4PM6A

Crystal structure of ctx-m-14 s70g beta-lactamase at 1.56 angstroms resolution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-14
publication title Molecular Basis for the Catalytic Specificity of the CTX-M Extended-Spectrum beta-Lactamases.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Hydrolase
total genus 91
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4pm6A00
2A3UA 4U0TA 2I72A 1TVFA 5FQJA 3VOZA 1WE4A 3N8LA 4E3JA 4OPQA 3WRZA 3QHYA 4NK3A 1K4FA 4B88A 2XH9A 3UE1A 4RX3A 5HL1A 3LY4A 4P0MA 4E3NA 5EOOA 1NZOA 3OCLA 1YQSA 3SH9A 3TSGA 3LY3A 1Y54A 1K56D 1XGIA 4JBFA 3NDEA 4S2NA 1IKGA 1FSWA 5FDHA 3IHBA 2XK1A 1K57C 5KZHA 4U3TA 2ZC5B 4PM9A 3Q82A 5FQQA 5EVIB 1FCNA 2Z2LB 3M2JA 3HLEA 4KZ3A 5DTSA 3HBRA 5EOEA 4P6BA 4WYYA 1XKZA 1YLZA 1PZOA 3O88A 1EROA 4LCLA 2IWBA 4O7DA 3IF6A 5EVLA 3BFEA 3IXBA 3IXHA 3NY4A 3N6IA 3NCKA 3SH8A 3A3IA 2QMIA 1MXOA 2XFSA 1YMXA 5DTKA 5GHYA 4BD1A 5FSRA 3ZG9B 3ZNYA 2ZQDA 4OPYA 2EFUA 4GN2A 2OLUA 5CXWA 4Y0TA 3BEBA 3SOIA 5HAQA 3O87A 4BL3A 2R9WA 3O86A 3ITBA 3AGEA 1PW8A 4JXSA 2HDQA 3HLWA 4GOGA 2Q9MA 3VP1A 3BFGA 1ES4A 3HLCA 5GL9A 1LL9A 4DXCA 1MKIA 1ES3A 4OLGA 4XUXA 4DRTA 5FQMA 4C6YA 3UNWA 5CGXA 3GV9A 1IYSA 4X53A 2Y2GA 4R23A 2Y59A 3G4PA 4GZBA 2P9VA 2WYXA 2Y2PA 3TG9A 3VFFA 1XGJA 2V20A 4GDBA 1OMEA 3G30A 1MPLA 4EBPA 5HAPA 2BG1A 3UN7A 1E4DA 2XEPA 4N9KA 4X56A 5G18A 1J9MA 3MZEA 4LV2A 5A90A 2Y2LA 4PM7A 5KSHA 2EXBA 3C7VA 3MZFA 2ZM2A 3LCEA 4KZ4A 5CTNA 5IHVA 4S2NC 3W4OA 4PPRA 2V2FF 1FSYA 1K55A 4OP8A 1PYYA 3HLFA 2OV5A 1I2WA 4OQ0A 4ZAMA 5JYOA 3O3VA 3DWZA 2JC7A 4KG5A 3S1YA 4N92A 2Y2KA 4QJGA 1ONHA 1Q2PA 3OZHA 4N1HA 2XD1A 2J8YA 4PM6A 4F94A 1S0WA 4FSFA 5E2EA 1GHMA 2OLVA 1W8YA 1WYCA 1YT4A 5FAOA 4KZ5A 4Y7PA 3BRMA 3SS3A 1SCWA 5DVAA 4H8RA 3NI9A 3DTMA 1YLPA 4KZ7A 3VOYA 2XF3A 4WMCD 3IF6C 4OPRA 1ESUA 1W5DA 4IBRA 1G6AA 3GSGA 3HVFA 1ZKJA 1BSGA 4OQHA 3N8RA 2V1ZA 1ERMA 1XP4A 4IVIA 1BLPA 4UHUA 3IH8A 1PWCA 1LHYA 2UWXA 4PM8A 4XXRA 3PAEA 2A49A 4RX2A 1JWVA 5DTTA 2VGKA 3UDFA 1KDWA 4N9LA 5CEBA 1Q2QA 1YLJA 4LCMA 3HLDA 4R4SA 3PBRA 3UDXA 2R9XA 4LV3A 3W4QA 3IXDA 1QMEA 4WZ5A 1ES2A 4P87A 3WS0A 1PI4A 2HDUA 2XD5A 3CMZA 4R1GA 4WM9A 5F1GA 4BQMA 5FASA 1GHPA 2H0TA 4MLLA 4S2KA 4S2IA 5FI7A 3G2YA 1NY0A 4JF4A 4FH2A 1WYBA 5KMWA 1IYOA 5F1FA 1BTLA 1NYMA 3Q1FA 3G2ZA 1SDEA 3C5AA 4GNUA 5EVIA 4K91A 3WS1A 4HEFA 4WEJA 3W4PA 3PBNA 1NZUA 1PWGA 3D4FA 3HLBA 3UO9A 4E6WA 4EWFA 1W7FA 2X02A 3VSKA 5F82A 3TOIA 4JF5A 5HFOA 3HUNA 3UE0A 4CJNA 1H8YA 3BFDA 4EUZA 3EQVA 4OONA 1JWZA 1TDLA 4S2JA 5AQ7A 4DE1A 1L0GA 3AGFA 1HTZA 1CI9A 1MWUA 3CJMA 2ZM8A 2WKIA 5TGFA 5FA7A 2C6WB 3N8SA 1L0FA 1YLYA 2ZQCA 3N7WA 4GKUA 1TEMA 4OVDA 3ZGAB 4X69A 4S2LA 2WK0A 3ZDJA 4BENA 2JE5A 4N1XA 4S2PA 2WUQA 2WAEA 3G35A 4OLDA 4QY5A 1K25A 1MY8A 3E2KA 3PBSA 3MFDA 1HVBA 2QPNA 1E3UD 1FQGA 1LI9A 3WS2A 4OPZA 2Y2HA 3OC2A 2J9PA 2XFTA 2HPBA 1G68A 1N9BA 1PW1A 4GD8A 1ALQA 3LO7A 3MZDA 1ERQA 3UDIA 3A3EA 4JXVA 4RYEA 2Z2MB 5FI2A 1NYYA 3GRJA 4OOYA 1HZOA 5EUAA 5EPHA 1FCMA 1GHIA 3Q7VB 1BLSA 4WZ5C 4KZAA 1I5QA 3FWLA 1DJCA 4MEZA 4QU3A 1K54A 1BLHA 5FQKA 2WGWB 2B5RA 2ZQ8A 3VP4A 4DE2A 2G2WA 3ZCZA 5EECA 3VP0A 4ZJ1A 5TFQA 1VQQA 2X01A 1CI8A 3SS4A 5EVIC 1YLTA 1O7EA 4X68A 4BL2A 2EX8A 4DDSA 5FAPA 4KG6A 2OSUA 1KGEA 1E25A 4PMAA 4E3OA 4KZ9A 3C4OA 5CECA 4YINA 3A3JA 4BLMA 4X6TA 4E6XA 1KGFA 1KGGA 1IYPA 1W8QA 2JBFA 2PU4A 3G31A 3ZG8B 5D3OA 3FZCA 1MBLA 2WZZA 4C3QA 5CHUA 4D2OA 4P85A 1W79A 5CGWA 4DF6A 3OPHA 4HESA 3UPNA 3UY6A 4FH4A 3WRTA 1KVLA 4GB7A 4OP5A 1EWZA 1RGYA 4RVAA 2WKEA 1S6RA 1K56A 4B4ZA 5HX9A 3FYZA 1CEGA 5GLBA 2PU2A 4K0WA 3FKVA 3M2KA 3DWKA 1YM1A 3QNCA 5E2FA 4KQQA 5CTMA 5DF8A 3RJUA 4QB8A 5HW3A 3V39A 3GQZA 2J9OA 3A3FA 2XLNA 5E43A 1LL5A 5GLAA 1KDSA 1L2SA 4ID4A 3ZG7B 3NC8A 4DE0A 4Y0OA 2HP9A 1GA9A 3AGDA 1NRFA 1DJBA 1N4OA 1GCEA 1EI5A 3VSLA 1PI5A 2WKHA 1FOFA 4JLFA 2RCXA 3IWIA 4S2MA 1BULA 2XR0A 2P74A 4LV0A 5E2HA 5AQBA 5M19A 4QHCA 3BECA 1K54C 3MKEA 4R3BA 4LENA 1KE3A 4XUZA 2E8IA 4OOLA 3BFCA 3ZG5A 1DJAA 2J7VA 3OCNA 3S22A 3MBZA 4WEKA 1FR1A 2Y2MA 1SKFA 2DRWA 2PBYA 3Q7ZA 2EXAA 5FQIA 1VM1A 2Y55A 5KSCA 3VMAA 1IKIA 2ZQAA 3BYDA 4UA6A 5FI6A 4DDYA 4NETA 4HBTA 4ZDXA 3RXXA 1KVMA 1JWPA 3DW0A 4OQGA 3GVBA 3FKWA 4RA7A 4WZ4A 3ZFZA 4BJPA 4M3KA 4KG2A 1RCJA 4IEDA 1KE4A 3PTEA 5GLCA 2XDMA 1DY6A 1K55C 1AXBA 2WADA 5FATA 1FR6A 5L2FA 5FQ9A 3CG5A 1BLCA 5AQ9A 2ZC6B 3E2LA 4MBHA 4ZJ2A 2DCFA 1H5XA 1K38A 3CZDA 3V50A 1XA1A 1ZC2A 2RL3A 2Y2NA 4GD6A 2ZLYA 3WS4A 1M6KA 3PAGA 1IYQA 3G34A 3LEZA 4U0XA 3PBQA 4KENB 1NXYA 5AQAA 3Q7VA 2Y4AA 3QNBA 4KZBA 1PIOA 3NBLA 4E3LA 2Y91A 1O07A 4WELA 4Y0UA 2WZXA 4ZTKA 3UPPA 3IWOA 3ISGA 5TR7A 3WS5A 2JCHA 2WGWA 2FFFB 5BOHA 4R3JA 3IF5A 4ZBEA 5M18A 1Z6FA 1H8ZA 2XGNA 3M6HA 3MXRA 4KZ8A 3ZG0A 3M6BA 1L0EA 4WMCA 1K6RA 4R4RA 1NJ4A 3PBOA 4UA7A 4DXBA 2H10A 3MKFA 4EBLA 4UAAA 4GDNA 1MWTA 4EBNA 1M40A 3BM6A 2BLSA 2XQZA 5F83A 1ONGA 5FAQA 4E3MA 4QY6A 1BUEA 1L0DA 4DKIA 2ZM0A 2GDNA 3UE3A 1TDGA 2X71A 1JTGA 2WGVA 4JF6A 3NDGA 4BD0A 2IWDA 2ZQ9A 2Y2JA 3V5MA 2QZ6A 4IVKA 3I7JA 4E3IA 4C75A 2IWCA 3IHAA 5EE8A 1MWSA 3HREA 5CHMA 5CGSA 4S2OA 2ZJ9A 3B3XA 3GTCA 2ZC4B 4LV1A 1I2SA 2EX6A 1KE0A 3IT9A 3NIAA 1U60A 3EQUA 4EQIA 5A91A 5J8XA 4KQRA 1CEFA 4OH0A 5A92A 4JXGA 1HD8A 3P09A 4FD8A 4MBKA 4OOMA 5I94A 3ZNTA 3VP3A 1IELA 3RXWA 3VP2A 3ZVTA 4CPKA 5HAIA 2ZMAA 3BFFA 3IF6B 5EVID 5A93A 1YLWA 5U47A 1ESIA 1SHVA 5E2GA 1SDNA 2H5SA 3FV7A 4JPMA 1MWRA 3V3RA 2EFXA 3OPLA 5GHXA 4K0XA 5DF9A 3GMWA 2HDRA 5CERA 2DNSA 4X55A 4MNRA 4EV4A 4DE3A 2WGIA 4YFMA 1IEMA 3IQAA 2C5WB 1RP5A 2EX2A 4E3KA 4WBGA 2EX9A 2ZD8A 1BT5A 3ITAA 3G32A 3Q81A 1GA0A 3IWQA 5GHZA 4KQOA 5HARA 4OKPA 1BZAA 5GLDA 2Y2QA 4Q8IA 4FCFA 5DF7A 2HP6A 3UPOA 4JKTA 3SH7A 3MXSA 2P9VB 1ZG6A 3HUOA 4L0LA 3ZVWA 1K57A 5CEDA 3IXGA 2HDSA 2ZQ7A 3OPPA 4Z9QA 1PZPA 1JVJA 1ZG4A 2ZC3B 1RGZA 3HLGA 4UA9A 5M1AA 1K4EA 1PWDA 2Q9NA 2H0YA 1E3UA 4A5RA 3WWXA 4ZJ3A 3A3DA 1LI0A 4MBFA 3HUMA 3Q07A 1LLBA 3OPRA 1FCOA 1C3BA 4HBUA 4PM5A 5CHJA 3IH9A 2HP5A 1XX2A 3ZHHA 3PBTA 3BLMA 1YMSA 1CK3A 1JTDA 1QMFA 1XPBA 5JYPA 2ZC7A 3SS5A 2WAFA 2CC1A 5CRFA 2FFYA 4OQIA 1K6SA 1XXMA 2Y2IA 4JXWA 1ES5A 3JYIA 3W8KA 2VGJA 2Y2OA 4KZ6A 3HL9A 3VFHA 3V3SA 3P98A 4QD4A 1XA7A 3C4PA 4B4XA 3C7UA 3S4XA 3BLSA 3GR2A 4R0QA 2G2UA 3N4IA 4IBXA
chains in the Genus database with same CATH superfamily
