4PM6A

Crystal structure of ctx-m-14 s70g beta-lactamase at 1.56 angstroms resolution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-14
publication title Molecular Basis for the Catalytic Specificity of the CTX-M Extended-Spectrum beta-Lactamases.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Hydrolase
total genus 91
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4pm6A00
3GRJA 4QB8A 5IHVA 4R1GA 3UPPA 1PI4A 2B5RA 4E3IA 1YLZA 2ZMAA 4KQQA 1KDSA 1ERQA 4WZ5A 2HP6A 1NYYA 5CHMA 2FFFB 1H5XA 1K4FA 1H8YA 1NRFA 5AQ9A 1YMXA 5F1GA 3VP3A 3HBRA 2WYXA 1HZOA 1ZC2A 3NDEA 4WYYA 3SH8A 3UPOA 2WGIA 3GMWA 3N4IA 2Y59A 4MBHA 4BJPA 1O07A 3LY4A 4JXGA 3FKVA 5FQ9A 4C6YA 4KZ4A 1GHPA 4E3OA 1K55C 3MXSA 3PBQA 1XKZA 1MXOA 5F83A 1ALQA 2ZQ9A 5A93A 3M6HA 3G35A 4ZBEA 2ZM0A 5TFQA 2ZLYA 3PBNA 3ZGAB 5EE8A 1QMFA 2HDUA 5CGWA 1PW8A 3Q07A 2CC1A 4S2KA 2WUQA 4KZAA 1RCJA 4PM9A 3E2KA 2ZD8A 1TDGA 4QHCA 2Y2OA 2J9PA 1ONGA 5EVLA 5FDHA 1JWPA 3BLSA 4R3BA 5EECA 1XX2A 3Q82A 2EX9A 5FI2A 4Y0UA 2EFXA 3D4FA 2Y2PA 1ZG4A 2DNSA 4ZJ3A 4KZ5A 1CK3A 1MWUA 2XFSA 3Q7VB 1CI8A 3AGFA 2Z2LB 5E2EA 1FR1A 1ZG6A 3WS5A 5KSHA 3Q81A 1L2SA 4KG6A 2I72A 4KZ6A 1JTDA 1OMEA 1YM1A 3O3VA 2Z2MB 4OOLA 5GLCA 4S2JA 3ZG7B 1VM1A 1PI5A 3GVBA 1EROA 2Y2QA 3VMAA 2ZQ7A 4IBRA 2Y2KA 3BRMA 3N6IA 5FASA 1N9BA 1TDLA 1PWGA 3ZFZA 2X01A 4U0XA 3A3JA 4DF6A 1GCEA 5A90A 3OZHA 1I2WA 3N8RA 1KE0A 5M1AA 4OPZA 1IEMA 5CERA 3S4XA 1GA9A 4GKUA 3RXXA 1IELA 4M3KA 1K25A 4DKIA 5L2FA 3BYDA 3IF6B 2Q9NA 1PZPA 2HDSA 4H8RA 3N8LA 3NY4A 3IH8A 2V20A 4UA6A 1L0FA 3WWXA 3OPRA 2P9VA 4ZJ1A 1W7FA 1SDNA 3NC8A 4HBUA 2C6WB 5CHUA 3LEZA 1ESUA 3OCNA 4JXVA 2A3UA 2XD1A 3E2LA 3LY3A 1K54A 1E4DA 4E3LA 3BFCA 1LI9A 1JWZA 2XEPA 4WELA 3OPHA 2ZJ9A 4D2OA 1CEFA 1O7EA 3C7UA 3LO7A 1SHVA 3VFFA 4DE3A 1YLPA 5EVIB 2XR0A 3NI9A 4N9KA 3TG9A 4ZAMA 1ONHA 4OONA 1XGIA 1IYQA 4BL3A 4DXBA 2EXBA 3IQAA 4BQMA 5FAOA 1I5QA 3GQZA 4MBKA 4PM8A 4EUZA 4U0TA 3BECA 1EWZA 4EV4A 3S1YA 2ZC5B 4A5RA 3FZCA 2EX8A 3V3SA 3M2JA 3UO9A 4EBPA 1YQSA 4HEFA 4MBFA 3UY6A 1Q2QA 4N9LA 2Q9MA 4UA7A 2X02A 5CHJA 3BM6A 5KSCA 3SS5A 1WE4A 4L0LA 2HPBA 3ZCZA 1LL9A 2H0TA 3UDFA 1RGYA 1KGFA 1CEGA 4PM6A 4R4RA 1VQQA 1FSYA 3MZFA 2X71A 2OSUA 2XD5A 4GB7A 4JF4A 4RA7A 3OPPA 3SH7A 4LV1A 1I2SA 4QY6A 4K0WA 4E3KA 4R23A 3GTCA 1RGZA 4DE2A 5BOHA 4RVAA 2EXAA 3HUMA 4P85A 5DF8A 5GHXA 5HARA 2UWXA 4KZ9A 1L0DA 3SS3A 4DDYA 4DRTA 5GL9A 2JCHA 2Y4AA 2H10A 4P6BA 4S2LA 4LV2A 1K55A 4B4ZA 2GDNA 3B3XA 5FQJA 5D3OA 1YLJA 3FV7A 1J9MA 3OC2A 3WS0A 4OPYA 4YFMA 4PPRA 3M6BA 1ES5A 2XDMA 2HDRA 2WGWA 3SOIA 4CPKA 4FSFA 3UE0A 1XGJA 3FYZA 5GLAA 3QNCA 1YMSA 5HAIA 4RYEA 4GD8A 4R3JA 2PBYA 4PMAA 2DRWA 4OQIA 1GA0A 4Q8IA 4JXWA 3A3DA 4OLGA 5FI7A 4PM5A 1LLBA 3N7WA 5A92A 1XA1A 2ZQAA 1NXYA 3C7VA 3TSGA 1WYBA 3G34A 4E3MA 1ESIA 2HP9A 2Y91A 3IHAA 4KG2A 5CRFA 2EX2A 2XFTA 3IXHA 1WYCA 4X69A 1BLPA 1N4OA 3VP1A 3IF6C 1SDEA 1W8QA 1PIOA 1MPLA 3G30A 3HLFA 4OQ0A 2WAEA 3IXGA 3FKWA 3IH9A 5J8XA 4IVIA 1MY8A 4E3NA 4P87A 2Y2LA 3A3IA 4JXSA 2WK0A 4NETA 3ZG0A 3IWQA 4BENA 4JPMA 1FR6A 3CJMA 4ZDXA 3G31A 4KZ8A 2WADA 2C5WB 5F82A 2E8IA 5HX9A 5KZHA 2Y2GA 1E25A 1CI9A 5EVIC 3PBOA 4DE1A 1PZOA 3GR2A 3IXDA 2ZM8A 3HLBA 4R4SA 3S22A 3HLCA 4KZ3A 3BFFA 3SH9A 5HL1A 1KVMA 4OVDA 2WAFA 1G68A 1M6KA 4FH4A 4QU3A 5CEBA 1HVBA 5FSRA 3HLDA 5FAPA 2WKEA 3G2YA 4NK3A 1JTGA 4BD1A 2WGVA 4EBNA 5HW3A 1KE4A 4GNUA 4MNRA 1AXBA 3NCKA 1Z6FA 4E6WA 1W79A 4GD6A 4U3TA 4X6TA 3RXWA 2J7VA 1KE3A 5DTKA 1NY0A 4QY5A 3HLWA 2FFYA 3HL9A 3CG5A 1XA7A 1LI0A 4CJNA 3ZG8B 4KG5A 4S2NC 4WEKA 1DJBA 2XH9A 3UPNA 4GDBA 4Y0OA 3A3FA 1M40A 4UA9A 3DW0A 3MFDA 4O7DA 4Z9QA 5AQAA 5FQKA 2BLSA 4N92A 2XQZA 4WZ4A 5G18A 4PM7A 1XP4A 4OKPA 4UHUA 5E43A 1BLHA 3HREA 1ES3A 3P09A 5DF7A 3VOYA 4OPRA 1ERMA 4IBXA 4DE0A 3UN7A 2HP5A 3MXRA 1EI5A 1K56A 1NYMA 4FD8A 3VOZA 1KDWA 1U60A 3WRTA 2PU2A 4K0XA 3G32A 3O88A 1BZAA 3W8KA 4XUZA 5FI6A 1DJCA 3ZVWA 3V50A 3PTEA 1S0WA 3TOIA 4OP8A 3HUOA 3M2KA 3G2ZA 2WZXA 3A3EA 4IVKA 3UDXA 2OLUA 5GLBA 3N8SA 1NZOA 1YLYA 3Q7VA 1MWRA 3QHYA 3MZDA 2P74A 5DVAA 5GHZA 4JKTA 1L0GA 3IXBA 1K56D 1W8YA 4R0QA 1IYPA 4E6XA 1IKGA 5I94A 1IKIA 2RL3A 3PBRA 2WKHA 3FWLA 5CGSA 4X68A 5AQBA 4WM9A 2OV5A 3WS2A 3EQUA 3IWIA 1FCNA 3O87A 4OOMA 2ZQ8A 4S2MA 3BLMA 1K57C 3HLEA 4YINA 3ISGA 3OCLA 3WS4A 1BT5A 2H0YA 2G2UA 2ZQDA 1PW1A 4HESA 5TR7A 2Y2MA 1PWCA 1TEMA 2R9WA 3DWKA 3GV9A 4KQOA 4KZ7A 4JBFA 5DF9A 3W4QA 2P9VB 3CMZA 4OOYA 3ZNTA 2J9OA 3PAGA 2XGNA 1ES2A 2EX6A 4B88A 4LCMA 1RP5A 5HAPA 3VP0A 2V1ZA 3V5MA 3IHBA 4GDNA 5TGFA 1BLCA 4XXRA 4GOGA 4BL2A 2V2FF 4WMCA 3UE3A 4KZBA 3ZVTA 4WZ5C 3G4PA 1ES4A 3IF6A 4S2OA 3WRZA 4OLDA 5U47A 3LCEA 3C4OA 1LL5A 3PBTA 5FAQA 1PYYA 4MEZA 3VFHA 3VSKA 3ZNYA 5CEDA 1ZKJA 4E3JA 1L0EA 1YLTA 2JBFA 2Y2IA 2EFUA 4OPQA 3W4PA 1W5DA 3ZG5A 4LV0A 3P98A 4S2IA 1FCOA 2VGKA 1IYSA 4RX2A 4WMCD 5CGXA 3VP4A 3MKEA 5M19A 4OQHA 3NDGA 1PWDA 2ZC7A 1K4EA 3NBLA 3UDIA 2QMIA 5EVIA 4RX3A 1XXMA 1BLSA 3BEBA 1MKIA 3IF5A 1BULA 4KENB 4JF5A 4KQRA 3UE1A 1FQGA 1KGEA 4N1XA 4ZJ2A 5M18A 2XF3A 4C75A 5FA7A 2QZ6A 1IYOA 2WZZA 2RCXA 3HUNA 3C5AA 1BTLA 2IWDA 4F94A 3DWZA 1TVFA 1SCWA 4X53A 4BD0A 2XLNA 1YT4A 5CXWA 5EOOA 3RJUA 3UNWA 4DXCA 3EQVA 2WKIA 3GSGA 5EVID 2JC7A 2ZM2A 1DY6A 3OPLA 2J8YA 3ITBA 5GLDA 3V3RA 3AGEA 4EBLA 2OLVA 5CTMA 2WGWB 1GHMA 4IEDA 2IWCA 3BFEA 3Q1FA 4FCFA 4S2NA 4EQIA 1SKFA 3VSLA 1K6SA 1E3UA 4MLLA 1S6RA 3Q7ZA 4ID4A 5JYPA 2JE5A 2XK1A 1MWTA 4K91A 3NIAA 3C4PA 1JVJA 2BG1A 3MKFA 1DJAA 5EOEA 3ITAA 4Y7PA 3PBSA 2PU4A 3QNBA 5FQMA 4B4XA 3AGDA 1KGGA 3ZDJA 1HD8A 2QPNA 3JYIA 3V39A 4GZBA 3SS4A 1MBLA 2ZQCA 3IT9A 5KMWA 2DCFA 1GHIA 5CTNA 2R9XA 4JF6A 4EWFA 4X56A 5E2GA 2Y55A 4BLMA 4FH2A 1FSWA 3I7JA 2VGJA 4S2PA 2H5SA 5FQQA 1E3UD 1Q2PA 4GN2A 4LV3A 3WS1A 1Y54A 3VP2A 4LCLA 4OH0A 1BUEA 4WEJA 2Y2JA 1MWSA 1C3BA 5E2HA 5HFOA 3PAEA 5FATA 3ZG9B 3HLGA 4HBTA 4QD4A 4XUXA 4ZTKA 1YLWA 3BFGA 1HTZA 3MBZA 4QJGA 1QMEA 5CECA 4JLFA 1NZUA 1K54C 4LENA 4N1HA 5F1FA 5EUAA 3IWOA 1LHYA 1K38A 1FOFA 2IWBA 3O86A 1H8ZA 1BSGA 3CZDA 2ZC4B 2A49A 4X55A 2G2WA 5JYOA 5HAQA 4WBGA 1G6AA 5A91A 3W4OA 5AQ7A 3DTMA 1K6RA 5EPHA 4Y0TA 2Y2NA 1KVLA 3ZHHA 3HVFA 4DDSA 5E2FA 1XPBA 4P0MA 1K57A 1NJ4A 2ZC6B 4OP5A 5GHYA 4OQGA 3BFDA 5DTTA 3MZEA 5DTSA 5FQIA 2ZC3B 2Y2HA 1JWVA 1FCMA 4UAAA 2HDQA 4C3QA
chains in the Genus database with same CATH superfamily
