3TOIA

Tailoring enzyme stability and exploiting stability-trait linkage by iterative truncation and optimization
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
248
structure length
248
Chain Sequence
b'GGARVGYIELDLNSGKVLESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPVAMATTLRKLLSGELLTLASRQQLMDWMEADKVAGPLLRSVLPAGWFIADKSGAGEHGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ampicillin resistance protein
publication title Exploring the Molecular Linkage of Protein Stability Traits for Enzyme Optimization by Iterative Truncation and Evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3toiA00
5FQQA 3NC8A 3WS0A 4ZJ3A 2R9XA 3P98A 4D2OA 3UPPA 2ZC6B 1YLPA 2EXBA 2H5SA 2OSUA 1YLZA 1ES3A 4U0XA 5CERA 2XFTA 5BOHA 2JE5A 1ZG6A 5GLDA 3ISGA 4OOMA 2ZM8A 4OOLA 3V39A 5FAOA 1YLYA 2V1ZA 1L0FA 4P85A 3RXWA 4BD1A 1ES5A 1FOFA 1XX2A 3B3XA 4OP5A 4ZJ2A 3IXGA 1S0WA 2JBFA 5HAIA 4DE3A 4F94A 5FI6A 1LL5A 5GHYA 4ZAMA 3ZCZA 3BFEA 3UE0A 3DW0A 3ZVWA 5FATA 3O87A 2IWBA 4DKIA 3OPLA 3W4OA 1NYMA 4HESA 4EQIA 2WGWA 5F1FA 4BQMA 2HPBA 4PM8A 1CEFA 4Z9QA 3SS4A 4MNRA 2JC7A 1H8ZA 1MWUA 3BYDA 4S2LA 1YQSA 3CMZA 5E2GA 5GLCA 5JYPA 5FAQA 5U47A 5FI2A 2EX8A 1NJ4A 3CZDA 4JPMA 1BTLA 5EE8A 5AQBA 1YMXA 5GL9A 2ZQ7A 4RYEA 3OC2A 3SH9A 2ZC5B 3EQVA 1LHYA 2HDQA 4IEDA 4KZ7A 3Q07A 3ZDJA 2BG1A 1FR1A 2ZC4B 3A3IA 5TFQA 3ZNTA 1BSGA 1C3BA 2A49A 3NIAA 3SS3A 3V50A 5L2FA 3HLBA 4EWFA 4OPQA 1ES2A 4CPKA 1K6RA 5EVLA 5CGSA 3HBRA 1BLPA 5F83A 5EECA 3UE3A 2ZQAA 5DVAA 2PBYA 4GKUA 4E3LA 2I72A 4O7DA 3OPHA 1MKIA 1AXBA 3MFDA 4OPYA 3Q1FA 5FQJA 4KZ6A 4L0LA 4EBPA 1KE0A 2VGJA 4QY5A 2EX6A 4C6YA 4OVDA 2Z2LB 5FQMA 5I94A 1IYQA 3SH8A 5CHMA 1VM1A 3TOIA 1N9BA 3FWLA 5CEBA 1KE4A 4OPRA 1O07A 3IXBA 1CI9A 2WUQA 2HP6A 1XXMA 3VP1A 2XF3A 5EPHA 1ESUA 4PM5A 3IT9A 4BL3A 3ZG7B 5GLBA 1SCWA 4P6BA 1TDGA 3CJMA 4S2KA 2GDNA 3IWQA 2J9OA 2R9WA 2BLSA 1K25A 1HZOA 2Y55A 5CGWA 4FSFA 1SDNA 2WKHA 4LV0A 3HLGA 4RA7A 2Y2MA 1JWVA 4OH0A 4M3KA 4R1GA 2HDSA 3PBRA 4GB7A 3V3SA 1M40A 1IYOA 1KGFA 3A3JA 1G6AA 3BFFA 3VFHA 4JF4A 3W8KA 2ZQCA 4LV2A 3C7UA 1NZOA 3AGFA 5F82A 1H5XA 2Q9MA 2XD5A 3HLEA 3M6HA 4BJPA 4DXCA 4QY6A 4XXRA 2Y2QA 4JF5A 3MZFA 3MXRA 1N4OA 5AQAA 1NZUA 5FAPA 1HD8A 4UA9A 3VP2A 4N1HA 4RX2A 5GHZA 1ONGA 1JTGA 2XEPA 1FCOA 4IVIA 4KG6A 3PBQA 1S6RA 5KSHA 1WYCA 5EUAA 5FA7A 1U60A 2XR0A 3PTEA 2RCXA 3G30A 2EX2A 3ZG9B 4LV1A 3WS2A 4BENA 3UN7A 3MKEA 4JBFA 1XP4A 2WGWB 5E2FA 1Q2PA 2QZ6A 4H8RA 4P0MA 2IWCA 1XGJA 5TR7A 4KZ8A 3ZG0A 2P74A 4QJGA 4QB8A 2VGKA 2G2UA 4PM7A 3GRJA 4IBXA 4JXGA 4R23A 3UPNA 3HLWA 2E8IA 1TEMA 2X01A 4E3NA 4EBLA 1PZOA 3Q81A 3PBOA 1FCMA 3LO7A 4UHUA 3UNWA 1IEMA 1YM1A 1PW8A 4GNUA 2WZZA 5AQ7A 3N8SA 4BD0A 1YLTA 1J9MA 3IQAA 5EVIB 4E3JA 3IWIA 3QNBA 2Y91A 3AGDA 2Z2MB 3M2JA 1K56A 5M1AA 4ZBEA 1KVLA 5FQ9A 1G68A 4DE1A 3GVBA 5EVID 1WYBA 3MXSA 1BLSA 4OQ0A 2OLUA 5A92A 4QHCA 1BULA 5HFOA 3WRTA 1LI0A 3BFDA 4WZ5C 3VMAA 3VSKA 2EXAA 3NY4A 1K57C 3V5MA 4JLFA 3NDGA 4NK3A 3GMWA 4WELA 5E2EA 2IWDA 3HUOA 4DXBA 1FCNA 4HEFA 1Y54A 4R4SA 2EFXA 4KENB 1CI8A 3Q7VA 4B88A 1YT4A 1K6SA 3HL9A 4FH2A 5E43A 4N92A 4UAAA 3IXHA 1W8QA 5EVIA 3VFFA 3PAEA 4N9LA 2XQZA 3O86A 4E3KA 5HAQA 1BUEA 2WYXA 4DDYA 1M6KA 3E2LA 3VP4A 3WS4A 4DE2A 3VP0A 5HL1A 3IF5A 2Y2PA 2ZMAA 4E6WA 5DTKA 2Y2NA 3IXDA 4MEZA 4KZ4A 2J8YA 3IH8A 2H0YA 5FQKA 1K54C 1K4FA 1MY8A 1PWCA 3N7WA 4ZDXA 3HLDA 4WYYA 1BLHA 1W7FA 4X6TA 3N6IA 1BLCA 3FKVA 2HP5A 3VOYA 1QMEA 4R3JA 1XGIA 3N8RA 3BRMA 3O88A 2ZD8A 1EI5A 1NYYA 3GTCA 5KZHA 2JCHA 2QMIA 1MWTA 3ITAA 1KE3A 4N1XA 1FSWA 1K55C 5FI7A 1FSYA 4R3BA 1W79A 4WEJA 4ZJ1A 2B5RA 2Y2JA 3D4FA 1TDLA 3ITBA 4KZ5A 1ESIA 4GD8A 3GQZA 1L0EA 1MXOA 2DRWA 2UWXA 5HARA 4HBUA 3G31A 2PU2A 3I7JA 4WMCD 4RVAA 3VP3A 3IH9A 4EBNA 4DE0A 1OMEA 2WAEA 1MPLA 5EOOA 2H10A 2P9VB 3HUMA 2Y59A 4PM9A 4X56A 4KQRA 3EQUA 4GN2A 4NETA 1LI9A 4U3TA 3S4XA 1H8YA 2XLNA 1KDSA 1ZC2A 3BLMA 3C7VA 4JF6A 4K91A 2V2FF 5HAPA 1KVMA 2XDMA 4WMCA 1YLWA 4GZBA 1ONHA 1SKFA 3NCKA 3S22A 1ES4A 1ERQA 3LCEA 4S2NC 4QD4A 3ZVTA 1MWSA 4HBTA 3C4OA 4UA6A 5HX9A 4DDSA 4ID4A 3BFGA 4RX3A 4KG5A 3RXXA 2EX9A 3WS1A 5A91A 3VOZA 4B4XA 4B4ZA 4E3MA 2Y4AA 3PBTA 3UE1A 2V20A 1IELA 3WWXA 1Q2QA 4JXWA 4EV4A 3BECA 4JXSA 2P9VA 1RGZA 2DCFA 3TG9A 4E3OA 1SHVA 2Q9NA 2Y2HA 4WZ4A 3ZHHA 1DJBA 1KGGA 3C4PA 3G2ZA 3G2YA 1K54A 3G4PA 4OLDA 1K56D 1GCEA 2OLVA 3G34A 5CHUA 4DRTA 1IYPA 1CK3A 5CHJA 4XUXA 5CTNA 1ZG4A 5KSCA 2WKIA 1PWDA 2ZC7A 3GR2A 3LY4A 3W4QA 3IWOA 3WRZA 3NBLA 2X71A 3MKFA 2ZJ9A 2ZQDA 3PAGA 3M6BA 1PZPA 5CXWA 2ZQ9A 3GSGA 3Q7VB 4IBRA 3QNCA 1IKGA 2HP9A 4MBKA 1JVJA 4Y0UA 1K55A 4E3IA 2XFSA 5GHXA 3UO9A 1MWRA 1WE4A 1PW1A 1IYSA 2Y2KA 3HUNA 4JXVA 4OKPA 4S2PA 2XH9A 5EOEA 1GA0A 2XD1A 4MBFA 1I2SA 5D3OA 3LEZA 3NI9A 1DY6A 4WM9A 1CEGA 1MBLA 2Y2OA 3RJUA 3PBNA 3IF6C 4X68A 1RP5A 3UY6A 5A93A 1PI4A 2OV5A 4C75A 3FYZA 3G35A 3M2KA 1W8YA 1GHIA 4MBHA 1NY0A 3VSLA 4XUZA 1KGEA 1PWGA 4U0TA 3A3EA 4OPZA 4CJNA 2J7VA 5JYOA 4OONA 5KMWA 1RGYA 4KQOA 3HREA 4YINA 2HDUA 2XGNA 4R4RA 5IHVA 1L0DA 5CEDA 2Y2LA 1NRFA 4GDNA 4S2NA 1HTZA 1XA7A 3ZG8B 2WADA 3HLCA 4IVKA 3PBSA 3G32A 4OQHA 3Q7ZA 1VQQA 3P09A 4S2JA 3E2KA 4S2OA 3DWZA 4KZBA 2RL3A 5FASA 3HLFA 3GV9A 1EROA 2H0TA 3MZEA 4LCLA 4OQGA 1YMSA 1O7EA 3AGEA 3QHYA 5HW3A 3C5AA 4KZAA 4P87A 2WK0A 3UDFA 3HVFA 2EFUA 5DTTA 3NDEA 3OCLA 2ZLYA 1L0GA 4A5RA 5CECA 4K0WA 4Y0TA 1SDEA 3JYIA 1QMFA 1L2SA 5A90A 4S2MA 4Y0OA 1JWZA 2X02A 4X53A 5GLAA 5F1GA 3IF6B 3BLSA 3BFCA 1BZAA 3CG5A 4ZTKA 3A3FA 4C3QA 3UDXA 1XPBA 4DF6A 2WAFA 5TGFA 1E25A 1PI5A 4LV3A 3IHAA 5DF9A 3W4PA 2G2WA 1GA9A 1I2WA 5M19A 3BM6A 1Z6FA 3ZG5A 4GD6A 4PPRA 5G18A 3BEBA 1I5QA 2Y2IA 4GDBA 1PYYA 2CC1A 5M18A 1FQGA 2XK1A 3IHBA 1KDWA 3OCNA 4OOYA 4KG2A 4PMAA 4JKTA 3UDIA 1FR6A 1LLBA 5FSRA 4OQIA 1K38A 2FFYA 3V3RA 5DTSA 1TVFA 1W5DA 2ZC3B 4UA7A 4OP8A 5DF7A 4X55A 1HVBA 1DJAA 3FV7A 3LY3A 3N8LA 1GHMA 3IF6A 4BLMA 1DJCA 4N9KA 4WZ5A 1ZKJA 1ALQA 5AQ9A 1K57A 3OZHA 4KZ9A 4X69A 2WGVA 3OPPA 1EWZA 3DWKA 3FZCA 3Q82A 1GHPA 1RCJA 4FH4A 3ZGAB 3O3VA 4KZ3A 2DNSA 1JTDA 1PIOA 3N4IA 1E3UD 1NXYA 4KQQA 2QPNA 3SS5A 4WEKA 3A3DA 2C5WB 3SH7A 1XA1A 4K0XA 5DF8A 2HDRA 1YLJA 2ZQ8A 5CGXA 3ZNYA 4S2IA 1IKIA 5FQIA 4QU3A 2J9PA 4WBGA 2WGIA 2ZM2A 4EUZA 3S1YA 2PU4A 4Y7PA 3DTMA 5CRFA 4E6XA 4MLLA 4R0QA 2A3UA 4FD8A 1LL9A 4Q8IA 2ZM0A 5CTMA 5EVIC 2WZXA 5J8XA 4PM6A 4LCMA 3SOIA 1K4EA 4BL2A 3FKWA 1BT5A 1E4DA 1E3UA 4LENA 3UPOA 3ZFZA 2WKEA 2Y2GA 4OLGA 1ERMA 4GOGA 2FFFB 1JWPA 4YFMA 5E2HA 2C6WB 3WS5A 3TSGA 1XKZA 3MZDA 4FCFA 3MBZA 5FDHA 3OPRA
chains in the Genus database with same CATH superfamily