2I72A 1A0KA 3ZYTA 4E3JA 4BBTA 3QHYA 4NK3A 1TS8A 5AVFA 2XH9A 1G6OA 3LY4A 4E3NA 4WUJA 1K56D 1XGIA 3NDEA 1FSWA 3TJZC 4YWZA 5KZHA 1K57C 4PM9A 1OTBA 3IX4A 2QJ7A 3BY8A 5EVIB 4KZ3A 5DTSA 1XKZA 1H0MA 5EVLA 3IXHA 3N6IA 2QMIA 5GHYA 4ESPA 5FSRA 4OPYA 1OJGA 3BEBA 2LB5A 2R9WA 3O86A 3HLWA 3VP1A 4DXCA 1UWNX 1SKOA 4O0PA 5DKLA 5CGXA 3UNWA 1IYSA 4R23A 3G4PA 5TBMA 2WYXA 2Y2PA 3GECA 4RQ9A 2V20A 3LYXA 1MPLA 4N9KA 5G18A 5A90A 1J9MA 1T19A 2IA2A 1FILA 4KZ4A 5CTNA 4S2NC 3MQQA 1SKOB 1FSYA 3LR0A 3HLFA 2W3FA 4ZAMA 4KG5A 3S1YA 4N92A 4QJGA 1Q2PA 3OZHA 4PM6A 2XD1A 4F94A 1YT4A 1TS0A 1KOUA 3BRMA 4KZ7A 3NI9A 3BQAA 3PYPA 4IBRA 5HZHA 1W63M 3MJQA 4UHUA 5I5LA 4PM8A 2VGKA 4LCMA 3HLDA 4R4SA 2R9XA 3W4QA 1QMEA 1BYWA 4P87A 2JKRM 5FASA 1GHPA 2H0TA 4DJ2A 4FH2A 1WYBA 5J3WA 1OT9A 3C5AA 4HEFA 3W4PA 3HCYA 4G3VA 4Y5FA 1LSVA 1W7FA 2KDKA 2X02A 5F82A 4EQ1A 3NOUC 5HFOA 3HUNA 3T4LA 4M4XA 4CJNA 4EUZA 4OONA 1JWZA 4S2JA 2W1TA 1CI9A 1MWUA 3E4QA 3KYZA 2ZM8A 4D60A 4Z1WA 2BTFP 3N7WA 3A0VA 3OOVA 3ZDJA 4N1XA 3E2KA 1YKDA 3PBSA 5HDDA 3MFDA 1E3UD 1MZUA 1FQGA 2W1TB 4OPZA 4MDZA 4ETXA 2Y2HA 1N9BA 4G3WA 5FI2A 1HZOA 5EPHA 1FCMA 3Q7VB 4KZAA 1OTIA 4MEZA 4QU3A 4HHDA 3VP4A 4YNRA 3UE6A 5J4EA 5TFQA 2X01A 1CI8A 2MJ6A 2P08A 4KG6A 4E3OA 3B47A 3C4OA 2ZL1B 4X6TA 1W8QA 1IYPA 2JBFA 5D3OA 3PR6A 5CHUA 4D2OA 1W79A 3OPHA 4OP5A 2R78A 1K56A 3C38A 3FYZA 1CEGA 3QNCA 2E8JA 1S4SA 5HW3A 3V39A 2J9OA 3BQ8A 5GLAA 3ZG7B 1GA9A 3E4OA 1XJ3A 1DJBA 1VB6A 1N4OA 2V1BA 1GCEA 3VSLA 1PI5A 1FOFA 2GJ3A 3T1XA 2E8IA 3BFCA 3RFBA 4ARZA 2J7VA 1FR1A 2Y2MA 5FQIA 2Y55A 1IKIA 3UB5P 5FI6A 1JWPA 3FKWA 2VV6A 5GLCA 2XDMA 3TW8A 5FATA 4ARZB 4JGQA 1BLCA 5AQ9A 4EUVA 1F5MA 4GS9A 1H5XA 1F9IA 5DFXA 3E4PA 3PBQA 5AQAA 2PR6A 2Y4AA 4KZBA 5A8BA 4O8GA 4WELA 1O07A 4Y0UA 4ZTKA 1D06A 3MR0A 5TR7A 3IF5A 1Z6FA 1H8ZA 2XGNA 3M6HA 3MXRA 4KZ8A 3M6BA 1L0EA 1NJ4A 2GNXA 5HD3A 1WA9A 2M7VA 1CF0A 4PKYA 1NLZA 4EBLA 4UAAA 4GDNA 1MWTA 1M40A 3SZTA 3V67A 2BLSA 2XQZA 4Y3IA 1BUEA 5F68A 4I3IA 3BJNA 4NEED 1TDGA 2X71A 1JTGA 2WGVA 3NDGA 3V5MA 2JKTM 4IVKA 2IWCA 3IHAA 5CGSA 4S2OA 3GTCA 4LV1A 1I2SA 3CITA 2EX6A 3NIAA 3EQUA 3P09A 4FD8A 4MBKA 5HAIA 1GSWA 5A93A 5EVID 1SDNA 2EFXA 4K0XA 3EEHA 1S66L 3GMWA 2HDRA 3T1QB 2WGIA 2FZ0A 3NECA 1RP5A 2EX2A 2J3TC 4E3KA 1D1JA 2ZD8A 3Q81A 3S7PA 5GLDA 2Y2QA 4Q8IA 3UPOA 4JKTA 3K3DA 1ZG6A 4L0LA 1F2KA 1ZG4A 1RGZA 3KYEA 2H0YA 4EU0A 1E3UA 5HDSA 3F1PA 3WWXA 2M1CA 1FCOA 3EWKA 1XJ2A 4HBUA 2HP5A 3ZHHA 3PBTA 2HGVA 2V8CA 1XPBA 2ZC7A 3SS5A 4I3JA 3IBRA 2D01A 2ZOIA 3EGDC 2Y2IA 3F1PB 4Y2FA 3K2NA 2I9VA 3N4IA 2A3UA 4U0TA 2ACGA 2PYRA 4Q0JA 3VOZA 1WE4A 1TF1A 1P9WA 4MN5A 3H7WA 1K4FA 4NXGA 4XT2B 1NZOA 3TSGA 2QHKA 2QJ5A 4JBFA 2OWJA 2XK1A 2QWSA 2O9AA 3MXQA 5EVEA 2HF6A 4CLCD 1W63Q 4LCLA 4O7DA 3IF6A 3UB6A 3BFEA 3NCKA 3SH8A 2B18A 3A3IA 1YMXA 4GLQA 2EFUA 4L9EA 1OT6A 4Y0TA 4DMZA 5IS1A 2XROA 3AGEA 1PW8A 2PR5A 3BFGA 2L1MA 3HLCA 2PT7A 4IUKA 4EXOA 4OLGA 4DRTA 3JVVA 3JVUA 3GV9A 2PDRA 4GZBA 3VFFA 4Y17A 4GDBA 1STZA 3G30A 5HAPA 4EBPA 3TE8A 1E4DA 4PM7A 2EXBA 3C7VA 2ZM2A 3LCEA 1IOUA 4PPRA 1PYYA 2OV5A 3F1OA 2JC7A 5L07A 4FSFA 1YSPA 2OLVA 1W8YA 1WYCA 4LPZA 4Y7PA 1S1ZA 5DVAA 4H8RA 2XF3A 3CAXA 4OPRA 4HI4A 1G6AA 1BSGA 3LIBA 1DP9A 4OQHA 2JKRI 3F1OB 4KUKA 4IVIA 1BLPA 3IH8A 1PWCA 3EOIA 1ZHHB 2UWXA 4XXRA 4RX2A 1LSWA 3UDFA 4BWIA 4NXEA 1KDWA 3S7NA 4N9LA 3D9YA 2PAVP 3IXDA 3MQ0A 4WZ5A 1ES2A 4EESA 3WS0A 2XD5A 3LR5A 4S2KA 2VGLM 2Z6DA 5F1FA 1NYMA 3QP2A 3G2ZA 4GNUA 5EVIA 4K91A 1PWGA 3ICYA 3T1SA 3QP8A 3LI9A 5EM0A 4HJ6A 2VKSA 1TDLA 2EWVA 1L0GA 1HTZA 3CJMA 2WKIA 5TGFA 3T50A 3N8SA 2ZQCA 4PKYG 3ZGAB 4X69A 4S2LA 2WK0A 4BENA 3BWLA 4QY5A 5HPIA 1HVBA 3L7HA 1EW0A 2A24A 2J9PA 4GD8A 3LO7A 1ERQA 4L9FA 1GHIA 3PXPA 5FQKA 2WGWB 2B5RA 4DE2A 2G2WA 2P04A 3P01A 2J80A 4ZJ1A 3LR3A 4HJ4A 3SS4A 2A24B 3PHYA 4Q0HA 4X68A 4X25A 2EWWA 1KGEA 1E25A 4JGRA 4PMAA 4EETB 4YINA 3A3JA 4WLAA 1KGFA 1KGGA 2VV7A 4C3QA 1VEUB 4H6JB 5FEFA 4HESA 2JKFA 4FH4A 5F5YA 3D72A 1S6RA 4JGOA 5HX9A 2PU2A 4K0WA 3M2KA 1YM1A 3T4JA 5CTMA 1V9ZA 4QB8A 1S4RA 1H3QA 2H28A 1L2SA 4DE0A 4Y0OA 4CLCA 3QP1A 2W1RA 2OAP1 1EI5A 2RCXA 1PFLA 3IWIA 4S2MA 2VA0A 2XR0A 2YKFA 1YSQA 5F6AA 1K54C 3LUQA 3ZG5A 4WEKA 3B33A 1N9LA 3Q7ZA 2EXAA 4CLCB 5KSCA 3BYDA 4UA6A 3CUEC 1DP6A 1KVMA 3DW0A 3GVBA 3ZFZA 3PTEA 2WADA 1FR6A 5FQ9A 3HJKA 3O5YA 4MMNA 3E2LA 2DCFA 4NKPA 2J3WA 3CZDA 1ZC2A 1ZTUA 4GD6A 3WS4A 3G34A 5IU1A 4U0XA 4KENB 4EW7A 3Q7VA 4BBVA 3UPPA 3IBJA 3IWOA 5EFWA 2JKTI 4HH3A 1MKMA 1K6RA 4R4RA 4UA7A 4LLOB 4HIAA 2PD8A 5L8MA 2Z6CA 5FAQA 1ONGA 3OBFA 4QY6A 1P97A 3UE3A 4HP9A 4BD0A 2ZL1A 3MMHA 3I7JA 4E3IA 3DTEA 5CHMA 3B3XA 3T12B 4F3LB 3LEQA 1KE0A 3IT9A 5A91A 5J8XA 3S7QA 1NRJA 4OH0A 5I94A 1G5UA 4II7A 5EV0A 3IX3A 3LR4A 1IELA 3ZVTA 2ZMAA 1SHVA 5E2GA 4UQIS 5DF9A 5CERA 1L3LA 4QPRA 4EV4A 1CJFA 3KSFA 1VETA 4ME4A 4WBGA 3ITAA 3G32A 2XRNA 3IWQA 4KQOA 1LL8A 1YAXA 4P6ZS 3MXSA 2P9VB 3HUOA 1K57A 3OPPA 4Z9QA 1PZPA 2ZC3B 5M1AA 3CPTB 1PWDA 2Q9NA 1VETB 3A3DA 3H9WA 5LBRA 1LLBA 3DTKA 1XFQA 1NWZA 4PM5A 5CHJA 3IH9A 1XX2A 3BLMA 1CK3A 1JTDA 5JYPA 5FL3A 5CRFA 2CC1A 2FFYA 1T1AA 4R3AA 1T1CA 4DJ3A 4PAUA 2GX5A 4KZ6A 3IS2A 3VFHA 1FIKA 3P98A 4IHQA 1XA7A 3C4PA 4B4XA 1OPXA 4R0QA 2V1AA 4IBXA 3U2AA 1TVFA 2O9BA 5FQJA 2K31A 3N8LA 3NJAA 4OPQA 4B88A 5HL1A 4P0MA 5EOOA 3SH9A 3IS2B 1YQSA 3HJIA 1Y54A 4S2NA 5K5BA 1IKGA 3KSIA 5FDHA 2HZ5A 4HH2A 2ZC5B 2XA7S 2W27A 3Q82A 3DTIA 5FQQA 3E98A 3HLEA 3HBRA 5EOEA 4P6BA 4WYYA 1PZOA 1EROA 3ZQ5A 3NY4A 4QWOA 1MXOA 2XFSA 2HJEA 3ZNYA 4YOFA 4GN2A 2OLUA 5CXWA 3O87A 2BASA 4BL3A 3ITBA 1OTAA 2HDQA 5AJGA 4GOGA 3ULFA 4HNBA 1LL9A 2O0YA 4XUXA 4HY8A 4X53A 4GHIA 2Y59A 2Q0OA 1XGJA 1OMEA 4FUWA 4Y13A 3FPWA 3UN7A 4X56A 4LV2A 2Y2LA 5KSHA 3MZFA 5HDCA 5IHVA 3W4OA 4OP8A 2VK3A 1I2WA 3O3VA 4GHIB 2Y2KA 1ONHA 2J8YA 2J3TD 5E2EA 5G4ZA 1GHMA 4BMWA 4GJ4A 5FAOA 4KZ5A 5TJJA 3SS3A 3DTMA 1YLPA 3VOYA 2W3HA 4WMCD 4WF0A 1ESUA 1W5DA 4GW9A 2YKHA 3BY9A 3GSGA 3HVFA 1ZKJA 4L9GA 3N8RA 4MCWA 4K08A 4CQHA 2A49A 1P0ZA 5FEGA 1Q2QA 1YLJA 2WKPA 3PBRA 4XT2A 4G3KA 1S67L 4LV3A 4MN6A 1PI4A 4R1GA 5HL6A 3CLOA 4WM9A 2OAQ1 4BQMA 4MLLA 2V0WA 3H82A 3T4OA 5FI7A 4JF4A 1NY0A 2ZMVA 5KMWA 1PNEA 1IYOA 3Q1FA 1SDEA 3WS1A 1G28A 2Y79A 4DN0A 4WEJA 3D4FA 3HLBA 3UO9A 4E6WA 4EWFA 4WN5A 3VSKA 1LT0A 3TOIA 4FOFA 1H8YA 3EQVA 2PHYA 3H82B 3AGFA 4BBUA 5HD5A 3LI8A 4ETZA 5FA7A 1XJ4A 2V0UA 3KSHA 5L10A 1L0FA 1TEMA 4OVDA 3LIEA 2NUPC 4S2PA 2WUQA 3G35A 3WS2A 3OC2A 2HPBA 1G68A 1H8MA 1PW1A 1ALQA 3MZDA 3UDIA 3A3EA 4JXVA 2Z2MB 3GRJA 4OOYA 5EUAA 3FWLA 1DJCA 2JHEA 5HSQA 1BLHA 2PRFA 3ZCZA 2V8FA 1O7EA 4BL2A 3MF0A 2KLIA 4HP4A 2LB9A 4KZ9A 5J7EA 5CECA 2WKRA 2OOLA 2VZWA 3G31A 2PU4A 3FZCA 2WZZA 3G6OA 4P85A 5CGWA 1KVLA 2VV8A 1EWZA 2Y8HA 3DWKA 3GDIA 4KQQA 5DF8A 3RJUA 1LL5A 1KDSA 4ID4A 2DMWA 3AGDA 5IT5A 2WKHA 4Y15A 4NG2A 3A0SA 2P74A 3T1RA 2NUTC 3BECA 4R3BA 3MKEA 4XUZA 4LENA 1KE3A 4OOLA 2ZMFA 2M7UA 3LIAA 3FPVA 3S22A 3MBZA 2DRWA 2PBDP 3VMAA 2ZQAA 3F1NB 3UB9A 4NETA 4ZDXA 3RXXA 4RA7A 4WZ4A 3L9KA 4BJPA 4M3KA 4KG2A 4IEDA 1KE4A 3DAVA 1K55C 5L2FA 3CG5A 3D3OA 4MN7A 3UB8A 4ZJ2A 2ZC6B 4I38A 3R7WB 1K38A 1Y4OA 1XA1A 1M6KA 3PAGA 3LEZA 4I3AA 1PIOA 3NBLA 4ZRRA 2FH5A 3ISGA 2WGWA 2FFFB 5M18A 1MC0A 3T4KA 3ZG0A 4WMCA 3PBOA 3MQOA 4DXBA 3RH8B 4NXBA 4HOIA 4O01A 4DKIA 1L0DA 4I5SA 2ZM0A 3VE3A 2QZ6A 3T4TA 2O99A 1DRMA 1VEUA 2HJ9C 4Q0IA 4H6JA 2KOIA 4X1MA 2ZJ9A 2ZC4B 2W3EA 1TS6A 1U60A 4EQIA 2VEAA 3IX8A 5A92A 4JXGA 1HD8A 3VP3A 3RXWA 1OTDA 5HWVA 1YLWA 2CMNA 4JPMA 3V3RA 3OPLA 2V9AA 1ACFA 3OLOA 2AVXA 2W0NA 4LFUA 4DE3A 4YFMA 3KX0X 1UWPX 