3TOIA

Tailoring enzyme stability and exploiting stability-trait linkage by iterative truncation and optimization
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
248
structure length
248
Chain Sequence
GGARVGYIELDLNSGKVLESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPVAMATTLRKLLSGELLTLASRQQLMDWMEADKVAGPLLRSVLPAGWFIADKSGAGEHGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ampicillin resistance protein
publication title Exploring the Molecular Linkage of Protein Stability Traits for Enzyme Optimization by Iterative Truncation and Evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3toiA00
2V20A 4JF6A 4S2LA 5CTMA 5J8XA 3IF6A 1K6SA 2HDUA 1K55A 4KZ3A 2ZC4B 3ZG9B 3VP1A 1AXBA 2Q9NA 3PAEA 2EX2A 3FZCA 4WBGA 5GHYA 3OZHA 1ESUA 2VGJA 3BLSA 1KGGA 3IF5A 5JYOA 4LENA 4LV2A 3NC8A 5CXWA 1KGFA 3VP2A 3ZVTA 4E3MA 2XGNA 1JVJA 1SCWA 3TOIA 1LI0A 1QMFA 3S1YA 1LHYA 3PTEA 3UE0A 2J9OA 2WGWB 1MBLA 1BSGA 3LY4A 3LY3A 4IEDA 2OLUA 5CGSA 3MKFA 3ZVWA 4GKUA 4B4XA 2EX8A 3MKEA 1KE0A 4N1HA 3VFFA 2H5SA 1J9MA 2XLNA 1ALQA 4JXGA 4OH0A 3HLFA 4BENA 4M3KA 3ZG7B 2Y2QA 4KZAA 3FYZA 2P74A 4X68A 5E43A 1N9BA 1W7FA 3MBZA 3W4PA 3BM6A 5HAQA 1W79A 2ZLYA 3UE3A 3UN7A 3VOYA 1LI9A 3SH9A 1BULA 4QY5A 1ONHA 3OC2A 5DF9A 5EVIC 2WGWA 3IH8A 2EX6A 2WZZA 1ONGA 3V50A 1NY0A 4IVIA 2H0YA 2OV5A 5E2FA 3G32A 2B5RA 2FFFB 2ZQAA 2HDSA 2JC7A 4O7DA 4OP8A 3V39A 1K6RA 5TGFA 3NI9A 1DJBA 2C6WB 3W4QA 2PU2A 3PAGA 4RX3A 4DE0A 4JKTA 5A90A 3VFHA 2HP5A 3CJMA 1Q2QA 5HARA 1ES3A 1YLTA 4GOGA 3WS1A 3VP4A 4HEFA 4HBUA 5HAPA 3ITAA 4ZAMA 2XDMA 3WS0A 5HFOA 2WADA 3HUNA 1K57A 5CTNA 1VM1A 3HVFA 5FI7A 4NETA 4WZ5C 1IYQA 5M18A 3N8LA 1YLZA 2XR0A 1CEGA 1S6RA 5G18A 3C5AA 4WEJA 3IXHA 5FQIA 4E6XA 1BLSA 2Z2LB 2ZJ9A 5EVID 2PBYA 4WYYA 2HDRA 1ZG4A 3HLBA 1PZOA 3ZNYA 3BFFA 4QB8A 5F83A 1EROA 5CHMA 3A3FA 3FKWA 4E3NA 5GL9A 2XEPA 2A3UA 5CGXA 2ZD8A 1EWZA 3OCLA 4PM9A 4B88A 4DE1A 1BT5A 3BLMA 3DTMA 4Y0TA 3BFCA 3SH7A 3Q7ZA 4P87A 4P6BA 2WZXA 3Q81A 3O87A 4OQ0A 1CI9A 3C4PA 5FA7A 5DTTA 1XGIA 1NZOA 4DDYA 4F94A 3GV9A 3TSGA 1K56D 3VP0A 3PBNA 1E3UD 1NYMA 4IVKA 4GD8A 4DE3A 4S2NC 4Z9QA 2WKEA 1S0WA 1KE3A 3GMWA 5A93A 2G2UA 4S2IA 1DJAA 1YQSA 2R9WA 4L0LA 2XFTA 2GDNA 3M6HA 3B3XA 2ZC6B 1L0FA 1KGEA 4RX2A 1E4DA 4BL2A 1MWUA 5DF8A 3Q82A 5TFQA 3CMZA 5AQAA 4Y7PA 4Y0UA 5F82A 1PWDA 3Q7VB 1FCOA 1I2SA 1TDGA 3AGFA 5AQBA 5HAIA 3RXWA 4MEZA 3AGDA 1XPBA 1JTGA 4GDNA 2HPBA 2ZMAA 2ZM0A 3GQZA 4R3JA 4E3IA 4KQOA 2XK1A 4KG5A 3CZDA 3ITBA 5GLBA 1I5QA 4FD8A 3UDXA 5AQ7A 3OCNA 4QJGA 1K4EA 2Y91A 1L2SA 1QMEA 2Q9MA 1CI8A 4X53A 5CERA 1H8YA 3O86A 4PM8A 1MPLA 4ZJ2A 3DW0A 2Y4AA 5DVAA 1L0DA 4H8RA 1JTDA 3A3EA 3HLEA 5FQJA 2ZM2A 2DCFA 1H8ZA 3N7WA 3O88A 5F1GA 3G2ZA 1GA9A 3D4FA 3GRJA 3IXDA 1HZOA 4KG2A 4DRTA 3C7UA 4WM9A 4ZTKA 1ZKJA 4ZDXA 1SHVA 1DY6A 2UWXA 4WZ5A 1MKIA 3HUOA 3LCEA 4HBTA 1L0GA 1H5XA 1HVBA 3DWZA 4P85A 2P9VB 4WEKA 2E8IA 1BLPA 1E3UA 5GLDA 2CC1A 4QD4A 3IHBA 4WZ4A 2J9PA 1K54C 4WMCA 3NDEA 3RJUA 4OQGA 3A3IA 5FQKA 4DE2A 4R23A 4OPQA 5GLAA 1CK3A 3NBLA 3ZDJA 4A5RA 4N9KA 3MXSA 2BG1A 3GTCA 4PM5A 1YMSA 3GR2A 4JF4A 4BJPA 5FAPA 5KSHA 3HL9A 2ZQCA 1KDSA 1FOFA 1M40A 2HP6A 2WK0A 1NXYA 5GHZA 4JPMA 5EE8A 3UPPA 1TDLA 2Y2PA 4DXBA 1FQGA 2WAFA 3OPLA 3G30A 4S2JA 3ISGA 5FAQA 3NCKA 4K0XA 3AGEA 4R4RA 1HD8A 4DDSA 3HLWA 3VMAA 2DNSA 5U47A 1IYSA 2X71A 1IEMA 3OPPA 1IYOA 3E2LA 4R1GA 1RCJA 1ES5A 4X55A 4ZJ3A 4NK3A 4OQIA 1K55C 2JE5A 4GZBA 2EXBA 1YLYA 1Y54A 5A92A 4E3OA 1YMXA 2WUQA 3BRMA 3FWLA 4S2NA 3A3DA 5HW3A 1LL5A 3UDFA 3W8KA 1KDWA 4DXCA 1ES2A 1G6AA 5GHXA 2XD1A 4KZ7A 1XP4A 1ZC2A 4GB7A 4K0WA 4KZ4A 3IQAA 1GCEA 5CHJA 5CRFA 2WGVA 2XFSA 1IKIA 4PMAA 5DTSA 4BD0A 4RVAA 4OPYA 3VSLA 3N8SA 4MBKA 5FASA 1PIOA 1O07A 1WE4A 4YFMA 3UPNA 3GSGA 1MY8A 5FAOA 4OOLA 1KVLA 4WELA 1GHMA 1SDNA 5E2GA 4GNUA 3QNBA 1ERQA 1FR6A 4BD1A 1YLPA 1YLWA 4BLMA 1XXMA 5CECA 4KENB 1PYYA 4QY6A 2EXAA 4KZ6A 4UA7A 5CHUA 3WWXA 4DKIA 4KQRA 3ZNTA 2RL3A 1ESIA 1FSWA 1NZUA 5M1AA 5E2EA 4KQQA 4LV3A 5FATA 4OOYA 4OKPA 1FCMA 2FFYA 2Y2MA 2Y2JA 4OLDA 3EQUA 4MBFA 2Y2NA 4OVDA 2PU4A 4S2KA 3G2YA 1MWSA 5EVIB 3M2KA 4MBHA 1PI4A 2XD5A 1CEFA 5KSCA 1LL9A 1YM1A 3IWQA 1OMEA 4N1XA 3IXBA 1FCNA 5JYPA 1U60A 3IWOA 2V1ZA 4R3BA 3PBRA 3UDIA 4LCMA 4EV4A 4S2PA 5FI6A 3BEBA 3MFDA 3EQVA 5KMWA 1WYCA 1ERMA 4S2MA 2H0TA 1G68A 2WYXA 1Q2PA 5DF7A 1KE4A 2DRWA 4C3QA 3ZG8B 3MZDA 5FQMA 5EVIA 1JWPA 2G2WA 1O7EA 3PBQA 4PM6A 2VGKA 5BOHA 3MZFA 3TG9A 3IWIA 3S22A 3WRZA 3ZG0A 3A3JA 2C5WB 4KZ5A 3JYIA 1FR1A 1XX2A 2OSUA 2Y2HA 3QNCA 3UY6A 3Q7VA 2Y2KA 3OPHA 1YLJA 5EPHA 5EOOA 1XGJA 4R4SA 4RA7A 3UO9A 2HP9A 4HESA 3OPRA 3P98A 1EI5A 5F1FA 3VSKA 2JBFA 2EFUA 4ZJ1A 2WAEA 1XA7A 4QU3A 1W5DA 4EWFA 3N6IA 3FV7A 1KVMA 3UPOA 1M6KA 3HBRA 3LEZA 4XUXA 2EX9A 1L0EA 1BTLA 3C4OA 3O3VA 4ID4A 4MNRA 4B4ZA 2QMIA 4YINA 3N4IA 3S4XA 3PBSA 5CEBA 4S2OA 1K56A 2Y2OA 1PWCA 1VQQA 3IT9A 3WS4A 5EECA 4JXVA 5HX9A 2IWDA 3SS4A 1W8QA 3CG5A 4EUZA 3RXXA 1PW8A 2ZQ7A 2WGIA 4E3LA 4PM7A 2OLVA 1BLHA 4X56A 4CPKA 4DF6A 3PBOA 3G34A 3HLGA 3MZEA 2X02A 4GD6A 5GLCA 3NIAA 3WS2A 4RYEA 4EQIA 3VP3A 1BLCA 3HLCA 3LO7A 2ZQ9A 2ZQDA 2P9VA 4X6TA 4KZBA 1WYBA 1XKZA 4LV0A 4MLLA 2IWCA 3BFGA 3V5MA 4OOMA 5EVLA 2Z2MB 3BFDA 2IWBA 4JXWA 3UE1A 1LLBA 1IELA 3M6BA 5CEDA 1JWZA 3WS5A 1ZG6A 4IBXA 4N92A 3E2KA 4Y0OA 2X01A 1K25A 3UNWA 1BUEA 1PI5A 3C7VA 3SS5A 4EBNA 4JF5A 5FSRA 1YT4A 5E2HA 2XF3A 1GHPA 2I72A 3IF6C 3M2JA 4OPZA 3IXGA 1XA1A 1RGYA 3GVBA 2RCXA 5AQ9A 1GHIA 5FI2A 5EUAA 1PZPA 3P09A 4U3TA 2H10A 1TVFA 4X69A 1MWTA 4JXSA 1C3BA 1MXOA 2J8YA 1N4OA 2QPNA 4IBRA 2Y2LA 4JLFA 4JBFA 3NY4A 3ZFZA 3SH8A 5FQQA 4EBPA 3G35A 4BL3A 3ZGAB 2ZC5B 5M19A 3V3RA 2XH9A 2QZ6A 4FSFA 3SOIA 3W4OA 4OQHA 1E25A 3HREA 2ZM8A 1TEMA 1SDEA 2ZC7A 2BLSA 4KG6A 3ZG5A 5A91A 4PPRA 1K4FA 3MXRA 3PBTA 3SS3A 5KZHA 1SKFA 4BQMA 1Z6FA 2HDQA 4U0TA 2XQZA 1MWRA 4XXRA 4C75A 4LCLA 4R0QA 4ZBEA 4UHUA 1W8YA 1NRFA 2J7VA 2Y55A 3BECA 4U0XA 2WKHA 2ZC3B 4QHCA 2JCHA 3I7JA 3ZHHA 1DJCA 5TR7A 1I2WA 1JWVA 2Y2IA 4UAAA 4OLGA 4FCFA 5IHVA 3HUMA 4D2OA 4XUZA 5HL1A 5I94A 3Q1FA 3QHYA 3ZCZA 4OPRA 2WKIA 4GDBA 5EOEA 4OP5A 4E6WA 2V2FF 4FH2A 3V3SA 3WRTA 4FH4A 3G31A 1RGZA 5FDHA 4CJNA 2A49A 3IHAA 3N8RA 3NDGA 4LV1A 4UA6A 4C6YA 1K54A 1K57C 4OONA 4KZ8A 4P0MA 3BYDA 4WMCD 1NJ4A 4E3JA 1BZAA 1HTZA 2R9XA 3DWKA 1PW1A 1PWGA 5DTKA 3HLDA 4E3KA 2EFXA 1ES4A 1FSYA 1IYPA 2ZQ8A 3IF6B 4K91A 3VOZA 4Q8IA 1NYYA 3BFEA 4N9LA 3IH9A 4EBLA 5CGWA 5L2FA 2Y2GA 1RP5A 5D3OA 5FQ9A 4KZ9A 1GA0A 1K38A 3FKVA 3G4PA 2Y59A 4GN2A 4UA9A 3Q07A 1IKGA
chains in the Genus database with same CATH superfamily
