3F1OB

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains, with an internally-bound artificial ligand
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
b'VCQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endothelial PAS domain-containing protein 1
molecule tags Transcription
source organism Homo sapiens
publication title Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
pubmed doi rcsb
total genus 30
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3f1oB01
4KQDA 5DKKA 3C8CA 2GJ3A 4EXOA 3GDIA 3ICYA 1N9NA 3LI8A 3MQQA 2KDKA 4HJ6A 4L9GA 5TBMB 4GW9A 4MN6A 4B9OA 5HD5A 3BY8A 4JGOA 3EEHA 2L0WA 1XJ6A 2H28A 2ZOHA 3MR0A 5DKLA 2Z6CA 3BY9A 5DJUA 5AVEA 4BBVA 2YKHA 3H82A 1GSWA 4R70A 5IU1A 1OT9A 4XT2B 3IBRA 1XJ3A 2A24B 2JHEA 3F1NB 3MQOA 4NXFA 2PD8A 4HQAA 2V1BA 3K3DA 4LRZE 1D7EA 2L1MA 4BBTA 3NHQA 3SW1A 4WUJA 1DP8A 3LIAA 2A24A 1XFQA 3E4OA 3F1NA 3HJKA 1F98A 4PKYG 5HDCA 5A8BA 1T1CA 3CAXA 2OOLA 4LLOB 4R38A 2PYRA 3NJAA 3UMEA 2EA9A 3OLOA 4HP9A 1TS8A 4E04A 4HY8A 2BASA 4R3AA 4WL9A 2QJ7A 2L4RA 2YKFA 1OJ5A 2J80A 4LRXC 2V1AA 4NXEA 3MFXA 2PYPA 2CMNA 2V9AA 4HH2A 3G6OA 3UB9A 1GSVA 4BBUA 1N9OA 2M1CA 4WLAA 2I9VA 5J3WA 4EETB 5HSQA 3LICA 4JGQA 2W0NA 2Z6DA 1DRMA 3A0VA 3LIBA 2PDRA 3PHYA 4HI4A 1XJ4A 2R78A 4HIAA 1LSVA 4I3JA 4I39A 3LUQA 3NOTC 1DP9A 2PHYA 4HHDA 3RTYA 3NOUC 5HWWA 2VV6A 2V0WA 4K08A 5I5LA 1S1ZA 3H82B 2ZOIA 4HP4A 2WKRA 4DJ2A 1N9LA 1OTEA 1V9ZA 2D02A 4EERA 4EEPA 3LIEA 1UWNX 1LSXA 3EWKA 3IS2B 5EFWA 5F68A 1D06A 1S67L 3CLOA 4EQ1A 1T1AA 4WN5A 3D72A 1S66L 1LSWA 4LPZA 5HWVA 1OTAA 3RH8B 1VB6A 3KX0X 5HZHA 2VV7A 5F6AA 2VV8A 4EESA 3B33A 1UWPX 4GCZA 2QJ5A 4RQ9A 1LL8A 1T1BA 2PR6A 3E4PA 3FC7A 2JN7A 4YWZA 4XT2A 4EW7A 2PR5A 3A0SA 1F9IA 1JNUA 5DJTA 5TBMA 3BWLA 3E4QA 3VE4A 4L9FA 1P97A 3LIFA 3LIDA 4NXBA 4GS9A 2OWHA 1S4RA 3F1PB 2P7JA 3FG8A 4I3AA 3UB7A 1DP6A 1S4SA 4M4XA 2PD7A 3MXQA 3NOPC 2OWJA 4HNBA 5G4YA 4R6LA 1XFNA 3C2WA 5HDSA 1EW0A 3CWFA 1KOUA 4GHIA 1NWZA 5HWTA 5KIZA 2QKPA 3H7WB 1OTIA 3UB8A 3ZQ5A 3H9WA 3K3CA 3ULFA 4F3LA 2VLGA 1V9YA 1OJGA 3LYXA 3HJIA 1WA9A 3P7NA 4H6JB 4KUKA 4LRYC 5IS1A 3T50A 4HH3A 1OTDA 4F3LB 2VEAA 1TS6A 1G28A 4HJ3A 2HV1A 5HD3A 4GS9B 3VE3A 5F5YA 4EEUA 4I38A 4KUOA 3F1OB 1OTBA 2K7SA 4H6JA 3PYPA 4I5SA 1TS0A 4MN5A 1P0ZA 2QHKA 1T18A 3LI9A 2D01A 4HJ4A 3UB6A 1BYWA 4L9EA 1ODVA 5AVFA 1UGUA 3F1OA 3UE6A 1Y28A 5J7EA 3GECA 4GHIB 3IS2A 1T19A 2KX6A 4JGRA 3H7WA 4WF0A 5HDDA 2WKPA 2WKQA 4NXGA 5G4ZA 3A0RA 4PKYA 3VOLA 1S1YA 3MJQA 1XJ2A 1OT6A 2INWA 1MZUA 1LT0A 4HOIA 2QWSA 4I3IA 4JGPA 5F69A 2W27A 3F1PA 4DJ3A 2V0UA 5J4EA 2ZBBA 2B02A 1GSXA 1X0OA 1TS7A 3UMDA
