4DE0A

Ctx-m-9 class a beta-lactamase complexed with compound 16
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
263
structure length
263
Chain Sequence
ETSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase
publication title Structure-Based Design of Potent and Ligand-Efficient Inhibitors of CTX-M Class A Beta-Lactamase
pubmed doi rcsb
source organism Escherichia coli
total genus 94
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4de0A00
1MPLA 2Y55A 1K56D 3G4PA 2ZJ9A 4EWFA 3A3DA 5GL9A 4E3LA 2OLUA 2Y2OA 1M6KA 1JTGA 4FH2A 1W79A 3Q07A 4DE0A 4BD1A 3PBSA 3AGFA 3PBQA 2A49A 4Y0TA 3MKEA 1I2SA 3HLDA 3E2LA 3IWOA 4P85A 2OV5A 3MZEA 1LHYA 3G2ZA 1JWVA 3NI9A 3S22A 3BFCA 4S2MA 1VQQA 4S2OA 5E2HA 1JWZA 4MEZA 1ZC2A 1SDEA 2WGIA 2Z2MB 1XXMA 5A91A 3ZHHA 3VSKA 1IYPA 4EQIA 2ZQDA 3UDFA 3UPOA 1DJCA 2XLNA 4D2OA 4BLMA 1LL5A 3MXRA 1YMSA 1FSWA 5CHJA 2IWCA 1K54C 3VMAA 4C3QA 1WE4A 3BLMA 3HREA 3UE0A 1MXOA 3UPNA 2JBFA 4Z9QA 1RP5A 3DWKA 2HDRA 1GHMA 1TDGA 1FR1A 1PWCA 2ZMAA 2XF3A 2RL3A 4NK3A 1ZKJA 4OQIA 3GV9A 2IWDA 4E3IA 1CEGA 1WYBA 4S2IA 1ONHA 2XD5A 4GN2A 5FQIA 1ERMA 2J8YA 2PU4A 3S4XA 3C7UA 4JF4A 4IEDA 2JC7A 1HVBA 1NZUA 2R9WA 1BLHA 3ITAA 4B88A 5EE8A 2Z2LB 2ZQ9A 4Y7PA 2OSUA 1KDWA 3HUMA 4KZ5A 1E3UD 3MXSA 2E8IA 4DF6A 3HLFA 3UY6A 3OPLA 4WYYA 5DF9A 1EI5A 1IEMA 4P6BA 5KSCA 5KSHA 1DJBA 3BEBA 3C5AA 4HEFA 3C4OA 5CTNA 1NZOA 1VM1A 4KZ4A 4OQHA 1DJAA 3NC8A 3SH9A 4KZ7A 4MBKA 1FOFA 3LY3A 3I7JA 1KDSA 2WGWA 1S6RA 3C7VA 3VP4A 5KMWA 1BLSA 4MLLA 5GHYA 2B5RA 2QPNA 1PW1A 1O07A 4S2NC 4UA6A 5FI7A 5HARA 5HW3A 5FQQA 2XQZA 2H0TA 3P09A 2XR0A 3AGDA 3N8RA 3FKWA 3Q81A 1BTLA 5FASA 1AXBA 4OPQA 4R4SA 5EVIC 1BT5A 2I72A 3IHAA 3RJUA 1L0EA 1BLPA 2Y2PA 5FQ9A 1ALQA 1EROA 2EX2A 3N8SA 4JPMA 4ZJ3A 3B3XA 3S1YA 3M2JA 4MBFA 4WZ5A 2EX6A 1K6RA 3BYDA 5DF7A 4LV3A 1GA9A 3HVFA 3A3IA 1LI0A 1MWUA 1G68A 1XA7A 3ZGAB 5JYOA 1H5XA 3Q1FA 2XK1A 1K57A 2ZD8A 4IVKA 4K0XA 5IHVA 4LCMA 3FV7A 1PZPA 3IXGA 3V5MA 1ES3A 1GCEA 3BLSA 4FCFA 3HLBA 4OPRA 5TFQA 2IWBA 5I94A 4K91A 1BULA 4N92A 4ZDXA 2QMIA 3Q7ZA 1RGZA 3RXWA 3ZG5A 1PW8A 1ES2A 1FR6A 2HP6A 2X71A 2Y2LA 4LV1A 4X53A 3MZFA 4BD0A 2VGJA 5GLDA 3P98A 3AGEA 3UNWA 4JKTA 4ZJ1A 2ZC3B 1ONGA 1K25A 3UN7A 1KE0A 3TG9A 1RGYA 4XUZA 4JXGA 1E25A 2Y4AA 5EVIB 3ISGA 3HL9A 3IHBA 3BFEA 3VSLA 2Y2IA 3NCKA 3W8KA 3HLEA 2X01A 1ZG4A 2WZXA 2WZZA 1CEFA 3IH9A 1I2WA 2JE5A 1CI9A 4ZAMA 1KE3A 3IF6A 4BENA 1PI4A 2ZQ7A 4IBXA 2ZQAA 4JXVA 3O88A 2J9PA 1KVMA 1IKGA 4N9LA 1KGGA 3IWIA 4RX3A 4Y0OA 3M6BA 5CTMA 3IXBA 2ZLYA 5EPHA 1ESIA 5DF8A 4CPKA 4MNRA 3Q7VA 1SKFA 4BQMA 1SCWA 1IYOA 1K56A 3ZVWA 4M3KA 4X56A 1YLJA 4PMAA 2HDUA 5HAIA 3G30A 4FH4A 5E2FA 3BM6A 3E2KA 3WS1A 5CERA 3CZDA 5GLAA 1FQGA 3UE1A 2J7VA 2Y2KA 4ZJ2A 5E2GA 4EBPA 1ESUA 3Q82A 4KZ3A 5U47A 1HTZA 2DRWA 4PM5A 2Q9NA 3IXDA 3OCLA 1GA0A 4S2JA 5CGXA 1YMXA 2C5WB 1DY6A 3IWQA 3N8LA 4GDNA 3N6IA 1EWZA 2P9VA 2Y2NA 4RVAA 4U0XA 4EUZA 1E4DA 4XXRA 4E3JA 2Y91A 4N1XA 2PU2A 4QU3A 1MWTA 4HESA 3BFGA 2C6WB 1FCNA 3D4FA 4JF6A 1N9BA 1H8ZA 4UA9A 4OOYA 5EVID 2EXBA 3ZDJA 4C75A 1PYYA 3BFDA 4GDBA 5L2FA 1ES4A 3JYIA 2WK0A 3GTCA 4KZBA 1W8YA 3V50A 4P0MA 3DW0A 3HBRA 4FD8A 3GRJA 3SS4A 2WKIA 2WUQA 5A93A 1ES5A 2R9XA 4OONA 1K38A 4KZAA 4WEKA 5EOEA 4LCLA 3IXHA 3OPHA 3A3FA 1JTDA 4IBRA 1SDNA 4KQRA 5F83A 5A90A 3V3SA 4DXCA 2HPBA 1H8YA 2XH9A 4X6TA 1YQSA 1FSYA 3LY4A 2WGVA 1YLYA 3MZDA 1HZOA 4R1GA 5FQMA 1E3UA 1CK3A 2A3UA 3MFDA 3IH8A 3IQAA 3W4QA 5HL1A 4UHUA 2EX8A 4KZ9A 1Q2PA 4JLFA 4E6WA 4WMCD 4CJNA 5JYPA 3ZG0A 3MKFA 4HBTA 4RA7A 3ZG8B 3VOYA 4DE1A 2EXAA 4ZBEA 3G31A 2V1ZA 4BL3A 4X68A 1PZOA 3HLGA 3OC2A 5BOHA 2FFYA 5E2EA 1M40A 1K6SA 1QMFA 1YLWA 4PPRA 3Q7VB 4RYEA 5HFOA 1XP4A 5CEBA 5TGFA 1YM1A 1XKZA 1Y54A 2V2FF 3BFFA 1KVLA 1PI5A 3EQVA 4R0QA 5HAQA 4ID4A 1S0WA 2UWXA 5FI2A 2WKHA 2WAFA 2G2WA 1TDLA 3NIAA 2Y2JA 5GHXA 2ZC6B 3QHYA 4A5RA 2BLSA 4U3TA 4IVIA 5FA7A 1XGJA 3OCNA 3SS3A 5CGSA 4OPYA 1MWRA 3VFHA 2P9VB 4E3NA 3HUNA 1XPBA 2EX9A 4OP5A 1W5DA 3WRTA 4KG5A 4OP8A 2HDQA 1KGEA 1BSGA 3OZHA 3GQZA 5AQ9A 1LL9A 2ZQCA 2WAEA 4NETA 1L0FA 4L0LA 4WZ4A 1IYSA 3FWLA 4PM7A 3ZNYA 2CC1A 5EECA 4DKIA 4QB8A 3UO9A 3LO7A 4DRTA 1FCOA 5EUAA 5M18A 4E3MA 5HAPA 3HLCA 4UAAA 4E6XA 4LV2A 4H8RA 4KQQA 3PAGA 4WZ5C 4P87A 4X69A 3G35A 3RXXA 1G6AA 3DTMA 4B4XA 1NYMA 1LLBA 4QY6A 3NDEA 3UE3A 2V20A 1NYYA 2JCHA 1K57C 5F1GA 4BL2A 1KGFA 3SOIA 2H10A 1K54A 4R23A 4GZBA 1IYQA 2BG1A 5EOOA 4EBLA 5DVAA 3ITBA 2P74A 5FI6A 4N9KA 3LCEA 4OLGA 4QY5A 5KZHA 4GB7A 3ZNTA 5AQAA 5A92A 3ZG7B 4GKUA 3WS5A 4S2KA 1IELA 2ZM8A 1IKIA 1GHIA 3O87A 4DDYA 2WGWB 4ZTKA 1K4EA 1TEMA 1BLCA 4WM9A 5EVLA 4LV0A 3VP3A 1XX2A 2ZC5B 1HD8A 1LI9A 5CXWA 5J8XA 1ZG6A 2EFUA 4KZ6A 3SH7A 5AQBA 3W4OA 2Y2GA 1XA1A 2HP9A 5DTSA 2G2UA 4S2PA 4WBGA 3V3RA 1MBLA 1PIOA 3TSGA 1U60A 1PWGA 2Y2QA 4QHCA 3PAEA 3PBTA 4DDSA 5CECA 3A3JA 2GDNA 4OH0A 3HUOA 4XUXA 2X02A 5CRFA 3IF6C 1I5QA 1JVJA 1N4OA 2ZQ8A 3M6HA 4R3JA 5FDHA 5FQKA 3WS2A 3ZCZA 3V39A 3N4IA 5FQJA 2EFXA 1JWPA 3NDGA 5GLBA 4B4ZA 4OPZA 1C3BA 4K0WA 4RX2A 5CHUA 1YLTA 5G18A 3TOIA 4OVDA 3WS4A 1BZAA 4S2NA 3UDXA 3OPRA 4GNUA 3VP2A 3G2YA 3VFFA 3C4PA 2H5SA 4OOLA 3HLWA 3VOZA 3NY4A 2XFSA 2ZC7A 5EVIA 5FAQA 1L2SA 1MWSA 3FZCA 1L0DA 5AQ7A 3OPPA 4MBHA 4JXWA 5M1AA 3G34A 2H0YA 2Y59A 2ZC4B 3WWXA 3PTEA 1MKIA 4WELA 3GR2A 4JXSA 2VGKA 3CG5A 4E3OA 3ZVTA 4OKPA 1SHVA 3GMWA 2QZ6A 3M2KA 4LENA 4C6YA 2XGNA 3O3VA 4EV4A 4QD4A 3BRMA 2PBYA 5GHZA 4YFMA 3CMZA 1Z6FA 3IT9A 3G32A 3LEZA 5DTTA 2RCXA 4QJGA 3UDIA 3IF6B 1RCJA 4GD6A 2Q9MA 3FYZA 3PBRA 3W4PA 3BECA 4DE3A 3VP1A 3SS5A 5CGWA 4JF5A 4PM8A 2XFTA 2XDMA 3VP0A 4WMCA 1GHPA 2ZM2A 4DXBA 4KQOA 1BUEA 1FCMA 5HX9A 4R4RA 2WADA 1TVFA 1ERQA 2WYXA 1XGIA 2Y2HA 4OQGA 3FKVA 1NJ4A 4KENB 5FAOA 5CEDA 1K55A 4X55A 1J9MA 2J9OA 5E43A 4JBFA 5FATA 4KZ8A 3QNCA 3DWZA 5DTKA 4S2LA 4EBNA 1PWDA 4KG2A 4WEJA 4KG6A 5GLCA 4O7DA 4OOMA 1W7FA 5F82A 2Y2MA 1CI8A 4OLDA 4DE2A 3PBOA 1NY0A 2XD1A 3UPPA 1L0GA 4PM6A 1MY8A 5FAPA 4HBUA 4F94A 1QMEA 1K4FA 3WRZA 1W8QA 2DNSA 5FSRA 2HDSA 4E3KA 3SH8A 2OLVA 1KE4A 3IF5A 4UA7A 2XEPA 4GOGA 3CJMA 3PBNA 1OMEA 3GSGA 2DCFA 1Q2QA 2ZM0A 1YT4A 3ZG9B 5F1FA 1NRFA 4N1HA 1YLPA 3GVBA 4R3BA 4U0TA 3WS0A 4BJPA 3N7WA 3QNBA 3NBLA 3MBZA 4GD8A 4OQ0A 4YINA 3ZFZA 2HP5A 5TR7A 4Y0UA 3EQUA 4PM9A 5CHMA 2WKEA 1YLZA 4Q8IA 5D3OA 5M19A 1NXYA 1O7EA 3A3EA 1K55C 2FFFB 1WYCA 4FSFA 3O86A
chains in the Genus database with same CATH superfamily
