3F1OB

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains, with an internally-bound artificial ligand
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
VCQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endothelial PAS domain-containing protein 1
publication title Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 30
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3f1oB01
2QWSA 2D01A 3ULFA 4EESA 1TS8A 3BY9A 2KDKA 3T50A 5IS1A 4HP9A 3LI8A 5G4ZA 3ICYA 1ODVA 2OWJA 3BWLA 3SW1A 4JGQA 5HDCA 3H82B 4M4XA 1S1YA 3FG8A 5DJUA 1F9IA 1DRMA 3G6OA 1GSXA 2A24A 1N9LA 2JHEA 2B02A 3C2WA 4EXOA 4LRZE 1XFQA 3MXQA 4GS9B 1VB6A 4HJ3A 3LIBA 3K3DA 2L0WA 3MJQA 1MZUA 5KIZA 3RH8B 3KX0X 1LSWA 1OTDA 4HJ6A 2V9AA 5HSQA 1P97A 2Z6CA 2PHYA 1KOUA 4EEUA 3PHYA 3F1NB 3GDIA 4DJ2A 2V1AA 3NOUC 1N9OA 4HIAA 4GCZA 2V1BA 5HZHA 1OTIA 4HJ4A 1OJ5A 3LI9A 5DJTA 3IBRA 4HH3A 4I3AA 5J4EA 1GSVA 2QJ7A 1OTBA 3P7NA 1OT6A 1N9NA 3NJAA 3PYPA 4XT2A 3RTYA 5HWTA 4NXFA 1V9ZA 4GHIB 4H6JB 2VV7A 1X0OA 2QKPA 3UB8A 5HD3A 3H7WA 4HNBA 2D02A 4E04A 1G28A 4HP4A 4EW7A 4PKYG 1LSXA 3UB7A 3D72A 3IS2B 4JGRA 5HD5A 3UB6A 2Z6DA 4L9GA 1XJ2A 1T1AA 1DP6A 1TS0A 2M1CA 4WN5A 4LRYC 1TS7A 4I38A 3E4QA 3MFXA 4R38A 5F6AA 3NOPC 4NXGA 3H82A 2R78A 3HJIA 3A0RA 2ZOIA 4NXEA 3HJKA 1F98A 5EFWA 2WKQA 1BYWA 2VV8A 3BY8A 2W27A 3LIFA 3LIEA 3MR0A 2JN7A 1OTEA 2PR5A 3LIAA 2VEAA 5HWWA 1DP9A 5I5LA 1V9YA 4DJ3A 2OWHA 3GECA 3VE4A 4I3IA 2V0UA 3UE6A 5A8BA 2GJ3A 4HQAA 1S4SA 4YWZA 4GW9A 3FC7A 5TBMB 4R70A 4BBUA 3F1PA 1S4RA 1Y28A 4MN6A 2YKHA 1D7EA 3ZQ5A 2PD7A 3UB9A 2PYPA 3LICA 2V0WA 1P0ZA 3EWKA 2VV6A 3CLOA 1D06A 4BBVA 1UGUA 4KQDA 5J3WA 4JGOA 4XT2B 2WKRA 4RQ9A 1NWZA 3LUQA 3NHQA 4MN5A 3IS2A 4EETB 3A0VA 4F3LB 4PKYA 3F1OB 2H28A 1UWPX 1UWNX 1LT0A 4HOIA 5DKLA 4I5SA 4WUJA 4EERA 4HY8A 5F5YA 5IU1A 4I39A 3UMEA 4EQ1A 5HDSA 4NXBA 1XJ3A 4WL9A 4WF0A 1T19A 1LL8A 4GS9A 1S67L 1TS6A 4BBTA 4LRXC 5AVFA 1WA9A 2ZBBA 2INWA 2PD8A 2KX6A 4K08A 1OTAA 3K3CA 2A24B 2L1MA 2YKFA 2K7SA 3B33A 1XJ4A 3F1NA 3LYXA 4L9EA 2ZOHA 5F69A 2OOLA 1OT9A 2W0NA 3CAXA 2VLGA 5TBMA 2L4RA 4R6LA 1XJ6A 5HDDA 4LPZA 3LIDA 1T18A 3H9WA 3E4PA 4WLAA 3VOLA 5F68A 4I3JA 3C8CA 4R3AA 1DP8A 5J7EA 1T1BA 3E4OA 5G4YA 1S66L 4GHIA 1EW0A 4H6JA 4L9FA 3F1PB 2PDRA 2EA9A 3NOTC 3UMDA 3MQQA 4HI4A 2CMNA 2QJ5A 1XFNA 2HV1A 4KUOA 1LSVA 3OLOA 2J80A 5HWVA 2WKPA 3VE3A 2QHKA 4HHDA 2PR6A 5AVEA 3CWFA 4HH2A 3MQOA 1JNUA 4LLOB 4KUKA 2P7JA 1T1CA 4F3LA 2I9VA 3H7WB 3F1OA 2PYRA 3A0SA 2BASA 4EEPA 1GSWA 4JGPA 1S1ZA 4B9OA 5DKKA 3EEHA 1OJGA
chains in the Genus database with same CATH superfamily
2D01A 3AGFA 1K54C 1YLYA 2B95A 2WKEA 5FQ9A 4Q0JA 4WM9A 4IBXA 2J3WA 3MZEA 3ICYA 1ODVA 1HZOA 3SW1A 1HD8A 4JGQA 3N6IA 2JKFA 3G30A 3H82B 3VP2A 3BEBA 4N92A 1VEUA 2Y2PA 2VKSA 5EVID 1KGGA 3HUOA 1GSXA 2A24A 2FZ0A 3G2YA 3DTIA 2B02A 4P6ZM 3NIAA 1MBLA 3A3IA 2JE5A 1JWVA 3K3DA 2VK3A 3RH8B 2XD1A 1K4FA 2GZAA 3Q1FA 4H8RA 2V9AA 3LY4A 4OOLA 4LV3A 3F1NB 1BLCA 2V1AA 4X25A 4Y0OA 2EXBA 3A3DA 3WWXA 3UY6A 4HBTA 2HDUA 4G3KA 2IA2A 3G31A 2XGNA 2Y8HA 3QP5A 1VM1A 4X56A 5L07A 3HBRA 2EWVA 4OONA 1NZOA 3V5MA 1IKIA 5L09A 3MSHA 3MF0A 3IH9A 1FCMA 4HJ4A 5DJTA 3JVVA 4GLQA 3R4KA 3N4IA 4M3KA 1NZUA 4HH3A 4I3AA 1GSVA 5FAQA 1FQGA 1OTBA 5EE8A 4IVKA 1N9NA 5HFOA 3PYPA 5FQQA 2XRNA 1V9ZA 4ETXA 2CC1A 4E3NA 3OCNA 4OH0A 1J9MA 3IWQA 4GKUA 3SH8A 5U47A 3PBTA 5FI6A 5HD3A 3H7WA 4WZ4A 1G28A 3GMWA 5C5KA 1HTZA 5IT5A 3ITBA 3FWLA 2ZQ7A 2A3UA 4O0PA 3C4PA 4Y5FA 3IS2B 4IEDA 4JGRA 5HD5A 4ZTKA 3UB6A 5I94A 2ZQCA 3WS4A 2MJ6A 2Z6DA 3MZDA 2B5RA 1MWRA 3LGOA 4DXBA 3SS3A 3VSLA 2OLVA 4XUZA 3IWOA 4KZ3A 2HP9A 4OLGA 5KSCA 4CLCC 4S2MA 3VP3A 4ME4A 4X53A 4X69A 4YINA 3HJIA 1NY0A 2B18A 3O5YA 3HJKA 3BRMA 2E8IA 1YLJA 2ZC7A 4NEED 2XR0A 1I5QA 2VV8A 5EM0A 5FQJA 2W27A 1L0FA 4OPQA 4BL2A 3BQAA 3LIEA 5EPHA 1Z09A 4EQIA 4BMWA 1VETB 3IXBA 3ZNTA 4ARZA 4K0WA 1LI9A 4MNRA 1PWGA 1FCNA 3LIAA 1L0DA 1PI4A 4PMAA 2A2LA 3IF6B 5I5LA 2Q9NA 4FH2A 1SZVA 4Y3IA 3GECA 1K4EA 4I3IA 5A8BA 2HJ9C 4E3MA 3FC7A 5TBMB 2BLSA 4R70A 4BBUA 2IWBA 1IOUA 1Y28A 2Y2MA 4MN6A 2YKHA 1D7EA 3C5AA 2PD7A 4LV2A 5CTNA 2PYPA 3NI9A 3LICA 4ZJ2A 1IYQA 1I2SA 5FI7A 2LB5A 1KE4A 3VFFA 3KSHA 3EWKA 1ZG4A 2ZMAA 2PBYA 4LCMA 2ZC4B 1UGUA 3B3XA 3OZHA 3LR5A 3BYDA 3HLEA 3QP2A 4XT2B 2WKRA 2WADA 2KLIA 2O99A 4JPMA 2W1TB 1N9BA 1I2WA 3KYZA 5EECA 4EETB 2XF3A 2PAVP 3HLFA 3HLGA 3BECA 1IFQA 1TF1A 3FV7A 1ES5A 4JXSA 4OOMA 2HJEA 3KO6A 5LBRA 2WZXA 5DKLA 4I5SA 4WUJA 4EERA 3T4KA 2WAEA 4HY8A 5DVAA 3VP0A 4JKTA 3OPRA 1YLZA 4I39A 4WZ5C 4MBFA 3NC8A 4NXBA 4WZ5A 3RFBA 3BFEA 2EFXA 4WL9A 2G7UA 2DCFA 2J7VA 5FA7A 1TDGA 3M6BA 3OPHA 4LRXC 1NLYA 4PM9A 1WA9A 5CECA 2PD8A 4OOYA 4K08A 1OTAA 2IWCA 3DBAA 4RX2A 1EWZA 4WMCA 3FYZA 1L3LA 2YKFA 3R7WB 3CITA 1XKZA 5F69A 4IJGA 4EBNA 2RCXA 3CAXA 3CMZA 3T4OA 2XLNA 4OQ0A 1SDNA 4LPZA 4PM7A 4S2JA 4QD4A 1T18A 3LFVA 3E4PA 4I3JA 3C8CA 1NXYA 5E2GA 4P0MA 5J7EA 5E2EA 2HP5A 4Y7PA 5GLBA 4H6JA 1EW0A 4EBPA 2XFTA 2PDRA 5DFYA 4L0LA 2M7UA 3UE1A 3B47A 3UMDA 4DF6A 4KG6A 2CMNA 1XFNA 5MC7A 1VQQA 3N8RA 4KUOA 1VHMA 3ZG0A 4QPRA 5E2HA 3AGEA 1TDLA 1XPBA 2J80A 4KG2A 1Q2PA 5TR7A 5FEGA 