3F1OB

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains, with an internally-bound artificial ligand
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
VCQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
publication title Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3f1oB01
3HJKA 4B9OA 3F1OA 1LL8A 1TS6A 3F1NA 4HOIA 1T19A 1S1YA 2QKPA 3UB9A 4YWZA 1OT9A 3H82A 3CLOA 4EXOA 2I9VA 4GHIA 4HJ3A 2VLGA 4GW9A 2Z6CA 3GECA 1UWNX 3NHQA 2H28A 2INWA 4JGRA 1XJ2A 3E4OA 1NWZA 3ZQ5A 5HDCA 1LSVA 1T1CA 4I3JA 3LIDA 1X0OA 1S67L 1N9NA 2Z6DA 5HDDA 4HIAA 1G28A 2CMNA 4F3LA 2OWHA 1N9OA 3F1PB 2QHKA 4R3AA 5F5YA 4F3LB 1P97A 2V0WA 4HP4A 4LRZE 2L0WA 3VE4A 4DJ2A 4BBVA 1BYWA 4WUJA 5TBMB 1DP6A 4EERA 1XFQA 4BBTA 4RQ9A 3EEHA 2PR5A 2WKRA 2W27A 1OTBA 1TS7A 2V0UA 3D72A 2PYRA 5EFWA 4WN5A 1LSXA 2VV7A 3A0SA 2ZBBA 3LIEA 3UE6A 2D02A 2QJ5A 4DJ3A 3CWFA 1TS8A 4HJ4A 4I5SA 4HI4A 4BBUA 2PD7A 3LI9A 4GS9A 2KDKA 1DP9A 5DKLA 1GSXA 3MJQA 2A24B 1OTEA 3MQOA 4GS9B 3NOTC 2QJ7A 3LYXA 4EETB 1OTIA 1LT0A 3UMDA 2L1MA 4NXFA 2VV6A 5F69A 4I3AA 3BY9A 5F68A 5HWTA 3UMEA 1DRMA 4PKYG 4LPZA 3F1OB 3F1NB 3EWKA 3NJAA 5HD5A 4NXEA 4KUOA 3RH8B 2M1CA 2B02A 3H82B 3H7WA 3ICYA 4GHIB 3BY8A 3OLOA 3BWLA 1XFNA 3H7WB 2BASA 1Y28A 2WKPA 4WL9A 2ZOHA 3C8CA 3LICA 2KX6A 5G4YA 2PYPA 4E04A 3B33A 3P7NA 4EEPA 1OT6A 1VB6A 3MXQA 3LIBA 1N9LA 1LSWA 3PHYA 4KUKA 2D01A 1EW0A 4KQDA 1S4RA 2V9AA 1KOUA 4GCZA 1UWPX 1GSVA 4LRYC 2W0NA 4PKYA 5HZHA 3CAXA 4MN5A 4MN6A 3C2WA 2WKQA 1OJ5A 5DJTA 1T1AA 4H6JA 4JGOA 4EESA 2QWSA 3VOLA 4R6LA 3KX0X 5AVEA 1V9YA 2ZOIA 2J80A 3UB7A 5A8BA 1OTDA 1XJ4A 3E4QA 3LIFA 4M4XA 5J4EA 4WLAA 3VE3A 4LLOB 4HHDA 1F98A 4HP9A 2HV1A 3K3CA 5AVFA 2P7JA 4L9FA 4HJ6A 4I3IA 3UB8A 2PHYA 5J3WA 3GDIA 2V1AA 3E4PA 4EEUA 3NOUC 1D06A 4JGPA 2OOLA 3G6OA 4I38A 1T1BA 3SW1A 5IS1A 3A0RA 1D7EA 2V1BA 3HJIA 3LI8A 5J7EA 2YKFA 1MZUA 5G4ZA 1GSWA 5HSQA 2VEAA 5I5LA 3MFXA 3FG8A 4XT2A 3LIAA 1S1ZA 2K7SA 4NXGA 2OWJA 4I39A 3T50A 4K08A 4L9EA 4XT2B 1OTAA 4HNBA 3LUQA 3IS2A 5HD3A 4EQ1A 2EA9A 3K3DA 3IS2B 5DJUA 5F6AA 4L9GA 5IU1A 1S66L 1DP8A 2L4RA 2PD8A 3UB6A 3F1PA 3PYPA 4R38A 5HDSA 4HQAA 1T18A 3RTYA 3FC7A 5TBMA 3IBRA 4HY8A 2GJ3A 3ULFA 2JN7A 3MQQA 1TS0A 4H6JB 4LRXC 2PR6A 5KIZA 3MR0A 4HH3A 4EW7A 2PDRA 1WA9A 5DKKA 1ODVA 1UGUA 5HWWA 4R70A 1S4SA 1XJ6A 2YKHA 1OJGA 2JHEA 3H9WA 4HH2A 2VV8A 3NOPC 2R78A 2A24A 4NXBA 1JNUA 3A0VA 1P0ZA 5HWVA 4WF0A 1V9ZA 1F9IA 4JGQA 1XJ3A
chains in the Genus database with same CATH superfamily
3IXGA 4DE0A 3Q7VA 1H8MA 1K0KA 3JVVA 2PAVP 3F1OA 3ITBA 3F1NA 3SS4A 1K4EA 4GB7A 4BL2A 3SH9A 3PAGA 2HP6A 3M6HA 4EXOA 2I9VA 3N7WA 4HJ3A 2VLGA 5BOHA 3W4QA 3NHQA 4E3OA 3HLCA 1XGIA 4FH4A 3ZG0A 4GOGA 1IYOA 1XJ2A 4G3KA 3A3FA 2E8IA 4C3QA 3QP4A 3ZQ5A 4ZJ3A 4R1GA 4N92A 1T1CA 1W7FA 4M3KA 3MXSA 4X6TA 3CITA 4JBFA 1PYYA 2Y2GA 3LIDA 3MSHA 1X0OA 4DE3A 3G2ZA 4QWOA 5E43A 5A92A 1N9NA 3NDEA 1U60A 3LEQA 5HDDA 2CMNA 4F3LA 2V1ZA 3T4KA 1N9OA 3SH8A 1MWRA 5F5YA 2V0WA 4P6ZS 1AWIA 4Q0JA 4ESPA 5EUAA 4LRZE 3A3DA 5HL1A 2C6WB 4WUJA 5TBMB 4DRTA 1SDNA 1RGYA 2EFXA 3FV7A 4DN0A 3FPVA 2HGVA 1XFQA 1BLCA 1FCOA 2ZC3B 5CTMA 4RQ9A 3C7UA 5FQMA 3S7PA 5CHUA 1FCNA 3UY6A 2PR5A 3DTKA 3V3SA 1O07A 3N4IA 2KLIA 1QMEA 3D72A 1ESIA 3EQVA 3MZFA 3RFBA 4EU0A 2XA7S 1LSXA 2B95A 2VGLS 1K55C 1TD5A 5E2EA 3S22A 3K2NA 2D02A 2Z2LB 3GMWA 5D3OA 4HJ4A 2Y2OA 2XLNA 2ZLYA 2HPBA 1MKMA 2PD7A 4BBUA 3LI9A 3SOIA 3HLFA 5J8XA 5DKLA 2XA7M 2A24B 2QJ7A 1K56D 5EVIB 1GHMA 1KE4A 1VQQA 4EETB 4MN7A 3E0YA 1OTIA 4II7A 4LCLA 1HD8A 5F1GA 3GVBA 5F69A 2Q9MA 4KZ7A 1GCEA 2JKRI 2E8JA 1N4OA 4PKYG 2OAP1 2B18A 5CGXA 2NUPC 1H8ZA 1K54A 5AQ9A 5L2FA 4ZJ2A 2M1CA 2ZJ9A 3H7WA 1ACFA 3P98A 2EX8A 3BWLA 3BFEA 1XFNA 1Y28A 2W3FA 4CLCD 5CEBA 4S2NC 2ZL1B 5E2GA 4FH2A 3C5AA 1KVMA 4Q8IA 2J9OA 2JC7A 2GDNA 3Q7ZA 5FATA 3C8CA 3LY4A 2QMIA 3IQAA 4KG6A 2OAQ1 3D9YA 5FDSA 1OT6A 4NEED 5DFYA 3MXQA 2WAFA 1CJFA 1G68A 2QZ6A 4KUKA 3ZHHA 2JCHA 3A3IA 4MMNA 4KQDA 4Z9QA 5CTNA 1ZG4A 4R4SA 1S4RA 2ZC6B 3N8LA 1I2WA 1KOUA 1YLWA 3IX3A 4WZ5A 3UO9A 2HDUA 1LHYA 3IF5A 4JF6A 5FEGA 1GA9A 3MZDA 3JPUA 4PKYA 4Z1WA 3CAXA 4KZ4A 2ZMFA 3VP4A 1IYQA 1WYCA 2WKQA 3OPLA 4ZJ1A 1FQGA 5EE8A 1T1AA 4JGOA 3VOLA 3KX0X 4X69A 2K31A 4UQIS 1XGJA 3ZGAB 1QMFA 4KZ3A 2ZOIA 5E2HA 3LO7A 3ZCZA 1XJ4A 3E4QA 4RVAA 5TJJA 2A49A 4U0TA 3NI9A 1LI0A 5FI7A 3KSHA 3ZG7B 3G31A 3QP5A 3BYDA 4E3LA 4GZBA 3B42A 4I3IA 5FQ9A 3BW6A 1NLZA 3UB8A 3GDIA 2V1AA 3E4PA 1IYPA 3PBQA 3EGDC 4EEUA 1EWZA 3NOUC 4BL3A 3W2ZA 3OC2A 2Y2NA 4KZ5A 3KSGA 5A90A 4N9KA 3QP8A 4E3KA 5HPIA 2O99A 5HW3A 2HP9A 1AXBA 3T1RA 3ZFZA 1L0FA 2V2FF 5G4ZA 3HUMA 1CI8A 2VEAA 3O3VA 1YSPA 1DY6A 3TSGA 1LLBA 4MBFA 5GLDA 3FG8A 3ZDJA 4NXGA 4DXBA 4K08A 1OMEA 3LUQA 3WS4A 3KSIA 4EQ1A 2HJEA 4Q0IA 3S7NA 3K3DA 2M7VA 5EVIC 3MKEA 2HDQA 2PU4A 4GN2A 1PWDA 3NECA 3UB6A 2V20A 3N8RA 5FA7A 5FQQA 1IYSA 3PBSA 5CHJA 2VZWA 1Z09A 1SKOA 1T18A 3O5YA 2JKFA 2P74A 3FC7A 3LR5A 2GJ3A 1M40A 2JN7A 4OH0A 3SH7A 1KE3A 3CPTA 4MNRA 4QHCA 4H6JB 2PR6A 2XSSA 2WZXA 1VETA 3IF6A 4OLDA 1W8QA 2BG1A 4JKTA 4PM7A 1ODVA 4OQ0A 1RGZA 1K57C 3AGDA 5AQ7A 2ZM0A 5TR7A 2WUQA 1N9BA 4R4RA 4XUZA 2HDRA 