2Y55A 3G4PA 2ZJ9A 2OLUA 4LFUA 1JTGA 4DE0A 3PBQA 3MKEA 3BQ8A 3IWOA 4P85A 3T1XA 3MZEA 2W3EA 3S22A 1PFLA 4S2OA 2Y79A 2Z2MB 4L9FA 3IX8A 3R7WB 3VSKA 3U4LP 3CUEA 1Y4OA 4BLMA 5CHJA 2IWCA 4Y17A 3VMAA 5DJUA 5HL6A 3BLMA 1BYWA 2W1TA 2JBFA 4NXFA 2HDRA 1GHMA 1TDGA 2INWA 2RL3A 2J80A 3QP4A 3GV9A 2IWDA 2J8YA 3DBAA 3C7UA 1HVBA 2JKTI 4HP9A 4B88A 4R38A 4Y7PA 3HLFA 5CTNA 1DJBA 3C5AA 1NZOA 1DJAA 1T1AA 3NC8A 5HDSA 3LY3A 3I7JA 1YPRA 1KOUA 1OTDA 1PW1A 1OTIA 2H0TA 3CLOA 3AGDA 3N8RA 2I72A 3RJUA 3N8SA 2OWJA 4IJGA 2EX6A 1GA9A 3HVFA 3A3IA 1MWUA 5JYOA 2I9VA 3FV7A 1W63Q 1PZPA 4FCFA 2IWBA 4DJ3A 2J3WA 4N92A 4ZDXA 4HP4A 1RGZA 1LSXA 1ES2A 4BD0A 3BWLA 3P98A 4QPRA 4LLOB 2W3DA 1KE0A 3TG9A 4P6ZS 3D72A 3A0RA 3IHBA 3L7HA 3HLEA 3EGXC 2X01A 4DJ2A 1I2WA 2JE5A 2M7VA 4Y2FA 5HWTA 1KE3A 3IF6A 3F1PB 5HDDA 2ZQAA 2J9PA 3BY8A 3IXBA 2ZLYA 2PAVP 5CTMA 1TF1A 3U2AA 2HJ9C 4PMAA 4FH4A 3E2KA 2OWHA 3OLOA 5U47A 4PM5A 2DRWA 3OCLA 3GDIA 3LGOA 3MQQA 3IWQA 1DY6A 3HJKA 3JVVA 2P9VA 2ZL1B 3H9WA 1E4DA 1LSWA 4N1XA 2PU2A 4QU3A 4HESA 3K2NA 1H8ZA 4UA9A 5G4ZA 4ETZA 3LYXA 1X0OA 4GDBA 2O0YA 4KZBA 2D01A 3RTYA 2M1CA 1ES5A 4LRZE 5F6AA 4WEKA 3IXHA 3OPHA 1JTDA 5HSQA 1SDNA 4DXCA 2HPBA 2VA0A 4QWOA 2WGVA 1E3UA 3W4QA 2QKPA 4WMCD 4O8GA 2VV6A 4RA7A 3ULFA 4R70A 4ZBEA 2V1ZA 4MDZA 3GECA 4X68A 3HLGA 4YNRA 1YLWA 5CEBA 5HFOA 1YM1A 1PI5A 4UEYA 2G2WA 1TDLA 2WKRA 3NIAA 5GHXA 4A5RA 4IVIA 5CGSA 4OPYA 1MWRA 2P9VB 2V9AA 3HUNA 1XPBA 1W5DA 4KG5A 4FTXA 4OP8A 1LL9A 4NETA 1L0FA 1T1BA 4F3LB 3S7QA 1CQAA 2B18A 4DRTA 5EUAA 5M18A 4E6XA 5IU1A 4KQQA 3PAGA 3DTMA 1NYMA 5I5LA 1LLBA 2MJ6A 3OOVA 5F1GA 4GLQA 1G6OA 4G3WA 3ITBA 5KZHA 4L9EA 4QY5A 2PYRA 1S67L 3IX4A 4WM9A 5G4YA 2ZMVA 1ZG6A 3UB6A 3QP6A 3UMDA 2Y2GA 1XA1A 2HP9A 3CI6A 1MBLA 3TW8A 2VK3A 3TSGA 5HPIA 4QHCA 3MMHA 3O5YA 3LUQA 2PR6A 5CRFA 1JVJA 5FDHA 3PYPA 4B4ZA 2LB9A 4K0WA 1BZAA 2KDKA 3VFFA 4EEUA 3TRCA 3VOZA 3E98A 2XFSA 4HI4A 1UWPX 3LR3A 3PR6A 3VOLA 1SKOA 4WELA 4LGWA 3KSFA 3GMWA 2WKQA 3O3VA 3BRMA 2PBYA 1XJ6A 1Z6FA 5TBMA 3P01A 3FYZA 2H28A 3PBRA 3W4PA 2WKPA 4LPZA 1MZUA 2XFTA 2A24B 2ZM2A 4DXBA 2VEAA 1BUEA 5HX9A 2WADA 1TVFA 1ERQA 4HH3A 1NWZA 4EETB 4X25A 1K55A 2K2NA 3QP5A 5DTKA 2QWSA 3CAXA 4MN6A 1XJ4A 5GLCA 5DJTA 1P9RA 3PBOA 3UPPA 2JKRI 1L0GA 1OT6A 1QMEA 2AVXA 5FSRA 1KE4A 3IF5A 4UA7A 4HOIA 3CJMA 3SW1A 3T4TA 5F1FA 3WS0A 1T18A 2W0NA 3NBLA 1VETA 2HP5A 4R6LA 3EQUA 3LEQA 5F69A 5CHMA 3TE8A 2WKEA 4HJ3A 5M19A 2VGLS 3C38A 3FKVA 1K55C 2FFFB 2ZOIA 1WYCA 3O86A 2P7JA 1D1JA 1MPLA 4EWFA 4E3LA 4FH2A 3FPWA 4EERA 4BD1A 3T4SA 3PBSA 3UB8A 4II7A 2E8JA 1LHYA 1DRMA 3BFCA 1XJ2A 4HY8A 1TS8A 1IYPA 4EQIA 4P6ZM 3UDFA 3MXQA 2XLNA 5FEGA 3MXRA 2Z6DA 3MSHA 3LR5A 1K54C 3HREA 4I5SA 4PHTA 1PWCA 2XA7S 1OTEA 2QYBA 3HCYA 4GHIB 1ZKJA 3NOPC 4DN0A 1CEGA 1WYBA 1ONHA 2XD5A 4I3AA 5FQIA 3S4XA 1NRJA 1NLYA 2R78A 4IEDA 2ZQ9A 1KDWA 4KZ5A 4DF6A 1E3UD 2E8IA 3H82B 3OPLA 5KSCA 1IEMA 1WA9A 3BEBA 4KZ4A 4OQHA 3SH9A 4KZ7A 4WL9A 1FOFA 1XJ3A 3C7VA 1S6RA 4BBUA 2B5RA 2CMNA 2QPNA 2VV8A 4UA6A 3VE4A 4S2NC 5HW3A 1T19A 2V1AA 5FQQA 3P09A 2XR0A 4EESA 4ESPA 5FQ9A 2Y2PA 4WZ5A 4GJ4A 5CX7A 5DF7A 4Q0IA 4LV3A 1LI0A 1G68A 3ZGAB 2XK1A 4ARZA 1K57A 3T4LA 3NECA 3IS2B 2A2LA 3V5MA 1GCEA 2V0WA 2Y8HA 2HGVA 5I94A 4K91A 2QMIA 3LIBA 3RXWA 3FC7A 2X71A 2VGJA 5GLDA 3SZTA 5F5YA 2HJEA 1K25A 4XUZA 3LIDA 3ISGA 3HL9A 2Y2IA 5C5KA 2Q0OA 1ZG4A 3LFVA 4M4XA 2W3FA 5EV0A 4KQDA 4BENA 4IBXA 4JGOA 4JXVA 1KVMA 1IKGA 3IWIA 2O9BA 5J4EA 1ESIA 4MNRA 1SKFA 2VKSA 1SCWA 4M3KA 1YLJA 5HAIA 2PD7A 2K7SA 2EWWA 3WS1A 3UE1A 5E2GA 3Q82A 3H7WB 2C5WB 3IX3A 4BBVA 4EUZA 4GS9A 3E0YA 4XXRA 4E3JA 3OBFA 2Y91A 2JKTM 2KLIA 1MWTA 2C6WB 4Y15A 4OOYA 4ARZB 1PYYA 5L2FA 3R4KA 1ZHHB 3JYIA 4CLCA 2L1MA 3DW0A 3SS4A 5EOEA 1N9NA 1H3QA 4KQRA 3V3SA 3CUEC 1S66L 2XH9A 4BBTA 3UMEA 3DTIA 3MZDA 1YLYA 2A3UA 1DP8A 3IQAA 4UHUA 3TJZC 4E6WA 4CJNA 5JYPA 3ZG0A 2W1RA 3ZG8B 2ZOHA 3G31A 4BL3A 5J7EA 5E2EA 1M40A 2FH5A 1XP4A 4B9OA 5TGFA 1Y54A 3BFFA 5HAQA 1KVLA 4R0QA 3B33A 1HLUP 4O0PA 3FG8A 2Y2JA 1XFNA 2ZC6B 5L10A 2BLSA 2VV7A 1XGJA 3SS3A 3VFHA 4E3NA 2EX9A 4JGQA 3S7NA 1YSQA 5AQ9A 2W1TB 4WZ4A 2KX6A 5EECA 4DKIA 3LO7A 3DAVA 3V67A 5HWVA 4P87A 4X69A 4B4XA 3NDEA 5HPFA 4BL2A 1GSWA 3EEAA 1KGFA 3SOIA 4MCWA 2H10A 4R23A 4GZBA 2BG1A 5DVAA 5FI6A 1OTBA 2GNXA 2OAQ1 4OLGA 3C8CA 4GB7A 3ZNTA 5A92A 3WS5A 4S2KA 1IELA 3O87A 1K4EA 2W3HA 5EVLA 5CXWA 1HD8A 5J8XA 2VLGA 2HF6A 2EFUA 5FEFA 5AQBA 2PT7A 5DTSA 1H0MA 4S2PA 3V3RA 1PIOA 1U60A 1OPXA 5CECA 3A3JA 4EU0A 3DTKA 4OH0A 3IF6C 1I5QA 2VGLM 3N4IA 5FQJA 5GLBA 2UV0E 4OPZA 1YLTA 5G18A 3T1RA 4Y3IA 3OPRA 4GNUA 3EEHA 3C4PA 1F9IA 3PHYA 3UB9A 5EVIA 5L09A 1MWSA 5AQ7A 2O99A 4JXWA 2H0YA 2Y59A 3L9KA 3KYQA 3M2KA 4LENA 4C6YA 4NKPA 3MF0A 2YKHA 5DTTA 3F1NA 3KX0X 2RCXA 4BWIA 4QJGA 3UDIA 3IF6B 2QJ5A 3BECA 4PM8A 4H6JA 4GCZA 1FILA 2XA7M 2WYXA 1XGIA 4KENB 4B93A 4X55A 1S1ZA 2J9OA 5E43A 4KZ8A 3QNCA 3DWZA 2D02A 1YKDA 5AJGA 4KG6A 5F82A 3CPTA 4OLDA 4DE2A 2VJWA 4NXBA 4HBUA 4PAUA 3WRZA 2VZWA 1W8QA 2OAP1 3LI9A 3PXPA 4D60A 1OMEA 3GSGA 2ZMFA 4MN7A 4U0TA 4BJPA 3QNBA 3MBZA 4OQ0A 1A0KA 4YINA 4LRYC 3F1OA 3IBRA 3K3CA 2BTFP 2L4RA 3A3DA 2Y2OA 1Z09A 4DMZA 1W79A 1MKMA 3Q07A 3T1SA 3UB5P 2A49A 3HLDA 3E2LA 2OV5A 3G2ZA 1JWVA 3NI9A 5E2HA 1JWZA 1SDEA 2WGIA 3ZHHA 5EM1A 4XT2A 3IBJA 1DJCA 4IHQA 4FOFA 4D2OA 1LL5A 1YMSA 4C3QA 1WE4A 3UE0A 2PR5A 4CLCD 3UPNA 3KSIA 4PKYG 4ME4A 1D7EA 1FR1A 4Q0HA 2ZMAA 2XF3A 4NK3A 2OOLA 4OQIA 4E3IA 2PU4A 3KO6A 2JC7A 3ITAA 1NZUA 1BLHA 1T1CA 5EE8A 2Z2LB 1VEUA 2OSUA 3KSHA 3HUMA 1OTAA 2G7UA 3RFBA 4WYYA 4X1LA 1EI5A 4P6BA 3C4OA 3QP8A 4CLCE 1VM1A 1NLZA 4MBKA 3A0SA 2WGWA 4MLLA 5GHYA 3F1OB 4EQ1A 3T4QA 3B47A 2HZ5A 3E4PA 1P9WA 5FASA 5HWWA 3IHAA 1L0EA 1BLPA 2B02A 3S1YA 2EX2A 1EROA 4ZJ3A 4NXEA 2VX8A 1DP9A 3M2JA 4MBFA 3BYDA 3E4OA 2QHKA 2PRFA 2ZD8A 4IVKA 5KIZA 1TS7A 5IHVA 3T4JA 1TD5A 3NULA 3S7PA 4WUJA 1ES3A 3BLSA 1IOUA 4I38A 1BULA 1PW8A 1FR6A 2HP6A 4LV1A 4X53A 3JVUA 3NHQA 3UNWA 1ONGA 1G5UA 4WF0A 1RGYA 1LSVA 5AVFA 3E4QA 3C2WA 3BFEA 2W27A 4UQIS 2PBDP 5EVEA 2WZXA 2WZZA 1CEFA 1SKOB 1UGUA 4N9LA 1VEUB 4RX3A 4Y0OA 3M6BA 3T1QB 2J3TD 4CPKA 5TBMB 1K56A 3MQ0A 4X56A 3G30A 5E2FA 1FQGA 2Y2KA 4EBPA 4KZ3A 1HTZA 4S2JA 3IXDA 1STZA 3N8LA 1EWZA 4RVAA 4U0XA 1FIKA 2XSSA 3MFXA 2HV1A 1FCNA 3D4FA 5EVID 2EXBA 4C75A 1ES4A 2L0WA 2V1BA 3GTCA 4AFIA 4ETXA 1V9YA 3HBRA 4FD8A 2XROA 2WUQA 5A93A 4OONA 1PRQA 1K38A 4KZAA 4LCLA 1F98A 2JKGA 3A3FA 1V9ZA 1VETB 1YQSA 3P7NA 5FQMA 1HZOA 1TS6A 3MFDA 3CHWP 2YKFA 2EX8A 4KZ9A 4X1MA 3MKFA 3ICYA 4HBTA 4EXOA 3VOYA 2EXAA 1PZOA 3OC2A 1QMFA 4RYEA 1XKZA 4JGPA 3MR0A 1S0WA 2UWXA 2WKHA 2WAFA 3BW6A 4U3TA 5FA7A 3D9YA 4I3IA 4OP5A 4KUKA 2HDQA 3OZHA 2ZQCA 2WAEA 3KYZA 1IYSA 3FWLA 3ZNYA 3UO9A 3EGDC 4HIAA 4E3MA 3HLCA 4UAAA 4WZ5C 3G35A 1G6AA 2EA9A 2V20A 1NYYA 2JCHA 1K57C 1VB6A 4R3AA 4L9GA 1IYQA 1ODVA 4HNBA 4EBLA 4N9KA 4EUVA 2ZBBA 3UE6A 3ZQ5A 5AQAA 3ZG7B 4GKUA 3LICA 1GHIA 1TEMA 1BLCA 1OT9A 4LV0A 1XX2A 2ZC5B 1LI9A 1L3LA 4KZ6A 3SH7A 3RH8B 3W4OA 4WBGA 1AWIA 2Y2QA 3PBTA 4DDSA 2GDNA 4R3JA 3WS2A 3V39A 5CHUA 4OVDA 3WS4A 1IFQA 3VP2A 3G2YA 2H5SA 4NEED 3BY9A 3NY4A 2ZC7A 1L2SA 3B42A 3OPPA 4MBHA 5M1AA 1OJGA 1Y28A 3LIEA 4JXSA 4E3OA 3F1PA 4OKPA 1P0ZA 4QD4A 2W3GA 4YFMA 3CMZA 3G32A 3LEZA 1ACFA 1RCJA 2Q9MA 3VV4A 4DE3A 3VP1A 4ZRRA 3SS5A 4JF5A 5EFWA 3VP0A 5A8BA 4CLCC 1GHPA 4KQOA 2Y2HA 5L07A 4OQGA 2ZL1A 5FAOA 5CEDA 5DFXA 4S2LA 4KG2A 1J3WA 4WLAA 1W7FA 2NUTC 3S7OA 2Y2MA 5FDSA 3MJQA 4GS9B 2XD1A 5FAPA 3T12B 1K4FA 1N9LA 2Z6CA 3EWKA 2HDSA 