3WS0A 4ZJ3A 4D2OA 2W27A 3B33A 3UPPA 1VEUB 2EXBA 2H5SA 5HPFA 3LYXA 2XFTA 3ISGA 4NKPA 4X25A 5FAOA 3KSHA 4P85A 3T4TA 1P0ZA 1FOFA 1XX2A 2KOIA 1Z09A 4DE3A 4Y17A 1LL5A 5GHYA 5F6AA 3BFEA 2KLIA 4EEUA 3W4OA 4HESA 4BQMA 1CEFA 4MNRA 3V67A 1OPXA 4S2LA 3BYDA 3KX0X 5JYPA 5GLCA 3CZDA 4JPMA 2A2LA 1D7EA 2ZQ7A 3OC2A 3E4OA 4WN5A 4GCZA 1BSGA 1C3BA 3V50A 5L2FA 3HLBA 1V9ZA 3NOUC 4OPQA 5EVLA 1MKIA 1AXBA 3Q1FA 5HDCA 4QY5A 2EX6A 4OVDA 5FQMA 3TOIA 1K0KA 2Z6DA 2WUQA 2I9VA 5EPHA 1HLUP 4PM5A 3IT9A 4BL3A 4ARZA 1SCWA 3CJMA 2GDNA 3IWQA 3MBZA 3GECA 5CGWA 4LV0A 2WKHA 3MJQA 2Y2MA 4OH0A 3MMHA 2HDSA 4LRZE 4GB7A 2JKRM 3A3JA 4QPRA 3W8KA 2XSSA 1H5XA 1N4OA 5FL3A 4RX2A 4NG2A 5GHZA 1OJGA 2UV0E 5IS1A 1WYCA 5EUAA 2XR0A 3PTEA 2EX2A 3WS2A 1S1YA 4YOFA 4H8RA 4P0MA 5IT5A 4QJGA 2VGKA 2G2UA 4IBXA 2WKRA 2X01A 4E3NA 3Q81A 4MDZA 1PW8A 2W3HA 5EVIB 1XFNA 3QNBA 2Y91A 3M2JA 4ZBEA 3GVBA 5EVID 4LRYC 1WYBA 4OQ0A 5A92A 3WRTA 3BFDA 3VMAA 1GSVA 3VSKA 4PAUA 3NDGA 5J7EA 3BJNA 1YT4A 4FH2A 3T4OA 3VFFA 3BWLA 2W3FA 2XQZA 3O86A 2WYXA 3VP4A 5HL1A 3T4LA 3OLOA 5FQKA 1PWCA 4ZDXA 1W7FA 1BLCA 3FKVA 3F1PB 2OAP1 3NOTC 2J3TC 2VGLS 2P04A 4EW7A 3D3OA 1KE3A 1K55C 1FSYA 4WEJA 4ZJ1A 3D4FA 1MXOA 2DRWA 4UQIS 3CHWP 4WMCD 2PU2A 4RVAA 3IH9A 4IUKA 5HDSA 2Y8HA 1MPLA 3HUMA 3QP2A 3LR3A 3KYQA 1VHMA 3LIEA 1KDSA 1ZC2A 4JF6A 3TW8A 2EWWA 3EEAA 4FOFA 3FC7A 3IS2A 3LCEA 3ZVTA 4HBTA 4UA6A 4ID4A 3IX8A 3VOZA 1EW0A 2PHYA 4JXWA 1VB6A 2QKPA 1RGZA 2J80A 2O9CA 3P01A 3R7WB 1SHVA 2Q9NA 1UWNX 3KSIA 3G34A 4DRTA 5CHJA 5DFXA 1ZG4A 3W4QA 1N9LA 1PWDA 3LY4A 2OWHA 2ZJ9A 3M6BA 2ZQ9A 1IOUA 3QNCA 4E3IA 1MWRA 3LI8A 2B02A 4S2PA 5EOEA 2XD1A 4MBFA 5D3OA 5LBRA 3QP4A 1TS8A 1DY6A 4ETZA 2Y2OA 3C30A 3IF6C 1MKMA 3UY6A 1PI4A 3E4PA 3G35A 3M2KA 3A3EA 5AJGA 5KMWA 1RGYA 3F1OA 4I3IA 2XRNA 4GDNA 1HTZA 4I39A 4YWZA 3HLCA 3ZG8B 4IVKA 3G32A 5FASA 3T4KA 4LCLA 3MZEA 3AGEA 4MMNA 4BBTA 2WK0A 3OCLA 2ZLYA 4A5RA 5CECA 3P7NA 1QMFA 2Z6CA 1ZTUA 4CLCB 5F1GA 3BFCA 3LR0A 4CLCD 3F1NA 1I2WA 5M19A 1Z6FA 2MJ6A 4EXOA 2W1RA 2CC1A 1KDWA 1OTEA 4OOYA 4JKTA 1LLBA 3V3RA 5DTSA 1TVFA 1W5DA 2W1TA 4L9GA 2ZC3B 4OP8A 4X55A 5FEGA 1HVBA 1DJAA 3FV7A 1DJCA 4N9KA 3DBAA 1ALQA 1K57A 3OZHA 4P6ZM 2M7UA 4KQQA 1E3UD 1NXYA 3KYZA 2QPNA 4WEKA 5G4ZA 1YLJA 2ZQ8A 5CGXA 5DKKA 4WBGA 2WGIA 3U4LP 4EUZA 3S1YA 2PU4A 5CRFA 3OBFA 4ESPA 4FD8A 1LL9A 2ZM0A 5EVIC 5IU1A 2WZXA 4NXEA 3UB8A 3S7QA 1E4DA 3ZFZA 4HHDA 3NOPC 1OTAA 4WUJA 3NC8A 3P98A 3U2AA 1YLPA 3T12B 5BOHA 2JE5A 1ZG6A 1YLYA 1L0FA 3RXWA 4BD1A 2QJ5A 2J3WA 4OP5A 4ZJ2A 2P7JA 2JBFA 4FUWA 2GZAA 3ZCZA 3UE0A 3DW0A 2G7UA 4DKIA 2W3DA 3OOVA 5J4EA 4Y2FA 1P9RA 2K31A 1N9NA 1MWUA 3CMZA 1T1AA 4HOIA 1NJ4A 5EE8A 4Y13A 5AQBA 2WKPA 5GL9A 2HDQA 4IEDA 1F5MA 2K7SA 3ZNTA 3ULFA 4G3WA 3SS3A 2V9AA 1YSPA 4ARZB 2L1MA 3H7WA 2ZQAA 4GKUA 4E3LA 3OPHA 1ZHHB 1NRJA 3EEHA 5FQJA 2PR5A 4L0LA 4R3AA 2VGJA 2VV8A 1GSWA 4HQAA 1IYQA 2AVXA 1ACFA 3FWLA 4Q0JA 5EM0A 1CI9A 2GX5A 4DJ3A 4O01A 3NULA 5GLBA 3VE3A 4P6BA 2D01A 4S2KA 2J9OA 3RH8B 4LLOB 2PDRA 1HZOA 1IFQA 3HLGA 4RA7A 1JWVA 3VV4A 3KYEA 1M40A 4EEPA 1KGFA 1G6AA 1FILA 4JF4A 4LV2A 2XD5A 4BJPA 1T1BA 4QY6A 4BMWA 4D60A 5AVEA 3MZFA 4UA9A 2XROA 5EM1A 2XEPA 3E4QA 2QYBA 3PBQA 3B42A 4GS9A 1U60A 3G30A 4BENA 2O9BA 1XP4A 2WGWB 1XGJA 5TR7A 2P74A 4PM7A 2V0WA 4NEED 2E8IA 1TEMA 4JGQA 4EBLA 2L4RA 3PBOA 4UHUA 1IEMA 4O8GA 5AQ7A 4BD0A 3IQAA 4E3JA 3JPUA 3IWIA 5M1AA 4WLAA 3R4KA 4ETXA 5FQ9A 4DE1A 4WF0A 5HFOA 4CLCC 4WZ5C 3NY4A 4NK3A 3LI9A 1FCNA 4R4SA 2EFXA 4KENB 1CI8A 3L9KA 3Q7VA 5E43A 3PXPA 1BYWA 1BUEA 2FH5A 3E2LA 5AVFA 4PHTA 4R38A 2Y2PA 2Y2NA 2PYRA 2J8YA 1K54C 1K4FA 3N7WA 3HLDA 4WYYA 5L10A 4X6TA 2HP5A 3PYPA 1NLYA 2QHKA 4R3JA 1F98A 4I38A 4MN7A 3O88A 1NYYA 3GTCA 2QMIA 1VETB 1FSWA 5FI7A 3IS2B 4R3BA 1W79A 2B5RA 1ESIA 2UWXA 3VP3A 4EBNA 2WAEA 1DP6A 2H10A 2Y59A 4X56A 1LI9A 4HI4A 2XLNA 3KSGA 2O99A 3C7VA 3BLMA 2V2FF 3ZYTA 4GZBA 4QD4A 5A8BA 4DDSA 4F3LA 4RX3A 4IJGA 3WS1A 3FG8A 5A91A 4B4ZA 1X0OA 4M4XA 1IELA 3WWXA 1Q2QA 2P9VA 1OT9A 3TG9A 4BWIA 3BY8A 4E3OA 1SKOA 3G2YA 1K56D 5MC7A 3CWFA 1CK3A 4XUXA 3JVVA 5CTNA 3G6OA 5KSCA 4QWOA 2ZC7A 2JKGA 3MKFA 2ZQDA 1PZPA 5CXWA 3GSGA 4MBKA 3LR5A 1K55A 3F1OB 5GHXA 4JXVA 4HNBA 5K5BA 1S4RA 5L09A 3CUEA 1RP5A 3FYZA 2IA2A 1GHIA 3VSLA 5JYOA 2J7VA 3LR4A 1D06A 4YINA 3CPTA 5IHVA 4HJ4A 3S7PA 1NRFA 3MXQA 1XA7A 2WADA 4OQHA 5HD5A 3Q7ZA 3P09A 4S2JA 3F1NB 1PFLA 2RL3A 3HLFA 1EROA 5HW3A 4XT2A 5FEFA 3T1RA 2EFUA 5DTTA 3A0VA 2PAVP 1NLZA 1STZA 3MFXA 3LIBA 1KOUA 4K0WA 3GDIA 2W1TB 4S2MA 2B18A 5L07A 4C3QA 1XPBA 2WAFA 2Y79A 3LEQA 1E25A 1PI5A 3VOLA 1OT6A 5M18A 1PYYA 4L9FA 4PKYG 3OCNA 4KG2A 4ZRRA 3MSHA 5FSRA 4OQIA 1T19A 3H82B 1W63Q 4UA7A 3N8LA 3IF6A 5DFYA 2HGVA 4KZ9A 3CI6A 3LIDA 3K2NA 2DNSA 1JTDA 1PIOA 3SS5A 2XA7S 2HV1A 3ZNYA 4S2IA 4QU3A 4Y7PA 3DTMA 3T4JA 4R0QA 1SZVA 2A3UA 4Q8IA 4FTXA 3LUQA 3SOIA 1K4EA 1TS6A 1BT5A 4HJ3A 3PR6A 2FFFB 1S66L 2VKSA 4JGPA 4YNRA 4E04A 4FCFA 5FDHA 3OPRA 4EU0A 2R9XA 3K3DA 2OSUA 4JGRA 1YLZA 3MF0A 1ES3A 2VA0A 3V39A 4OOLA 4OOMA 3LIFA 4K08A 2V1ZA 4BBUA 4GJ4A 1LL8A 3BQAA 5HD3A 3IXGA 1S0WA 2OOLA 3FPVA 4F94A 4ZAMA 4GW9A 3DTKA 3ZVWA 5FATA 3O87A 2V8FA 3OPLA 3CLOA 1S1ZA 5HWTA 2PRFA 4Z9QA 3SS4A 3H7WB 2JC7A 4O0PA 1TS7A 1UGUA 5FAQA 5FI2A 3H9WA 3T1SA 3BW6A 2QJ7A 3C38A 2ZC5B 4KZ7A 1LHYA 2BG1A 1FR1A 5TFQA 2JKTI 1XJ2A 5G4YA 4EWFA 1ES2A 4CPKA 3HBRA 1BLPA 3UE3A 1G5UA 4OPYA 4KZ6A 1KE0A 4B9OA 3UE6A 4C6YA 3SH8A 5CHMA 1VM1A 1N9BA 5CEBA 2K2NA 4OPRA 1O07A 1XJ6A 3VP1A 3ZG7B 2W0NA 1TDGA 3E98A 4HIAA 4H6JA 2BLSA 1K25A 2Y55A 4FSFA 1SDNA 3F1PA 4M3KA 4R1GA 4GS9B 4DMZA 2PBDP 3PBRA 3V3SA 1NWZA 3D72A 3BFFA 3MS6A 3VFHA 3IX3A 1NZOA 3CITA 2Q9MA 3HLEA 5F82A 1T18A 4XXRA 4JF5A 3MXRA 3O5YA 3IX4A 5AQAA 1HD8A 3VP2A 4KG6A 1FCOA 1S6RA 5KSHA 2RCXA 1L3LA 3UN7A 3NECA 5EV0A 5E2FA 1Q2PA 3MQ0A 2IWCA 1TF1A 1DRMA 4QB8A 5TBMA 3VE4A 4CQHA 3GRJA 4R23A 1CQAA 2V1BA 5EFWA 1OTIA 1OTBA 1PZOA 2E8JA 3LO7A 4B93A 1YM1A 2WZZA 1YLTA 1J9MA 3JVUA 2ZMVA 1YKDA 3AGDA 2Z2MB 2YKHA 1KVLA 1DP9A 3MXSA 4QHCA 1BULA 3BQ8A 3DTEA 3QP5A 2EXAA 1CJFA 1K57C 1LSXA 2O0YA 5E2EA 1WA9A 2LB5A 2IWDA 5C5KA 4DXBA 1Y54A 3HL9A 4UAAA 3IXHA 1W8QA 3RFBA 3PAEA 4N9LA 4E3KA 1M6KA 3QP1A 2VGLM 3IF5A 3DTIA 3QP8A 3IXDA 4MEZA 4Q0IA 3IH8A 1F2KA 1BLHA 2FZ0A 3VOYA 4UQIM 1QMEA 1XGIA 3N8RA 4KUOA 3KO6A 2ZD8A 2BASA 5HDDA 2JCHA 3LIAA 3S7NA 1XFQA 1XJ4A 1YPRA 2V0UA 2Y2JA 3ITBA 4KZ5A 4GD8A 4F3LB 4HBUA 3G31A 1A0KA 2NUPC 2VZWA 3A0RA 4DE0A 1OMEA 2P08A 2P9VB 4PM9A 4KQRA 3EQUA 2VEAA 1FIKA 3S4XA 1H8YA 4CLCA 4RQ9A 1J3WA 1ONHA 3S22A 2V1AA 4S2NC 1ERQA 3BFGA 5F68A 3RXXA 2HZ5A 1YSQA 3PBTA 3UE1A 4EV4A 4HP9A 5F5YA 2Y2HA 4WZ4A 3C4PA 3G2ZA 2D02A 1K54A 3LGOA 3A0SA 1GCEA 1TS0A 5CHUA 1IYPA 2ZOIA 5L8MA 3SW1A 3WRZA 3NBLA 5DJUA 3PAGA 2JKFA 1IKGA 3CPTB 3UO9A 3HUNA 1PW1A 2VV6A 2Y2KA 4OKPA 3IBJA 1GA0A 1PRQA 1GSXA 2B95A 2JN7A 4MN6A 1CEGA 3RJUA 3PBNA 4XT2B 5A93A 4C75A 1NY0A 1KGEA 1PWGA 4U0TA 4CJNA 4OPZA 4DN0A 4KQOA 3HREA 3UMEA 1L0DA 5CEDA 1Y28A 2GJ3A 2Y2LA 5TJJA 3MR0A 4R70A 3HCYA 4OQGA 2H0TA 3QHYA 4P87A 3UDFA 3HVFA 4AFIA 4HY8A 5A90A 1L2SA 1JWZA 4X53A 5GLAA 4GHIA 3IF6B 3BLSA 3T50A 3L7HA 1BZAA 3UDXA 5TGFA 4LV3A 5DF9A 3W4PA 2G2WA 3HJKA 1MC0A 5J3WA 4GD6A 3BEBA 2Y2IA 4GDBA 1FQGA 2XK1A 2VV7A 4Z1WA 4PMAA 3IBRA 4JGOA 3UDIA 2PD7A 2FFYA 3CAXA 3LY3A 1GHMA 4BLMA 4WL9A 1P9WA 5I5LA 4Q0HA 1MZUA 5AQ9A 1EWZA 3FZCA 3Q82A 1GHPA 4Y15A 4FH4A 3ZGAB 