95A 4R70A 2NUTC 4GS9A 2XFTA 2ZQAA 4BJPA 4KUKA 3SH8A 1K56A 3KSIA 4LV0A 2KX6A 4OKPA 3OC2A 1XPBA 3IF5A 3T4LA 3BQ8A 3UN7A 1YPRA 3ZFZA 1TD5A 1H8MA 2Y55A 3NDGA 1OTBA 3G2ZA 1BT5A 4PM7A 4UEYA 4PKYA 2Y2KA 5F82A 5KSHA 1K6RA 3KSHA 1SDNA 3H7WA 3P01A 3V3RA 5KMWA 3EOIA 2EX8A 2WGIA 1Q2PA 4JLFA 4MMNA 5CHJA 4ZRRA 2VV6A 1DJAA 2WKIA 3D72A 1ZC2A 3A3JA 1V9YA 3BWLA 4E6WA 4YWZA 4ESPA 2BLSA 3IH9A 1AWIA 5EVIC 1YLWA 4KG2A 2WKHA 5FEFA 1PYYA 1OTEA 1YM1A 4PM5A 1T1CA 4OOMA 5HW3A 5FQ9A 4R3JA 2WGVA 2L0WA 3AGEA 3TOIA 1OPXA 4MBKA 3BM6A 2VKSA 3D9YA 5DTKA 4GJ4A 4Y17A 3CLOA 1T1AA 4FD8A 2Y79A 1FILA 4IEDA 4WL9A 4EU0A 5HWTA 5DTSA 1XGIA 3MFDA 1G6OA 1N9LA 4LRXC 3P7NA 3ISGA 3BJNA 2P08A 1F5MA 3A3FA 5CHUA 3T4TA 1P0ZA 3PHYA 4FTXA 2XK1A 4L0LA 1XJ2A 4I5SA 5E2HA 1H0MA 3C38A 3G2YA 1EWZA 3C2WA 1GSVA 1Z09A 4HOIA 3UB9A 1Z6FA 4EXOA 4DDSA 4PM9A 4I3AA 3QNBA 2QZ6A 4EBPA 5F83A 2Y59A 1LL5A 3O88A 4IBXA 3OZHA 3VOLA 3UE3A 2EFUA 4DE1A 4BBVA 5FDHA 3EWKA 3IWQA 4EV4A 3N8SA 3B47A 2DNSA 2JC7A 1ES4A 4JGRA 3QP2A 2A24B 5EVID 3T12B 3LGOA 2C6WB 3D4FA 1FSYA 3C7VA 1H8YA 1PWDA 3IT9A 2K2NA 5CTNA 3IS2B 1LSXA 1SKOA 2Y2PA 4BL3A 1YSPA 4HP9A 2Y4AA 3LR4A 2QWSA 1VEUA 3ZG5A 3T4QA 4KG6A 5HPIA 4KUOA 3ZNTA 3IXGA 3JVVA 5FL3A 2WAEA 4OOYA 3S7NA 5CERA 5HDCA 3T50A 1YLJA 5HD5A 1EROA 1VM1A 2Y2GA 2MJ6A 5HDDA 4NG2A 1CEFA 2ZC6B 1TDGA 2R9WA 4X55A 2A2LA 4RX2A 3R7WB 3F1OB 2H5SA 3MMHA 1H3QA 1KVLA 1OT9A 4P85A 1P9RA 5KIZA 4KENB 5JYPA 4GOGA 1PNEA 4Y0UA 1E3UD 1MY8A 4MNRA 4YINA 5HAQA 4X56A 2J8YA 5J8XA 1T1BA 3LIDA 2OOLA 3P09A 4WMCA 3UDIA 3BLSA 2VGJA 3FYZA 5C5KA 1DP9A 2CC1A 4K0WA 3ZYTA 2Y2LA 2HJEA 3PXPA 2P74A 3G32A 3IXDA 1BLCA 1SZVA 4JXSA 3TE8A 2Y91A 3SS5A 3FG8A 3CZDA 2JKRI 3BY9A 3MXSA 2R78A 4O8GA 2EA9A 3PBSA 3JPUA 1KGEA 2DRWA 3FKVA 4C6YA 2B02A 1XKZA 4QU3A 1BZAA 2WYXA 3BFEA 5J3WA 1K4FA 4M3KA 4E3IA 3JYIA 2WUQA 1TF1A 1KOUA 2J9OA 4B88A 1KE4A 4X25A 4BD0A 1IKGA 2XSSA 2W3DA 5EVEA 2W3FA 1W8QA 3BRMA 3UB7A 4OPQA 4HH3A 3TSGA 4CLCE 3DTMA 3LIBA 3PTEA 3MFXA 2P7JA 1PWGA 2LB5A 5DTTA 2ZM2A 3UE1A 1NXYA 1BSGA 4DE0A 4EQIA 1S0WA 2OAP1 4YNRA 1BLHA 4GD8A 1OJ5A 3LR3A 2J9PA 3T1QB 3G6OA 3MXRA 2YKHA 1SHVA 1XJ3A 4ZDXA 3IBRA 4P6ZM 5AJGA 4E04A 5TFQA 4S2KA 2ZJ9A 4KQDA 2XQZA 4S2NC 3WRZA 4B4XA 1VETA 2O9CA 2M7VA 2D02A 2JE5A 5G18A 2WGWA 1K57C 3HREA 5EM1A 4BENA 1QMFA 5FI6A 3I7JA 1M40A 4GS9B 1LT0A 3NECA 2B5RA 3IQAA 4R4RA 3DBAA 1IEMA 3CJMA 3S1YA 3NHQA 2L1MA 4KG5A 3NCKA 3CAXA 4OPYA 1TEMA 5GLCA 4ZBEA 3RTYA 1OTIA 2Q9MA 3VP2A 5L10A 1P9WA 5EOEA 3ULFA 3ZG8B 1MWRA 3UB5P 4QPRA 4KZAA 1K55C 4I3JA 3DWKA 3M2KA 4N9LA 3VFFA 3H7WB 4ZTKA 4GB7A 1Y54A 2ZD8A 3R4KA 3FZCA 3Q7ZA 1L0EA 1YMXA 1OMEA 1W63M 3F1PB 1XGJA 2PYRA 2VGLS 1TS0A 5DJUA 3NULA 2XLNA 3DTEA 1MPLA 3UMDA 4BBTA 2ZC7A 2JKRM 1LI0A 3BFGA 2X71A 1XJ4A 5F68A 3EGDC 2HDQA 5HL1A 2HP5A 4Z9QA 3N4IA 5MC7A 1DP8A 2V2FF 4BD1A 2A3UA 3S22A 3LEQA 4ZJ2A 5J4EA 4D2OA 3V50A 4HESA 1NWZA 4JXWA 4LV1A 1BLPA 1S1ZA 4HJ6A 4UA6A 4NXFA 3LICA 3SS4A 5TJJA 4E3KA 3LY3A 4HH2A 4O01A 3HLFA 2VZWA 3NC8A 1GHMA 3WRTA 3HJIA 5HWVA 5M18A 4KQOA 1MWUA 5E2EA 5K5BA 3QP1A 2JKFA 1K4EA 4R0QA 3A3EA 4DJ3A 3CUEA 4GZBA 4YOFA 4JGQA 3AGDA 4ID4A 4K0XA 1N9BA 3EQUA 4EQ1A 4EUZA 1YSQA 4EERA 4IBRA 1YAXA 4NEED 4R6LA 3EQVA 5L09A 4E3LA 4Q0JA 2XD1A 4EEUA 5EE8A 2PU2A 5GLDA 3C4PA 1SKOB 4K08A 3NI9A 4YFMA 3EEAA 2BTFP 3W8KA 3VOYA 2VJWA 1VEUB 4IHQA 1JTDA 3UNWA 1LHYA 5E43A 2HP6A 4UQIM 3PAEA 4ETZA 3MR0A 4LRZE 1S1YA 3RXXA 4X53A 1KDSA 2PT7A 1NJ4A 1GHPA 1CJFA 1TS6A 2PD7A 2V0WA 1Q2QA 4WM9A 1ALQA 4JPMA 1U60A 2W3GA 2C5WB 3OPPA 4LGWA 3G4PA 3PBQA 4I38A 1NY0A 4QWOA 3WS1A 3OPRA 5L8MA 4RA7A 2WAFA 1LLBA 2ZC4B 2XA7M 2R9XA 3F1PA 4R3BA 4GDBA 2WKEA 1V9ZA 1P97A 3IF6A 4K91A 3BFCA 1ES2A 4X6TA 1I2SA 1J3WA 4S2PA 2HGVA 5CECA 1ES5A 3LFVA 4JXGA 4WMCD 3T1RA 3VE4A 2E8IA 2JKGA 1ONHA 2QJ5A 1OTAA 4IUKA 2J80A 1E4DA 3IHAA 1JVJA 5EV0A 5L2FA 5GHYA 2J3TD 1EW0A 4KQRA 3FPWA 1NYYA 1GA0A 1TVFA 3SH7A 5EUAA 5FDSA 3NY4A 1F2KA 3KYQA 4Y3IA 4GLQA 2KDKA 4WLAA 3CMZA 1DJCA 2WZZA 4WZ5C 4ZAMA 2FFFB 2W3EA 3IXBA 3UE6A 4HHDA 3GQZA 4CJNA 4X68A 3F1NA 3PBOA 3CHWP 2B18A 4Y13A 1JTGA 4I39A 2ZMVA 1ZKJA 3O86A 4C75A 3LEZA 3MZFA 3KO6A 4DN0A 1TS8A 2HPBA 4PPRA 5AQ7A 1RCJA 3CITA 4OPZA 1CQAA 4OQIA 5FQQA 3QNCA 4L9EA 4PM8A 1IOUA 3P98A 4JKTA 3HUMA 4QD4A 1N4OA 2EXAA 3BY8A 5FA7A 4U3TA 1FOFA 4OPRA 3ZVTA 3TJZC 3QP8A 3RFBA 3FKWA 4FCFA 3C5AA 4NXBA 3CG5A 3CWFA 3SH9A 1RP5A 2I72A 4XUXA 1FCNA 1SDEA 5A93A 4HJ3A 5HD3A 2Y2IA 3H82A 1VETB 1D7EA 1PFLA 2WGWB 2PYPA 5A92A 4EW7A 5HDSA 2V9AA 4LV3A 4UHUA 5F6AA 2BASA 3ZCZA 3A0RA 5TGFA 1N9NA 1CI8A 5TR7A 3GDIA 4GD6A 1XA7A 3UDFA 4RVAA 5U47A 5DF8A
chains in the Genus database with same CATH topology