4E3KA 2OLVA 4YOFA 3PBNA 2DCFA 1Q2QA 2ZM0A 1YT4A 5IT5A 3GVBA 4CLCB 3N7WA 4GD8A 3ZFZA 5DFYA 5TR7A 4Y0UA 4Q8IA 2BASA 1O7EA 3A3EA 2IA2A 4NG2A 4FSFA 1S4SA 1K56D 5GL9A 1F2KA 1M6KA 3AGFA 1PNEA 4Y0TA 5MC7A 4Q0JA 1I2SA 3BJNA 4EEPA 2GJ3A 4IUHA 2FZ0A 4S2MA 1VQQA 4MEZA 1ZC2A 1XXMA 5A91A 2ZQDA 3KSGA 3UPOA 4MMNA 1CJFA 4UQIM 1FSWA 1MXOA 1F5MA 5L8MA 4E04A 4F3LA 1EW0A 2V8CA 4Z9QA 1RP5A 3DWKA 2J3TC 3T4OA 4S2IA 3ZYTA 4GN2A 3LIFA 3W2ZA 1ERMA 4JF4A 3C30A 2R9WA 3MXSA 3UY6A 2JHEA 5DF9A 5KSHA 4HEFA 4HQAA 5LBRA 1GSVA 1KDSA 3VP4A 5KMWA 1BLSA 5FI7A 1O07A 2QJ7A 5HARA 2XQZA 1MC0A 3FKWA 3Q81A 1BTLA 1DP6A 4CQHA 1AXBA 4OPQA 4R4SA 5EVIC 1BT5A 1ALQA 3JPUA 4JPMA 3B3XA 3DTEA 1K6RA 1S4RA 5FL3A 1XA7A 1H5XA 3Q1FA 4HJ4A 4K0XA 4LCMA 2JN7A 3BQAA 3IXGA 5TFQA 3HLBA 4OPRA 4NXGA 2PHYA 3Q7ZA 3ZG5A 1G28A 2Y2LA 3MZFA 4IUKA 3AGEA 4JKTA 4ZJ1A 3LR4A 2ZC3B 3UN7A 4HJ6A 4WN5A 2GZAA 4JXGA 1E25A 2Y4AA 5EVIB 3NOTC 3VSLA 5HDCA 3NCKA 4FUWA 5HD3A 3W8KA 3IH9A 3NJAA 1CI9A 1YSPA 4GW9A 4ZAMA 1PI4A 2ZQ7A 4BMWA 1JNUA 1VHMA 3O88A 1KGGA 4HHDA 2JKFA 1OJ5A 5EPHA 4Z1WA 5DF8A 2V0UA 3Q7VA 2A24A 4BQMA 1IYOA 3F1NB 3ZVWA 3LI8A 2LB5A 4I39A 2HDUA 5HZHA 3VE3A 3BM6A 5CERA 3CZDA 4H6JB 5GLAA 2J7VA 5EM0A 4ZJ2A 1ESUA 2Q9NA 1GA0A 5CGXA 1YMXA 4GDNA 4Y5FA 3N6IA 2Y2NA 3KYEA 2B95A 1P97A 3BFGA 1N9OA 1ZTUA 1N9BA 4JF6A 3CPTB 3ZDJA 3BFDA 1GSXA 2WK0A 1W8YA 3V50A 4P0MA 5IS1A 3GRJA 2WKIA 2R9XA 3LR0A 4I3JA 4YWZA 3QP1A 4IBRA 5TJJA 1D06A 5A90A 4K08A 1SZVA 1H8YA 3CWFA 4X6TA 1FSYA 3LY4A 2P08A 4R1GA 4RQ9A 1CK3A 3IH8A 5HL1A 1YAXA 1Q2PA 4JLFA 2JKRM 4DE1A 1S1YA 2NUPC 5BOHA 2FFYA 1K6SA 4PPRA 3Q7VB 4Y13A 4EW7A 2V2FF 3EQVA 2KOIA 4ID4A 4HH2A 5FI2A 5AVEA 4G3VA 4XT2B 2DMWA 2K31A 3QHYA 5K5BA 3CITA 3QP2A 3OCNA 2P04A 3WRTA 4GHIA 1KGEA 1BSGA 3GQZA 2PYPA 4L0LA 4PM7A 2CC1A 4QB8A 2ACGA 1FCOA 3H82A 5HAPA 4LV2A 4H8RA 2PDRA 2O9CA 3RXXA 4QY6A 1LL8A 1UWNX 3UE3A 3D3OA 5DKLA 1K54A 3MQOA 5EOOA 4LRXC 3T4KA 2P74A 1H8MA 3LCEA 3EOIA 2ZM8A 1IKIA 4DDYA 2WGWB 4ZTKA 3LIAA 5F68A 3VP3A 1TS0A 4MN5A 3K3DA 3T50A 2G2UA 3IS2A 1PWGA 3PAEA 3HJIA 3FPVA 3HUOA 4XUXA 2X02A 1N4OA 2ZQ8A 3M6HA 2EWVA 5FQKA 3ZCZA 2EFXA 1JWPA 3NDGA 1C3BA 3A0VA 4RX2A 4O01A 3TOIA 5HD5A 4S2NA 3UDXA 2XRNA 4OOLA 3HLWA 5FAQA 2PD8A 3FZCA 1L0DA 4PKYA 3G34A 2ZC4B 2GX5A 3WWXA 3PTEA 1MKIA 3GR2A 2VGKA 3CG5A 3ZVTA 1SHVA 3MS6A 1CF0A 2QZ6A 2XGNA 4EV4A 5GHZA 1K0KA 3IT9A 2O9AA 1XFQA 4GD6A 2M7UA 5CGWA 3R7WA 3NOUC 2XDMA 3UB7A 4WMCA 3H7WA 4JGRA 1FCMA 4R4RA 1NJ4A 5J3WA 1J9MA 4JBFA 5FATA 4EBNA 1PWDA 4WEJA 1W63M 3G6OA 4O7DA 4OOMA 1CI8A 1NY0A 4PM6A 1MY8A 4F94A 2DNSA 2V8FA 3SH8A 2XEPA 4GOGA 4G3KA 3ZG9B 1NRFA 4N1HA 1YLPA 4R3BA 4PM9A 1YLZA 5DKKA 5D3OA 1NXYA 1LT0A 4KUOA 5F83A
chains in the Genus database with same CATH topology
1MPLA 2Y55A 1K56D 3G4PA 2ZJ9A 4EWFA 3A3DA 5GL9A 4E3LA 2OLUA 2Y2OA 1M6KA 1JTGA 4FH2A 1W79A 3Q07A 4DE0A 4BD1A 3PBSA 3AGFA 3PBQA 2A49A 4Y0TA 3MKEA 1I2SA 3HLDA 3E2LA 3IWOA 4P85A 2OV5A 3MZEA 1LHYA 3G2ZA 1JWVA 3NI9A 3S22A 3BFCA 4S2MA 1VQQA 4S2OA 5E2HA 1JWZA 4MEZA 1ZC2A 1SDEA 2WGIA 2Z2MB 1XXMA 5A91A 3ZHHA 3VSKA 1IYPA 4EQIA 2ZQDA 3UDFA 3UPOA 1DJCA 2XLNA 4D2OA 4BLMA 1LL5A 3MXRA 1YMSA 1FSWA 5CHJA 2IWCA 1K54C 3VMAA 4C3QA 1WE4A 3BLMA 3HREA 3UE0A 1MXOA 3UPNA 2JBFA 4Z9QA 1RP5A 3DWKA 2HDRA 1GHMA 1TDGA 1FR1A 1PWCA 2ZMAA 2XF3A 2RL3A 4NK3A 1ZKJA 4OQIA 3GV9A 2IWDA 4E3IA 1CEGA 1WYBA 4S2IA 1ONHA 2XD5A 4GN2A 5FQIA 1ERMA 2J8YA 2PU4A 3S4XA 3C7UA 4JF4A 4IEDA 2JC7A 1HVBA 1NZUA 2R9WA 1BLHA 3ITAA 4B88A 5EE8A 2Z2LB 2ZQ9A 4Y7PA 2OSUA 1KDWA 3HUMA 4KZ5A 1E3UD 3MXSA 2E8IA 4DF6A 3HLFA 3UY6A 3OPLA 4WYYA 5DF9A 1EI5A 1IEMA 4P6BA 5KSCA 5KSHA 1DJBA 3BEBA 3C5AA 4HEFA 3C4OA 5CTNA 1NZOA 1VM1A 4KZ4A 4OQHA 1DJAA 3NC8A 3SH9A 4KZ7A 4MBKA 1FOFA 3LY3A 3I7JA 1KDSA 2WGWA 1S6RA 3C7VA 3VP4A 5KMWA 1BLSA 4MLLA 5GHYA 2B5RA 2QPNA 1PW1A 1O07A 4S2NC 4UA6A 5FI7A 5HARA 5HW3A 5FQQA 2XQZA 2H0TA 3P09A 2XR0A 3AGDA 3N8RA 3FKWA 3Q81A 1BTLA 5FASA 1AXBA 4OPQA 4R4SA 5EVIC 1BT5A 2I72A 3IHAA 3RJUA 1L0EA 1BLPA 2Y2PA 5FQ9A 1ALQA 1EROA 2EX2A 3N8SA 4JPMA 4ZJ3A 3B3XA 3S1YA 3M2JA 4MBFA 4WZ5A 2EX6A 1K6RA 3BYDA 5DF7A 4LV3A 1GA9A 3HVFA 3A3IA 1LI0A 1MWUA 1G68A 1XA7A 3ZGAB 5JYOA 1H5XA 3Q1FA 2XK1A 1K57A 2ZD8A 4IVKA 4K0XA 5IHVA 4LCMA 3FV7A 1PZPA 3IXGA 3V5MA 1ES3A 1GCEA 3BLSA 4FCFA 3HLBA 4OPRA 5TFQA 2IWBA 5I94A 4K91A 1BULA 4N92A 4ZDXA 2QMIA 3Q7ZA 1RGZA 3RXWA 3ZG5A 1PW8A 1ES2A 1FR6A 2HP6A 2X71A 2Y2LA 4LV1A 4X53A 3MZFA 4BD0A 2VGJA 5GLDA 3P98A 3AGEA 3UNWA 4JKTA 4ZJ1A 2ZC3B 1ONGA 1K25A 3UN7A 1KE0A 3TG9A 1RGYA 4XUZA 4JXGA 1E25A 2Y4AA 5EVIB 3ISGA 3HL9A 3IHBA 3BFEA 3VSLA 2Y2IA 3NCKA 3W8KA 3HLEA 2X01A 1ZG4A 2WZXA 2WZZA 1CEFA 3IH9A 1I2WA 2JE5A 1CI9A 4ZAMA 1KE3A 3IF6A 4BENA 1PI4A 2ZQ7A 4IBXA 2ZQAA 4JXVA 3O88A 2J9PA 1KVMA 1IKGA 4N9LA 1KGGA 3IWIA 4RX3A 4Y0OA 3M6BA 5CTMA 3IXBA 2ZLYA 5EPHA 1ESIA 5DF8A 4CPKA 4MNRA 3Q7VA 1SKFA 4BQMA 1SCWA 1IYOA 1K56A 3ZVWA 4M3KA 4X56A 1YLJA 4PMAA 2HDUA 5HAIA 3G30A 4FH4A 5E2FA 3BM6A 3E2KA 3WS1A 5CERA 3CZDA 5GLAA 1FQGA 3UE1A 2J7VA 2Y2KA 4ZJ2A 5E2GA 4EBPA 1ESUA 3Q82A 4KZ3A 5U47A 1HTZA 2DRWA 4PM5A 2Q9NA 3IXDA 3OCLA 1GA0A 4S2JA 5CGXA 1YMXA 2C5WB 1DY6A 3IWQA 3N8LA 4GDNA 3N6IA 1EWZA 2P9VA 2Y2NA 4RVAA 4U0XA 4EUZA 1E4DA 4XXRA 4E3JA 2Y91A 4N1XA 2PU2A 4QU3A 1MWTA 4HESA 3BFGA 2C6WB 1FCNA 3D4FA 4JF6A 1N9BA 1H8ZA 4UA9A 4OOYA 5EVID 2EXBA 3ZDJA 4C75A 1PYYA 3BFDA 4GDBA 5L2FA 1ES4A 3JYIA 2WK0A 3GTCA 4KZBA 1W8YA 3V50A 4P0MA 3DW0A 3HBRA 4FD8A 3GRJA 3SS4A 2WKIA 2WUQA 5A93A 1ES5A 2R9XA 4OONA 1K38A 4KZAA 4WEKA 5EOEA 4LCLA 3IXHA 3OPHA 3A3FA 1JTDA 4IBRA 1SDNA 4KQRA 5F83A 5A90A 3V3SA 4DXCA 2HPBA 1H8YA 2XH9A 4X6TA 1YQSA 1FSYA 3LY4A 2WGVA 1YLYA 3MZDA 1HZOA 4R1GA 5FQMA 1E3UA 1CK3A 2A3UA 3MFDA 3IH8A 3IQAA 3W4QA 5HL1A 4UHUA 2EX8A 4KZ9A 1Q2PA 4JLFA 4E6WA 4WMCD 4CJNA 5JYPA 3ZG0A 3MKFA 4HBTA 4RA7A 3ZG8B 3VOYA 4DE1A 2EXAA 4ZBEA 3G31A 2V1ZA 4BL3A 4X68A 1PZOA 3HLGA 3OC2A 5BOHA 2FFYA 5E2EA 1M40A 1K6SA 1QMFA 1YLWA 4PPRA 3Q7VB 4RYEA 5HFOA 1XP4A 5CEBA 5TGFA 1YM1A 1XKZA 1Y54A 2V2FF 3BFFA 1KVLA 1PI5A 3EQVA 4R0QA 5HAQA 4ID4A 1S0WA 2UWXA 5FI2A 2WKHA 2WAFA 2G2WA 1TDLA 3NIAA 2Y2JA 5GHXA 2ZC6B 3QHYA 4A5RA 2BLSA 4U3TA 4IVIA 5FA7A 1XGJA 3OCNA 3SS3A 5CGSA 4OPYA 1MWRA 3VFHA 2P9VB 4E3NA 3HUNA 1XPBA 2EX9A 4OP5A 1W5DA 3WRTA 4KG5A 4OP8A 2HDQA 1KGEA 1BSGA 3OZHA 3GQZA 5AQ9A 1LL9A 2ZQCA 2WAEA 4NETA 1L0FA 4L0LA 4WZ4A 1IYSA 3FWLA 4PM7A 3ZNYA 2CC1A 5EECA 4DKIA 4QB8A 3UO9A 3LO7A 4DRTA 1FCOA 5EUAA 5M18A 4E3MA 5HAPA 3HLCA 4UAAA 4E6XA 4LV2A 4H8RA 4KQQA 3PAGA 4WZ5C 4P87A 4X69A 3G35A 3RXXA 1G6AA 3DTMA 4B4XA 1NYMA 1LLBA 4QY6A 3NDEA 3UE3A 2V20A 1NYYA 2JCHA 1K57C 5F1GA 4BL2A 1KGFA 3SOIA 2H10A 1K54A 4R23A 4GZBA 1IYQA 2BG1A 5EOOA 4EBLA 5DVAA 3ITBA 2P74A 5FI6A 4N9KA 3LCEA 4OLGA 4QY5A 5KZHA 4GB7A 3ZNTA 5AQAA 5A92A 3ZG7B 4GKUA 3WS5A 4S2KA 1IELA 2ZM8A 1IKIA 1GHIA 3O87A 4DDYA 2WGWB 4ZTKA 1K4EA 1TEMA 1BLCA 4WM9A 5EVLA 4LV0A 3VP3A 1XX2A 2ZC5B 1HD8A 1LI9A 5CXWA 5J8XA 1ZG6A 