chains in the Genus database with same CATH superfamily
5TBMB 3G30A 5BOHA 5E2HA 3QP4A 3U4LP 3HLGA 1ZHHB 3BY9A 4GLQA 5IHVA 1FCMA 2C6WB 5DTSA 1YKDA 3OPRA 3C38A 4RX2A 2W3DA 4DDYA 2P74A 2OSUA 3CPTB 3PBQA 4CLCE 4E04A 2JKGA 1VEUB 1K56D 1HD8A 3OOVA 1LL5A 2B5RA 4FH4A 2A3UA 5EECA 2V0WA 1NJ4A 2OAP1 1V9ZA 1K6SA 1FQGA 3LIEA 4E3KA 4N9LA 2Y79A 2Q9NA 2RL3A 2HZ5A 5HX9A 3KX0X 3MQ0A 3I7JA 4YWZA 3GVBA 2XR0A 3BWLA 3KSHA 2V2FF 3LIDA 3UB7A 4LV1A 4MDZA 3WS0A 2PU2A 1QMFA 1HLUP 4KZAA 3FWLA 5FQ9A 5J8XA 4H6JB 3IX8A 2EX6A 1G28A 1SKOA 5AJGA 4GOGA 4H6JA 1ALQA 1TS0A 1ERQA 3HUOA 3JPUA 1Y28A 2Y2NA 1SHVA 2O9CA 3BEBA 2MJ6A 1K0KA 2GX5A 3MJQA 3GV9A 2INWA 5FAQA 4DMZA 1L0DA 1ONGA 3Q82A 1IYQA 3OZHA 2KDKA 1CJFA 3DTEA 4IJGA 1K54C 5DKLA 4EBLA 4MBKA 1IYPA 4WEKA 1GSWA 3Q1FA 1XJ3A 2EWVA 4H8RA 3E4OA 2PYRA 4C75A 4E6XA 2QJ7A 3BM6A 2L4RA 4CLCD 1JTDA 3BECA 3C5AA 3VFHA 1PW8A 1SKFA 1IFQA 1XJ4A 1LSVA 3E98A 3LGOA 3AGDA 2V1ZA 5HWWA 2E8JA 3PAEA 3KYQA 3C7UA 5KSCA 4WN5A 4FH2A 3IF6B 3N8RA 3DWKA 4MN7A 4ARZA 3ZNTA 3E2KA 4RQ9A 1ERMA 2QJ5A 3A0SA 1JNUA 5TBMA 1NRFA 4L9FA 2P7JA 1S4SA 3MZDA 3CPTA 3CWFA 5EV0A 1G6AA 5HPIA 4EUZA 5L2FA 2ZL1B 3G34A 4F3LB 4GS9B 4EEUA 4NEED 3MBZA 4I5SA 4MN5A 3UB6A 3TRCA 4GHIB 4G3KA 5HDDA 1O07A 3VOLA 1M6KA 1IKGA 5DKKA 2JC7A 5CX7A 3GDIA 3S7OA 4L9GA 2EWWA 3D9YA 4JKTA 4OP5A 2Z6CA 4LGWA 3UE0A 2WKHA 4DE2A 3ITAA 1NY0A 4X1LA 1N4OA 3V3SA 1YSPA 1PWDA 2EA9A 2H5SA 4GD8A 1XA1A 3SZTA 4NKPA 2EX8A 3ZGAB 1Y54A 5U47A 5J3WA 3N6IA 4GJ4A 1E4DA 2IWBA 3T1XA 4Y2FA 5KSHA 1S1ZA 4BENA 1N9LA 1NYYA 5CECA 5TFQA 1D06A 3A3EA 3JVUA 5FI6A 1PZPA 5GL9A 1LHYA 3IXDA 4DE1A 3B33A 4EESA 2EFUA 1F9IA 5DF9A 5FASA 2A49A 4OPYA 3VMAA 4I3AA 3GSGA 3T1QB 4Z1WA 2WGWA 2Y2HA 5FA7A 3H7WB 5L07A 3KYEA 2VLGA 1E25A 4ZDXA 2WKEA 2DNSA 2GNXA 2VZWA 5EM0A 3NCKA 1ES5A 4NK3A 1L0FA 1IOUA 3HLCA 4DE3A 1C3BA 3A0RA 1YT4A 1E3UA 3VP3A 2Y2OA 4RVAA 1X0OA 5EOEA 1WYBA 4KQQA 3V50A 4HEFA 3IF6A 4BLMA 1CI9A 3H82A 3F1NB 4LRZE 1ESUA 3W8KA 5HDCA 5A8BA 2OOLA 3UMEA 3RJUA 1MC0A 1L3LA 1KDWA 1W79A 4LRXC 1DY6A 5EPHA 4QJGA 2X71A 4BJPA 3R4KA 4ME4A 4N1XA 3CITA 3QNCA 1K55A 2RCXA 4K08A 3IS2B 3MKEA 4E6WA 4DXCA 3T4QA 5L10A 2PT7A 1W63Q 2ZC4B 1TF1A 5FI2A 1L0EA 2FFYA 4XT2A 2ZMFA 2FFFB 1FSYA 1JTGA 2XFSA 3LR0A 3N8LA 5EVID 4B4ZA 1EW0A 3QP8A 4CLCB 1PI5A 4M3KA 4PM6A 4ZRRA 3NDEA 3KSFA 4FSFA 2WGIA 4LFUA 3SH7A 3QP6A 1SCWA 5FQMA 1ESIA 1P9WA 2WGVA 3WS4A 3ZVTA 3C4PA 1ACFA 4UAAA 1S6RA 1ES4A 3T1RA 5DFXA 2OLVA 4EXOA 3MQQA 4MN6A 4S2KA 4Y5FA 