4G3VA 3E0YA 1XA1A 3FPWA 5DF8A 2ACGA 5FQIA 2J9PA 2ZM2A 4P6ZS 4E6XA 2LB9A 2NUTC 3NHQA 4LCMA 4BL2A 3FKWA 4II7A 3RTYA 1G28A 4LENA 3UPOA 2WKEA 4OLGA 4GOGA 3T4SA 1JWPA 2VK3A 3TSGA 1XKZA 3KSFA 1Y4OA 5FQQA 1AWIA 2ZC6B 4U0XA 5CERA 5GLDA 2INWA 2ZM8A 3PHYA 2A24A 1ES5A 3B3XA 3UB7A 2ZL1A 3ICYA 5HAIA 5FI6A 2KX6A 5DKLA 1LT0A 3C8CA 2IWBA 1VEUA 1NYMA 4EQIA 5F1FA 2WGWA 2HPBA 4KUKA 2V8CA 4PM8A 1UWPX 1DP8A 1H8ZA 1F9IA 1YQSA 5E2GA 4X1MA 5U47A 4MCWA 2EX8A 2BTFP 1H8MA 1BTLA 1YMXA 4RYEA 1W63M 3SH9A 4X1LA 3EQVA 2PYPA 3Q07A 3ZDJA 4MN5A 1H3QA 2ZC4B 3A3IA 3NIAA 2A49A 3UB5P 4EQ1A 1K6RA 5CGSA 5F83A 5EECA 4IUHA 5DVAA 2PBYA 3DAVA 2I72A 4O7DA 4H6JB 1OTDA 3MFDA 2H28A 4EBPA 2Z2LB 5I94A 2HJ9C 2PR6A 1KE4A 2JKTM 4Y5FA 2JKRI 3IXBA 5CX7A 2HP6A 1XXMA 2XF3A 2OWJA 1ESUA 1T1CA 2R9WA 1PNEA 3CUEC 1N9OA 4ME4A 5DJTA 5HWWA 4EERA 3B47A 1IYOA 1TD5A 1VETA 2ZQCA 2ZBBA 3C7UA 3T1XA 3AGFA 3M6HA 4DXCA 1S67L 5TBMB 2Y2QA 5HSQA 3C2WA 5HL6A 4I3JA 1NZUA 5FAPA 4N1HA 1YAXA 2EWVA 1ONGA 4IVIA 1JTGA 4PKYA 5FA7A 1OJ5A 3ZG9B 4LV1A 3MKEA 4JBFA 4NXFA 4EESA 2QZ6A 4KZ8A 3ZG0A 4Y3IA 4JXGA 3UPNA 3HLWA 3EOIA 4HJ6A 5HPIA 1FCMA 3UNWA 4GNUA 2DMWA 3N8SA 3EGDC 3TJZC 3NJAA 1K56A 1G68A 1BLSA 4L9EA 2OLUA 3LICA 5EVEA 1LI0A 3V5MA 4JLFA 3GMWA 4WELA 3HUOA 4HEFA 1V9YA 4B88A 1K6SA 4N92A 5EVIA 4GLQA 5HAQA 4DDYA 3WS4A 4DE2A 3VP0A 3UB9A 2ZMAA 4E6WA 5DTKA 4KZ4A 3D9YA 2OAQ1 3UMDA 2H0YA 1MY8A 1G6OA 3N6IA 2M7VA 4EETB 3UB6A 3BRMA 1EI5A 5KIZA 5KZHA 4I3AA 1MWTA 3ITAA 2ZOHA 4N1XA 2M1CA 4LGWA 1TDLA 3GQZA 1L0EA 3MQOA 5HARA 3I7JA 2W3EA 2KDKA 5EOOA 4GN2A 4NETA 4U3TA 1H0MA 2VX8A 4K91A 3S7OA 4EUVA 1D1JA 5HAPA 1KVMA 2XDMA 4WMCA 1YLWA 4KQDA 3EWKA 1SKFA 3NCKA 1XJ3A 1ES4A 1MWSA 5HX9A 3C4OA 2EA9A 4B4XA 4E3MA 2EX9A 2Y4AA 2V20A 2Q0OA 3BECA 2VLGA 4JXSA 1ODVA 1CF0A 2DCFA 3H82A 5HZHA 1JNUA 2YKFA 3ZHHA 2JHEA 1DJBA 1KGGA 3BY9A 3G4PA 4OLDA 2OLVA 2ZMFA 4LPZA 2WKIA 3GR2A 3IWOA 2X71A 4HP4A 3ZQ5A 5HWVA 3Q7VB 3K3CA 4IBRA 2HP9A 1LSWA 1JVJA 4Y0UA 3R7WA 2XFSA 1WE4A 1IYSA 4BBVA 2XH9A 1I2SA 3LEZA 4CLCE 3NI9A 2HF6A 2O9AA 4G3KA 4WM9A 1MBLA 4X68A 1P97A 2OV5A 1W8YA 4MBHA 5FDSA 3LFVA 4XUZA 4OONA 2W3GA 2HDUA 2XGNA 4R6LA 4R4RA 4GHIB 4S2NA 3W2ZA 3PBSA 1VQQA 4S2OA 3E2KA 3DWZA 4KZBA 3GV9A 2L0WA 4NXBA 1YMSA 1O7EA 3C5AA 4KZAA 3NDEA 3QP6A 2CMNA 1L0GA 3SZTA 2HJEA 4Y0TA 1SDEA 3JYIA 4Y0OA 2X02A 3CG5A 4ZTKA 3A3FA 3T1QB 4DF6A 3IHAA 4IHQA 1GA9A 3BM6A 3ZG5A 4PPRA 5G18A 1I5QA 4I5SA 3HJIA 3IHBA 1FR6A 4DJ2A 1K38A 2XA7M 2WKQA 5DF7A 4NXGA 1LSVA 4WZ5A 1SKOB 1ZKJA 4X69A 2WGVA 3OPPA 3EGXC 3DWKA 1RCJA 2GNXA 3O3VA 4KZ3A 3N4IA 4UEYA 3A3DA 2C5WB 3SH7A 2VJWA 3TRCA 4K0XA 2HDRA 4LRXC 1IKIA 2PT7A 2J3TD 4LFUA 2QWSA 4MLLA 5CTMA 5J8XA 3TE8A 4PM6A 1E3UA 2PD8A 5F69A 2A24B 1S4SA 2Y2GA 3T4QA 4HH3A 2ZL1B 1ERMA 4YFMA 3MQQA 5E2HA 2C6WB 3WS5A 3MZDA 4KG5A 4HH2A 2R78A
chains in the Genus database with same CATH topology
5FQQA 3NC8A 3WS0A 4ZJ3A 2R9XA 3P98A 4D2OA 3UPPA 2ZC6B 1YLPA 2EXBA 2H5SA 2OSUA 1YLZA 1ES3A 4U0XA 5CERA 2XFTA 5BOHA 2JE5A 1ZG6A 5GLDA 3ISGA 4OOMA 2ZM8A 4OOLA 3V39A 5FAOA 1YLYA 2V1ZA 1L0FA 4P85A 3RXWA 4BD1A 1ES5A 1FOFA 1XX2A 3B3XA 4OP5A 4ZJ2A 3IXGA 1S0WA 2JBFA 5HAIA 4DE3A 4F94A 5FI6A 1LL5A 5GHYA 4ZAMA 3ZCZA 3BFEA 3UE0A 3DW0A 3ZVWA 5FATA 3O87A 2IWBA 4DKIA 3OPLA 3W4OA 1NYMA 4HESA 4EQIA 2WGWA 5F1FA 4BQMA 2HPBA 4PM8A 1CEFA 4Z9QA 3SS4A 4MNRA 2JC7A 1H8ZA 1MWUA 3BYDA 4S2LA 1YQSA 3CMZA 5E2GA 5GLCA 5JYPA 5FAQA 5U47A 5FI2A 2EX8A 1NJ4A 3CZDA 4JPMA 1BTLA 5EE8A 5AQBA 1YMXA 5GL9A 2ZQ7A 4RYEA 3OC2A 3SH9A 2ZC5B 3EQVA 1LHYA 2HDQA 4IEDA 4KZ7A 3Q07A 3ZDJA 2BG1A 1FR1A 2ZC4B 3A3IA 5TFQA 3ZNTA 1BSGA 1C3BA 2A49A 3NIAA 3SS3A 3V50A 5L2FA 3HLBA 4EWFA 4OPQA 1ES2A 4CPKA 1K6RA 5EVLA 5CGSA 3HBRA 1BLPA 5F83A 5EECA 3UE3A 2ZQAA 5DVAA 2PBYA 4GKUA 4E3LA 2I72A 4O7DA 3OPHA 1MKIA 1AXBA 3MFDA 4OPYA 3Q1FA 5FQJA 4KZ6A 4L0LA 4EBPA 1KE0A 2VGJA 4QY5A 2EX6A 4C6YA 4OVDA 2Z2LB 5FQMA 5I94A 1IYQA 3SH8A 5CHMA 1VM1A 3TOIA 1N9BA 3FWLA 5CEBA 1KE4A 4OPRA 1O07A 3IXBA 1CI9A 2WUQA 2HP6A 1XXMA 3VP1A 2XF3A 5EPHA 1ESUA 4PM5A 3IT9A 4BL3A 3ZG7B 5GLBA 1SCWA 4P6BA 1TDGA 3CJMA 4S2KA 2GDNA 3IWQA 2J9OA 2R9WA 2BLSA 1K25A 1HZOA 2Y55A 5CGWA 4FSFA 1SDNA 2WKHA 4LV0A 3HLGA 4RA7A 2Y2MA 1JWVA 4OH0A 4M3KA 4R1GA 2HDSA 3PBRA 4GB7A 3V3SA 1M40A 1IYOA 1KGFA 3A3JA 1G6AA 3BFFA 3VFHA 4JF4A 3W8KA 2ZQCA 4LV2A 3C7UA 1NZOA 3AGFA 5F82A 1H5XA 2Q9MA 2XD5A 3HLEA 3M6HA 4BJPA 4DXCA 4QY6A 4XXRA 2Y2QA 4JF5A 3MZFA 3MXRA 1N4OA 5AQAA 1NZUA 5FAPA 1HD8A 4UA9A 3VP2A 4N1HA 4RX2A 5GHZA 1ONGA 1JTGA 2XEPA 1FCOA 4IVIA 4KG6A 3PBQA 1S6RA 5KSHA 1WYCA 5EUAA 5FA7A 1U60A 2XR0A 3PTEA 2RCXA 3G30A 2EX2A 3ZG9B 4LV1A 3WS2A 4BENA 3UN7A 3MKEA 4JBFA 1XP4A 2WGWB 5E2FA 1Q2PA 2QZ6A 4H8RA 4P0MA 2IWCA 1XGJA 5TR7A 4KZ8A 3ZG0A 2P74A 4QJGA 4QB8A 2VGKA 2G2UA 4PM7A 3GRJA 4IBXA 4JXGA 4R23A 3UPNA 3HLWA 2E8IA 1TEMA 2X01A 4E3NA 4EBLA 1PZOA 3Q81A 3PBOA 1FCMA 3LO7A 4UHUA 3UNWA 1IEMA 1YM1A 1PW8A 4GNUA 2WZZA 5AQ7A 3N8SA 4BD0A 1YLTA 1J9MA 3IQAA 5EVIB 4E3JA 3IWIA 3QNBA 2Y91A 3AGDA 2Z2MB 3M2JA 1K56A 5M1AA 4ZBEA 1KVLA 5FQ9A 1G68A 4DE1A 3GVBA 5EVID 1WYBA 3MXSA 1BLSA 4OQ0A 2OLUA 5A92A 4QHCA 1BULA 5HFOA 3WRTA 1LI0A 3BFDA 4WZ5C 3VMAA 3VSKA 2EXAA 3NY4A 1K57C 3V5MA 4JLFA 3NDGA 4NK3A 3GMWA 4WELA 5E2EA 2IWDA 3HUOA 4DXBA 1FCNA 4HEFA 1Y54A 4R4SA 2EFXA 4KENB 1CI8A 3Q7VA 4B88A 1YT4A 1K6SA 3HL9A 4FH2A 5E43A 4N92A 4UAAA 3IXHA 1W8QA 5EVIA 3VFFA 3PAEA 4N9LA 2XQZA 3O86A 4E3KA 5HAQA 1BUEA 2WYXA 4DDYA 1M6KA 3E2LA 3VP4A 3WS4A 4DE2A 3VP0A 5HL1A 3IF5A 2Y2PA 2ZMAA 4E6WA 5DTKA 2Y2NA 3IXDA 4MEZA 4KZ4A 2J8YA 3IH8A 2H0YA 5FQKA 1K54C 1K4FA 1MY8A 1PWCA 3N7WA 4ZDXA 3HLDA 4WYYA 1BLHA 1W7FA 4X6TA 3N6IA 1BLCA 3FKVA 2HP5A 3VOYA 1QMEA 4R3JA 1XGIA 3N8RA 3BRMA 3O88A 2ZD8A 1EI5A 1NYYA 3GTCA 5KZHA 2JCHA 2QMIA 1MWTA 3ITAA 1KE3A 4N1XA 1FSWA 1K55C 5FI7A 1FSYA 4R3BA 1W79A 4WEJA 4ZJ1A 2B5RA 2Y2JA 3D4FA 1TDLA 3ITBA 4KZ5A 1ESIA 4GD8A 3GQZA 1L0EA 1MXOA 2DRWA 2UWXA 5HARA 4HBUA 3G31A 2PU2A 3I7JA 4WMCD 4RVAA 3VP3A 3IH9A 4EBNA 4DE0A 1OMEA 2WAEA 1MPLA 5EOOA 2H10A 2P9VB 3HUMA 2Y59A 4PM9A 4X56A 4KQRA 3EQUA 4GN2A 4NETA 1LI9A 4U3TA 3S4XA 1H8YA 2XLNA 1KDSA 1ZC2A 3BLMA 3C7VA 4JF6A 4K91A 2V2FF 5HAPA 1KVMA 2XDMA 4WMCA 1YLWA 4GZBA 1ONHA 1SKFA 3NCKA 3S22A 1ES4A 1ERQA 3LCEA 4S2NC 4QD4A 3ZVTA 1MWSA 4HBTA 3C4OA 4UA6A 5HX9A 4DDSA 4ID4A 3BFGA 4RX3A 4KG5A 3RXXA 2EX9A 3WS1A 5A91A 3VOZA 4B4XA 4B4ZA 4E3MA 2Y4AA 3PBTA 3UE1A 2V20A 1IELA 3WWXA 1Q2QA 4JXWA 4EV4A 3BECA 4JXSA 2P9VA 1RGZA 2DCFA 3TG9A 4E3OA 1SHVA 2Q9NA 2Y2HA 4WZ4A 3ZHHA 1DJBA 1KGGA 3C4PA 3G2ZA 3G2YA 1K54A 3G4PA 4OLDA 1K56D 1GCEA 2OLVA 3G34A 5CHUA 4DRTA 1IYPA 1CK3A 5CHJA 4XUXA 5CTNA 1ZG4A 5KSCA 2WKIA 1PWDA 2ZC7A 3GR2A 3LY4A 3W4QA 3IWOA 3WRZA 3NBLA 2X71A 3MKFA 2ZJ9A 2ZQDA 3PAGA 3M6BA 1PZPA 5CXWA 2ZQ9A 3GSGA 3Q7VB 4IBRA 3QNCA 1IKGA 2HP9A 4MBKA 1JVJA 4Y0UA 1K55A 4E3IA 2XFSA 5GHXA 3UO9A 1MWRA 1WE4A 1PW1A 1IYSA 2Y2KA 3HUNA 4JXVA 4OKPA 4S2PA 2XH9A 5EOEA 1GA0A 2XD1A 4MBFA 1I2SA 5D3OA 3LEZA 3NI9A 