2EFUA 4KZ6A 3SH7A 5AQBA 3W4OA 2Y2GA 1XA1A 2HP9A 5DTSA 2G2UA 4S2PA 4WBGA 3V3RA 1MBLA 1PIOA 3TSGA 1U60A 1PWGA 2Y2QA 4QHCA 3PAEA 3PBTA 4DDSA 5CECA 3A3JA 2GDNA 4OH0A 3HUOA 4XUXA 2X02A 5CRFA 3IF6C 1I5QA 1JVJA 1N4OA 2ZQ8A 3M6HA 4R3JA 5FDHA 5FQKA 3WS2A 3ZCZA 3V39A 3N4IA 5FQJA 2EFXA 1JWPA 3NDGA 5GLBA 4B4ZA 4OPZA 1C3BA 4K0WA 4RX2A 5CHUA 1YLTA 5G18A 3TOIA 4OVDA 3WS4A 1BZAA 4S2NA 3UDXA 3OPRA 4GNUA 3VP2A 3G2YA 3VFFA 3C4PA 2H5SA 4OOLA 3HLWA 3VOZA 3NY4A 2XFSA 2ZC7A 5EVIA 5FAQA 1L2SA 1MWSA 3FZCA 1L0DA 5AQ7A 3OPPA 4MBHA 4JXWA 5M1AA 3G34A 2H0YA 2Y59A 2ZC4B 3WWXA 3PTEA 1MKIA 4WELA 3GR2A 4JXSA 2VGKA 3CG5A 4E3OA 3ZVTA 4OKPA 1SHVA 3GMWA 2QZ6A 3M2KA 4LENA 4C6YA 2XGNA 3O3VA 4EV4A 4QD4A 3BRMA 2PBYA 5GHZA 4YFMA 3CMZA 1Z6FA 3IT9A 3G32A 3LEZA 5DTTA 2RCXA 4QJGA 3UDIA 3IF6B 1RCJA 4GD6A 2Q9MA 3FYZA 3PBRA 3W4PA 3BECA 4DE3A 3VP1A 3SS5A 5CGWA 4JF5A 4PM8A 2XFTA 2XDMA 3VP0A 4WMCA 1GHPA 2ZM2A 4DXBA 4KQOA 1BUEA 1FCMA 5HX9A 4R4RA 2WADA 1TVFA 1ERQA 2WYXA 1XGIA 2Y2HA 4OQGA 3FKVA 1NJ4A 4KENB 5FAOA 5CEDA 1K55A 4X55A 1J9MA 2J9OA 5E43A 4JBFA 5FATA 4KZ8A 3QNCA 3DWZA 5DTKA 4S2LA 4EBNA 1PWDA 4KG2A 4WEJA 4KG6A 5GLCA 4O7DA 4OOMA 1W7FA 5F82A 2Y2MA 1CI8A 4OLDA 4DE2A 3PBOA 1NY0A 2XD1A 3UPPA 1L0GA 4PM6A 1MY8A 5FAPA 4HBUA 4F94A 1QMEA 1K4FA 3WRZA 1W8QA 2DNSA 5FSRA 2HDSA 4E3KA 3SH8A 2OLVA 1KE4A 3IF5A 4UA7A 2XEPA 4GOGA 3CJMA 3PBNA 1OMEA 3GSGA 2DCFA 1Q2QA 2ZM0A 1YT4A 3ZG9B 5F1FA 1NRFA 4N1HA 1YLPA 3GVBA 4R3BA 4U0TA 3WS0A 4BJPA 3N7WA 3QNBA 3NBLA 3MBZA 4GD8A 4OQ0A 4YINA 3ZFZA 2HP5A 5TR7A 4Y0UA 3EQUA 4PM9A 5CHMA 2WKEA 1YLZA 4Q8IA 5D3OA 5M19A 1NXYA 1O7EA 3A3EA 1K55C 2FFFB 1WYCA 4FSFA 3O86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MPL A;  2Y55 A;  1K56 D;  3G4P A;  2ZJ9 A;  4EWF A;  3A3D A;  5GL9 A;  4E3L A;  2OLU A;  2Y2O A;  1M6K A;  1JTG A;  4FH2 A;  1W79 A;  3Q07 A;  4DE0 A;  4BD1 A;  3PBS A;  3AGF A;  3PBQ A;  2A49 A;  4Y0T A;  3MKE A;  1I2S A;  3HLD A;  3E2L A;  3IWO A;  4P85 A;  2OV5 A;  3MZE A;  1LHY A;  3G2Z A;  1JWV A;  3NI9 A;  3S22 A;  3BFC A;  4S2M A;  1VQQ A;  4S2O A;  5E2H A;  1JWZ A;  4MEZ A;  1ZC2 A;  1SDE A;  2WGI A;  2Z2M B;  1XXM A;  5A91 A;  3ZHH A;  3VSK A;  1IYP A;  4EQI A;  2ZQD A;  3UDF A;  3UPO A;  1DJC A;  2XLN A;  4D2O A;  4BLM A;  1LL5 A;  3MXR A;  1YMS A;  1FSW A;  5CHJ A;  2IWC A;  1K54 C;  3VMA A;  4C3Q A;  1WE4 A;  3BLM A;  3HRE A;  3UE0 A;  1MXO A;  3UPN A;  2JBF A;  4Z9Q A;  1RP5 A;  3DWK A;  2HDR A;  1GHM A;  1TDG A;  1FR1 A;  1PWC A;  2ZMA A;  2XF3 A;  2RL3 A;  4NK3 A;  1ZKJ A;  4OQI A;  3GV9 A;  2IWD A;  4E3I A;  1CEG A;  1WYB A;  4S2I A;  1ONH A;  2XD5 A;  4GN2 A;  5FQI A;  1ERM A;  2J8Y A;  2PU4 A;  3S4X A;  3C7U A;  4JF4 A;  4IED A;  2JC7 A;  1HVB A;  1NZU A;  2R9W A;  1BLH A;  3ITA A;  4B88 A;  5EE8 A;  2Z2L B;  2ZQ9 A;  4Y7P A;  2OSU A;  1KDW A;  3HUM A;  4KZ5 A;  1E3U D;  3MXS A;  2E8I A;  4DF6 A;  3HLF A;  3UY6 A;  3OPL A;  4WYY A;  5DF9 A;  1EI5 A;  1IEM A;  4P6B A;  5KSC A;  5KSH A;  1DJB A;  3BEB A;  3C5A A;  4HEF A;  3C4O A;  5CTN A;  1NZO A;  1VM1 A;  4KZ4 A;  4OQH A;  1DJA A;  3NC8 A;  3SH9 A;  4KZ7 A;  4MBK A;  1FOF A;  3LY3 A;  3I7J A;  1KDS A;  2WGW A;  1S6R A;  3C7V A;  3VP4 A;  5KMW A;  1BLS A;  4MLL A;  5GHY A;  2B5R A;  2QPN A;  1PW1 A;  1O07 A;  4S2N C;  4UA6 A;  5FI7 A;  5HAR A;  5HW3 A;  5FQQ A;  2XQZ A;  2H0T A;  3P09 A;  2XR0 A;  3AGD A;  3N8R A;  3FKW A;  3Q81 A;  1BTL A;  5FAS A;  1AXB A;  4OPQ A;  4R4S A;  5EVI C;  1BT5 A;  2I72 A;  3IHA A;  3RJU A;  1L0E A;  1BLP A;  2Y2P A;  5FQ9 A;  1ALQ A;  1ERO A;  2EX2 A;  3N8S A;  4JPM A;  4ZJ3 A;  3B3X A;  3S1Y A;  3M2J A;  4MBF A;  4WZ5 A;  2EX6 A;  1K6R A;  3BYD A;  5DF7 A;  4LV3 A;  1GA9 A;  3HVF A;  3A3I A;  1LI0 A;  1MWU A;  1G68 A;  1XA7 A;  3ZGA B;  5JYO A;  1H5X A;  3Q1F A;  2XK1 A;  1K57 A;  2ZD8 A;  4IVK A;  4K0X A;  5IHV A;  4LCM A;  3FV7 A;  1PZP A;  3IXG A;  3V5M A;  1ES3 A;  1GCE A;  3BLS A;  4FCF A;  3HLB A;  4OPR A;  5TFQ A;  2IWB A;  5I94 A;  4K91 A;  1BUL A;  4N92 A;  4ZDX A;  2QMI A;  3Q7Z A;  1RGZ A;  3RXW A;  3ZG5 A;  1PW8 A;  1ES2 A;  1FR6 A;  2HP6 A;  2X71 A;  2Y2L A;  4LV1 A;  4X53 A;  3MZF A;  4BD0 A;  2VGJ A;  5GLD A;  3P98 A;  3AGE A;  3UNW A;  4JKT A;  4ZJ1 A;  2ZC3 B;  1ONG A;  1K25 A;  3UN7 A;  1KE0 A;  3TG9 A;  1RGY A;  4XUZ A;  4JXG A;  1E25 A;  2Y4A A;  5EVI B;  3ISG A;  3HL9 A;  3IHB A;  3BFE A;  3VSL A;  2Y2I A;  3NCK A;  3W8K A;  3HLE A;  2X01 A;  1ZG4 A;  2WZX A;  2WZZ A;  1CEF A;  3IH9 A;  1I2W A;  2JE5 A;  1CI9 A;  4ZAM A;  1KE3 A;  3IF6 A;  4BEN A;  1PI4 A;  2ZQ7 A;  4IBX A;  2ZQA A;  4JXV A;  3O88 A;  2J9P A;  1KVM A;  1IKG A;  4N9L A;  1KGG A;  3IWI A;  4RX3 A;  4Y0O A;  3M6B A;  5CTM A;  3IXB A;  2ZLY A;  5EPH A;  1ESI A;  5DF8 A;  4CPK A;  4MNR A;  3Q7V A;  1SKF A;  4BQM A;  1SCW A;  1IYO A;  1K56 A;  3ZVW A;  4M3K A;  4X56 A;  1YLJ A;  4PMA A;  2HDU A;  5HAI A;  3G30 A;  4FH4 A;  5E2F A;  3BM6 A;  3E2K A;  3WS1 A;  5CER A;  3CZD A;  5GLA A;  1FQG A;  3UE1 A;  2J7V A;  2Y2K A;  4ZJ2 A;  5E2G A;  4EBP A;  1ESU A;  3Q82 A;  4KZ3 A;  5U47 A;  1HTZ A;  2DRW A;  4PM5 A;  2Q9N A;  3IXD A;  3OCL A;  1GA0 A;  4S2J A;  5CGX A;  1YMX A;  2C5W B;  1DY6 A;  3IWQ A;  3N8L A;  4GDN A;  3N6I A;  1EWZ A;  2P9V A;  2Y2N A;  4RVA A;  4U0X A;  4EUZ A;  1E4D A;  4XXR A;  4E3J A;  2Y91 A;  4N1X A;  2PU2 A;  4QU3 A;  1MWT A;  4HES A;  3BFG A;  2C6W B;  1FCN A;  3D4F A;  4JF6 A;  1N9B A;  1H8Z A;  4UA9 A;  4OOY A;  5EVI D;  2EXB A;  3ZDJ A;  4C75 A;  1PYY A;  3BFD A;  4GDB A;  5L2F A;  1ES4 A;  3JYI A;  2WK0 A;  3GTC A;  4KZB A;  1W8Y A;  3V50 A;  4P0M A;  3DW0 A;  3HBR A;  4FD8 A;  3GRJ A;  3SS4 A;  2WKI A;  2WUQ A;  5A93 A;  1ES5 A;  2R9X A;  4OON A;  1K38 A;  4KZA A;  4WEK A;  5EOE A;  4LCL A;  3IXH A;  3OPH A;  3A3F A;  1JTD A;  4IBR A;  1SDN A;  4KQR A;  5F83 A;  5A90 A;  3V3S A;  4DXC A;  2HPB A;  1H8Y A;  2XH9 A;  4X6T A;  1YQS A;  1FSY A;  3LY4 A;  2WGV A;  1YLY A;  3MZD A;  1HZO A;  4R1G A;  5FQM A;  1E3U A;  1CK3 A;  2A3U A;  3MFD A;  3IH8 A;  3IQA A;  3W4Q A;  5HL1 A;  4UHU A;  2EX8 A;  4KZ9 A;  1Q2P A;  4JLF A;  4E6W A;  4WMC D;  4CJN A;  5JYP A;  3ZG0 A;  3MKF A;  4HBT A;  4RA7 A;  3ZG8 B;  3VOY A;  4DE1 A;  2EXA A;  4ZBE A;  3G31 A;  2V1Z A;  4BL3 A;  4X68 A;  1PZO A;  3HLG A;  3OC2 A;  5BOH A;  2FFY A;  5E2E A;  1M40 A;  1K6S A;  1QMF A;  1YLW A;  4PPR A;  3Q7V B;  4RYE A;  5HFO A;  1XP4 A;  5CEB A;  5TGF A;  1YM1 A;  1XKZ A;  1Y54 A;  2V2F F;  3BFF A;  1KVL A;  1PI5 A;  3EQV A;  4R0Q A;  5HAQ A;  4ID4 A;  1S0W A;  2UWX A;  5FI2 A;  2WKH A;  2WAF A;  2G2W A;  1TDL A;  3NIA A;  2Y2J A;  5GHX A;  2ZC6 B;  3QHY A;  4A5R A;  2BLS A;  4U3T A;  4IVI A;  5FA7 A;  1XGJ A;  3OCN A;  3SS3 A;  5CGS A;  4OPY A;  1MWR A;  3VFH A;  2P9V B;  4E3N A;  3HUN A;  1XPB A;  2EX9 A;  4OP5 