3VE3A 2ZC6B 4IHQA 4MMNA 4GD8A 5AVEA 4HH2A 4OP5A 1YAXA 3KSGA 2O0YA 4F3LA 2I9VA 5L8MA 2VX8A 5DTTA 2PYRA 3A0SA 3T1RA 4DMZA 1BLHA 4JGPA 4DDSA 1S1ZA 4B9OA 1JVJA 2XQZA 1XA1A 5TJJA 3ULFA 1L0EA 2KOIA 4G3WA 3PTEA 4EESA 4MN7A 3ZVTA 1ACFA 1GHIA 3BY9A 1QMFA 3LEQA 3TW8A 3W2ZA 1PW1A 4HP9A 4R1GA 3PBQA 5G4ZA 2OWJA 4U0TA 4NK3A 3UPOA 3LCEA 5A91A 5HW3A 1S1YA 3HLDA 2H0TA 2I72A 4LV0A 4KZ9A 5CEBA 3PBOA 3G6OA 4D2OA 2Z2MB 3T4JA 4EXOA 3BW6A 2UV0E 4K0XA 2ZM8A 4R4SA 3LIBA 3SS4A 2L0WA 4X55A 5CGSA 3DTKA 1MZUA 5KIZA 3T4QA 1Y54A 2Y91A 3KX0X 1LSWA 1MC0A 1WYBA 3RJUA 1MWSA 4HJ6A 3UPNA 1SKOA 5HSQA 3O87A 1W63M 4WELA 1ES2A 5CHMA 3T1QB 3PXPA 4EEUA 3PHYA 2WK0A 2ZL1B 3NDGA 1G6AA 4QB8A 5CHUA 1YQSA 4HIAA 4PM8A 4GCZA 5CGWA 1G6OA 3EOIA 1SKFA 4E3OA 2JKTI 5L10A 2Y59A 3OPLA 1OJ5A 3T1SA 3O88A 2EX2A 1PYYA 3P7NA 1Q2QA 3NJAA 2OLUA 3WRTA 1ESUA 4NXFA 1G5UA 2Y2IA 4RA7A 2VV7A 2QKPA 3UB8A 1NRFA 4HNBA 4RX3A 4QWOA 4CQHA 3BQ8A 4UQIS 2ZQAA 2Q0OA 2OV5A 1K38A 4NKPA 4CLCD 4HP4A 4PKYG 1HVBA 1LSXA 3UB7A 3SS5A 1HLUP 4BD1A 2GX5A 4BWIA 4UA9A 1H8ZA 1ES3A 1W5DA 3TOIA 3VSKA 2XD5A 1K54A 5EOEA 4E3JA 4KZ4A 3UE0A 5CXWA 1T1AA 2X02A 3MXSA 2JKRI 4DRTA 1TS0A 2Y2NA 5HAQA 3A3FA 1E4DA 4UA7A 4DE3A 3E4QA 3L7HA 4R38A 1GCEA 1PZPA 5F6AA 3NOPC 3H82A 3G35A 2R78A 4Y2FA 1CJFA 3ZVWA 5DTSA 2W3FA 1XGIA 2V1ZA 3A0RA 1TVFA 2ZOIA 2WGIA 3V67A 3C4OA 3IXGA 2WKQA 4BJPA 2XA7S 3S1YA 4RVAA 1BYWA 1DJAA 4E3IA 4KZ5A 4PM5A 1QMEA 1ERMA 1VEUB 2ZQ9A 1F5MA 1CQAA 5GLCA 3OOVA 1FILA 2PR5A 2Y2HA 4S2PA 1E3UA 1RGYA 1V9YA 2EX8A 3OC2A 2ZJ9A 4DJ3A 5HPIA 3VE4A 1P9RA 1BZAA 2HDRA 1S4SA 4ZDXA 2PBDP 2QPNA 3ZDJA 3ZQ5A 3SH9A 4FD8A 3UB9A 3B42A 5CERA 5GLAA 4E6WA 3CPTB 3RXXA 3ZNYA 3QP6A 5CTMA 2GDNA 2VV6A 3UN7A 1O7EA 2WKHA 4KQDA 2ZM2A 2WGVA 3Q7VB 4JGOA 4JBFA 3PBSA 1Y4OA 3VFHA 3NHQA 4MN5A 4IVIA 3IS2A 3HL9A 4O01A 3A0VA 4PKYA 1PNEA 3F1OB 2H28A 4DXCA 1UWPX 1YMSA 1UWNX 3JYIA 2PU2A 4Y0UA 3GRJA 4CLCA 1MKIA 3CHWP 1GHMA 3M6HA 4FCFA 4WMCD 2ZLYA 4XXRA 3GR2A 2VJWA 2P04A 3WS5A 1H3QA 4ZRRA 3A3EA 1XX2A 5HPFA 1XJ3A 2O9BA 1ZC2A 1T19A 1SCWA 3UDIA 1LL8A 4GS9A 1S67L 1YSQA 3SOIA 3G2ZA 1W8QA 4Y0TA 3VV4A 1VETA 3EEAA 2ZD8A 5AVFA 2ZBBA 2INWA 3LEZA 3IF6C 2H0YA 5JYPA 2XSSA 1NYYA 3K3CA 2QZ6A 2O9AA 3G4PA 1G68A 2A49A 2P08A 5FEFA 2PU4A 4WEKA 1FR1A 3LO7A 2XH9A 2OOLA 2W0NA 2VLGA 3V3SA 5TBMA 2L4RA 4R6LA 5DFXA 4HEFA 5EVIB 4UQIM 4X1LA 5FQKA 5FQMA 5L2FA 2FFYA 4X68A 1T1BA 4WBGA 4GHIA 4L9FA 4R23A 4ZJ3A 3PAEA 3UO9A 3IXHA 3MMHA 3NOTC 2AVXA 2ZMFA 4JXWA 3G34A 3FPVA 1S6RA 1ZHHB 5FL3A 4MBKA 2W1TA 4BENA 4R4RA 1KDWA 2XA7M 5DF9A 3U4LP 2P7JA 4CLCE 1ESIA 1XXMA 4Q0IA 2O9CA 4S2IA 3GVBA 4RYEA 4EEPA 3W4OA 4GDNA 3EEHA 1OJGA 4EW7A 2QWSA 4IUKA 5CEDA 1O07A 5DF7A 1KE0A 4EWFA 2J3TC 1FSYA 2Y2OA 1K56D 4KZAA 1CK3A 3A3JA 4KZBA 4LV1A 3CG5A 2JC7A 4M4XA 3IHAA 1NJ4A 3HLWA 1CI9A 1LLBA 3FG8A 5D3OA 5DJUA 4JLFA 1DRMA 4PHTA 2JHEA 2QYBA 3KSFA 4IBRA 2EX9A 3PAGA 3MXQA 1VB6A 4O8GA 3MJQA 4MLLA 1FOFA 4NETA 1H5XA 1OTDA 4GD6A 3BLSA 3DW0A 1P97A 2WZZA 2JKGA 3Q7ZA 3T1XA 1MXOA 5F1GA 4EV4A 1YPRA 3GDIA 1LL5A 4DJ2A 1N9OA 3GSGA 4GOGA 3S7PA 4OP8A 5CRFA 1YSPA 2XEPA 3WRZA 3N8LA 2WGWA 2V1BA 1BSGA 2Y4AA 2W1RA 1CEGA 2PRFA 2GNXA 4UAAA 3IBRA 2J9OA 4GZBA 4OQGA 5J4EA 2QJ7A 4OPRA 3IQAA 3JVUA 3HVFA 3E2LA 3WS1A 2K2NA 2W3HA 4H6JB 3QNCA 3UDXA 1ONGA 1MWTA 1X0OA 1XA7A 1NRJA 2FFFB 4E04A 3ZGAB 3TJZC 1WE4A 2ZQDA 3ZCZA 1ZTUA 2DMWA 2H10A 2QMIA 3O86A 4U0XA 4R3BA 1BLPA 4WEJA 1CF0A 2XDMA 4L9GA 1IELA 5GLDA 2H5SA 1GA0A 1DP6A 5FSRA 3S7QA 2DRWA 2HDSA 4KZ8A 4LRYC 1TS7A 1PRQA 3QP8A 1MKMA 4B4ZA 4II7A 3S7NA 2OSUA 3O3VA 4NXEA 1E3UD 5EFWA 4N9KA 3ITAA 3VOYA 3BFDA 4JXGA 4FOFA 4ZJ1A 3BY8A 2P9VA 1K56A 1W7FA 3LIFA 3ZG5A 2X71A 5F83A 3P98A 1U60A 2C5WB 5M19A 4CPKA 2EXAA 2VGLS 2JN7A 1OTEA 2Y79A 3EQVA 2VEAA 1FIKA 5HWWA 1EROA 5KSHA 4KENB 1DP9A 3HCYA 1K57C 1ZG6A 2XK1A 2OWHA 2Y2QA 4UEYA 1DY6A 3UE6A 2GJ3A 4ZAMA 4YWZA 4GW9A 3TRCA 1SKOB 3LR3A 3VMAA 2FH5A 4EBLA 3F1PA 1S4RA 5G18A 3MBZA 4OPZA 4PAUA 1ZKJA 2HGVA 4XUXA 1M40A 1TD5A 4P6BA 4KZ7A 4ZBEA 2Z2LB 2W3EA 3MQ0A 5GHYA 3CJMA 3E2KA 2V0WA 2XFSA 2NUPC 3IX4A 2WYXA 3BLMA 3CLOA 3BFFA 4BBVA 4KG5A 2HP6A 1BLSA 2EFUA 1YMXA 4X6TA 3NULA 1KDSA 3LUQA 3I7JA 3IT9A 5AQ9A 3T4LA 5AJGA 1J3WA 3VOZA 4C3QA 4DE1A 2NUTC 1LT0A 4OQIA 2V20A 1XGJA 3IH8A 1M6KA 1S0WA 4UHUA 4FSFA 1BT5A 1C3BA 3BFCA 4F94A 4Z9QA 5F5YA 3VP1A 1JTGA 2WKIA 4Y15A 3UMEA 3V39A 1W8YA 3ZHHA 2JKTM 4B93A 3Q07A 2Q9MA 1TS6A 1YLTA 1OPXA 4GNUA 3IF5A 2KX6A 1LI0A 2JCHA 2A24B 3L9KA 2L1MA 5HARA 1BUEA 3TSGA 3OCLA 2K7SA 3B33A 3T4SA 1N4OA 3KSIA 1XJ4A 3F1NA 5HX9A 1YLWA 3LYXA 2ZOHA 3MS6A 5A93A 5J8XA 1Z6FA 4PPRA 2EWWA 1LHYA 3LR4A 3MZFA 5TFQA 2HPBA 3W8KA 1XJ6A 1K6SA 2OAQ1 2V8CA 5BOHA 3LIDA 4DDYA 3H9WA 3ZYTA 4OQHA 4WLAA 2IWDA 1IYSA 3C30A 5F68A 4MBHA 4R3AA 3C7UA 4BL3A 5TGFA 1DP8A 2JKRM 5AQ7A 5G4YA 2LB9A 1S66L 3CPTA 4ETZA 4OKPA 4K91A 4OPYA 1GA9A 1FSWA 3UNWA 1L0GA 3KYEA 3CUEC 1DJCA 2QJ5A 1STZA 2HV1A 3CUEA 3OLOA 3Q7VA 1BULA 3ZG7B 3P01A 4MCWA 1MWUA 4JF4A 2ACGA 3CWFA 4QY6A 3MQOA 2DNSA 5FQIA 1JNUA 2R9XA 3IXDA 2J3TD 1K6RA 1K0KA 1T1CA 4GN2A 3H7WB 3HREA 2W3DA 3F1OA 4N9LA 4IUHA 5E2FA 5F82A 2VGLM 1GSWA 3WS2A 5K5BA 