1DY6A 4WM9A 1CEGA 1MBLA 2Y2OA 3RJUA 3PBNA 3IF6C 4X68A 1RP5A 3UY6A 5A93A 1PI4A 2OV5A 4C75A 3FYZA 3G35A 3M2KA 1W8YA 1GHIA 4MBHA 1NY0A 3VSLA 4XUZA 1KGEA 1PWGA 4U0TA 3A3EA 4OPZA 4CJNA 2J7VA 5JYOA 4OONA 5KMWA 1RGYA 4KQOA 3HREA 4YINA 2HDUA 2XGNA 4R4RA 5IHVA 1L0DA 5CEDA 2Y2LA 1NRFA 4GDNA 4S2NA 1HTZA 1XA7A 3ZG8B 2WADA 3HLCA 4IVKA 3PBSA 3G32A 4OQHA 3Q7ZA 1VQQA 3P09A 4S2JA 3E2KA 4S2OA 3DWZA 4KZBA 2RL3A 5FASA 3HLFA 3GV9A 1EROA 2H0TA 3MZEA 4LCLA 4OQGA 1YMSA 1O7EA 3AGEA 3QHYA 5HW3A 3C5AA 4KZAA 4P87A 2WK0A 3UDFA 3HVFA 2EFUA 5DTTA 3NDEA 3OCLA 2ZLYA 1L0GA 4A5RA 5CECA 4K0WA 4Y0TA 1SDEA 3JYIA 1QMFA 1L2SA 5A90A 4S2MA 4Y0OA 1JWZA 2X02A 4X53A 5GLAA 5F1GA 3IF6B 3BLSA 3BFCA 1BZAA 3CG5A 4ZTKA 3A3FA 4C3QA 3UDXA 1XPBA 4DF6A 2WAFA 5TGFA 1E25A 1PI5A 4LV3A 3IHAA 5DF9A 3W4PA 2G2WA 1GA9A 1I2WA 5M19A 3BM6A 1Z6FA 3ZG5A 4GD6A 4PPRA 5G18A 3BEBA 1I5QA 2Y2IA 4GDBA 1PYYA 2CC1A 5M18A 1FQGA 2XK1A 3IHBA 1KDWA 3OCNA 4OOYA 4KG2A 4PMAA 4JKTA 3UDIA 1FR6A 1LLBA 5FSRA 4OQIA 1K38A 2FFYA 3V3RA 5DTSA 1TVFA 1W5DA 2ZC3B 4UA7A 4OP8A 5DF7A 4X55A 1HVBA 1DJAA 3FV7A 3LY3A 3N8LA 1GHMA 3IF6A 4BLMA 1DJCA 4N9KA 4WZ5A 1ZKJA 1ALQA 5AQ9A 1K57A 3OZHA 4KZ9A 4X69A 2WGVA 3OPPA 1EWZA 3DWKA 3FZCA 3Q82A 1GHPA 1RCJA 4FH4A 3ZGAB 3O3VA 4KZ3A 2DNSA 1JTDA 1PIOA 3N4IA 1E3UD 1NXYA 4KQQA 2QPNA 3SS5A 4WEKA 3A3DA 2C5WB 3SH7A 1XA1A 4K0XA 5DF8A 2HDRA 1YLJA 2ZQ8A 5CGXA 3ZNYA 4S2IA 1IKIA 5FQIA 4QU3A 2J9PA 4WBGA 2WGIA 2ZM2A 4EUZA 3S1YA 2PU4A 4Y7PA 3DTMA 5CRFA 4E6XA 4MLLA 4R0QA 2A3UA 4FD8A 1LL9A 4Q8IA 2ZM0A 5CTMA 5EVIC 2WZXA 5J8XA 4PM6A 4LCMA 3SOIA 1K4EA 4BL2A 3FKWA 1BT5A 1E4DA 1E3UA 4LENA 3UPOA 3ZFZA 2WKEA 2Y2GA 4OLGA 1ERMA 4GOGA 2FFFB 1JWPA 4YFMA 5E2HA 2C6WB 3WS5A 3TSGA 1XKZA 3MZDA 4FCFA 3MBZA 5FDHA 3OPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FQQ A;  3NC8 A;  3WS0 A;  4ZJ3 A;  2R9X A;  3P98 A;  4D2O A;  3UPP A;  2ZC6 B;  1YLP A;  2EXB A;  2H5S A;  2OSU A;  1YLZ A;  1ES3 A;  4U0X A;  5CER A;  2XFT A;  5BOH A;  2JE5 A;  1ZG6 A;  5GLD A;  3ISG A;  4OOM A;  2ZM8 A;  4OOL A;  3V39 A;  5FAO A;  1YLY A;  2V1Z A;  1L0F A;  4P85 A;  3RXW A;  4BD1 A;  1ES5 A;  1FOF A;  1XX2 A;  3B3X A;  4OP5 A;  4ZJ2 A;  3IXG A;  1S0W A;  2JBF A;  5HAI A;  4DE3 A;  4F94 A;  5FI6 A;  1LL5 A;  5GHY A;  4ZAM A;  3ZCZ A;  3BFE A;  3UE0 A;  3DW0 A;  3ZVW A;  5FAT A;  3O87 A;  2IWB A;  4DKI A;  3OPL A;  3W4O A;  1NYM A;  4HES A;  4EQI A;  2WGW A;  5F1F A;  4BQM A;  2HPB A;  4PM8 A;  1CEF A;  4Z9Q A;  3SS4 A;  4MNR A;  2JC7 A;  1H8Z A;  1MWU A;  3BYD A;  4S2L A;  1YQS A;  3CMZ A;  5E2G A;  5GLC A;  5JYP A;  5FAQ A;  5U47 A;  5FI2 A;  2EX8 A;  1NJ4 A;  3CZD A;  4JPM A;  1BTL A;  5EE8 A;  5AQB A;  1YMX A;  5GL9 A;  2ZQ7 A;  4RYE A;  3OC2 A;  3SH9 A;  2ZC5 B;  3EQV A;  1LHY A;  2HDQ A;  4IED A;  4KZ7 A;  3Q07 A;  3ZDJ A;  2BG1 A;  1FR1 A;  2ZC4 B;  3A3I A;  5TFQ A;  3ZNT A;  1BSG A;  1C3B A;  2A49 A;  3NIA A;  3SS3 A;  3V50 A;  5L2F A;  3HLB A;  4EWF A;  4OPQ A;  1ES2 A;  4CPK A;  1K6R A;  5EVL A;  5CGS A;  3HBR A;  1BLP A;  5F83 A;  5EEC A;  3UE3 A;  2ZQA A;  5DVA A;  2PBY A;  4GKU A;  4E3L A;  2I72 A;  4O7D A;  3OPH A;  1MKI A;  1AXB A;  3MFD A;  4OPY A;  3Q1F A;  5FQJ A;  4KZ6 A;  4L0L A;  4EBP A;  1KE0 A;  2VGJ A;  4QY5 A;  2EX6 A;  4C6Y A;  4OVD A;  2Z2L B;  5FQM A;  5I94 A;  1IYQ A;  3SH8 A;  5CHM A;  1VM1 A;  3TOI A;  1N9B A;  3FWL A;  5CEB A;  1KE4 A;  4OPR A;  1O07 A;  3IXB A;  1CI9 A;  2WUQ A;  2HP6 A;  1XXM A;  3VP1 A;  2XF3 A;  5EPH A;  1ESU A;  4PM5 A;  3IT9 A;  4BL3 A;  3ZG7 B;  5GLB A;  1SCW A;  4P6B A;  1TDG A;  3CJM A;  4S2K A;  2GDN A;  3IWQ A;  2J9O A;  2R9W A;  2BLS A;  1K25 A;  1HZO A;  2Y55 A;  5CGW A;  4FSF A;  1SDN A;  2WKH A;  4LV0 A;  3HLG A;  4RA7 A;  2Y2M A;  1JWV A;  4OH0 A;  4M3K A;  4R1G A;  2HDS A;  3PBR A;  4GB7 A;  3V3S A;  1M40 A;  1IYO A;  1KGF A;  3A3J A;  1G6A A;  3BFF A;  3VFH A;  4JF4 A;  3W8K A;  2ZQC A;  4LV2 A;  3C7U A;  1NZO A;  3AGF A;  5F82 A;  1H5X A;  2Q9M A;  2XD5 A;  3HLE A;  3M6H A;  4BJP A;  4DXC A;  4QY6 A;  4XXR A;  2Y2Q A;  4JF5 A;  3MZF A;  3MXR A;  1N4O A;  5AQA A;  1NZU A;  5FAP A;  1HD8 A;  4UA9 A;  3VP2 A;  4N1H A;  4RX2 A;  5GHZ A;  1ONG A;  1JTG A;  2XEP A;  1FCO A;  4IVI A;  4KG6 A;  3PBQ A;  1S6R A;  5KSH A;  1WYC A;  5EUA A;  5FA7 A;  1U60 A;  2XR0 A;  3PTE A;  2RCX A;  3G30 A;  2EX2 A;  3ZG9 B;  4LV1 A;  3WS2 A;  4BEN A;  3UN7 A;  3MKE A;  4JBF A;  1XP4 A;  2WGW B;  5E2F A;  1Q2P A;  2QZ6 A;  4H8R A;  4P0M A;  2IWC A;  1XGJ A;  5TR7 A;  4KZ8 A;  3ZG0 A;  2P74 A;  4QJG A;  4QB8 A;  2VGK A;  2G2U A;  4PM7 A;  3GRJ A;  4IBX A;  4JXG A;  4R23 A;  3UPN A;  3HLW A;  2E8I A;  1TEM A;  2X01 A;  4E3N A;  4EBL A;  1PZO A;  3Q81 A;  3PBO A;  1FCM A;  3LO7 A;  4UHU A;  3UNW A;  1IEM A;  1YM1 A;  1PW8 A;  4GNU A;  2WZZ A;  5AQ7 A;  3N8S A;  4BD0 A;  1YLT A;  1J9M A;  3IQA A;  5EVI B;  4E3J A;  3IWI A;  3QNB A;  2Y91 A;  3AGD A;  2Z2M B;  3M2J A;  1K56 A;  5M1A A;  4ZBE A;  1KVL A;  5FQ9 A;  1G68 A;  4DE1 A;  3GVB A;  5EVI D;  1WYB A;  3MXS A;  1BLS A;  4OQ0 A;  2OLU A;  5A92 A;  4QHC A;  1BUL A;  5HFO A;  3WRT A;  1LI0 A;  3BFD A;  4WZ5 C;  3VMA A;  3VSK A;  2EXA A;  3NY4 A;  1K57 C;  3V5M A;  4JLF A;  3NDG A;  4NK3 A;  3GMW A;  4WEL A;  5E2E A;  2IWD A;  3HUO A;  4DXB A;  1FCN A;  4HEF A;  1Y54 A;  4R4S A;  2EFX A;  4KEN B;  1CI8 A;  3Q7V A;  4B88 A;  1YT4 A;  1K6S A;  3HL9 A;  4FH2 A;  5E43 A;  4N92 A;  4UAA A;  3IXH A;  1W8Q A;  5EVI A;  3VFF A;  3PAE A;  4N9L A;  2XQZ A;  3O86 A;  4E3K A;  5HAQ A;  1BUE A;  2WYX A;  4DDY A;  1M6K A;  3E2L A;  3VP4 A;  3WS4 A;  4DE2 A;  3VP0 A;  5HL1 A;  3IF5 A;  2Y2P A;  2ZMA A;  4E6W A;  5DTK A;  2Y2N A;  3IXD A;  4MEZ A;  4KZ4 A;  2J8Y A;  3IH8 A;  2H0Y A;  5FQK A;  1K54 C;  1K4F A;  1MY8 A;  1PWC A;  3N7W A;  4ZDX A;  3HLD A;  4WYY A;  1BLH A;  1W7F A;  4X6T A;  3N6I A;  1BLC A;  3FKV A;  2HP5 A;  3VOY A;  1QME A;  4R3J A;  1XGI A;  3N8R A;  3BRM A;  3O88 A;  2ZD8 A;  1EI5 A;  1NYY A;  3GTC A;  5KZH A;  2JCH A;  2QMI A;  1MWT A;  3ITA A;  1KE3 A;  4N1X A;  1FSW A;  1K55 C;  5FI7 A;  1FSY A;  4R3B A;  1W79 A;  4WEJ A;  4ZJ1 A;  2B5R A;  2Y2J A;  3D4F A;  1TDL A;  3ITB A;  4KZ5 A;  1ESI A;  4GD8 A;  3GQZ A;  1L0E A;  1MXO A;  2DRW A;  2UWX A;  5HAR A;  4HBU A;  3G31 A;  2PU2 A;  3I7J A;  4WMC D;  4RVA A;  3VP3 A;  3IH9 A;  4EBN A;  4DE0 A;  1OME A;  2WAE A;  1MPL A;  5EOO A;  2H10 A;  2P9V B;  3HUM A;  2Y59 A;  4PM9 A;  4X56 A;  4KQR A;  3EQU A;  4GN2 A;  4NET A;  1LI9 A;  4U3T A;  3S4X A;  1H8Y A;  2XLN A;  1KDS A;  1ZC2 A;  3BLM A;  3C7V A;  4JF6 A;  4K91 A;  2V2F F;  5HAP A;  1KVM A;  2XDM A;  4WMC A;  1YLW A;  4GZB A;  1ONH A;  1SKF A;  3NCK A;  3S22 A;  1ES4 A;  1ERQ A;  3LCE A;  4S2N C;  4QD4 A;  3ZVT A;  1MWS A;  4HBT A;  3C4O A;  4UA6 A;  5HX9 A;  4DDS A;  4ID4 A;  3BFG A;  4RX3 A;  