2C5WB 2EX9A 1GA0A 3JPUA 5HARA 1BZAA 4FCFA 5DF7A 2HP6A 5TBMB 3VE4A 3NOPC 3ZVWA 2ZQ7A 4E04A 1JVJA 1XFNA 4A5RA 2G7UA 4MBFA 3HUMA 3Q07A 3OPRA 4EERA 1C3BA 5DKKA 2WAFA 1XJ6A 4CLCE 4OQIA 1ES5A 2QYBA 3JYIA 2Y2OA 2EA9A 2W3GA 2B02A 4X1LA 3QP4A 3V3SA 5L09A 4QD4A 3W2ZA 1JNUA 3BLSA 2HV1A 1T1BA 3UMDA 3WRZA 3UE1A 4RX3A 3OCLA 3LY3A 4LGWA 1T18A 3IHBA 4U3TA 3C2WA 4F3LA 2JKGA 1FCNA 2Z2LB 2OWHA 3M2JA 5HWTA 3U4LP 1YLZA 3FC7A 3O88A 3UMEA 3E0YA 2IWBA 3IXBA 4NXFA 1LSXA 5KIZA 5F69A 1V9YA 5DTKA 4BD1A 3ZG9B 2XSSA 2ZQDA 3SOIA 4EEPA 5HAQA 3DBAA 2W3DA 2K2NA 4JXSA 3C30A 2Q9MA 1IFQA 1ES4A 5GL9A 1MKIA 2ZOHA 3EEAA 1ES3A 1GSXA 5FQMA 4C6YA 2Y2GA 2P9VA 3TG9A 3CPTA 2BG1A 4R38A 3T4QA 2XEPA 1VHMA 3MZEA 4R70A 2V2FF 1K55A 3B42A 4OQ0A 4IJGA 5JYOA 3DWZA 4N1HA 1S0WA 1YPRA 5HPFA 1SCWA 4KUOA 2P7JA 2KX6A 3IF6C 3QP6A 3BW6A 5HWWA 2V1ZA 1ERMA 1XP4A 1PRQA 4IUHA 1LHYA 3PAEA 1JWVA 5DTTA 5CEBA 3RTYA 3UDXA 3MFXA 2HDUA 3CMZA 5F1GA 2L0WA 4S2IA 4WL9A 5DJUA 3G2YA 4B93A 1BTLA 4HJ3A 3PBNA 1NZUA 4GCZA 3QP5A 4JGPA 4JF5A 3UE0A 3BFDA 5G4YA 1J3WA 5AQ7A 4DE1A 2VJWA 5EM1A 3LIFA 2A2LA 1K0KA 2C6WB 1YLYA 4GKUA 4LRXC 2D02A 2JE5A 4OLDA 2WAEA 4EEUA 1K25A 1MY8A 1HLUP 2QPNA 2UV0E 1LI9A 4UEYA 4GS9B 2XFTA 1ODVA 4RYEA 4PHTA 1NYYA 1NLYA 4WZ5C 1BLSA 1I5QA 4R6LA 1K54A 2ZQ8A 2QKPA 5EECA 3VP0A 1VQQA 3LIDA 5EVIC 1YLTA 3CHWP 2EX8A 3CUEA 4DDSA 3NHQA 5FAPA 2OSUA 4BLMA 4E6XA 3ZG8B 1MBLA 4DF6A 3UPNA 2K7SA 3UY6A 3WRTA 4GB7A 3CWFA 1RGYA 5DJTA 4RVAA 2WKEA 2VGLS 4B4ZA 5GLBA 3C8CA 3FKVA 4I39A 5E2FA 3VV4A 1OTEA 3SW1A 5FDSA 3GQZA 1Z09A 1X0OA 3A3FA 2XLNA 3A0RA 5E43A 3FG8A 3NC8A 2HP9A 1CQAA 3TRCA 1NRFA 3NOTC 1GSVA 4JLFA 1BULA 1N9NA 5C5KA 4LV0A 5E2HA 5AQBA 5M19A 4QHCA 4UQIM 5DFYA 1DJAA 3LFVA 3KSGA 3OCNA 1N9OA 1SKFA 2GZAA 2PBYA 1VM1A 4DDYA 4HBTA 2B95A 4OQGA 1RCJA 2INWA 2WKQA 1DY6A 1AXBA 4P6ZM 4KQDA 2PYPA 3KO6A 4MBHA 3LGOA 1SZVA 3V50A 3NULA 2O9CA 3S7OA 2RL3A 2Y2NA 2ZLYA 3LICA 1IYQA 4LRZE 1NXYA 3QNBA 4E3LA 2Y91A 4AFIA 2WZXA 3WS5A 2JCHA 1F98A 3MS6A 4CLCC 5BOHA 4R3JA 3K3CA 4ZBEA 4FTXA 2H10A 3MKFA 1Y28A 1DP8A 4EBNA 3BM6A 5F83A 3EGXC 4E3MA 2ZBBA 3CI6A 3P7NA 3H7WB 4B9OA 3MSHA 2GDNA 5MC7A 4JF6A 2IWDA 2ZQ9A 2Y2JA 4C75A 5EE8A 1MWSA 3HREA 3T4SA 1AWIA 4KQRA 1CEFA 2L4RA 4OOMA 2VX8A 3UB7A 3ZNTA 4CPKA 2JN7A 3VP2A 1P9RA 3BFFA 3IF6B 5U47A 2XA7M 1ESIA 2H5SA 3FV7A 1MWRA 3R4KA 5GHXA 2DNSA 4X55A 4MNRA 1IEMA 3IQAA 1BT5A 5GHZA 2PD7A 4OKPA 1TD5A 5AVEA 3SH7A 3F1NA 1UGUA 5CEDA 3IXGA 2HDSA 3HLGA 3VOLA 5CX7A 4UA9A 1K4EA 4ZJ3A 1LI0A 1TS7A 2VLGA 1YMSA 1QMFA 4LRYC 3R7WA 1OJ5A 4HQAA 1K6SA 1XXMA 4JXWA 3W8KA 2VGJA 3HL9A 1D7EA 3C7UA 3S4XA 3KYQA 1S1YA 3GR2A 2G2UA
chains in the Genus database with same CATH topology
2A3UA 4U0TA 2I72A 1TVFA 5FQJA 3VOZA 1WE4A 3N8LA 4E3JA 4OPQA 3WRZA 3QHYA 4NK3A 1K4FA 4B88A 2XH9A 3UE1A 4RX3A 5HL1A 3LY4A 4P0MA 4E3NA 5EOOA 1NZOA 3OCLA 1YQSA 3SH9A 3TSGA 3LY3A 1Y54A 1K56D 1XGIA 4JBFA 3NDEA 4S2NA 1IKGA 1FSWA 5FDHA 3IHBA 2XK1A 1K57C 5KZHA 4U3TA 2ZC5B 4PM9A 3Q82A 5FQQA 5EVIB 1FCNA 2Z2LB 3M2JA 3HLEA 4KZ3A 5DTSA 3HBRA 5EOEA 4P6BA 4WYYA 1XKZA 1YLZA 1PZOA 3O88A 1EROA 4LCLA 2IWBA 4O7DA 3IF6A 5EVLA 3BFEA 3IXBA 3IXHA 3NY4A 3N6IA 3NCKA 3SH8A 3A3IA 2QMIA 1MXOA 2XFSA 1YMXA 5DTKA 5GHYA 4BD1A 5FSRA 3ZG9B 3ZNYA 2ZQDA 4OPYA 2EFUA 4GN2A 2OLUA 5CXWA 4Y0TA 3BEBA 3SOIA 5HAQA 3O87A 4BL3A 2R9WA 3O86A 3ITBA 3AGEA 1PW8A 4JXSA 2HDQA 3HLWA 4GOGA 2Q9MA 3VP1A 3BFGA 1ES4A 3HLCA 5GL9A 1LL9A 4DXCA 1MKIA 1ES3A 4OLGA 4XUXA 4DRTA 5FQMA 4C6YA 3UNWA 5CGXA 3GV9A 1IYSA 4X53A 2Y2GA 4R23A 2Y59A 3G4PA 4GZBA 2P9VA 2WYXA 2Y2PA 3TG9A 3VFFA 1XGJA 2V20A 4GDBA 1OMEA 3G30A 1MPLA 4EBPA 5HAPA 2BG1A 3UN7A 1E4DA 2XEPA 4N9KA 4X56A 5G18A 1J9MA 3MZEA 4LV2A 5A90A 2Y2LA 4PM7A 5KSHA 2EXBA 3C7VA 3MZFA 2ZM2A 3LCEA 4KZ4A 5CTNA 5IHVA 4S2NC 3W4OA 4PPRA 2V2FF 1FSYA 1K55A 4OP8A 1PYYA 3HLFA 2OV5A 1I2WA 4OQ0A 4ZAMA 5JYOA 3O3VA 3DWZA 2JC7A 4KG5A 3S1YA 4N92A 2Y2KA 4QJGA 1ONHA 1Q2PA 3OZHA 4N1HA 2XD1A 2J8YA 4PM6A 4F94A 1S0WA 4FSFA 5E2EA 1GHMA 2OLVA 1W8YA 1WYCA 1YT4A 5FAOA 4KZ5A 4Y7PA 3BRMA 3SS3A 1SCWA 5DVAA 4H8RA 3NI9A 3DTMA 1YLPA 4KZ7A 3VOYA 2XF3A 4WMCD 3IF6C 4OPRA 1ESUA 1W5DA 4IBRA 1G6AA 3GSGA 3HVFA 1ZKJA 1BSGA 4OQHA 3N8RA 2V1ZA 1ERMA 1XP4A 4IVIA 1BLPA 4UHUA 3IH8A 1PWCA 1LHYA 2UWXA 4PM8A 4XXRA 3PAEA 2A49A 4RX2A 1JWVA 5DTTA 2VGKA 3UDFA 1KDWA 4N9LA 5CEBA 1Q2QA 1YLJA 4LCMA 3HLDA 4R4SA 3PBRA 3UDXA 2R9XA 4LV3A 3W4QA 3IXDA 1QMEA 4WZ5A 1ES2A 4P87A 3WS0A 1PI4A 2HDUA 2XD5A 3CMZA 4R1GA 4WM9A 5F1GA 4BQMA 5FASA 1GHPA 2H0TA 4MLLA 4S2KA 4S2IA 5FI7A 3G2YA 1NY0A 4JF4A 4FH2A 1WYBA 5KMWA 1IYOA 5F1FA 1BTLA 1NYMA 3Q1FA 3G2ZA 1SDEA 3C5AA 4GNUA 5EVIA 4K91A 3WS1A 4HEFA 4WEJA 3W4PA 3PBNA 1NZUA 1PWGA 3D4FA 3HLBA 3UO9A 4E6WA 4EWFA 1W7FA 2X02A 3VSKA 5F82A 3TOIA 4JF5A 5HFOA 3HUNA 3UE0A 4CJNA 1H8YA 3BFDA 4EUZA 3EQVA 4OONA 1JWZA 1TDLA 4S2JA 5AQ7A 4DE1A 1L0GA 3AGFA 1HTZA 1CI9A 1MWUA 3CJMA 2ZM8A 2WKIA 5TGFA 5FA7A 2C6WB 3N8SA 1L0FA 1YLYA 2ZQCA 3N7WA 4GKUA 1TEMA 4OVDA 3ZGAB 4X69A 4S2LA 2WK0A 3ZDJA 4BENA 2JE5A 4N1XA 4S2PA 2WUQA 2WAEA 3G35A 4OLDA 4QY5A 1K25A 1MY8A 3E2KA 3PBSA 3MFDA 1HVBA 2QPNA 1E3UD 1FQGA 1LI9A 3WS2A 4OPZA 2Y2HA 3OC2A 2J9PA 2XFTA 2HPBA 1G68A 1N9BA 1PW1A 4GD8A 1ALQA 3LO7A 3MZDA 1ERQA 3UDIA 3A3EA 4JXVA 4RYEA 2Z2MB 5FI2A 1NYYA 3GRJA 4OOYA 1HZOA 5EUAA 5EPHA 1FCMA 1GHIA 3Q7VB 1BLSA 4WZ5C 4KZAA 1I5QA 3FWLA 1DJCA 4MEZA 4QU3A 1K54A 1BLHA 5FQKA 2WGWB 2B5RA 2ZQ8A 3VP4A 4DE2A 2G2WA 3ZCZA 5EECA 3VP0A 4ZJ1A 5TFQA 1VQQA 2X01A 1CI8A 3SS4A 5EVIC 1YLTA 1O7EA 4X68A 4BL2A 2EX8A 4DDSA 5FAPA 4KG6A 2OSUA 1KGEA 1E25A 4PMAA 4E3OA 4KZ9A 3C4OA 5CECA 4YINA 3A3JA 4BLMA 4X6TA 4E6XA 1KGFA 1KGGA 1IYPA 1W8QA 2JBFA 2PU4A 3G31A 3ZG8B 5D3OA 3FZCA 1MBLA 2WZZA 4C3QA 5CHUA 4D2OA 4P85A 1W79A 5CGWA 4DF6A 3OPHA 4HESA 3UPNA 3UY6A 4FH4A 3WRTA 1KVLA 4GB7A 4OP5A 1EWZA 1RGYA 4RVAA 2WKEA 1S6RA 1K56A 4B4ZA 5HX9A 3FYZA 1CEGA 5GLBA 2PU2A 4K0WA 3FKVA 3M2KA 3DWKA 1YM1A 3QNCA 5E2FA 4KQQA 5CTMA 5DF8A 3RJUA 4QB8A 5HW3A 3V39A 3GQZA 2J9OA 3A3FA 2XLNA 5E43A 1LL5A 5GLAA 1KDSA 1L2SA 4ID4A 3ZG7B 3NC8A 4DE0A 4Y0OA 2HP9A 1GA9A 3AGDA 1NRFA 1DJBA 1N4OA 1GCEA 1EI5A 3VSLA 1PI5A 2WKHA 1FOFA 4JLFA 2RCXA 3IWIA 4S2MA 1BULA 2XR0A 2P74A 4LV0A 5E2HA 5AQBA 5M19A 4QHCA 3BECA 1K54C 3MKEA 4R3BA 4LENA 1KE3A 4XUZA 2E8IA 4OOLA 3BFCA 3ZG5A 1DJAA 2J7VA 3OCNA 3S22A 3MBZA 4WEKA 1FR1A 2Y2MA 1SKFA 2DRWA 2PBYA 3Q7ZA 2EXAA 5FQIA 1VM1A 2Y55A 5KSCA 3VMAA 1IKIA 2ZQAA 3BYDA 4UA6A 5FI6A 4DDYA 4NETA 4HBTA 4ZDXA 3RXXA 1KVMA 1JWPA 3DW0A 4OQGA 3GVBA 3FKWA 4RA7A 4WZ4A 3ZFZA 4BJPA 4M3KA 4KG2A 1RCJA 4IEDA 1KE4A 3PTEA 5GLCA 2XDMA 1DY6A 1K55C 1AXBA 2WADA 5FATA 1FR6A 5L2FA 5FQ9A 3CG5A 1BLCA 5AQ9A 2ZC6B 3E2LA 4MBHA 4ZJ2A 2DCFA 1H5XA 1K38A 3CZDA 3V50A 1XA1A 1ZC2A 2RL3A 2Y2NA 4GD6A 2ZLYA 3WS4A 1M6KA 3PAGA 1IYQA 3G34A 3LEZA 4U0XA 3PBQA 4KENB 1NXYA 5AQAA 3Q7VA 2Y4AA 3QNBA 4KZBA 1PIOA 3NBLA 4E3LA 2Y91A 1O07A 4WELA 4Y0UA 2WZXA 4ZTKA 3UPPA 3IWOA 3ISGA 