4QJGA 2UWXA 5DKKA 3W4PA 3HUNA 2VGKA 2VGJA 1TS8A 2Y2LA 5EUAA 4OVDA 2KDKA 3QP4A 3T50A 5IS1A 4E6XA 4R0QA 3ISGA 3LI8A 3BWLA 4E3LA 1TEMA 1ALQA 1P9WA 2K31A 3Q81A 5FASA 5EVLA 5HAPA 5HDCA 1ES4A 2G2WA 4CLCB 4OLDA 2ZMVA 4C75A 1F9IA 3IBJA 3C7VA 1N9LA 3DTEA 3IF6A 3C2WA 4LENA 4LRZE 1XFQA 4GJ4A 4KQQA 5CGXA 4GS9B 4S2KA 4HJ3A 2XROA 5AQAA 3EGDC 1H8MA 2BG1A 4ARZB 1BTLA 5CX7A 5EVIC 3NBLA 1OMEA 2Z6CA 4FUWA 3D9YA 5EVIA 2PHYA 3LR0A 5EM1A 1KOUA 2HZ5A 2W3GA 3DWZA 3NOUC 3G32A 3MKFA 4Z1WA 4JF6A 1W63Q 3PR6A 1MY8A 4EUVA 4Q8IA 5HZHA 4PM6A 2Y2JA 1OTIA 2WAFA 3OPPA 1D1JA 4GDBA 5A90A 3IHBA 3LI9A 3E0YA 3KYQA 5EOOA 3ZG9B 3AGDA 1KGEA 4A5RA 1OT6A 4AFIA 1SDEA 4XT2A 3D4FA 3RTYA 5HWTA 1AWIA 5GHXA 3BJNA 4O7DA 4YOFA 4G3VA 3SZTA 2VZWA 4GHIB 3RXWA 4EUZA 4P85A 2D02A 5EVEA 1YLPA 4WYYA 3DAVA 4ESPA 3EQUA 1PIOA 5FI2A 5DTKA 3TG9A 3MKEA 2PT7A 3N8SA 4LCLA 3D72A 3FZCA 3PBRA 4S2LA 5JYOA 1WYCA 3FKVA 1RCJA 4BQMA 1XJ2A 1CEFA 1PW8A 5GHZA 1KVLA 5M1AA 2M1CA 1E25A 4WN5A 1A0KA 4I38A 2Y2KA 3LY3A 3MFXA 4NXGA 3UDFA 4FTXA 3N7WA 2Y55A 5FAPA 3SH7A 3FPWA 4JXVA 1F98A 1IKGA 5DF8A 4EU0A 4DKIA 5F1FA 5KMWA 4Y13A 2M7VA 2V2FF 2C6WB 1RGZA 3R7WA 3MR0A 3DWKA 3E98A 3HUMA 3QP1A 2ZQ8A 3GV9A 5GL9A 1ONHA 2R9WA 4N1XA 4DN0A 1KVMA 4NG2A 3IWIA 4R3JA 2RL3A 3FKWA 1W79A 1K25A 3CI6A 4S2OA 2P74A 2V0UA 4HQAA 4GB7A 5FATA 3PBNA 3S7OA 1H0MA 1PFLA 4MDZA 3D3OA 1DJBA 3V50A 4P6ZS 1LL9A 2BTFP 3T12B 3ZG8B 1EI5A 2WGWB 2G2UA 3GTCA 1JTDA 1F2KA 1P0ZA 1KGFA 5HL1A 3HLCA 1IEMA 1D06A 4FH4A 2EX6A 3W4QA 1JWZA 4BD0A 3OBFA 2ZM0A 5FDHA 1NYMA 3V3RA 4C6YA 5J3WA 1IYOA 4Q0HA 1H8YA 4RQ9A 3Q82A 1NWZA 1PWDA 1RP5A 5FDSA 2VA0A 2HF6A 3NECA 4P87A 5E43A 2X01A 4UA6A 4F3LB 5M18A 1MPLA 5CHJA 3T4TA 3ZFZA 4N1HA 2OAP1 4BLMA 3M2JA 3TE8A 4HOIA 2Y2GA 2J8YA 4D60A 3S22A 3VP4A 4HBUA 4X1MA 1PWCA 5IU1A 2HDQA 1SHVA 1YM1A 1FR6A 4EQ1A 5HDSA 4YNRA 3BFGA 4DE0A 4E3KA 3WS0A 3IX8A 3MFDA 4WF0A 4CJNA 4B88A 3M2KA 4BBTA 3NY4A 2ZC5B 4LFUA 3S4XA 1KE3A 3P09A 2E8JA 5HL6A 4S2NC 4QY5A 2P9VB 1NLZA 4KQRA 1YT4A 3IX3A 4S2NA 5FAOA 5KZHA 2ZL1A 3U2AA 1K57A 4JF5A 3UPPA 4L9EA 3BM6A 1AXBA 4QU3A 4B4XA 4QHCA 1OT9A 1L2SA 3JPUA 2JBFA 5HDDA 3NCKA 5AQBA 4ID4A 5IHVA 3DTMA 4KQOA 3K2NA 3GQZA 2V8FA 4MEZA 2WUQA 3UE3A 3EGXC 1PI5A 1YKDA 3E4OA 1GHPA 1CI8A 3F1PB 3QNBA 2EA9A 3CZDA 3MQQA 4HI4A 1LSVA 5HWVA 2WKPA 4DE2A 1XP4A 1K55C 5A92A 3QHYA 2QHKA 4LGWA 4HHDA 2PR6A 1K55A 4Y17A 4YFMA 4LLOB 4HESA 4KUKA 1JWPA 5HAIA 3C38A 1FCOA 2ZC3B 1PZOA 1ERQA 1IYPA 2J9PA 3NDEA 2BASA 3MXRA 5EV0A 3HLBA 3UB5P 3VOLA 4KZ6A 4U3TA
chains in the Genus database with same CATH topology
2QWSA 2D01A 4IUKA 5TJJA 3ULFA 2KOIA 4G3WA 4EESA 1TS8A 4MN7A 4B9OA 2J3TC 3BY9A 2KDKA 3T50A 3TW8A 3W2ZA 5IS1A 4HP9A 4Q0JA 2J3WA 3LI8A 3PBQA 5G4ZA 3ICYA 1ODVA 2OWJA 3BWLA 3SW1A 4JGQA 1P9WA 2K31A 5HDCA 3H82B 4M4XA 4CLCB 2ZMVA 1S1YA 2VKSA 3FG8A 5DJUA 3PBOA 1F9IA 1DRMA 3G6OA 1GSXA 3IBJA 2A24A 2FZ0A 4PHTA 1N9LA 3KSFA 2JHEA 2QYBA 2B02A 3C2WA 4P6ZM 3T4JA 4EXOA 4LRZE 1XFQA 3BW6A 4GJ4A 3MXQA 4GS9B 1VB6A 4O8GA 4HJ3A 3LIBA 3K3DA 2L0WA 3MJQA 2XROA 1MZUA 5KIZA 3EGDC 3T4QA 3RH8B 1H8MA 3KX0X 4ARZB 1LSWA 2GZAA 1MC0A 5CX7A 1OTDA 4HJ6A 2V9AA 5HSQA 1P97A 2Z6CA 2PHYA 1W63M 4WELA 3LR0A 4OOLA 1KOUA 3PXPA 4EEUA 3PHYA 3F1NB 3GDIA 2W3GA 4DJ2A 2V1AA 3NOUC 1N9OA 3S7PA 1YSPA 4HIAA 4G3KA 4Z1WA 4GCZA 2IA2A 1W63Q 2Y8HA 3PR6A 4EUVA 1G6OA 2V1BA 2EWVA 3EOIA 2W1RA 5HZHA 2JKTI 1OTIA 2GNXA 3MF0A 1OJ5A 3LI9A 4HJ4A 5DJTA 3E0YA 3JVVA 3KYQA 3IBRA 4GLQA 3R4KA 4HH3A 4I3AA 5J4EA 1GSVA 2QJ7A 1OTBA 3P7NA 1OT6A 1N9NA 4AFIA 3NJAA 3JVUA 3PYPA 4XT2A 3RTYA 5HWTA 4NXFA 2XRNA 1V9ZA 3BJNA 4YOFA 4ETXA 4G3VA 3OCNA 2K2NA 2VZWA 2W3HA 4GHIB 4H6JB 2VV7A 1X0OA 2QKPA 3PBTA 1NRJA 3UB8A 5HD3A 3H7WA 4HNBA 2D02A 4E04A 1G28A 5C5KA 4CQHA 3BQ8A 3TJZC 3EQUA 4UQIS 5IT5A 4NKPA 4CLCD 4HP4A 4EW7A 4PKYG 1ZTUA 2DMWA 2PT7A 1LSXA 4O0PA 3UB7A 3D72A 3PBRA 2GX5A 4Y5FA 4BWIA 3IS2B 4JGRA 5HD5A 4WEJA 3UB6A 2MJ6A 2Z6DA 4L9GA 1XJ2A 1T1AA 2JKRI 1DP6A 1TS0A 2M1CA 3S7QA 4WN5A 4LRYC 1TS7A 4I38A 3E4QA 4CLCC 3MFXA 4R38A 1MKMA 5F6AA 3NOPC 4ME4A 4NXGA 3H82A 4II7A 2R78A 4Y2FA 3S7NA 3HJIA 2W3FA 3A0RA 2B18A 2ZOIA 4NXEA 3V67A 3FPWA 3O5YA 3HJKA 1F98A 5EFWA 4EU0A 4FOFA 2WKQA 4NEED 4BJPA 2XA7S 1BYWA 2VV8A 3BY8A 2W27A 2M7VA 3LIFA 3BQAA 3LIEA 3R7WA 3MR0A 3E98A 1F5MA 4BMWA 2VGLS 2JN7A 1OTEA 2Y79A 3OOVA 4ARZA 3EQVA 2PR5A 4DN0A 3LIAA 2VEAA 5HWWA 5KSHA 1DP9A 2A2LA 5I5LA 1V9YA 3HCYA 3OC2A 5HPIA 4DJ3A 4Y3IA 2OWHA 3GECA 3VE4A 4UEYA 3CI6A 1P9RA 4I3IA 2V0UA 3UE6A 5A8BA 2GJ3A 4HQAA 1S4SA 2HJ9C 4YWZA 4GW9A 3TRCA 3FC7A 3LR3A 3PBNA 5TBMB 4R70A 2FH5A 4BBUA 1IOUA 3F1PA 1S4RA 1Y28A 3S7OA 4MN6A 2YKHA 1D7EA 3ZQ5A 2PD7A 3UB9A 3B42A 2PYPA 4PAUA 3LICA 4MDZA 3D3OA 2HGVA 4P6ZS 1TD5A 2W3EA 3MQ0A 2LB5A 3KSHA 2V0WA 2NUPC 1P0ZA 3EWKA 2VV6A 3CLOA 1D06A 4BBVA 1UGUA 4KQDA 3LR5A 3OBFA 5J3WA 4Q0HA 4JGOA 4XT2B 2WKRA 4RQ9A 2KLIA 2O99A 1NWZA 3PBSA 3LUQA 2W1TB 3NHQA 4MN5A 2VA0A 2HF6A 3IS2A 3T4LA 3KYZA 4EETB 5AJGA 4O01A 3A0VA 4F3LB 4PKYA 1IFQA 3F1OB 2H28A 3T4TA 1TF1A 1UWPX 2OAP1 4OOMA 1UWNX 2HJEA 2NUTC 3KO6A 1LT0A 5LBRA 3TE8A 4HOIA 5DKLA 4I5SA 4CLCA 4WUJA 4FSFA 4EERA 3T4KA 