3DTEA 1H0MA 4HH2A 2VV8A 4OP8A 4KZAA 4D2OA 1K56A 1KDWA 4NXBA 1JNUA 1P0ZA 1IKGA 5HWVA 4WF0A 1MWSA 1Z6FA 3HLEA 1K25A 1F9IA 3HJKA 4B9OA 1P9RA 4OKPA 1TS6A 2EX6A 4HOIA 1T19A 2QKPA 4Y0OA 1KDSA 3LR4A 3GRJA 3VP2A 1OT9A 4OOLA 3W4PA 3H82A 4GDNA 4GHIA 3UDXA 4CLCA 2Z6CA 4EWFA 2H28A 2INWA 3ZG8B 4JGRA 1BLHA 2WAEA 4P85A 3E4OA 1HZOA 5HDCA 1LSVA 3VOYA 3DW0A 3C4OA 5FI2A 1DJCA 2J3TD 2W1TA 4I3JA 4X1LA 5KSCA 3LR0A 4OOYA 3UNWA 2XROA 2H0TA 1H8YA 2OWHA 4ID4A 4X25A 5EECA 4R3AA 1KGEA 1K4FA 4F3LB 1P97A 4HP4A 1S6RA 3VE4A 4DJ2A 1H3QA 2ZC4B 2J7VA 2X01A 1ERMA 3V50A 3EEHA 5FEFA 4RA7A 1WE4A 4S2IA 1LL9A 4S2PA 1TS7A 1PI5A 3V67A 3I7JA 3RXXA 4WN5A 2WKEA 4X55A 3GV9A 2W1RA 5HARA 3GTCA 3ZVWA 3OPRA 4JF5A 1TS8A 4LFUA 3VV4A 4I5SA 3CZDA 4GD8A 4HI4A 1TDLA 2WZZA 4GS9A 2GNXA 4C6YA 3NIAA 5EVID 2VKSA 1LT0A 3UMDA 1YM1A 2L1MA 5CEDA 4I3AA 3BY9A 1YLYA 5F68A 3RJUA 1EI5A 2JKRM 5HWTA 4QU3A 4EUZA 3TG9A 3G30A 4L0LA 4LPZA 3BRMA 1DJAA 3BJNA 5C5KA 4DE2A 2IWCA 1ZC2A 4XUXA 2NUTC 5EM1A 3VFHA 4NXEA 4KUOA 1MBLA 3BFDA 2FZ0A 3G2YA 2EFUA 1W5DA 1YMXA 3H7WB 1YLPA 1ERQA 3DAVA 1XA7A 3UPOA 1F2KA 4OQGA 4S2MA 2Y2HA 5G18A 5M1AA 3HUOA 3ISGA 2HJ9C 4DKIA 3VSLA 2DRWA 2ZOHA 4BD0A 1ES5A 3LICA 4IHQA 1Q2PA 1YSQA 2Q0OA 1ONGA 5U47A 5IHVA 1MPLA 3VSKA 1YKDA 1VB6A 1IKIA 3LIBA 1N9LA 1LSWA 4Y15A 5CRFA 2D01A 1EW0A 4C75A 3N6IA 4P6BA 1K6SA 3OCLA 5A93A 1OPXA 4LCMA 2V9AA 1STZA 4GCZA 3WS5A 1UWPX 5GHYA 1S0WA 5CGWA 1E4DA 2QYBA 2XQZA 5HZHA 1EROA 4P6ZM 4MN5A 4MN6A 1W8YA 5DJTA 3ZG5A 4K91A 5K5BA 1XKZA 4B88A 3C7VA 3T4TA 3UDFA 3CUEC 1YLTA 4EBPA 1KGFA 2R9XA 2J3WA 1ZTUA 4Y17A 3UE3A 4OQHA 3GSGA 3T4JA 1SCWA 2DCFA 5I94A 2RCXA 5J4EA 5AQBA 1NZOA 4O01A 4LLOB 5AQAA 4HHDA 3NULA 3IXHA 4HP9A 1PRQA 2VGLM 4Y0TA 4R23A 4U3TA 4WBGA 3IWQA 2XEPA 2XFSA 2P7JA 1JWZA 4HJ6A 3WRTA 5TFQA 2ZMAA 3IWOA 3VP1A 3NC8A 3LR3A 4ZRRA 3BM6A 2OOLA 2UV0E 3HL9A 4A5RA 2CC1A 2Y55A 3V39A 3SW1A 5IS1A 2V1BA 2XRNA 3MKFA 3LI8A 5J7EA 3T4LA 2YKFA 4CJNA 3V5MA 3BFFA 2Y79A 1GSWA 1ESUA 5HSQA 4IJGA 4FSFA 3C38A 2I72A 3BFGA 5I5LA 4DDSA 3O86A 3MFXA 3LIAA 4KZ8A 1J9MA 1XPBA 2OWJA 3BEBA 3T50A 3G34A 4EBLA 4KG5A 2R9WA 2HDSA 3JYIA 2ZMVA 4HNBA 4Y3IA 1KGGA 3IS2A 5HD3A 2GX5A 2EA9A 1NRFA 4JXVA 4G3VA 2IWDA 5DJUA 5IU1A 3S4XA 4L9GA 4PM5A 1S66L 4FTXA 4CQHA 1CQAA 4MDZA 2IWBA 2JKTI 3LGOA 2XK1A 2Y91A 3PYPA 4HBUA 3IHAA 5HDSA 3S7OA 3T1QB 2RL3A 2JKGA 4BD1A 2O9BA 5TBMA 2B5RA 3IBRA 4GKUA 2ZC7A 3C30A 4IVIA 3ULFA 3MQQA 1K54C 2DMWA 4LRXC 5M18A 3TW8A 5KIZA 4ARZB 2PBYA 5L8MA 3CPTB 4X68A 3WRZA 1VETB 3IF6B 4OONA 4JXWA 4OOMA 1CF0A 1J3WA 3QNBA 2V8FA 4IEDA 2W3GA 4R70A 3QP2A 5JYPA 1NYMA 4UQIM 1XJ6A 2YKHA 2XDMA 1FIKA 1K38A 4NETA 5DF8A 2ZQ8A 3ZG9B 1FOFA 3WWXA 4QPRA 1ES3A 1L0GA 2A24A 5EVEA 3MF0A 1ALQA 4ZTKA 4E3IA 1V9ZA 2VGJA 2Y4AA 2H0YA 1GHIA 4JGQA 1JTGA 4WZ5C 4X56A 4Y13A 4R3BA 3ZYTA 1LL8A 4K0WA 5CERA 4QJGA 1SDEA 2XGNA 2ZQCA 4LV1A 4AFIA 2Y2MA 3UB9A 4KZ9A 1E3UD 1XP4A 3CLOA 3G4PA 5DFXA 4F94A 1NYYA 2K2NA 5HAPA 3GECA 1UWNX 3BQAA 4DDYA 4KENB 1P9WA 4CLCB 2EX9A 2ZL1A 1YPRA 4B4XA 3PBOA 2ZQ9A 5GLBA 4S2KA 5FAPA 3CHWP 3DWKA 3PXPA 2W1TB 3T1XA 3IX4A 4Y0UA 3MBZA 1RCJA 2C5WB 4HIAA 4YFMA 4OP5A 2EXAA 3F1PB 3T4QA 2QHKA 5HL6A 3FKWA 3KSFA 4B4ZA 4B93A 1ONHA 4KG2A 4BBVA 1DP6A 3L9KA 4LGWA 3O87A 4WMCD 3CI6A 1LL5A 3WS1A 2WKRA 3OPHA 3R7WA 2W27A 1W79A 2V0UA 2PYRA 2H10A 4YOFA 1L0DA 4KQOA 2KOIA 2WGWA 1NJ4A 1Y4OA 3A0SA 1L0EA 3QP6A 3UE6A 3T12B 4OPZA 1E25A 1FR1A 2X71A 4WEKA 4BMWA 2KDKA 1GSXA 1OTEA 3CJMA 3W8KA 4GS9B 3LYXA 2O9AA 3R4KA 4QB8A 4ME4A 2PBDP 4R0QA 4O0PA 1DJBA 3Q7VB 5L09A 2BLSA 3B3XA 1VM1A 5A91A 3F1OB 3F1NB 3EWKA 4OQIA 4KQRA 4IUHA 5F1FA 3HLBA 5HD5A 3PBRA 4E3MA 3RH8B 3ICYA 3UDIA 1BLPA 3BY8A 4GNUA 1VEUA 1NLYA 2BASA 4JXSA 1H5XA 1YMSA 3IF6C 3HREA 2BTFP 4PHTA 2PT7A 2G7UA 1YQSA 1CEFA 1JWVA 4WL9A 2Y2LA 2ZQ7A 5EVLA 3CG5A 1W63Q 3OOVA 1YAXA 2Y2KA 5G4YA 2PYPA 3HLDA 2FFYA 3KYQA 3B33A 3P7NA 2VJWA 4EEPA 4HESA 1IOUA 2O0YA 5E2FA 1XXMA 4RX3A 2LB5A 2OLVA 3OZHA 2WGIA 5MC7A 3WS2A 2EWWA 5FL3A 3D3OA 3E2LA 2XD5A 5CHMA 5KSHA 4FCFA 4N9LA 4UA9A 3MS6A 4LRYC 2W0NA 5FAQA 5EPHA 3S7QA 4MLLA 3FZCA 4BJPA 4N1XA 4MBKA 1YLZA 2ZQDA 4H6JA 3LY3A 4EESA 2QWSA 3MZEA 5GLCA 4LV3A 4X1MA 4PM9A 4CLCC 3LFVA 4D60A 3VP3A 3E2KA 1NY0A 1V9YA 1ZHHB 3E98A 3PBNA 2P9VA 3LCEA 3FWLA 5A8BA 1OTDA 2EX2A 4M4XA 4OVDA 2J9PA 3PTEA 1K6RA 1PI4A 4BWIA 2P08A 3PR6A 1CK3A 3K3CA 3A3JA 1PIOA 1HTZA 4DE1A 3UE0A 5AVFA 2VX8A 2PHYA 5J3WA 1VHMA 3VMAA 3EGXC 1NXYA 2ZD8A 3A3EA 5L10A 3QNCA 4S2OA 4BLMA 4GD6A 1T1BA 1E3UA 1D7EA 5FASA 3ZNTA 1ZKJA 5DTKA 5GHZA 4JLFA 1HVBA 3SZTA 2W3DA 4FOFA 2XD1A 3EEAA 3CUEA 1K55A 4PPRA 3IH8A 3W4OA 4UHUA 4XT2A 4WM9A 4I39A 3ZVTA 5F83A 4OPQA 2HZ5A 4DMZA 1OTAA 3G35A 4Y2FA 1G6OA 1MC0A 3IS2B 5F6AA 2Y2QA 5HAQA 2L4RA 2JKTM 5FQJA 1BTLA 1YT4A 1I2SA 2G2UA 1CEGA 4ETZA 4R38A 3NCKA 1HLUP 1PZPA 3RTYA 1BSGA 3HVFA 4HY8A 3Q1FA 2XH9A 2WKHA 3WS0A 1TS0A 1WYBA 4WMCA 3BQ8A 4P0MA 4S2NA 4G3WA 4EW7A 3T1SA 4FD8A 3IXBA 2VA0A 2PDRA 2IA2A 1WA9A 1NRJA 3VOZA 1UGUA 3DTMA 5HWWA 1FCMA 3QHYA 4RX2A 4Q0HA 3M2KA 2EWVA 3EQUA 4OPRA 3P09A 1S4SA 1OJGA 5L07A 4K0XA 3KO6A 3L7HA 4UA7A 2VGKA 3P01A 1JTDA 2ZC5B 5CGSA 