3UB6A 3R7WA 4QB8A 1UWNX 3UPPA 3KX0X 4BMWA 2J3TC 1BYWA 3D3OA 5CHMA 4WZ5A 4GW9A 2WYXA 3NDEA 4NG2A 5I5LA 4BJPA 2BASA 4JXGA 2K2NA 5FQ9A 4C6YA 1GHPA 1OT6A 4EXOA 5F83A 3CUEA 2LB9A 3LI9A 5J3WA 1S4RA 3Q07A 5EVLA 2J80A 1CJFA 2PD8A 4Y0UA 2DNSA 1MWUA 1P9WA 3IX3A 2M7VA 1FR1A 1ZG6A 4JGOA 5KSHA 2I72A 1OMEA 1Y28A 3O3VA 2Z2MB 4OOLA 1MZUA 4R38A 2Y2QA 5HWTA 4IBRA 3BRMA 1D7EA 3ZFZA 3KYQA 3RTYA 5HD3A 3T4SA 5CERA 5G4YA 1K25A 1LSVA 3BYDA 2VKSA 2HDSA 1ZHHB 4H8RA 2V20A 2P9VA 4L9GA 1SDNA 3NC8A 2XD1A 4K08A 4E3LA 1JWZA 4WELA 3VFFA 3BW6A 1YLPA 2XR0A 4M4XA 3MS6A 3NOUC 4EU0A 3IQAA 1I5QA 5HWWA 4PM8A 3BECA 5EM1A 5DJTA 4Q0IA 3RH8B 4MN6A 2ZC5B 3FZCA 4G3KA 4G3VA 3UO9A 4HEFA 3UY6A 1Q2QA 4N9LA 2Q9MA 4UA7A 2X02A 5CHJA 3C8CA 1WE4A 1KOUA 2B18A 2H0TA 4PM6A 1KGFA 3MZFA 5G4ZA 5HD5A 4BBTA 4R23A 1RGZA 4RVAA 2EXAA 4P85A 4GJ4A 4NXEA 1L0DA 3KSHA 4O0PA 2JCHA 2Y4AA 4IUKA 2H10A 4S2LA 5A8BA 2GDNA 3B3XA 2QHKA 3QP5A 1J9MA 3LI8A 1OTIA 1OTBA 3TJZC 1XGJA 4G3WA 3O5YA 2ZOHA 5HAIA 2DRWA 1WA9A 4Q8IA 4R3AA 1LLBA 4YWZA 1NXYA 2Y79A 1WYBA 3G34A 5HZHA 3IHAA 3EGXC 2YKHA 3IXHA 4WL9A 4WLAA 3VP1A 1S4SA 1SDEA 1W8QA 3G30A 3W2ZA 3CPTB 3FKWA 3DTEA 3PR6A 4P87A 4KUOA 4JXSA 4NETA 4BENA 3BY9A 4ZDXA 5F82A 2E8IA 4Y2FA 1CQAA 3R4KA 3HLBA 4R4SA 3S22A 3C2WA 3SH9A 4OVDA 3VOLA 3U2AA 1T1CA 5AVEA 3ZYTA 4U3TA 2DMWA 4EESA 3CG5A 1XA7A 1LI0A 2KLIA 2XH9A 4GDBA 3A3FA 4UA9A 4Z9QA 5AQAA 4F3LB 4N92A 4Q0HA 5E43A 2HF6A 3OOVA 4ARZA 4FUWA 3HREA 2WKQA 5DF7A 2W3HA 2Y8HA 1NYMA 3QP2A 5DFXA 1U60A 1BZAA 3W8KA 1W63M 5FI6A 2I9VA 3PTEA 5HDCA 5GLBA 1S66L 3BWLA 3Q7VA 1MWRA 5GHZA 2HJEA 1W8YA 2Z6CA 2W1TB 4E6XA 2W3EA 5CGSA 2RL3A 2WKHA 3FWLA 2VV8A 5AQBA 3WS2A 2W3FA 3GECA 3IWIA 4I39A 4S2MA 4YINA 3ISGA 3WS4A 1PW1A 1TEMA 3DWKA 4KZ7A 3CMZA 3PAGA 4B88A 4NXFA 5TBMA 1RP5A 5HAPA 3V5MA 1SKOB 4GDNA 4GOGA 4WMCA 4KZBA 3ZVTA 3G4PA 3IF6A 1J3WA 3LCEA 1PYYA 3VFHA 3VSKA 1NWZA 2L1MA 2PBDP 2XRNA 4I3JA 2NUTC 3BJNA 3H7WA 2VEAA 5EVIA 2VV6A 4RX3A 2XA7S 1BLSA 3BEBA 4KENB 2UV0E 5FA7A 3F1OB 1IYOA 3V67A 1BTLA 3DWZA 4R6LA 5DFYA 3PYPA 3RJUA 3EQVA 2WKIA 1MKMA 1N9NA 3OPLA 2O9BA 3UB7A 3V3RA 2XA7M 2OLVA 5CTMA 4IEDA 2IWCA 4S2NA 1K6SA 4MLLA 1S6RA 3C4PA 3DBAA 2OWHA 4NKPA 3JYIA 3V39A 2O9AA 4LRZE 2EA9A 3I7JA 2ZMFA 5HL6A 4S2PA 4GN2A 1OPXA 4LV3A 3WS1A 4LCLA 1N9OA 2VGLS 3FG8A 1MWSA 5E2HA 5HFOA 1PRQA 5FATA 3HLGA 2QJ7A 4QD4A 4XUXA 1YLWA 4ZRRA 4JLFA 1K54C 5EUAA 4QPRA 2W1RA 1NRJA 2A49A 5JYOA 3GDIA 4UQIS 5EPHA 2W3GA 2Y2NA 5E2FA 4CLCB 2ZC6B 4OP5A 1VEUA 3KYEA 5FQIA 2W0NA 2ZC3B 1FCMA 2V8CA 2HDQA 3EOIA 2B5RA 4E3IA 2XROA 1KDSA 1ERQA 1TF1A 3FPWA 2FFFB 1D06A 1K4FA 2PR6A 1NRFA 5AQ9A 4DN0A 1YMXA 4UQIM 2JKTM 3HBRA 3T4KA 1HZOA 1ZC2A 4WYYA 3SH8A 3UPOA 3MQ0A 2WGIA 3N4IA 2Y59A 4H6JB 2ZQ9A 3G35A 2ZM0A 3T1SA 3ZGAB 5EE8A 5CGWA 1PW8A 2CC1A 4S2KA 1RCJA 3E2KA 2ZD8A 4QHCA 1ONGA 3BLSA 4R3BA 5EECA 4GHIB 1AWIA 5EVEA 4ZJ3A 4WF0A 3MR0A 5E2EA 1DRMA 3WS5A 3Q81A 1G5UA 5GLCA 1VM1A 3VMAA 1GSVA 1N9BA 1TDLA 2X01A 4DF6A 3OZHA 3N8RA 1IEMA 4GKUA 1IELA 4M3KA 4BBUA 3F1PA 4CLCC 3UMEA 3IH8A 1L0FA 4ZJ1A 2V1AA 5CHUA 3OCNA 2A3UA 4P6ZM 4MMNA 4DMZA 1E4DA 4HJ4A 2XEPA 4D2OA 3C7UA 4I5SA 1SHVA 4X1LA 4DE3A 2V1BA 2EXBA 3VV4A 4MBKA 4U0TA 4EV4A 1VETA 3S1YA 4A5RA 2EX8A 4EEPA 1TS0A 1T1BA 3M2JA 4GS9A 3SS5A 4HP9A 3HJIA 4NXGA 2HPBA 3ZCZA 3H82B 1H0MA 1FSYA 2OSUA 4GB7A 3C38A 3SH7A 4LV1A 4QY6A 4E3KA 1K0KA 5BOHA 5DF8A 2UWXA 4DRTA 2EWWA 2L4RA 1K55A 5D3OA 1YLJA 3FV7A 2J3TD 4YFMA 1ES5A 2XDMA 2WGWA 3SOIA 1G6OA 3UE0A 5J7EA 2JKTI 1YMSA 4GD8A 2PBYA 4PMAA 1GA0A 2HJ9C 1SZVA 3A3DA 3T12B 3N7WA 1XA1A 2ZQAA 3D9YA 4E3MA 1ESIA 5CRFA 2XFTA 1PIOA 3LFVA 4L9EA 3IXGA 5J8XA 3IH9A 3NHQA 3LEQA 3HCYA 4II7A 5IT5A 3CJMA 4YNRA 3ULFA 5HX9A 2Y2GA 3R7WB 2ZOIA 4DE1A 2M1CA 4GCZA 5HL1A 4NEED 2WAFA 4FH4A 4QU3A 1HVBA 5FSRA 4BD1A 2WGVA 5HW3A 4E6WA 2R78A 2VZWA 2O0YA 3RXWA 1KE3A 1NY0A 1F98A 4CJNA 3ZG8B 4KG5A 4WEKA 1YSPA 1H3QA 4Y0OA 1TS6A 1LL8A 2GJ3A 4O7DA 1S67L 3LICA 4WZ4A 5KIZA 4OKPA 3QP1A 4UHUA 1ES3A 3P09A 4HQAA 3UMDA 1PFLA 2HP5A 1EI5A 5AJGA 4CLCE 2PU2A 3G32A 3O88A 4XUZA 1F2KA 4DJ2A 3LR3A 1S0WA 3TOIA 2P04A 2J3WA 3EEHA 3DAVA 1NZOA 3CPTA 1YLYA 3QHYA 1OTAA 4JKTA 1L0GA 3IXBA 1IKGA 3IBRA 3PBRA 5F68A 3EQUA 4OOMA 2ZQ8A 3L9KA 1P0ZA 2G2UA 2ZQDA 5TR7A 4HESA 3GV9A 4ME4A 4HI4A 3W4QA 2P9VB 4B93A 2J9OA 1ES2A 2EX6A 4LCMA 3E4OA 1XJ6A 5TGFA 2WKRA 4WZ5C 3WRZA 5U47A 3C4OA 1LL5A 5CEDA 1YSQA 1ZKJA 4EETB 2EFUA 3ZG5A 3CUEC 3P98A 3VP4A 1IYSA 4RX2A 3FPVA 4Y5FA 5M19A 4OQHA 1PWDA 1DP8A 1TD5A 3NBLA 2V9AA 1KGEA 4ZJ2A 3P01A 2XF3A 4MN5A 5FL3A 2RCXA 3HUNA 3C5AA 2IWDA 4F94A 2D02A 4WUJA 2XLNA 1YT4A 5CXWA 1JNUA 3UNWA 5FEGA 3GSGA 2JC7A 2Q0OA 2ZM2A 2P08A 1DY6A 2ZL1A 3UB8A 3ITBA 5GLDA 2WKPA 3MQOA 1GHMA 3CI6A 3Q1FA 4QWOA 3VSLA 3LUQA 5HPFA 4K91A 3NIAA 2BG1A 2KOIA 3MKFA 3PBSA 5FQMA 3AGDA 4AFIA 3LR4A 3H9WA 3ICYA 3IT9A 2R9XA 4EWFA 2Y55A 1FSWA 4I38A 2VGJA 2H5SA 1W63Q 1E3UD 3D72A 1Y54A 4OH0A 4WEJA 2Y2JA 2QJ5A 3F1NA 4MDZA 4ZTKA 3MBZA 3PHYA 4QJGA 5F1FA 5F69A 3CZDA 3S7OA 4WBGA 3W4OA 5A91A 3ZHHA 4HY8A 1K57A 1NJ4A 2K31A 3JPUA 1A0KA 2Z6DA 5DTTA 2Y2HA 2AVXA 4KQDA 5IHVA 4R1GA 3TW8A 1YLZA 2QWSA 3U4LP 4KQQA 1NYYA 1H5XA 2KDKA 3DTKA 1H8YA 1UWPX 2VK3A 2E8JA 3DTIA 3K2NA 3GMWA 2W3DA 1O07A 4E3OA 3CHWP 3PBQA 1XKZA 1MXOA 4ARZB 3M6HA 4ZBEA 5TFQA 2ZLYA 5HPIA 2HDUA 2BTFP 4LFUA 2V0WA 4PM9A 1TDGA 5LBRA 2J9PA 2ZBBA 5FDHA 2EX9A 1GSWA 5FI2A 2EFXA 3D4FA 2Y2PA 3CAXA 4KZ5A 1CK3A 4O01A 2LB5A 3Q7VB 1CI8A 3IBJA 2GZAA 3LR5A 1L2SA 4KG6A 3OBFA 3ZG7B 1PI5A 2K7SA 2B95A 2PYPA 3N6IA 1PWGA 3T1XA 3A3JA 1GCEA 5A90A 5M1AA 5DKKA 5TBMB 3RXXA 4FTXA 3S7QA 4DKIA 4XT2A 4FOFA 3IF6B 2Q9NA 3P7NA 1PZPA 3N8LA 4UA6A 3WWXA 2C6WB 1ESUA 4EW7A 3IS2A 3H7WB 5EM0A 1O7EA 2MJ6A 5EVIB 3TG9A 4ZAMA 3E4PA 1XGIA 4H6JA 4DXBA 3CITA 1LSWA 5FAOA 1LSXA 4LLOB 1YQSA 4HHDA 4Y3IA 3UDFA 1CEGA 4R4RA 2OOLA 2XD5A 4JF4A 3OPPA 1I2SA 3VE3A 3HUMA 3UE6A 3NULA 5GHXA 4D60A 4KZ9A 5GL9A 2A24A 4P6BA 4B4ZA 5FQJA 3WS0A 4OPYA 1XJ3A 2HDRA 1F9IA 4FSFA 5GLAA 4RYEA 4B9OA 4OQIA 4CQHA 4OLGA 2FH5A 5A92A 3C7VA 2HP9A 4KG2A 5L09A 3E4QA 1BLPA 1N4OA 3IF6C 4HH2A 1MPLA 2WAEA 4L9FA 3BQAA 2PRFA 4HP4A 2Y2LA 3A3IA 1VEUB 4JPMA 1FR6A 4ETZA 1XJ2A 1CI9A 5EVIC 3PBOA 1PZOA 3GR2A 1T19A 2G7UA 3HLCA 4P6ZS 4KZ3A 5EFWA 3OLOA 4Y17A 3MMHA 1G68A 5CEBA 1M6KA 4IUHA 3HLDA 5FAPA 3T4QA 1JTGA 1YAXA 1KE4A 4I3AA 4MNRA 4BWIA 4GD6A 2J7VA 5J4EA 5DTKA 1PNEA 4QY5A 1ODVA 3HL9A 4CLCD 4S2NC 3LIDA 1DJBA 3KSIA 3UPNA 1M40A 4EEUA 3MFDA 5FQKA 2BLSA 2XQZA 4PM7A 4LRXC 3KSFA 1ACFA 2PAVP 3VOYA 1ERMA 4DE0A 5IU1A 3T4TA 3MXRA 4FD8A 3WRTA 3NOTC 2OWJA 1DJCA 3V50A 4LPZA 2JN7A 2WZXA 3UDXA 5AVFA 1VB6A 2HZ5A 5DVAA 3LIEA 3LR0A 1K56D 3E98A 3T4JA 1IYPA 1IKIA 2VJWA 4X68A 1DP9A 3F1PB 4ESPA 3BLMA 2QKPA 5L07A 2H0YA 2Y2MA 2GNXA 5DF9A 4JBFA 5HSQA 2V1ZA 3IHBA 4RQ9A 4XXRA 1DP6A 4BL2A 2V2FF 3UE3A 1ES4A 4S2OA 3PBTA 4IHQA 4EERA 3T4OA 1L0EA 1YLTA 3W4PA 1W5DA 1VETB 2PT7A 1TS7A 4S2IA 1FCOA 2VGKA 4JGPA 1FIKA 2ZC7A 4GS9B 2QMIA 4I3IA 1XXMA 1MKIA 3IF5A 4KQRA 1FQGA 1FILA 4X25A 2QZ6A 2WZZA 1HLUP 1SCWA 4X53A 5EOOA 3KYZA 1YKDA 3MFXA 1D1JA 2HGVA 3JVUA 2VLGA 4EBLA 2VV7A 1GSXA 2WGWB 5FDSA 3BFEA 4EQIA 1E3UA 4ID4A 1JVJA 5EOEA 1DJAA 3ITAA 4Y7PA 2PU4A 4B4XA 1T18A 2QPNA 2W27A 3LIFA 1MBLA 2ZQCA 1GHIA 4EQ1A 4X56A 2JKGA 3HJKA 5FQQA 1Q2PA 1MC0A 1BUEA 1C3BA 3ZG9B 3A0RA 1QMEA 5CECA 4N1HA 3T1RA 3IWOA 5K5BA 2IWBA 2PYRA 4X55A 5HAQA 5AQ7A 1K6RA 4DDSA 1XPBA 2JKFA 4OQGA 5DTSA 5CX7A 4K0WA 3GRJA 2VX8A 1N9LA 2PR5A 4PKYG 1PI4A 3RFBA 2PD7A 2ZMAA 3LYXA 2HP6A 5DKLA 3MF0A 1S1ZA 5F1GA 3VP3A 4R70A 3LIBA 2OAP1 2M7UA 