2J9PA 3MXRA 3LY4A 3Q7VA 4CPKA 4MBFA 4NK3A 4QY6A 5A90A 1SHVA 2XGNA 4OH0A 4ZDXA 1L0GA 5EECA 3IXHA 4S2NA 3O3VA 5TFQA 4S2KA 4ZJ3A 2FFYA 4DDYA 2ZJ9A 2XQZA 4S2NC 1ONGA 4QHCA 3WRZA 4B4XA 5GHZA 1K57A 4N92A 1DY6A 3VSKA 2JE5A 4OLDA 5G18A 2WGWA 1K57C 2XF3A 3HL9A 1O07A 1CK3A 5FSRA 1VQQA 3HLBA 3HREA 4WELA 4BENA 4E3NA 3MZDA 1QMFA 1YT4A 3VOZA 3M6HA 3W4QA 3A3IA 3IWOA 4Y0OA 5FI6A 5HX9A 2Y2QA 4BL2A 3I7JA 4Q8IA 1M40A 2GDNA 4KZ7A 2B5RA 3IQAA 4R4RA 5IHVA 4HBTA 5E2GA 5JYOA 4KZ5A 1S6RA 1WYCA 4OQ0A 3ZNYA 1IEMA 3CJMA 2ZQDA 3S1YA 1MWSA 5FQJA 4KG5A 1H8ZA 3NCKA 4OPYA 4UAAA 1TEMA 5GLCA 5CTMA 3UO9A 1L2SA 4GKUA 4ZBEA 2XR0A 4E3OA 3HLGA 3ZG7B 1ERMA 4R4SA 2ZC3B 3GRJA 2Q9MA 3VP2A 3GTCA 4JXVA 5BOHA 1MKIA 1K55A 5EOEA 3ZG8B 1MWRA 4KZ6A 4NETA 3UPOA 4KZAA 3TG9A 1K55C 3DWKA 4UA9A 3ITAA 5CHMA 2EXBA 2Q9NA 5CGSA 4WEKA 2Z2MB 4Y0TA 1RGZA 3M2KA 5CEBA 4U0XA 4N9LA 4DE3A 4E3MA 1SKFA 4IVKA 3VFFA 3IH8A 2WZXA 4WBGA 4R23A 1PIOA 4GB7A 5EOOA 4ZTKA 1PI5A 1Y54A 2ZD8A 2XFTA 2ZQAA 3VMAA 4BJPA 3MKEA 3FZCA 5DF9A 3SH8A 3Q7ZA 1K56A 1L0EA 4LV0A 1YMXA 1HVBA 4OKPA 1OMEA 3OC2A 4DE2A 1XPBA 4OP5A 3IF5A 1KE0A 1XGJA 3UN7A 4KQQA 1YQSA 1M6KA 1PZPA 4MEZA 5FATA 2XLNA 1MPLA 3ZFZA 5EVIB 4JF5A 1IYQA 2ZC7A 1LI0A 3BFDA 3G35A 4UA7A 1AXBA 3BFGA 2X71A 1KDWA 3ITBA 2HDQA 4PM6A 5HL1A 2HP5A 4Z9QA 2Y55A 3N4IA 4LENA 2WADA 3NDGA 3N6IA 3G2ZA 1BT5A 1IYSA 4PM7A 2V2FF 4BD1A 4H8RA 2A3UA 1KGGA 2ZQ9A 3S22A 3AGFA 4QY5A 1QMEA 3G31A 1BLSA 5A91A 3ZHHA 2Y2KA 5F82A 5KSHA 4GNUA 4ZJ2A 1K6RA 5CGWA 4D2OA 1SDNA 3HLWA 3V3RA 4KZ9A 5KMWA 3V50A 5D3OA 1LI9A 4HESA 4JXWA 1O7EA 2G2WA 1WE4A 2EX8A 4LV1A 2XFSA 5FASA 1BLPA 3PBTA 3M6BA 4EBLA 1K54A 1Q2PA 2WGIA 4FH2A 1MBLA 4JLFA 1W7FA 1NZOA 2G2UA 5CHJA 4UA6A 1DJAA 3SS4A 2JBFA 2WKIA 4E3KA 3LY3A 1ZC2A 3A3JA 3W4OA 2ZQCA 3HLFA 3BEBA 3GR2A 2HDRA 5EVIA 3NC8A 4BLMA 3MZEA 1BUEA 1GHMA 3WRTA 3OCLA 4E6WA 3MBZA 4WYYA 2BLSA 3IH9A 5EVIC 3VP0A 1YLWA 2OV5A 1RGYA 1I5QA 4KG2A 5I94A 5FAQA 2WKHA 4JF6A 5KZHA 3HBRA 1PYYA 1YM1A 3G30A 4PM5A 5M18A 4OOMA 5HW3A 5DF7A 4KQOA 3IWIA 5FQ9A 4R3JA 2WGVA 3E2LA 3ZG0A 2ZQ8A 5CGXA 1MWUA 1CI9A 3AGEA 4QJGA 3TOIA 2UWXA 2Y2MA 1ZG6A 3Q82A 5E2EA 3NDEA 1KE3A 3S4XA 4MBKA 3BM6A 2Y2HA 3HLEA 4A5RA 3DWZA 4R0QA 1K4EA 2IWCA 4BQMA 5DTKA 1PW8A 1FQGA 3A3EA 3HUNA 4LCLA 4FD8A 3A3DA 4OVDA 4KZ3A 4GZBA 1H5XA 3AGDA 4ID4A 2H0YA 4IEDA 3Q81A 1JWVA 4K0XA 5DTSA 1N9BA 1XGIA 3BECA 5E2FA 3MFDA 3SS3A 3EQUA 2QPNA 3MKFA 3ISGA 4EUZA 1K56D 3QHYA 5FQKA 4IBRA 1PZOA 1YLYA 3A3FA 5CHUA 4O7DA 2EX9A 4EWFA 3EQVA 3DW0A 4F94A 3WS2A 2XK1A 4OP8A 4L0LA 5CRFA 4E3LA 5E2HA 3G2YA 2XD1A 1EWZA 2RL3A 2DCFA 4WZ4A 5EE8A 1C3BA 1E25A 3V39A 3Q07A 5GHXA 4S2LA 3GV9A 2PU2A 5GLDA 2IWBA 1YLPA 4PMAA 4U0TA 1Z6FA 4C3QA 4DDSA 4PM9A 3QNBA 4OLGA 3C4PA 3IHBA 2QZ6A 4KZ4A 4EBPA 4YFMA 3NI9A 1HZOA 5F83A 2Y59A 2H10A 1LL5A 2OLUA 3O88A 4IBXA 3OZHA 3VOYA 3W8KA 4DXBA 3UE3A 2OSUA 4JF4A 1JTDA 3UNWA 1LHYA 5E43A 1FSWA 2HP6A 2EFUA 1E3UA 2OLVA 4OQGA 5GL9A 3PAEA 1EI5A 1FR1A 4DE1A 3B3XA 5FDHA 5M19A 3IWQA 3ZDJA 4EV4A 3RXXA 3IF6B 4X53A 1K38A 1KDSA 3N8SA 1NJ4A 1KGFA 2DNSA 2JC7A 1ES4A 1GHPA 2XEPA 2Y2OA 4FSFA 5HAPA 5FAPA 2HDUA 3UY6A 1CEGA 3HVFA 2WK0A 1Q2QA 5EVID 5AQAA 2C6WB 2Y2JA 4WM9A 3D4FA 1FSYA 1ALQA 3C7VA 4JPMA 3WS4A 5F1GA 1U60A 1H8YA 3HLCA 1PWDA 2C5WB 3UPPA 3OPPA 3IT9A 4P6BA 2JCHA 3G4PA 3PBQA 5CTNA 5HAIA 1PW1A 3BFFA 3BYDA 1NY0A 3N8RA 2ZQ7A 4DRTA 4OONA 5FQIA 2Y2PA 4DF6A 4N9KA 3WS1A 3OPRA 4BL3A 1XA1A 1HD8A 2PU4A 2WAFA 4RA7A 1LLBA 2Y4AA 3V3SA 2ZC4B 3ZG5A 4FH4A 3G34A 2X01A 3N7WA 4KG6A 2R9XA 2RCXA 1G68A 2ZLYA 3ZVWA 3ZNTA 3N8LA 5EPHA 1YLZA 4LV2A 3IXGA 4IVIA 4R3BA 2ZC5B 2WAEA 2WKEA 4GDBA 4OOYA 1I2WA 3FV7A 1TDLA 3C7UA 5CERA 3WS5A 1HTZA 3ZG9B 3IF6A 4K91A 3WWXA 3BFCA 1ES2A 4X6TA 3IF6C 1I2SA 2ZMAA 1MWTA 1YLJA 2X02A 1ZG4A 4S2PA 1YMSA 3M2JA 1L0DA 1GHIA 4JBFA 1ESIA 1EROA 1VM1A 2Y2GA 5CECA 1FR6A 1ES5A 5AQ9A 1CEFA 2ZC6B 1TDGA 2R9WA 4JXGA 4WMCD 4X55A 4S2MA 4RX2A 2E8IA 3HUOA 1JWZA 1ONHA 2H5SA 4R1GA 1FCMA 4LCMA 4S2JA 1KVLA 5GLAA 2XH9A 4RYEA 3OCNA 2EX6A 4X69A 4GN2A 4P85A 1E4DA 3IHAA 1JVJA 5L2FA 5GHYA 4E6XA 4HEFA 2EX2A 1BULA 1W79A 3OPHA 1L0FA 4KQRA 1GA9A 4E3JA 1IKIA 1NYYA 3GVBA 2ZM0A 1GA0A 1ES3A 1TVFA 3HLDA 4KENB 5JYPA 1XXMA 1IYPA 4GOGA 3SH7A 5EUAA 5CXWA 1DJBA 3NY4A 4Y0UA 3OPLA 5FI7A 3C4OA 1E3UD 1MY8A 4MNRA 4YINA 5HAQA 4X56A 2J8YA 5J8XA 3P09A 5U47A 4WMCA 4WZ5A 2HDSA 3UDIA 2V1ZA 3CMZA 3NBLA 5CEDA 4OQHA 3BLSA 1DJCA 2VGJA 2WZZA 3FYZA 4WZ5C 4ZAMA 2FFFB 1MXOA 1PI4A 2CC1A 4K0WA 3IXBA 3RJUA 2XD5A 4MBHA 4N1HA 5M1AA 4QB8A 3GQZA 5HARA 2Y2LA 4KZBA 4S2OA 4CJNA 2P74A 3G32A 3IXDA 4HBUA 1BLCA 4X68A 5DVAA 1NRFA 4XUZA 4JXSA 3VFHA 2Y91A 3PBOA 3SS5A 3UE0A 2EFXA 3CZDA 3FWLA 1W5DA 1NYMA 3MXSA 1JTGA 4P0MA 1ZKJA 3PBSA 3O86A 4GDNA 4C75A 1IYOA 4WEJA 1KGEA 3LEZA 2DRWA 3MZFA 3SOIA 4Y7PA 2P9VB 3GMWA 3FKVA 4C6YA 2PBYA 3VP4A 1XKZA 1WYBA 2HPBA 4PPRA 5AQ7A 2XDMA 4N1XA 1RCJA 2V20A 4OPZA 2IWDA 4OQIA 3Q1FA 4QU3A 3LCEA 5FQQA 5F1FA 3QNCA 1BTLA 1G6AA 1BZAA 4PM8A 3P98A 1NZUA 5FAOA 2QMIA 2ZM8A 3GSGA 2WYXA 4JKTA 3V5MA 3WS0A 3HUMA 3BFEA 4QD4A 1N4OA 3ZGAB 1K4FA 2EXAA 2J7VA 4M3KA 4E3IA 1PWCA 3JYIA 5FA7A 4B4ZA 1W8YA 3PAGA 4U3TA 2WUQA 1FOFA 4OPRA 3ZVTA 5KSCA 1FCOA 2J9OA 4B88A 1KE4A 3UPNA 1ESUA 2BG1A 3PBRA 2HP9A 4BD0A 2H0TA 3FKWA 1IKGA 4FCFA 4P87A 4DXCA 3C5AA 3Q7VB 3BLMA 1W8QA 3CG5A 3BRMA 3RXWA 3SH9A 1J9MA 1K6SA 3VP1A 3VSLA 3VP3A 4OPQA 2P9VA 1RP5A 2I72A 4KZ8A 4XUXA 1K25A 3PBNA 3TSGA 1FCNA 1GCEA 1SDEA 3DTMA 5A93A 3PTEA 4EBNA 1ERQA 2Y2IA 1KVMA 1PWGA 2Y2NA 4OOLA 3O87A 4ZJ1A 2VGKA 5AQBA 2WGWB 5DTTA 5A92A 2ZM2A 3UE1A 1SCWA 4DKIA 3W4PA 1NXYA 5FI2A 2A49A 5HFOA 1LL9A 4LV3A 4UHUA 3ZCZA 1BSGA 3LO7A 5TGFA 4DE0A 4MLLA 1S0WA 4EQIA 1K54C 4S2IA 1CI8A 5TR7A 1XX2A 1XP4A 5FQMA 4GD6A 1XA7A 1BLHA 5GLBA 1IELA 3NIAA 5EVLA 3UDFA 2Z2LB 3E2KA 4GD8A 4RX3A 1JWPA 4RVAA 4XXRA 1YLTA 3UDXA 5DF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9P A;  3MXR A;  3LY4 A;  3Q7V A;  4CPK A;  4MBF A;  4NK3 A;  4QY6 A;  5A90 A;  1SHV A;  2XGN A;  4OH0 A;  4ZDX A;  1L0G A;  5EEC A;  3IXH A;  4S2N A;  3O3V A;  5TFQ A;  4S2K A;  4ZJ3 A;  2FFY A;  4DDY A;  2ZJ9 A;  2XQZ A;  4S2N C;  1ONG A;  4QHC A;  3WRZ A;  4B4X A;  5GHZ A;  1K57 A;  4N92 A;  1DY6 