3IWIA 4LV2A 5FI6A 2MJ6A 2EXBA 3A0VA 4PM6A 1M6KA 3LEZA 1PWCA 3BECA 1I5QA 2XF3A 4NG2A 1FR6A 1S1YA 3UE1A 3T4OA 4DF6A 2OLUA 4YWZA 1IEMA 1BUEA 1ZG6A 4GW9A 4WEJA 4HEFA 4MCWA 3IT9A 1BLSA 1NWZA 2A2LA 2WK0A 4WYYA 5CXWA 2ACGA 1CI9A 3UPNA 3NDGA 4N1HA 5FDHA 4IBRA 5HPFA 3KYEA 4ZAMA 5EM0A 1S67L 3V3RA 2HF6A 5GL9A 2Z6DA 4O8GA 1G28A 1PZOA 3IBJA 4NKPA 4WELA 2G2WA 3HUNA 5LBRA 4X53A 1SKOB 4KZBA 2XR0A 2L0WA 3MFDA 1BYWA 3UB5P 2DNSA 2Z2MB 3IH9A 1KE0A 1G6AA 2WADA 4YNRA 4EERA 4BBTA 3KYZA 5CECA 4UAAA 1BZAA 3FYZA 4R3JA 3SS5A 1OTBA 3G32A 4PM8A 3GQZA 3QP1A 2W3HA 3R7WB 2Y2JA 5EFWA 3TJZC 1LI9A 2VV7A 3IX8A 2W3EA 2J8YA 5KMWA 2ZBBA 3HLGA 2WGWB 3LIEA 2QJ5A 4DJ3A 2J3TC 3CWFA 4IUKA 1IFQA 3Q07A 1MY8A 2HP5A 1SZVA 3Q82A 5EVIA 3Q81A 1DP9A 3MJQA 3MQOA 3NOTC 4H8RA 3N8SA 5HFOA 5F82A 2P04A 5GHXA 4FUWA 3OPPA 3UPPA 4UEYA 4XXRA 3AGEA 4NXFA 2VV6A 1PW1A 3SS3A 4QY5A 3B47A 3TOIA 3UMEA 1DRMA 2OV5A 3NJAA 4EV4A 4EQIA 3FKVA 1A0KA 1MWTA 4JF4A 2OSUA 2B02A 2XFTA 3FPWA 3H82B 5M19A 4GHIB 3OLOA 1VEUB 1FSWA 2ZQAA 2WKPA 3PBTA 1K57A 4BENA 4EBNA 5JYOA 4IVKA 2Y59A 5DVAA 2KX6A 4E04A 4Y5FA 3M6BA 1PNEA 4CPKA 2JE5A 4UA6A 1C3BA 3PHYA 3PAEA 1Y54A 2PU2A 3IXDA 1W63M 1ES4A 1PFLA 3HCYA 5TGFA 5FSRA 4PAUA 3BLMA 5DF7A 3OBFA 1GSVA 4JPMA 3BFCA 3NY4A 1KVLA 1MWUA 4PMAA 4IBXA 4P87A 2V8CA 3MQ0A 2VK3A 3C2WA 4KZ6A 1OJ5A 1D1JA 4OLGA 3ITAA 4MBHA 3VP0A 3RXWA 4QD4A 4ARZA 4R6LA 3TRCA 3JVUA 3UN7A 5AVEA 3GR2A 3AGFA 4BQMA 2J80A 2JBFA 3C4PA 3UB7A 4RYEA 1SHVA 4JXGA 2P9VB 3LIFA 1IELA 5KZHA 4WLAA 3VE3A 1F98A 1PW8A 5HAIA 2HV1A 1G5UA 4L9FA 3T4SA 4S2JA 4E3NA 2M7UA 1TEMA 5GLAA 4QY6A 2FFFB 3IHBA 1SKFA 1D06A 1TF1A 2UWXA 1TVFA 4JGPA 3HLWA 1L3LA 3G6OA 3M2JA 4HBTA 4I38A 5DTTA 1BT5A 3A0RA 3HJIA 4YINA 2Y2PA 2Y2IA 5CX7A 2X02A 1Q2QA 1MZUA 2GZAA 3DTIA 4S2LA 3D4FA 2A3UA 3HBRA 1S1ZA 2K7SA 4E3JA 4L9EA 4XT2B 2H5SA 2O9CA 5EOOA 1XA1A 2ZM2A 4KQQA 5DTSA 2WGVA 2Q9NA 4GLQA 1DP8A 1FSYA 2PD8A 4NK3A 3OCNA 5FQIA 2QPNA 3F1PA 5DF9A 5FQKA 3MMHA 4WZ4A 2PRFA 4CLCE 4GDBA 3DWZA 4HQAA 1TDGA 4LV0A 2LB9A 2WKIA 2Y8HA 4ZDXA 3MXRA 5EV0A 4EUVA 1JVJA 1L2SA 4OPYA 3O88A 3CMZA 4GJ4A 3MR0A 4HH3A 2FH5A 3TE8A 3VFFA 1MXOA 1O7EA 4LENA 5DKKA 4Y7PA 3BLSA 4E6XA 3U2AA 2AVXA 2ZM8A 3DBAA 1PWGA 4MEZA 1ES2A 1FILA 4DXCA 1BULA 3ZNYA 4O7DA 1F5MA 2JHEA 1MKIA 1YLJA 3H9WA 3U4LP 1JWPA 4ETXA 3NOPC 2R78A 1GA0A 3EOIA 5EOEA 4U0XA 1NZUA 3S1YA 4E6WA 3NBLA 5IT5A 2WYXA 4ZBEA 1GHPA 1RP5A 1XX2A 5HX9A 5AJGA 5FAOA 1XJ3A
chains in the Genus database with same CATH topology
3HJKA 4B9OA 1H8MA 1P9RA 3JVVA 3ZYTA 3F1OA 1LL8A 1TS6A 3F1NA 4HOIA 1T19A 1S1YA 2QKPA 3T4OA 4AFIA 3UB9A 4YWZA 3LR4A 1OT9A 4OOLA 3H82A 3CLOA 4EXOA 2I9VA 4GHIA 5DFXA 4HJ3A 2K2NA 2VLGA 4GW9A 4CLCA 2Z6CA 3GECA 4WEJA 1UWNX 3BQAA 3NHQA 2H28A 4MCWA 1P9WA 4CLCB 2INWA 4JGRA 1XJ2A 4G3KA 3PBOA 3E4OA 1NWZA 3ZQ5A 2A2LA 5HDCA 1LSVA 1T1CA 2J3TD 2W1TA 3CITA 4I3JA 3PXPA 2W1TB 3LIDA 5HPFA 3LR0A 1X0OA 1S67L 2XROA 1N9NA 2HF6A 2Z6DA 4O8GA 5HDDA 4HIAA 1G28A 2CMNA 3IBJA 4F3LA 2OWHA 4NKPA 3T4KA 1N9OA 3F1PB 4WELA 3T4QA 2QHKA 4R3AA 5F5YA 4F3LB 1P97A 2V0WA 4P6ZS 5HL6A 4Q0JA 4HP4A 5LBRA 3KSFA 4B93A 4LRZE 2L0WA 3VE4A 4DJ2A 4BBVA 1H3QA 1BYWA 4WUJA 5TBMB 1DP6A 4YNRA 4DN0A 3FPVA 4EERA 2HGVA 1XFQA 4BBTA 3KYZA 4RQ9A 3S7PA 3EEHA 3CI6A 2PR5A 2WKRA 3R7WA 2W27A 1OTBA 1TS7A 2V0UA 2KLIA 3D72A 3EQVA 2PYRA 2W3HA 3RFBA 3V67A 3R7WB 4EU0A 5EFWA 4YOFA 3TJZC 4WN5A 2XA7S 1LSXA 4KQOA 2VGLS 1TD5A 2VV7A 2KOIA 2W1RA 2W3EA 3A0SA 2ZBBA 3LIEA 3K2NA 2D02A 3UE6A 2QJ5A 4DJ3A 2J3TC 3CWFA 4IUKA 1TS8A 3VV4A 1IFQA 4HJ4A 4I5SA 4HI4A 1MKMA 2PD7A 4BBUA 4WEKA 3LI9A 4GS9A 4BMWA 2KDKA 1DP9A 5DKLA 1GSXA 2XA7M 3MJQA 2A24B 1OTEA 2GNXA 3MQOA 4GS9B 3NOTC 2QJ7A 3LYXA 2P04A 4EETB 2VKSA 2O9AA 3R4KA 4MN7A 3E0YA 1OTIA 1LT0A 3UMDA 4ME4A 4II7A 4UEYA 2L1MA 4NXFA 2VV6A 4O0PA 5F69A 4I3AA 3BY9A 5F68A 2JKRM 5HWTA 3B47A 2JKRI 3UMEA 1DRMA 4L0LA 4LPZA 4PKYG 3F1OB 2OAP1 3F1NB 3BJNA 3EWKA 3NJAA 5C5KA 2B18A 2NUPC 4IUHA 2NUTC 5HD5A 3PBRA 4NXEA 4KUOA 3RH8B 2M1CA 2B02A 3FPWA 3H82B 3H7WA 3ICYA 2FZ0A 4GHIB 3BY8A 3OLOA 3BWLA 1NLYA 1XFNA 3H7WB 2BASA 1Y28A 2W3FA 4CLCD 4PHTA 2WKPA 3PBTA 2PT7A 2G7UA 4WL9A 2HJ9C 1W63Q 2ZOHA 3C8CA 3OOVA 1YAXA 3LICA 2KX6A 5G4YA 4IHQA 1YSQA 2PYPA 4E04A 4Y5FA 2OAQ1 3KYQA 3B33A 3P7NA 2VJWA 4EEPA 1OT6A 1IOUA 4NEED 1YKDA 5DFYA 1VB6A 2O0YA 3MXQA 3LIBA 1N9LA 1LSWA 3PHYA 4KUKA 2LB5A 2D01A 1EW0A 1W63M 4MMNA 3HCYA 4KQDA 3OCLA 5MC7A 2EWWA 1OPXA 4PAUA 1S4RA 2V9AA 1KOUA 1STZA 5FL3A 4GCZA 3D3OA 3OBFA 1UWPX 1GSVA 5KSHA 2QYBA 4LRYC 2W0NA 4PKYA 3MQ0A 4Z1WA 5HZHA 3CAXA 3S7QA 4P6ZM 4MN5A 2ZMFA 4MN6A 4BJPA 3C2WA 2WKQA 1OJ5A 5DJTA 1T1AA 4H6JA 4JGOA 4EESA 5K5BA 2QWSA 3VOLA 4ARZA 4R6LA 3TRCA 3JVUA 3KX0X 3T4TA 2K31A 3CUEC 3LFVA 4UQIS 5AVEA 4CLCC 1V9YA 2J3WA 1ZTUA 1ZHHB 2ZOIA 3E98A 3PBNA 2J80A 3UE3A 3UB7A 3T4JA 5A8BA 1OTDA 1XJ4A 3E4QA 3LIFA 5TJJA 4M4XA 5J4EA 4WLAA 3VE3A 4O01A 4LLOB 4HHDA 1F98A 3KSHA 4BWIA 4HP9A 2P08A 3PR6A 2VGLM 2HV1A 3K3CA 3B42A 5AVFA 2P7JA 4L9FA 3T4SA 4HJ6A 2VX8A 4I3IA 3BW6A 1NLZA 3UB8A 2M7UA 2PHYA 5J3WA 1VHMA 3GDIA 2V1AA 3E4PA 3LR3A 4ZRRA 3PBQA 3EGDC 4EEUA 3NOUC 1TF1A 1D06A 