4MBHA 3LY4A 3FKVA 4KZ4A 5MC7A 1K55C 3MXSA 2A2LA 4NXBA 1ALQA 5A93A 3PBNA 1QMFA 1ZTUA 2WUQA 4KZAA 4O8GA 4HJ3A 2Y2OA 4F3LA 1X0OA 1JWPA 1XX2A 3Q82A 4HIAA 1IOUA 1EW0A 1ZG4A 4HH3A 2XFSA 3E0YA 3AGFA 2Z2LB 4KZ6A 1JTDA 1YM1A 3S7NA 2EWVA 2ZMVA 4S2JA 3GVBA 3EEAA 1EROA 4LGWA 2ZQ7A 4Q0JA 2Y2KA 3B42A 5FASA 2O99A 3A0SA 4U0XA 3SW1A 1I2WA 1KE0A 2W1TA 1CF0A 4OPZA 3S4XA 1GA9A 1V9ZA 3LGOA 3KSGA 4JGRA 5L2FA 3NY4A 3IX4A 1OTDA 4E04A 3OPRA 1W7FA 4HBUA 3LEZA 2GX5A 1SKOA 4JXVA 1XFQA 3E2LA 3LY3A 1K54A 3BFCA 1LI9A 3OPHA 2ZJ9A 2JHEA 1CEFA 3LO7A 3B33A 4N9KA 3NI9A 1ONHA 4OONA 1IYQA 2FZ0A 4BL3A 4BQMA 3GQZA 4EUZA 1EWZA 4EUVA 3V3SA 4EBPA 4MBFA 3C30A 3BM6A 5KSCA 3SZTA 4L0LA 4JGQA 1H8MA 3QP4A 1LL9A 1RGYA 1VQQA 4RA7A 2X71A 2ZL1B 1NLZA 3F1OA 3JVVA 4DE2A 3GTCA 3KO6A 1STZA 3G6OA 5HARA 3SS3A 4DDYA 3FC7A 1VHMA 2KX6A 1NLYA 4LV2A 1F5MA 3T1QB 2JKRM 3OC2A 4PPRA 3M6BA 2B02A 4CPKA 3FYZA 3QNCA 3UB5P 1XFNA 4R3JA 3MJQA 4JXWA 5FI7A 4PM5A 3F1NB 1S1YA 3TSGA 2Y91A 4MN7A 2EX2A 1WYCA 4X69A 1P9RA 1UGUA 3T50A 3HLFA 2L0WA 2H28A 4OQ0A 3MQQA 4IVIA 1MY8A 4E3NA 2CMNA 4Y15A 3NOPC 2PHYA 3IX8A 2WK0A 3ZG0A 3IWQA 3G31A 4KZ8A 2WADA 1OJGA 2C5WB 5EV0A 5KZHA 1E25A 4Z1WA 3IXDA 2ZM8A 4DJ3A 3CWFA 3BFFA 2ACGA 1KVMA 2WKEA 3G2YA 3QP6A 4NK3A 4CLCA 4EBNA 4GNUA 3T4LA 1AXBA 3NCKA 1OJ5A 3QP8A 1Z6FA 1W79A 1LT0A 4X6TA 4LRYC 3HLWA 5FEFA 3S7PA 3TE8A 3EWKA 5TJJA 2FFYA 4MCWA 5C5KA 4YOFA 3EGDC 3LIAA 2V0UA 3DW0A 4WN5A 5G18A 1XP4A 1Z09A 1BLHA 3NECA 4OPRA 4IBXA 3UN7A 5HWVA 3ZQ5A 1K56A 1XJ4A 3VOZA 1KDWA 4K0XA 4IJGA 3TRCA 2P7JA 4HNBA 3ZVWA 4PHTA 4OP8A 3HUOA 3M2KA 4GHIA 2NUPC 3G2ZA 3A3EA 4IVKA 1TS8A 2OLUA 3N8SA 2D01A 3K3CA 3MXQA 3MZDA 2P74A 4R0QA 5I94A 2IA2A 2VGLM 3BY8A 2HV1A 2OV5A 4WM9A 1Y4OA 1FCNA 4XT2B 3O87A 2INWA 1K57C 3HLEA 1OT9A 3OCLA 1BT5A 1PWCA 2R9WA 4KQOA 3ZNTA 4OOYA 2XGNA 3A0VA 2JKRI 3VP0A 1BLCA 5F5YA 2O9CA 4OLDA 3IS2B 5FAQA 4MEZA 3ZNYA 4UEYA 4E3JA 2QYBA 2JBFA 2Y2IA 4OPQA 2YKFA 4HOIA 4LV0A 4WMCD 5CGXA 3MSHA 4ETXA 3MKEA 3BQ8A 3NDGA 1OTEA 1K4EA 3UDIA 3L7HA 3CLOA 4Y13A 1BULA 4JF5A 3UE1A 2VA0A 5M18A 4N1XA 2XSSA 4C75A 4GLQA 4BBVA 1TVFA 5L10A 4BD0A 1L3LA 5DJUA 4DXCA 5EVID 2A24B 3H82A 3B47A 2J8YA 1T1AA 3AGEA 3NJAA 1JWVA 4FCFA 1SKFA 3Q7ZA 5JYPA 2JE5A 2XK1A 1MWTA 1G28A 3QNBA 2V8FA 1KGGA 3ZDJA 1HD8A 4GZBA 3PXPA 3SS4A 1V9YA 5KMWA 2DCFA 5CTNA 4JF6A 5E2GA 4BLMA 5HDDA 4FH2A 4X1MA 3VE4A 5HDSA 3VP2A 1P97A 3PAEA 2OAQ1 4HBTA 3BFGA 3K3DA 1HTZA 5IS1A 4KUKA 1NZUA 4LENA 4PKYA 1LHYA 1K38A 1FOFA 5L8MA 3O86A 1H8ZA 3UB9A 1BSGA 4HJ6A 2ZC4B 2G2WA 2PDRA 1G6AA 3DTMA 4Y0TA 1YPRA 1IFQA 1KVLA 3HVFA 5F6AA 4P0MA 5GHYA 3BFDA 3MZEA 4PAUA 4UAAA 4C3QA
chains in the Genus database with same CATH topology
3GRJA 4QB8A 5IHVA 4R1GA 3UPPA 1PI4A 2B5RA 4E3IA 1YLZA 2ZMAA 4KQQA 1KDSA 1ERQA 4WZ5A 2HP6A 1NYYA 5CHMA 2FFFB 1H5XA 1K4FA 1H8YA 1NRFA 5AQ9A 1YMXA 5F1GA 3VP3A 3HBRA 2WYXA 1HZOA 1ZC2A 3NDEA 4WYYA 3SH8A 3UPOA 2WGIA 3GMWA 3N4IA 2Y59A 4MBHA 4BJPA 1O07A 3LY4A 4JXGA 3FKVA 5FQ9A 4C6YA 4KZ4A 1GHPA 4E3OA 1K55C 3MXSA 3PBQA 1XKZA 1MXOA 5F83A 1ALQA 2ZQ9A 5A93A 3M6HA 3G35A 4ZBEA 2ZM0A 5TFQA 2ZLYA 3PBNA 3ZGAB 5EE8A 1QMFA 2HDUA 5CGWA 1PW8A 3Q07A 2CC1A 4S2KA 2WUQA 4KZAA 1RCJA 4PM9A 3E2KA 2ZD8A 1TDGA 4QHCA 2Y2OA 2J9PA 1ONGA 5EVLA 5FDHA 1JWPA 3BLSA 4R3BA 5EECA 1XX2A 3Q82A 2EX9A 5FI2A 4Y0UA 2EFXA 3D4FA 2Y2PA 1ZG4A 2DNSA 4ZJ3A 4KZ5A 1CK3A 1MWUA 2XFSA 3Q7VB 1CI8A 3AGFA 2Z2LB 5E2EA 1FR1A 1ZG6A 3WS5A 5KSHA 3Q81A 1L2SA 4KG6A 2I72A 4KZ6A 1JTDA 1OMEA 1YM1A 3O3VA 2Z2MB 4OOLA 5GLCA 4S2JA 3ZG7B 1VM1A 1PI5A 3GVBA 1EROA 2Y2QA 3VMAA 2ZQ7A 4IBRA 2Y2KA 3BRMA 3N6IA 5FASA 1N9BA 1TDLA 1PWGA 3ZFZA 2X01A 4U0XA 3A3JA 4DF6A 1GCEA 5A90A 3OZHA 1I2WA 3N8RA 1KE0A 5M1AA 4OPZA 1IEMA 5CERA 3S4XA 1GA9A 4GKUA 3RXXA 1IELA 4M3KA 1K25A 4DKIA 5L2FA 3BYDA 3IF6B 2Q9NA 1PZPA 2HDSA 4H8RA 3N8LA 3NY4A 3IH8A 2V20A 4UA6A 1L0FA 3WWXA 3OPRA 2P9VA 4ZJ1A 1W7FA 1SDNA 3NC8A 4HBUA 2C6WB 5CHUA 3LEZA 1ESUA 3OCNA 4JXVA 2A3UA 2XD1A 3E2LA 3LY3A 1K54A 1E4DA 4E3LA 3BFCA 1LI9A 1JWZA 2XEPA 4WELA 3OPHA 2ZJ9A 4D2OA 1CEFA 1O7EA 3C7UA 3LO7A 1SHVA 3VFFA 4DE3A 1YLPA 5EVIB 2XR0A 3NI9A 4N9KA 3TG9A 4ZAMA 1ONHA 4OONA 1XGIA 1IYQA 4BL3A 4DXBA 2EXBA 3IQAA 4BQMA 5FAOA 1I5QA 3GQZA 4MBKA 4PM8A 4EUZA 4U0TA 3BECA 1EWZA 4EV4A 3S1YA 2ZC5B 4A5RA 3FZCA 2EX8A 3V3SA 3M2JA 3UO9A 4EBPA 1YQSA 4HEFA 4MBFA 3UY6A 1Q2QA 4N9LA 2Q9MA 4UA7A 2X02A 5CHJA 3BM6A 5KSCA 3SS5A 1WE4A 4L0LA 2HPBA 3ZCZA 1LL9A 2H0TA 3UDFA 1RGYA 1KGFA 1CEGA 4PM6A 4R4RA 1VQQA 1FSYA 3MZFA 2X71A 2OSUA 2XD5A 4GB7A 4JF4A 4RA7A 3OPPA 3SH7A 4LV1A 1I2SA 4QY6A 4K0WA 4E3KA 4R23A 3GTCA 1RGZA 4DE2A 5BOHA 4RVAA 2EXAA 3HUMA 4P85A 5DF8A 5GHXA 5HARA 2UWXA 4KZ9A 1L0DA 3SS3A 4DDYA 4DRTA 5GL9A 2JCHA 2Y4AA 2H10A 4P6BA 4S2LA 4LV2A 1K55A 4B4ZA 2GDNA 3B3XA 5FQJA 5D3OA 1YLJA 3FV7A 1J9MA 3OC2A 3WS0A 4OPYA 4YFMA 4PPRA 3M6BA 1ES5A 2XDMA 2HDRA 2WGWA 3SOIA 4CPKA 4FSFA 3UE0A 1XGJA 3FYZA 5GLAA 3QNCA 1YMSA 5HAIA 4RYEA 4GD8A 4R3JA 2PBYA 4PMAA 2DRWA 4OQIA 1GA0A 4Q8IA 4JXWA 3A3DA 4OLGA 5FI7A 4PM5A 1LLBA 3N7WA 5A92A 1XA1A 2ZQAA 1NXYA 3C7VA 3TSGA 1WYBA 3G34A 4E3MA 1ESIA 2HP9A 2Y91A 3IHAA 4KG2A 5CRFA 2EX2A 2XFTA 3IXHA 1WYCA 4X69A 1BLPA 1N4OA 3VP1A 3IF6C 1SDEA 1W8QA 1PIOA 1MPLA 3G30A 3HLFA 4OQ0A 2WAEA 3IXGA 3FKWA 3IH9A 5J8XA 4IVIA 1MY8A 4E3NA 4P87A 2Y2LA 3A3IA 4JXSA 2WK0A 4NETA 3ZG0A 3IWQA 4BENA 4JPMA 1FR6A 3CJMA 4ZDXA 3G31A 4KZ8A 2WADA 2C5WB 5F82A 2E8IA 5HX9A 5KZHA 2Y2GA 1E25A 1CI9A 5EVIC 3PBOA 4DE1A 1PZOA 3GR2A 3IXDA 2ZM8A 3HLBA 4R4SA 3S22A 3HLCA 4KZ3A 3BFFA 3SH9A 5HL1A 1KVMA 4OVDA 2WAFA 1G68A 1M6KA 4FH4A 4QU3A 5CEBA 1HVBA 5FSRA 3HLDA 5FAPA 2WKEA 3G2YA 4NK3A 1JTGA 4BD1A 2WGVA 4EBNA 5HW3A 1KE4A 4GNUA 4MNRA 1AXBA 3NCKA 1Z6FA 4E6WA 1W79A 4GD6A 4U3TA 4X6TA 3RXWA 2J7VA 1KE3A 5DTKA 1NY0A 4QY5A 3HLWA 2FFYA 3HL9A 3CG5A 1XA7A 1LI0A 4CJNA 3ZG8B 4KG5A 4S2NC 4WEKA 1DJBA 2XH9A 3UPNA 4GDBA 4Y0OA 3A3FA 1M40A 4UA9A 3DW0A 3MFDA 4O7DA 4Z9QA 5AQAA 5FQKA 2BLSA 4N92A 2XQZA 4WZ4A 5G18A 4PM7A 1XP4A 4OKPA 4UHUA 5E43A 1BLHA 3HREA 1ES3A 3P09A 5DF7A 3VOYA 4OPRA 1ERMA 4IBXA 4DE0A 3UN7A 2HP5A 3MXRA 1EI5A 1K56A 1NYMA 4FD8A 3VOZA 1KDWA 1U60A 3WRTA 2PU2A 4K0XA 3G32A 3O88A 1BZAA 3W8KA 4XUZA 5FI6A 1DJCA 3ZVWA 3V50A 3PTEA 1S0WA 3TOIA 4OP8A 3HUOA 3M2KA 3G2ZA 2WZXA 3A3EA 4IVKA 3UDXA 2OLUA 5GLBA 3N8SA 1NZOA 1YLYA 3Q7VA 1MWRA 3QHYA 3MZDA 2P74A 5DVAA 5GHZA 4JKTA 1L0GA 3IXBA 1K56D 1W8YA 4R0QA 1IYPA 4E6XA 1IKGA 5I94A 1IKIA 2RL3A 3PBRA 2WKHA 3FWLA 5CGSA 4X68A 5AQBA 4WM9A 2OV5A 3WS2A 3EQUA 3IWIA 1FCNA 3O87A 4OOMA 2ZQ8A 4S2MA 3BLMA 1K57C 3HLEA 4YINA 3ISGA 3OCLA 3WS4A 1BT5A 2H0YA 2G2UA 2ZQDA 1PW1A 4HESA 5TR7A 2Y2MA 1PWCA 1TEMA 2R9WA 3DWKA 3GV9A 4KQOA 4KZ7A 4JBFA 5DF9A 3W4QA 2P9VB 3CMZA 4OOYA 3ZNTA 2J9OA 3PAGA 2XGNA 1ES2A 2EX6A 4B88A 4LCMA 1RP5A 5HAPA 3VP0A 2V1ZA 3V5MA 3IHBA 4GDNA 5TGFA 1BLCA 4XXRA 4GOGA 4BL2A 2V2FF 4WMCA 3UE3A 4KZBA 3ZVTA 4WZ5C 3G4PA 1ES4A 3IF6A 4S2OA 3WRZA 4OLDA 5U47A 3LCEA 