5DJUA 3TW8A 2GJ3A 2ZC4B 3KSFA 3F1NA 5GHYA 5EVEA 1ESUA 3R4KA 5HDSA 1KGGA 4L9EA 3LI8A 2WKRA 5JYOA 2NUTC 3ZVTA 3IX4A 3W2ZA 1XJ3A 2XGNA 1LI0A 1QMFA 4CLCC 4F3LB 4LRYC 1BSGA 4IEDA 4YOFA 4OH0A 1S66L 4CQHA 1N9BA 3EEHA 3IS2A 3VOYA 4R6LA 2EX6A 4GW9A 1CF0A 3UMDA 1GSXA 4IVIA 3G32A 2ZQAA 3V39A 2HDSA 2JC7A 3NI9A 1DJBA 3PAGA 3V67A 4DE0A 2EA9A 3MQ0A 3VFHA 2HP5A 5HARA 4I3IA 2OWJA 4ZAMA 1S1ZA 2WADA 3F1PB 4FTXA 3HUNA 1VM1A 4WZ5C 1V9YA 4E6XA 1BLSA 2Z2LB 2ZJ9A 4WYYA 2HDRA 1PFLA 4Z1WA 5GL9A 2ZD8A 1EWZA 1X0OA 4JGOA 1H0MA 3S7NA 1JNUA 4CLCB 3DTMA 1SKOA 1H8MA 4Y0TA 3O87A 3D72A 2V1BA 4DDYA 1P9RA 2VGLM 3VP0A 2CMNA 4X1LA 5TJJA 2WKEA 1KE3A 3GMWA 3CUEA 5AVEA 1S4RA 1GSWA 3PR6A 5DF8A 3CMZA 4Y7PA 1FCOA 4GDNA 4QPRA 2HJ9C 4E3IA 4HJ4A 3CZDA 1I5QA 4FD8A 3UDXA 5AQ7A 3OCNA 3GDIA 4PM8A 1MPLA 4ZJ2A 3DW0A 5DVAA 1JTDA 3HLEA 2DCFA 2B02A 3UB7A 3G2ZA 1GA9A 1HZOA 5FEGA 5MC7A 2QKPA 4P85A 1PRQA 2J9PA 2JKGA 3NDEA 3RJUA 3A3IA 5FQKA 3MXSA 2BG1A 2J3TC 3GTCA 1N9LA 2HZ5A 1W63Q 1FOFA 2HP6A 2M7VA 1NXYA 4YWZA 1TDLA 3G30A 3ISGA 5FAQA 4HH3A 2PD7A 4ARZA 1IYSA 2X71A 3D3OA 4R1GA 3LIEA 3LFVA 4NK3A 4OQIA 1UWNX 2EXBA 1Y54A 5A92A 2EWVA 4S2NA 1LL5A 2PR6A 1D7EA 1G6AA 2XA7S 4PKYG 4KZ7A 1ZC2A 5EM0A 1F5MA 5CHJA 2WGVA 4BD0A 1IKIA 4ETXA 4RVAA 3PXPA 2FH5A 3S7OA 3UPNA 3GSGA 5G4YA 3CWFA 1GHMA 4GNUA 3QNBA 4JGRA 1ERQA 1FR6A 3JPUA 5G4ZA 4EQ1A 5CECA 4KENB 2WKPA 4KQRA 3ZNTA 4LV3A 4OOYA 3JVVA 4OKPA 5AJGA 2PR5A 3EQUA 4O01A 4MBFA 3T1SA 2XD5A 1YKDA 3IXBA 3L9KA 2V1ZA 3PBRA 4LCMA 1VHMA 2H0TA 2WYXA 2M7UA 5EVIA 3SW1A 1WA9A 3MZFA 3WRZA 3ZG0A 4EETB 3A3JA 3QNCA 3MR0A 5L09A 3VE3A 3P98A 4ZJ1A 1XA7A 4QU3A 1KVMA 2A24B 5TBMA 4KUKA 1L0EA 5DKKA 1BTLA 3N4IA 5HSQA 5HX9A 3CG5A 4E3LA 4PM7A 2GX5A 4CPKA 4BBTA 3IS2B 3HLGA 3NIAA 2QJ5A 2PRFA 3LO7A 3HLCA 4X6TA 4LV0A 2W3GA 2IWCA 3V5MA 4OOMA 1ACFA 3BFDA 4PAUA 4ZRRA 1LLBA 5CEDA 2VGLS 3WS5A 1ZG6A 4N92A 2X01A 1BUEA 3C7VA 3SS5A 4EBNA 3CPTA 5FSRA 5E2HA 2I72A 4Y15A 2J80A 2RCXA 5AQ9A 4JBFA 3SH8A 3G35A 3V3RA 3SOIA 4OQHA 1E25A 1TEMA 5F6AA 5A91A 4PPRA 5I5LA 1MZUA 1SKFA 1OTIA 2O9CA 3MQOA 3RH8B 4AFIA 4NEED 4ETZA 4MMNA 2Y55A 2ZC3B 2INWA 2VEAA 1JWVA 1TS6A 2L4RA 4UAAA 3UB5P 3ZQ5A 4HJ3A 3K3DA 3HUMA 3Q1FA 3QHYA 5EOEA 2V2FF 5EV0A 2H28A 2JN7A 2YKHA 1RGZA 2E8JA 5AVFA 4P6ZM 4R3AA 4OONA 4KZ8A 3MMHA 4WMCD 2P08A 3P7NA 2R9XA 3MQQA 5DTKA 1N9OA 1IYPA 1T1CA 4Q0HA 3T4QA 4Q8IA 1PNEA 4EBLA 3HJKA 5FQ9A 3LEQA 3UMEA 2JKFA 2Y59A 4GN2A 3ITAA 4S2LA 3NJAA 3ZG9B 3PAEA 5A8BA 3IF5A 1J3WA 4NXFA 1N9NA 4LENA 4RQ9A 4E3MA 3NOUC 1SCWA 3TOIA 2QWSA 1LHYA 4QWOA 2WGWB 4KUOA 4B4XA 3H9WA 1OTDA 3A0SA 4BENA 3ZG7B 2Y2QA 5E43A 1W7FA 3W4PA 4MN5A 5HAQA 1OTAA 2FZ0A 3OC2A 5EVIC 2O9BA 3IH8A 1ONGA 2OAQ1 3V50A 2OV5A 3UDIA 5E2FA 1K6RA 5TGFA 4R38A 2Q0OA 4I3JA 4JKTA 5A90A 2A2LA 3CJMA 3UB9A 4HEFA 4EUVA 3UE6A 2HJEA 3RFBA 1K57A 5HL6A 4NETA 5M18A 1YLZA 1V9ZA 5G18A 3RTYA 2P04A 1NLYA 2PBYA 1ZG4A 3T4KA 3ZNYA 2JKTM 1TD5A 3BFFA 2G7UA 4HOIA 4Y5FA 5CHMA 3FKWA 5CGXA 3T1RA 5HD5A 3R7WB 4B88A 3E4OA 4L9FA 4P87A 2WZXA 4Y17A 5FA7A 5DTTA 1XGIA 3T4TA 3GV9A 1A0KA 3TSGA 3PBNA 1NYMA 4IVKA 4GD8A 4LGWA 4DE3A 4Z9QA 5A93A 1S0WA 1DJAA 3B3XA 4RX2A 1L0FA 2JKTI 3T50A 1MWUA 4Y0UA 5F82A 1F9IA 1PWDA 1TDGA 3AGFA 5AQBA 4WN5A 1YPRA 1XPBA 2HPBA 3BY9A 2HF6A 1XJ2A 2XK1A 1P97A 2M1CA 2VKSA 4QJGA 1K4EA 4B93A 2Y91A 1QMEA 2Q9MA 1H8YA 3H7WA 4HIAA 4EU0A 5F68A 1L3LA 1L0DA 3A3EA 1H8ZA 1CJFA 2YKFA 4KG2A 3C7UA 2ACGA 4ZDXA 1SHVA 1DY6A 4HP9A 1MKIA 1H5XA 3DWZA 4WEKA 2CC1A 2V8FA 5L8MA 4DE2A 5GLAA 1CK3A 4M4XA 1W63M 4PM5A 2ZL1B 1YMSA 3CPTB 3HL9A 2ZQCA 1M40A 3KX0X 3UPPA 4DXBA 3EOIA 4S2JA 3HLWA 3BWLA 3VMAA 3TRCA 3OPPA 3E2LA 4X55A 1ES5A 3C2WA 4GZBA 3W8KA 4DXCA 4G3KA 3NHQA 4KZ4A 3CAXA 3T1XA 1GCEA 5CRFA 4PMAA 2VV7A 4R70A 4OPYA 3VSLA 3H82B 3N8SA 4MBKA 1PIOA 1WE4A 4L9GA 1IOUA 1KVLA 1SDNA 4BD1A 3HJIA 3QP8A 1Z09A 2W1TA 4HH2A 1PYYA 4DJ3A 4UA7A 2EXAA 1OT6A 5CHUA 3LICA 4DKIA 2RL3A 1NZUA 3CITA 1FCMA 4WL9A 3LI9A 4OVDA 1MKMA 4S2KA 5KSCA 1OMEA 4N1XA 1FCNA 2P7JA 1U60A 3BY8A 3IWOA 4EV4A 3BEBA 1WYCA 1S4SA 1Q2PA 1KE4A 4C3QA 3A0RA 3MZDA 2G2WA 3PBQA 4PM6A 1FILA 5BOHA 1G28A 3S22A 2Y2HA 1OTBA 3ULFA 3Q7VA 1LT0A 1P9WA 3OPHA 1YLJA 5EPHA 1XGJA 4RA7A 2W3DA 4HESA 2QYBA 1EI5A 5F1FA 2EFUA 4GLQA 4NXGA 1W5DA 4EWFA 3UPOA 3HBRA 4XUXA 1XFNA 3OBFA 1Y4OA 4LRXC 3O3VA 3ZYTA 4ID4A 4HHDA 4YINA 4S2OA 1PWCA 3FC7A 3IT9A 5EECA 2IWDA 1W8QA 2K31A 1YAXA 2L0WA 3BQAA 4X56A 2B95A 4DF6A 3PBOA 3G34A 2JHEA 4UQIS 3KSGA 3VP3A 1BLCA 3OOVA 4LRZE 2ZQDA 2P9VA 3BW6A 4MLLA 3M6BA 1IELA 4XT2A 1JWZA 4Y0OA 4KQDA 1K25A 2QHKA 2XF3A 3M2JA 2W27A 1XA1A 1RGYA 3CLOA 1H3QA 3SZTA 1GHIA 4IJGA 1MWTA 3MSHA 1MXOA 1N4OA 2QPNA 1XJ4A 4JLFA 3UB8A 3NY4A 3ZFZA 5FQQA 2PAVP 4BWIA 2ZC5B 5M19A 2QZ6A 3W4OA 3DTIA 2ZM8A 4EERA 3B47A 3ZG5A 5KZHA 2HDQA 2KDKA 2XQZA 1MWRA 4C75A 1T1BA 4ZBEA 1VEUA 4UHUA 2WKQA 3BECA 4QHCA 2GZAA 2JCHA 2LB5A 5F5YA 1I2WA 4WUJA 5J4EA 2Y2IA 4OLGA 5IS1A 2L1MA 4FCFA 3JVUA 4D2OA 5HL1A 1GSVA 4OPRA 2WKIA 4OP5A 4E6WA 3F1OA 3V3SA 3WRTA 1VETB 5FDHA 3IHAA 3NDGA 4LV1A 4UA6A 3C8CA 4O0PA 3GECA 3A0VA 4HQAA 1NJ4A 1PW1A 3HLDA 1ES4A 4K08A 2V0UA 3F1NB 1NYYA 3IH9A 5HWWA 2Y2GA 2KOIA 4HNBA 4KZ9A 1K38A 4Y2FA 2AVXA 1IKGA 4Y13A 2V20A 5CTMA 3D9YA 3IF6A 2VZWA 1K6SA 2HDUA 1AXBA 2PYPA 4WBGA 3KO6A 2ZOIA 5KIZA 2VGJA 3BLSA 3QP1A 3NC8A 4LV2A 3VP2A 1KGFA 5HWTA 3S1YA 3CUEC 2NUPC 3LY4A 5CGSA 3LY3A 2PD8A 1KE0A 2W3EA 2H5SA 1J9MA 2XLNA 4M3KA 3FYZA 2P74A 3MBZA 1UWPX 3BM6A 3FPVA 2ZLYA 5EFWA 3UE3A 4F3LA 3LR4A 1ONHA 3UB6A 2WZZA 2ZOHA 1NLZA 2H0YA 4OP8A 4RX3A 4CLCD 1Q2QA 1ES3A 1YLTA 1LSWA 5HAPA 5IU1A 2XDMA 5HFOA 3N8LA 2XR0A 1CEGA 4X1MA 3C5AA 5FQIA 3IXHA 1SKOB 3HLBA 5FDSA 3F1PA 3NULA 4PKYA 2W3HA 1EROA 2VX8A 3A3FA 4E3NA 2XEPA 2A3UA 3OCLA 3L7HA 4PM9A 2IA2A 1OT9A 4DE1A 1BT5A 3BLMA 3SH7A 4P6BA 1VB6A 4OQ0A 3C4PA 4WLAA 4F94A 1K56D 4IUHA 4NG2A 1E3UD 4DN0A 2PBDP 2QJ7A 4UEYA 4S2NC 4S2IA 1S67L 2R9WA 4L0LA 1T1AA 4HI4A 3M6HA 4GHIA 2ZC6B 1KGEA 1E4DA 4BL2A 3Q7VB 1I2SA 5HAIA 4MEZA 1ZTUA 1JTGA 2ZMAA 2ZM0A 1T18A 1BYWA 4ESPA 3ITBA 5GLBA 4JGPA 1G6OA 1AWIA 1CI8A 4X53A 5CERA 3O86A 2Y4AA 1TF1A 4LLOB 2ZM2A 4H6JA 3N7WA 2K7SA 5K5BA 3GRJA 4DRTA 1ZKJA 2OOLA 3O5YA 2UWXA 2V9AA 4WZ5A 3HUOA 3LCEA 2P9VB 2E8IA 1BLPA 1E3UA 4QD4A 3IX8A 4WMCA 4HJ6A 4OPQA 3NBLA 4ARZB 4N9KA 3VOLA 1F2KA 5KSHA 2VJWA 2WK0A 1XFQA 4JPMA 1FQGA 3K2NA 4R4RA 3AGEA 1T19A 3IX3A 4D60A 5U47A 1IYOA 1RCJA 4E3OA 1YMXA 2WUQA 3BRMA 3FWLA 3A3DA 5HW3A 1KDWA 1ES2A 1STZA 2J3TD 3EGDC 1XP4A 4K0WA 3IQAA 3TE8A 1LSXA 2LB9A 1P0ZA 1FIKA 3T4LA 1O07A 2D01A 4YFMA 3T4JA 4OOLA 4WF0A 3BJNA 4II7A 5E2GA 2OWHA 3CI6A 1YLPA 3T4OA 1XXMA 2V8CA 3F1OB 2UV0E 4I38A 5M1AA 5FATA 2Y2MA 4OLDA 2PU4A 5EVIB 4EEUA 3IWQA 5KMWA 4S2MA 4Q0JA 1JWPA 2PDRA 1O7EA 4GS9A 5F69A 1KOUA 1D1JA 3IWIA 5TBMB 4DJ2A 2C5WB 4KZ5A 3JYIA 2OSUA 1XX2A 3UY6A 3NOTC 1G5UA 2Y2KA 4R4SA 2XA7M 2PHYA 3UO9A 2HP9A 3OPRA 3VSKA 2WAEA 4GJ4A 1M6KA 2EX9A 1F98A 1NWZA 4EEPA 3C4OA 4I5SA 4MNRA 4B4ZA 2XROA 1S1YA 2W3FA 3PBSA 5CEBA 4JXVA 4HP4A 3LIBA 5L10A 3SS4A 4EUZA 3RXXA 1PW8A 3NOPC 2A24A 4NXEA 2ZMVA 3LYXA 4GD6A 5GLCA 3MZEA 2X02A 3T12B 3MFXA 2ZQ9A 1SZVA 2VV8A 4E04A 2B18A 1WYBA 1XKZA 4MDZA 3BFGA 3VE4A 4G3VA 2Z2MB 4JXWA 5HDDA 5IT5A 4P6ZS 3FG8A 1YT4A 3IXGA 2PYRA 3GVBA 1YSQA 3P09A 4U3TA 3QP5A 2H10A 1TVFA 4X69A 2J8YA 2Y2LA 4EBPA 4BL3A 3MF0A 2V0WA 2XH9A 3E0YA 3HREA 2ZC7A 2BLSA 1K4FA 3MXRA 1Z6FA 