4KG5 A;  3RXX A;  2EX9 A;  3WS1 A;  5A91 A;  3VOZ A;  4B4X A;  4B4Z A;  4E3M A;  2Y4A A;  3PBT A;  3UE1 A;  2V20 A;  1IEL A;  3WWX A;  1Q2Q A;  4JXW A;  4EV4 A;  3BEC A;  4JXS A;  2P9V A;  1RGZ A;  2DCF A;  3TG9 A;  4E3O A;  1SHV A;  2Q9N A;  2Y2H A;  4WZ4 A;  3ZHH A;  1DJB A;  1KGG A;  3C4P A;  3G2Z A;  3G2Y A;  1K54 A;  3G4P A;  4OLD A;  1K56 D;  1GCE A;  2OLV A;  3G34 A;  5CHU A;  4DRT A;  1IYP A;  1CK3 A;  5CHJ A;  4XUX A;  5CTN A;  1ZG4 A;  5KSC A;  2WKI A;  1PWD A;  2ZC7 A;  3GR2 A;  3LY4 A;  3W4Q A;  3IWO A;  3WRZ A;  3NBL A;  2X71 A;  3MKF A;  2ZJ9 A;  2ZQD A;  3PAG A;  3M6B A;  1PZP A;  5CXW A;  2ZQ9 A;  3GSG A;  3Q7V B;  4IBR A;  3QNC A;  1IKG A;  2HP9 A;  4MBK A;  1JVJ A;  4Y0U A;  1K55 A;  4E3I A;  2XFS A;  5GHX A;  3UO9 A;  1MWR A;  1WE4 A;  1PW1 A;  1IYS A;  2Y2K A;  3HUN A;  4JXV A;  4OKP A;  4S2P A;  2XH9 A;  5EOE A;  1GA0 A;  2XD1 A;  4MBF A;  1I2S A;  5D3O A;  3LEZ A;  3NI9 A;  1DY6 A;  4WM9 A;  1CEG A;  1MBL A;  2Y2O A;  3RJU A;  3PBN A;  3IF6 C;  4X68 A;  1RP5 A;  3UY6 A;  5A93 A;  1PI4 A;  2OV5 A;  4C75 A;  3FYZ A;  3G35 A;  3M2K A;  1W8Y A;  1GHI A;  4MBH A;  1NY0 A;  3VSL A;  4XUZ A;  1KGE A;  1PWG A;  4U0T A;  3A3E A;  4OPZ A;  4CJN A;  2J7V A;  5JYO A;  4OON A;  5KMW A;  1RGY A;  4KQO A;  3HRE A;  4YIN A;  2HDU A;  2XGN A;  4R4R A;  5IHV A;  1L0D A;  5CED A;  2Y2L A;  1NRF A;  4GDN A;  4S2N A;  1HTZ A;  1XA7 A;  3ZG8 B;  2WAD A;  3HLC A;  4IVK A;  3PBS A;  3G32 A;  4OQH A;  3Q7Z A;  1VQQ A;  3P09 A;  4S2J A;  3E2K A;  4S2O A;  3DWZ A;  4KZB A;  2RL3 A;  5FAS A;  3HLF A;  3GV9 A;  1ERO A;  2H0T A;  3MZE A;  4LCL A;  4OQG A;  1YMS A;  1O7E A;  3AGE A;  3QHY A;  5HW3 A;  3C5A A;  4KZA A;  4P87 A;  2WK0 A;  3UDF A;  3HVF A;  2EFU A;  5DTT A;  3NDE A;  3OCL A;  2ZLY A;  1L0G A;  4A5R A;  5CEC A;  4K0W A;  4Y0T A;  1SDE A;  3JYI A;  1QMF A;  1L2S A;  5A90 A;  4S2M A;  4Y0O A;  1JWZ A;  2X02 A;  4X53 A;  5GLA A;  5F1G A;  3IF6 B;  3BLS A;  3BFC A;  1BZA A;  3CG5 A;  4ZTK A;  3A3F A;  4C3Q A;  3UDX A;  1XPB A;  4DF6 A;  2WAF A;  5TGF A;  1E25 A;  1PI5 A;  4LV3 A;  3IHA A;  5DF9 A;  3W4P A;  2G2W A;  1GA9 A;  1I2W A;  5M19 A;  3BM6 A;  1Z6F A;  3ZG5 A;  4GD6 A;  4PPR A;  5G18 A;  3BEB A;  1I5Q A;  2Y2I A;  4GDB A;  1PYY A;  2CC1 A;  5M18 A;  1FQG A;  2XK1 A;  3IHB A;  1KDW A;  3OCN A;  4OOY A;  4KG2 A;  4PMA A;  4JKT A;  3UDI A;  1FR6 A;  1LLB A;  5FSR A;  4OQI A;  1K38 A;  2FFY A;  3V3R A;  5DTS A;  1TVF A;  1W5D A;  2ZC3 B;  4UA7 A;  4OP8 A;  5DF7 A;  4X55 A;  1HVB A;  1DJA A;  3FV7 A;  3LY3 A;  3N8L A;  1GHM A;  3IF6 A;  4BLM A;  1DJC A;  4N9K A;  4WZ5 A;  1ZKJ A;  1ALQ A;  5AQ9 A;  1K57 A;  3OZH A;  4KZ9 A;  4X69 A;  2WGV A;  3OPP A;  1EWZ A;  3DWK A;  3FZC A;  3Q82 A;  1GHP A;  1RCJ A;  4FH4 A;  3ZGA B;  3O3V A;  4KZ3 A;  2DNS A;  1JTD A;  1PIO A;  3N4I A;  1E3U D;  1NXY A;  4KQQ A;  2QPN A;  3SS5 A;  4WEK A;  3A3D A;  2C5W B;  3SH7 A;  1XA1 A;  4K0X A;  5DF8 A;  2HDR A;  1YLJ A;  2ZQ8 A;  5CGX A;  3ZNY A;  4S2I A;  1IKI A;  5FQI A;  4QU3 A;  2J9P A;  4WBG A;  2WGI A;  2ZM2 A;  4EUZ A;  3S1Y A;  2PU4 A;  4Y7P A;  3DTM A;  5CRF A;  4E6X A;  4MLL A;  4R0Q A;  2A3U A;  4FD8 A;  1LL9 A;  4Q8I A;  2ZM0 A;  5CTM A;  5EVI C;  2WZX A;  5J8X A;  4PM6 A;  4LCM A;  3SOI A;  1K4E A;  4BL2 A;  3FKW A;  1BT5 A;  1E4D A;  1E3U A;  4LEN A;  3UPO A;  3ZFZ A;  2WKE A;  2Y2G A;  4OLG A;  1ERM A;  4GOG A;  2FFF B;  1JWP A;  4YFM A;  5E2H A;  2C6W B;  3WS5 A;  3TSG A;  1XKZ A;  3MZD A;  4FCF A;  3MBZ A;  5FDH A;  3OPR A; 
#chains in the Genus database with same CATH topology
 3WS0 A;  4ZJ3 A;  4D2O A;  2W27 A;  3B33 A;  3UPP A;  1VEU B;  2EXB A;  2H5S A;  5HPF A;  3LYX A;  2XFT A;  3ISG A;  4NKP A;  4X25 A;  5FAO A;  3KSH A;  4P85 A;  3T4T A;  1P0Z A;  1FOF A;  1XX2 A;  2KOI A;  1Z09 A;  4DE3 A;  4Y17 A;  1LL5 A;  5GHY A;  5F6A A;  3BFE A;  2KLI A;  4EEU A;  3W4O A;  4HES A;  4BQM A;  1CEF A;  4MNR A;  3V67 A;  1OPX A;  4S2L A;  3BYD A;  3KX0 X;  5JYP A;  5GLC A;  3CZD A;  4JPM A;  2A2L A;  1D7E A;  2ZQ7 A;  3OC2 A;  3E4O A;  4WN5 A;  4GCZ A;  1BSG A;  1C3B A;  3V50 A;  5L2F A;  3HLB A;  1V9Z A;  3NOU C;  4OPQ A;  5EVL A;  1MKI A;  1AXB A;  3Q1F A;  5HDC A;  4QY5 A;  2EX6 A;  4OVD A;  5FQM A;  3TOI A;  1K0K A;  2Z6D A;  2WUQ A;  2I9V A;  5EPH A;  1HLU P;  4PM5 A;  3IT9 A;  4BL3 A;  4ARZ A;  1SCW A;  3CJM A;  2GDN A;  3IWQ A;  3MBZ A;  3GEC A;  5CGW A;  4LV0 A;  2WKH A;  3MJQ A;  2Y2M A;  4OH0 A;  3MMH A;  2HDS A;  4LRZ E;  4GB7 A;  2JKR M;  3A3J A;  4QPR A;  3W8K A;  2XSS A;  1H5X A;  1N4O A;  5FL3 A;  4RX2 A;  4NG2 A;  5GHZ A;  1OJG A;  2UV0 E;  5IS1 A;  1WYC A;  5EUA A;  2XR0 A;  3PTE A;  2EX2 A;  3WS2 A;  1S1Y A;  4YOF A;  4H8R A;  4P0M A;  5IT5 A;  4QJG A;  2VGK A;  2G2U A;  4IBX A;  2WKR A;  2X01 A;  4E3N A;  3Q81 A;  4MDZ A;  1PW8 A;  2W3H A;  5EVI B;  1XFN A;  3QNB A;  2Y91 A;  3M2J A;  4ZBE A;  3GVB A;  5EVI D;  4LRY C;  1WYB A;  4OQ0 A;  5A92 A;  3WRT A;  3BFD A;  3VMA A;  1GSV A;  3VSK A;  4PAU A;  3NDG A;  5J7E A;  3BJN A;  1YT4 A;  4FH2 A;  3T4O A;  3VFF A;  3BWL A;  2W3F A;  2XQZ A;  3O86 A;  2WYX A;  3VP4 A;  5HL1 A;  3T4L A;  3OLO A;  5FQK A;  1PWC A;  4ZDX A;  1W7F A;  1BLC A;  3FKV A;  3F1P B;  2OAP 1;  3NOT C;  2J3T C;  2VGL S;  2P04 A;  4EW7 A;  3D3O A;  1KE3 A;  1K55 C;  1FSY A;  4WEJ A;  4ZJ1 A;  3D4F A;  1MXO A;  2DRW A;  4UQI S;  3CHW P;  4WMC D;  2PU2 A;  4RVA A;  3IH9 A;  4IUK A;  5HDS A;  2Y8H A;  1MPL A;  3HUM A;  3QP2 A;  3LR3 A;  3KYQ A;  1VHM A;  3LIE A;  1KDS A;  1ZC2 A;  4JF6 A;  3TW8 A;  2EWW A;  3EEA A;  4FOF A;  3FC7 A;  3IS2 A;  3LCE A;  3ZVT A;  4HBT A;  4UA6 A;  4ID4 A;  3IX8 A;  3VOZ A;  1EW0 A;  2PHY A;  4JXW A;  1VB6 A;  2QKP A;  1RGZ A;  2J80 A;  2O9C A;  3P01 A;  3R7W B;  1SHV A;  2Q9N A;  1UWN X;  3KSI A;  3G34 A;  4DRT A;  5CHJ A;  5DFX A;  1ZG4 A;  3W4Q A;  1N9L A;  1PWD A;  3LY4 A;  2OWH A;  2ZJ9 A;  3M6B A;  2ZQ9 A;  1IOU A;  3QNC A;  4E3I A;  1MWR A;  3LI8 A;  2B02 A;  4S2P A;  5EOE A;  2XD1 A;  4MBF A;  5D3O A;  5LBR A;  3QP4 A;  1TS8 A;  1DY6 A;  4ETZ A;  2Y2O A;  3C30 A;  3IF6 C;  1MKM A;  3UY6 A;  1PI4 A;  3E4P A;  3G35 A;  3M2K A;  3A3E A;  5AJG A;  5KMW A;  1RGY A;  3F1O A;  4I3I A;  2XRN A;  4GDN A;  1HTZ A;  4I39 A;  4YWZ A;  3HLC A;  3ZG8 B;  4IVK A;  3G32 A;  5FAS A;  3T4K A;  4LCL A;  3MZE A;  3AGE A;  4MMN A;  4BBT A;  2WK0 A;  3OCL A;  2ZLY A;  4A5R A;  5CEC A;  3P7N A;  1QMF A;  2Z6C A;  1ZTU A;  4CLC B;  5F1G A;  3BFC A;  3LR0 A;  4CLC D;  3F1N A;  1I2W A;  5M19 A;  1Z6F A;  2MJ6 A;  4EXO A;  2W1R A;  2CC1 A;  1KDW A;  1OTE A;  4OOY A;  4JKT A;  1LLB A;  3V3R A;  5DTS A;  1TVF A;  1W5D A;  2W1T A;  4L9G A;  2ZC3 B;  4OP8 A;  4X55 A;  5FEG A;  1HVB A;  1DJA A;  3FV7 A;  1DJC A;  4N9K A;  3DBA A;  1ALQ A;  1K57 A;  