3W2ZA 4JGPA 3EGXC 3OC2A 2OOLA 3KSGA 5HPIA 3G6OA 2O99A 4I38A 1T1BA 3SW1A 5IS1A 3A0RA 1D7EA 2V1BA 2XRNA 3HJIA 3LI8A 5J7EA 3T4LA 5CX7A 2YKFA 1MZUA 5G4ZA 2GZAA 2Y79A 1GSWA 2W3DA 4FOFA 3EEAA 5HSQA 3CUEA 4IJGA 4FSFA 2VEAA 3C38A 1YSPA 5I5LA 3MFXA 3FG8A 4XT2A 3LIAA 1S1ZA 2K7SA 4NXGA 2OWJA 4I39A 3T50A 4K08A 4L9EA 4XT2B 4DMZA 1OTAA 2O9CA 4Y2FA 2ZMVA 4HNBA 4Y3IA 1G6OA 1MC0A 3IS2A 3LUQA 5HD3A 2GX5A 3KSIA 2EA9A 4EQ1A 2HJEA 4Q0IA 3S7NA 3K3DA 4G3VA 2M7VA 3IS2B 5DJUA 5F6AA 4GLQA 4L9GA 5IU1A 1S66L 4CQHA 1DP8A 2L4RA 2PD8A 3OCNA 2JKTM 4MDZA 3UB6A 2JKTI 3F1PA 5DF9A 3MMHA 3PBSA 3PYPA 4ETZA 4R38A 2VZWA 5HDSA 3S7OA 4CLCE 4HQAA 1T18A 3O5YA 3RTYA 2LB9A 2O9BA 3FC7A 5TBMA 2Y8HA 3IBRA 4HY8A 3LR5A 2GJ3A 3C30A 3ULFA 2JN7A 3MQQA 1TS0A 4EUVA 2DMWA 4H6JB 4LRXC 2PR6A 2XSSA 4GJ4A 3TW8A 5KIZA 3MR0A 3BQ8A 4HH3A 4ARZB 4G3WA 2FH5A 5L8MA 4EW7A 3TE8A 2VA0A 2PDRA 2IA2A 1WA9A 5DKKA 1ODVA 1NRJA 1UGUA 4OOMA 5HWWA 3U2AA 3DBAA 4Q0HA 4R70A 2W3GA 2EWVA 3EQUA 4UQIM 1S4SA 1XJ6A 2YKHA 1OJGA 1F5MA 2JHEA 3H9WA 3KO6A 3P01A 4HH2A 4ETXA 4QPRA 2VV8A 3NOPC 2R78A 3EOIA 2A24A 3MF0A 4NXBA 2MJ6A 1JNUA 5IT5A 3A0VA 1P0ZA 5HWVA 4WF0A 1V9ZA 1F9IA 5AJGA 4JGQA 1XJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJK A;  4B9O A;  3F1O A;  1LL8 A;  1TS6 A;  3F1N A;  4HOI A;  1T19 A;  1S1Y A;  2QKP A;  3UB9 A;  4YWZ A;  1OT9 A;  3H82 A;  3CLO A;  4EXO A;  2I9V A;  4GHI A;  4HJ3 A;  2VLG A;  4GW9 A;  2Z6C A;  3GEC A;  1UWN X;  3NHQ A;  2H28 A;  2INW A;  4JGR A;  1XJ2 A;  3E4O A;  1NWZ A;  3ZQ5 A;  5HDC A;  1LSV A;  1T1C A;  4I3J A;  3LID A;  1X0O A;  1S67 L;  1N9N A;  2Z6D A;  5HDD A;  4HIA A;  1G28 A;  2CMN A;  4F3L A;  2OWH A;  1N9O A;  3F1P B;  2QHK A;  4R3A A;  5F5Y A;  4F3L B;  1P97 A;  2V0W A;  4HP4 A;  4LRZ E;  2L0W A;  3VE4 A;  4DJ2 A;  4BBV A;  1BYW A;  4WUJ A;  5TBM B;  1DP6 A;  4EER A;  1XFQ A;  4BBT A;  4RQ9 A;  3EEH A;  2PR5 A;  2WKR A;  2W27 A;  1OTB A;  1TS7 A;  2V0U A;  3D72 A;  2PYR A;  5EFW A;  4WN5 A;  1LSX A;  2VV7 A;  3A0S A;  2ZBB A;  3LIE A;  3UE6 A;  2D02 A;  2QJ5 A;  4DJ3 A;  3CWF A;  1TS8 A;  4HJ4 A;  4I5S A;  4HI4 A;  4BBU A;  2PD7 A;  3LI9 A;  4GS9 A;  2KDK A;  1DP9 A;  5DKL A;  1GSX A;  3MJQ A;  2A24 B;  1OTE A;  3MQO A;  4GS9 B;  3NOT C;  2QJ7 A;  3LYX A;  4EET B;  1OTI A;  1LT0 A;  3UMD A;  2L1M A;  4NXF A;  2VV6 A;  5F69 A;  4I3A A;  3BY9 A;  5F68 A;  5HWT A;  3UME A;  1DRM A;  4PKY G;  4LPZ A;  3F1O B;  3F1N B;  3EWK A;  3NJA A;  5HD5 A;  4NXE A;  4KUO A;  3RH8 B;  2M1C A;  2B02 A;  3H82 B;  3H7W A;  3ICY A;  4GHI B;  3BY8 A;  3OLO A;  3BWL A;  1XFN A;  3H7W B;  2BAS A;  1Y28 A;  2WKP A;  4WL9 A;  2ZOH A;  3C8C A;  3LIC A;  2KX6 A;  5G4Y A;  2PYP A;  4E04 A;  3B33 A;  3P7N A;  4EEP A;  1OT6 A;  1VB6 A;  3MXQ A;  3LIB A;  1N9L A;  1LSW A;  3PHY A;  4KUK A;  2D01 A;  1EW0 A;  4KQD A;  1S4R A;  2V9A A;  1KOU A;  4GCZ A;  1UWP X;  1GSV A;  4LRY C;  2W0N A;  4PKY A;  5HZH A;  3CAX A;  4MN5 A;  4MN6 A;  3C2W A;  2WKQ A;  1OJ5 A;  5DJT A;  1T1A A;  4H6J A;  4JGO A;  4EES A;  2QWS A;  3VOL A;  4R6L A;  3KX0 X;  5AVE A;  1V9Y A;  2ZOI A;  2J80 A;  3UB7 A;  5A8B A;  1OTD A;  1XJ4 A;  3E4Q A;  3LIF A;  4M4X A;  5J4E A;  4WLA A;  3VE3 A;  4LLO B;  4HHD A;  1F98 A;  4HP9 A;  2HV1 A;  3K3C A;  5AVF A;  2P7J A;  4L9F A;  4HJ6 A;  4I3I A;  3UB8 A;  2PHY A;  5J3W A;  3GDI A;  2V1A A;  3E4P A;  4EEU A;  3NOU C;  1D06 A;  4JGP A;  2OOL A;  3G6O A;  4I38 A;  1T1B A;  3SW1 A;  5IS1 A;  3A0R A;  1D7E A;  2V1B A;  3HJI A;  3LI8 A;  5J7E A;  2YKF A;  1MZU A;  5G4Z A;  1GSW A;  5HSQ A;  2VEA A;  5I5L A;  3MFX A;  3FG8 A;  4XT2 A;  3LIA A;  1S1Z A;  2K7S A;  4NXG A;  2OWJ A;  4I39 A;  3T50 A;  4K08 A;  4L9E A;  4XT2 B;  1OTA A;  4HNB A;  3LUQ A;  3IS2 A;  5HD3 A;  4EQ1 A;  2EA9 A;  3K3D A;  3IS2 B;  5DJU A;  5F6A A;  4L9G A;  5IU1 A;  1S66 L;  1DP8 A;  2L4R A;  2PD8 A;  3UB6 A;  3F1P A;  3PYP A;  4R38 A;  5HDS A;  4HQA A;  1T18 A;  3RTY A;  3FC7 A;  5TBM A;  3IBR A;  4HY8 A;  2GJ3 A;  3ULF A;  2JN7 A;  3MQQ A;  1TS0 A;  4H6J B;  4LRX C;  2PR6 A;  5KIZ A;  3MR0 A;  4HH3 A;  4EW7 A;  2PDR A;  1WA9 A;  5DKK A;  1ODV A;  1UGU A;  5HWW A;  4R70 A;  1S4S A;  1XJ6 A;  2YKH A;  1OJG A;  2JHE A;  3H9W A;  4HH2 A;  2VV8 A;  3NOP C;  2R78 A;  2A24 A;  4NXB A;  1JNU A;  3A0V A;  1P0Z A;  5HWV A;  4WF0 A;  1V9Z A;  1F9I A;  4JGQ A;  1XJ3 A; 
#chains in the Genus database with same CATH topology