2KX6A 4U0TA 4XXRA 5HPFA 2O9AA 4I39A 2O0YA 1NRFA 4U0XA 3CHWP 3QP6A 1IFQA 3ZHHA 1DJCA 4GDBA 4GHIB 2A49A 3N8RA 1LL8A 3DTKA 5J7EA 1K54A 1K57C 3C38A 3BYDA 4E3JA 2HV1A 3DWKA 3BQ8A 1OPXA 1PWGA 4E3KA 2EFXA 2ZQ8A 3E98A 3VOZA 1DP6A 4N9LA 5CGWA 5D3OA 3E4PA 1GA0A 3FKVA 1OJGA 3T4SA 3Q07A 3FPWA 4JF6A 4H6JB 5J8XA 4KZ3A 2R78A 1K55A 1UGUA 3VP1A 2Q9NA 2EX2A 3FZCA 4Y3IA 4CLCE 3OZHA 1OTEA 3KYEA 1DP9A 5CXWA 1JVJA 3EWKA 3UE0A 3PTEA 4X25A 2J9OA 1MBLA 3ZVWA 2OLUA 3MKFA 1DRMA 4GKUA 2EX8A 1TS7A 3MKEA 3P01A 3VFFA 4N1HA 4JXGA 1ALQA 3HLFA 4KZAA 4X68A 5C5KA 1W79A 5DFYA 3UN7A 1LI9A 3SH9A 1BULA 4QY5A 5DF9A 3KSIA 2WGWA 3U2AA 3OLOA 4MN6A 1NY0A 2B5RA 2FFFB 4O7DA 2C6WB 3W4QA 2PU2A 4PHTA 5FEFA 3LUQA 3B42A 4GOGA 3WS1A 3VP4A 4HBUA 3MJQA 3WS0A 4GCZA 5CTNA 3HVFA 2BASA 5FI7A 1IYQA 1S6RA 2Z6CA 4WEJA 5EVID 1PZOA 3S7PA 1D06A 3IBJA 4QB8A 5F83A 2VK3A 4IUKA 3BFCA 3EGXC 3Q7ZA 3Q81A 1CI9A 3K3CA 2VA0A 1NZOA 2GNXA 2DMWA 3R7WA 3KYZA 2G2UA 1YQSA 3QP2A 1NRJA 2XFTA 2GDNA 4GS9B 3KSHA 3Q82A 5TFQA 5AQAA 2ZBBA 3LR0A 3H7WB 3RXWA 4O8GA 3AGDA 3QP4A 3GQZA 4R3JA 4KQOA 4KG5A 4MCWA 1MC0A 3DBAA 1OJ5A 1L2SA 3PHYA 3HCYA 4H8RA 3NECA 5FQJA 3O88A 5LBRA 5F1GA 4BMWA 3D4FA 3IXDA 4WM9A 4ZTKA 5DJTA 4BBVA 1L0GA 4HBTA 3S7QA 1HVBA 4IHQA 4FOFA 5DKLA 1DP8A 5GLDA 2VLGA 3IHBA 4WZ4A 1K54C 4FUWA 1TS8A 4OQGA 4ME4A 4R23A 4HY8A 3ZDJA 4A5RA 3TJZC 4BBUA 3GR2A 4JF4A 4BJPA 5FAPA 1KDSA 5GHZA 5EE8A 2Y2PA 2WAFA 3OPLA 3NCKA 4K0XA 1HD8A 4DDSA 2EWWA 2DNSA 2W0NA 2ZL1A 2W1RA 1IEMA 2XSSA 1XJ6A 4ZJ3A 4DMZA 1K55C 2JE5A 1YLYA 3B33A 2V1AA 2D02A 2I9VA 3UDFA 3LR3A 5GHXA 2XD1A 3U4LP 5L07A 4GB7A 2W1TB 1HLUP 2PT7A 2XFSA 5DTSA 4B9OA 1TS0A 3ICYA 2KLIA 5FASA 4G3WA 5FAOA 1MY8A 4WELA 5HD3A 3LGOA 2J3WA 4BLMA 1YLWA 4QY6A 4KZ6A 3WWXA 1Y28A 3H82A 1ESIA 1FSWA 4MN7A 5E2EA 4KQQA 5DFXA 2FFYA 2Y2JA 2Y2NA 3MXQA 4CLCA 3G2YA 1MWSA 3M2KA 4MBHA 1PI4A 1CEFA 1LL9A 1YM1A 1ODVA 5CX7A 3LIFA 5JYPA 4R3BA 4S2PA 5FI6A 3MFDA 3EQVA 1ERMA 1G68A 5DF7A 2DRWA 3EEAA 3ZG8B 5FQMA 2VGKA 3TG9A 1FR1A 3C30A 5EOOA 2JBFA 3G6OA 5FL3A 3DTEA 3N6IA 3FV7A 2MJ6A 3LEZA 5EM1A 5HPIA 2K2NA 2QMIA 3S4XA 1K56A 1YSPA 2Y2OA 1VQQA 3WS4A 4XT2B 2ZQ7A 2WGIA 2OLVA 1BLHA 3DAVA 3WS2A 4EQIA 2OAP1 4RYEA 2Y8HA 3E4QA 2O99A 4KZBA 2Y79A 5J3WA 5EVLA 4EESA 3UE1A 2IWBA 2ZMFA 3KYQA 4IBXA 3E2KA 3UNWA 5HWVA 1PI5A 4JF5A 4LFUA 1GHPA 3IF6C 4OPZA 4NKPA 3IBRA 5FI2A 3LIAA 1PZPA 5EUAA 4YNRA 4JXSA 1C3BA 4IBRA 3VV4A 1VEUB 3ZGAB 3PYPA 4JGQA 4FSFA 1SDEA 1CQAA 4KG6A 3PBTA 3SS3A 4BQMA 3MS6A 4LCLA 4R0QA 3LR5A 1W8YA 2J7VA 2WKHA 3I7JA 5HDCA 5TR7A 3LIDA 2Z6DA 4UQIM 2JKRM 5IHVA 4LPZA 4XUZA 5I94A 3ZCZA 4EW7A 2BTFP 2VV6A 1EW0A 4FH2A 2XRNA 4FH4A 3G31A 4CJNA 4Q0IA 4C6YA 1LSVA 4P0MA 4EXOA 1K0KA 1BZAA 1HTZA 4NXBA 3T1QB 1FSYA 3IF6B 1VETA 4K91A 3BFEA 4I3AA 5L2FA 1RP5A 2HGVA 1ZHHB 3G4PA 4UA9A 2JKRI 5HZHA
chains in the Genus database with same CATH topology
2V20A 4JF6A 4S2LA 5CTMA 5J8XA 3IF6A 1K6SA 2HDUA 1K55A 4KZ3A 2ZC4B 3ZG9B 3VP1A 1AXBA 2Q9NA 3PAEA 2EX2A 3FZCA 4WBGA 5GHYA 3OZHA 1ESUA 2VGJA 3BLSA 1KGGA 3IF5A 5JYOA 4LENA 4LV2A 3NC8A 5CXWA 1KGFA 3VP2A 3ZVTA 4E3MA 2XGNA 1JVJA 1SCWA 3TOIA 1LI0A 1QMFA 3S1YA 1LHYA 3PTEA 3UE0A 2J9OA 2WGWB 1MBLA 1BSGA 3LY4A 3LY3A 4IEDA 2OLUA 5CGSA 3MKFA 3ZVWA 4GKUA 4B4XA 2EX8A 3MKEA 1KE0A 4N1HA 3VFFA 2H5SA 1J9MA 2XLNA 1ALQA 4JXGA 4OH0A 3HLFA 4BENA 4M3KA 3ZG7B 2Y2QA 4KZAA 3FYZA 2P74A 4X68A 5E43A 1N9BA 1W7FA 3MBZA 3W4PA 3BM6A 5HAQA 1W79A 2ZLYA 3UE3A 3UN7A 3VOYA 1LI9A 3SH9A 1BULA 4QY5A 1ONHA 3OC2A 5DF9A 5EVIC 2WGWA 3IH8A 2EX6A 2WZZA 1ONGA 3V50A 1NY0A 4IVIA 2H0YA 2OV5A 5E2FA 3G32A 2B5RA 2FFFB 2ZQAA 2HDSA 2JC7A 4O7DA 4OP8A 3V39A 1K6RA 5TGFA 3NI9A 1DJBA 2C6WB 3W4QA 2PU2A 3PAGA 4RX3A 4DE0A 4JKTA 5A90A 3VFHA 2HP5A 3CJMA 1Q2QA 5HARA 1ES3A 1YLTA 4GOGA 3WS1A 3VP4A 4HEFA 4HBUA 5HAPA 3ITAA 4ZAMA 2XDMA 3WS0A 5HFOA 2WADA 3HUNA 1K57A 5CTNA 1VM1A 3HVFA 5FI7A 4NETA 4WZ5C 1IYQA 5M18A 3N8LA 1YLZA 2XR0A 1CEGA 1S6RA 5G18A 3C5AA 4WEJA 3IXHA 5FQIA 4E6XA 1BLSA 2Z2LB 2ZJ9A 5EVID 2PBYA 4WYYA 2HDRA 1ZG4A 3HLBA 1PZOA 3ZNYA 3BFFA 4QB8A 5F83A 1EROA 5CHMA 3A3FA 3FKWA 4E3NA 5GL9A 2XEPA 2A3UA 5CGXA 2ZD8A 1EWZA 3OCLA 4PM9A 4B88A 4DE1A 1BT5A 3BLMA 3DTMA 4Y0TA 3BFCA 3SH7A 3Q7ZA 4P87A 4P6BA 2WZXA 3Q81A 3O87A 4OQ0A 1CI9A 3C4PA 5FA7A 5DTTA 1XGIA 1NZOA 4DDYA 4F94A 3GV9A 3TSGA 1K56D 3VP0A 3PBNA 1E3UD 1NYMA 4IVKA 4GD8A 4DE3A 4S2NC 4Z9QA 2WKEA 1S0WA 1KE3A 3GMWA 5A93A 2G2UA 4S2IA 1DJAA 1YQSA 2R9WA 4L0LA 2XFTA 2GDNA 3M6HA 3B3XA 2ZC6B 1L0FA 1KGEA 4RX2A 1E4DA 4BL2A 1MWUA 5DF8A 3Q82A 5TFQA 3CMZA 5AQAA 4Y7PA 4Y0UA 5F82A 1PWDA 3Q7VB 1FCOA 1I2SA 1TDGA 3AGFA 5AQBA 5HAIA 3RXWA 4MEZA 3AGDA 1XPBA 1JTGA 4GDNA 2HPBA 2ZMAA 2ZM0A 3GQZA 4R3JA 4E3IA 4KQOA 2XK1A 4KG5A 3CZDA 3ITBA 5GLBA 1I5QA 4FD8A 3UDXA 5AQ7A 3OCNA 4QJGA 1K4EA 2Y91A 1L2SA 1QMEA 2Q9MA 1CI8A 4X53A 5CERA 1H8YA 3O86A 4PM8A 1MPLA 4ZJ2A 3DW0A 2Y4AA 5DVAA 1L0DA 4H8RA 1JTDA 3A3EA 3HLEA 5FQJA 2ZM2A 2DCFA 1H8ZA 3N7WA 3O88A 5F1GA 3G2ZA 1GA9A 3D4FA 3GRJA 3IXDA 1HZOA 4KG2A 4DRTA 3C7UA 4WM9A 4ZTKA 1ZKJA 4ZDXA 1SHVA 1DY6A 2UWXA 4WZ5A 1MKIA 3HUOA 3LCEA 4HBTA 1L0GA 1H5XA 1HVBA 3DWZA 4P85A 2P9VB 4WEKA 2E8IA 1BLPA 1E3UA 5GLDA 2CC1A 4QD4A 3IHBA 4WZ4A 2J9PA 1K54C 4WMCA 3NDEA 3RJUA 4OQGA 3A3IA 5FQKA 4DE2A 4R23A 4OPQA 5GLAA 1CK3A 3NBLA 3ZDJA 4A5RA 4N9KA 3MXSA 2BG1A 3GTCA 4PM5A 1YMSA 3GR2A 4JF4A 4BJPA 5FAPA 5KSHA 3HL9A 2ZQCA 1KDSA 1FOFA 1M40A 2HP6A 2WK0A 1NXYA 5GHZA 4JPMA 5EE8A 3UPPA 1TDLA 2Y2PA 4DXBA 1FQGA 2WAFA 3OPLA 3G30A 4S2JA 3ISGA 5FAQA 3NCKA 4K0XA 3AGEA 4R4RA 1HD8A 4DDSA 3HLWA 3VMAA 2DNSA 5U47A 1IYSA 2X71A 1IEMA 3OPPA 1IYOA 3E2LA 4R1GA 1RCJA 1ES5A 4X55A 4ZJ3A 4NK3A 4OQIA 1K55C 2JE5A 4GZBA 2EXBA 1YLYA 1Y54A 5A92A 4E3OA 1YMXA 2WUQA 3BRMA 3FWLA 4S2NA 3A3DA 5HW3A 1LL5A 3UDFA 3W8KA 1KDWA 4DXCA 1ES2A 1G6AA 5GHXA 2XD1A 4KZ7A 1XP4A 1ZC2A 4GB7A 4K0WA 4KZ4A 3IQAA 1GCEA 5CHJA 5CRFA 2WGVA 2XFSA 1IKIA 4PMAA 5DTSA 4BD0A 4RVAA 4OPYA 3VSLA 3N8SA 4MBKA 5FASA 1PIOA 1O07A 1WE4A 4YFMA 3UPNA 3GSGA 1MY8A 5FAOA 4OOLA 1KVLA 4WELA 1GHMA 1SDNA 5E2GA 4GNUA 3QNBA 1ERQA 1FR6A 4BD1A 1YLPA 1YLWA 4BLMA 1XXMA 5CECA 4KENB 1PYYA 4QY6A 2EXAA 4KZ6A 4UA7A 5CHUA 3WWXA 4DKIA 4KQRA 3ZNTA 2RL3A 1ESIA 1FSWA 1NZUA 5M1AA 5E2EA 4KQQA 4LV3A 5FATA 4OOYA 4OKPA 1FCMA 2FFYA 2Y2MA 2Y2JA 4OLDA 3EQUA 4MBFA 2Y2NA 4OVDA 2PU4A 4S2KA 3G2YA 1MWSA 5EVIB 3M2KA 4MBHA 1PI4A 2XD5A 1CEFA 5KSCA 1LL9A 1YM1A 3IWQA 1OMEA 4N1XA 3IXBA 1FCNA 5JYPA 1U60A 3IWOA 2V1ZA 4R3BA 3PBRA 3UDIA 4LCMA 4EV4A 4S2PA 5FI6A 3BEBA 3MFDA 3EQVA 5KMWA 1WYCA 1ERMA 4S2MA 2H0TA 1G68A 2WYXA 1Q2PA 5DF7A 1KE4A 2DRWA 4C3QA 3ZG8B 3MZDA 5FQMA 5EVIA 1JWPA 2G2WA 1O7EA 3PBQA 4PM6A 2VGKA 5BOHA 3MZFA 3TG9A 3IWIA 3S22A 3WRZA 3ZG0A 3A3JA 2C5WB 4KZ5A 3JYIA 1FR1A 1XX2A 2OSUA 2Y2HA 3QNCA 3UY6A 3Q7VA 2Y2KA 3OPHA 1YLJA 5EPHA 5EOOA 1XGJA 4R4SA 4RA7A 3UO9A 2HP9A 4HESA 3OPRA 3P98A 1EI5A 5F1FA 3VSKA 2JBFA 2EFUA 4ZJ1A 2WAEA 1XA7A 4QU3A 1W5DA 4EWFA 3N6IA 3FV7A 1KVMA 3UPOA 1M6KA 3HBRA 3LEZA 