3C4OA 1LL5A 3PBTA 5FAQA 1PYYA 4MEZA 3VFHA 3VSKA 3ZNYA 5CEDA 1ZKJA 4E3JA 1L0EA 1YLTA 2JBFA 2Y2IA 2EFUA 4OPQA 3W4PA 1W5DA 3ZG5A 4LV0A 3P98A 4S2IA 1FCOA 2VGKA 1IYSA 4RX2A 4WMCD 5CGXA 3VP4A 3MKEA 5M19A 4OQHA 3NDGA 1PWDA 2ZC7A 1K4EA 3NBLA 3UDIA 2QMIA 5EVIA 4RX3A 1XXMA 1BLSA 3BEBA 1MKIA 3IF5A 1BULA 4KENB 4JF5A 4KQRA 3UE1A 1FQGA 1KGEA 4N1XA 4ZJ2A 5M18A 2XF3A 4C75A 5FA7A 2QZ6A 1IYOA 2WZZA 2RCXA 3HUNA 3C5AA 1BTLA 2IWDA 4F94A 3DWZA 1TVFA 1SCWA 4X53A 4BD0A 2XLNA 1YT4A 5CXWA 5EOOA 3RJUA 3UNWA 4DXCA 3EQVA 2WKIA 3GSGA 5EVID 2JC7A 2ZM2A 1DY6A 3OPLA 2J8YA 3ITBA 5GLDA 3V3RA 3AGEA 4EBLA 2OLVA 5CTMA 2WGWB 1GHMA 4IEDA 2IWCA 3BFEA 3Q1FA 4FCFA 4S2NA 4EQIA 1SKFA 3VSLA 1K6SA 1E3UA 4MLLA 1S6RA 3Q7ZA 4ID4A 5JYPA 2JE5A 2XK1A 1MWTA 4K91A 3NIAA 3C4PA 1JVJA 2BG1A 3MKFA 1DJAA 5EOEA 3ITAA 4Y7PA 3PBSA 2PU4A 3QNBA 5FQMA 4B4XA 3AGDA 1KGGA 3ZDJA 1HD8A 2QPNA 3JYIA 3V39A 4GZBA 3SS4A 1MBLA 2ZQCA 3IT9A 5KMWA 2DCFA 1GHIA 5CTNA 2R9XA 4JF6A 4EWFA 4X56A 5E2GA 2Y55A 4BLMA 4FH2A 1FSWA 3I7JA 2VGJA 4S2PA 2H5SA 5FQQA 1E3UD 1Q2PA 4GN2A 4LV3A 3WS1A 1Y54A 3VP2A 4LCLA 4OH0A 1BUEA 4WEJA 2Y2JA 1MWSA 1C3BA 5E2HA 5HFOA 3PAEA 5FATA 3ZG9B 3HLGA 4HBTA 4QD4A 4XUXA 4ZTKA 1YLWA 3BFGA 1HTZA 3MBZA 4QJGA 1QMEA 5CECA 4JLFA 1NZUA 1K54C 4LENA 4N1HA 5F1FA 5EUAA 3IWOA 1LHYA 1K38A 1FOFA 2IWBA 3O86A 1H8ZA 1BSGA 3CZDA 2ZC4B 2A49A 4X55A 2G2WA 5JYOA 5HAQA 4WBGA 1G6AA 5A91A 3W4OA 5AQ7A 3DTMA 1K6RA 5EPHA 4Y0TA 2Y2NA 1KVLA 3ZHHA 3HVFA 4DDSA 5E2FA 1XPBA 4P0MA 1K57A 1NJ4A 2ZC6B 4OP5A 5GHYA 4OQGA 3BFDA 5DTTA 3MZEA 5DTSA 5FQIA 2ZC3B 2Y2HA 1JWVA 1FCMA 4UAAA 2HDQA 4C3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GRJ A;  4QB8 A;  5IHV A;  4R1G A;  3UPP A;  1PI4 A;  2B5R A;  4E3I A;  1YLZ A;  2ZMA A;  4KQQ A;  1KDS A;  1ERQ A;  4WZ5 A;  2HP6 A;  1NYY A;  5CHM A;  2FFF B;  1H5X A;  1K4F A;  1H8Y A;  1NRF A;  5AQ9 A;  1YMX A;  5F1G A;  3VP3 A;  3HBR A;  2WYX A;  1HZO A;  1ZC2 A;  3NDE A;  4WYY A;  3SH8 A;  3UPO A;  2WGI A;  3GMW A;  3N4I A;  2Y59 A;  4MBH A;  4BJP A;  1O07 A;  3LY4 A;  4JXG A;  3FKV A;  5FQ9 A;  4C6Y A;  4KZ4 A;  1GHP A;  4E3O A;  1K55 C;  3MXS A;  3PBQ A;  1XKZ A;  1MXO A;  5F83 A;  1ALQ A;  2ZQ9 A;  5A93 A;  3M6H A;  3G35 A;  4ZBE A;  2ZM0 A;  5TFQ A;  2ZLY A;  3PBN A;  3ZGA B;  5EE8 A;  1QMF A;  2HDU A;  5CGW A;  1PW8 A;  3Q07 A;  2CC1 A;  4S2K A;  2WUQ A;  4KZA A;  1RCJ A;  4PM9 A;  3E2K A;  2ZD8 A;  1TDG A;  4QHC A;  2Y2O A;  2J9P A;  1ONG A;  5EVL A;  5FDH A;  1JWP A;  3BLS A;  4R3B A;  5EEC A;  1XX2 A;  3Q82 A;  2EX9 A;  5FI2 A;  4Y0U A;  2EFX A;  3D4F A;  2Y2P A;  1ZG4 A;  2DNS A;  4ZJ3 A;  4KZ5 A;  1CK3 A;  1MWU A;  2XFS A;  3Q7V B;  1CI8 A;  3AGF A;  2Z2L B;  5E2E A;  1FR1 A;  1ZG6 A;  3WS5 A;  5KSH A;  3Q81 A;  1L2S A;  4KG6 A;  2I72 A;  4KZ6 A;  1JTD A;  1OME A;  1YM1 A;  3O3V A;  2Z2M B;  4OOL A;  5GLC A;  4S2J A;  3ZG7 B;  1VM1 A;  1PI5 A;  3GVB A;  1ERO A;  2Y2Q A;  3VMA A;  2ZQ7 A;  4IBR A;  2Y2K A;  3BRM A;  3N6I A;  5FAS A;  1N9B A;  1TDL A;  1PWG A;  3ZFZ A;  2X01 A;  4U0X A;  3A3J A;  4DF6 A;  1GCE A;  5A90 A;  3OZH A;  1I2W A;  3N8R A;  1KE0 A;  5M1A A;  4OPZ A;  1IEM A;  5CER A;  3S4X A;  1GA9 A;  4GKU A;  3RXX A;  1IEL A;  4M3K A;  1K25 A;  4DKI A;  5L2F A;  3BYD A;  3IF6 B;  2Q9N A;  1PZP A;  2HDS A;  4H8R A;  3N8L A;  3NY4 A;  3IH8 A;  2V20 A;  4UA6 A;  1L0F A;  3WWX A;  3OPR A;  2P9V A;  4ZJ1 A;  1W7F A;  1SDN A;  3NC8 A;  4HBU A;  2C6W B;  5CHU A;  3LEZ A;  1ESU A;  3OCN A;  4JXV A;  2A3U A;  2XD1 A;  3E2L A;  3LY3 A;  1K54 A;  1E4D A;  4E3L A;  3BFC A;  1LI9 A;  1JWZ A;  2XEP A;  4WEL A;  3OPH A;  2ZJ9 A;  4D2O A;  1CEF A;  1O7E A;  3C7U A;  3LO7 A;  1SHV A;  3VFF A;  4DE3 A;  1YLP A;  5EVI B;  2XR0 A;  3NI9 A;  4N9K A;  3TG9 A;  4ZAM A;  1ONH A;  4OON A;  1XGI A;  1IYQ A;  4BL3 A;  4DXB A;  2EXB A;  3IQA A;  4BQM A;  5FAO A;  1I5Q A;  3GQZ A;  4MBK A;  4PM8 A;  4EUZ A;  4U0T A;  3BEC A;  1EWZ A;  4EV4 A;  3S1Y A;  2ZC5 B;  4A5R A;  3FZC A;  2EX8 A;  3V3S A;  3M2J A;  3UO9 A;  4EBP A;  1YQS A;  4HEF A;  4MBF A;  3UY6 A;  1Q2Q A;  4N9L A;  2Q9M A;  4UA7 A;  2X02 A;  5CHJ A;  3BM6 A;  5KSC A;  3SS5 A;  1WE4 A;  4L0L A;  2HPB A;  3ZCZ A;  1LL9 A;  2H0T A;  3UDF A;  1RGY A;  1KGF A;  1CEG A;  4PM6 A;  4R4R A;  1VQQ A;  1FSY A;  3MZF A;  2X71 A;  2OSU A;  2XD5 A;  4GB7 A;  4JF4 A;  4RA7 A;  3OPP A;  3SH7 A;  4LV1 A;  1I2S A;  4QY6 A;  4K0W A;  4E3K A;  4R23 A;  3GTC A;  1RGZ A;  4DE2 A;  5BOH A;  4RVA A;  2EXA A;  3HUM A;  4P85 A;  5DF8 A;  5GHX A;  5HAR A;  2UWX A;  4KZ9 A;  1L0D A;  3SS3 A;  4DDY A;  4DRT A;  5GL9 A;  2JCH A;  2Y4A A;  2H10 A;  4P6B A;  4S2L A;  4LV2 A;  1K55 A;  4B4Z A;  2GDN A;  3B3X A;  5FQJ A;  5D3O A;  1YLJ A;  3FV7 A;  1J9M A;  3OC2 A;  3WS0 A;  4OPY A;  4YFM A;  4PPR A;  3M6B A;  1ES5 A;  2XDM A;  2HDR A;  2WGW A;  3SOI A;  4CPK A;  4FSF A;  3UE0 A;  1XGJ A;  3FYZ A;  5GLA A;  3QNC A;  1YMS A;  5HAI A;  4RYE A;  4GD8 A;  4R3J A;  2PBY A;  4PMA A;  2DRW A;  4OQI A;  1GA0 A;  4Q8I A;  4JXW A;  3A3D A;  4OLG A;  5FI7 A;  4PM5 A;  1LLB A;  3N7W A;  5A92 A;  1XA1 A;  2ZQA A;  1NXY A;  3C7V A;  3TSG A;  1WYB A;  3G34 A;  4E3M A;  1ESI A;  2HP9 A;  2Y91 A;  3IHA A;  4KG2 A;  5CRF A;  2EX2 A;  2XFT A;  3IXH A;  1WYC A;  4X69 A;  1BLP A;  1N4O A;  3VP1 A;  3IF6 C;  1SDE A;  1W8Q A;  1PIO A;  1MPL A;  3G30 A;  3HLF A;  4OQ0 A;  2WAE A;  3IXG A;  3FKW A;  3IH9 A;  5J8X A;  4IVI A;  1MY8 A;  4E3N A;  4P87 A;  2Y2L A;  3A3I A;  4JXS A;  2WK0 A;  4NET A;  3ZG0 A;  3IWQ A;  4BEN A;  4JPM A;  1FR6 A;  3CJM A;  4ZDX A;  3G31 A;  4KZ8 A;  2WAD A;  2C5W B;  5F82 A;  2E8I A;  5HX9 A;  5KZH A;  2Y2G A;  1E25 A;  1CI9 A;  5EVI C;  3PBO A;  4DE1 A;  1PZO A;  3GR2 A;  3IXD A;  2ZM8 A;  3HLB A;  4R4S A;  3S22 A;  3HLC A;  4KZ3 A;  3BFF A;  3SH9 A;  5HL1 A;  1KVM A;  4OVD A;  2WAF A;  1G68 A;  1M6K A;  4FH4 A;  4QU3 A;  5CEB A;  1HVB A;  5FSR A;  3HLD A;  5FAP A;  2WKE A;  3G2Y A;  4NK3 A;  1JTG A;  4BD1 A;  2WGV A;  4EBN A;  5HW3 A;  1KE4 A;  4GNU A;  4MNR A;  1AXB A;  3NCK A;  1Z6F A;  4E6W A;  1W79 A;  4GD6 A;  4U3T A;  4X6T A;  3RXW A;  2J7V A;  1KE3 A;  5DTK A;  1NY0 A;  4QY5 A;  3HLW A;  2FFY A;  3HL9 A;  3CG5 A;  1XA7 A;  1LI0 A;  4CJN A;  3ZG8 B;  4KG5 A;  4S2N C;  4WEK A;  1DJB A;  2XH9 A;  3UPN A;  4GDB A;  4Y0O A;  3A3F A;  1M40 A;  4UA9 A;  3DW0 A;  3MFD A;  4O7D A;  4Z9Q A;  5AQA A;  5FQK A;  2BLS A;  4N92 A;  2XQZ A;  4WZ4 A;  5G18 A;  4PM7 A;  1XP4 A;  4OKP A;  4UHU A;  5E43 A;  1BLH A;  3HRE A;  1ES3 A;  3P09 A;  5DF7 A;  3VOY A;  4OPR A;  1ERM A;  4IBX A;  4DE0 A;  3UN7 A;  2HP5 A;  3MXR A;  1EI5 A;  1K56 A;  1NYM A;  4FD8 A;  3VOZ A;  1KDW A;  1U60 A;  3WRT A;  2PU2 A;  4K0X A;  3G32 A;  3O88 A;  1BZA A;  3W8K A;  4XUZ A;  5FI6 A;  1DJC A;  3ZVW A;  3V50 A;  3PTE A;  1S0W