4HY8A 5F5YA 5IU1A 4I39A 3UMEA 4EQ1A 2VJWA 5HDSA 2P04A 1H3QA 4YNRA 4ZRRA 4NXBA 2JKTM 4B93A 5HPFA 3RFBA 1XJ3A 4WL9A 2G7UA 2O9BA 4WF0A 1T19A 1LL8A 4GS9A 1S67L 1TS6A 1YSQA 4BBTA 3VV4A 3EEAA 4LRXC 1NLYA 1OPXA 5AVFA 1WA9A 2ZBBA 2INWA 2PD8A 2KX6A 4K08A 1OTAA 3DBAA 2XSSA 3K3CA 2A24B 5HL6A 2O9AA 2L1MA 1NLZA 2P08A 4WEKA 3OCLA 2YKFA 2K7SA 3B33A 3T4SA 3KSIA 3U2AA 1XJ4A 3CITA 3R7WB 3F1NA 3LYXA 4L9EA 2ZOHA 5F69A 4IJGA 2OOLA 1OT9A 2W0NA 3CAXA 2VLGA 3T4OA 2EWWA 3LR4A 5TBMA 2L4RA 4R6LA 5DFXA 1XJ6A 4UQIM 2OAQ1 5HDDA 4LPZA 3LIDA 3LFVA 1T18A 3E4PA 3H9WA 4KQOA 3K2NA 3ZYTA 4WLAA 3C30A 5F68A 4I3JA 3C8CA 4R3AA 1DP8A 3UE3A 2JKRM 5J7EA 3EGXC 1T1BA 1YKDA 3E4OA 5G4YA 2LB9A 1S66L 4ETZA 4GHIA 1EW0A 4H6JA 4L9FA 3F1PB 2PDRA 5DFYA 4L0LA 2M7UA 2EA9A 3B47A 3MMHA 3NOTC 3UMDA 3MQQA 3CUEC 4HI4A 2CMNA 2QJ5A 1STZA 1XFNA 5MC7A 2ZMFA 2HV1A 4KUOA 1VHMA 4QPRA 3CUEA 3FPVA 1LSVA 3OLOA 2J80A 5HWVA 2WKPA 1ZHHB 3P01A 5FL3A 3VE3A 2QHKA 4IHQA 4HHDA 4MMNA 2W1TA 4MCWA 2PR6A 5AVEA 3CWFA 4HH2A 3MQOA 1JNUA 4LLOB 1YAXA 2J3TD 3KSGA 2XA7M 4KUKA 2O0YA 5DF9A 2P7JA 1T1CA 4CLCE 4F3LA 3C38A 2I9VA 3H7WB 2W3DA 3F1OA 4IUHA 4Q0IA 2VX8A 5L8MA 2O9CA 2PYRA 3A0SA 2BASA 4EEPA 4DMZA 2VGLM 1GSWA 4JGPA 5K5BA 1S1ZA 3VOLA 5DKKA 3EEHA 1OJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWS A;  2D01 A;  3ULF A;  4EES A;  1TS8 A;  3BY9 A;  2KDK A;  3T50 A;  5IS1 A;  4HP9 A;  3LI8 A;  5G4Z A;  3ICY A;  1ODV A;  2OWJ A;  3BWL A;  3SW1 A;  4JGQ A;  5HDC A;  3H82 B;  4M4X A;  1S1Y A;  3FG8 A;  5DJU A;  1F9I A;  1DRM A;  3G6O A;  1GSX A;  2A24 A;  1N9L A;  2JHE A;  2B02 A;  3C2W A;  4EXO A;  4LRZ E;  1XFQ A;  3MXQ A;  4GS9 B;  1VB6 A;  4HJ3 A;  3LIB A;  3K3D A;  2L0W A;  3MJQ A;  1MZU A;  5KIZ A;  3RH8 B;  3KX0 X;  1LSW A;  1OTD A;  4HJ6 A;  2V9A A;  5HSQ A;  1P97 A;  2Z6C A;  2PHY A;  1KOU A;  4EEU A;  3PHY A;  3F1N B;  3GDI A;  4DJ2 A;  2V1A A;  3NOU C;  1N9O A;  4HIA A;  4GCZ A;  2V1B A;  5HZH A;  1OTI A;  4HJ4 A;  1OJ5 A;  3LI9 A;  5DJT A;  3IBR A;  4HH3 A;  4I3A A;  5J4E A;  1GSV A;  2QJ7 A;  1OTB A;  3P7N A;  1OT6 A;  1N9N A;  3NJA A;  3PYP A;  4XT2 A;  3RTY A;  5HWT A;  4NXF A;  1V9Z A;  4GHI B;  4H6J B;  2VV7 A;  1X0O A;  2QKP A;  3UB8 A;  5HD3 A;  3H7W A;  4HNB A;  2D02 A;  4E04 A;  1G28 A;  4HP4 A;  4EW7 A;  4PKY G;  1LSX A;  3UB7 A;  3D72 A;  3IS2 B;  4JGR A;  5HD5 A;  3UB6 A;  2Z6D A;  4L9G A;  1XJ2 A;  1T1A A;  1DP6 A;  1TS0 A;  2M1C A;  4WN5 A;  4LRY C;  1TS7 A;  4I38 A;  3E4Q A;  3MFX A;  4R38 A;  5F6A A;  3NOP C;  4NXG A;  3H82 A;  2R78 A;  3HJI A;  3A0R A;  2ZOI A;  4NXE A;  3HJK A;  1F98 A;  5EFW A;  2WKQ A;  1BYW A;  2VV8 A;  3BY8 A;  2W27 A;  3LIF A;  3LIE A;  3MR0 A;  2JN7 A;  1OTE A;  2PR5 A;  3LIA A;  2VEA A;  5HWW A;  1DP9 A;  5I5L A;  1V9Y A;  4DJ3 A;  2OWH A;  3GEC A;  3VE4 A;  4I3I A;  2V0U A;  3UE6 A;  5A8B A;  2GJ3 A;  4HQA A;  1S4S A;  4YWZ A;  4GW9 A;  3FC7 A;  5TBM B;  4R70 A;  4BBU A;  3F1P A;  1S4R A;  1Y28 A;  4MN6 A;  2YKH A;  1D7E A;  3ZQ5 A;  2PD7 A;  3UB9 A;  2PYP A;  3LIC A;  2V0W A;  1P0Z A;  3EWK A;  2VV6 A;  3CLO A;  1D06 A;  4BBV A;  1UGU A;  4KQD A;  5J3W A;  4JGO A;  4XT2 B;  2WKR A;  4RQ9 A;  1NWZ A;  3LUQ A;  3NHQ A;  4MN5 A;  3IS2 A;  4EET B;  3A0V A;  4F3L B;  4PKY A;  3F1O B;  2H28 A;  1UWP X;  1UWN X;  1LT0 A;  4HOI A;  5DKL A;  4I5S A;  4WUJ A;  4EER A;  4HY8 A;  5F5Y A;  5IU1 A;  4I39 A;  3UME A;  4EQ1 A;  5HDS A;  4NXB A;  1XJ3 A;  4WL9 A;  4WF0 A;  1T19 A;  1LL8 A;  4GS9 A;  1S67 L;  1TS6 A;  4BBT A;  4LRX C;  5AVF A;  1WA9 A;  2ZBB A;  2INW A;  2PD8 A;  2KX6 A;  4K08 A;  1OTA A;  3K3C A;  2A24 B;  2L1M A;  2YKF A;  2K7S A;  3B33 A;  1XJ4 A;  3F1N A;  3LYX A;  4L9E A;  2ZOH A;  5F69 A;  2OOL A;  1OT9 A;  2W0N A;  3CAX A;  2VLG A;  5TBM A;  2L4R A;  4R6L A;  1XJ6 A;  5HDD A;  4LPZ A;  3LID A;  1T18 A;  3H9W A;  3E4P A;  4WLA A;  3VOL A;  5F68 A;  4I3J A;  3C8C A;  4R3A A;  1DP8 A;  5J7E A;  1T1B A;  3E4O A;  5G4Y A;  1S66 L;  4GHI A;  1EW0 A;  4H6J A;  4L9F A;  3F1P B;  2PDR A;  2EA9 A;  3NOT C;  3UMD A;  3MQQ A;  4HI4 A;  2CMN A;  2QJ5 A;  1XFN A;  2HV1 A;  4KUO A;  1LSV A;  3OLO A;  2J80 A;  5HWV A;  2WKP A;  3VE3 A;  2QHK A;  4HHD A;  2PR6 A;  5AVE A;  3CWF A;  4HH2 A;  3MQO A;  1JNU A;  4LLO B;  4KUK A;  2P7J A;  1T1C A;  4F3L A;  2I9V A;  3H7W B;  3F1O A;  2PYR A;  3A0S A;  2BAS A;  4EEP A;  1GSW A;  4JGP A;  1S1Z A;  4B9O A;  5DKK A;  3EEH A;  1OJG A; 
#chains in the Genus database with same CATH topology