4XUXA 2EX9A 1L0EA 1BTLA 3C4OA 3O3VA 4ID4A 4MNRA 4B4ZA 2QMIA 4YINA 3N4IA 3S4XA 3PBSA 5CEBA 4S2OA 1K56A 2Y2OA 1PWCA 1VQQA 3IT9A 3WS4A 5EECA 4JXVA 5HX9A 2IWDA 3SS4A 1W8QA 3CG5A 4EUZA 3RXXA 1PW8A 2ZQ7A 2WGIA 4E3LA 4PM7A 2OLVA 1BLHA 4X56A 4CPKA 4DF6A 3PBOA 3G34A 3HLGA 3MZEA 2X02A 4GD6A 5GLCA 3NIAA 3WS2A 4RYEA 4EQIA 3VP3A 1BLCA 3HLCA 3LO7A 2ZQ9A 2ZQDA 2P9VA 4X6TA 4KZBA 1WYBA 1XKZA 4LV0A 4MLLA 2IWCA 3BFGA 3V5MA 4OOMA 5EVLA 2Z2MB 3BFDA 2IWBA 4JXWA 3UE1A 1LLBA 1IELA 3M6BA 5CEDA 1JWZA 3WS5A 1ZG6A 4IBXA 4N92A 3E2KA 4Y0OA 2X01A 1K25A 3UNWA 1BUEA 1PI5A 3C7VA 3SS5A 4EBNA 4JF5A 5FSRA 1YT4A 5E2HA 2XF3A 1GHPA 2I72A 3IF6C 3M2JA 4OPZA 3IXGA 1XA1A 1RGYA 3GVBA 2RCXA 5AQ9A 1GHIA 5FI2A 5EUAA 1PZPA 3P09A 4U3TA 2H10A 1TVFA 4X69A 1MWTA 4JXSA 1C3BA 1MXOA 2J8YA 1N4OA 2QPNA 4IBRA 2Y2LA 4JLFA 4JBFA 3NY4A 3ZFZA 3SH8A 5FQQA 4EBPA 3G35A 4BL3A 3ZGAB 2ZC5B 5M19A 3V3RA 2XH9A 2QZ6A 4FSFA 3SOIA 3W4OA 4OQHA 1E25A 3HREA 2ZM8A 1TEMA 1SDEA 2ZC7A 2BLSA 4KG6A 3ZG5A 5A91A 4PPRA 1K4FA 3MXRA 3PBTA 3SS3A 5KZHA 1SKFA 4BQMA 1Z6FA 2HDQA 4U0TA 2XQZA 1MWRA 4XXRA 4C75A 4LCLA 4R0QA 4ZBEA 4UHUA 1W8YA 1NRFA 2J7VA 2Y55A 3BECA 4U0XA 2WKHA 2ZC3B 4QHCA 2JCHA 3I7JA 3ZHHA 1DJCA 5TR7A 1I2WA 1JWVA 2Y2IA 4UAAA 4OLGA 4FCFA 5IHVA 3HUMA 4D2OA 4XUZA 5HL1A 5I94A 3Q1FA 3QHYA 3ZCZA 4OPRA 2WKIA 4GDBA 5EOEA 4OP5A 4E6WA 2V2FF 4FH2A 3V3SA 3WRTA 4FH4A 3G31A 1RGZA 5FDHA 4CJNA 2A49A 3IHAA 3N8RA 3NDGA 4LV1A 4UA6A 4C6YA 1K54A 1K57C 4OONA 4KZ8A 4P0MA 3BYDA 4WMCD 1NJ4A 4E3JA 1BZAA 1HTZA 2R9XA 3DWKA 1PW1A 1PWGA 5DTKA 3HLDA 4E3KA 2EFXA 1ES4A 1FSYA 1IYPA 2ZQ8A 3IF6B 4K91A 3VOZA 4Q8IA 1NYYA 3BFEA 4N9LA 3IH9A 4EBLA 5CGWA 5L2FA 2Y2GA 1RP5A 5D3OA 5FQ9A 4KZ9A 1GA0A 1K38A 3FKVA 3G4PA 2Y59A 4GN2A 4UA9A 3Q07A 1IKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V20 A;  4JF6 A;  4S2L A;  5CTM A;  5J8X A;  3IF6 A;  1K6S A;  2HDU A;  1K55 A;  4KZ3 A;  2ZC4 B;  3ZG9 B;  3VP1 A;  1AXB A;  2Q9N A;  3PAE A;  2EX2 A;  3FZC A;  4WBG A;  5GHY A;  3OZH A;  1ESU A;  2VGJ A;  3BLS A;  1KGG A;  3IF5 A;  5JYO A;  4LEN A;  4LV2 A;  3NC8 A;  5CXW A;  1KGF A;  3VP2 A;  3ZVT A;  4E3M A;  2XGN A;  1JVJ A;  1SCW A;  3TOI A;  1LI0 A;  1QMF A;  3S1Y A;  1LHY A;  3PTE A;  3UE0 A;  2J9O A;  2WGW B;  1MBL A;  1BSG A;  3LY4 A;  3LY3 A;  4IED A;  2OLU A;  5CGS A;  3MKF A;  3ZVW A;  4GKU A;  4B4X A;  2EX8 A;  3MKE A;  1KE0 A;  4N1H A;  3VFF A;  2H5S A;  1J9M A;  2XLN A;  1ALQ A;  4JXG A;  4OH0 A;  3HLF A;  4BEN A;  4M3K A;  3ZG7 B;  2Y2Q A;  4KZA A;  3FYZ A;  2P74 A;  4X68 A;  5E43 A;  1N9B A;  1W7F A;  3MBZ A;  3W4P A;  3BM6 A;  5HAQ A;  1W79 A;  2ZLY A;  3UE3 A;  3UN7 A;  3VOY A;  1LI9 A;  3SH9 A;  1BUL A;  4QY5 A;  1ONH A;  3OC2 A;  5DF9 A;  5EVI C;  2WGW A;  3IH8 A;  2EX6 A;  2WZZ A;  1ONG A;  3V50 A;  1NY0 A;  4IVI A;  2H0Y A;  2OV5 A;  5E2F A;  3G32 A;  2B5R A;  2FFF B;  2ZQA A;  2HDS A;  2JC7 A;  4O7D A;  4OP8 A;  3V39 A;  1K6R A;  5TGF A;  3NI9 A;  1DJB A;  2C6W B;  3W4Q A;  2PU2 A;  3PAG A;  4RX3 A;  4DE0 A;  4JKT A;  5A90 A;  3VFH A;  2HP5 A;  3CJM A;  1Q2Q A;  5HAR A;  1ES3 A;  1YLT A;  4GOG A;  3WS1 A;  3VP4 A;  4HEF A;  4HBU A;  5HAP A;  3ITA A;  4ZAM A;  2XDM A;  3WS0 A;  5HFO A;  2WAD A;  3HUN A;  1K57 A;  5CTN A;  1VM1 A;  3HVF A;  5FI7 A;  4NET A;  4WZ5 C;  1IYQ A;  5M18 A;  3N8L A;  1YLZ A;  2XR0 A;  1CEG A;  1S6R A;  5G18 A;  3C5A A;  4WEJ A;  3IXH A;  5FQI A;  4E6X A;  1BLS A;  2Z2L B;  2ZJ9 A;  5EVI D;  2PBY A;  4WYY A;  2HDR A;  1ZG4 A;  3HLB A;  1PZO A;  3ZNY A;  3BFF A;  4QB8 A;  5F83 A;  1ERO A;  5CHM A;  3A3F A;  3FKW A;  4E3N A;  5GL9 A;  2XEP A;  2A3U A;  5CGX A;  2ZD8 A;  1EWZ A;  3OCL A;  4PM9 A;  4B88 A;  4DE1 A;  1BT5 A;  3BLM A;  3DTM A;  4Y0T A;  3BFC A;  3SH7 A;  3Q7Z A;  4P87 A;  4P6B A;  2WZX A;  3Q81 A;  3O87 A;  4OQ0 A;  1CI9 A;  3C4P A;  5FA7 A;  5DTT A;  1XGI A;  1NZO A;  4DDY A;  4F94 A;  3GV9 A;  3TSG A;  1K56 D;  3VP0 A;  3PBN A;  1E3U D;  1NYM A;  4IVK A;  4GD8 A;  4DE3 A;  4S2N C;  4Z9Q A;  2WKE A;  1S0W A;  1KE3 A;  3GMW A;  5A93 A;  2G2U A;  4S2I A;  1DJA A;  1YQS A;  2R9W A;  4L0L A;  2XFT A;  2GDN A;  3M6H A;  3B3X A;  2ZC6 B;  1L0F A;  1KGE A;  4RX2 A;  1E4D A;  4BL2 A;  1MWU A;  5DF8 A;  3Q82 A;  5TFQ A;  3CMZ A;  5AQA A;  4Y7P A;  4Y0U A;  5F82 A;  1PWD A;  3Q7V B;  1FCO A;  1I2S A;  1TDG A;  3AGF A;  5AQB A;  5HAI A;  3RXW A;  4MEZ A;  3AGD A;  1XPB A;  1JTG A;  4GDN A;  2HPB A;  2ZMA A;  2ZM0 A;  3GQZ A;  4R3J A;  4E3I A;  4KQO A;  2XK1 A;  4KG5 A;  3CZD A;  3ITB A;  5GLB A;  1I5Q A;  4FD8 A;  3UDX A;  5AQ7 A;  3OCN A;  4QJG A;  1K4E A;  2Y91 A;  1L2S A;  1QME A;  2Q9M A;  1CI8 A;  4X53 A;  5CER A;  1H8Y A;  3O86 A;  4PM8 A;  1MPL A;  4ZJ2 A;  3DW0 A;  2Y4A A;  5DVA A;  1L0D A;  4H8R A;  1JTD A;  3A3E A;  3HLE A;  5FQJ A;  2ZM2 A;  2DCF A;  1H8Z A;  3N7W A;  3O88 A;  5F1G A;  3G2Z A;  1GA9 A;  3D4F A;  3GRJ A;  3IXD A;  1HZO A;  4KG2 A;  4DRT A;  3C7U A;  4WM9 A;  4ZTK A;  1ZKJ A;  4ZDX A;  1SHV A;  1DY6 A;  2UWX A;  4WZ5 A;  1MKI A;  3HUO A;  3LCE A;  4HBT A;  1L0G A;  1H5X A;  1HVB A;  3DWZ A;  4P85 A;  2P9V B;  4WEK A;  2E8I A;  1BLP A;  1E3U A;  5GLD A;  2CC1 A;  4QD4 A;  3IHB A;  4WZ4 A;  2J9P A;  1K54 C;  4WMC A;  3NDE A;  3RJU A;  4OQG A;  3A3I A;  5FQK A;  4DE2 A;  4R23 A;  4OPQ A;  5GLA A;  1CK3 A;  3NBL A;  3ZDJ A;  4A5R A;  4N9K A;  3MXS A;  2BG1 A;  3GTC A;  4PM5 A;  1YMS A;  3GR2 A;  4JF4 A;  4BJP A;  5FAP A;  5KSH A;  3HL9 A;  2ZQC A;  1KDS A;  1FOF A;  1M40 A;  2HP6 A;  2WK0 A;  1NXY A;  5GHZ A;  4JPM A;  5EE8 A;  3UPP A;  1TDL A;  2Y2P A;  4DXB A;  1FQG A;  2WAF A;  3OPL A;  3G30 A;  4S2J A;  3ISG A;  5FAQ A;  3NCK A;  4K0X A;  3AGE A;  4R4R A;  1HD8 A;  4DDS A;  3HLW A;  3VMA A;  2DNS A;  5U47 A;  1IYS A;  2X71 A;  1IEM A;  3OPP A;  1IYO A;  3E2L A;  4R1G A;  1RCJ A;  1ES5 A;  4X55 A;  4ZJ3 A;  4NK3 A;  4OQI A;  1K55 C;  2JE5 A;  4GZB A;  2EXB A;  1YLY A;  1Y54 A;  5A92 A;  4E3O A;  1YMX A;  2WUQ A;  3BRM A;  3FWL A;  4S2N A;  3A3D A;  5HW3 A;  1LL5 A;  3UDF A;  3W8K A;  1KDW A;  4DXC A;  1ES2 A;  1G6A A;  5GHX A;  2XD1 A;  4KZ7 A;  1XP4 A;  1ZC2 A;  4GB7 A;  4K0W A;  4KZ4 A;  3IQA A;  1GCE A;  5CHJ A;  5CRF A;  2WGV A;  2XFS A;  1IKI A;  4PMA A;  5DTS A;  4BD0 A;  4RVA A;  4OPY A;  3VSL A;  3N8S A;  4MBK A;  5FAS A;  1PIO A;  1O07 A;  1WE4 A;  4YFM A;  3UPN A;  3GSG A;  1MY8 A;  5FAO A;  4OOL A;  1KVL A;  4WEL A;  1GHM A;  1SDN A;  5E2G A;  4GNU A;  3QNB A;  1ERQ A;  1FR6 A;  4BD1 A;  1YLP A;  1YLW A;  4BLM A;  1XXM A;  5CEC A;  4KEN B;  1PYY A;  4QY6 A;  2EXA A;  4KZ6 A;  4UA7 A;  5CHU A;  3WWX A;  4DKI A;  4KQR A;  3ZNT A;  2RL3 A;  1ESI A;  1FSW A;  1NZU A;  5M1A A;  5E2E A;  4KQQ A;  4LV3 A;  5FAT A;  4OOY A;  4OKP A;  1FCM A;  2FFY A;  2Y2M A;  2Y2J A;  4OLD A;  3EQU A;  4MBF A;  2Y2N A;  4OVD A;  2PU4 A;  4S2K A;  