 3IXG A;  4DE0 A;  3Q7V A;  1H8M A;  1K0K A;  3JVV A;  2PAV P;  3F1O A;  3ITB A;  3F1N A;  3SS4 A;  1K4E A;  4GB7 A;  4BL2 A;  3SH9 A;  3PAG A;  2HP6 A;  3M6H A;  4EXO A;  2I9V A;  3N7W A;  4HJ3 A;  2VLG A;  5BOH A;  3W4Q A;  3NHQ A;  4E3O A;  3HLC A;  1XGI A;  4FH4 A;  3ZG0 A;  4GOG A;  1IYO A;  1XJ2 A;  4G3K A;  3A3F A;  2E8I A;  4C3Q A;  3QP4 A;  3ZQ5 A;  4ZJ3 A;  4R1G A;  4N92 A;  1T1C A;  1W7F A;  4M3K A;  3MXS A;  4X6T A;  3CIT A;  4JBF A;  1PYY A;  2Y2G A;  3LID A;  3MSH A;  1X0O A;  4DE3 A;  3G2Z A;  4QWO A;  5E43 A;  5A92 A;  1N9N A;  3NDE A;  1U60 A;  3LEQ A;  5HDD A;  2CMN A;  4F3L A;  2V1Z A;  3T4K A;  1N9O A;  3SH8 A;  1MWR A;  5F5Y A;  2V0W A;  4P6Z S;  1AWI A;  4Q0J A;  4ESP A;  5EUA A;  4LRZ E;  3A3D A;  5HL1 A;  2C6W B;  4WUJ A;  5TBM B;  4DRT A;  1SDN A;  1RGY A;  2EFX A;  3FV7 A;  4DN0 A;  3FPV A;  2HGV A;  1XFQ A;  1BLC A;  1FCO A;  2ZC3 B;  5CTM A;  4RQ9 A;  3C7U A;  5FQM A;  3S7P A;  5CHU A;  1FCN A;  3UY6 A;  2PR5 A;  3DTK A;  3V3S A;  1O07 A;  3N4I A;  2KLI A;  1QME A;  3D72 A;  1ESI A;  3EQV A;  3MZF A;  3RFB A;  4EU0 A;  2XA7 S;  1LSX A;  2B95 A;  2VGL S;  1K55 C;  1TD5 A;  5E2E A;  3S22 A;  3K2N A;  2D02 A;  2Z2L B;  3GMW A;  5D3O A;  4HJ4 A;  2Y2O A;  2XLN A;  2ZLY A;  2HPB A;  1MKM A;  2PD7 A;  4BBU A;  3LI9 A;  3SOI A;  3HLF A;  5J8X A;  5DKL A;  2XA7 M;  2A24 B;  2QJ7 A;  1K56 D;  5EVI B;  1GHM A;  1KE4 A;  1VQQ A;  4EET B;  4MN7 A;  3E0Y A;  1OTI A;  4II7 A;  4LCL A;  1HD8 A;  5F1G A;  3GVB A;  5F69 A;  2Q9M A;  4KZ7 A;  1GCE A;  2JKR I;  2E8J A;  1N4O A;  4PKY G;  2OAP 1;  2B18 A;  5CGX A;  2NUP C;  1H8Z A;  1K54 A;  5AQ9 A;  5L2F A;  4ZJ2 A;  2M1C A;  2ZJ9 A;  3H7W A;  1ACF A;  3P98 A;  2EX8 A;  3BWL A;  3BFE A;  1XFN A;  1Y28 A;  2W3F A;  4CLC D;  5CEB A;  4S2N C;  2ZL1 B;  5E2G A;  4FH2 A;  3C5A A;  1KVM A;  4Q8I A;  2J9O A;  2JC7 A;  2GDN A;  3Q7Z A;  5FAT A;  3C8C A;  3LY4 A;  2QMI A;  3IQA A;  4KG6 A;  2OAQ 1;  3D9Y A;  5FDS A;  1OT6 A;  4NEE D;  5DFY A;  3MXQ A;  2WAF A;  1CJF A;  1G68 A;  2QZ6 A;  4KUK A;  3ZHH A;  2JCH A;  3A3I A;  4MMN A;  4KQD A;  4Z9Q A;  5CTN A;  1ZG4 A;  4R4S A;  1S4R A;  2ZC6 B;  3N8L A;  1I2W A;  1KOU A;  1YLW A;  3IX3 A;  4WZ5 A;  3UO9 A;  2HDU A;  1LHY A;  3IF5 A;  4JF6 A;  5FEG A;  1GA9 A;  3MZD A;  3JPU A;  4PKY A;  4Z1W A;  3CAX A;  4KZ4 A;  2ZMF A;  3VP4 A;  1IYQ A;  1WYC A;  2WKQ A;  3OPL A;  4ZJ1 A;  1FQG A;  5EE8 A;  1T1A A;  4JGO A;  3VOL A;  3KX0 X;  4X69 A;  2K31 A;  4UQI S;  1XGJ A;  3ZGA B;  1QMF A;  4KZ3 A;  2ZOI A;  5E2H A;  3LO7 A;  3ZCZ A;  1XJ4 A;  3E4Q A;  4RVA A;  5TJJ A;  2A49 A;  4U0T A;  3NI9 A;  1LI0 A;  5FI7 A;  3KSH A;  3ZG7 B;  3G31 A;  3QP5 A;  3BYD A;  4E3L A;  4GZB A;  3B42 A;  4I3I A;  5FQ9 A;  3BW6 A;  1NLZ A;  3UB8 A;  3GDI A;  2V1A A;  3E4P A;  1IYP A;  3PBQ A;  3EGD C;  4EEU A;  1EWZ A;  3NOU C;  4BL3 A;  3W2Z A;  3OC2 A;  2Y2N A;  4KZ5 A;  3KSG A;  5A90 A;  4N9K A;  3QP8 A;  4E3K A;  5HPI A;  2O99 A;  5HW3 A;  2HP9 A;  1AXB A;  3T1R A;  3ZFZ A;  1L0F A;  2V2F F;  5G4Z A;  3HUM A;  1CI8 A;  2VEA A;  3O3V A;  1YSP A;  1DY6 A;  3TSG A;  1LLB A;  4MBF A;  5GLD A;  3FG8 A;  3ZDJ A;  4NXG A;  4DXB A;  4K08 A;  1OME A;  3LUQ A;  3WS4 A;  3KSI A;  4EQ1 A;  2HJE A;  4Q0I A;  3S7N A;  3K3D A;  2M7V A;  5EVI C;  3MKE A;  2HDQ A;  2PU4 A;  4GN2 A;  1PWD A;  3NEC A;  3UB6 A;  2V20 A;  3N8R A;  5FA7 A;  5FQQ A;  1IYS A;  3PBS A;  5CHJ A;  2VZW A;  1Z09 A;  1SKO A;  1T18 A;  3O5Y A;  2JKF A;  2P74 A;  3FC7 A;  3LR5 A;  2GJ3 A;  1M40 A;  2JN7 A;  4OH0 A;  3SH7 A;  1KE3 A;  3CPT A;  4MNR A;  4QHC A;  4H6J B;  2PR6 A;  2XSS A;  2WZX A;  1VET A;  3IF6 A;  4OLD A;  1W8Q A;  2BG1 A;  4JKT A;  4PM7 A;  1ODV A;  4OQ0 A;  1RGZ A;  1K57 C;  3AGD A;  5AQ7 A;  2ZM0 A;  5TR7 A;  2WUQ A;  1N9B A;  4R4R A;  4XUZ A;  2HDR A;  3DTE A;  1H0M A;  4HH2 A;  2VV8 A;  4OP8 A;  4KZA A;  4D2O A;  1K56 A;  1KDW A;  4NXB A;  1JNU A;  1P0Z A;  1IKG A;  5HWV A;  4WF0 A;  1MWS A;  1Z6F A;  3HLE A;  1K25 A;  1F9I A;  3HJK A;  4B9O A;  1P9R A;  4OKP A;  1TS6 A;  2EX6 A;  4HOI A;  1T19 A;  2QKP A;  4Y0O A;  1KDS A;  3LR4 A;  3GRJ A;  3VP2 A;  1OT9 A;  4OOL A;  3W4P A;  3H82 A;  4GDN A;  4GHI A;  3UDX A;  4CLC A;  2Z6C A;  4EWF A;  2H28 A;  2INW A;  3ZG8 B;  4JGR A;  1BLH A;  2WAE A;  4P85 A;  3E4O A;  1HZO A;  5HDC A;  1LSV A;  3VOY A;  3DW0 A;  3C4O A;  5FI2 A;  1DJC A;  2J3T D;  2W1T A;  4I3J A;  4X1L A;  5KSC A;  3LR0 A;  4OOY A;  3UNW A;  2XRO A;  2H0T A;  1H8Y A;  2OWH A;  4ID4 A;  4X25 A;  5EEC A;  4R3A A;  1KGE A;  1K4F A;  4F3L B;  1P97 A;  4HP4 A;  1S6R A;  3VE4 A;  4DJ2 A;  1H3Q A;  2ZC4 B;  2J7V A;  2X01 A;  1ERM A;  3V50 A;  3EEH A;  5FEF A;  4RA7 A;  1WE4 A;  4S2I A;  1LL9 A;  4S2P A;  1TS7 A;  1PI5 A;  3V67 A;  3I7J A;  3RXX A;  4WN5 A;  2WKE A;  4X55 A;  3GV9 A;  2W1R A;  5HAR A;  3GTC A;  3ZVW A;  3OPR A;  4JF5 A;  1TS8 A;  4LFU A;  3VV4 A;  4I5S A;  3CZD A;  4GD8 A;  4HI4 A;  1TDL A;  2WZZ A;  4GS9 A;  2GNX A;  4C6Y A;  3NIA A;  5EVI D;  2VKS A;  1LT0 A;  3UMD A;  1YM1 A;  2L1M A;  5CED A;  4I3A A;  3BY9 A;  1YLY A;  5F68 A;  3RJU A;  1EI5 A;  2JKR M;  5HWT A;  4QU3 A;  4EUZ A;  3TG9 A;  3G30 A;  4L0L A;  4LPZ A;  3BRM A;  1DJA A;  3BJN A;  5C5K A;  4DE2 A;  2IWC A;  1ZC2 A;  4XUX A;  2NUT C;  5EM1 A;  3VFH A;  4NXE A;  4KUO A;  1MBL A;  3BFD A;  2FZ0 A;  3G2Y A;  2EFU A;  1W5D A;  1YMX A;  3H7W B;  1YLP A;  1ERQ A;  3DAV A;  1XA7 A;  3UPO A;  1F2K A;  4OQG A;  4S2M A;  2Y2H A;  5G18 A;  5M1A A;  3HUO A;  3ISG A;  2HJ9 C;  4DKI A;  3VSL A;  2DRW A;  2ZOH A;  4BD0 A;  1ES5 A;  3LIC A;  4IHQ A;  