A;  3VSK A;  2JE5 A;  4OLD A;  5G18 A;  2WGW A;  1K57 C;  2XF3 A;  3HL9 A;  1O07 A;  1CK3 A;  5FSR A;  1VQQ A;  3HLB A;  3HRE A;  4WEL A;  4BEN A;  4E3N A;  3MZD A;  1QMF A;  1YT4 A;  3VOZ A;  3M6H A;  3W4Q A;  3A3I A;  3IWO A;  4Y0O A;  5FI6 A;  5HX9 A;  2Y2Q A;  4BL2 A;  3I7J A;  4Q8I A;  1M40 A;  2GDN A;  4KZ7 A;  2B5R A;  3IQA A;  4R4R A;  5IHV A;  4HBT A;  5E2G A;  5JYO A;  4KZ5 A;  1S6R A;  1WYC A;  4OQ0 A;  3ZNY A;  1IEM A;  3CJM A;  2ZQD A;  3S1Y A;  1MWS A;  5FQJ A;  4KG5 A;  1H8Z A;  3NCK A;  4OPY A;  4UAA A;  1TEM A;  5GLC A;  5CTM A;  3UO9 A;  1L2S A;  4GKU A;  4ZBE A;  2XR0 A;  4E3O A;  3HLG A;  3ZG7 B;  1ERM A;  4R4S A;  2ZC3 B;  3GRJ A;  2Q9M A;  3VP2 A;  3GTC A;  4JXV A;  5BOH A;  1MKI A;  1K55 A;  5EOE A;  3ZG8 B;  1MWR A;  4KZ6 A;  4NET A;  3UPO A;  4KZA A;  3TG9 A;  1K55 C;  3DWK A;  4UA9 A;  3ITA A;  5CHM A;  2EXB A;  2Q9N A;  5CGS A;  4WEK A;  2Z2M B;  4Y0T A;  1RGZ A;  3M2K A;  5CEB A;  4U0X A;  4N9L A;  4DE3 A;  4E3M A;  1SKF A;  4IVK A;  3VFF A;  3IH8 A;  2WZX A;  4WBG A;  4R23 A;  1PIO A;  4GB7 A;  5EOO A;  4ZTK A;  1PI5 A;  1Y54 A;  2ZD8 A;  2XFT A;  2ZQA A;  3VMA A;  4BJP A;  3MKE A;  3FZC A;  5DF9 A;  3SH8 A;  3Q7Z A;  1K56 A;  1L0E A;  4LV0 A;  1YMX A;  1HVB A;  4OKP A;  1OME A;  3OC2 A;  4DE2 A;  1XPB A;  4OP5 A;  3IF5 A;  1KE0 A;  1XGJ A;  3UN7 A;  4KQQ A;  1YQS A;  1M6K A;  1PZP A;  4MEZ A;  5FAT A;  2XLN A;  1MPL A;  3ZFZ A;  5EVI B;  4JF5 A;  1IYQ A;  2ZC7 A;  1LI0 A;  3BFD A;  3G35 A;  4UA7 A;  1AXB A;  3BFG A;  2X71 A;  1KDW A;  3ITB A;  2HDQ A;  4PM6 A;  5HL1 A;  2HP5 A;  4Z9Q A;  2Y55 A;  3N4I A;  4LEN A;  2WAD A;  3NDG A;  3N6I A;  3G2Z A;  1BT5 A;  1IYS A;  4PM7 A;  2V2F F;  4BD1 A;  4H8R A;  2A3U A;  1KGG A;  2ZQ9 A;  3S22 A;  3AGF A;  4QY5 A;  1QME A;  3G31 A;  1BLS A;  5A91 A;  3ZHH A;  2Y2K A;  5F82 A;  5KSH A;  4GNU A;  4ZJ2 A;  1K6R A;  5CGW A;  4D2O A;  1SDN A;  3HLW A;  3V3R A;  4KZ9 A;  5KMW A;  3V50 A;  5D3O A;  1LI9 A;  4HES A;  4JXW A;  1O7E A;  2G2W A;  1WE4 A;  2EX8 A;  4LV1 A;  2XFS A;  5FAS A;  1BLP A;  3PBT A;  3M6B A;  4EBL A;  1K54 A;  1Q2P A;  2WGI A;  4FH2 A;  1MBL A;  4JLF A;  1W7F A;  1NZO A;  2G2U A;  5CHJ A;  4UA6 A;  1DJA A;  3SS4 A;  2JBF A;  2WKI A;  4E3K A;  3LY3 A;  1ZC2 A;  3A3J A;  3W4O A;  2ZQC A;  3HLF A;  3BEB A;  3GR2 A;  2HDR A;  5EVI A;  3NC8 A;  4BLM A;  3MZE A;  1BUE A;  1GHM A;  3WRT A;  3OCL A;  4E6W A;  3MBZ A;  4WYY A;  2BLS A;  3IH9 A;  5EVI C;  3VP0 A;  1YLW A;  2OV5 A;  1RGY A;  1I5Q A;  4KG2 A;  5I94 A;  5FAQ A;  2WKH A;  4JF6 A;  5KZH A;  3HBR A;  1PYY A;  1YM1 A;  3G30 A;  4PM5 A;  5M18 A;  4OOM A;  5HW3 A;  5DF7 A;  4KQO A;  3IWI A;  5FQ9 A;  4R3J A;  2WGV A;  3E2L A;  3ZG0 A;  2ZQ8 A;  5CGX A;  1MWU A;  1CI9 A;  3AGE A;  4QJG A;  3TOI A;  2UWX A;  2Y2M A;  1ZG6 A;  3Q82 A;  5E2E A;  3NDE A;  1KE3 A;  3S4X A;  4MBK A;  3BM6 A;  2Y2H A;  3HLE A;  4A5R A;  3DWZ A;  4R0Q A;  1K4E A;  2IWC A;  4BQM A;  5DTK A;  1PW8 A;  1FQG A;  3A3E A;  3HUN A;  4LCL A;  4FD8 A;  3A3D A;  4OVD A;  4KZ3 A;  4GZB A;  1H5X A;  3AGD A;  4ID4 A;  2H0Y A;  4IED A;  3Q81 A;  1JWV A;  4K0X A;  5DTS A;  1N9B A;  1XGI A;  3BEC A;  5E2F A;  3MFD A;  3SS3 A;  3EQU A;  2QPN A;  3MKF A;  3ISG A;  4EUZ A;  1K56 D;  3QHY A;  5FQK A;  4IBR A;  1PZO A;  1YLY A;  3A3F A;  5CHU A;  4O7D A;  2EX9 A;  4EWF A;  3EQV A;  3DW0 A;  4F94 A;  3WS2 A;  2XK1 A;  4OP8 A;  4L0L A;  5CRF A;  4E3L A;  5E2H A;  3G2Y A;  2XD1 A;  1EWZ A;  2RL3 A;  2DCF A;  4WZ4 A;  5EE8 A;  1C3B A;  1E25 A;  3V39 A;  3Q07 A;  5GHX A;  4S2L A;  3GV9 A;  2PU2 A;  5GLD A;  2IWB A;  1YLP A;  4PMA A;  4U0T A;  1Z6F A;  4C3Q A;  4DDS A;  4PM9 A;  3QNB A;  4OLG A;  3C4P A;  3IHB A;  2QZ6 A;  4KZ4 A;  4EBP A;  4YFM A;  3NI9 A;  1HZO A;  5F83 A;  2Y59 A;  2H10 A;  1LL5 A;  2OLU A;  3O88 A;  4IBX A;  3OZH A;  3VOY A;  3W8K A;  4DXB A;  3UE3 A;  2OSU A;  4JF4 A;  1JTD A;  3UNW A;  1LHY A;  5E43 A;  1FSW A;  2HP6 A;  2EFU A;  1E3U A;  2OLV A;  4OQG A;  5GL9 A;  3PAE A;  1EI5 A;  1FR1 A;  4DE1 A;  3B3X A;  5FDH A;  5M19 A;  3IWQ A;  3ZDJ A;  4EV4 A;  3RXX A;  3IF6 B;  4X53 A;  1K38 A;  1KDS A;  3N8S A;  1NJ4 A;  1KGF A;  2DNS A;  2JC7 A;  1ES4 A;  1GHP A;  2XEP A;  2Y2O A;  4FSF A;  5HAP A;  5FAP A;  2HDU A;  3UY6 A;  1CEG A;  3HVF A;  2WK0 A;  1Q2Q A;  5EVI D;  5AQA A;  2C6W B;  2Y2J A;  4WM9 A;  3D4F A;  1FSY A;  1ALQ A;  3C7V A;  4JPM A;  3WS4 A;  5F1G A;  1U60 A;  1H8Y A;  3HLC A;  1PWD A;  2C5W B;  3UPP A;  3OPP A;  3IT9 A;  4P6B A;  2JCH A;  3G4P A;  3PBQ A;  5CTN A;  5HAI A;  1PW1 A;  3BFF A;  3BYD A;  1NY0 A;  3N8R A;  2ZQ7 A;  4DRT A;  4OON A;  5FQI A;  2Y2P A;  4DF6 A;  4N9K A;  3WS1 A;  3OPR A;  4BL3 A;  1XA1 A;  1HD8 A;  2PU4 A;  2WAF A;  4RA7 A;  1LLB A;  2Y4A A;  3V3S A;  2ZC4 B;  3ZG5 A;  4FH4 A;  3G34 A;  2X01 A;  3N7W A;  4KG6 A;  2R9X A;  2RCX A;  1G68 A;  2ZLY A;  3ZVW A;  3ZNT A;  3N8L A;  5EPH A;  1YLZ A;  4LV2 A;  3IXG A;  4IVI A;  4R3B A;  2ZC5 B;  2WAE A;  2WKE A;  4GDB A;  4OOY A;  1I2W A;  3FV7 A;  1TDL A;  3C7U A;  5CER A;  3WS5 A;  1HTZ A;  3ZG9 B;  3IF6 A;  4K91 A;  3WWX A;  3BFC A;  1ES2 A;  4X6T A;  3IF6 C;  1I2S A;  2ZMA A;  1MWT A;  1YLJ A;  2X02 A;  1ZG4 A;  4S2P A;  1YMS A;  3M2J A;  1L0D A;  1GHI A;  4JBF A;  1ESI A;  1ERO A;  1VM1 A;  2Y2G A;  