3MR0A 3CMZA 4R0QA 2AVXA 3UE3A 3ZHHA 1TVFA 4L0LA 1DP8A 3AGFA 3HJKA 1MPLA 1ZTUA 1MWTA 3NJAA 3OLOA 3IHBA 3S7PA 3MFDA 4OPQA 2CMNA 2V9AA 2ZL1A 2HGVA 3A3IA 2W0NA 2B18A 4NETA 5EVIA 1YLTA 5L8MA 4EEPA 2UWXA 3G4PA 2Y2IA 3EQVA 1T1AA 1PNEA 3DTIA 3NY4A 3VP0A 1CF0A 2VV8A 3SS4A 2ZQ8A 4XUZA 4CJNA 5AQAA 4OOMA 3EEAA 4D2OA 3O86A 1TDGA 4KZ7A 5K5BA 1FOFA 5KMWA 5KZHA 3K2NA 3ZG7B 4WEJA 1K54A 3GQZA 5IS1A 4HH3A 5LBRA 5HD3A 2K7SA 2W3FA 2LB5A 2HDSA 3LFVA 1CEGA 4L9EA 3BJNA 2BLSA 1F5MA 3GECA 3TOIA 3H7WA 2WKQA 4KZ8A 4YOFA 2J9OA 1OT6A 5F69A 3GTCA 2B02A 1RGYA 5FQJA 2P04A 3M6BA 3LI8A 1FCOA 1ZKJA 5HD5A 4MBHA 1KE4A 1YMXA 1WE4A 1PFLA 2ZM0A 3CZDA 2YKHA 5AVEA 3IX3A 4XT2B 4HBTA 4OH0A 2L1MA 2VK3A 2W3HA 2A24A 3A3FA 4ARZB 3CAXA 4R38A 3DWZA 1J3WA 2GZAA 1BLSA 1W8QA 4WL9A 2R9XA 2YKFA 1H8MA 1GSVA 4OQGA 5FL3A 2B95A 4X56A 4MBFA 4Y0UA 1PZOA 2PHYA 4WZ4A 2XFTA 3MF0A 5A91A 5C5KA 3OPLA 1JWZA 3VP4A 1LSXA 4E3MA 1NRJA 2WKIA 5FDSA 1S67L 2W3EA 2P9VA 3Q7VB 5HWVA 2J8YA 2K2NA 3ZG8B 3B3XA 4CLCC 2PBDP 1XKZA 3ZVWA 2VJWA 5EE8A 1H3QA 3F1PB 1RP5A 5EUAA 4HNBA 4IBXA 4R6LA 4ETZA 4KQRA 5TGFA 4BWIA 1OTIA 1CI8A 4UEYA 4N92A 1PW1A 5DFYA 3LYXA 3DTKA 5CEDA 4I38A 4WYYA 3RFBA 3OC2A 3MXRA 3RXWA 3T4KA 3UE6A 1NZOA 2Z2LB 3A3JA 1NXYA 4PKYA 4JBFA 5GLBA 1IYOA 1K25A 3WRZA 5FEGA 1MY8A 4PM7A 2W1TA 5J4EA 2O0YA 3LY3A 1BULA 5HPFA 4LENA 5CGWA 1SDNA 1W63M 2X01A 3ITBA 1MKIA 5IU1A 4OOLA 3K3DA 2E8IA 1D7EA 4ZBEA 1K57A 5TJJA 2XSSA 2Q9MA 1OJ5A 3A3DA 3G2YA 2X02A 2JKRM 3BFEA 3UNWA 5E43A 3W4QA 2NUPC 3NOTC 5GLAA 1DP9A 1GHPA 1F2KA 4EERA 4RA7A 3SH8A 4Y13A 4KG5A 2Y2KA 5F1GA 5EFWA 1VETB 1BLPA 2XLNA 2O9AA 2XF3A 4JPMA 2BG1A 2XD5A 1UWPX 1XP4A 4GKUA 1FR1A 2PR5A 3PXPA 2ZQDA 3LIFA 4NXBA 4GNUA 1DP6A 1XPBA 3MXQA 4BQMA 1AWIA 1OPXA 3Q81A 4IUHA 3EGXC 2DCFA 1S0WA 1TD5A 4WZ5A 3IHAA 4P87A 3M6HA 3VV4A 3ZG9B 2PAVP 4HJ4A 4JXVA 3F1OA 2J9PA 3BFFA 5CHJA 2HP5A 4JXSA 2ZC6B 3LR3A 3S7NA 3CG5A 1Q2PA 3Q7VA 4G3VA 5A92A 4WUJA 1FR6A 1F98A 3V39A 5FAPA 3NBLA 4IUKA 3QP5A 2EXBA 3V67A 3ZDJA 4A5RA 2V1AA 1IELA 1VQQA 3MFXA 4QU3A 1YM1A 5DVAA 3CUEC 2Z6DA 2V8CA 1EWZA 1W5DA 3G35A 4WMCA 3ZFZA 4FCFA 1GHMA 2WKRA 2D02A 5HFOA 3FKVA 3HLDA 4PHTA 2WAFA 3PBOA 4FD8A 5EVLA 2ZMVA 1VHMA 1IYSA 4QD4A 2PR6A 3FPVA 3UO9A 3GMWA 2EX2A 1P97A 2OWHA 1YSQA 3FG8A 4M4XA 4R4SA 3ZYTA 1G68A 1NWZA 1FILA 1K6RA 2H0YA 2H0TA 2ZQCA 2W1RA 5HARA 4N1HA 1KGGA 4KZ5A 4U3TA 4UHUA 2QHKA 2GDNA 2EXAA 2DMWA 1J9MA 4IVKA 4JGRA 5F1FA 1JWPA 5FI7A 5CTNA 2Y2JA 3LO7A 3DBAA 4QB8A 3C8CA 4Z9QA 3GR2A 1K57C 4RX3A 4WBGA 2VX8A 1BLHA 1ES2A 4IVIA 3IBRA 4YFMA 4JF4A 