 2D01 A;  3AGF A;  1K54 C;  1YLY A;  2B95 A;  2WKE A;  5FQ9 A;  4Q0J A;  4WM9 A;  4IBX A;  2J3W A;  3MZE A;  3ICY A;  1ODV A;  1HZO A;  3SW1 A;  1HD8 A;  4JGQ A;  3N6I A;  2JKF A;  3G30 A;  3H82 B;  3VP2 A;  3BEB A;  4N92 A;  1VEU A;  2Y2P A;  2VKS A;  5EVI D;  1KGG A;  3HUO A;  1GSX A;  2A24 A;  2FZ0 A;  3G2Y A;  3DTI A;  2B02 A;  4P6Z M;  3NIA A;  1MBL A;  3A3I A;  2JE5 A;  1JWV A;  3K3D A;  2VK3 A;  3RH8 B;  2XD1 A;  1K4F A;  2GZA A;  3Q1F A;  4H8R A;  2V9A A;  3LY4 A;  4OOL A;  4LV3 A;  3F1N B;  1BLC A;  2V1A A;  4X25 A;  4Y0O A;  2EXB A;  3A3D A;  3WWX A;  3UY6 A;  4HBT A;  2HDU A;  4G3K A;  2IA2 A;  3G31 A;  2XGN A;  2Y8H A;  3QP5 A;  1VM1 A;  4X56 A;  5L07 A;  3HBR A;  2EWV A;  4OON A;  1NZO A;  3V5M A;  1IKI A;  5L09 A;  3MSH A;  3MF0 A;  3IH9 A;  1FCM A;  4HJ4 A;  5DJT A;  3JVV A;  4GLQ A;  3R4K A;  3N4I A;  4M3K A;  1NZU A;  4HH3 A;  4I3A A;  1GSV A;  5FAQ A;  1FQG A;  1OTB A;  5EE8 A;  4IVK A;  1N9N A;  5HFO A;  3PYP A;  5FQQ A;  2XRN A;  1V9Z A;  4ETX A;  2CC1 A;  4E3N A;  3OCN A;  4OH0 A;  1J9M A;  3IWQ A;  4GKU A;  3SH8 A;  5U47 A;  3PBT A;  5FI6 A;  5HD3 A;  3H7W A;  4WZ4 A;  1G28 A;  3GMW A;  5C5K A;  1HTZ A;  5IT5 A;  3ITB A;  3FWL A;  2ZQ7 A;  2A3U A;  4O0P A;  3C4P A;  4Y5F A;  3IS2 B;  4IED A;  4JGR A;  5HD5 A;  4ZTK A;  3UB6 A;  5I94 A;  2ZQC A;  3WS4 A;  2MJ6 A;  2Z6D A;  3MZD A;  2B5R A;  1MWR A;  3LGO A;  4DXB A;  3SS3 A;  3VSL A;  2OLV A;  4XUZ A;  3IWO A;  4KZ3 A;  2HP9 A;  4OLG A;  5KSC A;  4CLC C;  4S2M A;  3VP3 A;  4ME4 A;  4X53 A;  4X69 A;  4YIN A;  3HJI A;  1NY0 A;  2B18 A;  3O5Y A;  3HJK A;  3BRM A;  2E8I A;  1YLJ A;  2ZC7 A;  4NEE D;  2XR0 A;  1I5Q A;  2VV8 A;  5EM0 A;  5FQJ A;  2W27 A;  1L0F A;  4OPQ A;  4BL2 A;  3BQA A;  3LIE A;  5EPH A;  1Z09 A;  4EQI A;  4BMW A;  1VET B;  3IXB A;  3ZNT A;  4ARZ A;  4K0W A;  1LI9 A;  4MNR A;  1PWG A;  1FCN A;  3LIA A;  1L0D A;  1PI4 A;  4PMA A;  2A2L A;  3IF6 B;  5I5L A;  2Q9N A;  4FH2 A;  1SZV A;  4Y3I A;  3GEC A;  1K4E A;  4I3I A;  5A8B A;  2HJ9 C;  4E3M A;  3FC7 A;  5TBM B;  2BLS A;  4R70 A;  4BBU A;  2IWB A;  1IOU A;  1Y28 A;  2Y2M A;  4MN6 A;  2YKH A;  1D7E A;  3C5A A;  2PD7 A;  4LV2 A;  5CTN A;  2PYP A;  3NI9 A;  3LIC A;  4ZJ2 A;  1IYQ A;  1I2S A;  5FI7 A;  2LB5 A;  1KE4 A;  3VFF A;  3KSH A;  3EWK A;  1ZG4 A;  2ZMA A;  2PBY A;  4LCM A;  2ZC4 B;  1UGU A;  3B3X A;  3OZH A;  3LR5 A;  3BYD A;  3HLE A;  3QP2 A;  4XT2 B;  2WKR A;  2WAD A;  2KLI A;  2O99 A;  4JPM A;  2W1T B;  1N9B A;  1I2W A;  3KYZ A;  5EEC A;  4EET B;  2XF3 A;  2PAV P;  3HLF A;  3HLG A;  3BEC A;  1IFQ A;  1TF1 A;  3FV7 A;  1ES5 A;  4JXS A;  4OOM A;  2HJE A;  3KO6 A;  5LBR A;  2WZX A;  5DKL A;  4I5S A;  4WUJ A;  4EER A;  3T4K A;  2WAE A;  4HY8 A;  5DVA A;  3VP0 A;  4JKT A;  3OPR A;  1YLZ A;  4I39 A;  4WZ5 C;  4MBF A;  3NC8 A;  4NXB A;  4WZ5 A;  3RFB A;  3BFE A;  2EFX A;  4WL9 A;  2G7U A;  2DCF A;  2J7V A;  5FA7 A;  1TDG A;  3M6B A;  3OPH A;  4LRX C;  1NLY A;  4PM9 A;  1WA9 A;  5CEC A;  2PD8 A;  4OOY A;  4K08 A;  1OTA A;  2IWC A;  3DBA A;  4RX2 A;  1EWZ A;  4WMC A;  3FYZ A;  1L3L A;  2YKF A;  3R7W B;  3CIT A;  1XKZ A;  5F69 A;  4IJG A;  4EBN A;  2RCX A;  3CAX A;  3CMZ A;  3T4O A;  2XLN A;  4OQ0 A;  1SDN A;  4LPZ A;  4PM7 A;  4S2J A;  4QD4 A;  1T18 A;  3LFV A;  3E4P A;  4I3J A;  3C8C A;  1NXY A;  5E2G A;  4P0M A;  5J7E A;  5E2E A;  2HP5 A;  4Y7P A;  5GLB A;  4H6J A;  1EW0 A;  4EBP A;  2XFT A;  2PDR A;  5DFY A;  4L0L A;  2M7U A;  3UE1 A;  3B47 A;  3UMD A;  4DF6 A;  4KG6 A;  2CMN A;  1XFN A;  5MC7 A;  1VQQ A;  3N8R A;  4KUO A;  1VHM A;  3ZG0 A;  4QPR A;  5E2H A;  3AGE A;  1TDL A;  1XPB A;  2J80 A;  4KG2 A;  1Q2P A;  5TR7 A;  5FEG A;  3VE3 A;  2ZC6 B;  4IHQ A;  4MMN A;  4GD8 A;  5AVE A;  4HH2 A;  4OP5 A;  1YAX A;  3KSG A;  2O0Y A;  4F3L A;  2I9V A;  5L8M A;  2VX8 A;  5DTT A;  2PYR A;  3A0S A;  3T1R A;  4DMZ A;  1BLH A;  4JGP A;  4DDS A;  1S1Z A;  4B9O A;  1JVJ A;  2XQZ A;  1XA1 A;  5TJJ A;  3ULF A;  1L0E A;  2KOI A;  4G3W A;  3PTE A;  4EES A;  4MN7 A;  3ZVT A;  1ACF A;  1GHI A;  3BY9 A;  1QMF A;  3LEQ A;  3TW8 A;  3W2Z A;  1PW1 A;  4HP9 A;  4R1G A;  3PBQ A;  5G4Z A;  2OWJ A;  4U0T A;  4NK3 A;  3UPO A;  3LCE A;  5A91 A;  5HW3 A;  1S1Y A;  3HLD A;  2H0T A;  2I72 A;  4LV0 A;  4KZ9 A;  5CEB A;  3PBO A;  3G6O A;  4D2O A;  2Z2M B;  3T4J A;  4EXO A;  3BW6 A;  2UV0 E;  4K0X A;  2ZM8 A;  4R4S A;  3LIB A;  3SS4 A;  2L0W A;  4X55 A;  5CGS A;  3DTK A;  1MZU A;  5KIZ A;  3T4Q A;  1Y54 A;  2Y91 A;  3KX0 X;  1LSW A;  1MC0 A;  1WYB A;  3RJU A;  1MWS A;  4HJ6 A;  3UPN A;  1SKO A;  5HSQ A;  3O87 A;  1W63 M;  4WEL A;  1ES2 A;  5CHM A;  3T1Q B;  3PXP A;  4EEU A;  3PHY A;  2WK0 A;  2ZL1 B;  3NDG A;  1G6A A;  4QB8 A;  5CHU A;  1YQS A;  4HIA A;  4PM8 A;  4GCZ A;  5CGW A;  1G6O A;  3EOI A;  1SKF A;  4E3O A;  2JKT I;  5L10 A;  2Y59 A;  3OPL A;  1OJ5 A;  3T1S A;  3O88 A;  2EX2 A;  1PYY A;  3P7N A;  1Q2Q A;  3NJA A;  2OLU A;  3WRT A;  1ESU A;  4NXF A;  1G5U A;  2Y2I A;  4RA7 A;  2VV7 A;  2QKP A;  3UB8 A;  1NRF A;  4HNB A;  4RX3 A;  4QWO A;  4CQH A;  3BQ8 A;  4UQI S;  2ZQA A;  2Q0O A;  2OV5 A;  1K38 A;  4NKP A;  4CLC D;  4HP4 A;  4PKY G;  1HVB A;  1LSX A;  3UB7 A;  3SS5 A;  1HLU P;  4BD1 A;  2GX5 A;  4BWI A;  4UA9 A;  1H8Z A;  1ES3 A;  1W5D A;  3TOI A;  3VSK A;  2XD5 A;  1K54 A;  5EOE A;  4E3J A;  4KZ4 A;  3UE0 A;  5CXW A;  1T1A A;  2X02 A;  3MXS A;  2JKR I;  4DRT A;  1TS0 A;  2Y2N A;  5HAQ A;  3A3F A;  1E4D A;  4UA7 A;  4DE3 A;  3E4Q A;  3L7H A;  4R38 A;  1GCE A;  1PZP A;  5F6A A;  3NOP C;  3H82 A;  3G35 A;  2R78 A;  4Y2F