5CEC A;  1FR6 A;  1ES5 A;  5AQ9 A;  1CEF A;  2ZC6 B;  1TDG A;  2R9W A;  4JXG A;  4WMC D;  4X55 A;  4S2M A;  4RX2 A;  2E8I A;  3HUO A;  1JWZ A;  1ONH A;  2H5S A;  4R1G A;  1FCM A;  4LCM A;  4S2J A;  1KVL A;  5GLA A;  2XH9 A;  4RYE A;  3OCN A;  2EX6 A;  4X69 A;  4GN2 A;  4P85 A;  1E4D A;  3IHA A;  1JVJ A;  5L2F A;  5GHY A;  4E6X A;  4HEF A;  2EX2 A;  1BUL A;  1W79 A;  3OPH A;  1L0F A;  4KQR A;  1GA9 A;  4E3J A;  1IKI A;  1NYY A;  3GVB A;  2ZM0 A;  1GA0 A;  1ES3 A;  1TVF A;  3HLD A;  4KEN B;  5JYP A;  1XXM A;  1IYP A;  4GOG A;  3SH7 A;  5EUA A;  5CXW A;  1DJB A;  3NY4 A;  4Y0U A;  3OPL A;  5FI7 A;  3C4O A;  1E3U D;  1MY8 A;  4MNR A;  4YIN A;  5HAQ A;  4X56 A;  2J8Y A;  5J8X A;  3P09 A;  5U47 A;  4WMC A;  4WZ5 A;  2HDS A;  3UDI A;  2V1Z A;  3CMZ A;  3NBL A;  5CED A;  4OQH A;  3BLS A;  1DJC A;  2VGJ A;  2WZZ A;  3FYZ A;  4WZ5 C;  4ZAM A;  2FFF B;  1MXO A;  1PI4 A;  2CC1 A;  4K0W A;  3IXB A;  3RJU A;  2XD5 A;  4MBH A;  4N1H A;  5M1A A;  4QB8 A;  3GQZ A;  5HAR A;  2Y2L A;  4KZB A;  4S2O A;  4CJN A;  2P74 A;  3G32 A;  3IXD A;  4HBU A;  1BLC A;  4X68 A;  5DVA A;  1NRF A;  4XUZ A;  4JXS A;  3VFH A;  2Y91 A;  3PBO A;  3SS5 A;  3UE0 A;  2EFX A;  3CZD A;  3FWL A;  1W5D A;  1NYM A;  3MXS A;  1JTG A;  4P0M A;  1ZKJ A;  3PBS A;  3O86 A;  4GDN A;  4C75 A;  1IYO A;  4WEJ A;  1KGE A;  3LEZ A;  2DRW A;  3MZF A;  3SOI A;  4Y7P A;  2P9V B;  3GMW A;  3FKV A;  4C6Y A;  2PBY A;  3VP4 A;  1XKZ A;  1WYB A;  2HPB A;  4PPR A;  5AQ7 A;  2XDM A;  4N1X A;  1RCJ A;  2V20 A;  4OPZ A;  2IWD A;  4OQI A;  3Q1F A;  4QU3 A;  3LCE A;  5FQQ A;  5F1F A;  3QNC A;  1BTL A;  1G6A A;  1BZA A;  4PM8 A;  3P98 A;  1NZU A;  5FAO A;  2QMI A;  2ZM8 A;  3GSG A;  2WYX A;  4JKT A;  3V5M A;  3WS0 A;  3HUM A;  3BFE A;  4QD4 A;  1N4O A;  3ZGA B;  1K4F A;  2EXA A;  2J7V A;  4M3K A;  4E3I A;  1PWC A;  3JYI A;  5FA7 A;  4B4Z A;  1W8Y A;  3PAG A;  4U3T A;  2WUQ A;  1FOF A;  4OPR A;  3ZVT A;  5KSC A;  1FCO A;  2J9O A;  4B88 A;  1KE4 A;  3UPN A;  1ESU A;  2BG1 A;  3PBR A;  2HP9 A;  4BD0 A;  2H0T A;  3FKW A;  1IKG A;  4FCF A;  4P87 A;  4DXC A;  3C5A A;  3Q7V B;  3BLM A;  1W8Q A;  3CG5 A;  3BRM A;  3RXW A;  3SH9 A;  1J9M A;  1K6S A;  3VP1 A;  3VSL A;  3VP3 A;  4OPQ A;  2P9V A;  1RP5 A;  2I72 A;  4KZ8 A;  4XUX A;  1K25 A;  3PBN A;  3TSG A;  1FCN A;  1GCE A;  1SDE A;  3DTM A;  5A93 A;  3PTE A;  4EBN A;  1ERQ A;  2Y2I A;  1KVM A;  1PWG A;  2Y2N A;  4OOL A;  3O87 A;  4ZJ1 A;  2VGK A;  5AQB A;  2WGW B;  5DTT A;  5A92 A;  2ZM2 A;  3UE1 A;  1SCW A;  4DKI A;  3W4P A;  1NXY A;  5FI2 A;  2A49 A;  5HFO A;  1LL9 A;  4LV3 A;  4UHU A;  3ZCZ A;  1BSG A;  3LO7 A;  5TGF A;  4DE0 A;  4MLL A;  1S0W A;  4EQI A;  1K54 C;  4S2I A;  1CI8 A;  5TR7 A;  1XX2 A;  1XP4 A;  5FQM A;  4GD6 A;  1XA7 A;  1BLH A;  5GLB A;  1IEL A;  3NIA A;  5EVL A;  3UDF A;  2Z2L B;  3E2K A;  4GD8 A;  4RX3 A;  1JWP A;  4RVA A;  4XXR A;  1YLT A;  3UDX A;  5DF8 A; 
#chains in the Genus database with same CATH topology
 2WKR A;  3A0S A;  4MDZ A;  2XGN A;  4L9G A;  3IXH A;  3O3V A;  2M7U A;  4DDY A;  1ONG A;  4QHC A;  4MN6 A;  1DY6 A;  4OLD A;  1O07 A;  1CK3 A;  1LSV A;  2V0U A;  1VQQ A;  4E3N A;  4I3I A;  2KOI A;  3M6H A;  3IWO A;  4Y0O A;  2Y2Q A;  4Q8I A;  4KZ7 A;  3LIA A;  3HJK A;  5JYO A;  4KZ5 A;  1MWS A;  1K0K A;  4UAA A;  3UO9 A;  5CTM A;  4EEP A;  4PAU A;  1F9I A;  4CLC A;  3HLG A;  3IBJ A;  3ZG7 B;  4R4S A;  3BQA A;  2ZC3 B;  3UB8 A;  3PR6 A;  4II7 A;  5IU1 A;  5BOH A;  4KZ6 A;  3TG9 A;  1VB6 A;  2HZ5 A;  5L07 A;  4UA9 A;  3ITA A;  4Q0I A;  2EXB A;  2Q9N A;  2Z2M B;  1RGZ A;  5CEB A;  1SKF A;  3IH8 A;  1PI5 A;  2ZL1 A;  3VMA A;  5AVE A;  5DF9 A;  4GHI A;  2I9V A;  2V1B A;  3W2Z A;  1KE0 A;  4KQQ A;  1YQS A;  1M6K A;  1CF0 A;  3E98 A;  3MF0 A;  3NOT C;  3EGX C;  4JF5 A;  3BFD A;  4UA7 A;  1KDW A;  4X1M A;  3FPV A;  1WA9 A;  1G28 A;  1IYS A;  3JVU A;  4Z1W A;  3LUQ A;  2PD8 A;  4H8R A;  1G5U A;  2ACG A;  4QY5 A;  3G31 A;  4HJ4 A;  1BLS A;  2QKP A;  1STZ A;  4GNU A;  5CGW A;  3HLW A;  4KZ9 A;  1LI9 A;  4MN7 A;  2W27 A;  1WE4 A;  5FAS A;  2XRN A;  3M6B A;  1K54 A;  3DTK A;  4FH2 A;  1NZO A;  2G2U A;  3T1S A;  3SZT A;  3MS6 A;  3NOU C;  1UWN X;  3W4O A;  5EVI A;  3OCL A;  3VP0 A;  3OOV A;  1RGY A;  1T19 A;  2JKT I;  3ICY A;  3E2L A;  3IX8 A;  4XT2 A;  3ZG0 A;  2ZQ8 A;  3FC7 A;  4QJG A;  2UWX A;  2Y2M A;  3S4X A;  3QP6 A;  1L3L A;  3HLE A;  4HQA A;  4BQM A;  5EFW A;  3IX3 A;  1GSX A;  1DP6 A;  4KZ3 A;  5EM0 A;  1H5X A;  3NJA A;  2H0Y A;  4G3K A;  3Q81 A;  1JWV A;  5E2F A;  3BEC A;  3SS3 A;  3MKF A;  1LSW A;  1K56 D;  5FQK A;  4FUW A;  3LIE A;  1PZO A;  2EX9 A;  2Q0O A;  3DW0 A;  3WS2 A;  3T4O A;  4OP8 A;  1Y28 A;  5CRF A;  1NLY A;  4NKP A;  2M1C A;  1C3B A;  3LYX A;  3V39 A;  5GHX A;  3GV9 A;  2IWB A;  1YLP A;  4OLG A;  1BYW A;  1NLZ A;  2H10 A;  2OLU A;  4R38 A;  4DXB A;  4DJ2 A;  1VHM A;  4JF4 A;  3E0Y A;  4ARZ A;  2OLV A;  4OQG A;  1E3U A;  4X1L A;  1FR1 A;  5M19 A;  3IF6 B;  3MQ0 A;  3QP5 A;  1KGF A;  2XEP A;  5HAP A;  4FSF A;  2Y2O A;  4IUH A;  2PDR A;  3UY6 A;  1CEG A;  3HVF A;  2WK0 A;  5AQA A;  1OJG A;  4Y2F A;  3WS4 A;  3UPP A;  4CQH A;  3LIF A;  1S66 L;  2JHE A;  2EWW A;  3BYD A;  4DRT A;  4OON A;  5FQI A;  4N9K A;  2O99 A;  4R3A A;  1XA1 A;  2PU4 A;  3V3S A;  3L9K A;  4FH4 A;  4HP4 A;  3N7W