5TR7A 3WS5A 2JCHA 2WGWA 2FFFB 5BOHA 4R3JA 3IF5A 4ZBEA 5M18A 1Z6FA 1H8ZA 2XGNA 3M6HA 3MXRA 4KZ8A 3ZG0A 3M6BA 1L0EA 4WMCA 1K6RA 4R4RA 1NJ4A 3PBOA 4UA7A 4DXBA 2H10A 3MKFA 4EBLA 4UAAA 4GDNA 1MWTA 4EBNA 1M40A 3BM6A 2BLSA 2XQZA 5F83A 1ONGA 5FAQA 4E3MA 4QY6A 1BUEA 1L0DA 4DKIA 2ZM0A 2GDNA 3UE3A 1TDGA 2X71A 1JTGA 2WGVA 4JF6A 3NDGA 4BD0A 2IWDA 2ZQ9A 2Y2JA 3V5MA 2QZ6A 4IVKA 3I7JA 4E3IA 4C75A 2IWCA 3IHAA 5EE8A 1MWSA 3HREA 5CHMA 5CGSA 4S2OA 2ZJ9A 3B3XA 3GTCA 2ZC4B 4LV1A 1I2SA 2EX6A 1KE0A 3IT9A 3NIAA 1U60A 3EQUA 4EQIA 5A91A 5J8XA 4KQRA 1CEFA 4OH0A 5A92A 4JXGA 1HD8A 3P09A 4FD8A 4MBKA 4OOMA 5I94A 3ZNTA 3VP3A 1IELA 3RXWA 3VP2A 3ZVTA 4CPKA 5HAIA 2ZMAA 3BFFA 3IF6B 5EVID 5A93A 1YLWA 5U47A 1ESIA 1SHVA 5E2GA 1SDNA 2H5SA 3FV7A 4JPMA 1MWRA 3V3RA 2EFXA 3OPLA 5GHXA 4K0XA 5DF9A 3GMWA 2HDRA 5CERA 2DNSA 4X55A 4MNRA 4EV4A 4DE3A 2WGIA 4YFMA 1IEMA 3IQAA 2C5WB 1RP5A 2EX2A 4E3KA 4WBGA 2EX9A 2ZD8A 1BT5A 3ITAA 3G32A 3Q81A 1GA0A 3IWQA 5GHZA 4KQOA 5HARA 4OKPA 1BZAA 5GLDA 2Y2QA 4Q8IA 4FCFA 5DF7A 2HP6A 3UPOA 4JKTA 3SH7A 3MXSA 2P9VB 1ZG6A 3HUOA 4L0LA 3ZVWA 1K57A 5CEDA 3IXGA 2HDSA 2ZQ7A 3OPPA 4Z9QA 1PZPA 1JVJA 1ZG4A 2ZC3B 1RGZA 3HLGA 4UA9A 5M1AA 1K4EA 1PWDA 2Q9NA 2H0YA 1E3UA 4A5RA 3WWXA 4ZJ3A 3A3DA 1LI0A 4MBFA 3HUMA 3Q07A 1LLBA 3OPRA 1FCOA 1C3BA 4HBUA 4PM5A 5CHJA 3IH9A 2HP5A 1XX2A 3ZHHA 3PBTA 3BLMA 1YMSA 1CK3A 1JTDA 1QMFA 1XPBA 5JYPA 2ZC7A 3SS5A 2WAFA 2CC1A 5CRFA 2FFYA 4OQIA 1K6SA 1XXMA 2Y2IA 4JXWA 1ES5A 3JYIA 3W8KA 2VGJA 2Y2OA 4KZ6A 3HL9A 3VFHA 3V3SA 3P98A 4QD4A 1XA7A 3C4PA 4B4XA 3C7UA 3S4XA 3BLSA 3GR2A 4R0QA 2G2UA 3N4IA 4IBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A3U A;  4U0T A;  2I72 A;  1TVF A;  5FQJ A;  3VOZ A;  1WE4 A;  3N8L A;  4E3J A;  4OPQ A;  3WRZ A;  3QHY A;  4NK3 A;  1K4F A;  4B88 A;  2XH9 A;  3UE1 A;  4RX3 A;  5HL1 A;  3LY4 A;  4P0M A;  4E3N A;  5EOO A;  1NZO A;  3OCL A;  1YQS A;  3SH9 A;  3TSG A;  3LY3 A;  1Y54 A;  1K56 D;  1XGI A;  4JBF A;  3NDE A;  4S2N A;  1IKG A;  1FSW A;  5FDH A;  3IHB A;  2XK1 A;  1K57 C;  5KZH A;  4U3T A;  2ZC5 B;  4PM9 A;  3Q82 A;  5FQQ A;  5EVI B;  1FCN A;  2Z2L B;  3M2J A;  3HLE A;  4KZ3 A;  5DTS A;  3HBR A;  5EOE A;  4P6B A;  4WYY A;  1XKZ A;  1YLZ A;  1PZO A;  3O88 A;  1ERO A;  4LCL A;  2IWB A;  4O7D A;  3IF6 A;  5EVL A;  3BFE A;  3IXB A;  3IXH A;  3NY4 A;  3N6I A;  3NCK A;  3SH8 A;  3A3I A;  2QMI A;  1MXO A;  2XFS A;  1YMX A;  5DTK A;  5GHY A;  4BD1 A;  5FSR A;  3ZG9 B;  3ZNY A;  2ZQD A;  4OPY A;  2EFU A;  4GN2 A;  2OLU A;  5CXW A;  4Y0T A;  3BEB A;  3SOI A;  5HAQ A;  3O87 A;  4BL3 A;  2R9W A;  3O86 A;  3ITB A;  3AGE A;  1PW8 A;  4JXS A;  2HDQ A;  3HLW A;  4GOG A;  2Q9M A;  3VP1 A;  3BFG A;  1ES4 A;  3HLC A;  5GL9 A;  1LL9 A;  4DXC A;  1MKI A;  1ES3 A;  4OLG A;  4XUX A;  4DRT A;  5FQM A;  4C6Y A;  3UNW A;  5CGX A;  3GV9 A;  1IYS A;  4X53 A;  2Y2G A;  4R23 A;  2Y59 A;  3G4P A;  4GZB A;  2P9V A;  2WYX A;  2Y2P A;  3TG9 A;  3VFF A;  1XGJ A;  2V20 A;  4GDB A;  1OME A;  3G30 A;  1MPL A;  4EBP A;  5HAP A;  2BG1 A;  3UN7 A;  1E4D A;  2XEP A;  4N9K A;  4X56 A;  5G18 A;  1J9M A;  3MZE A;  4LV2 A;  5A90 A;  2Y2L A;  4PM7 A;  5KSH A;  2EXB A;  3C7V A;  3MZF A;  2ZM2 A;  3LCE A;  4KZ4 A;  5CTN A;  5IHV A;  4S2N C;  3W4O A;  4PPR A;  2V2F F;  1FSY A;  1K55 A;  4OP8 A;  1PYY A;  3HLF A;  2OV5 A;  1I2W A;  4OQ0 A;  4ZAM A;  5JYO A;  3O3V A;  3DWZ A;  2JC7 A;  4KG5 A;  3S1Y A;  4N92 A;  2Y2K A;  4QJG A;  1ONH A;  1Q2P A;  3OZH A;  4N1H A;  2XD1 A;  2J8Y A;  4PM6 A;  4F94 A;  1S0W A;  4FSF A;  5E2E A;  1GHM A;  2OLV A;  1W8Y A;  1WYC A;  1YT4 A;  5FAO A;  4KZ5 A;  4Y7P A;  3BRM A;  3SS3 A;  1SCW A;  5DVA A;  4H8R A;  3NI9 A;  3DTM A;  1YLP A;  4KZ7 A;  3VOY A;  2XF3 A;  4WMC D;  3IF6 C;  4OPR A;  1ESU A;  1W5D A;  4IBR A;  1G6A A;  3GSG A;  3HVF A;  1ZKJ A;  1BSG A;  4OQH A;  3N8R A;  2V1Z A;  1ERM A;  1XP4 A;  4IVI A;  1BLP A;  4UHU A;  3IH8 A;  1PWC A;  1LHY A;  2UWX A;  4PM8 A;  4XXR A;  3PAE A;  2A49 A;  4RX2 A;  1JWV A;  5DTT A;  2VGK A;  3UDF A;  1KDW A;  4N9L A;  5CEB A;  1Q2Q A;  1YLJ A;  4LCM A;  3HLD A;  4R4S A;  3PBR A;  3UDX A;  2R9X A;  4LV3 A;  3W4Q A;  3IXD A;  1QME A;  4WZ5 A;  1ES2 A;  4P87 A;  3WS0 A;  1PI4 A;  2HDU A;  2XD5 A;  3CMZ A;  4R1G A;  4WM9 A;  5F1G A;  4BQM A;  5FAS A;  1GHP A;  2H0T A;  4MLL A;  4S2K A;  4S2I A;  5FI7 A;  3G2Y A;  1NY0 A;  4JF4 A;  4FH2 A;  1WYB A;  5KMW A;  1IYO A;  5F1F A;  1BTL A;  1NYM A;  3Q1F A;  3G2Z A;  1SDE A;  3C5A A;  4GNU A;  5EVI A;  4K91 A;  3WS1 A;  4HEF A;  4WEJ A;  3W4P A;  3PBN A;  1NZU A;  1PWG A;  3D4F A;  3HLB A;  3UO9 A;  4E6W A;  4EWF A;  1W7F A;  2X02 A;  3VSK A;  5F82 A;  3TOI A;  4JF5 A;  5HFO A;  3HUN A;  3UE0 A;  4CJN A;  1H8Y A;  3BFD A;  4EUZ A;  3EQV A;  4OON A;  1JWZ A;  1TDL A;  4S2J A;  5AQ7 A;  4DE1 A;  1L0G A;  3AGF A;  1HTZ A;  1CI9 A;  1MWU A;  3CJM A;  2ZM8 A;  2WKI A;  5TGF A;  5FA7 A;  2C6W B;  3N8S A;  1L0F A;  1YLY A;  2ZQC A;  3N7W A;  4GKU A;  1TEM A;  4OVD A;  3ZGA B;  4X69 A;  4S2L A;  2WK0 A;  3ZDJ A;  4BEN A;  2JE5 A;  4N1X A;  4S2P A;  2WUQ A;  2WAE A;  3G35 A;  4OLD A;  4QY5 A;  1K25 A;  1MY8 A;  3E2K A;  3PBS A;  3MFD A;  1HVB A;  2QPN A;  1E3U D;  1FQG A;  1LI9 A;  3WS2 A;  4OPZ A;  2Y2H A;  3OC2 A;  2J9P A;  2XFT A;  2HPB A;  1G68 A;  1N9B A;  1PW1 A;  4GD8 A;  1ALQ A;  3LO7 A;  3MZD A;  1ERQ A;  3UDI A;  3A3E A;  4JXV A;  4RYE A;  2Z2M B;  5FI2 A;  1NYY A;  3GRJ A;  4OOY A;  1HZO A;  5EUA A;  5EPH A;  1FCM A;  1GHI A;  3Q7V B;  1BLS A;  4WZ5 C;  4KZA A;  1I5Q A;  3FWL A;  1DJC A;  4MEZ A;  4QU3 A;  1K54 A;  1BLH A;  5FQK A;  2WGW B;  2B5R A;  2ZQ8 A;  3VP4 A;  4DE2 A;  2G2W A;  3ZCZ A;  5EEC A;  3VP0 A;  4ZJ1 A;  5TFQ A;  1VQQ A;  2X01 A;  1CI8 A;  3SS4 A;  5EVI C;  1YLT A;  1O7E A;  4X68 A;  4BL2 A;  2EX8 A;  4DDS A;  5FAP A;  4KG6 A;  2OSU A;  1KGE A;  1E25 A;  4PMA A;  4E3O A;  4KZ9 A;  3C4O A;  5CEC A;  4YIN A;  3A3J A;  4BLM A;  4X6T A;  4E6X A;  1KGF A;  1KGG A;  1IYP A;  1W8Q A;  2JBF A;  2PU4 A;  3G31 A;  3ZG8 B;  5D3O A;  3FZC A;  1MBL A;  2WZZ A;  4C3Q A;  5CHU A;  4D2O A;  4P85 A;  1W79 A;  5CGW A;  4DF6 A;  3OPH A;  4HES A;  3UPN A;  3UY6 A;  4FH4 A;  3WRT A;  1KVL A;  4GB7 A;  4OP5 A;  1EWZ A;  1RGY A;  4RVA A;  2WKE A;  1S6R A;  1K56 A;  4B4Z A;  5HX9 A;  3FYZ A;  1CEG A;  5GLB A;  2PU2 A;  4K0W A;  3FKV A;  3M2K A;  3DWK A;  1YM1 A;  3QNC A;  5E2F A;  4KQQ A;  5CTM A;  5DF8 A;  3RJU A;  4QB8 A;  5HW3 A;  3V39 A;  3GQZ A;  2J9O A;  3A3F A;  2XLN A;  5E43 A;  1LL5 A;  5GLA A;  1KDS A;  1L2S A;  4ID4 A;  3ZG7 B;  3NC8 A;  4DE0 A;  4Y0O A;  2HP9 A;  1GA9 A;  3AGD A;  1NRF A;  1DJB A;  1N4O A;  1GCE A;  1EI5 A;  3VSL A;  1PI5 A;  2WKH A;  1FOF A;  4JLF A;  2RCX A;  3IWI A;  4S2M A;  1BUL A;  2XR0 A;  2P74 A;  4LV0 A;  5E2H A;  5AQB A;  5M19 