A;  1W5D A;  3WRT A;  4KG5 A;  4OP8 A;  2HDQ A;  1KGE A;  1BSG A;  3OZH A;  3GQZ A;  5AQ9 A;  1LL9 A;  2ZQC A;  2WAE A;  4NET A;  1L0F A;  4L0L A;  4WZ4 A;  1IYS A;  3FWL A;  4PM7 A;  3ZNY A;  2CC1 A;  5EEC A;  4DKI A;  4QB8 A;  3UO9 A;  3LO7 A;  4DRT A;  1FCO A;  5EUA A;  5M18 A;  4E3M A;  5HAP A;  3HLC A;  4UAA A;  4E6X A;  4LV2 A;  4H8R A;  4KQQ A;  3PAG A;  4WZ5 C;  4P87 A;  4X69 A;  3G35 A;  3RXX A;  1G6A A;  3DTM A;  4B4X A;  1NYM A;  1LLB A;  4QY6 A;  3NDE A;  3UE3 A;  2V20 A;  1NYY A;  2JCH A;  1K57 C;  5F1G A;  4BL2 A;  1KGF A;  3SOI A;  2H10 A;  1K54 A;  4R23 A;  4GZB A;  1IYQ A;  2BG1 A;  5EOO A;  4EBL A;  5DVA A;  3ITB A;  2P74 A;  5FI6 A;  4N9K A;  3LCE A;  4OLG A;  4QY5 A;  5KZH A;  4GB7 A;  3ZNT A;  5AQA A;  5A92 A;  3ZG7 B;  4GKU A;  3WS5 A;  4S2K A;  1IEL A;  2ZM8 A;  1IKI A;  1GHI A;  3O87 A;  4DDY A;  2WGW B;  4ZTK A;  1K4E A;  1TEM A;  1BLC A;  4WM9 A;  5EVL A;  4LV0 A;  3VP3 A;  1XX2 A;  2ZC5 B;  1HD8 A;  1LI9 A;  5CXW A;  5J8X A;  1ZG6 A;  2EFU A;  4KZ6 A;  3SH7 A;  5AQB A;  3W4O A;  2Y2G A;  1XA1 A;  2HP9 A;  5DTS A;  2G2U A;  4S2P A;  4WBG A;  3V3R A;  1MBL A;  1PIO A;  3TSG A;  1U60 A;  1PWG A;  2Y2Q A;  4QHC A;  3PAE A;  3PBT A;  4DDS A;  5CEC A;  3A3J A;  2GDN A;  4OH0 A;  3HUO A;  4XUX A;  2X02 A;  5CRF A;  3IF6 C;  1I5Q A;  1JVJ A;  1N4O A;  2ZQ8 A;  3M6H A;  4R3J A;  5FDH A;  5FQK A;  3WS2 A;  3ZCZ A;  3V39 A;  3N4I A;  5FQJ A;  2EFX A;  1JWP A;  3NDG A;  5GLB A;  4B4Z A;  4OPZ A;  1C3B A;  4K0W A;  4RX2 A;  5CHU A;  1YLT A;  5G18 A;  3TOI A;  4OVD A;  3WS4 A;  1BZA A;  4S2N A;  3UDX A;  3OPR A;  4GNU A;  3VP2 A;  3G2Y A;  3VFF A;  3C4P A;  2H5S A;  4OOL A;  3HLW A;  3VOZ A;  3NY4 A;  2XFS A;  2ZC7 A;  5EVI A;  5FAQ A;  1L2S A;  1MWS A;  3FZC A;  1L0D A;  5AQ7 A;  3OPP A;  4MBH A;  4JXW A;  5M1A A;  3G34 A;  2H0Y A;  2Y59 A;  2ZC4 B;  3WWX A;  3PTE A;  1MKI A;  4WEL A;  3GR2 A;  4JXS A;  2VGK A;  3CG5 A;  4E3O A;  3ZVT A;  4OKP A;  1SHV A;  3GMW A;  2QZ6 A;  3M2K A;  4LEN A;  4C6Y A;  2XGN A;  3O3V A;  4EV4 A;  4QD4 A;  3BRM A;  2PBY A;  5GHZ A;  4YFM A;  3CMZ A;  1Z6F A;  3IT9 A;  3G32 A;  3LEZ A;  5DTT A;  2RCX A;  4QJG A;  3UDI A;  3IF6 B;  1RCJ A;  4GD6 A;  2Q9M A;  3FYZ A;  3PBR A;  3W4P A;  3BEC A;  4DE3 A;  3VP1 A;  3SS5 A;  5CGW A;  4JF5 A;  4PM8 A;  2XFT A;  2XDM A;  3VP0 A;  4WMC A;  1GHP A;  2ZM2 A;  4DXB A;  4KQO A;  1BUE A;  1FCM A;  5HX9 A;  4R4R A;  2WAD A;  1TVF A;  1ERQ A;  2WYX A;  1XGI A;  2Y2H A;  4OQG A;  3FKV A;  1NJ4 A;  4KEN B;  5FAO A;  5CED A;  1K55 A;  4X55 A;  1J9M A;  2J9O A;  5E43 A;  4JBF A;  5FAT A;  4KZ8 A;  3QNC A;  3DWZ A;  5DTK A;  4S2L A;  4EBN A;  1PWD A;  4KG2 A;  4WEJ A;  4KG6 A;  5GLC A;  4O7D A;  4OOM A;  1W7F A;  5F82 A;  2Y2M A;  1CI8 A;  4OLD A;  4DE2 A;  3PBO A;  1NY0 A;  2XD1 A;  3UPP A;  1L0G A;  4PM6 A;  1MY8 A;  5FAP A;  4HBU A;  4F94 A;  1QME A;  1K4F A;  3WRZ A;  1W8Q A;  2DNS A;  5FSR A;  2HDS A;  4E3K A;  3SH8 A;  2OLV A;  1KE4 A;  3IF5 A;  4UA7 A;  2XEP A;  4GOG A;  3CJM A;  3PBN A;  1OME A;  3GSG A;  2DCF A;  1Q2Q A;  2ZM0 A;  1YT4 A;  3ZG9 B;  5F1F A;  1NRF A;  4N1H A;  1YLP A;  3GVB A;  4R3B A;  4U0T A;  3WS0 A;  4BJP A;  3N7W A;  3QNB A;  3NBL A;  3MBZ A;  4GD8 A;  4OQ0 A;  4YIN A;  3ZFZ A;  2HP5 A;  5TR7 A;  4Y0U A;  3EQU A;  4PM9 A;  5CHM A;  2WKE A;  1YLZ A;  4Q8I A;  5D3O A;  5M19 A;  1NXY A;  1O7E A;  3A3E A;  1K55 C;  2FFF B;  1WYC A;  4FSF A;  3O86 A; 
#chains in the Genus database with same CATH topology
 2Y55 A;  3G4P A;  2ZJ9 A;  2OLU A;  4LFU A;  1JTG A;  4DE0 A;  3PBQ A;  3MKE A;  3BQ8 A;  3IWO A;  4P85 A;  3T1X A;  3MZE A;  2W3E A;  3S22 A;  1PFL A;  4S2O A;  2Y79 A;  2Z2M B;  4L9F A;  3IX8 A;  3R7W B;  3VSK A;  3U4L P;  3CUE A;  1Y4O A;  4BLM A;  5CHJ A;  2IWC A;  4Y17 A;  3VMA A;  5DJU A;  5HL6 A;  3BLM A;  1BYW A;  2W1T A;  2JBF A;  4NXF A;  2HDR A;  1GHM A;  1TDG A;  2INW A;  2RL3 A;  2J80 A;  3QP4 A;  3GV9 A;  2IWD A;  2J8Y A;  3DBA A;  3C7U A;  1HVB A;  2JKT I;  4HP9 A;  4B88 A;  4R38 A;  4Y7P A;  3HLF A;  5CTN A;  1DJB A;  3C5A A;  1NZO A;  1DJA A;  1T1A A;  3NC8 A;  5HDS A;  3LY3 A;  3I7J A;  1YPR A;  1KOU A;  1OTD A;  1PW1 A;  1OTI A;  2H0T A;  3CLO A;  3AGD A;  3N8R A;  2I72 A;  3RJU A;  3N8S A;  2OWJ A;  4IJG A;  2EX6 A;  1GA9 A;  3HVF A;  3A3I A;  1MWU A;  5JYO A;  2I9V A;  3FV7 A;  1W63 Q;  1PZP A;  4FCF A;  2IWB A;  4DJ3 A;  2J3W A;  4N92 A;  4ZDX A;  4HP4 A;  1RGZ A;  1LSX A;  1ES2 A;  4BD0 A;  3BWL A;  3P98 A;  4QPR A;  4LLO B;  2W3D A;  1KE0 A;  3TG9 A;  4P6Z S;  3D72 A;  3A0R A;  3IHB A;  3L7H A;  3HLE A;  3EGX C;  2X01 A;  4DJ2 A;  1I2W A;  2JE5 A;  2M7V A;  4Y2F A;  5HWT A;  1KE3 A;  3IF6 A;  3F1P B;  5HDD A;  2ZQA A;  2J9P A;  3BY8 A;  3IXB A;  2ZLY A;  2PAV P;  5CTM A;  1TF1 A;  3U2A A;  2HJ9 C;  4PMA A;  4FH4 A;  3E2K A;  2OWH A;  3OLO A;  5U47 A;  4PM5 A;  2DRW A;  3OCL A;  3GDI A;  3LGO A;  3MQQ A;  3IWQ A;  1DY6 A;  3HJK A;  3JVV A;  2P9V A;  2ZL1 B;  3H9W A;  1E4D A;  1LSW A;  4N1X A;  2PU2 A;  4QU3 A;  4HES A;  3K2N A;  1H8Z A;  4UA9 A;  5G4Z A;  4ETZ A;  3LYX A;  1X0O A;  4GDB A;  2O0Y A;  4KZB A;  2D01 A;  3RTY A;  2M1C A;  1ES5 A;  4LRZ E;  5F6A A;  4WEK A;  3IXH A;  3OPH A;  1JTD A;  5HSQ A;  1SDN A;  4DXC A;  2HPB A;  2VA0 A;  4QWO A;  2WGV A;  1E3U A;  3W4Q A;  2QKP A;  4WMC D;  4O8G A;  2VV6 A;  4RA7 A;  3ULF A;  4R70 A;  4ZBE A;  2V1Z A;  4MDZ A;  3GEC A;  4X68 A;  3HLG A;  4YNR A;  1YLW A;  5CEB A;  5HFO A;  1YM1 A;  1PI5 A;  4UEY A;  2G2W A;  1TDL A;  2WKR A;  3NIA A;  5GHX A;  4A5R A;  4IVI A;  5CGS A;  4OPY A;  1MWR A;  2P9V B;  2V9A A;  3HUN A;  1XPB A;  1W5D A;  4KG5 A;  4FTX A;  4OP8 A;  1LL9 A;  4NET A;  1L0F A;  1T1B A;  4F3L B;  3S7Q A;  1CQA A;  2B18 A;  4DRT A;  5EUA A;  5M18 A;  4E6X A;  5IU1 A;  4KQQ A;  3PAG A;  3DTM A;  1NYM A;  5I5L A;  1LLB A;  2MJ6 A;  3OOV A;  5F1G A;  4GLQ A;  1G6O A;  4G3W A;  3ITB A;  5KZH A;  4L9E A;  4QY5 A;  2PYR A;  1S67 L;  3IX4 A;  4WM9 A;  5G4Y A;  2ZMV A;  1ZG6 A;  3UB6 A;  3QP6 A;  3UMD A;  2Y2G A;  1XA1 A;  2HP9 A;  3CI6 A;  1MBL A;  3TW8 A;  2VK3 A;  3TSG A;  5HPI A;  4QHC A;  3MMH A;  3O5Y A;  3LUQ A;  2PR6 A;  5CRF A;  1JVJ A;  5FDH A;  3PYP A;  4B4Z A;  2LB9 A;  4K0W A;  1BZA A;  2KDK A;  3VFF A;  4EEU A;  3TRC A;  3VOZ A;  3E98 A;  2XFS A;  4HI4 A;  1UWP X;  3LR3 A;  3PR6 A;  3VOL A;  1SKO A;  4WEL A;  4LGW A;  3KSF A;  3GMW A;  2WKQ A;  3O3V A;  3BRM A;  2PBY A;  1XJ6 A;  1Z6F A;  5TBM A;  3P01 A;  3FYZ A;  2H28 A;  3PBR A;  3W4P A;  2WKP A;  4LPZ A;  1MZU A;  2XFT A;  2A24 B;  2ZM2 A;  4DXB A;  2VEA A;  1BUE A;  5HX9 A;  2WAD A;  1TVF A;  1ERQ A;  4HH3 A;  1NWZ A;  4EET B;  4X25 A;  1K55 A;  2K2N A;  3QP5 A;  5DTK A;  2QWS A;  3CAX A;  4MN6 A;  1XJ4 A;  5GLC A;  5DJT