2V1BA 2V8FA 3WS1A 2IA2A 3N4IA 1CEFA 4D60A 3NDGA 3LY4A 4NXEA 1YLZA 2PYPA 5JYPA 3T12B 3IBJA 4ESPA 3UPNA 4P6ZS 2KOIA 3SH9A 5GHXA 5M19A 4BL3A 4HHDA 2P08A 2VV6A 3B47A 3U2AA 4HP4A 3C4OA 5IT5A 2JCHA 1VM1A 4X69A 1D1JA 4B88A 3EGDC 4EQ1A 3BQ8A 4O8GA 4S2OA 3MS6A 4KZBA 4IBRA 5E2EA 1T1BA 1KDSA 4KG6A 1STZA 4K0WA 3LEZA 4KZ4A 4X6TA 3O5YA 5CTMA 3IF5A 1XGJA 2ZQ9A 4S2MA 3P01A 1H0MA 4X25A 2WADA 1N9BA 3H9WA 2HJ9C 3HUNA 4Y17A 4ID4A 5EOOA 2VEAA 1TS6A 4E3LA 2HDUA 4Y3IA 5E2FA 3SS3A 4Y15A 1GCEA 4BD0A 5DTKA 1YLJA 4NXGA 5G4ZA 1NZUA 4B4XA 2HP9A 1XJ2A 2K31A 3S22A 4QHCA 4HOIA 4N9KA 4HESA 1TEMA 2V0UA 3VOZA 1IKIA 3BYDA 3JVVA 4KQDA 2W1TB 1N9NA 4B9OA 2O9BA 2ZOHA 5F82A 4JF6A 3HLWA 1OT9A 4MEZA 3W2ZA 3HVFA 1H8ZA 4Y0OA 3VE4A 4WELA 1L0GA 1XFQA 1KGFA 2ZJ9A 3N8SA 2VGLS 2XEPA 1JWVA 3PBSA 4E3JA 1PYYA 2KLIA 3PBRA 1OMEA 4S2JA 3ZG0A 5HSQA 3ZG5A 3LIBA 1HVBA 3PHYA 4HI4A 3GRJA 2R78A 3DTMA 3RTYA 5FATA 4LV0A 5JYOA 4X1MA 4X53A 3T4TA 3MKFA 2QYBA 3DW0A 1DJCA 4LCLA 4O01A 1VB6A 1NLYA 2JKFA 3FC7A 2HP6A 4WZ5C 1Y4OA 3BFDA 3O88A 4P6BA 4KENB 4BMWA 3CUEA 1S4RA 4KZ3A 2OWJA 4Q0HA 4YINA 5GLCA 3IH8A 2QKPA 5F83A 1V9YA 4BL2A 1WA9A 4NG2A 4MLLA 3RXXA 3T4JA 1MKMA 3VFFA 2XROA 1Z09A 5L09A 4WF0A 4EUVA 2Y55A 4OPZA 4E3NA 4OKPA 4I3IA 4DJ3A 3UY6A 2WK0A 1MBLA 2ZC5B 1FIKA 3W4OA 1DJBA 2L0WA 1XJ6A 5CXWA 3OPHA 1BT5A 2R9WA 3WWXA 1LI9A 2XA7M 3HLBA 2OV5A 3F1NA 3LEQA 1LL9A 2H10A 2OLUA 3M2JA 1XGIA 4HP9A 1XA7A 3IWIA 2W3GA 1RGZA 2J80A 3SOIA 1FSWA 4JF5A 5DF7A 3Q7ZA 2I9VA 5GHYA 2WZZA 1DRMA 4I3JA 3BFCA 4MMNA 1HTZA 1WYCA 5HL6A 3D4FA 5I5LA 3P09A 3IXBA 4DJ2A 3QP1A 4K0XA 5MC7A 4DN0A 1YLWA 4R1GA 1CQAA 3PBNA 5F6AA 4HBUA 2XA7S 4CLCA 3IXGA 4Q0JA 3NOPC 5G4YA 4QWOA 5FDHA 5FAOA 3PAGA 2M7UA 2ZQAA 4F3LA 1BZAA 5TR7A 1K55C 4KUOA 4X55A 4Y0TA 2ZC3B 3PYPA 1ZC2A 4OVDA 5FSRA 4PM5A 3MMHA 2ZMAA 1PRQA 1VEUA 2ACGA 1MWRA 1H5XA 4F94A 3BW6A 5CHMA 2J7VA 2UV0E 1SZVA 4OOYA 4HJ6A 4WM9A 3S4XA 1E3UD 4DRTA 3BY8A 3EEHA 2G2WA 4BBVA 5DJUA 4QY5A 3S1YA 4UQIS 2Y2LA 3O3VA 5I94A 4KQOA 4X68A 1I5QA 3ZNYA 1JVJA 5M18A 1TS8A 2ZLYA 1YQSA 3E0YA 3NC8A 3G32A 1SKOB 4R23A 4E3OA 3G31A 3MZEA 4WLAA 2J3WA 3UDFA 3A0VA 4JGOA 3LUQA 5CEBA 3CHWP 5CHUA 4OP8A 5GHZA 3H82B 4ZJ1A 4PPRA 4S2NA 3CLOA 3BLSA 1S66L 3PBTA 1RCJA 1BSGA 5DF8A 4YNRA 3OBFA 5HZHA 2XK1A 4GCZA 4UQIM 4JXGA 2Y91A 1H8YA 4GDBA 4UA9A 2P9VB 1Q2QA 1KOUA 3MZFA 4GHIA 1W7FA 3ZQ5A 3ULFA 1MWUA 5FEFA 3HJIA 3P7NA 4GDNA 1VETA 3T50A 2JE5A 3AGEA 4XXRA 4HJ3A 2HV1A 3QNBA 5F5YA 1OTBA 4JLFA 2EX9A 1ODVA 4CPKA 1ONHA 4UA7A 4XUXA 5FQIA 2QWSA 3BQAA 2CC1A 4Y7PA 3TG9A 1GA9A 