A;  3E4O A;  1G68 A;  2ZLY A;  4P6Z S;  2ZOI A;  3N8L A;  1YLZ A;  4IVI A;  2ZC5 B;  2L4R A;  2GX5 A;  1TDL A;  3C7U A;  3ZG9 B;  3DAV A;  1MWT A;  1S4R A;  2X02 A;  1XFQ A;  1GHI A;  4LLO B;  3B33 A;  1ESI A;  4WN5 A;  1JWZ A;  2PBD P;  1FCM A;  1DRM A;  4RYE A;  3F1N B;  4GN2 A;  3MQO A;  2W0N A;  4E3J A;  2GJ3 A;  5IS1 A;  3H9W A;  3HLD A;  1IYP A;  2V8F A;  3OPL A;  5FI7 A;  3C4O A;  2WKP A;  2O9B A;  4LPZ A;  4B93 A;  5CED A;  4OQH A;  1MXO A;  1PI4 A;  2XD5 A;  5IT5 A;  3C30 A;  5M1A A;  4QB8 A;  5HAR A;  4KZB A;  3UB6 A;  4HBU A;  5DVA A;  2INW A;  3UE0 A;  2EFX A;  1W5D A;  2J3T C;  2QYB A;  4GCZ A;  4NXE A;  2VV7 A;  1PRQ A;  5DKK A;  4H6J A;  3GMW A;  2PBY A;  4RQ9 A;  1WYB A;  4LFU A;  4N1X A;  5F1F A;  3LCE A;  2PAV P;  4EES A;  1BTL A;  1G6A A;  3H82 B;  4HY8 A;  5FAO A;  1NZU A;  3GSG A;  2YKF A;  3PYP A;  3O5Y A;  1PWC A;  2HF6 A;  1W8Y A;  1TS7 A;  1FCO A;  1ESU A;  4BWI A;  3PBR A;  2EWV A;  3B42 A;  3OLO A;  5AVF A;  5HL6 A;  3BLM A;  3RXW A;  2VX8 A;  1J9M A;  1K6S A;  2P9V A;  3CPT A;  4KZ8 A;  1K25 A;  3PBN A;  2Y2N A;  5TBM A;  4OOL A;  3O87 A;  2VGK A;  5AQB A;  3TRC A;  1SCW A;  3W4P A;  5HFO A;  1LL9 A;  4MLL A;  1K54 C;  1XX2 A;  1XP4 A;  5GLB A;  3T1X A;  3VV4 A;  2Z2L B;  4RX3 A;  4XXR A;  3UDX A;  3Q7V A;  4MBF A;  4NK3 A;  4G3V A;  4OH0 A;  4CLC B;  5EEC A;  1S4S A;  4S2N A;  4CLC D;  4EET B;  4ZJ3 A;  4IJG A;  3LR5 A;  2GZA A;  1K57 A;  2DMW A;  3HL9 A;  5FSR A;  3HLB A;  4PKY G;  3MZD A;  1YT4 A;  3VOZ A;  3A3I A;  5I5L A;  4ETX A;  4BL2 A;  2ZL1 B;  2GDN A;  1D1J A;  2ZOH A;  3S7P A;  5G4Y A;  4OQ0 A;  1WYC A;  4UQI S;  3ZNY A;  4GHI B;  2J3W A;  2ZMF A;  1D06 A;  1H8Z A;  2VEA A;  2W1T B;  1L2S A;  4GKU A;  2XRO A;  2XR0 A;  3ZQ5 A;  1ERM A;  2PR5 A;  3GRJ A;  2HJ9 C;  1K55 A;  3E4Q A;  3UPO A;  5CHM A;  2WZX A;  5DJT A;  3L7H A;  4WBG A;  2JN7 A;  2PRF A;  2XA7 S;  4F3L A;  3MKE A;  3KX0 X;  1HVB A;  4DE2 A;  5HPF A;  4OP5 A;  4BBU A;  3D3O A;  1PZP A;  4MEZ A;  5FAT A;  5LBR A;  4L9F A;  5EVI B;  1IYQ A;  3G35 A;  1AXB A;  1ZHH B;  3ITB A;  4PM6 A;  4Q0H A;  4LEN A;  2WAD A;  2V1A A;  3N6I A;  3LI8 A;  5G4Z A;  5DKL A;  4D60 A;  4XT2 B;  1KGG A;  2ZQ9 A;  2VA0 A;  3AGF A;  1QME A;  5A91 A;  3T4K A;  3ZHH A;  3TW8 A;  5D3O A;  1O7E A;  2G2W A;  2XFS A;  3PBT A;  4EBL A;  2Z6C A;  1MBL A;  1W7F A;  2KLI A;  3KSG A;  2JBF A;  2OAQ 1;  2ZQC A;  3BEB A;  3GR2 A;  2HDR A;  4BLM A;  3MZE A;  1BUE A;  3MBZ A;  4WYY A;  2OV5 A;  1I5Q A;  5I94 A;  5FAQ A;  4JF6 A;  5KZH A;  3HBR A;  4NXG A;  3G30 A;  2W3H A;  5DF7 A;  3IWI A;  3T4S A;  1UGU A;  2UV0 E;  5CGX A;  1CI9 A;  1ZG6 A;  3Q82 A;  3NDE A;  1KE3 A;  2Y2H A;  4A5R A;  3DWZ A;  2IWC A;  2QHK A;  1PW8 A;  1FQG A;  5J7E A;  3HUN A;  3T4J A;  3CI6 A;  4LCL A;  3A3D A;  4OVD A;  4DMZ A;  3CUE C;  2FH5 A;  4ARZ B;  3MXQ A;  1ACF A;  3E4P A;  2QPN A;  4M4X A;  2Z6D A;  3QHY A;  3UME A;  4JGO A;  1YLY A;  4ME4 A;  4O7D A;  1OT6 A;  4EWF A;  4F94 A;  3S7Q A;  1ODV A;  1X0O A;  2RL3 A;  2DCF A;  4WZ4 A;  1E25 A;  4LRY C;  3Q07 A;  4S2L A;  4PMA A;  4U0T A;  3MSH A;  4C3Q A;  3IHB A;  4KZ4 A;  1HZO A;  3K2N A;  3KYE A;  1HLU P;  2OSU A;  1FSW A;  2W1R A;  3EEH A;  5GL9 A;  1EI5 A;  3B3X A;  1S67 L;  2W1T A;  3ZDJ A;  1K38 A;  4Y15 A;  3QP4 A;  5FAP A;  2IA2 A;  2HDU A;  2Y2J A;  2VK3 A;  5F1G A;  3HLC A;  4HI4 A;  4P6B A;  2JCH A;  3LI9 A;  3OBF A;  1T18 A;  5HAI A;  1PW1 A;  2CMN A;  3BFF A;  3N8R A;  2ZQ7 A;  4DF6 A;  4BMW A;  1HD8 A;  1XFN A;  3SW1 A;  3G34 A;  2X01 A;  2RCX A;  3ZVW A;  5EPH A;  4LV2 A;  5DFY A;  1I2W A;  3FV7 A;  3WS5 A;  3A0V A;  1HTZ A;  2VGL M;  1MZU A;  3WWX A;  3IF6 C;  2ZMA A;  1ZG4 A;  1YMS A;  1MKM A;  1YKD A;  2A24 A;  3M2J A;  1L0D A;  4JBF A;  1GSW A;  1FR6 A;  3NOP C;  5AQ9 A;  1OTD A;  4S2M A;  3HUO A;  3IS2 A;  4R1G A;  4LCM A;  4S2J A;  5GLA A;  2XH9 A;  3OCN A;  2EX6 A;  4X69 A;  4E6X A;  4HEF A;  2EX2 A;  1BUL A;  1W79 A;  3OPH A;  1L0F A;  1GA9 A;  3K3D A;  1IKI A;  3GVB A;  2ZM0 A;  2Y8H A;  1ES3 A;  4H6J B;  1XXM A;  2OWH A;  5CXW A;  1DJB A;  2GNX A;  2VV8 A;  5CX7 A;  4WZ5 A;  2HDS A;  2V1Z A;  3NBL A;  1IFQ A;  3R7W A;  1F98 A;  5HSQ A;  3F1O A;  3RJU A;  4MBH A;  4N1H A;  4S2O A;  3RH8 B;  1NRF A;  3KSF A;  4WUJ A;  4XUZ A;  3VFH A;  2P04 A;  3FWL A;  1NYM A;  1ZTU A;  2WKQ A;  4P0M A;  1UWP X;  5HWW A;  4GDN A;  4G3W A;  1IYO A;  4WEJ A;  1N9O A;  3SOI A;  4Y7P A;  2P9V B;  3CPT B;  3VP4 A;  2XDM A;  2V20 A;  2IWD A;  1W63 Q;  2ZBB A;  3Q1F A;  1FIK A;  5TBM B;  3MJQ A;  3V5M A;  3WS0 A;  2QMI A;  2ZM8 A;  2V8C A;  4O0P A;  3ZGA B;  2J7V A;  4B4Z A;  3PAG A;  2QJ7 A;  5DFX A;  2O9A A;  2E8J A;  3U4L P;  5KSC A;  4PHT A;  3UPN A;  2BG1 A;  2HP9 A;  4MCW A;  2H0T A;  4MN5 A;  4P87 A;  4DXC A;  5F5Y A;  3Q7V B;  3S7O A;  3VP1 A;  3VSL A;  3K3C A;  4JGP A;  3VP3 A;  2H28 A;  1GCE A;  4Y5F A;  4EBN A;  1ERQ A;  3V67 A;  1KVM A;  4ZJ1 A;  2O0Y A;  4EUV A;  3LR0 A;  3U2A A;  4DKI A;  5FI2 A;  2A49 A;  4HNB A;  3LO7 A;  1XJ6 A;  4S2I A;  5FQM A;  4HIA A;  1IEL A;  2D01 A;  3NIA A;  5EVL A;  3E2K A;  2NUP C;  1Y4O A;  1JWP A;  1YLT A;  5F69 A;  1MC0 A;  3LY4 A;  4CPK A;  3HCY A;  2AVX A;  4QY6 A;  5A90 A;  5FEG A;  1L0G A;  2OWJ A;  4AFI A;  2FFY A;  3BW6 A;  3GEC A;  5GHZ A;  