A;  3TOI A;  4OP8 A;  3HUO A;  3M2K A;  3G2Z A;  2WZX A;  3A3E A;  4IVK A;  3UDX A;  2OLU A;  5GLB A;  3N8S A;  1NZO A;  1YLY A;  3Q7V A;  1MWR A;  3QHY A;  3MZD A;  2P74 A;  5DVA A;  5GHZ A;  4JKT A;  1L0G A;  3IXB A;  1K56 D;  1W8Y A;  4R0Q A;  1IYP A;  4E6X A;  1IKG A;  5I94 A;  1IKI A;  2RL3 A;  3PBR A;  2WKH A;  3FWL A;  5CGS A;  4X68 A;  5AQB A;  4WM9 A;  2OV5 A;  3WS2 A;  3EQU A;  3IWI A;  1FCN A;  3O87 A;  4OOM A;  2ZQ8 A;  4S2M A;  3BLM A;  1K57 C;  3HLE A;  4YIN A;  3ISG A;  3OCL A;  3WS4 A;  1BT5 A;  2H0Y A;  2G2U A;  2ZQD A;  1PW1 A;  4HES A;  5TR7 A;  2Y2M A;  1PWC A;  1TEM A;  2R9W A;  3DWK A;  3GV9 A;  4KQO A;  4KZ7 A;  4JBF A;  5DF9 A;  3W4Q A;  2P9V B;  3CMZ A;  4OOY A;  3ZNT A;  2J9O A;  3PAG A;  2XGN A;  1ES2 A;  2EX6 A;  4B88 A;  4LCM A;  1RP5 A;  5HAP A;  3VP0 A;  2V1Z A;  3V5M A;  3IHB A;  4GDN A;  5TGF A;  1BLC A;  4XXR A;  4GOG A;  4BL2 A;  2V2F F;  4WMC A;  3UE3 A;  4KZB A;  3ZVT A;  4WZ5 C;  3G4P A;  1ES4 A;  3IF6 A;  4S2O A;  3WRZ A;  4OLD A;  5U47 A;  3LCE A;  3C4O A;  1LL5 A;  3PBT A;  5FAQ A;  1PYY A;  4MEZ A;  3VFH A;  3VSK A;  3ZNY A;  5CED A;  1ZKJ A;  4E3J A;  1L0E A;  1YLT A;  2JBF A;  2Y2I A;  2EFU A;  4OPQ A;  3W4P A;  1W5D A;  3ZG5 A;  4LV0 A;  3P98 A;  4S2I A;  1FCO A;  2VGK A;  1IYS A;  4RX2 A;  4WMC D;  5CGX A;  3VP4 A;  3MKE A;  5M19 A;  4OQH A;  3NDG A;  1PWD A;  2ZC7 A;  1K4E A;  3NBL A;  3UDI A;  2QMI A;  5EVI A;  4RX3 A;  1XXM A;  1BLS A;  3BEB A;  1MKI A;  3IF5 A;  1BUL A;  4KEN B;  4JF5 A;  4KQR A;  3UE1 A;  1FQG A;  1KGE A;  4N1X A;  4ZJ2 A;  5M18 A;  2XF3 A;  4C75 A;  5FA7 A;  2QZ6 A;  1IYO A;  2WZZ A;  2RCX A;  3HUN A;  3C5A A;  1BTL A;  2IWD A;  4F94 A;  3DWZ A;  1TVF A;  1SCW A;  4X53 A;  4BD0 A;  2XLN A;  1YT4 A;  5CXW A;  5EOO A;  3RJU A;  3UNW A;  4DXC A;  3EQV A;  2WKI A;  3GSG A;  5EVI D;  2JC7 A;  2ZM2 A;  1DY6 A;  3OPL A;  2J8Y A;  3ITB A;  5GLD A;  3V3R A;  3AGE A;  4EBL A;  2OLV A;  5CTM A;  2WGW B;  1GHM A;  4IED A;  2IWC A;  3BFE A;  3Q1F A;  4FCF A;  4S2N A;  4EQI A;  1SKF A;  3VSL A;  1K6S A;  1E3U A;  4MLL A;  1S6R A;  3Q7Z A;  4ID4 A;  5JYP A;  2JE5 A;  2XK1 A;  1MWT A;  4K91 A;  3NIA A;  3C4P A;  1JVJ A;  2BG1 A;  3MKF A;  1DJA A;  5EOE A;  3ITA A;  4Y7P A;  3PBS A;  2PU4 A;  3QNB A;  5FQM A;  4B4X A;  3AGD A;  1KGG A;  3ZDJ A;  1HD8 A;  2QPN A;  3JYI A;  3V39 A;  4GZB A;  3SS4 A;  1MBL A;  2ZQC A;  3IT9 A;  5KMW A;  2DCF A;  1GHI A;  5CTN A;  2R9X A;  4JF6 A;  4EWF A;  4X56 A;  5E2G A;  2Y55 A;  4BLM A;  4FH2 A;  1FSW A;  3I7J A;  2VGJ A;  4S2P A;  2H5S A;  5FQQ A;  1E3U D;  1Q2P A;  4GN2 A;  4LV3 A;  3WS1 A;  1Y54 A;  3VP2 A;  4LCL A;  4OH0 A;  1BUE A;  4WEJ A;  2Y2J A;  1MWS A;  1C3B A;  5E2H A;  5HFO A;  3PAE A;  5FAT A;  3ZG9 B;  3HLG A;  4HBT A;  4QD4 A;  4XUX A;  4ZTK A;  1YLW A;  3BFG A;  1HTZ A;  3MBZ A;  4QJG A;  1QME A;  5CEC A;  4JLF A;  1NZU A;  1K54 C;  4LEN A;  4N1H A;  5F1F A;  5EUA A;  3IWO A;  1LHY A;  1K38 A;  1FOF A;  2IWB A;  3O86 A;  1H8Z A;  1BSG A;  3CZD A;  2ZC4 B;  2A49 A;  4X55 A;  2G2W A;  5JYO A;  5HAQ A;  4WBG A;  1G6A A;  5A91 A;  3W4O A;  5AQ7 A;  3DTM A;  1K6R A;  5EPH A;  4Y0T A;  2Y2N A;  1KVL A;  3ZHH A;  3HVF A;  4DDS A;  5E2F A;  1XPB A;  4P0M A;  1K57 A;  1NJ4 A;  2ZC6 B;  4OP5 A;  5GHY A;  4OQG A;  3BFD A;  5DTT A;  3MZE A;  5DTS A;  5FQI A;  2ZC3 B;  2Y2H A;  1JWV A;  1FCM A;  4UAA A;  2HDQ A;  4C3Q A; 
#chains in the Genus database with same CATH topology
 3UB6 A;  3R7W A;  4QB8 A;  1UWN X;  3UPP A;  3KX0 X;  4BMW A;  2J3T C;  1BYW A;  3D3O A;  5CHM A;  4WZ5 A;  4GW9 A;  2WYX A;  3NDE A;  4NG2 A;  5I5L A;  4BJP A;  2BAS A;  4JXG A;  2K2N A;  5FQ9 A;  4C6Y A;  1GHP A;  1OT6 A;  4EXO A;  5F83 A;  3CUE A;  2LB9 A;  3LI9 A;  5J3W A;  1S4R A;  3Q07 A;  5EVL A;  2J80 A;  1CJF A;  2PD8 A;  4Y0U A;  2DNS A;  1MWU A;  1P9W A;  3IX3 A;  2M7V A;  1FR1 A;  1ZG6 A;  4JGO A;  5KSH A;  2I72 A;  1OME A;  1Y28 A;  3O3V A;  2Z2M B;  4OOL A;  1MZU A;  4R38 A;  2Y2Q A;  5HWT A;  4IBR A;  3BRM A;  1D7E A;  3ZFZ A;  3KYQ A;  3RTY A;  5HD3 A;  3T4S A;  5CER A;  5G4Y A;  1K25 A;  1LSV A;  3BYD A;  2VKS A;  2HDS A;  1ZHH B;  4H8R A;  2V20 A;  2P9V A;  4L9G A;  1SDN A;  3NC8 A;  2XD1 A;  4K08 A;  4E3L A;  1JWZ A;  4WEL A;  3VFF A;  3BW6 A;  1YLP A;  2XR0 A;  4M4X A;  3MS6 A;  3NOU C;  4EU0 A;  3IQA A;  1I5Q A;  5HWW A;  4PM8 A;  3BEC A;  5EM1 A;  5DJT A;  4Q0I A;  3RH8 B;  4MN6 A;  2ZC5 B;  3FZC A;  4G3K A;  4G3V A;  3UO9 A;  4HEF A;  3UY6 A;  1Q2Q A;  4N9L A;  2Q9M A;  4UA7 A;  2X02 A;  5CHJ A;  3C8C A;  1WE4 A;  1KOU A;  2B18 A;  2H0T A;  4PM6 A;  1KGF A;  3MZF A;  5G4Z A;  5HD5 A;  4BBT A;  4R23 A;  1RGZ A;  4RVA A;  2EXA A;  4P85 A;  4GJ4 A;  4NXE A;  1L0D A;  3KSH A;  4O0P A;  2JCH A;  2Y4A A;  4IUK A;  2H10 A;  4S2L A;  5A8B A;  2GDN A;  3B3X A;  2QHK A;  3QP5 A;  1J9M A;  3LI8 A;  1OTI A;  1OTB A;  3TJZ C;  1XGJ A;  4G3W A;  3O5Y A;  2ZOH A;  5HAI A;  2DRW A;  1WA9 A;  4Q8I A;  4R3A A;  1LLB A;  4YWZ A;  1NXY A;  2Y79 A;  1WYB A;  3G34 A;  5HZH A;  3IHA A;  3EGX C;  2YKH A;  3IXH A;  4WL9 A;  4WLA A;  3VP1 A;  1S4S A;  1SDE A;  1W8Q A;  3G30 A;  3W2Z A;  3CPT B;  3FKW A;  3DTE A;  3PR6 A;  4P87 A;  4KUO A;  4JXS A;  4NET A;  4BEN A;  3BY9 A;  4ZDX A;  5F82 A;  2E8I A;  4Y2F A;  1CQA A;  3R4K A;  3HLB A;  4R4S A;  3S22 A;  3C2W A;  3SH9 A;  4OVD A;  3VOL A;  3U2A A;  1T1C A;  5AVE A;  3ZYT A;  4U3T A;  2DMW A;  4EES A;  3CG5 A;  1XA7 A;  1LI0 A;  2KLI A;  2XH9 A;  4GDB A;  3A3F A;  4UA9 A;  4Z9Q A;  5AQA A;  4F3L B;  4N92 A;  4Q0H A;  5E43 A;  2HF6 A;  3OOV A;  4ARZ A;  4FUW A;  3HRE A;  2WKQ A;  5DF7 A;  2W3H A;  2Y8H A;  1NYM A;  3QP2 A;  5DFX A;  1U60 A;  1BZA A;  3W8K A;  1W63 M;  5FI6 A;  2I9V A;  3PTE A;  5HDC A;  5GLB A;  1S66 L;  3BWL A;  3Q7V A;  1MWR A;  5GHZ A;  2HJE A;  1W8Y A;  2Z6C A;  2W1T B;  4E6X A;  2W3E A;  5CGS A;  2RL3 A;  2WKH A;  3FWL A;  2VV8 A;  5AQB A;  3WS2 A;  2W3F A;  3GEC A;  3IWI A;  4I39 A;  4S2M A;  4YIN A;  3ISG A;  3WS4 A;  1PW1 A;  1TEM A;  3DWK A;  4KZ7 A;  3CMZ A;  3PAG A;  4B88 A;  4NXF A;  5TBM A;  1RP5 A;  5HAP A;  3V5M A;  1SKO B;  4GDN A;  4GOG A;  4WMC A;  4KZB A;  3ZVT A;  3G4P A;  3IF6 A;  1J3W A;  3LCE A;  1PYY A;  3VFH A;  3VSK A;  1NWZ A;  2L1M A;  2PBD P;  2XRN A;  4I3J A;  2NUT C;  3BJN A;  3H7W A;  2VEA A;  5EVI A;  2VV6 A;  4RX3 A;  2XA7 S;  1BLS A;  3BEB A;  4KEN B;  2UV0 E;  5FA7 A;  3F1O B;  1IYO A;  3V67 A;  1BTL A;  3DWZ A;  4R6L A;  5DFY A;  3PYP A;  3RJU A;  3EQV A;  2WKI A;  1MKM A;  1N9N A;  3OPL A;  2O9B A;  3UB7 A;  3V3R A;  2XA7 M;  2OLV A;  5CTM A;  4IED A;  2IWC A;  4S2N A;  1K6S A;  4MLL A;  1S6R A;  3C4P A;  3DBA A;  2OWH A;  4NKP A;  3JYI A;  3V39 A;  2O9A A;  4LRZ E;  2EA9 A;  3I7J A;  