5G18A 3HLFA 1ZG4A 3TSGA 3O87A 2GJ3A 1NLZA 3NECA 4II7A 4KZ6A 4GB7A 5A93A 3FZCA 1PIOA 2JHEA 3D3OA 2PD8A 4HQAA 1YAXA 4PAUA 4S2LA 5CRFA 3NHQA 3R7WB 3ISGA 4PMAA 4C6YA 3Q07A 2IWDA 1BUEA 5HAQA 2WZXA 3HBRA 3LR5A 5FQKA 3EOIA 4EBPA 3UPOA 5E2GA 2JKTM 3KO6A 4EETB 3LICA 1PWGA 4ZTKA 4NXFA 3WRTA 2ZOIA 3OCNA 3T4OA 2QZ6A 2Y2GA 2VV7A 2NUTC 1LI0A 3ZCZA 4EW7A 5DJTA 4FTXA 3T4SA 4FOFA 1DJAA 4EWFA 3WS2A 2VGKA 1G6OA 5EVIB 1MXOA 2ZC7A 2HDQA 5KIZA 2ZD8A 3UB8A 3SS5A 1P9RA 2WYXA 4OPRA 3TE8A 1FCNA 3LCEA 4LV3A 3UPPA 3VP1A 4R3BA 1BYWA 4OQ0A 4G3WA 4OONA 4R4RA 2WKPA 2LB9A 1S1YA 1MZUA 5DTTA 2W27A 2OAQ1 3IX4A 3FKWA 3IWQA 2PBYA 2H28A 4OQHA 4JXWA 2VGJA 3N7WA 4R70A 3KSIA 3MQOA 1YLPA 1AXBA 3JYIA 4PKYG 2Y59A 2J3TD 4P0MA 3HUMA 2BTFP 1G5UA 3UE1A 2Y2MA 3V5MA 2Y4AA 3NIAA 3LR4A 4HH2A 2IWCA 3HLEA 3PR6A 4HIAA 2PDRA 1KGEA 2Y2QA 4IEDA 2VA0A 2G2UA 4OLDA 4QY6A 5AQ9A 1OTEA 1Z6FA 2EFXA 1SDEA 4WMCD 3KSGA 4E3IA 1MWSA 3KYZA 5EM1A 4S2IA 3L7HA 1LL8A 3E4PA 2JN7A 4PM9A 1O7EA 2V20A 3E4QA 3NULA 3R7WA 2VGLM 2QMIA 1XFNA 3PTEA 4GN2A 5HDSA 2XQZA 1K56A 2FH5A 1GHIA 3UDIA 1YMSA 3VSKA 3T4LA 4LRYC 3IXHA 4KZ9A 1OTDA 2O99A 4PM8A 2FZ0A 1U60A 1NYMA 5CGXA 4O7DA 1YPRA 1P0ZA 2HJEA 4EQIA 3IS2A 1T19A 4LV2A 5EVIC 4EBNA 2ZM8A 3QHYA 3DAVA 3F1PA 4O0PA 1TDLA 4Q0IA 2ZBBA 3UN7A 2JBFA 5FQQA 3UMDA 3WS5A 2G7UA 3ICYA 4CQHA 4U0TA 2ZQ7A 1K38A 1XX2A 2A24B 4FUWA 1YLYA 3OCLA 3QP2A 5M1AA 4S2PA 5AQ7A 3CI6A 1T1CA 2DRWA 3FPWA 4HY8A 4R3AA 3TW8A 3T1SA 2I72A 3UB9A 1HZOA 1N9OA 1L2SA 4JGQA 4P6ZM 4ETXA 1KVLA 3MXSA 3NOUC 5HW3A 3G2ZA 3UDXA 3EWKA 1M40A 1LSWA 2VKSA 1OTAA 3RH8B 3HREA 1XXMA 4DDSA 1GA0A 4BBTA 4ZJ3A 1KE0A 2WGWB 2C5WB 2HDRA 3M2KA 4MCWA 2XDMA 1I2WA 2M7VA 4LCMA 4DE0A 1I2SA 2Q0OA 4Q8IA 2JKTI 3IT9A 1OJGA 4KUKA 1ES3A 3VE3A 2Z2MB 5A90A 4MNRA 1PWCA 1BLCA 3UB5P 3LI9A 5AVFA 2QPNA 2WUQA 1BTLA 2KX6A 3IWOA 3BLMA 4DKIA 4JGPA 3L9KA 3MSHA 1W8YA 3VSLA 4EV4A 1LLBA 1TS7A 3IH9A 4K91A 4B93A 4AFIA 4GW9A 1IEMA 2PRFA 3B42A 4IHQA 4OQIA 4DXBA 1KE3A 4RYEA 1A0KA 2JKRI 3IQAA 5CGSA 3S7QA 1EI5A 3W4PA 3SW1A 4S2NC 1ZG6A 3LIAA 4EU0A 5AQBA 3OPPA 5GLDA 3BFGA 2BASA 4UA6A 3TJZC 3G6OA 4BBUA 2M1CA 4C3QA 4GZBA 3E2LA 3HL9A 4LLOB 4I39A 1PI4A 3C7VA 1UWNX 5D3OA 5F68A 5CERA 4DF6A 3FV7A 3D72A 3VP2A 5HAIA 4LPZA 3IF6C 1CK3A 5EVEA 2XD1A 2XRNA 3P98A 3CJMA 4R3JA 1KVMA 5HAPA 5HL1A 4U0XA 1K4FA 4GS9A 4QPRA 2PD7A 4P85A 2WAEA 3C2WA 4KG2A 2Y2PA 3BRMA 3HCYA 3V3RA 2J3TC 5HWTA 4OLGA 3K3CA 2ZM2A 3NI9A 4ZAMA 1K4EA 1QMEA 3F1OB 3EQUA 1T18A 2D01A 2Y8HA 3VOYA 1UGUA 5J7EA 2A2LA 4ZJ2A 2HF6A 3FYZA 4GD6A 2PU4A 1LT0A 2XH9A 4BD1A 1EROA 2XGNA 1GSXA 2HPBA 3C30A