A;  4QHC A;  3BEC A;  1K54 C;  3MKE A;  4R3B A;  4LEN A;  1KE3 A;  4XUZ A;  2E8I A;  4OOL A;  3BFC A;  3ZG5 A;  1DJA A;  2J7V A;  3OCN A;  3S22 A;  3MBZ A;  4WEK A;  1FR1 A;  2Y2M A;  1SKF A;  2DRW A;  2PBY A;  3Q7Z A;  2EXA A;  5FQI A;  1VM1 A;  2Y55 A;  5KSC A;  3VMA A;  1IKI A;  2ZQA A;  3BYD A;  4UA6 A;  5FI6 A;  4DDY A;  4NET A;  4HBT A;  4ZDX A;  3RXX A;  1KVM A;  1JWP A;  3DW0 A;  4OQG A;  3GVB A;  3FKW A;  4RA7 A;  4WZ4 A;  3ZFZ A;  4BJP A;  4M3K A;  4KG2 A;  1RCJ A;  4IED A;  1KE4 A;  3PTE A;  5GLC A;  2XDM A;  1DY6 A;  1K55 C;  1AXB A;  2WAD A;  5FAT A;  1FR6 A;  5L2F A;  5FQ9 A;  3CG5 A;  1BLC A;  5AQ9 A;  2ZC6 B;  3E2L A;  4MBH A;  4ZJ2 A;  2DCF A;  1H5X A;  1K38 A;  3CZD A;  3V50 A;  1XA1 A;  1ZC2 A;  2RL3 A;  2Y2N A;  4GD6 A;  2ZLY A;  3WS4 A;  1M6K A;  3PAG A;  1IYQ A;  3G34 A;  3LEZ A;  4U0X A;  3PBQ A;  4KEN B;  1NXY A;  5AQA A;  3Q7V A;  2Y4A A;  3QNB A;  4KZB A;  1PIO A;  3NBL A;  4E3L A;  2Y91 A;  1O07 A;  4WEL A;  4Y0U A;  2WZX A;  4ZTK A;  3UPP A;  3IWO A;  3ISG A;  5TR7 A;  3WS5 A;  2JCH A;  2WGW A;  2FFF B;  5BOH A;  4R3J A;  3IF5 A;  4ZBE A;  5M18 A;  1Z6F A;  1H8Z A;  2XGN A;  3M6H A;  3MXR A;  4KZ8 A;  3ZG0 A;  3M6B A;  1L0E A;  4WMC A;  1K6R A;  4R4R A;  1NJ4 A;  3PBO A;  4UA7 A;  4DXB A;  2H10 A;  3MKF A;  4EBL A;  4UAA A;  4GDN A;  1MWT A;  4EBN A;  1M40 A;  3BM6 A;  2BLS A;  2XQZ A;  5F83 A;  1ONG A;  5FAQ A;  4E3M A;  4QY6 A;  1BUE A;  1L0D A;  4DKI A;  2ZM0 A;  2GDN A;  3UE3 A;  1TDG A;  2X71 A;  1JTG A;  2WGV A;  4JF6 A;  3NDG A;  4BD0 A;  2IWD A;  2ZQ9 A;  2Y2J A;  3V5M A;  2QZ6 A;  4IVK A;  3I7J A;  4E3I A;  4C75 A;  2IWC A;  3IHA A;  5EE8 A;  1MWS A;  3HRE A;  5CHM A;  5CGS A;  4S2O A;  2ZJ9 A;  3B3X A;  3GTC A;  2ZC4 B;  4LV1 A;  1I2S A;  2EX6 A;  1KE0 A;  3IT9 A;  3NIA A;  1U60 A;  3EQU A;  4EQI A;  5A91 A;  5J8X A;  4KQR A;  1CEF A;  4OH0 A;  5A92 A;  4JXG A;  1HD8 A;  3P09 A;  4FD8 A;  4MBK A;  4OOM A;  5I94 A;  3ZNT A;  3VP3 A;  1IEL A;  3RXW A;  3VP2 A;  3ZVT A;  4CPK A;  5HAI A;  2ZMA A;  3BFF A;  3IF6 B;  5EVI D;  5A93 A;  1YLW A;  5U47 A;  1ESI A;  1SHV A;  5E2G A;  1SDN A;  2H5S A;  3FV7 A;  4JPM A;  1MWR A;  3V3R A;  2EFX A;  3OPL A;  5GHX A;  4K0X A;  5DF9 A;  3GMW A;  2HDR A;  5CER A;  2DNS A;  4X55 A;  4MNR A;  4EV4 A;  4DE3 A;  2WGI A;  4YFM A;  1IEM A;  3IQA A;  2C5W B;  1RP5 A;  2EX2 A;  4E3K A;  4WBG A;  2EX9 A;  2ZD8 A;  1BT5 A;  3ITA A;  3G32 A;  3Q81 A;  1GA0 A;  3IWQ A;  5GHZ A;  4KQO A;  5HAR A;  4OKP A;  1BZA A;  5GLD A;  2Y2Q A;  4Q8I A;  4FCF A;  5DF7 A;  2HP6 A;  3UPO A;  4JKT A;  3SH7 A;  3MXS A;  2P9V B;  1ZG6 A;  3HUO A;  4L0L A;  3ZVW A;  1K57 A;  5CED A;  3IXG A;  2HDS A;  2ZQ7 A;  3OPP A;  4Z9Q A;  1PZP A;  1JVJ A;  1ZG4 A;  2ZC3 B;  1RGZ A;  3HLG A;  4UA9 A;  5M1A A;  1K4E A;  1PWD A;  2Q9N A;  2H0Y A;  1E3U A;  4A5R A;  3WWX A;  4ZJ3 A;  3A3D A;  1LI0 A;  4MBF A;  3HUM A;  3Q07 A;  1LLB A;  3OPR A;  1FCO A;  1C3B A;  4HBU A;  4PM5 A;  5CHJ A;  3IH9 A;  2HP5 A;  1XX2 A;  3ZHH A;  3PBT A;  3BLM A;  1YMS A;  1CK3 A;  1JTD A;  1QMF A;  1XPB A;  5JYP A;  2ZC7 A;  3SS5 A;  2WAF A;  2CC1 A;  5CRF A;  2FFY A;  4OQI A;  1K6S A;  1XXM A;  2Y2I A;  4JXW A;  1ES5 A;  3JYI A;  3W8K A;  2VGJ A;  2Y2O A;  4KZ6 A;  3HL9 A;  3VFH A;  3V3S A;  3P98 A;  4QD4 A;  1XA7 A;  3C4P A;  4B4X A;  3C7U A;  3S4X A;  3BLS A;  3GR2 A;  4R0Q A;  2G2U A;  3N4I A;  4IBX A; 
#chains in the Genus database with same CATH topology
 2I72 A;  1A0K A;  3ZYT A;  4E3J A;  4BBT A;  3QHY A;  4NK3 A;  1TS8 A;  5AVF A;  2XH9 A;  1G6O A;  3LY4 A;  4E3N A;  4WUJ A;  1K56 D;  1XGI A;  3NDE A;  1FSW A;  3TJZ C;  4YWZ A;  5KZH A;  1K57 C;  4PM9 A;  1OTB A;  3IX4 A;  2QJ7 A;  3BY8 A;  5EVI B;  4KZ3 A;  5DTS A;  1XKZ A;  1H0M A;  5EVL A;  3IXH A;  3N6I A;  2QMI A;  5GHY A;  4ESP A;  5FSR A;  4OPY A;  1OJG A;  3BEB A;  2LB5 A;  2R9W A;  3O86 A;  3HLW A;  3VP1 A;  4DXC A;  1UWN X;  1SKO A;  4O0P A;  5DKL A;  5CGX A;  3UNW A;  1IYS A;  4R23 A;  3G4P A;  5TBM A;  2WYX A;  2Y2P A;  3GEC A;  4RQ9 A;  2V20 A;  3LYX A;  1MPL A;  4N9K A;  5G18 A;  5A90 A;  1J9M A;  1T19 A;  2IA2 A;  1FIL A;  4KZ4 A;  5CTN A;  4S2N C;  3MQQ A;  1SKO B;  1FSY A;  3LR0 A;  3HLF A;  2W3F A;  4ZAM A;  4KG5 A;  3S1Y A;  4N92 A;  4QJG A;  1Q2P A;  3OZH A;  4PM6 A;  2XD1 A;  4F94 A;  1YT4 A;  1TS0 A;  1KOU A;  3BRM A;  4KZ7 A;  3NI9 A;  3BQA A;  3PYP A;  4IBR A;  5HZH A;  1W63 M;  3MJQ A;  4UHU A;  5I5L A;  4PM8 A;  2VGK A;  4LCM A;  3HLD A;  4R4S A;  2R9X A;  3W4Q A;  1QME A;  1BYW A;  4P87 A;  2JKR M;  5FAS A;  1GHP A;  2H0T A;  4DJ2 A;  4FH2 A;  1WYB A;  5J3W A;  1OT9 A;  3C5A A;  4HEF A;  3W4P A;  3HCY A;  4G3V A;  4Y5F A;  1LSV A;  1W7F A;  2KDK A;  2X02 A;  5F82 A;  4EQ1 A;  3NOU C;  5HFO A;  3HUN A;  3T4L A;  4M4X A;  4CJN A;  4EUZ A;  4OON A;  1JWZ A;  4S2J A;  2W1T A;  1CI9 A;  1MWU A;  3E4Q A;  3KYZ A;  2ZM8 A;  4D60 A;  4Z1W A;  2BTF P;  3N7W A;  3A0V A;  3OOV A;  3ZDJ A;  4N1X A;  3E2K A;  1YKD A;  3PBS A;  5HDD A;  3MFD A;  1E3U D;  1MZU A;  1FQG A;  2W1T B;  4OPZ A;  4MDZ A;  4ETX A;  2Y2H A;  1N9B A;  4G3W A;  5FI2 A;  1HZO A;  5EPH A;  1FCM A;  3Q7V B;  4KZA A;  1OTI A;  4MEZ A;  4QU3 A;  4HHD A;  3VP4 A;  4YNR A;  3UE6 A;  5J4E A;  5TFQ A;  2X01 A;  1CI8 A;  2MJ6 A;  2P08 A;  4KG6 A;  4E3O A;  3B47 A;  3C4O A;  2ZL1 B;  4X6T A;  1W8Q A;  1IYP A;  2JBF A;  5D3O A;  3PR6 A;  5CHU A;  4D2O A;  1W79 A;  3OPH A;  4OP5 A;  2R78 A;  1K56 A;  3C38 A;  3FYZ A;  1CEG A;  3QNC A;  2E8J A;  1S4S A;  5HW3 A;  3V39 A;  2J9O A;  3BQ8 A;  5GLA A;  3ZG7 B;  1GA9 A;  3E4O A;  1XJ3 A;  1DJB A;  1VB6 A;  1N4O A;  2V1B A;  1GCE A;  3VSL A;  1PI5 A;  1FOF A;  2GJ3 A;  3T1X A;  2E8I A;  3BFC A;  3RFB A;  4ARZ A;  2J7V A;  1FR1 A;  2Y2M A;  5FQI A;  2Y55 A;  1IKI A;  3UB5 P;  5FI6 A;  1JWP A;  3FKW A;  2VV6 A;  5GLC A;  2XDM A;  3TW8 A;  5FAT A;  4ARZ B;  4JGQ A;  1BLC A;  5AQ9 A;  4EUV A;  1F5M A;  4GS9 A;  1H5X A;  1F9I A;  5DFX A;  3E4P A;  3PBQ A;  5AQA A;  2PR6 A;  2Y4A A;  4KZB A;  5A8B A;  4O8G A;  4WEL A;  1O07 A;  4Y0U A;  4ZTK A;  1D06 A;  3MR0 A;  5TR7 A;  3IF5 A;  1Z6F A;  1H8Z A;  2XGN A;  3M6H A;  3MXR A;  4KZ8 A;  3M6B A;  1L0E A;  1NJ4 A;  2GNX A;  5HD3 A;  1WA9 A;  2M7V A;  1CF0 A;  4PKY A;  1NLZ A;  4EBL A;  4UAA A;  4GDN A;  1MWT A;  1M40 A;  3SZT A;  3V67 A;  2BLS A;  2XQZ A;  4Y3I A;  1BUE A;  5F68 A;  4I3I A;  3BJN A;  4NEE D;  1TDG A;  2X71 A;  1JTG A;  2WGV A;  3NDG A;  3V5M A;  2JKT M;  4IVK A;  2IWC A;  3IHA A;  5CGS A;  4S2O A;  3GTC A;  4LV1 A;  1I2S A;  3CIT A;  2EX6 A;  3NIA A;  3EQU A;  3P09 A;  4FD8 A;  4MBK A;  5HAI A;  1GSW A;  5A93 A;  5EVI D;  1SDN A;  2EFX A;  4K0X A;  3EEH A;  1S66 L;  3GMW A;  2HDR A;  3T1Q B;  2WGI A;  2FZ0 A;  