2ZMF A;  5HL6 A;  4S2P A;  4GN2 A;  1OPX A;  4LV3 A;  3WS1 A;  4LCL A;  1N9O A;  2VGL S;  3FG8 A;  1MWS A;  5E2H A;  5HFO A;  1PRQ A;  5FAT A;  3HLG A;  2QJ7 A;  4QD4 A;  4XUX A;  1YLW A;  4ZRR A;  4JLF A;  1K54 C;  5EUA A;  4QPR A;  2W1R A;  1NRJ A;  2A49 A;  5JYO A;  3GDI A;  4UQI S;  5EPH A;  2W3G A;  2Y2N A;  5E2F A;  4CLC B;  2ZC6 B;  4OP5 A;  1VEU A;  3KYE A;  5FQI A;  2W0N A;  2ZC3 B;  1FCM A;  2V8C A;  2HDQ A;  3EOI A;  2B5R A;  4E3I A;  2XRO A;  1KDS A;  1ERQ A;  1TF1 A;  3FPW A;  2FFF B;  1D06 A;  1K4F A;  2PR6 A;  1NRF A;  5AQ9 A;  4DN0 A;  1YMX A;  4UQI M;  2JKT M;  3HBR A;  3T4K A;  1HZO A;  1ZC2 A;  4WYY A;  3SH8 A;  3UPO A;  3MQ0 A;  2WGI A;  3N4I A;  2Y59 A;  4H6J B;  2ZQ9 A;  3G35 A;  2ZM0 A;  3T1S A;  3ZGA B;  5EE8 A;  5CGW A;  1PW8 A;  2CC1 A;  4S2K A;  1RCJ A;  3E2K A;  2ZD8 A;  4QHC A;  1ONG A;  3BLS A;  4R3B A;  5EEC A;  4GHI B;  1AWI A;  5EVE A;  4ZJ3 A;  4WF0 A;  3MR0 A;  5E2E A;  1DRM A;  3WS5 A;  3Q81 A;  1G5U A;  5GLC A;  1VM1 A;  3VMA A;  1GSV A;  1N9B A;  1TDL A;  2X01 A;  4DF6 A;  3OZH A;  3N8R A;  1IEM A;  4GKU A;  1IEL A;  4M3K A;  4BBU A;  3F1P A;  4CLC C;  3UME A;  3IH8 A;  1L0F A;  4ZJ1 A;  2V1A A;  5CHU A;  3OCN A;  2A3U A;  4P6Z M;  4MMN A;  4DMZ A;  1E4D A;  4HJ4 A;  2XEP A;  4D2O A;  3C7U A;  4I5S A;  1SHV A;  4X1L A;  4DE3 A;  2V1B A;  2EXB A;  3VV4 A;  4MBK A;  4U0T A;  4EV4 A;  1VET A;  3S1Y A;  4A5R A;  2EX8 A;  4EEP A;  1TS0 A;  1T1B A;  3M2J A;  4GS9 A;  3SS5 A;  4HP9 A;  3HJI A;  4NXG A;  2HPB A;  3ZCZ A;  3H82 B;  1H0M A;  1FSY A;  2OSU A;  4GB7 A;  3C38 A;  3SH7 A;  4LV1 A;  4QY6 A;  4E3K A;  1K0K A;  5BOH A;  5DF8 A;  2UWX A;  4DRT A;  2EWW A;  2L4R A;  1K55 A;  5D3O A;  1YLJ A;  3FV7 A;  2J3T D;  4YFM A;  1ES5 A;  2XDM A;  2WGW A;  3SOI A;  1G6O A;  3UE0 A;  5J7E A;  2JKT I;  1YMS A;  4GD8 A;  2PBY A;  4PMA A;  1GA0 A;  2HJ9 C;  1SZV A;  3A3D A;  3T12 B;  3N7W A;  1XA1 A;  2ZQA A;  3D9Y A;  4E3M A;  1ESI A;  5CRF A;  2XFT A;  1PIO A;  3LFV A;  4L9E A;  3IXG A;  5J8X A;  3IH9 A;  3NHQ A;  3LEQ A;  3HCY A;  4II7 A;  5IT5 A;  3CJM A;  4YNR A;  3ULF A;  5HX9 A;  2Y2G A;  3R7W B;  2ZOI A;  4DE1 A;  2M1C A;  4GCZ A;  5HL1 A;  4NEE D;  2WAF A;  4FH4 A;  4QU3 A;  1HVB A;  5FSR A;  4BD1 A;  2WGV A;  5HW3 A;  4E6W A;  2R78 A;  2VZW A;  2O0Y A;  3RXW A;  1KE3 A;  1NY0 A;  1F98 A;  4CJN A;  3ZG8 B;  4KG5 A;  4WEK A;  1YSP A;  1H3Q A;  4Y0O A;  1TS6 A;  1LL8 A;  2GJ3 A;  4O7D A;  1S67 L;  3LIC A;  4WZ4 A;  5KIZ A;  4OKP A;  3QP1 A;  4UHU A;  1ES3 A;  3P09 A;  4HQA A;  3UMD A;  1PFL A;  2HP5 A;  1EI5 A;  5AJG A;  4CLC E;  2PU2 A;  3G32 A;  3O88 A;  4XUZ A;  1F2K A;  4DJ2 A;  3LR3 A;  1S0W A;  3TOI A;  2P04 A;  2J3W A;  3EEH A;  3DAV A;  1NZO A;  3CPT A;  1YLY A;  3QHY A;  1OTA A;  4JKT A;  1L0G A;  3IXB A;  1IKG A;  3IBR A;  3PBR A;  5F68 A;  3EQU A;  4OOM A;  2ZQ8 A;  3L9K A;  1P0Z A;  2G2U A;  2ZQD A;  5TR7 A;  4HES A;  3GV9 A;  4ME4 A;  4HI4 A;  3W4Q A;  2P9V B;  4B93 A;  2J9O A;  1ES2 A;  2EX6 A;  4LCM A;  3E4O A;  1XJ6 A;  5TGF A;  2WKR A;  4WZ5 C;  3WRZ A;  5U47 A;  3C4O A;  1LL5 A;  5CED A;  1YSQ A;  1ZKJ A;  4EET B;  2EFU A;  3ZG5 A;  3CUE C;  3P98 A;  3VP4 A;  1IYS A;  4RX2 A;  3FPV A;  4Y5F A;  5M19 A;  4OQH A;  1PWD A;  1DP8 A;  1TD5 A;  3NBL A;  2V9A A;  1KGE A;  4ZJ2 A;  3P01 A;  2XF3 A;  4MN5 A;  5FL3 A;  2RCX A;  3HUN A;  3C5A A;  2IWD A;  4F94 A;  2D02 A;  4WUJ A;  2XLN A;  1YT4 A;  5CXW A;  1JNU A;  3UNW A;  5FEG A;  3GSG A;  2JC7 A;  2Q0O A;  2ZM2 A;  2P08 A;  1DY6 A;  2ZL1 A;  3UB8 A;  3ITB A;  5GLD A;  2WKP A;  3MQO A;  1GHM A;  3CI6 A;  3Q1F A;  4QWO A;  3VSL A;  3LUQ A;  5HPF A;  4K91 A;  3NIA A;  2BG1 A;  2KOI A;  3MKF A;  3PBS A;  5FQM A;  3AGD A;  4AFI A;  3LR4 A;  3H9W A;  3ICY A;  3IT9 A;  2R9X A;  4EWF A;  2Y55 A;  1FSW A;  4I38 A;  2VGJ A;  2H5S A;  1W63 Q;  1E3U D;  3D72 A;  1Y54 A;  4OH0 A;  4WEJ A;  2Y2J A;  2QJ5 A;  3F1N A;  4MDZ A;  4ZTK A;  3MBZ A;  3PHY A;  4QJG A;  5F1F A;  5F69 A;  3CZD A;  3S7O A;  4WBG A;  3W4O A;  5A91 A;  3ZHH A;  4HY8 A;  1K57 A;  1NJ4 A;  2K31 A;  3JPU A;  1A0K A;  2Z6D A;  5DTT A;  2Y2H A;  2AVX A;  4KQD A;  5IHV A;  4R1G A;  3TW8 A;  1YLZ A;  2QWS A;  3U4L P;  4KQQ A;  1NYY A;  1H5X A;  2KDK A;  3DTK A;  1H8Y A;  1UWP X;  2VK3 A;  2E8J A;  3DTI A;  3K2N A;  3GMW A;  2W3D A;  1O07 A;  4E3O A;  3CHW P;  3PBQ A;  1XKZ A;  1MXO A;  4ARZ B;  3M6H A;  4ZBE A;  5TFQ A;  2ZLY A;  5HPI A;  2HDU A;  2BTF P;  4LFU A;  2V0W A;  4PM9 A;  1TDG A;  5LBR A;  2J9P A;  2ZBB A;  5FDH A;  2EX9 A;  1GSW A;  5FI2 A;  2EFX A;  3D4F A;  2Y2P A;  3CAX A;  4KZ5 A;  1CK3 A;  4O01 A;  2LB5 A;  3Q7V B;  1CI8 A;  3IBJ A;  2GZA A;  3LR5 A;  1L2S A;  4KG6 A;  3OBF A;  3ZG7 B;  1PI5 A;  2K7S A;  2B95 A;  2PYP A;  3N6I A;  1PWG A;  3T1X A;  3A3J A;  1GCE A;  5A90 A;  5M1A A;  5DKK A;  5TBM B;  3RXX A;  4FTX A;  3S7Q A;  4DKI A;  4XT2 A;  4FOF A;  3IF6 B;  2Q9N A;  3P7N A;  1PZP A;  3N8L A;  4UA6 A;  3WWX A;  2C6W B;  1ESU A;  4EW7 A;  3IS2 A;  3H7W B;  5EM0 A;  1O7E A;  2MJ6 A;  5EVI B;  3TG9 A;  4ZAM A;  3E4P A;  1XGI A;  4H6J A;  4DXB A;  3CIT A;  1LSW A;  5FAO A;  1LSX A;  4LLO B;  1YQS A;  4HHD A;  4Y3I A;  3UDF A;  1CEG A;  4R4R A;  2OOL A;  2XD5 A;  4JF4 A;  3OPP A;  1I2S A;  3VE3 A;  3HUM A;  3UE6 A;  3NUL A;  5GHX A;  4D60 A;  4KZ9 A;  5GL9 A;  2A24 A;  4P6B A;  4B4Z A;  5FQJ A;  3WS0 A;  4OPY A;  1XJ3 A;  2HDR A;  1F9I A;  4FSF A;  5GLA A;  4RYE A;  4B9O A;  4OQI A;  4CQH A;  4OLG A;  2FH5 A;  5A92 A;  3C7V A;  2HP9 A;  4KG2 A;  5L09 A;  3E4Q A;  1BLP A;  1N4O A;  3IF6 C;  4HH2 A;  1MPL A;  2WAE A;  4L9F A;  3BQA A;  2PRF A;  4HP4 A;  2Y2L A;  3A3I A;  1VEU B;  4JPM A;  1FR6 A;  4ETZ A;  1XJ2 A;  1CI9 A;  5EVI C;  3PBO A;  1PZO A;  3GR2 A;  1T19 A;  2G7U A;  3HLC A;  4P6Z S;  4KZ3 A;  5EFW A;  3OLO A;  4Y17 A;  3MMH A;  1G68 A;  5CEB A;  1M6K A;  4IUH A;  3HLD A;  5FAP A;  3T4Q A;  1JTG A;  1YAX A;  1KE4 A;  4I3A A;  4MNR A;  4BWI A;  4GD6 A;  2J7V A;  5J4E A;  5DTK A;  1PNE A;  4QY5 A;  1ODV A;  3HL9 A;  4CLC D;  4S2N C;  3LID A;  1DJB A;  3KSI A;  3UPN A;  1M40 A;  4EEU A;  3MFD A;  5FQK A;  2BLS A;  2XQZ A;  4PM7 A;  4LRX C;  3KSF A;  1ACF A;  2PAV P;  3VOY A;  1ERM A;  4DE0 A;  5IU1 A;  3T4T A;  3MXR A;  4FD8 A;  3WRT A;  3NOT C;  2OWJ A;  1DJC A;  3V50 A;  4LPZ A;  2JN7 A;  2WZX A;  3UDX A;  5AVF A;  1VB6 A;  2HZ5 A;  5DVA A;  3LIE A;  3LR0 A;  1K56 D;  3E98 A;  3T4J A;  1IYP A;  1IKI A;  2VJW A;  4X68 A;  1DP9 A;  3F1P B;  4ESP A;  3BLM A;  2QKP A;  5L07 A;  2H0Y A;  2Y2M A;  2GNX A;  5DF9 A;  4JBF A;  5HSQ A;  2V1Z A;  3IHB A;  4RQ9 A;  4XXR A;  1DP6 A;  4BL2 A;  2V2F F;  3UE3 A;  1ES4 A;  4S2O A;  3PBT A;  4IHQ A;  4EER A;  3T4O A;  1L0E A;  1YLT A;  3W4P A;  1W5D A;  