3OZH A;  4P6Z M;  2M7U A;  4KQQ A;  1E3U D;  1NXY A;  3KYZ A;  2QPN A;  4WEK A;  5G4Z A;  1YLJ A;  2ZQ8 A;  5CGX A;  5DKK A;  4WBG A;  2WGI A;  3U4L P;  4EUZ A;  3S1Y A;  2PU4 A;  5CRF A;  3OBF A;  4ESP A;  4FD8 A;  1LL9 A;  2ZM0 A;  5EVI C;  5IU1 A;  2WZX A;  4NXE A;  3UB8 A;  3S7Q A;  1E4D A;  3ZFZ A;  4HHD A;  3NOP C;  1OTA A;  4WUJ A;  3NC8 A;  3P98 A;  3U2A A;  1YLP A;  3T12 B;  5BOH A;  2JE5 A;  1ZG6 A;  1YLY A;  1L0F A;  3RXW A;  4BD1 A;  2QJ5 A;  2J3W A;  4OP5 A;  4ZJ2 A;  2P7J A;  2JBF A;  4FUW A;  2GZA A;  3ZCZ A;  3UE0 A;  3DW0 A;  2G7U A;  4DKI A;  2W3D A;  3OOV A;  5J4E A;  4Y2F A;  1P9R A;  2K31 A;  1N9N A;  1MWU A;  3CMZ A;  1T1A A;  4HOI A;  1NJ4 A;  5EE8 A;  4Y13 A;  5AQB A;  2WKP A;  5GL9 A;  2HDQ A;  4IED A;  1F5M A;  2K7S A;  3ZNT A;  3ULF A;  4G3W A;  3SS3 A;  2V9A A;  1YSP A;  4ARZ B;  2L1M A;  3H7W A;  2ZQA A;  4GKU A;  4E3L A;  3OPH A;  1ZHH B;  1NRJ A;  3EEH A;  5FQJ A;  2PR5 A;  4L0L A;  4R3A A;  2VGJ A;  2VV8 A;  1GSW A;  4HQA A;  1IYQ A;  2AVX A;  1ACF A;  3FWL A;  4Q0J A;  5EM0 A;  1CI9 A;  2GX5 A;  4DJ3 A;  4O01 A;  3NUL A;  5GLB A;  3VE3 A;  4P6B A;  2D01 A;  4S2K A;  2J9O A;  3RH8 B;  4LLO B;  2PDR A;  1HZO A;  1IFQ A;  3HLG A;  4RA7 A;  1JWV A;  3VV4 A;  3KYE A;  1M40 A;  4EEP A;  1KGF A;  1G6A A;  1FIL A;  4JF4 A;  4LV2 A;  2XD5 A;  4BJP A;  1T1B A;  4QY6 A;  4BMW A;  4D60 A;  5AVE A;  3MZF A;  4UA9 A;  2XRO A;  5EM1 A;  2XEP A;  3E4Q A;  2QYB A;  3PBQ A;  3B42 A;  4GS9 A;  1U60 A;  3G30 A;  4BEN A;  2O9B A;  1XP4 A;  2WGW B;  1XGJ A;  5TR7 A;  2P74 A;  4PM7 A;  2V0W A;  4NEE D;  2E8I A;  1TEM A;  4JGQ A;  4EBL A;  2L4R A;  3PBO A;  4UHU A;  1IEM A;  4O8G A;  5AQ7 A;  4BD0 A;  3IQA A;  4E3J A;  3JPU A;  3IWI A;  5M1A A;  4WLA A;  3R4K A;  4ETX A;  5FQ9 A;  4DE1 A;  4WF0 A;  5HFO A;  4CLC C;  4WZ5 C;  3NY4 A;  4NK3 A;  3LI9 A;  1FCN A;  4R4S A;  2EFX A;  4KEN B;  1CI8 A;  3L9K A;  3Q7V A;  5E43 A;  3PXP A;  1BYW A;  1BUE A;  2FH5 A;  3E2L A;  5AVF A;  4PHT A;  4R38 A;  2Y2P A;  2Y2N A;  2PYR A;  2J8Y A;  1K54 C;  1K4F A;  3N7W A;  3HLD A;  4WYY A;  5L10 A;  4X6T A;  2HP5 A;  3PYP A;  1NLY A;  2QHK A;  4R3J A;  1F98 A;  4I38 A;  4MN7 A;  3O88 A;  1NYY A;  3GTC A;  2QMI A;  1VET B;  1FSW A;  5FI7 A;  3IS2 B;  4R3B A;  1W79 A;  2B5R A;  1ESI A;  2UWX A;  3VP3 A;  4EBN A;  2WAE A;  1DP6 A;  2H10 A;  2Y59 A;  4X56 A;  1LI9 A;  4HI4 A;  2XLN A;  3KSG A;  2O99 A;  3C7V A;  3BLM A;  2V2F F;  3ZYT A;  4GZB A;  4QD4 A;  5A8B A;  4DDS A;  4F3L A;  4RX3 A;  4IJG A;  3WS1 A;  3FG8 A;  5A91 A;  4B4Z A;  1X0O A;  4M4X A;  1IEL A;  3WWX A;  1Q2Q A;  2P9V A;  1OT9 A;  3TG9 A;  4BWI A;  3BY8 A;  4E3O A;  1SKO A;  3G2Y A;  1K56 D;  5MC7 A;  3CWF A;  1CK3 A;  4XUX A;  3JVV A;  5CTN A;  3G6O A;  5KSC A;  4QWO A;  2ZC7 A;  2JKG A;  3MKF A;  2ZQD A;  1PZP A;  5CXW A;  3GSG A;  4MBK A;  3LR5 A;  1K55 A;  3F1O B;  5GHX A;  4JXV A;  4HNB A;  5K5B A;  1S4R A;  5L09 A;  3CUE A;  1RP5 A;  3FYZ A;  2IA2 A;  1GHI A;  3VSL A;  5JYO A;  2J7V A;  3LR4 A;  1D06 A;  4YIN A;  3CPT A;  5IHV A;  4HJ4 A;  3S7P A;  1NRF A;  3MXQ A;  1XA7 A;  2WAD A;  4OQH A;  5HD5 A;  3Q7Z A;  3P09 A;  4S2J A;  3F1N B;  1PFL A;  2RL3 A;  3HLF A;  1ERO A;  5HW3 A;  4XT2 A;  5FEF A;  3T1R A;  2EFU A;  5DTT A;  3A0V A;  2PAV P;  1NLZ A;  1STZ A;  3MFX A;  3LIB A;  1KOU A;  4K0W A;  3GDI A;  2W1T B;  4S2M A;  2B18 A;  5L07 A;  4C3Q A;  1XPB A;  2WAF A;  2Y79 A;  3LEQ A;  1E25 A;  1PI5 A;  3VOL A;  1OT6 A;  5M18 A;  1PYY A;  4L9F A;  4PKY G;  3OCN A;  4KG2 A;  4ZRR A;  3MSH A;  5FSR A;  4OQI A;  1T19 A;  3H82 B;  1W63 Q;  4UA7 A;  3N8L A;  3IF6 A;  5DFY A;  2HGV A;  4KZ9 A;  3CI6 A;  3LID A;  3K2N A;  2DNS A;  1JTD A;  1PIO A;  3SS5 A;  2XA7 S;  2HV1 A;  3ZNY A;  4S2I A;  4QU3 A;  4Y7P A;  3DTM A;  3T4J A;  4R0Q A;  1SZV A;  2A3U A;  4Q8I A;  4FTX A;  3LUQ A;  3SOI A;  1K4E A;  1TS6 A;  1BT5 A;  4HJ3 A;  3PR6 A;  2FFF B;  1S66 L;  2VKS A;  4JGP A;  4YNR A;  4E04 A;  4FCF A;  5FDH A;  3OPR A;  4EU0 A;  2R9X A;  3K3D A;  2OSU A;  4JGR A;  1YLZ A;  3MF0 A;  1ES3 A;  2VA0 A;  3V39 A;  4OOL A;  4OOM A;  3LIF A;  4K08 A;  2V1Z A;  4BBU A;  4GJ4 A;  1LL8 A;  3BQA A;  5HD3 A;  3IXG A;  1S0W A;  2OOL A;  3FPV A;  4F94 A;  4ZAM A;  4GW9 A;  3DTK A;  3ZVW A;  5FAT A;  3O87 A;  2V8F A;  3OPL A;  3CLO A;  1S1Z A;  5HWT A;  2PRF A;  4Z9Q A;  3SS4 A;  3H7W B;  2JC7 A;  4O0P A;  1TS7 A;  1UGU A;  5FAQ A;  5FI2 A;  3H9W A;  3T1S A;  3BW6 A;  2QJ7 A;  3C38 A;  2ZC5 B;  4KZ7 A;  1LHY A;  2BG1 A;  1FR1 A;  5TFQ A;  2JKT I;  1XJ2 A;  5G4Y A;  4EWF A;  1ES2 A;  4CPK A;  3HBR A;  1BLP A;  3UE3 A;  1G5U A;  4OPY A;  4KZ6 A;  1KE0 A;  4B9O A;  3UE6 A;  4C6Y A;  3SH8 A;  5CHM A;  1VM1 A;  1N9B A;  5CEB A;  2K2N A;  4OPR A;  1O07 A;  1XJ6 A;  3VP1 A;  3ZG7 B;  2W0N A;  1TDG A;  3E98 A;  4HIA A;  4H6J A;  2BLS A;  1K25 A;  2Y55 A;  4FSF A;  1SDN A;  3F1P A;  4M3K A;  4R1G A;  4GS9 B;  4DMZ A;  2PBD P;  3PBR A;  3V3S A;  1NWZ A;  3D72 A;  3BFF A;  3MS6 A;  3VFH A;  3IX3 A;  1NZO A;  3CIT A;  2Q9M A;  3HLE A;  5F82 A;  1T18 A;  4XXR A;  4JF5 A;  3MXR A;  3O5Y A;  3IX4 A;  5AQA A;  1HD8 A;  3VP2 A;  4KG6 A;  1FCO A;  1S6R A;  5KSH A;  2RCX A;  1L3L A;  3UN7 A;  3NEC A;  5EV0 A;  5E2F A;  1Q2P A;  3MQ0 A;  2IWC A;  1TF1 A;  1DRM A;  4QB8 A;  5TBM A;  3VE4 A;  4CQH A;  3GRJ A;  4R23 A;  1CQA A;  2V1B A;  5EFW A;  1OTI A;  1OTB A;  1PZO A;  2E8J A;  3LO7 A;  4B93 A;  1YM1 A;  2WZZ A;  1YLT A;  1J9M A;  3JVU A;  2ZMV A;  1YKD A;  3AGD A;  2Z2M B;  2YKH A;  1KVL A;  1DP9 A;  3MXS A;  4QHC A;  1BUL A;  3BQ8 A;  3DTE A;  3QP5 A;  2EXA A;  1CJF A;  1K57 C;  1LSX A;  2O0Y A;  5E2E A;  1WA9 A;  2LB5 A;  2IWD A;  5C5K A;  4DXB A;  1Y54 A;  3HL9 A;  4UAA A;  3IXH A;  1W8Q A;  3RFB A;  3PAE A;  4N9L A;  4E3K A;  1M6K A;  3QP1 A;  2VGL M;  3IF5 A;  3DTI A;  3QP8 A;  3IXD A;  4MEZ A;  4Q0I A;  3IH8 A;  1F2K A;  1BLH A;  2FZ0 A;  3VOY A;  4UQI M;  1QME A;  1XGI A;  3N8R A;  4KUO A;  3KO6 A;  2ZD8 A;  2BAS A;  5HDD A;  2JCH A;  3LIA A;  3S7N A;  1XFQ A;  1XJ4 A;  1YPR A;  2V0U A;  2Y2J A;  3ITB A;  4KZ5 A;  4GD8 A;  4F3L B;  4HBU A;  3G31 A;  1A0K A;  2NUP C;  2VZW A;  3A0R A;  4DE0 A;  1OME A;  2P08 A;  2P9V B;  4PM9 A;  4KQR A;  3EQU A;  2VEA A;  1FIK A;  3S4X A;  1H8Y A;  4CLC A;  4RQ9 A;  1J3W A;  1ONH A;  3S22 A;  2V1A A;  4S2N C;  1ERQ A;  3BFG A;  5F68 A;  3RXX A;  2HZ5 A;  1YSQ A;  3PBT A;  3UE1 A;  4EV4 A;  4HP9 A;  5F5Y A;  2Y2H A;  4WZ4 A;  3C4P A;  3G2Z A;  2D02 A;  1K54 A;  3LGO A;  3A0S A;  1GCE A;  1TS0 A;  5CHU A;  1IYP A;  2ZOI A;  5L8M A;  3SW1 A;  3WRZ A;  3NBL A;  5DJU A;  3PAG A;  2JKF A;  1IKG A;  3CPT B;  3UO9 A;  3HUN A;  1PW1 A;  2VV6 A;  2Y2K A;  4OKP A;  3IBJ A;  1GA0 A;  1PRQ A;  1GSX A;  2B95 A;  2JN7 A;  4MN6 A;  1CEG