3G2Y A;  1MWS A;  5EVI B;  3M2K A;  4MBH A;  1PI4 A;  2XD5 A;  1CEF A;  5KSC A;  1LL9 A;  1YM1 A;  3IWQ A;  1OME A;  4N1X A;  3IXB A;  1FCN A;  5JYP A;  1U60 A;  3IWO A;  2V1Z A;  4R3B A;  3PBR A;  3UDI A;  4LCM A;  4EV4 A;  4S2P A;  5FI6 A;  3BEB A;  3MFD A;  3EQV A;  5KMW A;  1WYC A;  1ERM A;  4S2M A;  2H0T A;  1G68 A;  2WYX A;  1Q2P A;  5DF7 A;  1KE4 A;  2DRW A;  4C3Q A;  3ZG8 B;  3MZD A;  5FQM A;  5EVI A;  1JWP A;  2G2W A;  1O7E A;  3PBQ A;  4PM6 A;  2VGK A;  5BOH A;  3MZF A;  3TG9 A;  3IWI A;  3S22 A;  3WRZ A;  3ZG0 A;  3A3J A;  2C5W B;  4KZ5 A;  3JYI A;  1FR1 A;  1XX2 A;  2OSU A;  2Y2H A;  3QNC A;  3UY6 A;  3Q7V A;  2Y2K A;  3OPH A;  1YLJ A;  5EPH A;  5EOO A;  1XGJ A;  4R4S A;  4RA7 A;  3UO9 A;  2HP9 A;  4HES A;  3OPR A;  3P98 A;  1EI5 A;  5F1F A;  3VSK A;  2JBF A;  2EFU A;  4ZJ1 A;  2WAE A;  1XA7 A;  4QU3 A;  1W5D A;  4EWF A;  3N6I A;  3FV7 A;  1KVM A;  3UPO A;  1M6K A;  3HBR A;  3LEZ A;  4XUX A;  2EX9 A;  1L0E A;  1BTL A;  3C4O A;  3O3V A;  4ID4 A;  4MNR A;  4B4Z A;  2QMI A;  4YIN A;  3N4I A;  3S4X A;  3PBS A;  5CEB A;  4S2O A;  1K56 A;  2Y2O A;  1PWC A;  1VQQ A;  3IT9 A;  3WS4 A;  5EEC A;  4JXV A;  5HX9 A;  2IWD A;  3SS4 A;  1W8Q A;  3CG5 A;  4EUZ A;  3RXX A;  1PW8 A;  2ZQ7 A;  2WGI A;  4E3L A;  4PM7 A;  2OLV A;  1BLH A;  4X56 A;  4CPK A;  4DF6 A;  3PBO A;  3G34 A;  3HLG A;  3MZE A;  2X02 A;  4GD6 A;  5GLC A;  3NIA A;  3WS2 A;  4RYE A;  4EQI A;  3VP3 A;  1BLC A;  3HLC A;  3LO7 A;  2ZQ9 A;  2ZQD A;  2P9V A;  4X6T A;  4KZB A;  1WYB A;  1XKZ A;  4LV0 A;  4MLL A;  2IWC A;  3BFG A;  3V5M A;  4OOM A;  5EVL A;  2Z2M B;  3BFD A;  2IWB A;  4JXW A;  3UE1 A;  1LLB A;  1IEL A;  3M6B A;  5CED A;  1JWZ A;  3WS5 A;  1ZG6 A;  4IBX A;  4N92 A;  3E2K A;  4Y0O A;  2X01 A;  1K25 A;  3UNW A;  1BUE A;  1PI5 A;  3C7V A;  3SS5 A;  4EBN A;  4JF5 A;  5FSR A;  1YT4 A;  5E2H A;  2XF3 A;  1GHP A;  2I72 A;  3IF6 C;  3M2J A;  4OPZ A;  3IXG A;  1XA1 A;  1RGY A;  3GVB A;  2RCX A;  5AQ9 A;  1GHI A;  5FI2 A;  5EUA A;  1PZP A;  3P09 A;  4U3T A;  2H10 A;  1TVF A;  4X69 A;  1MWT A;  4JXS A;  1C3B A;  1MXO A;  2J8Y A;  1N4O A;  2QPN A;  4IBR A;  2Y2L A;  4JLF A;  4JBF A;  3NY4 A;  3ZFZ A;  3SH8 A;  5FQQ A;  4EBP A;  3G35 A;  4BL3 A;  3ZGA B;  2ZC5 B;  5M19 A;  3V3R A;  2XH9 A;  2QZ6 A;  4FSF A;  3SOI A;  3W4O A;  4OQH A;  1E25 A;  3HRE A;  2ZM8 A;  1TEM A;  1SDE A;  2ZC7 A;  2BLS A;  4KG6 A;  3ZG5 A;  5A91 A;  4PPR A;  1K4F A;  3MXR A;  3PBT A;  3SS3 A;  5KZH A;  1SKF A;  4BQM A;  1Z6F A;  2HDQ A;  4U0T A;  2XQZ A;  1MWR A;  4XXR A;  4C75 A;  4LCL A;  4R0Q A;  4ZBE A;  4UHU A;  1W8Y A;  1NRF A;  2J7V A;  2Y55 A;  3BEC A;  4U0X A;  2WKH A;  2ZC3 B;  4QHC A;  2JCH A;  3I7J A;  3ZHH A;  1DJC A;  5TR7 A;  1I2W A;  1JWV A;  2Y2I A;  4UAA A;  4OLG A;  4FCF A;  5IHV A;  3HUM A;  4D2O A;  4XUZ A;  5HL1 A;  5I94 A;  3Q1F A;  3QHY A;  3ZCZ A;  4OPR A;  2WKI A;  4GDB A;  5EOE A;  4OP5 A;  4E6W A;  2V2F F;  4FH2 A;  3V3S A;  3WRT A;  4FH4 A;  3G31 A;  1RGZ A;  5FDH A;  4CJN A;  2A49 A;  3IHA A;  3N8R A;  3NDG A;  4LV1 A;  4UA6 A;  4C6Y A;  1K54 A;  1K57 C;  4OON A;  4KZ8 A;  4P0M A;  3BYD A;  4WMC D;  1NJ4 A;  4E3J A;  1BZA A;  1HTZ A;  2R9X A;  3DWK A;  1PW1 A;  1PWG A;  5DTK A;  3HLD A;  4E3K A;  2EFX A;  1ES4 A;  1FSY A;  1IYP A;  2ZQ8 A;  3IF6 B;  4K91 A;  3VOZ A;  4Q8I A;  1NYY A;  3BFE A;  4N9L A;  3IH9 A;  4EBL A;  5CGW A;  5L2F A;  2Y2G A;  1RP5 A;  5D3O A;  5FQ9 A;  4KZ9 A;  1GA0 A;  1K38 A;  3FKV A;  3G4P A;  2Y59 A;  4GN2 A;  4UA9 A;  3Q07 A;  1IKG A; 
#chains in the Genus database with same CATH topology
 5DJU A;  3TW8 A;  2GJ3 A;  2ZC4 B;  3KSF A;  3F1N A;  5GHY A;  5EVE A;  1ESU A;  3R4K A;  5HDS A;  1KGG A;  4L9E A;  3LI8 A;  2WKR A;  5JYO A;  2NUT C;  3ZVT A;  3IX4 A;  3W2Z A;  1XJ3 A;  2XGN A;  1LI0 A;  1QMF A;  4CLC C;  4F3L B;  4LRY C;  1BSG A;  4IED A;  4YOF A;  4OH0 A;  1S66 L;  4CQH A;  1N9B A;  3EEH A;  3IS2 A;  3VOY A;  4R6L A;  2EX6 A;  4GW9 A;  1CF0 A;  3UMD A;  1GSX A;  4IVI A;  3G32 A;  2ZQA A;  3V39 A;  2HDS A;  2JC7 A;  3NI9 A;  1DJB A;  3PAG A;  3V67 A;  4DE0 A;  2EA9 A;  3MQ0 A;  3VFH A;  2HP5 A;  5HAR A;  4I3I A;  2OWJ A;  4ZAM A;  1S1Z A;  2WAD A;  3F1P B;  4FTX A;  3HUN A;  1VM1 A;  4WZ5 C;  1V9Y A;  4E6X A;  1BLS A;  2Z2L B;  2ZJ9 A;  4WYY A;  2HDR A;  1PFL A;  4Z1W A;  5GL9 A;  2ZD8 A;  1EWZ A;  1X0O A;  4JGO A;  1H0M A;  3S7N A;  1JNU A;  4CLC B;  3DTM A;  1SKO A;  1H8M A;  4Y0T A;  3O87 A;  3D72 A;  2V1B A;  4DDY A;  1P9R A;  2VGL M;  3VP0 A;  2CMN A;  4X1L A;  5TJJ A;  2WKE A;  1KE3 A;  3GMW A;  3CUE A;  5AVE A;  1S4R A;  1GSW A;  3PR6 A;  5DF8 A;  3CMZ A;  4Y7P A;  1FCO A;  4GDN A;  4QPR A;  2HJ9 C;  4E3I A;  4HJ4 A;  3CZD A;  1I5Q A;  4FD8 A;  3UDX A;  5AQ7 A;  3OCN A;  3GDI A;  4PM8 A;  1MPL A;  4ZJ2 A;  3DW0 A;  5DVA A;  1JTD A;  3HLE A;  2DCF A;  2B02 A;  3UB7 A;  3G2Z A;  1GA9 A;  1HZO A;  5FEG A;  5MC7 A;  2QKP A;  4P85 A;  1PRQ A;  2J9P A;  2JKG A;  3NDE A;  3RJU A;  3A3I A;  5FQK A;  3MXS A;  2BG1 A;  2J3T C;  3GTC A;  1N9L A;  2HZ5 A;  1W63 Q;  1FOF A;  2HP6 A;  2M7V A;  1NXY A;  4YWZ A;  1TDL A;  3G30 A;  3ISG A;  5FAQ A;  4HH3 A;  2PD7 A;  4ARZ A;  1IYS A;  2X71 A;  3D3O A;  4R1G A;  3LIE A;  3LFV A;  4NK3 A;  4OQI A;  1UWN X;  2EXB A;  1Y54 A;  5A92 A;  2EWV A;  4S2N A;  1LL5 A;  2PR6 A;  1D7E A;  1G6A A;  2XA7 S;  4PKY G;  4KZ7 A;  1ZC2 A;  5EM0 A;  1F5M A;  5CHJ A;  2WGV A;  4BD0 A;  1IKI A;  4ETX A;  4RVA A;  3PXP A;  2FH5 A;  3S7O A;  3UPN A;  3GSG A;  5G4Y A;  3CWF A;  1GHM A;  4GNU A;  3QNB A;  4JGR A;  1ERQ A;  1FR6 A;  3JPU A;  5G4Z A;  4EQ1 A;  5CEC A;  4KEN B;  2WKP A;  4KQR A;  3ZNT A;  4LV3 A;  4OOY A;  3JVV A;  4OKP A;  5AJG A;  2PR5 A;  3EQU A;  4O01 A;  4MBF A;  3T1S A;  2XD5 A;  1YKD A;  3IXB A;  3L9K A;  2V1Z A;  3PBR A;  4LCM A;  1VHM A;  2H0T A;  2WYX A;  2M7U A;  5EVI A;  3SW1 A;  1WA9 A;  3MZF A;  3WRZ A;  3ZG0 A;  4EET B;  3A3J A;  3QNC A;  3MR0 A;  5L09 A;  3VE3 A;  3P98 A;  4ZJ1 A;  1XA7 A;  4QU3 A;  1KVM A;  2A24 B;  5TBM A;  4KUK A;  1L0E A;  5DKK A;  1BTL A;  3N4I A;  5HSQ A;  5HX9 A;  3CG5 A;  4E3L A;  4PM7 A;  2GX5 A;  4CPK A;  4BBT A;  3IS2 B;  3HLG A;  3NIA A;  2QJ5 A;  2PRF A;  3LO7 A;  3HLC A;  4X6T A;  4LV0 A;  2W3G A;  2IWC A;  3V5M A;  4OOM A;  1ACF A;  3BFD A;  4PAU A;  4ZRR A;  1LLB A;  5CED A;  2VGL S;  3WS5 A;  1ZG6 A;  4N92 A;  2X01 A;  1BUE A;  3C7V A;  3SS5 A;  4EBN A;  3CPT A;  5FSR A;  5E2H A;  2I72 A;  4Y15 A;  2J80 A;  2RCX A;  5AQ9 A;  4JBF A;  3SH8 A;  3G35 A;  3V3R A;  3SOI A;  4OQH A;  1E25 A;  1TEM A;  5F6A A;  5A91 A;  4PPR A;  5I5L A;  1MZU A;  1SKF A;  1OTI A;  2O9C A;  3MQO A;  3RH8 B;  4AFI A;  4NEE D;  4ETZ A;  4MMN A;  2Y55 A;  2ZC3 B;  2INW A;  2VEA A;  1JWV A;  1TS6 A;  2L4R A;  4UAA A;  3UB5 P;  3ZQ5 A;  