A;  1P9R A;  3PBO A;  3UPP A;  2JKR I;  1L0G A;  1OT6 A;  1QME A;  2AVX A;  5FSR A;  1KE4 A;  3IF5 A;  4UA7 A;  4HOI A;  3CJM A;  3SW1 A;  3T4T A;  5F1F A;  3WS0 A;  1T18 A;  2W0N A;  3NBL A;  1VET A;  2HP5 A;  4R6L A;  3EQU A;  3LEQ A;  5F69 A;  5CHM A;  3TE8 A;  2WKE A;  4HJ3 A;  5M19 A;  2VGL S;  3C38 A;  3FKV A;  1K55 C;  2FFF B;  2ZOI A;  1WYC A;  3O86 A;  2P7J A;  1D1J A;  1MPL A;  4EWF A;  4E3L A;  4FH2 A;  3FPW A;  4EER A;  4BD1 A;  3T4S A;  3PBS A;  3UB8 A;  4II7 A;  2E8J A;  1LHY A;  1DRM A;  3BFC A;  1XJ2 A;  4HY8 A;  1TS8 A;  1IYP A;  4EQI A;  4P6Z M;  3UDF A;  3MXQ A;  2XLN A;  5FEG A;  3MXR A;  2Z6D A;  3MSH A;  3LR5 A;  1K54 C;  3HRE A;  4I5S A;  4PHT A;  1PWC A;  2XA7 S;  1OTE A;  2QYB A;  3HCY A;  4GHI B;  1ZKJ A;  3NOP C;  4DN0 A;  1CEG A;  1WYB A;  1ONH A;  2XD5 A;  4I3A A;  5FQI A;  3S4X A;  1NRJ A;  1NLY A;  2R78 A;  4IED A;  2ZQ9 A;  1KDW A;  4KZ5 A;  4DF6 A;  1E3U D;  2E8I A;  3H82 B;  3OPL A;  5KSC A;  1IEM A;  1WA9 A;  3BEB A;  4KZ4 A;  4OQH A;  3SH9 A;  4KZ7 A;  4WL9 A;  1FOF A;  1XJ3 A;  3C7V A;  1S6R A;  4BBU A;  2B5R A;  2CMN A;  2QPN A;  2VV8 A;  4UA6 A;  3VE4 A;  4S2N C;  5HW3 A;  1T19 A;  2V1A A;  5FQQ A;  3P09 A;  2XR0 A;  4EES A;  4ESP A;  5FQ9 A;  2Y2P A;  4WZ5 A;  4GJ4 A;  5CX7 A;  5DF7 A;  4Q0I A;  4LV3 A;  1LI0 A;  1G68 A;  3ZGA B;  2XK1 A;  4ARZ A;  1K57 A;  3T4L A;  3NEC A;  3IS2 B;  2A2L A;  3V5M A;  1GCE A;  2V0W A;  2Y8H A;  2HGV A;  5I94 A;  4K91 A;  2QMI A;  3LIB A;  3RXW A;  3FC7 A;  2X71 A;  2VGJ A;  5GLD A;  3SZT A;  5F5Y A;  2HJE A;  1K25 A;  4XUZ A;  3LID A;  3ISG A;  3HL9 A;  2Y2I A;  5C5K A;  2Q0O A;  1ZG4 A;  3LFV A;  4M4X A;  2W3F A;  5EV0 A;  4KQD A;  4BEN A;  4IBX A;  4JGO A;  4JXV A;  1KVM A;  1IKG A;  3IWI A;  2O9B A;  5J4E A;  1ESI A;  4MNR A;  1SKF A;  2VKS A;  1SCW A;  4M3K A;  1YLJ A;  5HAI A;  2PD7 A;  2K7S A;  2EWW A;  3WS1 A;  3UE1 A;  5E2G A;  3Q82 A;  3H7W B;  2C5W B;  3IX3 A;  4BBV A;  4EUZ A;  4GS9 A;  3E0Y A;  4XXR A;  4E3J A;  3OBF A;  2Y91 A;  2JKT M;  2KLI A;  1MWT A;  2C6W B;  4Y15 A;  4OOY A;  4ARZ B;  1PYY A;  5L2F A;  3R4K A;  1ZHH B;  3JYI A;  4CLC A;  2L1M A;  3DW0 A;  3SS4 A;  5EOE A;  1N9N A;  1H3Q A;  4KQR A;  3V3S A;  3CUE C;  1S66 L;  2XH9 A;  4BBT A;  3UME A;  3DTI A;  3MZD A;  1YLY A;  2A3U A;  1DP8 A;  3IQA A;  4UHU A;  3TJZ C;  4E6W A;  4CJN A;  5JYP A;  3ZG0 A;  2W1R A;  3ZG8 B;  2ZOH A;  3G31 A;  4BL3 A;  5J7E A;  5E2E A;  1M40 A;  2FH5 A;  1XP4 A;  4B9O A;  5TGF A;  1Y54 A;  3BFF A;  5HAQ A;  1KVL A;  4R0Q A;  3B33 A;  1HLU P;  4O0P A;  3FG8 A;  2Y2J A;  1XFN A;  2ZC6 B;  5L10 A;  2BLS A;  2VV7 A;  1XGJ A;  3SS3 A;  3VFH A;  4E3N A;  2EX9 A;  4JGQ A;  3S7N A;  1YSQ A;  5AQ9 A;  2W1T B;  4WZ4 A;  2KX6 A;  5EEC A;  4DKI A;  3LO7 A;  3DAV A;  3V67 A;  5HWV A;  4P87 A;  4X69 A;  4B4X A;  3NDE A;  5HPF A;  4BL2 A;  1GSW A;  3EEA A;  1KGF A;  3SOI A;  4MCW A;  2H10 A;  4R23 A;  4GZB A;  2BG1 A;  5DVA A;  5FI6 A;  1OTB A;  2GNX A;  2OAQ 1;  4OLG A;  3C8C A;  4GB7 A;  3ZNT A;  5A92 A;  3WS5 A;  4S2K A;  1IEL A;  3O87 A;  1K4E A;  2W3H A;  5EVL A;  5CXW A;  1HD8 A;  5J8X A;  2VLG A;  2HF6 A;  2EFU A;  5FEF A;  5AQB A;  2PT7 A;  5DTS A;  1H0M A;  4S2P A;  3V3R A;  1PIO A;  1U60 A;  1OPX A;  5CEC A;  3A3J A;  4EU0 A;  3DTK A;  4OH0 A;  3IF6 C;  1I5Q A;  2VGL M;  3N4I A;  5FQJ A;  5GLB A;  2UV0 E;  4OPZ A;  1YLT A;  5G18 A;  3T1R A;  4Y3I A;  3OPR A;  4GNU A;  3EEH A;  3C4P A;  1F9I A;  3PHY A;  3UB9 A;  5EVI A;  5L09 A;  1MWS A;  5AQ7 A;  2O99 A;  4JXW A;  2H0Y A;  2Y59 A;  3L9K A;  3KYQ A;  3M2K A;  4LEN A;  4C6Y A;  4NKP A;  3MF0 A;  2YKH A;  5DTT A;  3F1N A;  3KX0 X;  2RCX A;  4BWI A;  4QJG A;  3UDI A;  3IF6 B;  2QJ5 A;  3BEC A;  4PM8 A;  4H6J A;  4GCZ A;  1FIL A;  2XA7 M;  2WYX A;  1XGI A;  4KEN B;  4B93 A;  4X55 A;  1S1Z A;  2J9O A;  5E43 A;  4KZ8 A;  3QNC A;  3DWZ A;  2D02 A;  1YKD A;  5AJG A;  4KG6 A;  5F82 A;  3CPT A;  4OLD A;  4DE2 A;  2VJW A;  4NXB A;  4HBU A;  4PAU A;  3WRZ A;  2VZW A;  1W8Q A;  2OAP 1;  3LI9 A;  3PXP A;  4D60 A;  1OME A;  3GSG A;  2ZMF A;  4MN7 A;  4U0T A;  4BJP A;  3QNB A;  3MBZ A;  4OQ0 A;  1A0K A;  4YIN A;  4LRY C;  3F1O A;  3IBR A;  3K3C A;  2BTF P;  2L4R A;  3A3D A;  2Y2O A;  1Z09 A;  4DMZ A;  1W79 A;  1MKM A;  3Q07 A;  3T1S A;  3UB5 P;  2A49 A;  3HLD A;  3E2L A;  2OV5 A;  3G2Z A;  1JWV A;  3NI9 A;  5E2H A;  1JWZ A;  1SDE A;  2WGI A;  3ZHH A;  5EM1 A;  4XT2 A;  3IBJ A;  1DJC A;  4IHQ A;  4FOF A;  4D2O A;  1LL5 A;  1YMS A;  4C3Q A;  1WE4 A;  3UE0 A;  2PR5 A;  4CLC D;  3UPN A;  3KSI A;  4PKY G;  4ME4 A;  1D7E A;  1FR1 A;  4Q0H A;  2ZMA A;  2XF3 A;  4NK3 A;  2OOL A;  4OQI A;  4E3I A;  2PU4 A;  3KO6 A;  2JC7 A;  3ITA A;  1NZU A;  1BLH A;  1T1C A;  5EE8 A;  2Z2L B;  1VEU A;  2OSU A;  3KSH A;  3HUM A;  1OTA A;  2G7U A;  3RFB A;  4WYY A;  4X1L A;  1EI5 A;  4P6B A;  3C4O A;  3QP8 A;  4CLC E;  1VM1 A;  1NLZ A;  4MBK A;  3A0S A;  2WGW A;  4MLL A;  5GHY A;  3F1O B;  4EQ1 A;  3T4Q A;  3B47 A;  2HZ5 A;  3E4P A;  1P9W A;  5FAS A;  5HWW A;  3IHA A;  1L0E A;  1BLP A;  2B02 A;  3S1Y A;  2EX2 A;  1ERO A;  4ZJ3 A;  4NXE A;  2VX8 A;  1DP9 A;  3M2J A;  4MBF A;  3BYD A;  3E4O A;  2QHK A;  2PRF A;  2ZD8 A;  4IVK A;  5KIZ A;  1TS7 A;  5IHV A;  3T4J A;  1TD5 A;  3NUL A;  3S7P A;  4WUJ A;  1ES3 A;  3BLS A;  1IOU A;  4I38 A;  1BUL A;  1PW8 A;  1FR6 A;  2HP6 A;  4LV1 A;  4X53 A;  3JVU A;  3NHQ A;  3UNW A;  1ONG A;  1G5U A;  4WF0 A;  1RGY A;  1LSV A;  5AVF A;  3E4Q A;  3C2W A;  3BFE A;  2W27 A;  4UQI S;  2PBD P;  5EVE A;  2WZX A;  2WZZ A;  1CEF A;  1SKO B;  1UGU A;  4N9L A;  1VEU B;  4RX3 A;  4Y0O A;  3M6B A;  3T1Q B;  2J3T D;  4CPK A;  5TBM B;  1K56 A;  3MQ0 A;  4X56 A;  3G30 A;  5E2F A;  1FQG A;  2Y2K A;  4EBP A;  4KZ3 A;  1HTZ A;  4S2J A;  3IXD A;  1STZ A;  3N8L A;  1EWZ A;  4RVA A;  4U0X A;  1FIK A;  2XSS A;  3MFX A;  2HV1 A;  1FCN A;  3D4F A;  5EVI D;  2EXB A;  4C75 A;  1ES4 A;  2L0W A;  2V1B A;  3GTC A;  4AFI A;  4ETX A;  1V9Y A;  3HBR A;  4FD8 A;  2XRO A;  2WUQ A;  5A93 A;  4OON A;  1PRQ A;  1K38 A;  4KZA A;  4LCL A;  1F98 A;  2JKG A;  3A3F A;  1V9Z A;  1VET B;  1YQS A;  3P7N A;  5FQM A;  1HZO A;  1TS6 A;  3MFD A;  3CHW P;  2YKF A;  2EX8 A;  4KZ9 A;  4X1M A;  3MKF A;  3ICY A;  4HBT A;  4EXO A;  3VOY A;  2EXA A;  1PZO A;  3OC2 A;  1QMF A;  4RYE A;  1XKZ A;  4JGP A;  3MR0 A;  1S0W A;  2UWX A;  2WKH A;  2WAF A;  3BW6 A;  4U3T A;  5FA7 A;  3D9Y A;  4I3I A;  4OP5 A;  4KUK A;  2HDQ A;  3OZH A;  2ZQC A;  2WAE A;  3KYZ A;  1IYS A;  3FWL A;  3ZNY A;  3UO9 A;  3EGD C;  4HIA A;  4E3M A;  3HLC A;  4UAA A;  4WZ5 C;  3G35 A;  1G6A A;  2EA9 A;  2V20 A;  1NYY A;  2JCH A;  1K57 C;  1VB6 A;  4R3A A;  4L9G A;  1IYQ A;  1ODV A;  4HNB A;  4EBL A;  4N9K A;  4EUV A;  2ZBB A;  3UE6 A;  