3NEC A;  1RP5 A;  2EX2 A;  2J3T C;  4E3K A;  1D1J A;  2ZD8 A;  3Q81 A;  3S7P A;  5GLD A;  2Y2Q A;  4Q8I A;  3UPO A;  4JKT A;  3K3D A;  1ZG6 A;  4L0L A;  1F2K A;  1ZG4 A;  1RGZ A;  3KYE A;  2H0Y A;  4EU0 A;  1E3U A;  5HDS A;  3F1P A;  3WWX A;  2M1C A;  1FCO A;  3EWK A;  1XJ2 A;  4HBU A;  2HP5 A;  3ZHH A;  3PBT A;  2HGV A;  2V8C A;  1XPB A;  2ZC7 A;  3SS5 A;  4I3J A;  3IBR A;  2D01 A;  2ZOI A;  3EGD C;  2Y2I A;  3F1P B;  4Y2F A;  3K2N A;  2I9V A;  3N4I A;  2A3U A;  4U0T A;  2ACG A;  2PYR A;  4Q0J A;  3VOZ A;  1WE4 A;  1TF1 A;  1P9W A;  4MN5 A;  3H7W A;  1K4F A;  4NXG A;  4XT2 B;  1NZO A;  3TSG A;  2QHK A;  2QJ5 A;  4JBF A;  2OWJ A;  2XK1 A;  2QWS A;  2O9A A;  3MXQ A;  5EVE A;  2HF6 A;  4CLC D;  1W63 Q;  4LCL A;  4O7D A;  3IF6 A;  3UB6 A;  3BFE A;  3NCK A;  3SH8 A;  2B18 A;  3A3I A;  1YMX A;  4GLQ A;  2EFU A;  4L9E A;  1OT6 A;  4Y0T A;  4DMZ A;  5IS1 A;  2XRO A;  3AGE A;  1PW8 A;  2PR5 A;  3BFG A;  2L1M A;  3HLC A;  2PT7 A;  4IUK A;  4EXO A;  4OLG A;  4DRT A;  3JVV A;  3JVU A;  3GV9 A;  2PDR A;  4GZB A;  3VFF A;  4Y17 A;  4GDB A;  1STZ A;  3G30 A;  5HAP A;  4EBP A;  3TE8 A;  1E4D A;  4PM7 A;  2EXB A;  3C7V A;  2ZM2 A;  3LCE A;  1IOU A;  4PPR A;  1PYY A;  2OV5 A;  3F1O A;  2JC7 A;  5L07 A;  4FSF A;  1YSP A;  2OLV A;  1W8Y A;  1WYC A;  4LPZ A;  4Y7P A;  1S1Z A;  5DVA A;  4H8R A;  2XF3 A;  3CAX A;  4OPR A;  4HI4 A;  1G6A A;  1BSG A;  3LIB A;  1DP9 A;  4OQH A;  2JKR I;  3F1O B;  4KUK A;  4IVI A;  1BLP A;  3IH8 A;  1PWC A;  3EOI A;  1ZHH B;  2UWX A;  4XXR A;  4RX2 A;  1LSW A;  3UDF A;  4BWI A;  4NXE A;  1KDW A;  3S7N A;  4N9L A;  3D9Y A;  2PAV P;  3IXD A;  3MQ0 A;  4WZ5 A;  1ES2 A;  4EES A;  3WS0 A;  2XD5 A;  3LR5 A;  4S2K A;  2VGL M;  2Z6D A;  5F1F A;  1NYM A;  3QP2 A;  3G2Z A;  4GNU A;  5EVI A;  4K91 A;  1PWG A;  3ICY A;  3T1S A;  3QP8 A;  3LI9 A;  5EM0 A;  4HJ6 A;  2VKS A;  1TDL A;  2EWV A;  1L0G A;  1HTZ A;  3CJM A;  2WKI A;  5TGF A;  3T50 A;  3N8S A;  2ZQC A;  4PKY G;  3ZGA B;  4X69 A;  4S2L A;  2WK0 A;  4BEN A;  3BWL A;  4QY5 A;  5HPI A;  1HVB A;  3L7H A;  1EW0 A;  2A24 A;  2J9P A;  4GD8 A;  3LO7 A;  1ERQ A;  4L9F A;  1GHI A;  3PXP A;  5FQK A;  2WGW B;  2B5R A;  4DE2 A;  2G2W A;  2P04 A;  3P01 A;  2J80 A;  4ZJ1 A;  3LR3 A;  4HJ4 A;  3SS4 A;  2A24 B;  3PHY A;  4Q0H A;  4X68 A;  4X25 A;  2EWW A;  1KGE A;  1E25 A;  4JGR A;  4PMA A;  4EET B;  4YIN A;  3A3J A;  4WLA A;  1KGF A;  1KGG A;  2VV7 A;  4C3Q A;  1VEU B;  4H6J B;  5FEF A;  4HES A;  2JKF A;  4FH4 A;  5F5Y A;  3D72 A;  1S6R A;  4JGO A;  5HX9 A;  2PU2 A;  4K0W A;  3M2K A;  1YM1 A;  3T4J A;  5CTM A;  1V9Z A;  4QB8 A;  1S4R A;  1H3Q A;  2H28 A;  1L2S A;  4DE0 A;  4Y0O A;  4CLC A;  3QP1 A;  2W1R A;  2OAP 1;  1EI5 A;  2RCX A;  1PFL A;  3IWI A;  4S2M A;  2VA0 A;  2XR0 A;  2YKF A;  1YSQ A;  5F6A A;  1K54 C;  3LUQ A;  3ZG5 A;  4WEK A;  3B33 A;  1N9L A;  3Q7Z A;  2EXA A;  4CLC B;  5KSC A;  3BYD A;  4UA6 A;  3CUE C;  1DP6 A;  1KVM A;  3DW0 A;  3GVB A;  3ZFZ A;  3PTE A;  2WAD A;  1FR6 A;  5FQ9 A;  3HJK A;  3O5Y A;  4MMN A;  3E2L A;  2DCF A;  4NKP A;  2J3W A;  3CZD A;  1ZC2 A;  1ZTU A;  4GD6 A;  3WS4 A;  3G34 A;  5IU1 A;  4U0X A;  4KEN B;  4EW7 A;  3Q7V A;  4BBV A;  3UPP A;  3IBJ A;  3IWO A;  5EFW A;  2JKT I;  4HH3 A;  1MKM A;  1K6R A;  4R4R A;  4UA7 A;  4LLO B;  4HIA A;  2PD8 A;  5L8M A;  2Z6C A;  5FAQ A;  1ONG A;  3OBF A;  4QY6 A;  1P97 A;  3UE3 A;  4HP9 A;  4BD0 A;  2ZL1 A;  3MMH A;  3I7J A;  4E3I A;  3DTE A;  5CHM A;  3B3X A;  3T12 B;  4F3L B;  3LEQ A;  1KE0 A;  3IT9 A;  5A91 A;  5J8X A;  3S7Q A;  1NRJ A;  4OH0 A;  5I94 A;  1G5U A;  4II7 A;  5EV0 A;  3IX3 A;  3LR4 A;  1IEL A;  3ZVT A;  2ZMA A;  1SHV A;  5E2G A;  4UQI S;  5DF9 A;  5CER A;  1L3L A;  4QPR A;  4EV4 A;  1CJF A;  3KSF A;  1VET A;  4ME4 A;  4WBG A;  3ITA A;  3G32 A;  2XRN A;  3IWQ A;  4KQO A;  1LL8 A;  1YAX A;  4P6Z S;  3MXS A;  2P9V B;  3HUO A;  1K57 A;  3OPP A;  4Z9Q A;  1PZP A;  2ZC3 B;  5M1A A;  3CPT B;  1PWD A;  2Q9N A;  1VET B;  3A3D A;  3H9W A;  5LBR A;  1LLB A;  3DTK A;  1XFQ A;  1NWZ A;  4PM5 A;  5CHJ A;  3IH9 A;  1XX2 A;  3BLM A;  1CK3 A;  1JTD A;  5JYP A;  5FL3 A;  5CRF A;  2CC1 A;  2FFY A;  1T1A A;  4R3A A;  1T1C A;  4DJ3 A;  4PAU A;  2GX5 A;  4KZ6 A;  3IS2 A;  3VFH A;  1FIK A;  3P98 A;  4IHQ A;  1XA7 A;  3C4P A;  4B4X A;  1OPX A;  4R0Q A;  2V1A A;  4IBX A;  3U2A A;  1TVF A;  2O9B A;  5FQJ A;  2K31 A;  3N8L A;  3NJA A;  4OPQ A;  4B88 A;  5HL1 A;  4P0M A;  5EOO A;  3SH9 A;  3IS2 B;  1YQS A;  3HJI A;  1Y54 A;  4S2N A;  5K5B A;  1IKG A;  3KSI A;  5FDH A;  2HZ5 A;  4HH2 A;  2ZC5 B;  2XA7 S;  2W27 A;  3Q82 A;  3DTI A;  5FQQ A;  3E98 A;  3HLE A;  3HBR A;  5EOE A;  4P6B A;  4WYY A;  1PZO A;  1ERO A;  3ZQ5 A;  3NY4 A;  4QWO A;  1MXO A;  2XFS A;  2HJE A;  3ZNY A;  4YOF A;  4GN2 A;  2OLU A;  5CXW A;  3O87 A;  2BAS A;  4BL3 A;  3ITB A;  1OTA A;  2HDQ A;  5AJG A;  4GOG A;  3ULF A;  4HNB A;  1LL9 A;  2O0Y A;  4XUX A;  4HY8 A;  4X53 A;  4GHI A;  2Y59 A;  2Q0O A;  1XGJ A;  1OME A;  4FUW A;  4Y13 A;  3FPW A;  3UN7 A;  4X56 A;  4LV2 A;  2Y2L A;  5KSH A;  3MZF A;  5HDC A;  5IHV A;  3W4O A;  4OP8 A;  2VK3 A;  1I2W A;  3O3V A;  4GHI B;  2Y2K A;  1ONH A;  2J8Y A;  2J3T D;  5E2E A;  5G4Z A;  1GHM A;  4BMW A;  4GJ4 A;  5FAO A;  4KZ5 A;  5TJJ A;  3SS3 A;  3DTM A;  1YLP A;  3VOY A;  2W3H A;  4WMC D;  4WF0 A;  1ESU A;  1W5D A;  4GW9 A;  2YKH A;  3BY9 A;  3GSG A;  3HVF A;  1ZKJ A;  4L9G A;  3N8R A;  4MCW A;  4K08 A;  4CQH A;  2A49 A;  1P0Z A;  5FEG A;  1Q2Q A;  1YLJ A;  2WKP A;  3PBR A;  4XT2 A;  4G3K A;  1S67 L;  4LV3 A;  4MN6 A;  1PI4 A;  4R1G A;  5HL6 A;  3CLO A;  4WM9 A;  2OAQ 1;  4BQM A;  4MLL A;  2V0W A;  3H82 A;  3T4O A;  5FI7 A;  4JF4 A;  1NY0 A;  2ZMV A;  5KMW A;  1PNE A;  1IYO A;  3Q1F A;  1SDE A;  3WS1 A;  1G28 A;  2Y79 A;  4DN0 A;  4WEJ A;  3D4F A;  3HLB A;  3UO9 A;  4E6W A;  4EWF A;  4WN5 A;  3VSK A;  1LT0 A;  3TOI A;  4FOF A;  1H8Y A;  3EQV A;  2PHY A;  3H82 B;  3AGF A;  4BBU A;  5HD5 A;  3LI8 A;  4ETZ A;  5FA7 A;  1XJ4 A;  2V0U A;  3KSH A;  5L10 A;  1L0F A;  1TEM A;  4OVD A;  3LIE A;  2NUP C;  4S2P A;  2WUQ A;  3G35 A;  3WS2 A;  3OC2 A;  2HPB A;  1G68 A;  1H8M A;  1PW1 A;  1ALQ A;  3MZD A;  3UDI A;  3A3E A;  4JXV A;  2Z2M B;  3GRJ A;  4OOY A;  5EUA A;  3FWL A;  1DJC A;  2JHE A;  5HSQ A;  1BLH A;  2PRF A;  3ZCZ A;  2V8F A;  1O7E A;  4BL2 A;  3MF0 A;  2KLI A;  4HP4 A;  2LB9 A;  4KZ9 A;  5J7E A;  5CEC A;  2WKR A;  2OOL A;  2VZW A;  3G31 A;  2PU4 A;  3FZC A;  2WZZ A;  3G6O A;  4P85 A;  5CGW A;  1KVL A;  2VV8 A;  1EWZ A;  2Y8H A;  3DWK A;  3GDI A;  4KQQ A;  5DF8 A;  3RJU A;  1LL5 A;  1KDS A;  4ID4 A;  2DMW A;  3AGD A;  5IT5 A;  2WKH A;  4Y15 A;  4NG2 A;  3A0S A;  2P74 A;  3T1R A;  2NUT C;  3BEC A;  4R3B A;  3MKE A;  4XUZ A;  4LEN A;  1KE3 A;  4OOL A;  