A;  3RJU A;  3PBN A;  4XT2 B;  5A93 A;  4C75 A;  1NY0 A;  1KGE A;  1PWG A;  4U0T A;  4CJN A;  4OPZ A;  4DN0 A;  4KQO A;  3HRE A;  3UME A;  1L0D A;  5CED A;  1Y28 A;  2GJ3 A;  2Y2L A;  5TJJ A;  3MR0 A;  4R70 A;  3HCY A;  4OQG A;  2H0T A;  3QHY A;  4P87 A;  3UDF A;  3HVF A;  4AFI A;  4HY8 A;  5A90 A;  1L2S A;  1JWZ A;  4X53 A;  5GLA A;  4GHI A;  3IF6 B;  3BLS A;  3T50 A;  3L7H A;  1BZA A;  3UDX A;  5TGF A;  4LV3 A;  5DF9 A;  3W4P A;  2G2W A;  3HJK A;  1MC0 A;  5J3W A;  4GD6 A;  3BEB A;  2Y2I A;  4GDB A;  1FQG A;  2XK1 A;  2VV7 A;  4Z1W A;  4PMA A;  3IBR A;  4JGO A;  3UDI A;  2PD7 A;  2FFY A;  3CAX A;  3LY3 A;  1GHM A;  4BLM A;  4WL9 A;  1P9W A;  5I5L A;  4Q0H A;  1MZU A;  5AQ9 A;  1EWZ A;  3FZC A;  3Q82 A;  1GHP A;  4Y15 A;  4FH4 A;  3ZGA B;  4G3V A;  3E0Y A;  1XA1 A;  3FPW A;  5DF8 A;  2ACG A;  5FQI A;  2J9P A;  2ZM2 A;  4P6Z S;  4E6X A;  2LB9 A;  2NUT C;  3NHQ A;  4LCM A;  4BL2 A;  3FKW A;  4II7 A;  3RTY A;  1G28 A;  4LEN A;  3UPO A;  2WKE A;  4OLG A;  4GOG A;  3T4S A;  1JWP A;  2VK3 A;  3TSG A;  1XKZ A;  3KSF A;  1Y4O A;  5FQQ A;  1AWI A;  2ZC6 B;  4U0X A;  5CER A;  5GLD A;  2INW A;  2ZM8 A;  3PHY A;  2A24 A;  1ES5 A;  3B3X A;  3UB7 A;  2ZL1 A;  3ICY A;  5HAI A;  5FI6 A;  2KX6 A;  5DKL A;  1LT0 A;  3C8C A;  2IWB A;  1VEU A;  1NYM A;  4EQI A;  5F1F A;  2WGW A;  2HPB A;  4KUK A;  2V8C A;  4PM8 A;  1UWP X;  1DP8 A;  1H8Z A;  1F9I A;  1YQS A;  5E2G A;  4X1M A;  5U47 A;  4MCW A;  2EX8 A;  2BTF P;  1H8M A;  1BTL A;  1YMX A;  4RYE A;  1W63 M;  3SH9 A;  4X1L A;  3EQV A;  2PYP A;  3Q07 A;  3ZDJ A;  4MN5 A;  1H3Q A;  2ZC4 B;  3A3I A;  3NIA A;  2A49 A;  3UB5 P;  4EQ1 A;  1K6R A;  5CGS A;  5F83 A;  5EEC A;  4IUH A;  5DVA A;  2PBY A;  3DAV A;  2I72 A;  4O7D A;  4H6J B;  1OTD A;  3MFD A;  2H28 A;  4EBP A;  2Z2L B;  5I94 A;  2HJ9 C;  2PR6 A;  1KE4 A;  2JKT M;  4Y5F A;  2JKR I;  3IXB A;  5CX7 A;  2HP6 A;  1XXM A;  2XF3 A;  2OWJ A;  1ESU A;  1T1C A;  2R9W A;  1PNE A;  3CUE C;  1N9O A;  4ME4 A;  5DJT A;  5HWW A;  4EER A;  3B47 A;  1IYO A;  1TD5 A;  1VET A;  2ZQC A;  2ZBB A;  3C7U A;  3T1X A;  3AGF A;  3M6H A;  4DXC A;  1S67 L;  5TBM B;  2Y2Q A;  5HSQ A;  3C2W A;  5HL6 A;  4I3J A;  1NZU A;  5FAP A;  4N1H A;  1YAX A;  2EWV A;  1ONG A;  4IVI A;  1JTG A;  4PKY A;  5FA7 A;  1OJ5 A;  3ZG9 B;  4LV1 A;  3MKE A;  4JBF A;  4NXF A;  4EES A;  2QZ6 A;  4KZ8 A;  3ZG0 A;  4Y3I A;  4JXG A;  3UPN A;  3HLW A;  3EOI A;  4HJ6 A;  5HPI A;  1FCM A;  3UNW A;  4GNU A;  2DMW A;  3N8S A;  3EGD C;  3TJZ C;  3NJA A;  1K56 A;  1G68 A;  1BLS A;  4L9E A;  2OLU A;  3LIC A;  5EVE A;  1LI0 A;  3V5M A;  4JLF A;  3GMW A;  4WEL A;  3HUO A;  4HEF A;  1V9Y A;  4B88 A;  1K6S A;  4N92 A;  5EVI A;  4GLQ A;  5HAQ A;  4DDY A;  3WS4 A;  4DE2 A;  3VP0 A;  3UB9 A;  2ZMA A;  4E6W A;  5DTK A;  4KZ4 A;  3D9Y A;  2OAQ 1;  3UMD A;  2H0Y A;  1MY8 A;  1G6O A;  3N6I A;  2M7V A;  4EET B;  3UB6 A;  3BRM A;  1EI5 A;  5KIZ A;  5KZH A;  4I3A A;  1MWT A;  3ITA A;  2ZOH A;  4N1X A;  2M1C A;  4LGW A;  1TDL A;  3GQZ A;  1L0E A;  3MQO A;  5HAR A;  3I7J A;  2W3E A;  2KDK A;  5EOO A;  4GN2 A;  4NET A;  4U3T A;  1H0M A;  2VX8 A;  4K91 A;  3S7O A;  4EUV A;  1D1J A;  5HAP A;  1KVM A;  2XDM A;  4WMC A;  1YLW A;  4KQD A;  3EWK A;  1SKF A;  3NCK A;  1XJ3 A;  1ES4 A;  1MWS A;  5HX9 A;  3C4O A;  2EA9 A;  4B4X A;  4E3M A;  2EX9 A;  2Y4A A;  2V20 A;  2Q0O A;  3BEC A;  2VLG A;  4JXS A;  1ODV A;  1CF0 A;  2DCF A;  3H82 A;  5HZH A;  1JNU A;  2YKF A;  3ZHH A;  2JHE A;  1DJB A;  1KGG A;  3BY9 A;  3G4P A;  4OLD A;  2OLV A;  2ZMF A;  4LPZ A;  2WKI A;  3GR2 A;  3IWO A;  2X71 A;  4HP4 A;  3ZQ5 A;  5HWV A;  3Q7V B;  3K3C A;  4IBR A;  2HP9 A;  1LSW A;  1JVJ A;  4Y0U A;  3R7W A;  2XFS A;  1WE4 A;  1IYS A;  4BBV A;  2XH9 A;  1I2S A;  3LEZ A;  4CLC E;  3NI9 A;  2HF6 A;  2O9A A;  4G3K A;  4WM9 A;  1MBL A;  4X68 A;  1P97 A;  2OV5 A;  1W8Y A;  4MBH A;  5FDS A;  3LFV A;  4XUZ A;  4OON A;  2W3G A;  2HDU A;  2XGN A;  4R6L A;  4R4R A;  4GHI B;  4S2N A;  3W2Z A;  3PBS A;  1VQQ A;  4S2O A;  3E2K A;  3DWZ A;  4KZB A;  3GV9 A;  2L0W A;  4NXB A;  1YMS A;  1O7E A;  3C5A A;  4KZA A;  3NDE A;  3QP6 A;  2CMN A;  1L0G A;  3SZT A;  2HJE A;  4Y0T A;  1SDE A;  3JYI A;  4Y0O A;  2X02 A;  3CG5 A;  4ZTK A;  3A3F A;  3T1Q B;  4DF6 A;  3IHA A;  4IHQ A;  1GA9 A;  3BM6 A;  3ZG5 A;  4PPR A;  5G18 A;  1I5Q A;  4I5S A;  3HJI A;  3IHB A;  1FR6 A;  4DJ2 A;  1K38 A;  2XA7 M;  2WKQ A;  5DF7 A;  4NXG A;  1LSV A;  4WZ5 A;  1SKO B;  1ZKJ A;  4X69 A;  2WGV A;  3OPP A;  3EGX C;  3DWK A;  1RCJ A;  2GNX A;  3O3V A;  4KZ3 A;  3N4I A;  4UEY A;  3A3D A;  2C5W B;  3SH7 A;  2VJW A;  3TRC A;  4K0X A;  2HDR A;  4LRX C;  1IKI A;  2PT7 A;  2J3T D;  4LFU A;  2QWS A;  4MLL A;  5CTM A;  5J8X A;  3TE8 A;  4PM6 A;  1E3U A;  2PD8 A;  5F69 A;  2A24 B;  1S4S A;  2Y2G A;  3T4Q A;  4HH3 A;  2ZL1 B;  1ERM A;  4YFM A;  3MQQ A;  5E2H A;  2C6W B;  3WS5 A;  3MZD A;  4KG5 A;  4HH2 A;  2R78 A; 
#chains in the Genus database with same CATH homology
 5FQQ A;  3NC8 A;  3WS0 A;  4ZJ3 A;  2R9X A;  3P98 A;  4D2O A;  3UPP A;  2ZC6 B;  1YLP A;  2EXB A;  2H5S A;  2OSU A;  1YLZ A;  1ES3 A;  4U0X A;  5CER A;  2XFT A;  5BOH A;  2JE5 A;  1ZG6 A;  5GLD A;  3ISG A;  4OOM A;  2ZM8 A;  4OOL A;  3V39 A;  5FAO A;  1YLY A;  2V1Z A;  1L0F A;  4P85 A;  3RXW A;  4BD1 A;  1ES5 A;  1FOF A;  1XX2 A;  3B3X A;  4OP5 A;  4ZJ2 A;  3IXG A;  1S0W A;  2JBF A;  5HAI A;  4DE3 A;  4F94 A;  5FI6 A;  1LL5 A;  5GHY A;  4ZAM A;  3ZCZ A;  3BFE A;  3UE0 A;  3DW0 A;  3ZVW A;  5FAT A;  3O87 A;  2IWB A;  4DKI A;  3OPL A;  3W4O A;  1NYM A;  4HES A;  4EQI A;  2WGW A;  5F1F A;  4BQM A;  2HPB A;  4PM8 A;  1CEF A;  4Z9Q A;  3SS4 A;  4MNR A;  2JC7 A;  1H8Z A;  1MWU A;  3BYD A;  4S2L A;  1YQS A;  3CMZ A;  5E2G A;  5GLC A;  5JYP A;  5FAQ A;  5U47 A;  5FI2 A;  2EX8 A;  1NJ4 A;  3CZD A;  4JPM A;  1BTL A;  5EE8 A;  5AQB A;  1YMX A;  5GL9 A;  2ZQ7 A;  4RYE A;  3OC2 A;  3SH9 A;  2ZC5 B;  3EQV A;  1LHY A;  2HDQ A;  4IED A;  4KZ7 A;  3Q07 A;  3ZDJ A;  2BG1 A;  1FR1 A;  2ZC4 B;  3A3I A;  5TFQ A;  3ZNT A;  1BSG A;  1C3B A;  2A49 A;  3NIA A;  3SS3 A;  3V50 A;  5L2F A;  3HLB A;  4EWF A;  4OPQ A;  1ES2 A;  4CPK A;  1K6R A;  5EVL A;  5CGS A;  3HBR A;  1BLP A;  5F83 A;  5EEC A;  3UE3 A;  2ZQA A;  5DVA A;  2PBY A;  4GKU A;  4E3L A;  2I72 A;  4O7D A;  3OPH A;  1MKI A;  1AXB A;  3MFD A;  4OPY A;  3Q1F A;  5FQJ A;  4KZ6 A;  4L0L A;  4EBP A;  1KE0 A;  2VGJ A;  4QY5 A;  2EX6 A;  4C6Y A;  4OVD A;  2Z2L B;  5FQM A;  5I94 A;  1IYQ A;  3SH8 A;  5CHM A;  1VM1 A;  3TOI A;  1N9B A;  3FWL A;  5CEB A;  1KE4 A;  4OPR A;  1O07 A;  3IXB A;  1CI9 A;  2WUQ A;  2HP6 A;  1XXM A;  3VP1 A;  2XF3 A;  5EPH A;  1ESU A;  4PM5 A;  3IT9 A;  4BL3 A;  3ZG7 B;  5GLB A;  1SCW A;  4P6B A;  1TDG A;  3CJM A;  4S2K A;  2GDN A;  3IWQ A;  2J9O A;  2R9W