4N92 A;  5HZH A;  3VSK A;  2XF3 A;  4B9O A;  2LB9 A;  5A8B A;  4WEL A;  2PHY A;  3W4Q A;  5HX9 A;  3C8C A;  2JKT M;  1NRJ A;  2K31 A;  3DTI A;  4F3L B;  5IHV A;  4HBT A;  5E2G A;  1S6R A;  4FOF A;  2ZQD A;  5FQJ A;  1A0K A;  1JNU A;  3VE3 A;  4E3O A;  2FZ0 A;  2G7U A;  3MQQ A;  4WF0 A;  4CLC C;  3GTC A;  4GW9 A;  2K7S A;  4JXV A;  1MKI A;  2HV1 A;  4NET A;  3KYZ A;  2PR6 A;  1LL8 A;  2VLG A;  3IX4 A;  5CGS A;  4WEK A;  4Y0T A;  4U0X A;  4DE3 A;  4E3M A;  4IVK A;  4R23 A;  1PIO A;  5EOO A;  2B95 A;  4R70 A;  2NUT C;  4GS9 A;  2XFT A;  2ZQA A;  4BJP A;  4KUK A;  3SH8 A;  1K56 A;  3KSI A;  4LV0 A;  2KX6 A;  4OKP A;  3OC2 A;  1XPB A;  3IF5 A;  3T4L A;  3BQ8 A;  3UN7 A;  1YPR A;  3ZFZ A;  1TD5 A;  1H8M A;  2Y55 A;  3NDG A;  1OTB A;  3G2Z A;  1BT5 A;  4PM7 A;  4UEY A;  4PKY A;  2Y2K A;  5F82 A;  5KSH A;  1K6R A;  3KSH A;  1SDN A;  3H7W A;  3P01 A;  3V3R A;  5KMW A;  3EOI A;  2EX8 A;  2WGI A;  1Q2P A;  4JLF A;  4MMN A;  5CHJ A;  4ZRR A;  2VV6 A;  1DJA A;  2WKI A;  3D72 A;  1ZC2 A;  3A3J A;  1V9Y A;  3BWL A;  4E6W A;  4YWZ A;  4ESP A;  2BLS A;  3IH9 A;  1AWI A;  5EVI C;  1YLW A;  4KG2 A;  2WKH A;  5FEF A;  1PYY A;  1OTE A;  1YM1 A;  4PM5 A;  1T1C A;  4OOM A;  5HW3 A;  5FQ9 A;  4R3J A;  2WGV A;  2L0W A;  3AGE A;  3TOI A;  1OPX A;  4MBK A;  3BM6 A;  2VKS A;  3D9Y A;  5DTK A;  4GJ4 A;  4Y17 A;  3CLO A;  1T1A A;  4FD8 A;  2Y79 A;  1FIL A;  4IED A;  4WL9 A;  4EU0 A;  5HWT A;  5DTS A;  1XGI A;  3MFD A;  1G6O A;  1N9L A;  4LRX C;  3P7N A;  3ISG A;  3BJN A;  2P08 A;  1F5M A;  3A3F A;  5CHU A;  3T4T A;  1P0Z A;  3PHY A;  4FTX A;  2XK1 A;  4L0L A;  1XJ2 A;  4I5S A;  5E2H A;  1H0M A;  3C38 A;  3G2Y A;  1EWZ A;  3C2W A;  1GSV A;  1Z09 A;  4HOI A;  3UB9 A;  1Z6F A;  4EXO A;  4DDS A;  4PM9 A;  4I3A A;  3QNB A;  2QZ6 A;  4EBP A;  5F83 A;  2Y59 A;  1LL5 A;  3O88 A;  4IBX A;  3OZH A;  3VOL A;  3UE3 A;  2EFU A;  4DE1 A;  4BBV A;  5FDH A;  3EWK A;  3IWQ A;  4EV4 A;  3N8S A;  3B47 A;  2DNS A;  2JC7 A;  1ES4 A;  4JGR A;  3QP2 A;  2A24 B;  5EVI D;  3T12 B;  3LGO A;  2C6W B;  3D4F A;  1FSY A;  3C7V A;  1H8Y A;  1PWD A;  3IT9 A;  2K2N A;  5CTN A;  3IS2 B;  1LSX A;  1SKO A;  2Y2P A;  4BL3 A;  1YSP A;  4HP9 A;  2Y4A A;  3LR4 A;  2QWS A;  1VEU A;  3ZG5 A;  3T4Q A;  4KG6 A;  5HPI A;  4KUO A;  3ZNT A;  3IXG A;  3JVV A;  5FL3 A;  2WAE A;  4OOY A;  3S7N A;  5CER A;  5HDC A;  3T50 A;  1YLJ A;  5HD5 A;  1ERO A;  1VM1 A;  2Y2G A;  2MJ6 A;  5HDD A;  4NG2 A;  1CEF A;  2ZC6 B;  1TDG A;  2R9W A;  4X55 A;  2A2L A;  4RX2 A;  3R7W B;  3F1O B;  2H5S A;  3MMH A;  1H3Q A;  1KVL A;  1OT9 A;  4P85 A;  1P9R A;  5KIZ A;  4KEN B;  5JYP A;  4GOG A;  1PNE A;  4Y0U A;  1E3U D;  1MY8 A;  4MNR A;  4YIN A;  5HAQ A;  4X56 A;  2J8Y A;  5J8X A;  1T1B A;  3LID A;  2OOL A;  3P09 A;  4WMC A;  3UDI A;  3BLS A;  2VGJ A;  3FYZ A;  5C5K A;  1DP9 A;  2CC1 A;  4K0W A;  3ZYT A;  2Y2L A;  2HJE A;  3PXP A;  2P74 A;  3G32 A;  3IXD A;  1BLC A;  1SZV A;  4JXS A;  3TE8 A;  2Y91 A;  3SS5 A;  3FG8 A;  3CZD A;  2JKR I;  3BY9 A;  3MXS A;  2R78 A;  4O8G A;  2EA9 A;  3PBS A;  3JPU A;  1KGE A;  2DRW A;  3FKV A;  4C6Y A;  2B02 A;  1XKZ A;  4QU3 A;  1BZA A;  2WYX A;  3BFE A;  5J3W A;  1K4F A;  4M3K A;  4E3I A;  3JYI A;  2WUQ A;  1TF1 A;  1KOU A;  2J9O A;  4B88 A;  1KE4 A;  4X25 A;  4BD0 A;  1IKG A;  2XSS A;  2W3D A;  5EVE A;  2W3F A;  1W8Q A;  3BRM A;  3UB7 A;  4OPQ A;  4HH3 A;  3TSG A;  4CLC E;  3DTM A;  3LIB A;  3PTE A;  3MFX A;  2P7J A;  1PWG A;  2LB5 A;  5DTT A;  2ZM2 A;  3UE1 A;  1NXY A;  1BSG A;  4DE0 A;  4EQI A;  1S0W A;  2OAP 1;  4YNR A;  1BLH A;  4GD8 A;  1OJ5 A;  3LR3 A;  2J9P A;  3T1Q B;  3G6O A;  3MXR A;  2YKH A;  1SHV A;  1XJ3 A;  4ZDX A;  3IBR A;  4P6Z M;  5AJG A;  4E04 A;  5TFQ A;  4S2K A;  2ZJ9 A;  4KQD A;  2XQZ A;  4S2N C;  3WRZ A;  4B4X A;  1VET A;  2O9C A;  2M7V A;  2D02 A;  2JE5 A;  5G18 A;  2WGW A;  1K57 C;  3HRE A;  5EM1 A;  4BEN A;  1QMF A;  5FI6 A;  3I7J A;  1M40 A;  4GS9 B;  1LT0 A;  3NEC A;  2B5R A;  3IQA A;  4R4R A;  3DBA A;  1IEM A;  3CJM A;  3S1Y A;  3NHQ A;  2L1M A;  4KG5 A;  3NCK A;  3CAX A;  4OPY A;  1TEM A;  5GLC A;  4ZBE A;  3RTY A;  1OTI A;  2Q9M A;  3VP2 A;  5L10 A;  1P9W A;  5EOE A;  3ULF A;  3ZG8 B;  1MWR A;  3UB5 P;  4QPR A;  4KZA A;  1K55 C;  4I3J A;  3DWK A;  3M2K A;  4N9L A;  3VFF A;  3H7W B;  4ZTK A;  4GB7 A;  1Y54 A;  2ZD8 A;  3R4K A;  3FZC A;  3Q7Z A;  1L0E A;  1YMX A;  1OME A;  1W63 M;  3F1P B;  1XGJ A;  2PYR A;  2VGL S;  1TS0 A;  5DJU A;  3NUL A;  2XLN A;  3DTE A;  1MPL A;  3UMD A;  4BBT A;  2ZC7 A;  2JKR M;  1LI0 A;  3BFG A;  2X71 A;  1XJ4 A;  5F68 A;  3EGD C;  2HDQ A;  5HL1 A;  2HP5 A;  4Z9Q A;  3N4I A;  5MC7 A;  1DP8 A;  2V2F F;  4BD1 A;  2A3U A;  3S22 A;  3LEQ A;  4ZJ2 A;  5J4E A;  4D2O A;  3V50 A;  4HES A;  1NWZ A;  4JXW A;  4LV1 A;  1BLP A;  1S1Z A;  4HJ6 A;  4UA6 A;  4NXF A;  3LIC A;  3SS4 A;  5TJJ A;  4E3K A;  3LY3 A;  4HH2 A;  4O01 A;  3HLF A;  2VZW A;  3NC8 A;  1GHM A;  3WRT A;  3HJI A;  5HWV A;  5M18 A;  4KQO A;  1MWU A;  5E2E A;  5K5B A;  3QP1 A;  2JKF A;  1K4E A;  4R0Q A;  3A3E A;  4DJ3 A;  3CUE A;  4GZB A;  4YOF A;  4JGQ A;  3AGD A;  4ID4 A;  4K0X A;  1N9B A;  3EQU A;  4EQ1 A;  4EUZ A;  1YSQ A;  4EER A;  4IBR A;  1YAX A;  4NEE D;  4R6L A;  3EQV A;  5L09 A;  4E3L A;  4Q0J A;  2XD1 A;  4EEU A;  5EE8 A;  2PU2 A;  5GLD