3ZQ5 A;  5AQA A;  3ZG7 B;  4GKU A;  3LIC A;  1GHI A;  1TEM A;  1BLC A;  1OT9 A;  4LV0 A;  1XX2 A;  2ZC5 B;  1LI9 A;  1L3L A;  4KZ6 A;  3SH7 A;  3RH8 B;  3W4O A;  4WBG A;  1AWI A;  2Y2Q A;  3PBT A;  4DDS A;  2GDN A;  4R3J A;  3WS2 A;  3V39 A;  5CHU A;  4OVD A;  3WS4 A;  1IFQ A;  3VP2 A;  3G2Y A;  2H5S A;  4NEE D;  3BY9 A;  3NY4 A;  2ZC7 A;  1L2S A;  3B42 A;  3OPP A;  4MBH A;  5M1A A;  1OJG A;  1Y28 A;  3LIE A;  4JXS A;  4E3O A;  3F1P A;  4OKP A;  1P0Z A;  4QD4 A;  2W3G A;  4YFM A;  3CMZ A;  3G32 A;  3LEZ A;  1ACF A;  1RCJ A;  2Q9M A;  3VV4 A;  4DE3 A;  3VP1 A;  4ZRR A;  3SS5 A;  4JF5 A;  5EFW A;  3VP0 A;  5A8B A;  4CLC C;  1GHP A;  4KQO A;  2Y2H A;  5L07 A;  4OQG A;  2ZL1 A;  5FAO A;  5CED A;  5DFX A;  4S2L A;  4KG2 A;  1J3W A;  4WLA A;  1W7F A;  2NUT C;  3S7O A;  2Y2M A;  5FDS A;  3MJQ A;  4GS9 B;  2XD1 A;  5FAP A;  3T12 B;  1K4F A;  1N9L A;  2Z6C A;  3EWK A;  2HDS A;  4E3K A;  2OLV A;  4YOF A;  3PBN A;  2DCF A;  1Q2Q A;  2ZM0 A;  1YT4 A;  5IT5 A;  3GVB A;  4CLC B;  3N7W A;  4GD8 A;  3ZFZ A;  5DFY A;  5TR7 A;  4Y0U A;  4Q8I A;  2BAS A;  1O7E A;  3A3E A;  2IA2 A;  4NG2 A;  4FSF A;  1S4S A;  1K56 D;  5GL9 A;  1F2K A;  1M6K A;  3AGF A;  1PNE A;  4Y0T A;  5MC7 A;  4Q0J A;  1I2S A;  3BJN A;  4EEP A;  2GJ3 A;  4IUH A;  2FZ0 A;  4S2M A;  1VQQ A;  4MEZ A;  1ZC2 A;  1XXM A;  5A91 A;  2ZQD A;  3KSG A;  3UPO A;  4MMN A;  1CJF A;  4UQI M;  1FSW A;  1MXO A;  1F5M A;  5L8M A;  4E04 A;  4F3L A;  1EW0 A;  2V8C A;  4Z9Q A;  1RP5 A;  3DWK A;  2J3T C;  3T4O A;  4S2I A;  3ZYT A;  4GN2 A;  3LIF A;  3W2Z A;  1ERM A;  4JF4 A;  3C30 A;  2R9W A;  3MXS A;  3UY6 A;  2JHE A;  5DF9 A;  5KSH A;  4HEF A;  4HQA A;  5LBR A;  1GSV A;  1KDS A;  3VP4 A;  5KMW A;  1BLS A;  5FI7 A;  1O07 A;  2QJ7 A;  5HAR A;  2XQZ A;  1MC0 A;  3FKW A;  3Q81 A;  1BTL A;  1DP6 A;  4CQH A;  1AXB A;  4OPQ A;  4R4S A;  5EVI C;  1BT5 A;  1ALQ A;  3JPU A;  4JPM A;  3B3X A;  3DTE A;  1K6R A;  1S4R A;  5FL3 A;  1XA7 A;  1H5X A;  3Q1F A;  4HJ4 A;  4K0X A;  4LCM A;  2JN7 A;  3BQA A;  3IXG A;  5TFQ A;  3HLB A;  4OPR A;  4NXG A;  2PHY A;  3Q7Z A;  3ZG5 A;  1G28 A;  2Y2L A;  3MZF A;  4IUK A;  3AGE A;  4JKT A;  4ZJ1 A;  3LR4 A;  2ZC3 B;  3UN7 A;  4HJ6 A;  4WN5 A;  2GZA A;  4JXG A;  1E25 A;  2Y4A A;  5EVI B;  3NOT C;  3VSL A;  5HDC A;  3NCK A;  4FUW A;  5HD3 A;  3W8K A;  3IH9 A;  3NJA A;  1CI9 A;  1YSP A;  4GW9 A;  4ZAM A;  1PI4 A;  2ZQ7 A;  4BMW A;  1JNU A;  1VHM A;  3O88 A;  1KGG A;  4HHD A;  2JKF A;  1OJ5 A;  5EPH A;  4Z1W A;  5DF8 A;  2V0U A;  3Q7V A;  2A24 A;  4BQM A;  1IYO A;  3F1N B;  3ZVW A;  3LI8 A;  2LB5 A;  4I39 A;  2HDU A;  5HZH A;  3VE3 A;  3BM6 A;  5CER A;  3CZD A;  4H6J B;  5GLA A;  2J7V A;  5EM0 A;  4ZJ2 A;  1ESU A;  2Q9N A;  1GA0 A;  5CGX A;  1YMX A;  4GDN A;  4Y5F A;  3N6I A;  2Y2N A;  3KYE A;  2B95 A;  1P97 A;  3BFG A;  1N9O A;  1ZTU A;  1N9B A;  4JF6 A;  3CPT B;  3ZDJ A;  3BFD A;  1GSX A;  2WK0 A;  1W8Y A;  3V50 A;  4P0M A;  5IS1 A;  3GRJ A;  2WKI A;  2R9X A;  3LR0 A;  4I3J A;  4YWZ A;  3QP1 A;  4IBR A;  5TJJ A;  1D06 A;  5A90 A;  4K08 A;  1SZV A;  1H8Y A;  3CWF A;  4X6T A;  1FSY A;  3LY4 A;  2P08 A;  4R1G A;  4RQ9 A;  1CK3 A;  3IH8 A;  5HL1 A;  1YAX A;  1Q2P A;  4JLF A;  2JKR M;  4DE1 A;  1S1Y A;  2NUP C;  5BOH A;  2FFY A;  1K6S A;  4PPR A;  3Q7V B;  4Y13 A;  4EW7 A;  2V2F F;  3EQV A;  2KOI A;  4ID4 A;  4HH2 A;  5FI2 A;  5AVE A;  4G3V A;  4XT2 B;  2DMW A;  2K31 A;  3QHY A;  5K5B A;  3CIT A;  3QP2 A;  3OCN A;  2P04 A;  3WRT A;  4GHI A;  1KGE A;  1BSG A;  3GQZ A;  2PYP A;  4L0L A;  4PM7 A;  2CC1 A;  4QB8 A;  2ACG A;  1FCO A;  3H82 A;  5HAP A;  4LV2 A;  4H8R A;  2PDR A;  2O9C A;  3RXX A;  4QY6 A;  1LL8 A;  1UWN X;  3UE3 A;  3D3O A;  5DKL A;  1K54 A;  3MQO A;  5EOO A;  4LRX C;  3T4K A;  2P74 A;  1H8M A;  3LCE A;  3EOI A;  2ZM8 A;  1IKI A;  4DDY A;  2WGW B;  4ZTK A;  3LIA A;  5F68 A;  3VP3 A;  1TS0 A;  4MN5 A;  3K3D A;  3T50 A;  2G2U A;  3IS2 A;  1PWG A;  3PAE A;  3HJI A;  3FPV A;  3HUO A;  4XUX A;  2X02 A;  1N4O A;  2ZQ8 A;  3M6H A;  2EWV A;  5FQK A;  3ZCZ A;  2EFX A;  1JWP A;  3NDG A;  1C3B A;  3A0V A;  4RX2 A;  4O01 A;  3TOI A;  5HD5 A;  4S2N A;  3UDX A;  2XRN A;  4OOL A;  3HLW A;  5FAQ A;  2PD8 A;  3FZC A;  1L0D A;  4PKY A;  3G34 A;  2ZC4 B;  2GX5 A;  3WWX A;  3PTE A;  1MKI A;  3GR2 A;  2VGK A;  3CG5 A;  3ZVT A;  1SHV A;  3MS6 A;  1CF0 A;  2QZ6 A;  2XGN A;  4EV4 A;  5GHZ A;  1K0K A;  3IT9 A;  2O9A A;  1XFQ A;  4GD6 A;  2M7U A;  5CGW A;  3R7W A;  3NOU C;  2XDM A;  3UB7 A;  4WMC A;  3H7W A;  4JGR A;  1FCM A;  4R4R A;  1NJ4 A;  5J3W A;  1J9M A;  4JBF A;  5FAT A;  4EBN A;  1PWD A;  4WEJ A;  1W63 M;  3G6O A;  4O7D A;  4OOM A;  1CI8 A;  1NY0 A;  4PM6 A;  1MY8 A;  4F94 A;  2DNS A;  2V8F A;  3SH8 A;  2XEP A;  4GOG A;  4G3K A;  3ZG9 B;  1NRF A;  4N1H A;  1YLP A;  4R3B A;  4PM9 A;  1YLZ A;  5DKK A;  5D3O A;  1NXY A;  1LT0 A;  4KUO A;  5F83 A; 
#chains in the Genus database with same CATH homology
 1MPL A;  2Y55 A;  1K56 D;  3G4P A;  2ZJ9 A;  4EWF A;  3A3D A;  5GL9 A;  4E3L A;  2OLU A;  2Y2O A;  1M6K A;  1JTG A;  4FH2 A;  1W79 A;  3Q07 A;  4DE0 A;  4BD1 A;  3PBS A;  3AGF A;  3PBQ A;  2A49 A;  4Y0T A;  3MKE A;  1I2S A;  3HLD A;  3E2L A;  3IWO A;  4P85 A;  2OV5 A;  3MZE A;  1LHY A;  3G2Z A;  1JWV A;  3NI9 A;  3S22 A;  3BFC A;  4S2M A;  1VQQ A;  4S2O A;  5E2H A;  1JWZ A;  4MEZ A;  1ZC2 A;  1SDE A;  2WGI A;  2Z2M B;  1XXM A;  5A91 A;  3ZHH A;  3VSK A;  1IYP A;  4EQI A;  2ZQD A;  3UDF A;  3UPO A;  1DJC A;  2XLN A;  4D2O A;  4BLM A;  1LL5 A;  3MXR A;  1YMS A;  1FSW A;  5CHJ A;  2IWC A;  1K54 C;  3VMA A;  4C3Q A;  1WE4 A;  3BLM A;  3HRE A;  3UE0 A;  1MXO A;  3UPN A;  2JBF A;  4Z9Q A;  1RP5 A;  3DWK A;  2HDR A;  1GHM A;  1TDG A;  1FR1 A;  1PWC A;  2ZMA A;  2XF3 A;  2RL3 A;  4NK3 A;  1ZKJ A;  4OQI A;  3GV9 A;  2IWD A;  4E3I A;  1CEG A;  1WYB A;  4S2I A;  1ONH A;  2XD5 A;  4GN2 A;  5FQI A;  1ERM A;  2J8Y A;  2PU4 A;  3S4X A;  3C7U A;  4JF4 A;  4IED A;  2JC7 A;  1HVB A;  1NZU A;  2R9W A;  1BLH A;  3ITA A;  4B88 A;  5EE8 A;  2Z2L B;  2ZQ9 A;  4Y7P A;  2OSU A;  1KDW A;  3HUM A;  4KZ5 A;  1E3U D;  3MXS A;  2E8I A;  4DF6 A;  3HLF A;  3UY6 A;  3OPL A;  4WYY A;  5DF9 A;  1EI5 A;  1IEM A;  4P6B A;  5KSC A;  5KSH A;  1DJB A;  3BEB A;  3C5A A;  4HEF A;  3C4O A;  5CTN A;  1NZO A;  1VM1 A;  4KZ4 A;  4OQH A;  1DJA A;  3NC8 A;  3SH9 A;  4KZ7 A;  4MBK A;  1FOF A;  3LY3 A;  3I7J A;  1KDS A;  2WGW A;  1S6R A;  3C7V A;  3VP4 A;  5KMW A;  1BLS A;  4MLL A;  5GHY A;  2B5R A;  2QPN A;  1PW1 A;  1O07 A;  4S2N C;  4UA6 A;  5FI7 A;  5HAR A;  5HW3 A;  5FQQ A;  2XQZ A;  2H0T A;  3P09 A;  2XR0 A;  3AGD A;  3N8R A;  3FKW A;  3Q81 A;  1BTL A;  5FAS A;  1AXB A;  4OPQ A;  4R4S A;  5EVI C;  1BT5 A;  2I72 A;  3IHA A;  3RJU A;  1L0E A;  1BLP A;  2Y2P A;  5FQ9 A;  