chains in the Genus database with same CATH topology
3C8CA 2GJ3A 1NLZA 5TBMB 4EXOA 4II7A 3MQQA 4MN6A 4Y5FA 3MR0A 1ZHHB 3BY9A 4GLQA 2VX8A 1YKDA 3IBRA 2JHEA 3D3OA 2PD8A 4HQAA 2V1BA 3C38A 3UE3A 1YAXA 4PAUA 3NHQA 3R7WB 4L0LA 1DP8A 2IA2A 2W3DA 3HJKA 1ZTUA 3NJAA 3OLOA 3PBQA 4CLCE 4E04A 3LR5A 3S7PA 3EOIA 4NXEA 2PYPA 2CMNA 2V9AA 2JKTM 3KO6A 4EETB 2HGVA 3IBJA 3LICA 4P6ZS 3OOVA 2KOIA 2W0NA 2B18A 4NXFA 4HHDA 5L8MA 2P08A 2VV6A 2V0WA 3B47A 3U2AA 2ZOIA 4HP4A 2OAP1 1V9ZA 4EEPA 3LIEA 5IT5A 3OCNA 3EQVA 2Y79A 3EGDC 4EQ1A 1T1AA 3T4OA 3BQ8A 4O8GA 3KX0X 2VV7A 2VV8A 2NUTC 3MQ0A 1T1BA 4YWZA 4EW7A 5DJTA 1STZA 4OOMA 3BWLA 3T4SA 3EEAA 3KSHA 3LIDA 4FOFA 3O5YA 3UB7A 4MDZA 1G6OA 3P01A 5K5BA 5KIZA 3UB8A 3K2NA 3H9WA 4WEJA 1P9RA 2HJ9C 4H6JB 3TE8A 5IS1A 4HH3A 2VEAA 5LBRA 1TS6A 1G28A 5AJGA 5HD3A 2K7SA 2W3FA 4H6JA 4Y3IA 2LB5A 1TS0A 3LFVA 1BYWA 4L9EA 4G3WA 3BJNA 1Y28A 1F5MA 3GECA 3H7WA 2O9CA 2MJ6A 2WKQA 2LB9A 2WKPA 4NXGA 5G4ZA 2GX5A 1S1YA 3MJQA 4YOFA 1XJ2A 2K31A 1OT6A 2INWA 1MZUA 4HOIA 5F69A 2W27A 4DMZA 2OAQ1 2V0UA 2B02A 3JVVA 4KQDA 2P04A 2W1TB 1N9NA 3LI8A 2KDKA 4B9OA 5HD5A 2O9BA 2ZOHA 2H28A 4IJGA 5DKLA 5AVEA 2YKHA 4WEKA 1GSWA 4R70A 1OT9A 4XT2B 3KSIA 1XJ3A 2EWVA 3MQOA 3W2ZA 2L1MA 2W3HA 3VE4A 4WELA 1XFQA 2A24A 3E4OA 4PKYG 4ARZB 2J3TD 3CAXA 4R38A 2VGLS 2PYRA 3PBSA 2GZAA 4WL9A 2QJ7A 2KLIA 3PBRA 2L4RA 2YKFA 1H8MA 4CLCD 3LR4A 4HH2A 1GSVA 5HSQA 5FL3A 3LIBA 3PHYA 3PR6A 2PDRA 4HI4A 1IFQA 1XJ4A 2R78A 4HIAA 1LSVA 3E98A 2VA0A 2PHYA 3RTYA 3MF0A 5HWWA 5C5KA 1OTEA 1LSXA 3KYQA 3T4TA 1NRJA 1S67L 2QYBA 4WN5A 2W3EA 3KSGA 5HWVA 3KYZA 2K2NA 4MN7A 4O01A 4ARZA 1VB6A 4CLCC 4RQ9A 2QJ5A 1LL8A 1NLYA 3E4PA 3FC7A 2JN7A 3A0SA 1JNUA 5TBMA 3E4QA 4L9FA 2VJWA 3R7WA 4BMWA 1H3QA 1S4RA 3CUEA 2P7JA 3F1PB 2VGLM 1S4SA 4HNBA 2OWJA 4R6LA 1XFNA 5HDSA 4ETZA 4Q0HA 3CWFA 5HPIA 4BWIA 2QKPA 2FH5A 1OTIA 4UEYA 5DFYA 1V9YA 3LYXA 3T4LA 1WA9A 4LRYC 1OTDA 2O99A 4F3LB 4GS9B 4EEUA 2FZ0A 4NEED 4I38A 3RFBA 4I5SA 4MN5A 3OC2A 1P0ZA 3T4JA 3UB6A 1MKMA 3T4KA 2XROA 2HJEA 3UE6A 3TRCA 4GHIB 3IS2A 1T19A 4WF0A 4G3KA 5HDDA 4EUVA 4PKYA 3VOLA 4I3IA 4DJ3A 3F1PA 4O0PA 2W1TA 5J4EA 4Q0IA 2ZBBA 2O0YA 5HPFA 3UMDA 2G7UA 5DKKA 5CX7A 3GDIA 3ICYA 3S7OA 4L9GA 2EWWA 4CQHA 1W63M 2L0WA 1XJ6A 2Z6CA 5IU1A 2A24B 4OOLA 3OCLA 2XA7M 3K3DA 1D7EA 3F1NA 3CI6A 1T1CA 1YSPA 5TJJA 2XSSA 2EA9A 4HP9A 3FPWA 4HY8A 4R3AA 2W3GA 1OJ5A 2J80A 4NKPA 3TW8A 3UB9A 1N9OA 2JKRM 2I9VA 5J3WA 4JGQA 4P6ZM 4ETXA 1DRMA 4I3JA 4GJ4A 4MMNA 2NUPC 3NOTC 1DP9A 3NOUC 4Y2FA 5HL6A 5I5LA 