A;  1CJF A;  3ZVW A;  5DTS A;  2W3F A;  1XGI A;  2V1Z A;  3A0R A;  1TVF A;  2ZOI A;  2WGI A;  3V67 A;  3C4O A;  3IXG A;  2WKQ A;  4BJP A;  2XA7 S;  3S1Y A;  4RVA A;  1BYW A;  1DJA A;  4E3I A;  4KZ5 A;  4PM5 A;  1QME A;  1ERM A;  1VEU B;  2ZQ9 A;  1F5M A;  1CQA A;  5GLC A;  3OOV A;  1FIL A;  2PR5 A;  2Y2H A;  4S2P A;  1E3U A;  1RGY A;  1V9Y A;  2EX8 A;  3OC2 A;  2ZJ9 A;  4DJ3 A;  5HPI A;  3VE4 A;  1P9R A;  1BZA A;  2HDR A;  1S4S A;  4ZDX A;  2PBD P;  2QPN A;  3ZDJ A;  3ZQ5 A;  3SH9 A;  4FD8 A;  3UB9 A;  3B42 A;  5CER A;  5GLA A;  4E6W A;  3CPT B;  3RXX A;  3ZNY A;  3QP6 A;  5CTM A;  2GDN A;  2VV6 A;  3UN7 A;  1O7E A;  2WKH A;  4KQD A;  2ZM2 A;  2WGV A;  3Q7V B;  4JGO A;  4JBF A;  3PBS A;  1Y4O A;  3VFH A;  3NHQ A;  4MN5 A;  4IVI A;  3IS2 A;  3HL9 A;  4O01 A;  3A0V A;  4PKY A;  1PNE A;  3F1O B;  2H28 A;  4DXC A;  1UWP X;  1YMS A;  1UWN X;  3JYI A;  2PU2 A;  4Y0U A;  3GRJ A;  4CLC A;  1MKI A;  3CHW P;  1GHM A;  3M6H A;  4FCF A;  4WMC D;  2ZLY A;  4XXR A;  3GR2 A;  2VJW A;  2P04 A;  3WS5 A;  1H3Q A;  4ZRR A;  3A3E A;  1XX2 A;  5HPF A;  1XJ3 A;  2O9B A;  1ZC2 A;  1T19 A;  1SCW A;  3UDI A;  1LL8 A;  4GS9 A;  1S67 L;  1YSQ A;  3SOI A;  3G2Z A;  1W8Q A;  4Y0T A;  3VV4 A;  1VET A;  3EEA A;  2ZD8 A;  5AVF A;  2ZBB A;  2INW A;  3LEZ A;  3IF6 C;  2H0Y A;  5JYP A;  2XSS A;  1NYY A;  3K3C A;  2QZ6 A;  2O9A A;  3G4P A;  1G68 A;  2A49 A;  2P08 A;  5FEF A;  2PU4 A;  4WEK A;  1FR1 A;  3LO7 A;  2XH9 A;  2OOL A;  2W0N A;  2VLG A;  3V3S A;  5TBM A;  2L4R A;  4R6L A;  5DFX A;  4HEF A;  5EVI B;  4UQI M;  4X1L A;  5FQK A;  5FQM A;  5L2F A;  2FFY A;  4X68 A;  1T1B A;  4WBG A;  4GHI A;  4L9F A;  4R23 A;  4ZJ3 A;  3PAE A;  3UO9 A;  3IXH A;  3MMH A;  3NOT C;  2AVX A;  2ZMF A;  4JXW A;  3G34 A;  3FPV A;  1S6R A;  1ZHH B;  5FL3 A;  4MBK A;  2W1T A;  4BEN A;  4R4R A;  1KDW A;  2XA7 M;  5DF9 A;  3U4L P;  2P7J A;  4CLC E;  1ESI A;  1XXM A;  4Q0I A;  2O9C A;  4S2I A;  3GVB A;  4RYE A;  4EEP A;  3W4O A;  4GDN A;  3EEH A;  1OJG A;  4EW7 A;  2QWS A;  4IUK A;  5CED A;  1O07 A;  5DF7 A;  1KE0 A;  4EWF A;  2J3T C;  1FSY A;  2Y2O A;  1K56 D;  4KZA A;  1CK3 A;  3A3J A;  4KZB A;  4LV1 A;  3CG5 A;  2JC7 A;  4M4X A;  3IHA A;  1NJ4 A;  3HLW A;  1CI9 A;  1LLB A;  3FG8 A;  5D3O A;  5DJU A;  4JLF A;  1DRM A;  4PHT A;  2JHE A;  2QYB A;  3KSF A;  4IBR A;  2EX9 A;  3PAG A;  3MXQ A;  1VB6 A;  4O8G A;  3MJQ A;  4MLL A;  1FOF A;  4NET A;  1H5X A;  1OTD A;  4GD6 A;  3BLS A;  3DW0 A;  1P97 A;  2WZZ A;  2JKG A;  3Q7Z A;  3T1X A;  1MXO A;  5F1G A;  4EV4 A;  1YPR A;  3GDI A;  1LL5 A;  4DJ2 A;  1N9O A;  3GSG A;  4GOG A;  3S7P A;  4OP8 A;  5CRF A;  1YSP A;  2XEP A;  3WRZ A;  3N8L A;  2WGW A;  2V1B A;  1BSG A;  2Y4A A;  2W1R A;  1CEG A;  2PRF A;  2GNX A;  4UAA A;  3IBR A;  2J9O A;  4GZB A;  4OQG A;  5J4E A;  2QJ7 A;  4OPR A;  3IQA A;  3JVU A;  3HVF A;  3E2L A;  3WS1 A;  2K2N A;  2W3H A;  4H6J B;  3QNC A;  3UDX A;  1ONG A;  1MWT A;  1X0O A;  1XA7 A;  1NRJ A;  2FFF B;  4E04 A;  3ZGA B;  3TJZ C;  1WE4 A;  2ZQD A;  3ZCZ A;  1ZTU A;  2DMW A;  2H10 A;  2QMI A;  3O86 A;  4U0X A;  4R3B A;  1BLP A;  4WEJ A;  1CF0 A;  2XDM A;  4L9G A;  1IEL A;  5GLD A;  2H5S A;  1GA0 A;  1DP6 A;  5FSR A;  3S7Q A;  2DRW A;  2HDS A;  4KZ8 A;  4LRY C;  1TS7 A;  1PRQ A;  3QP8 A;  1MKM A;  4B4Z A;  4II7 A;  3S7N A;  2OSU A;  3O3V A;  4NXE A;  1E3U D;  5EFW A;  4N9K A;  3ITA A;  3VOY A;  3BFD A;  4JXG A;  4FOF A;  4ZJ1 A;  3BY8 A;  2P9V A;  1K56 A;  1W7F A;  3LIF A;  3ZG5 A;  2X71 A;  5F83 A;  3P98 A;  1U60 A;  2C5W B;  5M19 A;  4CPK A;  2EXA A;  2VGL S;  2JN7 A;  1OTE A;  2Y79 A;  3EQV A;  2VEA A;  1FIK A;  5HWW A;  1ERO A;  5KSH A;  4KEN B;  1DP9 A;  3HCY A;  1K57 C;  1ZG6 A;  2XK1 A;  2OWH A;  2Y2Q A;  4UEY A;  1DY6 A;  3UE6 A;  2GJ3 A;  4ZAM A;  4YWZ A;  4GW9 A;  3TRC A;  1SKO B;  3LR3 A;  3VMA A;  2FH5 A;  4EBL A;  3F1P A;  1S4R A;  5G18 A;  3MBZ A;  4OPZ A;  4PAU A;  1ZKJ A;  2HGV A;  4XUX A;  1M40 A;  1TD5 A;  4P6B A;  4KZ7 A;  4ZBE A;  2Z2L B;  2W3E A;  3MQ0 A;  5GHY A;  3CJM A;  3E2K A;  2V0W A;  2XFS A;  2NUP C;  3IX4 A;  2WYX A;  3BLM A;  3CLO A;  3BFF A;  4BBV A;  4KG5 A;  2HP6 A;  1BLS A;  2EFU A;  1YMX A;  4X6T A;  3NUL A;  1KDS A;  3LUQ A;  3I7J A;  3IT9 A;  5AQ9 A;  3T4L A;  5AJG A;  1J3W A;  3VOZ A;  4C3Q A;  4DE1 A;  2NUT C;  1LT0 A;  4OQI A;  2V20 A;  1XGJ A;  3IH8 A;  1M6K A;  1S0W A;  4UHU A;  4FSF A;  1BT5 A;  1C3B A;  3BFC A;  4F94 A;  4Z9Q A;  5F5Y A;  3VP1 A;  1JTG A;  2WKI A;  4Y15 A;  3UME A;  3V39 A;  1W8Y A;  3ZHH A;  2JKT M;  4B93 A;  3Q07 A;  2Q9M A;  1TS6 A;  1YLT A;  1OPX A;  4GNU A;  3IF5 A;  2KX6 A;  1LI0 A;  2JCH A;  2A24 B;  3L9K A;  2L1M A;  5HAR A;  1BUE A;  3TSG A;  3OCL A;  2K7S A;  3B33 A;  3T4S A;  1N4O A;  3KSI A;  1XJ4 A;  3F1N A;  5HX9 A;  1YLW A;  3LYX A;  2ZOH A;  3MS6 A;  5A93 A;  5J8X A;  1Z6F A;  4PPR A;  2EWW A;  1LHY A;  3LR4 A;  3MZF A;  5TFQ A;  2HPB A;  3W8K A;  1XJ6 A;  1K6S A;  2OAQ 1;  2V8C A;  5BOH A;  3LID A;  4DDY A;  3H9W A;  3ZYT A;  4OQH