1Q2P A;  1YSQ A;  2Q0O A;  1ONG A;  5U47 A;  5IHV A;  1MPL A;  3VSK A;  1YKD A;  1VB6 A;  1IKI A;  3LIB A;  1N9L A;  1LSW A;  4Y15 A;  5CRF A;  2D01 A;  1EW0 A;  4C75 A;  3N6I A;  4P6B A;  1K6S A;  3OCL A;  5A93 A;  1OPX A;  4LCM A;  2V9A A;  1STZ A;  4GCZ A;  3WS5 A;  1UWP X;  5GHY A;  1S0W A;  5CGW A;  1E4D A;  2QYB A;  2XQZ A;  5HZH A;  1ERO A;  4P6Z M;  4MN5 A;  4MN6 A;  1W8Y A;  5DJT A;  3ZG5 A;  4K91 A;  5K5B A;  1XKZ A;  4B88 A;  3C7V A;  3T4T A;  3UDF A;  3CUE C;  1YLT A;  4EBP A;  1KGF A;  2R9X A;  2J3W A;  1ZTU A;  4Y17 A;  3UE3 A;  4OQH A;  3GSG A;  3T4J A;  1SCW A;  2DCF A;  5I94 A;  2RCX A;  5J4E A;  5AQB A;  1NZO A;  4O01 A;  4LLO B;  5AQA A;  4HHD A;  3NUL A;  3IXH A;  4HP9 A;  1PRQ A;  2VGL M;  4Y0T A;  4R23 A;  4U3T A;  4WBG A;  3IWQ A;  2XEP A;  2XFS A;  2P7J A;  1JWZ A;  4HJ6 A;  3WRT A;  5TFQ A;  2ZMA A;  3IWO A;  3VP1 A;  3NC8 A;  3LR3 A;  4ZRR A;  3BM6 A;  2OOL A;  2UV0 E;  3HL9 A;  4A5R A;  2CC1 A;  2Y55 A;  3V39 A;  3SW1 A;  5IS1 A;  2V1B A;  2XRN A;  3MKF A;  3LI8 A;  5J7E A;  3T4L A;  2YKF A;  4CJN A;  3V5M A;  3BFF A;  2Y79 A;  1GSW A;  1ESU A;  5HSQ A;  4IJG A;  4FSF A;  3C38 A;  2I72 A;  3BFG A;  5I5L A;  4DDS A;  3O86 A;  3MFX A;  3LIA A;  4KZ8 A;  1J9M A;  1XPB A;  2OWJ A;  3BEB A;  3T50 A;  3G34 A;  4EBL A;  4KG5 A;  2R9W A;  2HDS A;  3JYI A;  2ZMV A;  4HNB A;  4Y3I A;  1KGG A;  3IS2 A;  5HD3 A;  2GX5 A;  2EA9 A;  1NRF A;  4JXV A;  4G3V A;  2IWD A;  5DJU A;  5IU1 A;  3S4X A;  4L9G A;  4PM5 A;  1S66 L;  4FTX A;  4CQH A;  1CQA A;  4MDZ A;  2IWB A;  2JKT I;  3LGO A;  2XK1 A;  2Y91 A;  3PYP A;  4HBU A;  3IHA A;  5HDS A;  3S7O A;  3T1Q B;  2RL3 A;  2JKG A;  4BD1 A;  2O9B A;  5TBM A;  2B5R A;  3IBR A;  4GKU A;  2ZC7 A;  3C30 A;  4IVI A;  3ULF A;  3MQQ A;  1K54 C;  2DMW A;  4LRX C;  5M18 A;  3TW8 A;  5KIZ A;  4ARZ B;  2PBY A;  5L8M A;  3CPT B;  4X68 A;  3WRZ A;  1VET B;  3IF6 B;  4OON A;  4JXW A;  4OOM A;  1CF0 A;  1J3W A;  3QNB A;  2V8F A;  4IED A;  2W3G A;  4R70 A;  3QP2 A;  5JYP A;  1NYM A;  4UQI M;  1XJ6 A;  2YKH A;  2XDM A;  1FIK A;  1K38 A;  4NET A;  5DF8 A;  2ZQ8 A;  3ZG9 B;  1FOF A;  3WWX A;  4QPR A;  1ES3 A;  1L0G A;  2A24 A;  5EVE A;  3MF0 A;  1ALQ A;  4ZTK A;  4E3I A;  1V9Z A;  2VGJ A;  2Y4A A;  2H0Y A;  1GHI A;  4JGQ A;  1JTG A;  4WZ5 C;  4X56 A;  4Y13 A;  4R3B A;  3ZYT A;  1LL8 A;  4K0W A;  5CER A;  4QJG A;  1SDE A;  2XGN A;  2ZQC A;  4LV1 A;  4AFI A;  2Y2M A;  3UB9 A;  4KZ9 A;  1E3U D;  1XP4 A;  3CLO A;  3G4P A;  5DFX A;  4F94 A;  1NYY A;  2K2N A;  5HAP A;  3GEC A;  1UWN X;  3BQA A;  4DDY A;  4KEN B;  1P9W A;  4CLC B;  2EX9 A;  2ZL1 A;  1YPR A;  4B4X A;  3PBO A;  2ZQ9 A;  5GLB A;  4S2K A;  5FAP A;  3CHW P;  3DWK A;  3PXP A;  2W1T B;  3T1X A;  3IX4 A;  4Y0U A;  3MBZ A;  1RCJ A;  2C5W B;  4HIA A;  4YFM A;  4OP5 A;  2EXA A;  3F1P B;  3T4Q A;  2QHK A;  5HL6 A;  3FKW A;  3KSF A;  4B4Z A;  4B93 A;  1ONH A;  4KG2 A;  4BBV A;  1DP6 A;  3L9K A;  4LGW A;  3O87 A;  4WMC D;  3CI6 A;  1LL5 A;  3WS1 A;  2WKR A;  3OPH A;  3R7W A;  2W27 A;  1W79 A;  2V0U A;  2PYR A;  2H10 A;  4YOF A;  1L0D A;  4KQO A;  2KOI A;  2WGW A;  1NJ4 A;  1Y4O A;  3A0S A;  1L0E A;  3QP6 A;  3UE6 A;  3T12 B;  4OPZ A;  1E25 A;  1FR1 A;  2X71 A;  4WEK A;  4BMW A;  2KDK A;  1GSX A;  1OTE A;  3CJM A;  3W8K A;  4GS9 B;  3LYX A;  2O9A A;  3R4K A;  4QB8 A;  4ME4 A;  2PBD P;  4R0Q A;  4O0P A;  1DJB A;  3Q7V B;  5L09 A;  2BLS A;  3B3X A;  1VM1 A;  5A91 A;  3F1O B;  3F1N B;  3EWK A;  4OQI A;  4KQR A;  4IUH A;  5F1F A;  3HLB A;  5HD5 A;  3PBR A;  4E3M A;  3RH8 B;  3ICY A;  3UDI A;  1BLP A;  3BY8 A;  4GNU A;  1VEU A;  1NLY A;  2BAS A;  4JXS A;  1H5X A;  1YMS A;  3IF6 C;  3HRE A;  2BTF P;  4PHT A;  2PT7 A;  2G7U A;  1YQS A;  1CEF A;  1JWV A;  4WL9 A;  2Y2L A;  2ZQ7 A;  5EVL A;  3CG5 A;  1W63 Q;  3OOV A;  1YAX A;  2Y2K A;  5G4Y A;  2PYP A;  3HLD A;  2FFY A;  3KYQ A;  3B33 A;  3P7N A;  2VJW A;  4EEP A;  4HES A;  1IOU A;  2O0Y A;  5E2F A;  1XXM A;  4RX3 A;  2LB5 A;  2OLV A;  3OZH A;  2WGI A;  5MC7 A;  3WS2 A;  2EWW A;  5FL3 A;  3D3O A;  3E2L A;  2XD5 A;  5CHM A;  5KSH A;  4FCF A;  4N9L A;  4UA9 A;  3MS6 A;  4LRY C;  2W0N A;  5FAQ A;  5EPH A;  3S7Q A;  4MLL A;  3FZC A;  4BJP A;  4N1X A;  4MBK A;  1YLZ A;  2ZQD A;  4H6J A;  3LY3 A;  4EES A;  2QWS A;  3MZE A;  5GLC A;  4LV3 A;  4X1M A;  4PM9 A;  4CLC C;  3LFV A;  4D60 A;  3VP3 A;  3E2K A;  1NY0 A;  1V9Y A;  1ZHH B;  3E98 A;  3PBN A;  2P9V A;  3LCE A;  3FWL A;  5A8B A;  1OTD A;  2EX2 A;  4M4X A;  4OVD A;  2J9P A;  3PTE A;  1K6R A;  1PI4 A;  4BWI A;  2P08 A;  3PR6 A;  1CK3 A;  3K3C A;  3A3J A;  1PIO A;  1HTZ A;  4DE1 A;  3UE0 A;  5AVF A;  2VX8 A;  2PHY A;  5J3W A;  1VHM A;  3VMA A;  3EGX C;  1NXY A;  2ZD8 A;  3A3E A;  5L10 A;  3QNC A;  4S2O A;  4BLM A;  4GD6 A;  1T1B A;  1E3U A;  1D7E A;  5FAS A;  3ZNT A;  1ZKJ A;  5DTK A;  5GHZ A;  4JLF A;  1HVB A;  3SZT A;  2W3D A;  4FOF A;  2XD1 A;  3EEA A;  3CUE A;  1K55 A;  4PPR A;  3IH8 A;  3W4O A;  4UHU A;  4XT2 A;  4WM9 A;  