1S1ZA 5KSHA 4DJ2A 1N9LA 4EERA 3EWKA 5EFWA 1D06A 5MC7A 2O9AA 4DN0A 1LSWA 2VKSA 1OTAA 3JVUA 3RH8B 3PBNA 5F6AA 4EESA 3B33A 1UWPX 4BBTA 2PR5A 1F9IA 2XA7S 4CLCA 4Q0JA 3PXPA 5DF9A 3LIFA 4NXBA 4I3AA 1DP6A 3MXQA 3NOPC 5G4YA 4MCWA 2M7VA 4Z1WA 1OPXA 2M7UA 3H7WB 4IUHA 4F3LA 2VLGA 2JKTI 1OJGA 3EGXC 4KUKA 1TD5A 3VE3A 2GNXA 2VZWA 4KUOA 3PYPA 3VV4A 3LI9A 4HJ4A 5AVFA 3F1OA 2KX6A 3MMHA 1IOUA 3A0RA 3BW6A 4JGPA 3LR3A 1X0OA 3S7NA 1TS7A 4B93A 4AFIA 4HJ6A 4GW9A 3BY8A 3B42A 3EEHA 4IHQA 4BBVA 5DJUA 3H82A 4UQIS 2JKRI 3F1NB 3S7QA 4G3VA 4LRZE 4KQOA 3SW1A 4WUJA 3LIAA 4EU0A 5HDCA 5A8BA 1F98A 2OOLA 3UMEA 4IUKA 1TS8A 3E0YA 1MC0A 2BASA 4LRXC 3V67A 2V1AA 3TJZC 3MFXA 3G6OA 4BBUA 2M1CA 4WLAA 2J3WA 3CUEC 2Z6DA 3A0VA 4JGOA 4LLOB 4BJPA 4I39A 3LUQA 3R4KA 4ME4A 3CITA 4K08A 3H82B 2WKRA 2D02A 1UWNX 3IS2B 3T4QA 5F68A 4PHTA 2PT7A 3CLOA 3D72A 1S66L 4LPZA 3PBOA 1W63Q 3PBTA 2ZMVA 1TF1A 1VHMA 4YNRA 3OBFA 5HZHA 4GCZA 4UQIM 2XRNA 2PR6A 4XT2A 3FPVA 2ZMFA 1P97A 3LR0A 4GS9A 2OWHA 1YSQA 3FG8A 4M4XA 4QPRA 2PD7A 3C2WA 1EW0A 3HCYA 1KOUA 2J3TC 3ZYTA 4GHIA 1NWZA 5HWTA 3ZQ5A 3K3CA 3ULFA 4CLCB 3HJIA 2W1RA 3P7NA 4ZRRA 3T50A 3KSFA 4HJ3A 2HV1A 5F5YA 4FSFA 3F1OB 3EQUA 1OTBA 2QHKA 1T18A 2D01A 2DMWA 2Y8HA 1ODVA 1UGUA 5J7EA 2A2LA 2HF6A 4JGRA 1P9WA 3DBAA 1LT0A 2QWSA 3BQAA 1GSXA 3C30A 5DFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KQD A;  5DKK A;  3C8C A;  2GJ3 A;  4EXO A;  3GDI A;  3ICY A;  1N9N A;  3LI8 A;  3MQQ A;  2KDK A;  4HJ6 A;  4L9G A;  5TBM B;  4GW9 A;  4MN6 A;  4B9O A;  5HD5 A;  3BY8 A;  4JGO A;  3EEH A;  2L0W A;  1XJ6 A;  2H28 A;  2ZOH A;  3MR0 A;  5DKL A;  2Z6C A;  3BY9 A;  5DJU A;  5AVE A;  4BBV A;  2YKH A;  3H82 A;  1GSW A;  4R70 A;  5IU1 A;  1OT9 A;  4XT2 B;  3IBR A;  1XJ3 A;  2A24 B;  2JHE A;  3F1N B;  3MQO A;  4NXF A;  2PD8 A;  4HQA A;  2V1B A;  3K3D A;  4LRZ E;  1D7E A;  2L1M A;  4BBT A;  3NHQ A;  3SW1 A;  4WUJ A;  1DP8 A;  3LIA A;  2A24 A;  1XFQ A;  3E4O A;  3F1N A;  3HJK A;  1F98 A;  4PKY G;  5HDC A;  5A8B A;  1T1C A;  3CAX A;  2OOL A;  4LLO B;  4R38 A;  2PYR A;  3NJA A;  3UME A;  2EA9 A;  3OLO A;  4HP9 A;  1TS8 A;  4E04 A;  4HY8 A;  2BAS A;  4R3A A;  4WL9 A;  2QJ7 A;  2L4R A;  2YKF A;  1OJ5 A;  2J80 A;  4LRX C;  2V1A A;  4NXE A;  3MFX A;  2PYP A;  2CMN A;  2V9A A;  4HH2 A;  3G6O A;  3UB9 A;  1GSV A;  4BBU A;  1N9O A;  2M1C A;  4WLA A;  2I9V A;  5J3W A;  4EET B;  5HSQ A;  3LIC A;  4JGQ A;  2W0N A;  2Z6D A;  1DRM A;  3A0V A;  3LIB A;  2PDR A;  3PHY A;  4HI4 A;  1XJ4 A;  2R78 A;  4HIA A;  1LSV A;  