4HJ3 A;  3K3D A;  3HUM A;  3Q1F A;  3QHY A;  5EOE A;  2V2F F;  5EV0 A;  2H28 A;  2JN7 A;  2YKH A;  1RGZ A;  2E8J A;  5AVF A;  4P6Z M;  4R3A A;  4OON A;  4KZ8 A;  3MMH A;  4WMC D;  2P08 A;  3P7N A;  2R9X A;  3MQQ A;  5DTK A;  1N9O A;  1IYP A;  1T1C A;  4Q0H A;  3T4Q A;  4Q8I A;  1PNE A;  4EBL A;  3HJK A;  5FQ9 A;  3LEQ A;  3UME A;  2JKF A;  2Y59 A;  4GN2 A;  3ITA A;  4S2L A;  3NJA A;  3ZG9 B;  3PAE A;  5A8B A;  3IF5 A;  1J3W A;  4NXF A;  1N9N A;  4LEN A;  4RQ9 A;  4E3M A;  3NOU C;  1SCW A;  3TOI A;  2QWS A;  1LHY A;  4QWO A;  2WGW B;  4KUO A;  4B4X A;  3H9W A;  1OTD A;  3A0S A;  4BEN A;  3ZG7 B;  2Y2Q A;  5E43 A;  1W7F A;  3W4P A;  4MN5 A;  5HAQ A;  1OTA A;  2FZ0 A;  3OC2 A;  5EVI C;  2O9B A;  3IH8 A;  1ONG A;  2OAQ 1;  3V50 A;  2OV5 A;  3UDI A;  5E2F A;  1K6R A;  5TGF A;  4R38 A;  2Q0O A;  4I3J A;  4JKT A;  5A90 A;  2A2L A;  3CJM A;  3UB9 A;  4HEF A;  4EUV A;  3UE6 A;  2HJE A;  3RFB A;  1K57 A;  5HL6 A;  4NET A;  5M18 A;  1YLZ A;  1V9Z A;  5G18 A;  3RTY A;  2P04 A;  1NLY A;  2PBY A;  1ZG4 A;  3T4K A;  3ZNY A;  2JKT M;  1TD5 A;  3BFF A;  2G7U A;  4HOI A;  4Y5F A;  5CHM A;  3FKW A;  5CGX A;  3T1R A;  5HD5 A;  3R7W B;  4B88 A;  3E4O A;  4L9F A;  4P87 A;  2WZX A;  4Y17 A;  5FA7 A;  5DTT A;  1XGI A;  3T4T A;  3GV9 A;  1A0K A;  3TSG A;  3PBN A;  1NYM A;  4IVK A;  4GD8 A;  4LGW A;  4DE3 A;  4Z9Q A;  5A93 A;  1S0W A;  1DJA A;  3B3X A;  4RX2 A;  1L0F A;  2JKT I;  3T50 A;  1MWU A;  4Y0U A;  5F82 A;  1F9I A;  1PWD A;  1TDG A;  3AGF A;  5AQB A;  4WN5 A;  1YPR A;  1XPB A;  2HPB A;  3BY9 A;  2HF6 A;  1XJ2 A;  2XK1 A;  1P97 A;  2M1C A;  2VKS A;  4QJG A;  1K4E A;  4B93 A;  2Y91 A;  1QME A;  2Q9M A;  1H8Y A;  3H7W A;  4HIA A;  4EU0 A;  5F68 A;  1L3L A;  1L0D A;  3A3E A;  1H8Z A;  1CJF A;  2YKF A;  4KG2 A;  3C7U A;  2ACG A;  4ZDX A;  1SHV A;  1DY6 A;  4HP9 A;  1MKI A;  1H5X A;  3DWZ A;  4WEK A;  2CC1 A;  2V8F A;  5L8M A;  4DE2 A;  5GLA A;  1CK3 A;  4M4X A;  1W63 M;  4PM5 A;  2ZL1 B;  1YMS A;  3CPT B;  3HL9 A;  2ZQC A;  1M40 A;  3KX0 X;  3UPP A;  4DXB A;  3EOI A;  4S2J A;  3HLW A;  3BWL A;  3VMA A;  3TRC A;  3OPP A;  3E2L A;  4X55 A;  1ES5 A;  3C2W A;  4GZB A;  3W8K A;  4DXC A;  4G3K A;  3NHQ A;  4KZ4 A;  3CAX A;  3T1X A;  1GCE A;  5CRF A;  4PMA A;  2VV7 A;  4R70 A;  4OPY A;  3VSL A;  3H82 B;  3N8S A;  4MBK A;  1PIO A;  1WE4 A;  4L9G A;  1IOU A;  1KVL A;  1SDN A;  4BD1 A;  3HJI A;  3QP8 A;  1Z09 A;  2W1T A;  4HH2 A;  1PYY A;  4DJ3 A;  4UA7 A;  2EXA A;  1OT6 A;  5CHU A;  3LIC A;  4DKI A;  2RL3 A;  1NZU A;  3CIT A;  1FCM A;  4WL9 A;  3LI9 A;  4OVD A;  1MKM A;  4S2K A;  5KSC A;  1OME A;  4N1X A;  1FCN A;  2P7J A;  1U60 A;  3BY8 A;  3IWO A;  4EV4 A;  3BEB A;  1WYC A;  1S4S A;  1Q2P A;  1KE4 A;  4C3Q A;  3A0R A;  3MZD A;  2G2W A;  3PBQ A;  4PM6 A;  1FIL A;  5BOH A;  1G28 A;  3S22 A;  2Y2H A;  1OTB A;  3ULF A;  3Q7V A;  1LT0 A;  1P9W A;  3OPH A;  1YLJ A;  5EPH A;  1XGJ A;  4RA7 A;  2W3D A;  4HES A;  2QYB A;  1EI5 A;  5F1F A;  2EFU A;  4GLQ A;  4NXG A;  1W5D A;  4EWF A;  3UPO A;  3HBR A;  4XUX A;  1XFN A;  3OBF A;  1Y4O A;  4LRX C;  3O3V A;  3ZYT A;  4ID4 A;  4HHD A;  4YIN A;  4S2O A;  1PWC A;  3FC7 A;  3IT9 A;  5EEC A;  2IWD A;  1W8Q A;  2K31 A;  1YAX A;  2L0W A;  3BQA A;  4X56 A;  2B95 A;  4DF6 A;  3PBO A;  3G34 A;  2JHE A;  4UQI S;  3KSG A;  3VP3 A;  1BLC A;  3OOV A;  4LRZ E;  2ZQD A;  2P9V A;  3BW6 A;  4MLL A;  3M6B A;  1IEL A;  4XT2 A;  1JWZ A;  4Y0O A;  4KQD A;  1K25 A;  2QHK A;  2XF3 A;  3M2J A;  2W27 A;  1XA1 A;  1RGY A;  3CLO A;  1H3Q A;  3SZT A;  1GHI A;  4IJG A;  1MWT A;  3MSH A;  1MXO A;  1N4O A;  2QPN A;  1XJ4 A;  4JLF A;  3UB8 A;  3NY4 A;  3ZFZ A;  5FQQ A;  2PAV P;  4BWI A;  2ZC5 B;  5M19 A;  2QZ6 A;  3W4O A;  3DTI A;  2ZM8 A;  4EER A;  3B47 A;  3ZG5 A;  5KZH A;  2HDQ A;  2KDK A;  2XQZ A;  1MWR A;  4C75 A;  1T1B A;  4ZBE A;  1VEU A;  4UHU A;  2WKQ A;  3BEC A;  4QHC A;  2GZA A;  2JCH A;  2LB5 A;  5F5Y A;  1I2W A;  4WUJ A;  5J4E A;  2Y2I A;  4OLG A;  5IS1 A;  2L1M A;  4FCF A;  3JVU A;  4D2O A;  5HL1 A;  1GSV A;  4OPR A;  2WKI A;  4OP5 A;  4E6W A;  3F1O A;  3V3S A;  3WRT A;  1VET B;  5FDH A;  3IHA A;  3NDG A;  4LV1 A;  4UA6 A;  3C8C A;  4O0P A;  3GEC A;  3A0V A;  4HQA A;  1NJ4 A;  1PW1 A;  3HLD A;  1ES4 A;  4K08 A;  2V0U A;  3F1N B;  1NYY A;  3IH9 A;  5HWW A;  2Y2G A;  2KOI A;  4HNB A;  4KZ9 A;  1K38 A;  4Y2F A;  2AVX A;  1IKG A;  4Y13 A;  2V20 A;  5CTM A;  3D9Y A;  3IF6 A;  2VZW A;  1K6S A;  2HDU A;  1AXB A;  2PYP A;  4WBG A;  3KO6 A;  2ZOI A;  5KIZ A;  2VGJ A;  3BLS A;  3QP1 A;  3NC8 A;  4LV2 A;  3VP2 A;  1KGF A;  5HWT A;  3S1Y A;  3CUE C;  2NUP C;  3LY4 A;  5CGS A;  3LY3 A;  2PD8 A;  1KE0 A;  2W3E A;  2H5S A;  1J9M A;  2XLN A;  4M3K A;  3FYZ A;  2P74 A;  3MBZ A;  1UWP X;  3BM6 A;  3FPV A;  2ZLY A;  5EFW A;  3UE3 A;  4F3L A;  3LR4 A;  1ONH A;  3UB6 A;  2WZZ A;  2ZOH A;  1NLZ A;  2H0Y A;  4OP8 A;  4RX3 A;  4CLC D;  1Q2Q A;  1ES3 A;  1YLT A;  1LSW A;  5HAP A;  5IU1 A;  2XDM A;  5HFO A;  3N8L A;  2XR0 A;  1CEG A;  4X1M A;  3C5A A;  5FQI A;  3IXH A;  1SKO B;  3HLB A;  5FDS A;  3F1P A;  3NUL A;  4PKY A;  2W3H A;  1ERO A;  2VX8 A;  3A3F A;  4E3N A;  2XEP A;  2A3U A;  3OCL A;  3L7H A;  4PM9 A;  2IA2 A;  1OT9 A;  4DE1 A;  1BT5 A;  3BLM A;  3SH7 A;  4P6B A;  1VB6 A;  4OQ0 A;  3C4P A;  4WLA A;  4F94 A;  1K56 D;  4IUH A;  4NG2 A;  1E3U D;  4DN0 A;  2PBD P;  2QJ7 A;  4UEY A;  4S2N C;  4S2I A;  1S67 L;  2R9W A;  4L0L A;  1T1A A;  4HI4 A;  3M6H A;  4GHI A;  2ZC6 B;  1KGE A;  1E4D A;  4BL2 A;  3Q7V B;  1I2S A;  5HAI A;  4MEZ A;  1ZTU A;  1JTG A;  2ZMA A;  2ZM0 A;  1T18 A;  1BYW A;  4ESP A;  3ITB A;  5GLB A;  4JGP A;  1G6O A;  1AWI A;  1CI8 A;  4X53 A;  5CER A;  3O86 A;  2Y4A A;  1TF1 A;  4LLO B;  2ZM2 A;  4H6J A;  3N7W A;  2K7S A;  5K5B A;  3GRJ A;  4DRT A;  1ZKJ A;  2OOL A;  3O5Y A;  2UWX A;  2V9A A;  4WZ5 A;  3HUO A;  3LCE A;  2P9V B;  2E8I A;  1BLP A;  1E3U A;  4QD4 A;  3IX8 A;  4WMC A;  4HJ6 A;  4OPQ A;  3NBL A;  4ARZ B;  4N9K A;  3VOL A;  1F2K A;  5KSH A;  2VJW A;  2WK0 A;  1XFQ A;  4JPM A;  1FQG A;  3K2N A;  4R4R A;  3AGE A;  1T19 A;  3IX3 A;  4D60 A;  5U47 A;  1IYO A;  1RCJ A;  4E3O A;  1YMX A;  2WUQ A;  3BRM A;  3FWL A;  3A3D A;  5HW3 A;  1KDW A;  1ES2 A;  1STZ A;  2J3T D;  3EGD C;  1XP4 A;  4K0W A;  3IQA A;  3TE8 A;  1LSX A;  2LB9 A;  1P0Z A;  1FIK A;  3T4L A;  1O07 A;  2D01 A;  4YFM A;  3T4J A;  4OOL A;  4WF0 A;  3BJN A;  4II7 A;  5E2G A;  2OWH A;  3CI6 A;  1YLP A;  3T4O A;  1XXM A;  2V8C A;  3F1O B;  2UV0 E;  4I38 A;  5M1A A;  5FAT A;  2Y2M A;  4OLD A;  2PU4 A;  5EVI B;  4EEU A;  3IWQ A;  5KMW A;  4S2M A;  4Q0J A;  1JWP A;  2PDR A;  1O7E A;  4GS9 A;  5F69 A;  1KOU A;  1D1J A;  3IWI A;  5TBM B;  4DJ2 A;  2C5W B;  4KZ5 A;  3JYI A;  2OSU A;  1XX2 A;  3UY6 A;  3NOT C;  1G5U A;  2Y2K A;  4R4S A;  