1VET B;  2PT7 A;  1TS7 A;  4S2I A;  1FCO A;  2VGK A;  4JGP A;  1FIK A;  2ZC7 A;  4GS9 B;  2QMI A;  4I3I A;  1XXM A;  1MKI A;  3IF5 A;  4KQR A;  1FQG A;  1FIL A;  4X25 A;  2QZ6 A;  2WZZ A;  1HLU P;  1SCW A;  4X53 A;  5EOO A;  3KYZ A;  1YKD A;  3MFX A;  1D1J A;  2HGV A;  3JVU A;  2VLG A;  4EBL A;  2VV7 A;  1GSX A;  2WGW B;  5FDS A;  3BFE A;  4EQI A;  1E3U A;  4ID4 A;  1JVJ A;  5EOE A;  1DJA A;  3ITA A;  4Y7P A;  2PU4 A;  4B4X A;  1T18 A;  2QPN A;  2W27 A;  3LIF A;  1MBL A;  2ZQC A;  1GHI A;  4EQ1 A;  4X56 A;  2JKG A;  3HJK A;  5FQQ A;  1Q2P A;  1MC0 A;  1BUE A;  1C3B A;  3ZG9 B;  3A0R A;  1QME A;  5CEC A;  4N1H A;  3T1R A;  3IWO A;  5K5B A;  2IWB A;  2PYR A;  4X55 A;  5HAQ A;  5AQ7 A;  1K6R A;  4DDS A;  1XPB A;  2JKF A;  4OQG A;  5DTS A;  5CX7 A;  4K0W A;  3GRJ A;  2VX8 A;  1N9L A;  2PR5 A;  4PKY G;  1PI4 A;  3RFB A;  2PD7 A;  2ZMA A;  3LYX A;  2HP6 A;  5DKL A;  3MF0 A;  1S1Z A;  5F1G A;  3VP3 A;  4R70 A;  3LIB A;  2OAP 1;  2M7U A;  4MBH A;  3LY4 A;  3FKV A;  4KZ4 A;  5MC7 A;  1K55 C;  3MXS A;  2A2L A;  4NXB A;  1ALQ A;  5A93 A;  3PBN A;  1QMF A;  1ZTU A;  2WUQ A;  4KZA A;  4O8G A;  4HJ3 A;  2Y2O A;  4F3L A;  1X0O A;  1JWP A;  1XX2 A;  3Q82 A;  4HIA A;  1IOU A;  1EW0 A;  1ZG4 A;  4HH3 A;  2XFS A;  3E0Y A;  3AGF A;  2Z2L B;  4KZ6 A;  1JTD A;  1YM1 A;  3S7N A;  2EWV A;  2ZMV A;  4S2J A;  3GVB A;  3EEA A;  1ERO A;  4LGW A;  2ZQ7 A;  4Q0J A;  2Y2K A;  3B42 A;  5FAS A;  2O99 A;  3A0S A;  4U0X A;  3SW1 A;  1I2W A;  1KE0 A;  2W1T A;  1CF0 A;  4OPZ A;  3S4X A;  1GA9 A;  1V9Z A;  3LGO A;  3KSG A;  4JGR A;  5L2F A;  3NY4 A;  3IX4 A;  1OTD A;  4E04 A;  3OPR A;  1W7F A;  4HBU A;  3LEZ A;  2GX5 A;  1SKO A;  4JXV A;  1XFQ A;  3E2L A;  3LY3 A;  1K54 A;  3BFC A;  1LI9 A;  3OPH A;  2ZJ9 A;  2JHE A;  1CEF A;  3LO7 A;  3B33 A;  4N9K A;  3NI9 A;  1ONH A;  4OON A;  1IYQ A;  2FZ0 A;  4BL3 A;  4BQM A;  3GQZ A;  4EUZ A;  1EWZ A;  4EUV A;  3V3S A;  4EBP A;  4MBF A;  3C30 A;  3BM6 A;  5KSC A;  3SZT A;  4L0L A;  4JGQ A;  1H8M A;  3QP4 A;  1LL9 A;  1RGY A;  1VQQ A;  4RA7 A;  2X71 A;  2ZL1 B;  1NLZ A;  3F1O A;  3JVV A;  4DE2 A;  3GTC A;  3KO6 A;  1STZ A;  3G6O A;  5HAR A;  3SS3 A;  4DDY A;  3FC7 A;  1VHM A;  2KX6 A;  1NLY A;  4LV2 A;  1F5M A;  3T1Q B;  2JKR M;  3OC2 A;  4PPR A;  3M6B A;  2B02 A;  4CPK A;  3FYZ A;  3QNC A;  3UB5 P;  1XFN A;  4R3J A;  3MJQ A;  4JXW A;  5FI7 A;  4PM5 A;  3F1N B;  1S1Y A;  3TSG A;  2Y91 A;  4MN7 A;  2EX2 A;  1WYC A;  4X69 A;  1P9R A;  1UGU A;  3T50 A;  3HLF A;  2L0W A;  2H28 A;  4OQ0 A;  3MQQ A;  4IVI A;  1MY8 A;  4E3N A;  2CMN A;  4Y15 A;  3NOP C;  2PHY A;  3IX8 A;  2WK0 A;  3ZG0 A;  3IWQ A;  3G31 A;  4KZ8 A;  2WAD A;  1OJG A;  2C5W B;  5EV0 A;  5KZH A;  1E25 A;  4Z1W A;  3IXD A;  2ZM8 A;  4DJ3 A;  3CWF A;  3BFF A;  2ACG A;  1KVM A;  2WKE A;  3G2Y A;  3QP6 A;  4NK3 A;  4CLC A;  4EBN A;  4GNU A;  3T4L A;  1AXB A;  3NCK A;  1OJ5 A;  3QP8 A;  1Z6F A;  1W79 A;  1LT0 A;  4X6T A;  4LRY C;  3HLW A;  5FEF A;  3S7P A;  3TE8 A;  3EWK A;  5TJJ A;  2FFY A;  4MCW A;  5C5K A;  4YOF A;  3EGD C;  3LIA A;  2V0U A;  3DW0 A;  4WN5 A;  5G18 A;  1XP4 A;  1Z09 A;  1BLH A;  3NEC A;  4OPR A;  4IBX A;  3UN7 A;  5HWV A;  3ZQ5 A;  1K56 A;  1XJ4 A;  3VOZ A;  1KDW A;  4K0X A;  4IJG A;  3TRC A;  2P7J A;  4HNB A;  3ZVW A;  4PHT A;  4OP8 A;  3HUO A;  3M2K A;  4GHI A;  2NUP C;  3G2Z A;  3A3E A;  4IVK A;  1TS8 A;  2OLU A;  3N8S A;  2D01 A;  3K3C A;  3MXQ A;  3MZD A;  2P74 A;  4R0Q A;  5I94 A;  2IA2 A;  2VGL M;  3BY8 A;  2HV1 A;  2OV5 A;  4WM9 A;  1Y4O A;  1FCN A;  4XT2 B;  3O87 A;  2INW A;  1K57 C;  3HLE A;  1OT9 A;  3OCL A;  1BT5 A;  1PWC A;  2R9W A;  4KQO A;  3ZNT A;  4OOY A;  2XGN A;  3A0V A;  2JKR I;  3VP0 A;  1BLC A;  5F5Y A;  2O9C A;  4OLD A;  3IS2 B;  5FAQ A;  4MEZ A;  3ZNY A;  4UEY A;  4E3J A;  2QYB A;  2JBF A;  2Y2I A;  4OPQ A;  2YKF A;  4HOI A;  4LV0 A;  4WMC D;  5CGX A;  3MSH A;  4ETX A;  3MKE A;  3BQ8 A;  3NDG A;  1OTE A;  1K4E A;  3UDI A;  3L7H A;  3CLO A;  4Y13 A;  1BUL A;  4JF5 A;  3UE1 A;  2VA0 A;  5M18 A;  4N1X A;  2XSS A;  4C75 A;  4GLQ A;  4BBV A;  1TVF A;  5L10 A;  4BD0 A;  1L3L A;  5DJU A;  4DXC A;  5EVI D;  2A24 B;  3H82 A;  3B47 A;  2J8Y A;  1T1A A;  3AGE A;  3NJA A;  1JWV A;  4FCF A;  1SKF A;  3Q7Z A;  5JYP A;  2JE5 A;  2XK1 A;  1MWT A;  1G28 A;  3QNB A;  2V8F A;  1KGG A;  3ZDJ A;  1HD8 A;  4GZB A;  3PXP A;  3SS4 A;  1V9Y A;  5KMW A;  2DCF A;  5CTN A;  4JF6 A;  5E2G A;  4BLM A;  5HDD A;  4FH2 A;  4X1M A;  3VE4 A;  5HDS A;  3VP2 A;  1P97 A;  3PAE A;  2OAQ 1;  4HBT A;  3BFG A;  3K3D A;  1HTZ A;  5IS1 A;  4KUK A;  1NZU A;  4LEN A;  4PKY A;  1LHY A;  1K38 A;  1FOF A;  5L8M A;  3O86 A;  1H8Z A;  3UB9 A;  1BSG A;  4HJ6 A;  2ZC4 B;  2G2W A;  2PDR A;  1G6A A;  3DTM A;  4Y0T A;  1YPR A;  1IFQ A;  1KVL A;  3HVF A;  5F6A A;  4P0M A;  5GHY A;  3BFD A;  3MZE A;  4PAU A;  4UAA A;  4C3Q A; 
#chains in the Genus database with same CATH homology
 3GRJ A;  4QB8 A;  5IHV A;  4R1G A;  3UPP A;  1PI4 A;  2B5R A;  4E3I A;  1YLZ A;  2ZMA A;  4KQQ A;  1KDS A;  1ERQ A;  4WZ5 A;  2HP6 A;  1NYY A;  5CHM A;  2FFF B;  1H5X A;  1K4F A;  1H8Y A;  1NRF A;  5AQ9 A;  1YMX A;  5F1G A;  3VP3 A;  3HBR A;  2WYX A;  1HZO A;  1ZC2 A;  3NDE A;  4WYY A;  3SH8 A;  3UPO A;  2WGI A;  3GMW A;  3N4I A;  2Y59 A;  4MBH A;  4BJP A;  1O07 A;  3LY4 A;  4JXG A;  3FKV A;  5FQ9 A;  4C6Y A;  4KZ4 A;  1GHP A;  4E3O A;  1K55 C;  3MXS A;  3PBQ A;  1XKZ A;  1MXO A;  5F83 A;  1ALQ A;  2ZQ9 A;  5A93 A;  3M6H A;  3G35 A;  4ZBE A;  2ZM0 A;  5TFQ A;  2ZLY A;  3PBN A;  3ZGA B;  5EE8 A;  1QMF A;  2HDU A;  5CGW A;  1PW8 A;  3Q07 A;  2CC1 A;  4S2K A;  2WUQ A;  4KZA A;  1RCJ A;  4PM9 A;  3E2K A;  2ZD8 A;  1TDG A;  4QHC A;  2Y2O A;  2J9P A;  1ONG A;  5EVL A;  5FDH A;  1JWP A;  3BLS A;  4R3B A;  5EEC A;  1XX2 A;  3Q82 A;  2EX9 A;  5FI2 A;  4Y0U A;  2EFX A;  3D4F A;  2Y2P A;  1ZG4 A;  2DNS A;  4ZJ3 A;  4KZ5 A;  1CK3 A;  1MWU A;  2XFS A;  3Q7V B;  1CI8 A;  3AGF A;  2Z2L B;  5E2E A;  1FR1 A;  1ZG6 A;  3WS5 A;  5KSH A;  3Q81 A;  1L2S A;  4KG6 A;  2I72 A;  4KZ6 A;  1JTD A;  1OME A;  1YM1 A;  3O3V A;  2Z2M B;  4OOL A;  5GLC A;  4S2J A;  3ZG7 B;  1VM1 A;  1PI5 A;  3GVB A;  1ERO A;  2Y2Q A;  3VMA A;  2ZQ7 A;  4IBR A;  2Y2K A;  3BRM A;  3N6I A;  5FAS A;  1N9B A;  1TDL A;  1PWG A;  3ZFZ A;  2X01 A;  4U0X A;  3A3J A;  4DF6 A;  1GCE A;  5A90 A;  3OZH A;  1I2W A;  3N8R A;  1KE0 A;  5M1A A;  4OPZ A;  1IEM A;  5CER A;  3S4X A;  1GA9 A;  4GKU A;  3RXX A;  1IEL A;  4M3K A;  1K25 A;  4DKI A;  5L2F A;  3BYD A;  3IF6 B;  2Q9N A;  1PZP A;  2HDS A;  4H8R A;  3N8L A;  3NY4 A;  3IH8 A;  2V20 A;  4UA6 A;  1L0F A;  3WWX A;  3OPR A;  2P9V A;  4ZJ1 A;  1W7F A;  1SDN A;  3NC8 A;  4HBU A;  2C6W B;  5CHU A;  3LEZ A;  1ESU A;  3OCN A;  4JXV A;  2A3U A;  2XD1 