1ALQ A;  1ERO A;  2EX2 A;  3N8S A;  4JPM A;  4ZJ3 A;  3B3X A;  3S1Y A;  3M2J A;  4MBF A;  4WZ5 A;  2EX6 A;  1K6R A;  3BYD A;  5DF7 A;  4LV3 A;  1GA9 A;  3HVF A;  3A3I A;  1LI0 A;  1MWU A;  1G68 A;  1XA7 A;  3ZGA B;  5JYO A;  1H5X A;  3Q1F A;  2XK1 A;  1K57 A;  2ZD8 A;  4IVK A;  4K0X A;  5IHV A;  4LCM A;  3FV7 A;  1PZP A;  3IXG A;  3V5M A;  1ES3 A;  1GCE A;  3BLS A;  4FCF A;  3HLB A;  4OPR A;  5TFQ A;  2IWB A;  5I94 A;  4K91 A;  1BUL A;  4N92 A;  4ZDX A;  2QMI A;  3Q7Z A;  1RGZ A;  3RXW A;  3ZG5 A;  1PW8 A;  1ES2 A;  1FR6 A;  2HP6 A;  2X71 A;  2Y2L A;  4LV1 A;  4X53 A;  3MZF A;  4BD0 A;  2VGJ A;  5GLD A;  3P98 A;  3AGE A;  3UNW A;  4JKT A;  4ZJ1 A;  2ZC3 B;  1ONG A;  1K25 A;  3UN7 A;  1KE0 A;  3TG9 A;  1RGY A;  4XUZ A;  4JXG A;  1E25 A;  2Y4A A;  5EVI B;  3ISG A;  3HL9 A;  3IHB A;  3BFE A;  3VSL A;  2Y2I A;  3NCK A;  3W8K A;  3HLE A;  2X01 A;  1ZG4 A;  2WZX A;  2WZZ A;  1CEF A;  3IH9 A;  1I2W A;  2JE5 A;  1CI9 A;  4ZAM A;  1KE3 A;  3IF6 A;  4BEN A;  1PI4 A;  2ZQ7 A;  4IBX A;  2ZQA A;  4JXV A;  3O88 A;  2J9P A;  1KVM A;  1IKG A;  4N9L A;  1KGG A;  3IWI A;  4RX3 A;  4Y0O A;  3M6B A;  5CTM A;  3IXB A;  2ZLY A;  5EPH A;  1ESI A;  5DF8 A;  4CPK A;  4MNR A;  3Q7V A;  1SKF A;  4BQM A;  1SCW A;  1IYO A;  1K56 A;  3ZVW A;  4M3K A;  4X56 A;  1YLJ A;  4PMA A;  2HDU A;  5HAI A;  3G30 A;  4FH4 A;  5E2F A;  3BM6 A;  3E2K A;  3WS1 A;  5CER A;  3CZD A;  5GLA A;  1FQG A;  3UE1 A;  2J7V A;  2Y2K A;  4ZJ2 A;  5E2G A;  4EBP A;  1ESU A;  3Q82 A;  4KZ3 A;  5U47 A;  1HTZ A;  2DRW A;  4PM5 A;  2Q9N A;  3IXD A;  3OCL A;  1GA0 A;  4S2J A;  5CGX A;  1YMX A;  2C5W B;  1DY6 A;  3IWQ A;  3N8L A;  4GDN A;  3N6I A;  1EWZ A;  2P9V A;  2Y2N A;  4RVA A;  4U0X A;  4EUZ A;  1E4D A;  4XXR A;  4E3J A;  2Y91 A;  4N1X A;  2PU2 A;  4QU3 A;  1MWT A;  4HES A;  3BFG A;  2C6W B;  1FCN A;  3D4F A;  4JF6 A;  1N9B A;  1H8Z A;  4UA9 A;  4OOY A;  5EVI D;  2EXB A;  3ZDJ A;  4C75 A;  1PYY A;  3BFD A;  4GDB A;  5L2F A;  1ES4 A;  3JYI A;  2WK0 A;  3GTC A;  4KZB A;  1W8Y A;  3V50 A;  4P0M A;  3DW0 A;  3HBR A;  4FD8 A;  3GRJ A;  3SS4 A;  2WKI A;  2WUQ A;  5A93 A;  1ES5 A;  2R9X A;  4OON A;  1K38 A;  4KZA A;  4WEK A;  5EOE A;  4LCL A;  3IXH A;  3OPH A;  3A3F A;  1JTD A;  4IBR A;  1SDN A;  4KQR A;  5F83 A;  5A90 A;  3V3S A;  4DXC A;  2HPB A;  1H8Y A;  2XH9 A;  4X6T A;  1YQS A;  1FSY A;  3LY4 A;  2WGV A;  1YLY A;  3MZD A;  1HZO A;  4R1G A;  5FQM A;  1E3U A;  1CK3 A;  2A3U A;  3MFD A;  3IH8 A;  3IQA A;  3W4Q A;  5HL1 A;  4UHU A;  2EX8 A;  4KZ9 A;  1Q2P A;  4JLF A;  4E6W A;  4WMC D;  4CJN A;  5JYP A;  3ZG0 A;  3MKF A;  4HBT A;  4RA7 A;  3ZG8 B;  3VOY A;  4DE1 A;  2EXA A;  4ZBE A;  3G31 A;  2V1Z A;  4BL3 A;  4X68 A;  1PZO A;  3HLG A;  3OC2 A;  5BOH A;  2FFY A;  5E2E A;  1M40 A;  1K6S A;  1QMF A;  1YLW A;  4PPR A;  3Q7V B;  4RYE A;  5HFO A;  1XP4 A;  5CEB A;  5TGF A;  1YM1 A;  1XKZ A;  1Y54 A;  2V2F F;  3BFF A;  1KVL A;  1PI5 A;  3EQV A;  4R0Q A;  5HAQ A;  4ID4 A;  1S0W A;  2UWX A;  5FI2 A;  2WKH A;  2WAF A;  2G2W A;  1TDL A;  3NIA A;  2Y2J A;  5GHX A;  2ZC6 B;  3QHY A;  4A5R A;  2BLS A;  4U3T A;  4IVI A;  5FA7 A;  1XGJ A;  3OCN A;  3SS3 A;  5CGS A;  4OPY A;  1MWR A;  3VFH A;  2P9V B;  4E3N A;  3HUN A;  1XPB A;  2EX9 A;  4OP5 A;  1W5D A;  3WRT A;  4KG5 A;  4OP8 A;  2HDQ A;  1KGE A;  1BSG A;  3OZH A;  3GQZ A;  5AQ9 A;  1LL9 A;  2ZQC A;  2WAE A;  4NET A;  1L0F A;  4L0L A;  4WZ4 A;  1IYS A;  3FWL A;  4PM7 A;  3ZNY A;  2CC1 A;  5EEC A;  4DKI A;  4QB8 A;  3UO9 A;  3LO7 A;  4DRT A;  1FCO A;  5EUA A;  5M18 A;  4E3M A;  5HAP A;  3HLC A;  4UAA A;  4E6X A;  4LV2 A;  4H8R A;  4KQQ A;  3PAG A;  4WZ5 C;  4P87 A;  4X69 A;  3G35 A;  3RXX A;  1G6A A;  3DTM A;  4B4X A;  1NYM A;  1LLB A;  4QY6 A;  3NDE A;  3UE3 A;  2V20 A;  1NYY A;  2JCH A;  1K57 C;  5F1G A;  4BL2 A;  1KGF A;  3SOI A;  2H10 A;  1K54 A;  4R23 A;  4GZB A;  1IYQ A;  2BG1 A;  5EOO A;  4EBL A;  5DVA A;  3ITB A;  2P74 A;  5FI6 A;  4N9K A;  3LCE A;  4OLG A;  4QY5 A;  5KZH A;  4GB7 A;  3ZNT A;  5AQA A;  5A92 A;  3ZG7 B;  4GKU A;  3WS5 A;  4S2K A;  1IEL A;  2ZM8 A;  1IKI A;  1GHI A;  3O87 A;  4DDY A;  2WGW B;  4ZTK A;  1K4E A;  1TEM A;  1BLC A;  4WM9 A;  5EVL A;  4LV0 A;  3VP3 A;  1XX2 A;  2ZC5 B;  1HD8 A;  1LI9 A;  5CXW A;  5J8X A;  1ZG6 A;  2EFU A;  4KZ6 A;  3SH7 A;  5AQB A;  3W4O A;  2Y2G A;  1XA1 A;  2HP9 A;  5DTS A;  2G2U A;  4S2P A;  4WBG A;  3V3R A;  1MBL A;  1PIO A;  3TSG A;  1U60 A;  1PWG A;  2Y2Q A;  4QHC A;  3PAE A;  3PBT A;  4DDS A;  5CEC A;  3A3J A;  2GDN A;  4OH0 A;  3HUO A;  4XUX A;  2X02 A;  5CRF A;  3IF6 C;  1I5Q A;  1JVJ A;  1N4O A;  2ZQ8 A;  3M6H A;  4R3J A;  5FDH A;  5FQK A;  3WS2 A;  3ZCZ A;  3V39 A;  3N4I A;  5FQJ A;  2EFX A;  1JWP A;  3NDG A;  5GLB A;  4B4Z A;  4OPZ A;  1C3B A;  4K0W A;  4RX2 A;  5CHU A;  1YLT A;  5G18 A;  3TOI A;  4OVD A;  3WS4 A;  1BZA A;  4S2N A;  3UDX A;  3OPR A;  4GNU A;  3VP2 A;  3G2Y A;  3VFF A;  3C4P A;  2H5S A;  4OOL A;  3HLW A;  3VOZ A;  3NY4 A;  2XFS A;  2ZC7 A;  5EVI A;  5FAQ A;  1L2S A;  1MWS A;  3FZC A;  1L0D A;  5AQ7 A;  3OPP A;  4MBH A;  4JXW A;  5M1A A;  3G34 A;  2H0Y A;  2Y59 A;  2ZC4 B;  3WWX A;  3PTE A;  1MKI A;  4WEL A;  3GR2 A;  4JXS A;  2VGK A;  3CG5 A;  4E3O A;  3ZVT A;  4OKP A;  1SHV A;  3GMW A;  2QZ6 A;  3M2K A;  4LEN A;  4C6Y A;  2XGN A;  3O3V A;  4EV4 A;  4QD4 A;  3BRM A;  2PBY A;  5GHZ A;  4YFM A;  3CMZ A;  1Z6F A;  3IT9 A;  3G32 A;  3LEZ A;  5DTT A;  2RCX A;  4QJG A;  3UDI A;  3IF6 B;  1RCJ A;  4GD6 A;  2Q9M A;  3FYZ A;  3PBR A;  3W4P A;  3BEC A;  4DE3 A;  3VP1 A;  3SS5 A;  5CGW A;  4JF5 A;  4PM8 A;  2XFT A;  2XDM A;  3VP0 A;  4WMC A;  1GHP A;  2ZM2 A;  4DXB A;  4KQO A;  1BUE A;  1FCM A;  5HX9 A;  4R4R A;  2WAD A;  1TVF A;  1ERQ A;  2WYX A;  1XGI A;  2Y2H A;  4OQG A;  3FKV A;  1NJ4 A;  4KEN B;  5FAO A;  5CED A;  1K55 A;  4X55 A;  1J9M A;  2J9O A;  5E43 A;  4JBF A;  5FAT A;  4KZ8 A;  3QNC A;  3DWZ A;  5DTK A;  4S2L A;  4EBN A;  1PWD A;  4KG2 A;  4WEJ A;  4KG6 A;  5GLC A;  4O7D A;  4OOM A;  1W7F A;  5F82 A;  2Y2M A;  1CI8 A;  4OLD A;  4DE2 A;  3PBO A;  1NY0 A;  2XD1 A;  3UPP A;  1L0G A;  4PM6 A;  1MY8 A;  5FAP A;  4HBU A;  4F94 A;  1QME A;  1K4F A;  3WRZ A;  1W8Q A;  2DNS A;  5FSR A;  2HDS A;  4E3K A;  3SH8 A;  2OLV A;  1KE4 A;  3IF5 A;  4UA7 A;  2XEP A;  4GOG A;  3CJM A;  3PBN A;  1OME A;  3GSG A;  2DCF A;  1Q2Q A;  2ZM0 A;  1YT4 A;  3ZG9 B;  5F1F A;  1NRF A;  4N1H A;  1YLP A;  3GVB A;  4R3B A;  4U0T A;  3WS0 A;  4BJP A;  3N7W A;  3QNB A;  3NBL A;  3MBZ A;  4GD8 A;  4OQ0 A;  4YIN A;  3ZFZ A;  2HP5 A;  5TR7 A;  4Y0U A;  3EQU A;  4PM9 A;  5CHM A;  2WKE A;  1YLZ A;  4Q8I A;  5D3O A;  5M19 A;  1NXY A;  1O7E A;  3A3E A;  1K55 C;  2FFF B;  1WYC A;  4FSF A;  3O86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...