2XA7 M;  2PHY A;  3UO9 A;  2HP9 A;  3OPR A;  3VSK A;  2WAE A;  4GJ4 A;  1M6K A;  2EX9 A;  1F98 A;  1NWZ A;  4EEP A;  3C4O A;  4I5S A;  4MNR A;  4B4Z A;  2XRO A;  1S1Y A;  2W3F A;  3PBS A;  5CEB A;  4JXV A;  4HP4 A;  3LIB A;  5L10 A;  3SS4 A;  4EUZ A;  3RXX A;  1PW8 A;  3NOP C;  2A24 A;  4NXE A;  2ZMV A;  3LYX A;  4GD6 A;  5GLC A;  3MZE A;  2X02 A;  3T12 B;  3MFX A;  2ZQ9 A;  1SZV A;  2VV8 A;  4E04 A;  2B18 A;  1WYB A;  1XKZ A;  4MDZ A;  3BFG A;  3VE4 A;  4G3V A;  2Z2M B;  4JXW A;  5HDD A;  5IT5 A;  4P6Z S;  3FG8 A;  1YT4 A;  3IXG A;  2PYR A;  3GVB A;  1YSQ A;  3P09 A;  4U3T A;  3QP5 A;  2H10 A;  1TVF A;  4X69 A;  2J8Y A;  2Y2L A;  4EBP A;  4BL3 A;  3MF0 A;  2V0W A;  2XH9 A;  3E0Y A;  3HRE A;  2ZC7 A;  2BLS A;  1K4F A;  3MXR A;  1Z6F A;  2KX6 A;  4U0T A;  4XXR A;  5HPF A;  2O9A A;  4I39 A;  2O0Y A;  1NRF A;  4U0X A;  3CHW P;  3QP6 A;  1IFQ A;  3ZHH A;  1DJC A;  4GDB A;  4GHI B;  2A49 A;  3N8R A;  1LL8 A;  3DTK A;  5J7E A;  1K54 A;  1K57 C;  3C38 A;  3BYD A;  4E3J A;  2HV1 A;  3DWK A;  3BQ8 A;  1OPX A;  1PWG A;  4E3K A;  2EFX A;  2ZQ8 A;  3E98 A;  3VOZ A;  1DP6 A;  4N9L A;  5CGW A;  5D3O A;  3E4P A;  1GA0 A;  3FKV A;  1OJG A;  3T4S A;  3Q07 A;  3FPW A;  4JF6 A;  4H6J B;  5J8X A;  4KZ3 A;  2R78 A;  1K55 A;  1UGU A;  3VP1 A;  2Q9N A;  2EX2 A;  3FZC A;  4Y3I A;  4CLC E;  3OZH A;  1OTE A;  3KYE A;  1DP9 A;  5CXW A;  1JVJ A;  3EWK A;  3UE0 A;  3PTE A;  4X25 A;  2J9O A;  1MBL A;  3ZVW A;  2OLU A;  3MKF A;  1DRM A;  4GKU A;  2EX8 A;  1TS7 A;  3MKE A;  3P01 A;  3VFF A;  4N1H A;  4JXG A;  1ALQ A;  3HLF A;  4KZA A;  4X68 A;  5C5K A;  1W79 A;  5DFY A;  3UN7 A;  1LI9 A;  3SH9 A;  1BUL A;  4QY5 A;  5DF9 A;  3KSI A;  2WGW A;  3U2A A;  3OLO A;  4MN6 A;  1NY0 A;  2B5R A;  2FFF B;  4O7D A;  2C6W B;  3W4Q A;  2PU2 A;  4PHT A;  5FEF A;  3LUQ A;  3B42 A;  4GOG A;  3WS1 A;  3VP4 A;  4HBU A;  3MJQ A;  3WS0 A;  4GCZ A;  5CTN A;  3HVF A;  2BAS A;  5FI7 A;  1IYQ A;  1S6R A;  2Z6C A;  4WEJ A;  5EVI D;  1PZO A;  3S7P A;  1D06 A;  3IBJ A;  4QB8 A;  5F83 A;  2VK3 A;  4IUK A;  3BFC A;  3EGX C;  3Q7Z A;  3Q81 A;  1CI9 A;  3K3C A;  2VA0 A;  1NZO A;  2GNX A;  2DMW A;  3R7W A;  3KYZ A;  2G2U A;  1YQS A;  3QP2 A;  1NRJ A;  2XFT A;  2GDN A;  4GS9 B;  3KSH A;  3Q82 A;  5TFQ A;  5AQA A;  2ZBB A;  3LR0 A;  3H7W B;  3RXW A;  4O8G A;  3AGD A;  3QP4 A;  3GQZ A;  4R3J A;  4KQO A;  4KG5 A;  4MCW A;  1MC0 A;  3DBA A;  1OJ5 A;  1L2S A;  3PHY A;  3HCY A;  4H8R A;  3NEC A;  5FQJ A;  3O88 A;  5LBR A;  5F1G A;  4BMW A;  3D4F A;  3IXD A;  4WM9 A;  4ZTK A;  5DJT A;  4BBV A;  1L0G A;  4HBT A;  3S7Q A;  1HVB A;  4IHQ A;  4FOF A;  5DKL A;  1DP8 A;  5GLD A;  2VLG A;  3IHB A;  4WZ4 A;  1K54 C;  4FUW A;  1TS8 A;  4OQG A;  4ME4 A;  4R23 A;  4HY8 A;  3ZDJ A;  4A5R A;  3TJZ C;  4BBU A;  3GR2 A;  4JF4 A;  4BJP A;  5FAP A;  1KDS A;  5GHZ A;  5EE8 A;  2Y2P A;  2WAF A;  3OPL A;  3NCK A;  4K0X A;  1HD8 A;  4DDS A;  2EWW A;  2DNS A;  2W0N A;  2ZL1 A;  2W1R A;  1IEM A;  2XSS A;  1XJ6 A;  4ZJ3 A;  4DMZ A;  1K55 C;  2JE5 A;  1YLY A;  3B33 A;  2V1A A;  2D02 A;  2I9V A;  3UDF A;  3LR3 A;  5GHX A;  2XD1 A;  3U4L P;  5L07 A;  4GB7 A;  2W1T B;  1HLU P;  2PT7 A;  2XFS A;  5DTS A;  4B9O A;  1TS0 A;  3ICY A;  2KLI A;  5FAS A;  4G3W A;  5FAO A;  1MY8 A;  4WEL A;  5HD3 A;  3LGO A;  2J3W A;  4BLM A;  1YLW A;  4QY6 A;  4KZ6 A;  3WWX A;  1Y28 A;  3H82 A;  1ESI A;  1FSW A;  4MN7 A;  5E2E A;  4KQQ A;  5DFX A;  2FFY A;  2Y2J A;  2Y2N A;  3MXQ A;  4CLC A;  3G2Y A;  1MWS A;  3M2K A;  4MBH A;  1PI4 A;  1CEF A;  1LL9 A;  1YM1 A;  1ODV A;  5CX7 A;  3LIF A;  5JYP A;  4R3B A;  4S2P A;  5FI6 A;  3MFD A;  3EQV A;  1ERM A;  1G68 A;  5DF7 A;  2DRW A;  3EEA A;  3ZG8 B;  5FQM A;  2VGK A;  3TG9 A;  1FR1 A;  3C30 A;  5EOO A;  2JBF A;  3G6O A;  5FL3 A;  3DTE A;  3N6I A;  3FV7 A;  2MJ6 A;  3LEZ A;  5EM1 A;  5HPI A;  2K2N A;  2QMI A;  3S4X A;  1K56 A;  1YSP A;  2Y2O A;  1VQQ A;  3WS4 A;  4XT2 B;  2ZQ7 A;  2WGI A;  2OLV A;  1BLH A;  3DAV A;  3WS2 A;  4EQI A;  2OAP 1;  4RYE A;  2Y8H A;  3E4Q A;  2O99 A;  4KZB A;  2Y79 A;  5J3W A;  5EVL A;  4EES A;  3UE1 A;  2IWB A;  2ZMF A;  3KYQ A;  4IBX A;  3E2K A;  3UNW A;  5HWV A;  1PI5 A;  4JF5 A;  4LFU A;  1GHP A;  3IF6 C;  4OPZ A;  4NKP A;  3IBR A;  5FI2 A;  3LIA A;  1PZP A;  5EUA A;  4YNR A;  4JXS A;  1C3B A;  4IBR A;  3VV4 A;  1VEU B;  3ZGA B;  3PYP A;  4JGQ A;  4FSF A;  1SDE A;  1CQA A;  4KG6 A;  3PBT A;  3SS3 A;  4BQM A;  3MS6 A;  4LCL A;  4R0Q A;  3LR5 A;  1W8Y A;  2J7V A;  2WKH A;  3I7J A;  5HDC A;  5TR7 A;  3LID A;  2Z6D A;  4UQI M;  2JKR M;  5IHV A;  4LPZ A;  4XUZ A;  5I94 A;  3ZCZ A;  4EW7 A;  2BTF P;  2VV6 A;  1EW0 A;  4FH2 A;  2XRN A;  4FH4 A;  3G31 A;  4CJN A;  4Q0I A;  4C6Y A;  1LSV A;  4P0M A;  4EXO A;  1K0K A;  1BZA A;  1HTZ A;  4NXB A;  3T1Q B;  1FSY A;  3IF6 B;  1VET A;  4K91 A;  3BFE A;  4I3A A;  5L2F A;  1RP5 A;  2HGV A;  1ZHH B;  3G4P A;  4UA9 A;  2JKR I;  5HZH A; 
#chains in the Genus database with same CATH homology
 2V20 A;  4JF6 A;  4S2L A;  5CTM A;  5J8X A;  3IF6 A;  1K6S A;  2HDU A;  1K55 A;  4KZ3 A;  2ZC4 B;  3ZG9 B;  3VP1 A;  1AXB A;  2Q9N A;  3PAE A;  2EX2 A;  3FZC A;  4WBG A;  5GHY A;  3OZH A;  1ESU A;  2VGJ A;  3BLS A;  1KGG A;  3IF5 A;  5JYO A;  4LEN A;  4LV2 A;  3NC8 A;  5CXW A;  1KGF A;  3VP2 A;  3ZVT A;  4E3M A;  2XGN A;  1JVJ A;  1SCW A;  3TOI A;  1LI0 A;  1QMF A;  3S1Y A;  1LHY A;  3PTE A;  3UE0 A;  2J9O A;  2WGW B;  1MBL A;  1BSG A;  3LY4 A;  3LY3 A;  4IED A;  2OLU A;  5CGS A;  3MKF A;  3ZVW A;  4GKU A;  4B4X A;  2EX8 A;  3MKE A;  1KE0 A;  4N1H A;  3VFF A;  2H5S A;  1J9M A;  2XLN A;  1ALQ A;  4JXG A;  4OH0 A;  3HLF A;  4BEN A;  4M3K A;  3ZG7 B;  2Y2Q A;  4KZA A;  3FYZ A;  2P74 A;  4X68 A;  5E43 A;  1N9B A;  1W7F A;  3MBZ A;  3W4P A;  3BM6 A;  5HAQ A;  1W79 A;  2ZLY A;  3UE3 A;  3UN7 A;  3VOY A;  1LI9 A;  3SH9 A;  1BUL A;  4QY5 A;  1ONH A;  3OC2 A;  5DF9 A;  5EVI C;  2WGW A;  3IH8 A;  2EX6 A;  2WZZ A;  1ONG A;  3V50 A;  1NY0 A;  4IVI A;  2H0Y A;  2OV5 A;  5E2F A;  3G32 A;  2B5R A;  2FFF B;  2ZQA A;  2HDS A;  2JC7 A;  4O7D A;  4OP8 A;  3V39 A;  1K6R A;  5TGF A;  3NI9 A;  1DJB A;  2C6W B;  3W4Q A;  2PU2 A;  3PAG A;  4RX3 A;  4DE0 A;  4JKT A;  5A90 A;  3VFH A;  2HP5 A;  3CJM A;  1Q2Q A;  5HAR A;  1ES3 A;  1YLT A;  4GOG A;  3WS1 A;  3VP4 A;  4HEF A;  4HBU A;  5HAP A;  3ITA A;  4ZAM A;  2XDM A;  3WS0 A;  5HFO A;  2WAD A;  3HUN A;  1K57 A;  5CTN A;  1VM1 A;  3HVF A;  5FI7 A;  4NET A;  4WZ5 C;  1IYQ A;  5M18 A;  3N8L A;  1YLZ A;  2XR0 A;  1CEG A;  1S6R A;  5G18 A;  3C5A A;  4WEJ A;  3IXH A;  5FQI A;  4E6X A;  1BLS A;  2Z2L B;  2ZJ9 A;  5EVI D;  2PBY A;  4WYY A;  2HDR A;  1ZG4 A;  3HLB A;  1PZO A;  3ZNY A;  3BFF A;  4QB8 A;  5F83 A;  1ERO A;  5CHM A;  3A3F A;  3FKW A;  4E3N A;  5GL9 A;  2XEP A;  2A3U A;  5CGX