2ZMF A;  2M7U A;  3LIA A;  3FPV A;  3S22 A;  3MBZ A;  2DRW A;  2PBD P;  3VMA A;  2ZQA A;  3F1N B;  3UB9 A;  4NET A;  4ZDX A;  3RXX A;  4RA7 A;  4WZ4 A;  3L9K A;  4BJP A;  4M3K A;  4KG2 A;  4IED A;  1KE4 A;  3DAV A;  1K55 C;  5L2F A;  3CG5 A;  3D3O A;  4MN7 A;  3UB8 A;  4ZJ2 A;  2ZC6 B;  4I38 A;  3R7W B;  1K38 A;  1Y4O A;  1XA1 A;  1M6K A;  3PAG A;  3LEZ A;  4I3A A;  1PIO A;  3NBL A;  4ZRR A;  2FH5 A;  3ISG A;  2WGW A;  2FFF B;  5M18 A;  1MC0 A;  3T4K A;  3ZG0 A;  4WMC A;  3PBO A;  3MQO A;  4DXB A;  3RH8 B;  4NXB A;  4HOI A;  4O01 A;  4DKI A;  1L0D A;  4I5S A;  2ZM0 A;  3VE3 A;  2QZ6 A;  3T4T A;  2O99 A;  1DRM A;  1VEU A;  2HJ9 C;  4Q0I A;  4H6J A;  2KOI A;  4X1M A;  2ZJ9 A;  2ZC4 B;  2W3E A;  1TS6 A;  1U60 A;  4EQI A;  2VEA A;  3IX8 A;  5A92 A;  4JXG A;  1HD8 A;  3VP3 A;  3RXW A;  1OTD A;  5HWV A;  1YLW A;  2CMN A;  4JPM A;  3V3R A;  3OPL A;  2V9A A;  1ACF A;  3OLO A;  2AVX A;  2W0N A;  4LFU A;  4DE3 A;  4YFM A;  3KX0 X;  1UWP X;  2C5W B;  2EX9 A;  1GA0 A;  3JPU A;  5HAR A;  1BZA A;  4FCF A;  5DF7 A;  2HP6 A;  5TBM B;  3VE4 A;  3NOP C;  3ZVW A;  2ZQ7 A;  4E04 A;  1JVJ A;  1XFN A;  4A5R A;  2G7U A;  4MBF A;  3HUM A;  3Q07 A;  3OPR A;  4EER A;  1C3B A;  5DKK A;  2WAF A;  1XJ6 A;  4CLC E;  4OQI A;  1ES5 A;  2QYB A;  3JYI A;  2Y2O A;  2EA9 A;  2W3G A;  2B02 A;  4X1L A;  3QP4 A;  3V3S A;  5L09 A;  4QD4 A;  3W2Z A;  1JNU A;  3BLS A;  2HV1 A;  1T1B A;  3UMD A;  3WRZ A;  3UE1 A;  4RX3 A;  3OCL A;  3LY3 A;  4LGW A;  1T18 A;  3IHB A;  4U3T A;  3C2W A;  4F3L A;  2JKG A;  1FCN A;  2Z2L B;  2OWH A;  3M2J A;  5HWT A;  3U4L P;  1YLZ A;  3FC7 A;  3O88 A;  3UME A;  3E0Y A;  2IWB A;  3IXB A;  4NXF A;  1LSX A;  5KIZ A;  5F69 A;  1V9Y A;  5DTK A;  4BD1 A;  3ZG9 B;  2XSS A;  2ZQD A;  3SOI A;  4EEP A;  5HAQ A;  3DBA A;  2W3D A;  2K2N A;  4JXS A;  3C30 A;  2Q9M A;  1IFQ A;  1ES4 A;  5GL9 A;  1MKI A;  2ZOH A;  3EEA A;  1ES3 A;  1GSX A;  5FQM A;  4C6Y A;  2Y2G A;  2P9V A;  3TG9 A;  3CPT A;  2BG1 A;  4R38 A;  3T4Q A;  2XEP A;  1VHM A;  3MZE A;  4R70 A;  2V2F F;  1K55 A;  3B42 A;  4OQ0 A;  4IJG A;  5JYO A;  3DWZ A;  4N1H A;  1S0W A;  1YPR A;  5HPF A;  1SCW A;  4KUO A;  2P7J A;  2KX6 A;  3IF6 C;  3QP6 A;  3BW6 A;  5HWW A;  2V1Z A;  1ERM A;  1XP4 A;  1PRQ A;  4IUH A;  1LHY A;  3PAE A;  1JWV A;  5DTT A;  5CEB A;  3RTY A;  3UDX A;  3MFX A;  2HDU A;  3CMZ A;  5F1G A;  2L0W A;  4S2I A;  4WL9 A;  5DJU A;  3G2Y A;  4B93 A;  1BTL A;  4HJ3 A;  3PBN A;  1NZU A;  4GCZ A;  3QP5 A;  4JGP A;  4JF5 A;  3UE0 A;  3BFD A;  5G4Y A;  1J3W A;  5AQ7 A;  4DE1 A;  2VJW A;  5EM1 A;  3LIF A;  2A2L A;  1K0K A;  2C6W B;  1YLY A;  4GKU A;  4LRX C;  2D02 A;  2JE5 A;  4OLD A;  2WAE A;  4EEU A;  1K25 A;  1MY8 A;  1HLU P;  2QPN A;  2UV0 E;  1LI9 A;  4UEY A;  4GS9 B;  2XFT A;  1ODV A;  4RYE A;  4PHT A;  1NYY A;  1NLY A;  4WZ5 C;  1BLS A;  1I5Q A;  4R6L A;  1K54 A;  2ZQ8 A;  2QKP A;  5EEC A;  3VP0 A;  1VQQ A;  3LID A;  5EVI C;  1YLT A;  3CHW P;  2EX8 A;  3CUE A;  4DDS A;  3NHQ A;  5FAP A;  2OSU A;  4BLM A;  4E6X A;  3ZG8 B;  1MBL A;  4DF6 A;  3UPN A;  2K7S A;  3UY6 A;  3WRT A;  4GB7 A;  3CWF A;  1RGY A;  5DJT A;  4RVA A;  2WKE A;  2VGL S;  4B4Z A;  5GLB A;  3C8C A;  3FKV A;  4I39 A;  5E2F A;  3VV4 A;  1OTE A;  3SW1 A;  5FDS A;  3GQZ A;  1Z09 A;  1X0O A;  3A3F A;  2XLN A;  3A0R A;  5E43 A;  3FG8 A;  3NC8 A;  2HP9 A;  1CQA A;  3TRC A;  1NRF A;  3NOT C;  1GSV A;  4JLF A;  1BUL A;  1N9N A;  5C5K A;  4LV0 A;  5E2H A;  5AQB A;  5M19 A;  4QHC A;  4UQI M;  5DFY A;  1DJA A;  3LFV A;  3KSG A;  3OCN A;  1N9O A;  1SKF A;  2GZA A;  2PBY A;  1VM1 A;  4DDY A;  4HBT A;  2B95 A;  4OQG A;  1RCJ A;  2INW A;  2WKQ A;  1DY6 A;  1AXB A;  4P6Z M;  4KQD A;  2PYP A;  3KO6 A;  4MBH A;  3LGO A;  1SZV A;  3V50 A;  3NUL A;  2O9C A;  3S7O A;  2RL3 A;  2Y2N A;  2ZLY A;  3LIC A;  1IYQ A;  4LRZ E;  1NXY A;  3QNB A;  4E3L A;  2Y91 A;  4AFI A;  2WZX A;  3WS5 A;  2JCH A;  1F98 A;  3MS6 A;  4CLC C;  5BOH A;  4R3J A;  3K3C A;  4ZBE A;  4FTX A;  2H10 A;  3MKF A;  1Y28 A;  1DP8 A;  4EBN A;  3BM6 A;  5F83 A;  3EGX C;  4E3M A;  2ZBB A;  3CI6 A;  3P7N A;  3H7W B;  4B9O A;  3MSH A;  2GDN A;  5MC7 A;  4JF6 A;  2IWD A;  2ZQ9 A;  2Y2J A;  4C75 A;  5EE8 A;  1MWS A;  3HRE A;  3T4S A;  1AWI A;  4KQR A;  1CEF A;  2L4R A;  4OOM A;  2VX8 A;  3UB7 A;  3ZNT A;  4CPK A;  2JN7 A;  3VP2 A;  1P9R A;  3BFF A;  3IF6 B;  5U47 A;  2XA7 M;  1ESI A;  2H5S A;  3FV7 A;  1MWR A;  3R4K A;  5GHX A;  2DNS A;  4X55 A;  4MNR A;  1IEM A;  3IQA A;  1BT5 A;  5GHZ A;  2PD7 A;  4OKP A;  1TD5 A;  5AVE A;  3SH7 A;  3F1N A;  1UGU A;  5CED A;  3IXG A;  2HDS A;  3HLG A;  3VOL A;  5CX7 A;  4UA9 A;  1K4E A;  4ZJ3 A;  1LI0 A;  1TS7 A;  2VLG A;  1YMS A;  1QMF A;  4LRY C;  3R7W A;  1OJ5 A;  4HQA A;  1K6S A;  1XXM A;  4JXW A;  3W8K A;  2VGJ A;  3HL9 A;  1D7E A;  3C7U A;  3S4X A;  3KYQ A;  1S1Y A;  3GR2 A;  2G2U A; 
#chains in the Genus database with same CATH homology
 2A3U A;  4U0T A;  2I72 A;  1TVF A;  5FQJ A;  3VOZ A;  1WE4 A;  3N8L A;  4E3J A;  4OPQ A;  3WRZ A;  3QHY A;  4NK3 A;  1K4F A;  4B88 A;  2XH9 A;  3UE1 A;  4RX3 A;  5HL1 A;  3LY4 A;  4P0M A;  4E3N A;  5EOO A;  1NZO A;  3OCL A;  1YQS A;  3SH9 A;  3TSG A;  3LY3 A;  1Y54 A;  1K56 D;  1XGI A;  4JBF A;  3NDE A;  4S2N A;  1IKG A;  1FSW A;  5FDH A;  3IHB A;  2XK1 A;  1K57 C;  5KZH A;  4U3T A;  2ZC5 B;  4PM9 A;  3Q82 A;  5FQQ A;  5EVI B;  1FCN A;  2Z2L B;  3M2J A;  3HLE A;  4KZ3 A;  5DTS A;  3HBR A;  5EOE A;  4P6B A;  4WYY A;  1XKZ A;  1YLZ A;  1PZO A;  3O88 A;  1ERO A;  4LCL A;  2IWB A;  4O7D A;  3IF6 A;  5EVL A;  3BFE A;  3IXB A;  3IXH A;  3NY4 A;  3N6I A;  3NCK A;  3SH8 A;  3A3I A;  2QMI A;  1MXO A;  2XFS A;  1YMX A;  5DTK A;  5GHY A;  4BD1 A;  5FSR A;  3ZG9 B;  3ZNY A;  2ZQD A;  4OPY A;  2EFU A;  4GN2 A;  2OLU A;  5CXW A;  4Y0T A;  3BEB A;  3SOI A;  5HAQ A;  3O87 A;  4BL3 A;  2R9W A;  3O86 A;  3ITB A;  3AGE A;  1PW8 A;  4JXS A;  2HDQ A;  3HLW A;  4GOG A;  2Q9M A;  3VP1 A;  3BFG A;  1ES4 A;  3HLC A;  5GL9 A;  1LL9 A;  4DXC A;  1MKI A;  1ES3 A;  4OLG A;  4XUX A;  4DRT A;  5FQM A;  4C6Y A;  3UNW A;  5CGX A;  3GV9 A;  1IYS A;  4X53 A;  2Y2G A;  4R23 A;  2Y59 A;  3G4P A;  4GZB A;  2P9V A;  2WYX A;  2Y2P A;  3TG9 A;  3VFF A;  1XGJ A;  2V20 A;  4GDB A;  1OME A;  3G30 A;  1MPL A;  4EBP A;  5HAP A;  2BG1 A;  3UN7 A;  1E4D A;  2XEP A;  4N9K A;  4X56 A;  5G18 A;  1J9M A;  3MZE A;  4LV2 A;  5A90 A;  2Y2L A;  4PM7 A;  5KSH A;  2EXB A;  3C7V A;  3MZF A;  2ZM2 A;  3LCE A;  4KZ4 A;  5CTN A;  5IHV A;  4S2N C;  3W4O A;  4PPR A;  2V2F F;  1FSY A;  1K55 A;  4OP8 A;  1PYY A;  3HLF A;  2OV5 A;  1I2W A;  4OQ0 A;  4ZAM A;  5JYO A;  3O3V A;  3DWZ A;  2JC7 A;  4KG5 A;  3S1Y A;  4N92 A;  2Y2K A;  4QJG A;  1ONH A;  1Q2P A;  3OZH A;  4N1H A;  2XD1 A;  2J8Y A;  4PM6 