A;  3C4P A;  1SKO B;  4K08 A;  3NI9 A;  4YFM A;  3EEA A;  2BTF P;  3W8K A;  3VOY A;  2VJW A;  1VEU B;  4IHQ A;  1JTD A;  3UNW A;  1LHY A;  5E43 A;  2HP6 A;  4UQI M;  3PAE A;  4ETZ A;  3MR0 A;  4LRZ E;  1S1Y A;  3RXX A;  4X53 A;  1KDS A;  2PT7 A;  1NJ4 A;  1GHP A;  1CJF A;  1TS6 A;  2PD7 A;  2V0W A;  1Q2Q A;  4WM9 A;  1ALQ A;  4JPM A;  1U60 A;  2W3G A;  2C5W B;  3OPP A;  4LGW A;  3G4P A;  3PBQ A;  4I38 A;  1NY0 A;  4QWO A;  3WS1 A;  3OPR A;  5L8M A;  4RA7 A;  2WAF A;  1LLB A;  2ZC4 B;  2XA7 M;  2R9X A;  3F1P A;  4R3B A;  4GDB A;  2WKE A;  1V9Z A;  1P97 A;  3IF6 A;  4K91 A;  3BFC A;  1ES2 A;  4X6T A;  1I2S A;  1J3W A;  4S2P A;  2HGV A;  5CEC A;  1ES5 A;  3LFV A;  4JXG A;  4WMC D;  3T1R A;  3VE4 A;  2E8I A;  2JKG A;  1ONH A;  2QJ5 A;  1OTA A;  4IUK A;  2J80 A;  1E4D A;  3IHA A;  1JVJ A;  5EV0 A;  5L2F A;  5GHY A;  2J3T D;  1EW0 A;  4KQR A;  3FPW A;  1NYY A;  1GA0 A;  1TVF A;  3SH7 A;  5EUA A;  5FDS A;  3NY4 A;  1F2K A;  3KYQ A;  4Y3I A;  4GLQ A;  2KDK A;  4WLA A;  3CMZ A;  1DJC A;  2WZZ A;  4WZ5 C;  4ZAM A;  2FFF B;  2W3E A;  3IXB A;  3UE6 A;  4HHD A;  3GQZ A;  4CJN A;  4X68 A;  3F1N A;  3PBO A;  3CHW P;  2B18 A;  4Y13 A;  1JTG A;  4I39 A;  2ZMV A;  1ZKJ A;  3O86 A;  4C75 A;  3LEZ A;  3MZF A;  3KO6 A;  4DN0 A;  1TS8 A;  2HPB A;  4PPR A;  5AQ7 A;  1RCJ A;  3CIT A;  4OPZ A;  1CQA A;  4OQI A;  5FQQ A;  3QNC A;  4L9E A;  4PM8 A;  1IOU A;  3P98 A;  4JKT A;  3HUM A;  4QD4 A;  1N4O A;  2EXA A;  3BY8 A;  5FA7 A;  4U3T A;  1FOF A;  4OPR A;  3ZVT A;  3TJZ C;  3QP8 A;  3RFB A;  3FKW A;  4FCF A;  3C5A A;  4NXB A;  3CG5 A;  3CWF A;  3SH9 A;  1RP5 A;  2I72 A;  4XUX A;  1FCN A;  1SDE A;  5A93 A;  4HJ3 A;  5HD3 A;  2Y2I A;  3H82 A;  1VET B;  1D7E A;  1PFL A;  2WGW B;  2PYP A;  5A92 A;  4EW7 A;  5HDS A;  2V9A A;  4LV3 A;  4UHU A;  5F6A A;  2BAS A;  3ZCZ A;  3A0R A;  5TGF A;  1N9N A;  1CI8 A;  5TR7 A;  3GDI A;  4GD6 A;  1XA7 A;  3UDF A;  4RVA A;  5U47 A;  5DF8 A; 
#chains in the Genus database with same CATH homology
 2J9P A;  3MXR A;  3LY4 A;  3Q7V A;  4CPK A;  4MBF A;  4NK3 A;  4QY6 A;  5A90 A;  1SHV A;  2XGN A;  4OH0 A;  4ZDX A;  1L0G A;  5EEC A;  3IXH A;  4S2N A;  3O3V A;  5TFQ A;  4S2K A;  4ZJ3 A;  2FFY A;  4DDY A;  2ZJ9 A;  2XQZ A;  4S2N C;  1ONG A;  4QHC A;  3WRZ A;  4B4X A;  5GHZ A;  1K57 A;  4N92 A;  1DY6 A;  3VSK A;  2JE5 A;  4OLD A;  5G18 A;  2WGW A;  1K57 C;  2XF3 A;  3HL9 A;  1O07 A;  1CK3 A;  5FSR A;  1VQQ A;  3HLB A;  3HRE A;  4WEL A;  4BEN A;  4E3N A;  3MZD A;  1QMF A;  1YT4 A;  3VOZ A;  3M6H A;  3W4Q A;  3A3I A;  3IWO A;  4Y0O A;  5FI6 A;  5HX9 A;  2Y2Q A;  4BL2 A;  3I7J A;  4Q8I A;  1M40 A;  2GDN A;  4KZ7 A;  2B5R A;  3IQA A;  4R4R A;  5IHV A;  4HBT A;  5E2G A;  5JYO A;  4KZ5 A;  1S6R A;  1WYC A;  4OQ0 A;  3ZNY A;  1IEM A;  3CJM A;  2ZQD A;  3S1Y A;  1MWS A;  5FQJ A;  4KG5 A;  1H8Z A;  3NCK A;  4OPY A;  4UAA A;  1TEM A;  5GLC A;  5CTM A;  3UO9 A;  1L2S A;  4GKU A;  4ZBE A;  2XR0 A;  4E3O A;  3HLG A;  3ZG7 B;  1ERM A;  4R4S A;  2ZC3 B;  3GRJ A;  2Q9M A;  3VP2 A;  3GTC A;  4JXV A;  5BOH A;  1MKI A;  1K55 A;  5EOE A;  3ZG8 B;  1MWR A;  4KZ6 A;  4NET A;  3UPO A;  4KZA A;  3TG9 A;  1K55 C;  3DWK A;  4UA9 A;  3ITA A;  5CHM A;  2EXB A;  2Q9N A;  5CGS A;  4WEK A;  2Z2M B;  4Y0T A;  1RGZ A;  3M2K A;  5CEB A;  4U0X A;  4N9L A;  4DE3 A;  4E3M A;  1SKF A;  4IVK A;  3VFF A;  3IH8 A;  2WZX A;  4WBG A;  4R23 A;  1PIO A;  4GB7 A;  5EOO A;  4ZTK A;  1PI5 A;  1Y54 A;  2ZD8 A;  2XFT A;  2ZQA A;  3VMA A;  4BJP A;  3MKE A;  3FZC A;  5DF9 A;  3SH8 A;  3Q7Z A;  1K56 A;  1L0E A;  4LV0 A;  1YMX A;  1HVB A;  4OKP A;  1OME A;  3OC2 A;  4DE2 A;  1XPB A;  4OP5 A;  3IF5 A;  1KE0 A;  1XGJ A;  3UN7 A;  4KQQ A;  1YQS A;  1M6K A;  1PZP A;  4MEZ A;  5FAT A;  2XLN A;  1MPL A;  3ZFZ A;  5EVI B;  4JF5 A;  1IYQ A;  2ZC7 A;  1LI0 A;  3BFD A;  3G35 A;  4UA7 A;  1AXB A;  3BFG A;  2X71 A;  1KDW A;  3ITB A;  2HDQ A;  4PM6 A;  5HL1 A;  2HP5 A;  4Z9Q A;  2Y55 A;  3N4I A;  4LEN A;  2WAD A;  3NDG A;  3N6I A;  3G2Z A;  1BT5 A;  1IYS A;  4PM7 A;  2V2F F;  4BD1 A;  4H8R A;  2A3U A;  1KGG A;  2ZQ9 A;  3S22 A;  3AGF A;  4QY5 A;  1QME A;  3G31 A;  1BLS A;  5A91 A;  3ZHH A;  2Y2K A;  5F82 A;  5KSH A;  4GNU A;  4ZJ2 A;  1K6R A;  5CGW A;  4D2O A;  1SDN A;  3HLW A;  3V3R A;  4KZ9 A;  5KMW A;  3V50 A;  5D3O A;  1LI9 A;  4HES A;  4JXW A;  1O7E A;  2G2W A;  1WE4 A;  2EX8 A;  4LV1 A;  2XFS A;  5FAS A;  1BLP A;  3PBT A;  3M6B A;  4EBL A;  1K54 A;  1Q2P A;  2WGI A;  4FH2 A;  1MBL A;  4JLF A;  1W7F A;  1NZO A;  2G2U A;  5CHJ A;  4UA6 A;  1DJA A;  3SS4 A;  2JBF A;  2WKI A;  4E3K A;  3LY3 A;  1ZC2 A;  3A3J A;  3W4O A;  2ZQC A;  3HLF A;  3BEB A;  3GR2 A;  2HDR A;  5EVI A;  3NC8 A;  4BLM A;  3MZE A;  1BUE A;  1GHM A;  3WRT A;  3OCL A;  4E6W A;  3MBZ A;  4WYY A;  2BLS A;  3IH9 A;  5EVI C;  3VP0 A;  1YLW A;  2OV5 A;  1RGY A;  1I5Q A;  4KG2 A;  5I94 A;  5FAQ A;  2WKH A;  4JF6 A;  5KZH A;  3HBR A;  1PYY A;  1YM1 A;  3G30 A;  4PM5 A;  5M18 A;  4OOM A;  5HW3 A;  5DF7 A;  4KQO A;  3IWI A;  5FQ9 A;  4R3J A;  2WGV A;  3E2L A;  3ZG0 A;  2ZQ8 A;  5CGX A;  1MWU A;  1CI9 A;  3AGE A;  4QJG A;  3TOI A;  2UWX A;  2Y2M A;  1ZG6 A;  3Q82 A;  5E2E A;  3NDE A;  1KE3 A;  3S4X A;  4MBK A;  3BM6 A;  2Y2H A;  3HLE A;  4A5R A;  3DWZ A;  4R0Q A;  1K4E A;  2IWC A;  4BQM A;  5DTK A;  