4I39 A;  3ZVT A;  5F83 A;  4OPQ A;  2HZ5 A;  4DMZ A;  1OTA A;  3G35 A;  4Y2F A;  1G6O A;  1MC0 A;  3IS2 B;  5F6A A;  2Y2Q A;  5HAQ A;  2L4R A;  2JKT M;  5FQJ A;  1BTL A;  1YT4 A;  1I2S A;  2G2U A;  1CEG A;  4ETZ A;  4R38 A;  3NCK A;  1HLU P;  1PZP A;  3RTY A;  1BSG A;  3HVF A;  4HY8 A;  3Q1F A;  2XH9 A;  2WKH A;  3WS0 A;  1TS0 A;  1WYB A;  4WMC A;  3BQ8 A;  4P0M A;  4S2N A;  4G3W A;  4EW7 A;  3T1S A;  4FD8 A;  3IXB A;  2VA0 A;  2PDR A;  2IA2 A;  1WA9 A;  1NRJ A;  3VOZ A;  1UGU A;  3DTM A;  5HWW A;  1FCM A;  3QHY A;  4RX2 A;  4Q0H A;  3M2K A;  2EWV A;  3EQU A;  4OPR A;  3P09 A;  1S4S A;  1OJG A;  5L07 A;  4K0X A;  3KO6 A;  3L7H A;  4UA7 A;  2VGK A;  3P01 A;  1JTD A;  2ZC5 B;  5CGS A;  3IWI A;  4LV2 A;  5FI6 A;  2MJ6 A;  2EXB A;  3A0V A;  4PM6 A;  1M6K A;  3LEZ A;  1PWC A;  3BEC A;  1I5Q A;  2XF3 A;  4NG2 A;  1FR6 A;  1S1Y A;  3UE1 A;  3T4O A;  4DF6 A;  2OLU A;  4YWZ A;  1IEM A;  1BUE A;  1ZG6 A;  4GW9 A;  4WEJ A;  4HEF A;  4MCW A;  3IT9 A;  1BLS A;  1NWZ A;  2A2L A;  2WK0 A;  4WYY A;  5CXW A;  2ACG A;  1CI9 A;  3UPN A;  3NDG A;  4N1H A;  5FDH A;  4IBR A;  5HPF A;  3KYE A;  4ZAM A;  5EM0 A;  1S67 L;  3V3R A;  2HF6 A;  5GL9 A;  2Z6D A;  4O8G A;  1G28 A;  1PZO A;  3IBJ A;  4NKP A;  4WEL A;  2G2W A;  3HUN A;  5LBR A;  4X53 A;  1SKO B;  4KZB A;  2XR0 A;  2L0W A;  3MFD A;  1BYW A;  3UB5 P;  2DNS A;  2Z2M B;  3IH9 A;  1KE0 A;  1G6A A;  2WAD A;  4YNR A;  4EER A;  4BBT A;  3KYZ A;  5CEC A;  4UAA A;  1BZA A;  3FYZ A;  4R3J A;  3SS5 A;  1OTB A;  3G32 A;  4PM8 A;  3GQZ A;  3QP1 A;  2W3H A;  3R7W B;  2Y2J A;  5EFW A;  3TJZ C;  1LI9 A;  2VV7 A;  3IX8 A;  2W3E A;  2J8Y A;  5KMW A;  2ZBB A;  3HLG A;  2WGW B;  3LIE A;  2QJ5 A;  4DJ3 A;  2J3T C;  3CWF A;  4IUK A;  1IFQ A;  3Q07 A;  1MY8 A;  2HP5 A;  1SZV A;  3Q82 A;  5EVI A;  3Q81 A;  1DP9 A;  3MJQ A;  3MQO A;  3NOT C;  4H8R A;  3N8S A;  5HFO A;  5F82 A;  2P04 A;  5GHX A;  4FUW A;  3OPP A;  3UPP A;  4UEY A;  4XXR A;  3AGE A;  4NXF A;  2VV6 A;  1PW1 A;  3SS3 A;  4QY5 A;  3B47 A;  3TOI A;  3UME A;  1DRM A;  2OV5 A;  3NJA A;  4EV4 A;  4EQI A;  3FKV A;  1A0K A;  1MWT A;  4JF4 A;  2OSU A;  2B02 A;  2XFT A;  3FPW A;  3H82 B;  5M19 A;  4GHI B;  3OLO A;  1VEU B;  1FSW A;  2ZQA A;  2WKP A;  3PBT A;  1K57 A;  4BEN A;  4EBN A;  5JYO A;  4IVK A;  2Y59 A;  5DVA A;  2KX6 A;  4E04 A;  4Y5F A;  3M6B A;  1PNE A;  4CPK A;  2JE5 A;  4UA6 A;  1C3B A;  3PHY A;  3PAE A;  1Y54 A;  2PU2 A;  3IXD A;  1W63 M;  1ES4 A;  1PFL A;  3HCY A;  5TGF A;  5FSR A;  4PAU A;  3BLM A;  5DF7 A;  3OBF A;  1GSV A;  4JPM A;  3BFC A;  3NY4 A;  1KVL A;  1MWU A;  4PMA A;  4IBX A;  4P87 A;  2V8C A;  3MQ0 A;  2VK3 A;  3C2W A;  4KZ6 A;  1OJ5 A;  1D1J A;  4OLG A;  3ITA A;  4MBH A;  3VP0 A;  3RXW A;  4QD4 A;  4ARZ A;  4R6L A;  3TRC A;  3JVU A;  3UN7 A;  5AVE A;  3GR2 A;  3AGF A;  4BQM A;  2J80 A;  2JBF A;  3C4P A;  3UB7 A;  4RYE A;  1SHV A;  4JXG A;  2P9V B;  3LIF A;  1IEL A;  5KZH A;  4WLA A;  3VE3 A;  1F98 A;  1PW8 A;  5HAI A;  2HV1 A;  1G5U A;  4L9F A;  3T4S A;  4S2J A;  4E3N A;  2M7U A;  1TEM A;  5GLA A;  4QY6 A;  2FFF B;  3IHB A;  1SKF A;  1D06 A;  1TF1 A;  2UWX A;  1TVF A;  4JGP A;  3HLW A;  1L3L A;  3G6O A;  3M2J A;  4HBT A;  4I38 A;  5DTT A;  1BT5 A;  3A0R A;  3HJI A;  4YIN A;  2Y2P A;  2Y2I A;  5CX7 A;  2X02 A;  1Q2Q A;  1MZU A;  2GZA A;  3DTI A;  4S2L A;  3D4F A;  2A3U A;  3HBR A;  1S1Z A;  2K7S A;  4E3J A;  4L9E A;  4XT2 B;  2H5S A;  2O9C A;  5EOO A;  1XA1 A;  2ZM2 A;  4KQQ A;  5DTS A;  2WGV A;  2Q9N A;  4GLQ A;  1DP8 A;  1FSY A;  2PD8 A;  4NK3 A;  3OCN A;  5FQI A;  2QPN A;  3F1P A;  5DF9 A;  5FQK A;  3MMH A;  4WZ4 A;  2PRF A;  4CLC E;  4GDB A;  3DWZ A;  4HQA A;  1TDG A;  4LV0 A;  2LB9 A;  2WKI A;  2Y8H A;  4ZDX A;  3MXR A;  5EV0 A;  4EUV A;  1JVJ A;  1L2S A;  4OPY A;  3O88 A;  3CMZ A;  4GJ4 A;  3MR0 A;  4HH3 A;  2FH5 A;  3TE8 A;  3VFF A;  1MXO A;  1O7E A;  4LEN A;  5DKK A;  4Y7P A;  3BLS A;  4E6X A;  3U2A A;  2AVX A;  2ZM8 A;  3DBA A;  1PWG A;  4MEZ A;  1ES2 A;  1FIL A;  4DXC A;  1BUL A;  3ZNY A;  4O7D A;  1F5M A;  2JHE A;  1MKI A;  1YLJ A;  3H9W A;  3U4L P;  1JWP A;  4ETX A;  3NOP C;  2R78 A;  1GA0 A;  3EOI A;  5EOE A;  4U0X A;  1NZU A;  3S1Y A;  4E6W A;  3NBL A;  5IT5 A;  2WYX A;  4ZBE A;  1GHP A;  1RP5 A;  1XX2 A;  5HX9 A;  5AJG A;  5FAO A;  1XJ3 A; 
#chains in the Genus database with same CATH homology