A;  4WLA A;  2IWD A;  1IYS A;  3C30 A;  5F68 A;  4MBH A;  4R3A A;  3C7U A;  4BL3 A;  5TGF A;  1DP8 A;  2JKR M;  5AQ7 A;  5G4Y A;  2LB9 A;  1S66 L;  3CPT A;  4ETZ A;  4OKP A;  4K91 A;  4OPY A;  1GA9 A;  1FSW A;  3UNW A;  1L0G A;  3KYE A;  3CUE C;  1DJC A;  2QJ5 A;  1STZ A;  2HV1 A;  3CUE A;  3OLO A;  3Q7V A;  1BUL A;  3ZG7 B;  3P01 A;  4MCW A;  1MWU A;  4JF4 A;  2ACG A;  3CWF A;  4QY6 A;  3MQO A;  2DNS A;  5FQI A;  1JNU A;  2R9X A;  3IXD A;  2J3T D;  1K6R A;  1K0K A;  1T1C A;  4GN2 A;  3H7W B;  3HRE A;  2W3D A;  3F1O A;  4N9L A;  4IUH A;  5E2F A;  5F82 A;  2VGL M;  1GSW A;  3WS2 A;  5K5B A;  4QJG A;  2UWX A;  5DKK A;  3W4P A;  3HUN A;  2VGK A;  2VGJ A;  1TS8 A;  2Y2L A;  5EUA A;  4OVD A;  2KDK A;  3QP4 A;  3T50 A;  5IS1 A;  4E6X A;  4R0Q A;  3ISG A;  3LI8 A;  3BWL A;  4E3L A;  1TEM A;  1ALQ A;  1P9W A;  2K31 A;  3Q81 A;  5FAS A;  5EVL A;  5HAP A;  5HDC A;  1ES4 A;  2G2W A;  4CLC B;  4OLD A;  2ZMV A;  4C75 A;  1F9I A;  3IBJ A;  3C7V A;  1N9L A;  3DTE A;  3IF6 A;  3C2W A;  4LEN A;  4LRZ E;  1XFQ A;  4GJ4 A;  4KQQ A;  5CGX A;  4GS9 B;  4S2K A;  4HJ3 A;  2XRO A;  5AQA A;  3EGD C;  1H8M A;  2BG1 A;  4ARZ B;  1BTL A;  5CX7 A;  5EVI C;  3NBL A;  1OME A;  2Z6C A;  4FUW A;  3D9Y A;  5EVI A;  2PHY A;  3LR0 A;  5EM1 A;  1KOU A;  2HZ5 A;  2W3G A;  3DWZ A;  3NOU C;  3G32 A;  3MKF A;  4Z1W A;  4JF6 A;  1W63 Q;  3PR6 A;  1MY8 A;  4EUV A;  4Q8I A;  5HZH A;  4PM6 A;  2Y2J A;  1OTI A;  2WAF A;  3OPP A;  1D1J A;  4GDB A;  5A90 A;  3IHB A;  3LI9 A;  3E0Y A;  3KYQ A;  5EOO A;  3ZG9 B;  3AGD A;  1KGE A;  4A5R A;  1OT6 A;  4AFI A;  1SDE A;  4XT2 A;  3D4F A;  3RTY A;  5HWT A;  1AWI A;  5GHX A;  3BJN A;  4O7D A;  4YOF A;  4G3V A;  3SZT A;  2VZW A;  4GHI B;  3RXW A;  4EUZ A;  4P85 A;  2D02 A;  5EVE A;  1YLP A;  4WYY A;  3DAV A;  4ESP A;  3EQU A;  1PIO A;  5FI2 A;  5DTK A;  3TG9 A;  3MKE A;  2PT7 A;  3N8S A;  4LCL A;  3D72 A;  3FZC A;  3PBR A;  4S2L A;  5JYO A;  1WYC A;  3FKV A;  1RCJ A;  4BQM A;  1XJ2 A;  1CEF A;  1PW8 A;  5GHZ A;  1KVL A;  5M1A A;  2M1C A;  1E25 A;  4WN5 A;  1A0K A;  4I38 A;  2Y2K A;  3LY3 A;  3MFX A;  4NXG A;  3UDF A;  4FTX A;  3N7W A;  2Y55 A;  5FAP A;  3SH7 A;  3FPW A;  4JXV A;  1F98 A;  1IKG A;  5DF8 A;  4EU0 A;  4DKI A;  5F1F A;  5KMW A;  4Y13 A;  2M7V A;  2V2F F;  2C6W B;  1RGZ A;  3R7W A;  3MR0 A;  3DWK A;  3E98 A;  3HUM A;  3QP1 A;  2ZQ8 A;  3GV9 A;  5GL9 A;  1ONH A;  2R9W A;  4N1X A;  4DN0 A;  1KVM A;  4NG2 A;  3IWI A;  4R3J A;  2RL3 A;  3FKW A;  1W79 A;  1K25 A;  3CI6 A;  4S2O A;  2P74 A;  2V0U A;  4HQA A;  4GB7 A;  5FAT A;  3PBN A;  3S7O A;  1H0M A;  1PFL A;  4MDZ A;  3D3O A;  1DJB A;  3V50 A;  4P6Z S;  1LL9 A;  2BTF P;  3T12 B;  3ZG8 B;  1EI5 A;  2WGW B;  2G2U A;  3GTC A;  1JTD A;  1F2K A;  1P0Z A;  1KGF A;  5HL1 A;  3HLC A;  1IEM A;  1D06 A;  4FH4 A;  2EX6 A;  3W4Q A;  1JWZ A;  4BD0 A;  3OBF A;  2ZM0 A;  5FDH A;  1NYM A;  3V3R A;  4C6Y A;  5J3W A;  1IYO A;  4Q0H A;  1H8Y A;  4RQ9 A;  3Q82 A;  1NWZ A;  1PWD A;  1RP5 A;  5FDS A;  2VA0 A;  2HF6 A;  3NEC A;  4P87 A;  5E43 A;  2X01 A;  4UA6 A;  4F3L B;  5M18 A;  1MPL A;  5CHJ A;  3T4T A;  3ZFZ A;  4N1H A;  2OAP 1;  4BLM A;  3M2J A;  3TE8 A;  4HOI A;  2Y2G A;  2J8Y A;  4D60 A;  3S22 A;  3VP4 A;  4HBU A;  4X1M A;  1PWC A;  5IU1 A;  2HDQ A;  1SHV A;  1YM1 A;  1FR6 A;  4EQ1 A;  5HDS A;  4YNR A;  3BFG A;  4DE0 A;  4E3K A;  3WS0 A;  3IX8 A;  3MFD A;  4WF0 A;  4CJN A;  4B88 A;  3M2K A;  4BBT A;  3NY4 A;  2ZC5 B;  4LFU A;  3S4X A;  1KE3 A;  3P09 A;  2E8J A;  5HL6 A;  4S2N C;  4QY5 A;  2P9V B;  1NLZ A;  4KQR A;  1YT4 A;  3IX3 A;  4S2N A;  5FAO A;  5KZH A;  2ZL1 A;  3U2A A;  1K57 A;  4JF5 A;  3UPP A;  4L9E A;  3BM6 A;  1AXB A;  4QU3 A;  4B4X A;  4QHC A;  1OT9 A;  1L2S A;  3JPU A;  2JBF A;  5HDD A;  3NCK A;  5AQB A;  4ID4 A;  5IHV A;  3DTM A;  4KQO A;  3K2N A;  3GQZ A;  2V8F A;  4MEZ A;  2WUQ A;  3UE3 A;  3EGX C;  1PI5 A;  1YKD A;  3E4O A;  1GHP A;  1CI8 A;  3F1P B;  3QNB A;  2EA9 A;  3CZD A;  3MQQ A;  4HI4 A;  1LSV A;  5HWV A;  2WKP A;  4DE2 A;  1XP4 A;  1K55 C;  5A92 A;  3QHY A;  2QHK A;  4LGW A;  4HHD A;  2PR6 A;  1K55 A;  4Y17 A;  4YFM A;  4LLO B;  4HES A;  4KUK A;  1JWP A;  5HAI A;  3C38 A;  1FCO A;  2ZC3 B;  1PZO A;  1ERQ A;  1IYP A;  2J9P A;  3NDE A;  2BAS A;  3MXR A;  5EV0 A;  3HLB A;  3UB5 P;  3VOL A;  4KZ6 A;  4U3T A; 
#chains in the Genus database with same CATH homology