A;  2BLS A;  1K25 A;  1HZO A;  2Y55 A;  5CGW A;  4FSF A;  1SDN A;  2WKH A;  4LV0 A;  3HLG A;  4RA7 A;  2Y2M A;  1JWV A;  4OH0 A;  4M3K A;  4R1G A;  2HDS A;  3PBR A;  4GB7 A;  3V3S A;  1M40 A;  1IYO A;  1KGF A;  3A3J A;  1G6A A;  3BFF A;  3VFH A;  4JF4 A;  3W8K A;  2ZQC A;  4LV2 A;  3C7U A;  1NZO A;  3AGF A;  5F82 A;  1H5X A;  2Q9M A;  2XD5 A;  3HLE A;  3M6H A;  4BJP A;  4DXC A;  4QY6 A;  4XXR A;  2Y2Q A;  4JF5 A;  3MZF A;  3MXR A;  1N4O A;  5AQA A;  1NZU A;  5FAP A;  1HD8 A;  4UA9 A;  3VP2 A;  4N1H A;  4RX2 A;  5GHZ A;  1ONG A;  1JTG A;  2XEP A;  1FCO A;  4IVI A;  4KG6 A;  3PBQ A;  1S6R A;  5KSH A;  1WYC A;  5EUA A;  5FA7 A;  1U60 A;  2XR0 A;  3PTE A;  2RCX A;  3G30 A;  2EX2 A;  3ZG9 B;  4LV1 A;  3WS2 A;  4BEN A;  3UN7 A;  3MKE A;  4JBF A;  1XP4 A;  2WGW B;  5E2F A;  1Q2P A;  2QZ6 A;  4H8R A;  4P0M A;  2IWC A;  1XGJ A;  5TR7 A;  4KZ8 A;  3ZG0 A;  2P74 A;  4QJG A;  4QB8 A;  2VGK A;  2G2U A;  4PM7 A;  3GRJ A;  4IBX A;  4JXG A;  4R23 A;  3UPN A;  3HLW A;  2E8I A;  1TEM A;  2X01 A;  4E3N A;  4EBL A;  1PZO A;  3Q81 A;  3PBO A;  1FCM A;  3LO7 A;  4UHU A;  3UNW A;  1IEM A;  1YM1 A;  1PW8 A;  4GNU A;  2WZZ A;  5AQ7 A;  3N8S A;  4BD0 A;  1YLT A;  1J9M A;  3IQA A;  5EVI B;  4E3J A;  3IWI A;  3QNB A;  2Y91 A;  3AGD A;  2Z2M B;  3M2J A;  1K56 A;  5M1A A;  4ZBE A;  1KVL A;  5FQ9 A;  1G68 A;  4DE1 A;  3GVB A;  5EVI D;  1WYB A;  3MXS A;  1BLS A;  4OQ0 A;  2OLU A;  5A92 A;  4QHC A;  1BUL A;  5HFO A;  3WRT A;  1LI0 A;  3BFD A;  4WZ5 C;  3VMA A;  3VSK A;  2EXA A;  3NY4 A;  1K57 C;  3V5M A;  4JLF A;  3NDG A;  4NK3 A;  3GMW A;  4WEL A;  5E2E A;  2IWD A;  3HUO A;  4DXB A;  1FCN A;  4HEF A;  1Y54 A;  4R4S A;  2EFX A;  4KEN B;  1CI8 A;  3Q7V A;  4B88 A;  1YT4 A;  1K6S A;  3HL9 A;  4FH2 A;  5E43 A;  4N92 A;  4UAA A;  3IXH A;  1W8Q A;  5EVI A;  3VFF A;  3PAE A;  4N9L A;  2XQZ A;  3O86 A;  4E3K A;  5HAQ A;  1BUE A;  2WYX A;  4DDY A;  1M6K A;  3E2L A;  3VP4 A;  3WS4 A;  4DE2 A;  3VP0 A;  5HL1 A;  3IF5 A;  2Y2P A;  2ZMA A;  4E6W A;  5DTK A;  2Y2N A;  3IXD A;  4MEZ A;  4KZ4 A;  2J8Y A;  3IH8 A;  2H0Y A;  5FQK A;  1K54 C;  1K4F A;  1MY8 A;  1PWC A;  3N7W A;  4ZDX A;  3HLD A;  4WYY A;  1BLH A;  1W7F A;  4X6T A;  3N6I A;  1BLC A;  3FKV A;  2HP5 A;  3VOY A;  1QME A;  4R3J A;  1XGI A;  3N8R A;  3BRM A;  3O88 A;  2ZD8 A;  1EI5 A;  1NYY A;  3GTC A;  5KZH A;  2JCH A;  2QMI A;  1MWT A;  3ITA A;  1KE3 A;  4N1X A;  1FSW A;  1K55 C;  5FI7 A;  1FSY A;  4R3B A;  1W79 A;  4WEJ A;  4ZJ1 A;  2B5R A;  2Y2J A;  3D4F A;  1TDL A;  3ITB A;  4KZ5 A;  1ESI A;  4GD8 A;  3GQZ A;  1L0E A;  1MXO A;  2DRW A;  2UWX A;  5HAR A;  4HBU A;  3G31 A;  2PU2 A;  3I7J A;  4WMC D;  4RVA A;  3VP3 A;  3IH9 A;  4EBN A;  4DE0 A;  1OME A;  2WAE A;  1MPL A;  5EOO A;  2H10 A;  2P9V B;  3HUM A;  2Y59 A;  4PM9 A;  4X56 A;  4KQR A;  3EQU A;  4GN2 A;  4NET A;  1LI9 A;  4U3T A;  3S4X A;  1H8Y A;  2XLN A;  1KDS A;  1ZC2 A;  3BLM A;  3C7V A;  4JF6 A;  4K91 A;  2V2F F;  5HAP A;  1KVM A;  2XDM A;  4WMC A;  1YLW A;  4GZB A;  1ONH A;  1SKF A;  3NCK A;  3S22 A;  1ES4 A;  1ERQ A;  3LCE A;  4S2N C;  4QD4 A;  3ZVT A;  1MWS A;  4HBT A;  3C4O A;  4UA6 A;  5HX9 A;  4DDS A;  4ID4 A;  3BFG A;  4RX3 A;  4KG5 A;  3RXX A;  2EX9 A;  3WS1 A;  5A91 A;  3VOZ A;  4B4X A;  4B4Z A;  4E3M A;  2Y4A A;  3PBT A;  3UE1 A;  2V20 A;  1IEL A;  3WWX A;  1Q2Q A;  4JXW A;  4EV4 A;  3BEC A;  4JXS A;  2P9V A;  1RGZ A;  2DCF A;  3TG9 A;  4E3O A;  1SHV A;  2Q9N A;  2Y2H A;  4WZ4 A;  3ZHH A;  1DJB A;  1KGG A;  3C4P A;  3G2Z A;  3G2Y A;  1K54 A;  3G4P A;  4OLD A;  1K56 D;  1GCE A;  2OLV A;  3G34 A;  5CHU A;  4DRT A;  1IYP A;  1CK3 A;  5CHJ A;  4XUX A;  5CTN A;  1ZG4 A;  5KSC A;  2WKI A;  1PWD A;  2ZC7 A;  3GR2 A;  3LY4 A;  3W4Q A;  3IWO A;  3WRZ A;  3NBL A;  2X71 A;  3MKF A;  2ZJ9 A;  2ZQD A;  3PAG A;  3M6B A;  1PZP A;  5CXW A;  2ZQ9 A;  3GSG A;  3Q7V B;  4IBR A;  3QNC A;  1IKG A;  2HP9 A;  4MBK A;  1JVJ A;  4Y0U A;  1K55 A;  4E3I A;  2XFS A;  5GHX A;  3UO9 A;  1MWR A;  1WE4 A;  1PW1 A;  1IYS A;  2Y2K A;  3HUN A;  4JXV A;  4OKP A;  4S2P A;  2XH9 A;  5EOE A;  1GA0 A;  2XD1 A;  4MBF A;  1I2S A;  5D3O A;  3LEZ A;  3NI9 A;  1DY6 A;  4WM9 A;  1CEG A;  1MBL A;  2Y2O A;  3RJU A;  3PBN A;  3IF6 C;  4X68 A;  1RP5 A;  3UY6 A;  5A93 A;  1PI4 A;  2OV5 A;  4C75 A;  3FYZ A;  3G35 A;  3M2K A;  1W8Y A;  1GHI A;  4MBH A;  1NY0 A;  3VSL A;  4XUZ A;  1KGE A;  1PWG A;  4U0T A;  3A3E A;  4OPZ A;  4CJN A;  2J7V A;  5JYO A;  4OON A;  5KMW A;  1RGY A;  4KQO A;  3HRE A;  4YIN A;  2HDU A;  2XGN A;  4R4R A;  5IHV A;  1L0D A;  5CED A;  2Y2L A;  1NRF A;  4GDN A;  4S2N A;  1HTZ A;  1XA7 A;  3ZG8 B;  2WAD A;  3HLC A;  4IVK A;  3PBS A;  3G32 A;  4OQH A;  3Q7Z A;  1VQQ A;  3P09 A;  4S2J A;  3E2K A;  4S2O A;  3DWZ A;  4KZB A;  2RL3 A;  5FAS A;  3HLF A;  3GV9 A;  1ERO A;  2H0T A;  3MZE A;  4LCL A;  4OQG A;  1YMS A;  1O7E A;  3AGE A;  3QHY A;  5HW3 A;  3C5A A;  4KZA A;  4P87 A;  2WK0 A;  3UDF A;  3HVF A;  2EFU A;  5DTT A;  3NDE A;  3OCL A;  2ZLY A;  1L0G A;  4A5R A;  5CEC A;  4K0W A;  4Y0T A;  1SDE A;  3JYI A;  1QMF A;  1L2S A;  5A90 A;  4S2M A;  4Y0O A;  1JWZ A;  2X02 A;  4X53 A;  5GLA A;  5F1G A;  3IF6 B;  3BLS A;  3BFC A;  1BZA A;  3CG5 A;  4ZTK A;  3A3F A;  4C3Q A;  3UDX A;  1XPB A;  4DF6 A;  2WAF A;  5TGF A;  1E25 A;  1PI5 A;  4LV3 A;  3IHA A;  5DF9 A;  3W4P A;  2G2W A;  1GA9 A;  1I2W A;  5M19 A;  3BM6 A;  1Z6F A;  3ZG5 A;  4GD6 A;  4PPR A;  5G18 A;  3BEB A;  1I5Q A;  2Y2I A;  4GDB A;  1PYY A;  2CC1 A;  5M18 A;  1FQG A;  2XK1 A;  3IHB A;  1KDW A;  3OCN A;  4OOY A;  4KG2 A;  4PMA A;  4JKT A;  3UDI A;  1FR6 A;  1LLB A;  5FSR A;  4OQI A;  1K38 A;  2FFY A;  3V3R A;  5DTS A;  1TVF A;  1W5D A;  2ZC3 B;  4UA7 A;  4OP8 A;  5DF7 A;  4X55 A;  1HVB A;  1DJA A;  3FV7 A;  3LY3 A;  3N8L A;  1GHM A;  3IF6 A;  4BLM A;  1DJC A;  4N9K A;  4WZ5 A;  1ZKJ A;  1ALQ A;  5AQ9 A;  1K57 A;  3OZH A;  4KZ9 A;  4X69 A;  2WGV A;  3OPP A;  1EWZ A;  3DWK A;  3FZC A;  3Q82 A;  1GHP A;  1RCJ A;  4FH4 A;  3ZGA B;  3O3V A;  4KZ3 A;  2DNS A;  1JTD A;  1PIO A;  3N4I A;  1E3U D;  1NXY A;  4KQQ A;  2QPN A;  3SS5 A;  4WEK A;  3A3D A;  2C5W B;  3SH7 A;  1XA1 A;  4K0X A;  5DF8 A;  2HDR A;  1YLJ A;  2ZQ8 A;  5CGX A;  3ZNY A;  4S2I A;  1IKI A;  5FQI A;  4QU3 A;  2J9P A;  4WBG A;  2WGI A;  2ZM2 A;  4EUZ A;  3S1Y A;  2PU4 A;  4Y7P A;  3DTM A;  5CRF A;  4E6X A;  4MLL A;  4R0Q A;  2A3U A;  4FD8 A;  1LL9 A;  4Q8I A;  2ZM0 A;  5CTM A;  5EVI C;  2WZX A;  5J8X A;  4PM6 A;  4LCM A;  3SOI A;  1K4E A;  4BL2 A;  3FKW A;  1BT5 A;  1E4D A;  1E3U A;  4LEN A;  3UPO A;  3ZFZ A;  2WKE A;  2Y2G A;  4OLG A;  1ERM A;  4GOG A;  2FFF B;  1JWP A;  4YFM A;  5E2H A;  2C6W B;  3WS5 A;  3TSG A;  1XKZ A;  3MZD A;  4FCF A;  3MBZ A;  5FDH A;  3OPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...