A;  4F94 A;  1S0W A;  4FSF A;  5E2E A;  1GHM A;  2OLV A;  1W8Y A;  1WYC A;  1YT4 A;  5FAO A;  4KZ5 A;  4Y7P A;  3BRM A;  3SS3 A;  1SCW A;  5DVA A;  4H8R A;  3NI9 A;  3DTM A;  1YLP A;  4KZ7 A;  3VOY A;  2XF3 A;  4WMC D;  3IF6 C;  4OPR A;  1ESU A;  1W5D A;  4IBR A;  1G6A A;  3GSG A;  3HVF A;  1ZKJ A;  1BSG A;  4OQH A;  3N8R A;  2V1Z A;  1ERM A;  1XP4 A;  4IVI A;  1BLP A;  4UHU A;  3IH8 A;  1PWC A;  1LHY A;  2UWX A;  4PM8 A;  4XXR A;  3PAE A;  2A49 A;  4RX2 A;  1JWV A;  5DTT A;  2VGK A;  3UDF A;  1KDW A;  4N9L A;  5CEB A;  1Q2Q A;  1YLJ A;  4LCM A;  3HLD A;  4R4S A;  3PBR A;  3UDX A;  2R9X A;  4LV3 A;  3W4Q A;  3IXD A;  1QME A;  4WZ5 A;  1ES2 A;  4P87 A;  3WS0 A;  1PI4 A;  2HDU A;  2XD5 A;  3CMZ A;  4R1G A;  4WM9 A;  5F1G A;  4BQM A;  5FAS A;  1GHP A;  2H0T A;  4MLL A;  4S2K A;  4S2I A;  5FI7 A;  3G2Y A;  1NY0 A;  4JF4 A;  4FH2 A;  1WYB A;  5KMW A;  1IYO A;  5F1F A;  1BTL A;  1NYM A;  3Q1F A;  3G2Z A;  1SDE A;  3C5A A;  4GNU A;  5EVI A;  4K91 A;  3WS1 A;  4HEF A;  4WEJ A;  3W4P A;  3PBN A;  1NZU A;  1PWG A;  3D4F A;  3HLB A;  3UO9 A;  4E6W A;  4EWF A;  1W7F A;  2X02 A;  3VSK A;  5F82 A;  3TOI A;  4JF5 A;  5HFO A;  3HUN A;  3UE0 A;  4CJN A;  1H8Y A;  3BFD A;  4EUZ A;  3EQV A;  4OON A;  1JWZ A;  1TDL A;  4S2J A;  5AQ7 A;  4DE1 A;  1L0G A;  3AGF A;  1HTZ A;  1CI9 A;  1MWU A;  3CJM A;  2ZM8 A;  2WKI A;  5TGF A;  5FA7 A;  2C6W B;  3N8S A;  1L0F A;  1YLY A;  2ZQC A;  3N7W A;  4GKU A;  1TEM A;  4OVD A;  3ZGA B;  4X69 A;  4S2L A;  2WK0 A;  3ZDJ A;  4BEN A;  2JE5 A;  4N1X A;  4S2P A;  2WUQ A;  2WAE A;  3G35 A;  4OLD A;  4QY5 A;  1K25 A;  1MY8 A;  3E2K A;  3PBS A;  3MFD A;  1HVB A;  2QPN A;  1E3U D;  1FQG A;  1LI9 A;  3WS2 A;  4OPZ A;  2Y2H A;  3OC2 A;  2J9P A;  2XFT A;  2HPB A;  1G68 A;  1N9B A;  1PW1 A;  4GD8 A;  1ALQ A;  3LO7 A;  3MZD A;  1ERQ A;  3UDI A;  3A3E A;  4JXV A;  4RYE A;  2Z2M B;  5FI2 A;  1NYY A;  3GRJ A;  4OOY A;  1HZO A;  5EUA A;  5EPH A;  1FCM A;  1GHI A;  3Q7V B;  1BLS A;  4WZ5 C;  4KZA A;  1I5Q A;  3FWL A;  1DJC A;  4MEZ A;  4QU3 A;  1K54 A;  1BLH A;  5FQK A;  2WGW B;  2B5R A;  2ZQ8 A;  3VP4 A;  4DE2 A;  2G2W A;  3ZCZ A;  5EEC A;  3VP0 A;  4ZJ1 A;  5TFQ A;  1VQQ A;  2X01 A;  1CI8 A;  3SS4 A;  5EVI C;  1YLT A;  1O7E A;  4X68 A;  4BL2 A;  2EX8 A;  4DDS A;  5FAP A;  4KG6 A;  2OSU A;  1KGE A;  1E25 A;  4PMA A;  4E3O A;  4KZ9 A;  3C4O A;  5CEC A;  4YIN A;  3A3J A;  4BLM A;  4X6T A;  4E6X A;  1KGF A;  1KGG A;  1IYP A;  1W8Q A;  2JBF A;  2PU4 A;  3G31 A;  3ZG8 B;  5D3O A;  3FZC A;  1MBL A;  2WZZ A;  4C3Q A;  5CHU A;  4D2O A;  4P85 A;  1W79 A;  5CGW A;  4DF6 A;  3OPH A;  4HES A;  3UPN A;  3UY6 A;  4FH4 A;  3WRT A;  1KVL A;  4GB7 A;  4OP5 A;  1EWZ A;  1RGY A;  4RVA A;  2WKE A;  1S6R A;  1K56 A;  4B4Z A;  5HX9 A;  3FYZ A;  1CEG A;  5GLB A;  2PU2 A;  4K0W A;  3FKV A;  3M2K A;  3DWK A;  1YM1 A;  3QNC A;  5E2F A;  4KQQ A;  5CTM A;  5DF8 A;  3RJU A;  4QB8 A;  5HW3 A;  3V39 A;  3GQZ A;  2J9O A;  3A3F A;  2XLN A;  5E43 A;  1LL5 A;  5GLA A;  1KDS A;  1L2S A;  4ID4 A;  3ZG7 B;  3NC8 A;  4DE0 A;  4Y0O A;  2HP9 A;  1GA9 A;  3AGD A;  1NRF A;  1DJB A;  1N4O A;  1GCE A;  1EI5 A;  3VSL A;  1PI5 A;  2WKH A;  1FOF A;  4JLF A;  2RCX A;  3IWI A;  4S2M A;  1BUL A;  2XR0 A;  2P74 A;  4LV0 A;  5E2H A;  5AQB A;  5M19 A;  4QHC A;  3BEC A;  1K54 C;  3MKE A;  4R3B A;  4LEN A;  1KE3 A;  4XUZ A;  2E8I A;  4OOL A;  3BFC A;  3ZG5 A;  1DJA A;  2J7V A;  3OCN A;  3S22 A;  3MBZ A;  4WEK A;  1FR1 A;  2Y2M A;  1SKF A;  2DRW A;  2PBY A;  3Q7Z A;  2EXA A;  5FQI A;  1VM1 A;  2Y55 A;  5KSC A;  3VMA A;  1IKI A;  2ZQA A;  3BYD A;  4UA6 A;  5FI6 A;  4DDY A;  4NET A;  4HBT A;  4ZDX A;  3RXX A;  1KVM A;  1JWP A;  3DW0 A;  4OQG A;  3GVB A;  3FKW A;  4RA7 A;  4WZ4 A;  3ZFZ A;  4BJP A;  4M3K A;  4KG2 A;  1RCJ A;  4IED A;  1KE4 A;  3PTE A;  5GLC A;  2XDM A;  1DY6 A;  1K55 C;  1AXB A;  2WAD A;  5FAT A;  1FR6 A;  5L2F A;  5FQ9 A;  3CG5 A;  1BLC A;  5AQ9 A;  2ZC6 B;  3E2L A;  4MBH A;  4ZJ2 A;  2DCF A;  1H5X A;  1K38 A;  3CZD A;  3V50 A;  1XA1 A;  1ZC2 A;  2RL3 A;  2Y2N A;  4GD6 A;  2ZLY A;  3WS4 A;  1M6K A;  3PAG A;  1IYQ A;  3G34 A;  3LEZ A;  4U0X A;  3PBQ A;  4KEN B;  1NXY A;  5AQA A;  3Q7V A;  2Y4A A;  3QNB A;  4KZB A;  1PIO A;  3NBL A;  4E3L A;  2Y91 A;  1O07 A;  4WEL A;  4Y0U A;  2WZX A;  4ZTK A;  3UPP A;  3IWO A;  3ISG A;  5TR7 A;  3WS5 A;  2JCH A;  2WGW A;  2FFF B;  5BOH A;  4R3J A;  3IF5 A;  4ZBE A;  5M18 A;  1Z6F A;  1H8Z A;  2XGN A;  3M6H A;  3MXR A;  4KZ8 A;  3ZG0 A;  3M6B A;  1L0E A;  4WMC A;  1K6R A;  4R4R A;  1NJ4 A;  3PBO A;  4UA7 A;  4DXB A;  2H10 A;  3MKF A;  4EBL A;  4UAA A;  4GDN A;  1MWT A;  4EBN A;  1M40 A;  3BM6 A;  2BLS A;  2XQZ A;  5F83 A;  1ONG A;  5FAQ A;  4E3M A;  4QY6 A;  1BUE A;  1L0D A;  4DKI A;  2ZM0 A;  2GDN A;  3UE3 A;  1TDG A;  2X71 A;  1JTG A;  2WGV A;  4JF6 A;  3NDG A;  4BD0 A;  2IWD A;  2ZQ9 A;  2Y2J A;  3V5M A;  2QZ6 A;  4IVK A;  3I7J A;  4E3I A;  4C75 A;  2IWC A;  3IHA A;  5EE8 A;  1MWS A;  3HRE A;  5CHM A;  5CGS A;  4S2O A;  2ZJ9 A;  3B3X A;  3GTC A;  2ZC4 B;  4LV1 A;  1I2S A;  2EX6 A;  1KE0 A;  3IT9 A;  3NIA A;  1U60 A;  3EQU A;  4EQI A;  5A91 A;  5J8X A;  4KQR A;  1CEF A;  4OH0 A;  5A92 A;  4JXG A;  1HD8 A;  3P09 A;  4FD8 A;  4MBK A;  4OOM A;  5I94 A;  3ZNT A;  3VP3 A;  1IEL A;  3RXW A;  3VP2 A;  3ZVT A;  4CPK A;  5HAI A;  2ZMA A;  3BFF A;  3IF6 B;  5EVI D;  5A93 A;  1YLW A;  5U47 A;  1ESI A;  1SHV A;  5E2G A;  1SDN A;  2H5S A;  3FV7 A;  4JPM A;  1MWR A;  3V3R A;  2EFX A;  3OPL A;  5GHX A;  4K0X A;  5DF9 A;  3GMW A;  2HDR A;  5CER A;  2DNS A;  4X55 A;  4MNR A;  4EV4 A;  4DE3 A;  2WGI A;  4YFM A;  1IEM A;  3IQA A;  2C5W B;  1RP5 A;  2EX2 A;  4E3K A;  4WBG A;  2EX9 A;  2ZD8 A;  1BT5 A;  3ITA A;  3G32 A;  3Q81 A;  1GA0 A;  3IWQ A;  5GHZ A;  4KQO A;  5HAR A;  4OKP A;  1BZA A;  5GLD A;  2Y2Q A;  4Q8I A;  4FCF A;  5DF7 A;  2HP6 A;  3UPO A;  4JKT A;  3SH7 A;  3MXS A;  2P9V B;  1ZG6 A;  3HUO A;  4L0L A;  3ZVW A;  1K57 A;  5CED A;  3IXG A;  2HDS A;  2ZQ7 A;  3OPP A;  4Z9Q A;  1PZP A;  1JVJ A;  1ZG4 A;  2ZC3 B;  1RGZ A;  3HLG A;  4UA9 A;  5M1A A;  1K4E A;  1PWD A;  2Q9N A;  2H0Y A;  1E3U A;  4A5R A;  3WWX A;  4ZJ3 A;  3A3D A;  1LI0 A;  4MBF A;  3HUM A;  3Q07 A;  1LLB A;  3OPR A;  1FCO A;  1C3B A;  4HBU A;  4PM5 A;  5CHJ A;  3IH9 A;  2HP5 A;  1XX2 A;  3ZHH A;  3PBT A;  3BLM A;  1YMS A;  1CK3 A;  1JTD A;  1QMF A;  1XPB A;  5JYP A;  2ZC7 A;  3SS5 A;  2WAF A;  2CC1 A;  5CRF A;  2FFY A;  4OQI A;  1K6S A;  1XXM A;  2Y2I A;  4JXW A;  1ES5 A;  3JYI A;  3W8K A;  2VGJ A;  2Y2O A;  4KZ6 A;  3HL9 A;  3VFH A;  3V3S A;  3P98 A;  4QD4 A;  1XA7 A;  3C4P A;  4B4X A;  3C7U A;  3S4X A;  3BLS A;  3GR2 A;  4R0Q A;  2G2U A;  3N4I A;  4IBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...