 2QWS A;  2D01 A;  4IUK A;  5TJJ A;  3ULF A;  2KOI A;  4G3W A;  4EES A;  1TS8 A;  4MN7 A;  4B9O A;  2J3T C;  3BY9 A;  2KDK A;  3T50 A;  3TW8 A;  3W2Z A;  5IS1 A;  4HP9 A;  4Q0J A;  2J3W A;  3LI8 A;  3PBQ A;  5G4Z A;  3ICY A;  1ODV A;  2OWJ A;  3BWL A;  3SW1 A;  4JGQ A;  1P9W A;  2K31 A;  5HDC A;  3H82 B;  4M4X A;  4CLC B;  2ZMV A;  1S1Y A;  2VKS A;  3FG8 A;  5DJU A;  3PBO A;  1F9I A;  1DRM A;  3G6O A;  1GSX A;  3IBJ A;  2A24 A;  2FZ0 A;  4PHT A;  1N9L A;  3KSF A;  2JHE A;  2QYB A;  2B02 A;  3C2W A;  4P6Z M;  3T4J A;  4EXO A;  4LRZ E;  1XFQ A;  3BW6 A;  4GJ4 A;  3MXQ A;  4GS9 B;  1VB6 A;  4O8G A;  4HJ3 A;  3LIB A;  3K3D A;  2L0W A;  3MJQ A;  2XRO A;  1MZU A;  5KIZ A;  3EGD C;  3T4Q A;  3RH8 B;  1H8M A;  3KX0 X;  4ARZ B;  1LSW A;  2GZA A;  1MC0 A;  5CX7 A;  1OTD A;  4HJ6 A;  2V9A A;  5HSQ A;  1P97 A;  2Z6C A;  2PHY A;  1W63 M;  4WEL A;  3LR0 A;  4OOL A;  1KOU A;  3PXP A;  4EEU A;  3PHY A;  3F1N B;  3GDI A;  2W3G A;  4DJ2 A;  2V1A A;  3NOU C;  1N9O A;  3S7P A;  1YSP A;  4HIA A;  4G3K A;  4Z1W A;  4GCZ A;  2IA2 A;  1W63 Q;  2Y8H A;  3PR6 A;  4EUV A;  1G6O A;  2V1B A;  2EWV A;  3EOI A;  2W1R A;  5HZH A;  2JKT I;  1OTI A;  2GNX A;  3MF0 A;  1OJ5 A;  3LI9 A;  4HJ4 A;  5DJT A;  3E0Y A;  3JVV A;  3KYQ A;  3IBR A;  4GLQ A;  3R4K A;  4HH3 A;  4I3A A;  5J4E A;  1GSV A;  2QJ7 A;  1OTB A;  3P7N A;  1OT6 A;  1N9N A;  4AFI A;  3NJA A;  3JVU A;  3PYP A;  4XT2 A;  3RTY A;  5HWT A;  4NXF A;  2XRN A;  1V9Z A;  3BJN A;  4YOF A;  4ETX A;  4G3V A;  3OCN A;  2K2N A;  2VZW A;  2W3H A;  4GHI B;  4H6J B;  2VV7 A;  1X0O A;  2QKP A;  3PBT A;  1NRJ A;  3UB8 A;  5HD3 A;  3H7W A;  4HNB A;  2D02 A;  4E04 A;  1G28 A;  5C5K A;  4CQH A;  3BQ8 A;  3TJZ C;  3EQU A;  4UQI S;  5IT5 A;  4NKP A;  4CLC D;  4HP4 A;  4EW7 A;  4PKY G;  1ZTU A;  2DMW A;  2PT7 A;  1LSX A;  4O0P A;  3UB7 A;  3D72 A;  3PBR A;  2GX5 A;  4Y5F A;  4BWI A;  3IS2 B;  4JGR A;  5HD5 A;  4WEJ A;  3UB6 A;  2MJ6 A;  2Z6D A;  4L9G A;  1XJ2 A;  1T1A A;  2JKR I;  1DP6 A;  1TS0 A;  2M1C A;  3S7Q A;  4WN5 A;  4LRY C;  1TS7 A;  4I38 A;  3E4Q A;  4CLC C;  3MFX A;  4R38 A;  1MKM A;  5F6A A;  3NOP C;  4ME4 A;  4NXG A;  3H82 A;  4II7 A;  2R78 A;  4Y2F A;  3S7N A;  3HJI A;  2W3F A;  3A0R A;  2B18 A;  2ZOI A;  4NXE A;  3V67 A;  3FPW A;  3O5Y A;  3HJK A;  1F98 A;  5EFW A;  4EU0 A;  4FOF A;  2WKQ A;  4NEE D;  4BJP A;  2XA7 S;  1BYW A;  2VV8 A;  3BY8 A;  2W27 A;  2M7V A;  3LIF A;  3BQA A;  3LIE A;  3R7W A;  3MR0 A;  3E98 A;  1F5M A;  4BMW A;  2VGL S;  2JN7 A;  1OTE A;  2Y79 A;  3OOV A;  4ARZ A;  3EQV A;  2PR5 A;  4DN0 A;  3LIA A;  2VEA A;  5HWW A;  5KSH A;  1DP9 A;  2A2L A;  5I5L A;  1V9Y A;  3HCY A;  3OC2 A;  5HPI A;  4DJ3 A;  4Y3I A;  2OWH A;  3GEC A;  3VE4 A;  4UEY A;  3CI6 A;  1P9R A;  4I3I A;  2V0U A;  3UE6 A;  5A8B A;  2GJ3 A;  4HQA A;  1S4S A;  2HJ9 C;  4YWZ A;  4GW9 A;  3TRC A;  3FC7 A;  3LR3 A;  3PBN A;  5TBM B;  4R70 A;  2FH5 A;  4BBU A;  1IOU A;  3F1P A;  1S4R A;  1Y28 A;  3S7O A;  4MN6 A;  2YKH A;  1D7E A;  3ZQ5 A;  2PD7 A;  3UB9 A;  3B42 A;  2PYP A;  4PAU A;  3LIC A;  4MDZ A;  3D3O A;  2HGV A;  4P6Z S;  1TD5 A;  2W3E A;  3MQ0 A;  2LB5 A;  3KSH A;  2V0W A;  2NUP C;  1P0Z A;  3EWK A;  2VV6 A;  3CLO A;  1D06 A;  4BBV A;  1UGU A;  4KQD A;  3LR5 A;  3OBF A;  5J3W A;  4Q0H A;  4JGO A;  4XT2 B;  2WKR A;  4RQ9 A;  2KLI A;  2O99 A;  1NWZ A;  3PBS A;  3LUQ A;  2W1T B;  3NHQ A;  4MN5 A;  2VA0 A;  2HF6 A;  3IS2 A;  3T4L A;  3KYZ A;  4EET B;  5AJG A;  4O01 A;  3A0V A;  4F3L B;  4PKY A;  1IFQ A;  3F1O B;  2H28 A;  3T4T A;  1TF1 A;  1UWP X;  2OAP 1;  4OOM A;  1UWN X;  2HJE A;  2NUT C;  3KO6 A;  1LT0 A;  5LBR A;  3TE8 A;  4HOI A;  5DKL A;  4I5S A;  4CLC A;  4WUJ A;  4FSF A;  4EER A;  3T4K A;  4HY8 A;  5F5Y A;  5IU1 A;  4I39 A;  3UME A;  4EQ1 A;  2VJW A;  5HDS A;  2P04 A;  1H3Q A;  4YNR A;  4ZRR A;  4NXB A;  2JKT M;  4B93 A;  5HPF A;  3RFB A;  1XJ3 A;  4WL9 A;  2G7U A;  2O9B A;  4WF0 A;  1T19 A;  1LL8 A;  4GS9 A;  1S67 L;  1TS6 A;  1YSQ A;  4BBT A;  3VV4 A;  3EEA A;  4LRX C;  1NLY A;  1OPX A;  5AVF A;  1WA9 A;  2ZBB A;  2INW A;  2PD8 A;  2KX6 A;  4K08 A;  1OTA A;  3DBA A;  2XSS A;  3K3C A;  2A24 B;  5HL6 A;  2O9A A;  2L1M A;  1NLZ A;  2P08 A;  4WEK A;  3OCL A;  2YKF A;  2K7S A;  3B33 A;  3T4S A;  3KSI A;  3U2A A;  1XJ4 A;  3CIT A;  3R7W B;  3F1N A;  3LYX A;  4L9E A;  2ZOH A;  5F69 A;  4IJG A;  2OOL A;  1OT9 A;  2W0N A;  3CAX A;  2VLG A;  3T4O A;  2EWW A;  3LR4 A;  5TBM A;  2L4R A;  4R6L A;  5DFX A;  1XJ6 A;  4UQI M;  2OAQ 1;  5HDD A;  4LPZ A;  3LID A;  3LFV A;  1T18 A;  3E4P A;  3H9W A;  4KQO A;  3K2N A;  3ZYT A;  4WLA A;  3C30 A;  5F68 A;  4I3J A;  3C8C A;  4R3A A;  1DP8 A;  3UE3 A;  2JKR M;  5J7E A;  3EGX C;  1T1B A;  1YKD A;  3E4O A;  5G4Y A;  2LB9 A;  1S66 L;  4ETZ A;  4GHI A;  1EW0 A;  4H6J A;  4L9F A;  3F1P B;  2PDR A;  5DFY A;  4L0L A;  2M7U A;  2EA9 A;  3B47 A;  3MMH A;  3NOT C;  3UMD A;  3MQQ A;  3CUE C;  4HI4 A;  2CMN A;  2QJ5 A;  1STZ A;  1XFN A;  5MC7 A;  2ZMF A;  2HV1 A;  4KUO A;  1VHM A;  4QPR A;  3CUE A;  3FPV A;  1LSV A;  3OLO A;  2J80 A;  5HWV A;  2WKP A;  1ZHH B;  3P01 A;  5FL3 A;  3VE3 A;  2QHK A;  4IHQ A;  4HHD A;  4MMN A;  2W1T A;  4MCW A;  2PR6 A;  5AVE A;  3CWF A;  4HH2 A;  3MQO A;  1JNU A;  4LLO B;  1YAX A;  2J3T D;  3KSG A;  2XA7 M;  4KUK A;  2O0Y A;  5DF9 A;  2P7J A;  1T1C A;  4CLC E;  4F3L A;  3C38 A;  2I9V A;  3H7W B;  2W3D A;  3F1O A;  4IUH A;  4Q0I A;  2VX8 A;  5L8M A;  2O9C A;  2PYR A;  3A0S A;  2BAS A;  4EEP A;  4DMZ A;  2VGL M;  1GSW A;  4JGP A;  5K5B A;  1S1Z A;  3VOL A;  5DKK A;  3EEH A;  1OJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...