A;  2ZD8 A;  1EWZ A;  3OCL A;  4PM9 A;  4B88 A;  4DE1 A;  1BT5 A;  3BLM A;  3DTM A;  4Y0T A;  3BFC A;  3SH7 A;  3Q7Z A;  4P87 A;  4P6B A;  2WZX A;  3Q81 A;  3O87 A;  4OQ0 A;  1CI9 A;  3C4P A;  5FA7 A;  5DTT A;  1XGI A;  1NZO A;  4DDY A;  4F94 A;  3GV9 A;  3TSG A;  1K56 D;  3VP0 A;  3PBN A;  1E3U D;  1NYM A;  4IVK A;  4GD8 A;  4DE3 A;  4S2N C;  4Z9Q A;  2WKE A;  1S0W A;  1KE3 A;  3GMW A;  5A93 A;  2G2U A;  4S2I A;  1DJA A;  1YQS A;  2R9W A;  4L0L A;  2XFT A;  2GDN A;  3M6H A;  3B3X A;  2ZC6 B;  1L0F A;  1KGE A;  4RX2 A;  1E4D A;  4BL2 A;  1MWU A;  5DF8 A;  3Q82 A;  5TFQ A;  3CMZ A;  5AQA A;  4Y7P A;  4Y0U A;  5F82 A;  1PWD A;  3Q7V B;  1FCO A;  1I2S A;  1TDG A;  3AGF A;  5AQB A;  5HAI A;  3RXW A;  4MEZ A;  3AGD A;  1XPB A;  1JTG A;  4GDN A;  2HPB A;  2ZMA A;  2ZM0 A;  3GQZ A;  4R3J A;  4E3I A;  4KQO A;  2XK1 A;  4KG5 A;  3CZD A;  3ITB A;  5GLB A;  1I5Q A;  4FD8 A;  3UDX A;  5AQ7 A;  3OCN A;  4QJG A;  1K4E A;  2Y91 A;  1L2S A;  1QME A;  2Q9M A;  1CI8 A;  4X53 A;  5CER A;  1H8Y A;  3O86 A;  4PM8 A;  1MPL A;  4ZJ2 A;  3DW0 A;  2Y4A A;  5DVA A;  1L0D A;  4H8R A;  1JTD A;  3A3E A;  3HLE A;  5FQJ A;  2ZM2 A;  2DCF A;  1H8Z A;  3N7W A;  3O88 A;  5F1G A;  3G2Z A;  1GA9 A;  3D4F A;  3GRJ A;  3IXD A;  1HZO A;  4KG2 A;  4DRT A;  3C7U A;  4WM9 A;  4ZTK A;  1ZKJ A;  4ZDX A;  1SHV A;  1DY6 A;  2UWX A;  4WZ5 A;  1MKI A;  3HUO A;  3LCE A;  4HBT A;  1L0G A;  1H5X A;  1HVB A;  3DWZ A;  4P85 A;  2P9V B;  4WEK A;  2E8I A;  1BLP A;  1E3U A;  5GLD A;  2CC1 A;  4QD4 A;  3IHB A;  4WZ4 A;  2J9P A;  1K54 C;  4WMC A;  3NDE A;  3RJU A;  4OQG A;  3A3I A;  5FQK A;  4DE2 A;  4R23 A;  4OPQ A;  5GLA A;  1CK3 A;  3NBL A;  3ZDJ A;  4A5R A;  4N9K A;  3MXS A;  2BG1 A;  3GTC A;  4PM5 A;  1YMS A;  3GR2 A;  4JF4 A;  4BJP A;  5FAP A;  5KSH A;  3HL9 A;  2ZQC A;  1KDS A;  1FOF A;  1M40 A;  2HP6 A;  2WK0 A;  1NXY A;  5GHZ A;  4JPM A;  5EE8 A;  3UPP A;  1TDL A;  2Y2P A;  4DXB A;  1FQG A;  2WAF A;  3OPL A;  3G30 A;  4S2J A;  3ISG A;  5FAQ A;  3NCK A;  4K0X A;  3AGE A;  4R4R A;  1HD8 A;  4DDS A;  3HLW A;  3VMA A;  2DNS A;  5U47 A;  1IYS A;  2X71 A;  1IEM A;  3OPP A;  1IYO A;  3E2L A;  4R1G A;  1RCJ A;  1ES5 A;  4X55 A;  4ZJ3 A;  4NK3 A;  4OQI A;  1K55 C;  2JE5 A;  4GZB A;  2EXB A;  1YLY A;  1Y54 A;  5A92 A;  4E3O A;  1YMX A;  2WUQ A;  3BRM A;  3FWL A;  4S2N A;  3A3D A;  5HW3 A;  1LL5 A;  3UDF A;  3W8K A;  1KDW A;  4DXC A;  1ES2 A;  1G6A A;  5GHX A;  2XD1 A;  4KZ7 A;  1XP4 A;  1ZC2 A;  4GB7 A;  4K0W A;  4KZ4 A;  3IQA A;  1GCE A;  5CHJ A;  5CRF A;  2WGV A;  2XFS A;  1IKI A;  4PMA A;  5DTS A;  4BD0 A;  4RVA A;  4OPY A;  3VSL A;  3N8S A;  4MBK A;  5FAS A;  1PIO A;  1O07 A;  1WE4 A;  4YFM A;  3UPN A;  3GSG A;  1MY8 A;  5FAO A;  4OOL A;  1KVL A;  4WEL A;  1GHM A;  1SDN A;  5E2G A;  4GNU A;  3QNB A;  1ERQ A;  1FR6 A;  4BD1 A;  1YLP A;  1YLW A;  4BLM A;  1XXM A;  5CEC A;  4KEN B;  1PYY A;  4QY6 A;  2EXA A;  4KZ6 A;  4UA7 A;  5CHU A;  3WWX A;  4DKI A;  4KQR A;  3ZNT A;  2RL3 A;  1ESI A;  1FSW A;  1NZU A;  5M1A A;  5E2E A;  4KQQ A;  4LV3 A;  5FAT A;  4OOY A;  4OKP A;  1FCM A;  2FFY A;  2Y2M A;  2Y2J A;  4OLD A;  3EQU A;  4MBF A;  2Y2N A;  4OVD A;  2PU4 A;  4S2K A;  3G2Y A;  1MWS A;  5EVI B;  3M2K A;  4MBH A;  1PI4 A;  2XD5 A;  1CEF A;  5KSC A;  1LL9 A;  1YM1 A;  3IWQ A;  1OME A;  4N1X A;  3IXB A;  1FCN A;  5JYP A;  1U60 A;  3IWO A;  2V1Z A;  4R3B A;  3PBR A;  3UDI A;  4LCM A;  4EV4 A;  4S2P A;  5FI6 A;  3BEB A;  3MFD A;  3EQV A;  5KMW A;  1WYC A;  1ERM A;  4S2M A;  2H0T A;  1G68 A;  2WYX A;  1Q2P A;  5DF7 A;  1KE4 A;  2DRW A;  4C3Q A;  3ZG8 B;  3MZD A;  5FQM A;  5EVI A;  1JWP A;  2G2W A;  1O7E A;  3PBQ A;  4PM6 A;  2VGK A;  5BOH A;  3MZF A;  3TG9 A;  3IWI A;  3S22 A;  3WRZ A;  3ZG0 A;  3A3J A;  2C5W B;  4KZ5 A;  3JYI A;  1FR1 A;  1XX2 A;  2OSU A;  2Y2H A;  3QNC A;  3UY6 A;  3Q7V A;  2Y2K A;  3OPH A;  1YLJ A;  5EPH A;  5EOO A;  1XGJ A;  4R4S A;  4RA7 A;  3UO9 A;  2HP9 A;  4HES A;  3OPR A;  3P98 A;  1EI5 A;  5F1F A;  3VSK A;  2JBF A;  2EFU A;  4ZJ1 A;  2WAE A;  1XA7 A;  4QU3 A;  1W5D A;  4EWF A;  3N6I A;  3FV7 A;  1KVM A;  3UPO A;  1M6K A;  3HBR A;  3LEZ A;  4XUX A;  2EX9 A;  1L0E A;  1BTL A;  3C4O A;  3O3V A;  4ID4 A;  4MNR A;  4B4Z A;  2QMI A;  4YIN A;  3N4I A;  3S4X A;  3PBS A;  5CEB A;  4S2O A;  1K56 A;  2Y2O A;  1PWC A;  1VQQ A;  3IT9 A;  3WS4 A;  5EEC A;  4JXV A;  5HX9 A;  2IWD A;  3SS4 A;  1W8Q A;  3CG5 A;  4EUZ A;  3RXX A;  1PW8 A;  2ZQ7 A;  2WGI A;  4E3L A;  4PM7 A;  2OLV A;  1BLH A;  4X56 A;  4CPK A;  4DF6 A;  3PBO A;  3G34 A;  3HLG A;  3MZE A;  2X02 A;  4GD6 A;  5GLC A;  3NIA A;  3WS2 A;  4RYE A;  4EQI A;  3VP3 A;  1BLC A;  3HLC A;  3LO7 A;  2ZQ9 A;  2ZQD A;  2P9V A;  4X6T A;  4KZB A;  1WYB A;  1XKZ A;  4LV0 A;  4MLL A;  2IWC A;  3BFG A;  3V5M A;  4OOM A;  5EVL A;  2Z2M B;  3BFD A;  2IWB A;  4JXW A;  3UE1 A;  1LLB A;  1IEL A;  3M6B A;  5CED A;  1JWZ A;  3WS5 A;  1ZG6 A;  4IBX A;  4N92 A;  3E2K A;  4Y0O A;  2X01 A;  1K25 A;  3UNW A;  1BUE A;  1PI5 A;  3C7V A;  3SS5 A;  4EBN A;  4JF5 A;  5FSR A;  1YT4 A;  5E2H A;  2XF3 A;  1GHP A;  2I72 A;  3IF6 C;  3M2J A;  4OPZ A;  3IXG A;  1XA1 A;  1RGY A;  3GVB A;  2RCX A;  5AQ9 A;  1GHI A;  5FI2 A;  5EUA A;  1PZP A;  3P09 A;  4U3T A;  2H10 A;  1TVF A;  4X69 A;  1MWT A;  4JXS A;  1C3B A;  1MXO A;  2J8Y A;  1N4O A;  2QPN A;  4IBR A;  2Y2L A;  4JLF A;  4JBF A;  3NY4 A;  3ZFZ A;  3SH8 A;  5FQQ A;  4EBP A;  3G35 A;  4BL3 A;  3ZGA B;  2ZC5 B;  5M19 A;  3V3R A;  2XH9 A;  2QZ6 A;  4FSF A;  3SOI A;  3W4O A;  4OQH A;  1E25 A;  3HRE A;  2ZM8 A;  1TEM A;  1SDE A;  2ZC7 A;  2BLS A;  4KG6 A;  3ZG5 A;  5A91 A;  4PPR A;  1K4F A;  3MXR A;  3PBT A;  3SS3 A;  5KZH A;  1SKF A;  4BQM A;  1Z6F A;  2HDQ A;  4U0T A;  2XQZ A;  1MWR A;  4XXR A;  4C75 A;  4LCL A;  4R0Q A;  4ZBE A;  4UHU A;  1W8Y A;  1NRF A;  2J7V A;  2Y55 A;  3BEC A;  4U0X A;  2WKH A;  2ZC3 B;  4QHC A;  2JCH A;  3I7J A;  3ZHH A;  1DJC A;  5TR7 A;  1I2W A;  1JWV A;  2Y2I A;  4UAA A;  4OLG A;  4FCF A;  5IHV A;  3HUM A;  4D2O A;  4XUZ A;  5HL1 A;  5I94 A;  3Q1F A;  3QHY A;  3ZCZ A;  4OPR A;  2WKI A;  4GDB A;  5EOE A;  4OP5 A;  4E6W A;  2V2F F;  4FH2 A;  3V3S A;  3WRT A;  4FH4 A;  3G31 A;  1RGZ A;  5FDH A;  4CJN A;  2A49 A;  3IHA A;  3N8R A;  3NDG A;  4LV1 A;  4UA6 A;  4C6Y A;  1K54 A;  1K57 C;  4OON A;  4KZ8 A;  4P0M A;  3BYD A;  4WMC D;  1NJ4 A;  4E3J A;  1BZA A;  1HTZ A;  2R9X A;  3DWK A;  1PW1 A;  1PWG A;  5DTK A;  3HLD A;  4E3K A;  2EFX A;  1ES4 A;  1FSY A;  1IYP A;  2ZQ8 A;  3IF6 B;  4K91 A;  3VOZ A;  4Q8I A;  1NYY A;  3BFE A;  4N9L A;  3IH9 A;  4EBL A;  5CGW A;  5L2F A;  2Y2G A;  1RP5 A;  5D3O A;  5FQ9 A;  4KZ9 A;  1GA0 A;  1K38 A;  3FKV A;  3G4P A;  2Y59 A;  4GN2 A;  4UA9 A;  3Q07 A;  1IKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...