 3HJK A;  4B9O A;  1H8M A;  1P9R A;  3JVV A;  3ZYT A;  3F1O A;  1LL8 A;  1TS6 A;  3F1N A;  4HOI A;  1T19 A;  1S1Y A;  2QKP A;  3T4O A;  4AFI A;  3UB9 A;  4YWZ A;  3LR4 A;  1OT9 A;  4OOL A;  3H82 A;  3CLO A;  4EXO A;  2I9V A;  4GHI A;  5DFX A;  4HJ3 A;  2K2N A;  2VLG A;  4GW9 A;  4CLC A;  2Z6C A;  3GEC A;  4WEJ A;  1UWN X;  3BQA A;  3NHQ A;  2H28 A;  4MCW A;  1P9W A;  4CLC B;  2INW A;  4JGR A;  1XJ2 A;  4G3K A;  3PBO A;  3E4O A;  1NWZ A;  3ZQ5 A;  2A2L A;  5HDC A;  1LSV A;  1T1C A;  2J3T D;  2W1T A;  3CIT A;  4I3J A;  3PXP A;  2W1T B;  3LID A;  5HPF A;  3LR0 A;  1X0O A;  1S67 L;  2XRO A;  1N9N A;  2HF6 A;  2Z6D A;  4O8G A;  5HDD A;  4HIA A;  1G28 A;  2CMN A;  3IBJ A;  4F3L A;  2OWH A;  4NKP A;  3T4K A;  1N9O A;  3F1P B;  4WEL A;  3T4Q A;  2QHK A;  4R3A A;  5F5Y A;  4F3L B;  1P97 A;  2V0W A;  4P6Z S;  5HL6 A;  4Q0J A;  4HP4 A;  5LBR A;  3KSF A;  4B93 A;  4LRZ E;  2L0W A;  3VE4 A;  4DJ2 A;  4BBV A;  1H3Q A;  1BYW A;  4WUJ A;  5TBM B;  1DP6 A;  4YNR A;  4DN0 A;  3FPV A;  4EER A;  2HGV A;  1XFQ A;  4BBT A;  3KYZ A;  4RQ9 A;  3S7P A;  3EEH A;  3CI6 A;  2PR5 A;  2WKR A;  3R7W A;  2W27 A;  1OTB A;  1TS7 A;  2V0U A;  2KLI A;  3D72 A;  3EQV A;  2PYR A;  2W3H A;  3RFB A;  3V67 A;  3R7W B;  4EU0 A;  5EFW A;  4YOF A;  3TJZ C;  4WN5 A;  2XA7 S;  1LSX A;  4KQO A;  2VGL S;  1TD5 A;  2VV7 A;  2KOI A;  2W1R A;  2W3E A;  3A0S A;  2ZBB A;  3LIE A;  3K2N A;  2D02 A;  3UE6 A;  2QJ5 A;  4DJ3 A;  2J3T C;  3CWF A;  4IUK A;  1TS8 A;  3VV4 A;  1IFQ A;  4HJ4 A;  4I5S A;  4HI4 A;  1MKM A;  2PD7 A;  4BBU A;  4WEK A;  3LI9 A;  4GS9 A;  4BMW A;  2KDK A;  1DP9 A;  5DKL A;  1GSX A;  2XA7 M;  3MJQ A;  2A24 B;  1OTE A;  2GNX A;  3MQO A;  4GS9 B;  3NOT C;  2QJ7 A;  3LYX A;  2P04 A;  4EET B;  2VKS A;  2O9A A;  3R4K A;  4MN7 A;  3E0Y A;  1OTI A;  1LT0 A;  3UMD A;  4ME4 A;  4II7 A;  4UEY A;  2L1M A;  4NXF A;  2VV6 A;  4O0P A;  5F69 A;  4I3A A;  3BY9 A;  5F68 A;  2JKR M;  5HWT A;  3B47 A;  2JKR I;  3UME A;  1DRM A;  4L0L A;  4LPZ A;  4PKY G;  3F1O B;  2OAP 1;  3F1N B;  3BJN A;  3EWK A;  3NJA A;  5C5K A;  2B18 A;  2NUP C;  4IUH A;  2NUT C;  5HD5 A;  3PBR A;  4NXE A;  4KUO A;  3RH8 B;  2M1C A;  2B02 A;  3FPW A;  3H82 B;  3H7W A;  3ICY A;  2FZ0 A;  4GHI B;  3BY8 A;  3OLO A;  3BWL A;  1NLY A;  1XFN A;  3H7W B;  2BAS A;  1Y28 A;  2W3F A;  4CLC D;  4PHT A;  2WKP A;  3PBT A;  2PT7 A;  2G7U A;  4WL9 A;  2HJ9 C;  1W63 Q;  2ZOH A;  3C8C A;  3OOV A;  1YAX A;  3LIC A;  2KX6 A;  5G4Y A;  4IHQ A;  1YSQ A;  2PYP A;  4E04 A;  4Y5F A;  2OAQ 1;  3KYQ A;  3B33 A;  3P7N A;  2VJW A;  4EEP A;  1OT6 A;  1IOU A;  4NEE D;  1YKD A;  5DFY A;  1VB6 A;  2O0Y A;  3MXQ A;  3LIB A;  1N9L A;  1LSW A;  3PHY A;  4KUK A;  2LB5 A;  2D01 A;  1EW0 A;  1W63 M;  4MMN A;  3HCY A;  4KQD A;  3OCL A;  5MC7 A;  2EWW A;  1OPX A;  4PAU A;  1S4R A;  2V9A A;  1KOU A;  1STZ A;  5FL3 A;  4GCZ A;  3D3O A;  3OBF A;  1UWP X;  1GSV A;  5KSH A;  2QYB A;  4LRY C;  2W0N A;  4PKY A;  3MQ0 A;  4Z1W A;  5HZH A;  3CAX A;  3S7Q A;  4P6Z M;  4MN5 A;  2ZMF A;  4MN6 A;  4BJP A;  3C2W A;  2WKQ A;  1OJ5 A;  5DJT A;  1T1A A;  4H6J A;  4JGO A;  4EES A;  5K5B A;  2QWS A;  3VOL A;  4ARZ A;  4R6L A;  3TRC A;  3JVU A;  3KX0 X;  3T4T A;  2K31 A;  3CUE C;  3LFV A;  4UQI S;  5AVE A;  4CLC C;  1V9Y A;  2J3W A;  1ZTU A;  1ZHH B;  2ZOI A;  3E98 A;  3PBN A;  2J80 A;  3UE3 A;  3UB7 A;  3T4J A;  5A8B A;  1OTD A;  1XJ4 A;  3E4Q A;  3LIF A;  5TJJ A;  4M4X A;  5J4E A;  4WLA A;  3VE3 A;  4O01 A;  4LLO B;  4HHD A;  1F98 A;  3KSH A;  4BWI A;  4HP9 A;  2P08 A;  3PR6 A;  2VGL M;  2HV1 A;  3K3C A;  3B42 A;  5AVF A;  2P7J A;  4L9F A;  3T4S A;  4HJ6 A;  2VX8 A;  4I3I A;  3BW6 A;  1NLZ A;  3UB8 A;  2M7U A;  2PHY A;  5J3W A;  1VHM A;  3GDI A;  2V1A A;  3E4P A;  3LR3 A;  4ZRR A;  3PBQ A;  3EGD C;  4EEU A;  3NOU C;  1TF1 A;  1D06 A;  3W2Z A;  4JGP A;  3EGX C;  3OC2 A;  2OOL A;  3KSG A;  5HPI A;  3G6O A;  2O99 A;  4I38 A;  1T1B A;  3SW1 A;  5IS1 A;  3A0R A;  1D7E A;  2V1B A;  2XRN A;  3HJI A;  3LI8 A;  5J7E A;  3T4L A;  5CX7 A;  2YKF A;  1MZU A;  5G4Z A;  2GZA A;  2Y79 A;  1GSW A;  2W3D A;  4FOF A;  3EEA A;  5HSQ A;  3CUE A;  4IJG A;  4FSF A;  2VEA A;  3C38 A;  1YSP A;  5I5L A;  3MFX A;  3FG8 A;  4XT2 A;  3LIA A;  1S1Z A;  2K7S A;  4NXG A;  2OWJ A;  4I39 A;  3T50 A;  4K08 A;  4L9E A;  4XT2 B;  4DMZ A;  1OTA A;  2O9C A;  4Y2F A;  2ZMV A;  4HNB A;  4Y3I A;  1G6O A;  1MC0 A;  3IS2 A;  3LUQ A;  5HD3 A;  2GX5 A;  3KSI A;  2EA9 A;  4EQ1 A;  2HJE A;  4Q0I A;  3S7N A;  3K3D A;  4G3V A;  2M7V A;  3IS2 B;  5DJU A;  5F6A A;  4GLQ A;  4L9G A;  5IU1 A;  1S66 L;  4CQH A;  1DP8 A;  2L4R A;  2PD8 A;  3OCN A;  2JKT M;  4MDZ A;  3UB6 A;  2JKT I;  3F1P A;  5DF9 A;  3MMH A;  3PBS A;  3PYP A;  4ETZ A;  4R38 A;  2VZW A;  5HDS A;  3S7O A;  4CLC E;  4HQA A;  1T18 A;  3O5Y A;  3RTY A;  2LB9 A;  2O9B A;  3FC7 A;  5TBM A;  2Y8H A;  3IBR A;  4HY8 A;  3LR5 A;  2GJ3 A;  3C30 A;  3ULF A;  2JN7 A;  3MQQ A;  1TS0 A;  4EUV A;  2DMW A;  4H6J B;  4LRX C;  2PR6 A;  2XSS A;  4GJ4 A;  3TW8 A;  5KIZ A;  3MR0 A;  3BQ8 A;  4HH3 A;  4ARZ B;  4G3W A;  2FH5 A;  5L8M A;  4EW7 A;  3TE8 A;  2VA0 A;  2PDR A;  2IA2 A;  1WA9 A;  5DKK A;  1ODV A;  1NRJ A;  1UGU A;  4OOM A;  5HWW A;  3U2A A;  3DBA A;  4Q0H A;  4R70 A;  2W3G A;  2EWV A;  3EQU A;  4UQI M;  1S4S A;  1XJ6 A;  2YKH A;  1OJG A;  1F5M A;  2JHE A;  3H9W A;  3KO6 A;  3P01 A;  4HH2 A;  4ETX A;  4QPR A;  2VV8 A;  3NOP C;  2R78 A;  3EOI A;  2A24 A;  3MF0 A;  4NXB A;  2MJ6 A;  1JNU A;  5IT5 A;  3A0V A;  1P0Z A;  5HWV A;  4WF0 A;  1V9Z A;  1F9I A;  5AJG A;  4JGQ A;  1XJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...