A;  3E2L A;  3LY3 A;  1K54 A;  1E4D A;  4E3L A;  3BFC A;  1LI9 A;  1JWZ A;  2XEP A;  4WEL A;  3OPH A;  2ZJ9 A;  4D2O A;  1CEF A;  1O7E A;  3C7U A;  3LO7 A;  1SHV A;  3VFF A;  4DE3 A;  1YLP A;  5EVI B;  2XR0 A;  3NI9 A;  4N9K A;  3TG9 A;  4ZAM A;  1ONH A;  4OON A;  1XGI A;  1IYQ A;  4BL3 A;  4DXB A;  2EXB A;  3IQA A;  4BQM A;  5FAO A;  1I5Q A;  3GQZ A;  4MBK A;  4PM8 A;  4EUZ A;  4U0T A;  3BEC A;  1EWZ A;  4EV4 A;  3S1Y A;  2ZC5 B;  4A5R A;  3FZC A;  2EX8 A;  3V3S A;  3M2J A;  3UO9 A;  4EBP A;  1YQS A;  4HEF A;  4MBF A;  3UY6 A;  1Q2Q A;  4N9L A;  2Q9M A;  4UA7 A;  2X02 A;  5CHJ A;  3BM6 A;  5KSC A;  3SS5 A;  1WE4 A;  4L0L A;  2HPB A;  3ZCZ A;  1LL9 A;  2H0T A;  3UDF A;  1RGY A;  1KGF A;  1CEG A;  4PM6 A;  4R4R A;  1VQQ A;  1FSY A;  3MZF A;  2X71 A;  2OSU A;  2XD5 A;  4GB7 A;  4JF4 A;  4RA7 A;  3OPP A;  3SH7 A;  4LV1 A;  1I2S A;  4QY6 A;  4K0W A;  4E3K A;  4R23 A;  3GTC A;  1RGZ A;  4DE2 A;  5BOH A;  4RVA A;  2EXA A;  3HUM A;  4P85 A;  5DF8 A;  5GHX A;  5HAR A;  2UWX A;  4KZ9 A;  1L0D A;  3SS3 A;  4DDY A;  4DRT A;  5GL9 A;  2JCH A;  2Y4A A;  2H10 A;  4P6B A;  4S2L A;  4LV2 A;  1K55 A;  4B4Z A;  2GDN A;  3B3X A;  5FQJ A;  5D3O A;  1YLJ A;  3FV7 A;  1J9M A;  3OC2 A;  3WS0 A;  4OPY A;  4YFM A;  4PPR A;  3M6B A;  1ES5 A;  2XDM A;  2HDR A;  2WGW A;  3SOI A;  4CPK A;  4FSF A;  3UE0 A;  1XGJ A;  3FYZ A;  5GLA A;  3QNC A;  1YMS A;  5HAI A;  4RYE A;  4GD8 A;  4R3J A;  2PBY A;  4PMA A;  2DRW A;  4OQI A;  1GA0 A;  4Q8I A;  4JXW A;  3A3D A;  4OLG A;  5FI7 A;  4PM5 A;  1LLB A;  3N7W A;  5A92 A;  1XA1 A;  2ZQA A;  1NXY A;  3C7V A;  3TSG A;  1WYB A;  3G34 A;  4E3M A;  1ESI A;  2HP9 A;  2Y91 A;  3IHA A;  4KG2 A;  5CRF A;  2EX2 A;  2XFT A;  3IXH A;  1WYC A;  4X69 A;  1BLP A;  1N4O A;  3VP1 A;  3IF6 C;  1SDE A;  1W8Q A;  1PIO A;  1MPL A;  3G30 A;  3HLF A;  4OQ0 A;  2WAE A;  3IXG A;  3FKW A;  3IH9 A;  5J8X A;  4IVI A;  1MY8 A;  4E3N A;  4P87 A;  2Y2L A;  3A3I A;  4JXS A;  2WK0 A;  4NET A;  3ZG0 A;  3IWQ A;  4BEN A;  4JPM A;  1FR6 A;  3CJM A;  4ZDX A;  3G31 A;  4KZ8 A;  2WAD A;  2C5W B;  5F82 A;  2E8I A;  5HX9 A;  5KZH A;  2Y2G A;  1E25 A;  1CI9 A;  5EVI C;  3PBO A;  4DE1 A;  1PZO A;  3GR2 A;  3IXD A;  2ZM8 A;  3HLB A;  4R4S A;  3S22 A;  3HLC A;  4KZ3 A;  3BFF A;  3SH9 A;  5HL1 A;  1KVM A;  4OVD A;  2WAF A;  1G68 A;  1M6K A;  4FH4 A;  4QU3 A;  5CEB A;  1HVB A;  5FSR A;  3HLD A;  5FAP A;  2WKE A;  3G2Y A;  4NK3 A;  1JTG A;  4BD1 A;  2WGV A;  4EBN A;  5HW3 A;  1KE4 A;  4GNU A;  4MNR A;  1AXB A;  3NCK A;  1Z6F A;  4E6W A;  1W79 A;  4GD6 A;  4U3T A;  4X6T A;  3RXW A;  2J7V A;  1KE3 A;  5DTK A;  1NY0 A;  4QY5 A;  3HLW A;  2FFY A;  3HL9 A;  3CG5 A;  1XA7 A;  1LI0 A;  4CJN A;  3ZG8 B;  4KG5 A;  4S2N C;  4WEK A;  1DJB A;  2XH9 A;  3UPN A;  4GDB A;  4Y0O A;  3A3F A;  1M40 A;  4UA9 A;  3DW0 A;  3MFD A;  4O7D A;  4Z9Q A;  5AQA A;  5FQK A;  2BLS A;  4N92 A;  2XQZ A;  4WZ4 A;  5G18 A;  4PM7 A;  1XP4 A;  4OKP A;  4UHU A;  5E43 A;  1BLH A;  3HRE A;  1ES3 A;  3P09 A;  5DF7 A;  3VOY A;  4OPR A;  1ERM A;  4IBX A;  4DE0 A;  3UN7 A;  2HP5 A;  3MXR A;  1EI5 A;  1K56 A;  1NYM A;  4FD8 A;  3VOZ A;  1KDW A;  1U60 A;  3WRT A;  2PU2 A;  4K0X A;  3G32 A;  3O88 A;  1BZA A;  3W8K A;  4XUZ A;  5FI6 A;  1DJC A;  3ZVW A;  3V50 A;  3PTE A;  1S0W A;  3TOI A;  4OP8 A;  3HUO A;  3M2K A;  3G2Z A;  2WZX A;  3A3E A;  4IVK A;  3UDX A;  2OLU A;  5GLB A;  3N8S A;  1NZO A;  1YLY A;  3Q7V A;  1MWR A;  3QHY A;  3MZD A;  2P74 A;  5DVA A;  5GHZ A;  4JKT A;  1L0G A;  3IXB A;  1K56 D;  1W8Y A;  4R0Q A;  1IYP A;  4E6X A;  1IKG A;  5I94 A;  1IKI A;  2RL3 A;  3PBR A;  2WKH A;  3FWL A;  5CGS A;  4X68 A;  5AQB A;  4WM9 A;  2OV5 A;  3WS2 A;  3EQU A;  3IWI A;  1FCN A;  3O87 A;  4OOM A;  2ZQ8 A;  4S2M A;  3BLM A;  1K57 C;  3HLE A;  4YIN A;  3ISG A;  3OCL A;  3WS4 A;  1BT5 A;  2H0Y A;  2G2U A;  2ZQD A;  1PW1 A;  4HES A;  5TR7 A;  2Y2M A;  1PWC A;  1TEM A;  2R9W A;  3DWK A;  3GV9 A;  4KQO A;  4KZ7 A;  4JBF A;  5DF9 A;  3W4Q A;  2P9V B;  3CMZ A;  4OOY A;  3ZNT A;  2J9O A;  3PAG A;  2XGN A;  1ES2 A;  2EX6 A;  4B88 A;  4LCM A;  1RP5 A;  5HAP A;  3VP0 A;  2V1Z A;  3V5M A;  3IHB A;  4GDN A;  5TGF A;  1BLC A;  4XXR A;  4GOG A;  4BL2 A;  2V2F F;  4WMC A;  3UE3 A;  4KZB A;  3ZVT A;  4WZ5 C;  3G4P A;  1ES4 A;  3IF6 A;  4S2O A;  3WRZ A;  4OLD A;  5U47 A;  3LCE A;  3C4O A;  1LL5 A;  3PBT A;  5FAQ A;  1PYY A;  4MEZ A;  3VFH A;  3VSK A;  3ZNY A;  5CED A;  1ZKJ A;  4E3J A;  1L0E A;  1YLT A;  2JBF A;  2Y2I A;  2EFU A;  4OPQ A;  3W4P A;  1W5D A;  3ZG5 A;  4LV0 A;  3P98 A;  4S2I A;  1FCO A;  2VGK A;  1IYS A;  4RX2 A;  4WMC D;  5CGX A;  3VP4 A;  3MKE A;  5M19 A;  4OQH A;  3NDG A;  1PWD A;  2ZC7 A;  1K4E A;  3NBL A;  3UDI A;  2QMI A;  5EVI A;  4RX3 A;  1XXM A;  1BLS A;  3BEB A;  1MKI A;  3IF5 A;  1BUL A;  4KEN B;  4JF5 A;  4KQR A;  3UE1 A;  1FQG A;  1KGE A;  4N1X A;  4ZJ2 A;  5M18 A;  2XF3 A;  4C75 A;  5FA7 A;  2QZ6 A;  1IYO A;  2WZZ A;  2RCX A;  3HUN A;  3C5A A;  1BTL A;  2IWD A;  4F94 A;  3DWZ A;  1TVF A;  1SCW A;  4X53 A;  4BD0 A;  2XLN A;  1YT4 A;  5CXW A;  5EOO A;  3RJU A;  3UNW A;  4DXC A;  3EQV A;  2WKI A;  3GSG A;  5EVI D;  2JC7 A;  2ZM2 A;  1DY6 A;  3OPL A;  2J8Y A;  3ITB A;  5GLD A;  3V3R A;  3AGE A;  4EBL A;  2OLV A;  5CTM A;  2WGW B;  1GHM A;  4IED A;  2IWC A;  3BFE A;  3Q1F A;  4FCF A;  4S2N A;  4EQI A;  1SKF A;  3VSL A;  1K6S A;  1E3U A;  4MLL A;  1S6R A;  3Q7Z A;  4ID4 A;  5JYP A;  2JE5 A;  2XK1 A;  1MWT A;  4K91 A;  3NIA A;  3C4P A;  1JVJ A;  2BG1 A;  3MKF A;  1DJA A;  5EOE A;  3ITA A;  4Y7P A;  3PBS A;  2PU4 A;  3QNB A;  5FQM A;  4B4X A;  3AGD A;  1KGG A;  3ZDJ A;  1HD8 A;  2QPN A;  3JYI A;  3V39 A;  4GZB A;  3SS4 A;  1MBL A;  2ZQC A;  3IT9 A;  5KMW A;  2DCF A;  1GHI A;  5CTN A;  2R9X A;  4JF6 A;  4EWF A;  4X56 A;  5E2G A;  2Y55 A;  4BLM A;  4FH2 A;  1FSW A;  3I7J A;  2VGJ A;  4S2P A;  2H5S A;  5FQQ A;  1E3U D;  1Q2P A;  4GN2 A;  4LV3 A;  3WS1 A;  1Y54 A;  3VP2 A;  4LCL A;  4OH0 A;  1BUE A;  4WEJ A;  2Y2J A;  1MWS A;  1C3B A;  5E2H A;  5HFO A;  3PAE A;  5FAT A;  3ZG9 B;  3HLG A;  4HBT A;  4QD4 A;  4XUX A;  4ZTK A;  1YLW A;  3BFG A;  1HTZ A;  3MBZ A;  4QJG A;  1QME A;  5CEC A;  4JLF A;  1NZU A;  1K54 C;  4LEN A;  4N1H A;  5F1F A;  5EUA A;  3IWO A;  1LHY A;  1K38 A;  1FOF A;  2IWB A;  3O86 A;  1H8Z A;  1BSG A;  3CZD A;  2ZC4 B;  2A49 A;  4X55 A;  2G2W A;  5JYO A;  5HAQ A;  4WBG A;  1G6A A;  5A91 A;  3W4O A;  5AQ7 A;  3DTM A;  1K6R A;  5EPH A;  4Y0T A;  2Y2N A;  1KVL A;  3ZHH A;  3HVF A;  4DDS A;  5E2F A;  1XPB A;  4P0M A;  1K57 A;  1NJ4 A;  2ZC6 B;  4OP5 A;  5GHY A;  4OQG A;  3BFD A;  5DTT A;  3MZE A;  5DTS A;  5FQI A;  2ZC3 B;  2Y2H A;  1JWV A;  1FCM A;  4UAA A;  2HDQ A;  4C3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...