1PW8 A;  1FQG A;  3A3E A;  3HUN A;  4LCL A;  4FD8 A;  3A3D A;  4OVD A;  4KZ3 A;  4GZB A;  1H5X A;  3AGD A;  4ID4 A;  2H0Y A;  4IED A;  3Q81 A;  1JWV A;  4K0X A;  5DTS A;  1N9B A;  1XGI A;  3BEC A;  5E2F A;  3MFD A;  3SS3 A;  3EQU A;  2QPN A;  3MKF A;  3ISG A;  4EUZ A;  1K56 D;  3QHY A;  5FQK A;  4IBR A;  1PZO A;  1YLY A;  3A3F A;  5CHU A;  4O7D A;  2EX9 A;  4EWF A;  3EQV A;  3DW0 A;  4F94 A;  3WS2 A;  2XK1 A;  4OP8 A;  4L0L A;  5CRF A;  4E3L A;  5E2H A;  3G2Y A;  2XD1 A;  1EWZ A;  2RL3 A;  2DCF A;  4WZ4 A;  5EE8 A;  1C3B A;  1E25 A;  3V39 A;  3Q07 A;  5GHX A;  4S2L A;  3GV9 A;  2PU2 A;  5GLD A;  2IWB A;  1YLP A;  4PMA A;  4U0T A;  1Z6F A;  4C3Q A;  4DDS A;  4PM9 A;  3QNB A;  4OLG A;  3C4P A;  3IHB A;  2QZ6 A;  4KZ4 A;  4EBP A;  4YFM A;  3NI9 A;  1HZO A;  5F83 A;  2Y59 A;  2H10 A;  1LL5 A;  2OLU A;  3O88 A;  4IBX A;  3OZH A;  3VOY A;  3W8K A;  4DXB A;  3UE3 A;  2OSU A;  4JF4 A;  1JTD A;  3UNW A;  1LHY A;  5E43 A;  1FSW A;  2HP6 A;  2EFU A;  1E3U A;  2OLV A;  4OQG A;  5GL9 A;  3PAE A;  1EI5 A;  1FR1 A;  4DE1 A;  3B3X A;  5FDH A;  5M19 A;  3IWQ A;  3ZDJ A;  4EV4 A;  3RXX A;  3IF6 B;  4X53 A;  1K38 A;  1KDS A;  3N8S A;  1NJ4 A;  1KGF A;  2DNS A;  2JC7 A;  1ES4 A;  1GHP A;  2XEP A;  2Y2O A;  4FSF A;  5HAP A;  5FAP A;  2HDU A;  3UY6 A;  1CEG A;  3HVF A;  2WK0 A;  1Q2Q A;  5EVI D;  5AQA A;  2C6W B;  2Y2J A;  4WM9 A;  3D4F A;  1FSY A;  1ALQ A;  3C7V A;  4JPM A;  3WS4 A;  5F1G A;  1U60 A;  1H8Y A;  3HLC A;  1PWD A;  2C5W B;  3UPP A;  3OPP A;  3IT9 A;  4P6B A;  2JCH A;  3G4P A;  3PBQ A;  5CTN A;  5HAI A;  1PW1 A;  3BFF A;  3BYD A;  1NY0 A;  3N8R A;  2ZQ7 A;  4DRT A;  4OON A;  5FQI A;  2Y2P A;  4DF6 A;  4N9K A;  3WS1 A;  3OPR A;  4BL3 A;  1XA1 A;  1HD8 A;  2PU4 A;  2WAF A;  4RA7 A;  1LLB A;  2Y4A A;  3V3S A;  2ZC4 B;  3ZG5 A;  4FH4 A;  3G34 A;  2X01 A;  3N7W A;  4KG6 A;  2R9X A;  2RCX A;  1G68 A;  2ZLY A;  3ZVW A;  3ZNT A;  3N8L A;  5EPH A;  1YLZ A;  4LV2 A;  3IXG A;  4IVI A;  4R3B A;  2ZC5 B;  2WAE A;  2WKE A;  4GDB A;  4OOY A;  1I2W A;  3FV7 A;  1TDL A;  3C7U A;  5CER A;  3WS5 A;  1HTZ A;  3ZG9 B;  3IF6 A;  4K91 A;  3WWX A;  3BFC A;  1ES2 A;  4X6T A;  3IF6 C;  1I2S A;  2ZMA A;  1MWT A;  1YLJ A;  2X02 A;  1ZG4 A;  4S2P A;  1YMS A;  3M2J A;  1L0D A;  1GHI A;  4JBF A;  1ESI A;  1ERO A;  1VM1 A;  2Y2G A;  5CEC A;  1FR6 A;  1ES5 A;  5AQ9 A;  1CEF A;  2ZC6 B;  1TDG A;  2R9W A;  4JXG A;  4WMC D;  4X55 A;  4S2M A;  4RX2 A;  2E8I A;  3HUO A;  1JWZ A;  1ONH A;  2H5S A;  4R1G A;  1FCM A;  4LCM A;  4S2J A;  1KVL A;  5GLA A;  2XH9 A;  4RYE A;  3OCN A;  2EX6 A;  4X69 A;  4GN2 A;  4P85 A;  1E4D A;  3IHA A;  1JVJ A;  5L2F A;  5GHY A;  4E6X A;  4HEF A;  2EX2 A;  1BUL A;  1W79 A;  3OPH A;  1L0F A;  4KQR A;  1GA9 A;  4E3J A;  1IKI A;  1NYY A;  3GVB A;  2ZM0 A;  1GA0 A;  1ES3 A;  1TVF A;  3HLD A;  4KEN B;  5JYP A;  1XXM A;  1IYP A;  4GOG A;  3SH7 A;  5EUA A;  5CXW A;  1DJB A;  3NY4 A;  4Y0U A;  3OPL A;  5FI7 A;  3C4O A;  1E3U D;  1MY8 A;  4MNR A;  4YIN A;  5HAQ A;  4X56 A;  2J8Y A;  5J8X A;  3P09 A;  5U47 A;  4WMC A;  4WZ5 A;  2HDS A;  3UDI A;  2V1Z A;  3CMZ A;  3NBL A;  5CED A;  4OQH A;  3BLS A;  1DJC A;  2VGJ A;  2WZZ A;  3FYZ A;  4WZ5 C;  4ZAM A;  2FFF B;  1MXO A;  1PI4 A;  2CC1 A;  4K0W A;  3IXB A;  3RJU A;  2XD5 A;  4MBH A;  4N1H A;  5M1A A;  4QB8 A;  3GQZ A;  5HAR A;  2Y2L A;  4KZB A;  4S2O A;  4CJN A;  2P74 A;  3G32 A;  3IXD A;  4HBU A;  1BLC A;  4X68 A;  5DVA A;  1NRF A;  4XUZ A;  4JXS A;  3VFH A;  2Y91 A;  3PBO A;  3SS5 A;  3UE0 A;  2EFX A;  3CZD A;  3FWL A;  1W5D A;  1NYM A;  3MXS A;  1JTG A;  4P0M A;  1ZKJ A;  3PBS A;  3O86 A;  4GDN A;  4C75 A;  1IYO A;  4WEJ A;  1KGE A;  3LEZ A;  2DRW A;  3MZF A;  3SOI A;  4Y7P A;  2P9V B;  3GMW A;  3FKV A;  4C6Y A;  2PBY A;  3VP4 A;  1XKZ A;  1WYB A;  2HPB A;  4PPR A;  5AQ7 A;  2XDM A;  4N1X A;  1RCJ A;  2V20 A;  4OPZ A;  2IWD A;  4OQI A;  3Q1F A;  4QU3 A;  3LCE A;  5FQQ A;  5F1F A;  3QNC A;  1BTL A;  1G6A A;  1BZA A;  4PM8 A;  3P98 A;  1NZU A;  5FAO A;  2QMI A;  2ZM8 A;  3GSG A;  2WYX A;  4JKT A;  3V5M A;  3WS0 A;  3HUM A;  3BFE A;  4QD4 A;  1N4O A;  3ZGA B;  1K4F A;  2EXA A;  2J7V A;  4M3K A;  4E3I A;  1PWC A;  3JYI A;  5FA7 A;  4B4Z A;  1W8Y A;  3PAG A;  4U3T A;  2WUQ A;  1FOF A;  4OPR A;  3ZVT A;  5KSC A;  1FCO A;  2J9O A;  4B88 A;  1KE4 A;  3UPN A;  1ESU A;  2BG1 A;  3PBR A;  2HP9 A;  4BD0 A;  2H0T A;  3FKW A;  1IKG A;  4FCF A;  4P87 A;  4DXC A;  3C5A A;  3Q7V B;  3BLM A;  1W8Q A;  3CG5 A;  3BRM A;  3RXW A;  3SH9 A;  1J9M A;  1K6S A;  3VP1 A;  3VSL A;  3VP3 A;  4OPQ A;  2P9V A;  1RP5 A;  2I72 A;  4KZ8 A;  4XUX A;  1K25 A;  3PBN A;  3TSG A;  1FCN A;  1GCE A;  1SDE A;  3DTM A;  5A93 A;  3PTE A;  4EBN A;  1ERQ A;  2Y2I A;  1KVM A;  1PWG A;  2Y2N A;  4OOL A;  3O87 A;  4ZJ1 A;  2VGK A;  5AQB A;  2WGW B;  5DTT A;  5A92 A;  2ZM2 A;  3UE1 A;  1SCW A;  4DKI A;  3W4P A;  1NXY A;  5FI2 A;  2A49 A;  5HFO A;  1LL9 A;  4LV3 A;  4UHU A;  3ZCZ A;  1BSG A;  3LO7 A;  5TGF A;  4DE0 A;  4MLL A;  1S0W A;  4EQI A;  1K54 C;  4S2I A;  1CI8 A;  5TR7 A;  1XX2 A;  1XP4 A;  5FQM A;  4GD6 A;  1XA7 A;  1BLH A;  5GLB A;  1IEL A;  3NIA A;  5EVL A;  3UDF A;  2Z2L B;  3E2K A;  4GD8 A;  4RX3 A;  1JWP A;  4RVA A;  4XXR A;  1YLT A;  3UDX A;  5DF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...