4I3J A;  4I39 A;  3LUQ A;  3NOT C;  1DP9 A;  2PHY A;  4HHD A;  3RTY A;  3NOU C;  5HWW A;  2VV6 A;  2V0W A;  4K08 A;  5I5L A;  1S1Z A;  3H82 B;  2ZOI A;  4HP4 A;  2WKR A;  4DJ2 A;  1N9L A;  1OTE A;  1V9Z A;  2D02 A;  4EER A;  4EEP A;  3LIE A;  1UWN X;  1LSX A;  3EWK A;  3IS2 B;  5EFW A;  5F68 A;  1D06 A;  1S67 L;  3CLO A;  4EQ1 A;  1T1A A;  4WN5 A;  3D72 A;  1S66 L;  1LSW A;  4LPZ A;  5HWV A;  1OTA A;  3RH8 B;  1VB6 A;  3KX0 X;  5HZH A;  2VV7 A;  5F6A A;  2VV8 A;  4EES A;  3B33 A;  1UWP X;  4GCZ A;  2QJ5 A;  4RQ9 A;  1LL8 A;  1T1B A;  2PR6 A;  3E4P A;  3FC7 A;  2JN7 A;  4YWZ A;  4XT2 A;  4EW7 A;  2PR5 A;  3A0S A;  1F9I A;  1JNU A;  5DJT A;  5TBM A;  3BWL A;  3E4Q A;  3VE4 A;  4L9F A;  1P97 A;  3LIF A;  3LID A;  4NXB A;  4GS9 A;  2OWH A;  1S4R A;  3F1P B;  2P7J A;  3FG8 A;  4I3A A;  3UB7 A;  1DP6 A;  1S4S A;  4M4X A;  2PD7 A;  3MXQ A;  3NOP C;  2OWJ A;  4HNB A;  5G4Y A;  4R6L A;  1XFN A;  3C2W A;  5HDS A;  1EW0 A;  3CWF A;  1KOU A;  4GHI A;  1NWZ A;  5HWT A;  5KIZ A;  2QKP A;  3H7W B;  1OTI A;  3UB8 A;  3ZQ5 A;  3H9W A;  3K3C A;  3ULF A;  4F3L A;  2VLG A;  1V9Y A;  1OJG A;  3LYX A;  3HJI A;  1WA9 A;  3P7N A;  4H6J B;  4KUK A;  4LRY C;  5IS1 A;  3T50 A;  4HH3 A;  1OTD A;  4F3L B;  2VEA A;  1TS6 A;  1G28 A;  4HJ3 A;  2HV1 A;  5HD3 A;  4GS9 B;  3VE3 A;  5F5Y A;  4EEU A;  4I38 A;  4KUO A;  3F1O B;  1OTB A;  2K7S A;  4H6J A;  3PYP A;  4I5S A;  1TS0 A;  4MN5 A;  1P0Z A;  2QHK A;  1T18 A;  3LI9 A;  2D01 A;  4HJ4 A;  3UB6 A;  1BYW A;  4L9E A;  1ODV A;  5AVF A;  1UGU A;  3F1O A;  3UE6 A;  1Y28 A;  5J7E A;  3GEC A;  4GHI B;  3IS2 A;  1T19 A;  2KX6 A;  4JGR A;  3H7W A;  4WF0 A;  5HDD A;  2WKP A;  2WKQ A;  4NXG A;  5G4Z A;  3A0R A;  4PKY A;  3VOL A;  1S1Y A;  3MJQ A;  1XJ2 A;  1OT6 A;  2INW A;  1MZU A;  1LT0 A;  4HOI A;  2QWS A;  4I3I A;  4JGP A;  5F69 A;  2W27 A;  3F1P A;  4DJ3 A;  2V0U A;  5J4E A;  2ZBB A;  2B02 A;  1GSX A;  1X0O A;  1TS7 A;  3UMD A; 
#chains in the Genus database with same CATH topology
 5TBM B;  3G30 A;  5BOH A;  5E2H A;  3QP4 A;  3U4L P;  3HLG A;  1ZHH B;  3BY9 A;  4GLQ A;  5IHV A;  1FCM A;  2C6W B;  5DTS A;  1YKD A;  3OPR A;  3C38 A;  4RX2 A;  2W3D A;  4DDY A;  2P74 A;  2OSU A;  3CPT B;  3PBQ A;  4CLC E;  4E04 A;  2JKG A;  1VEU B;  1K56 D;  1HD8 A;  3OOV A;  1LL5 A;  2B5R A;  4FH4 A;  2A3U A;  5EEC A;  2V0W A;  1NJ4 A;  2OAP 1;  1V9Z A;  1K6S A;  1FQG A;  3LIE A;  4E3K A;  4N9L A;  2Y79 A;  2Q9N A;  2RL3 A;  2HZ5 A;  5HX9 A;  3KX0 X;  3MQ0 A;  3I7J A;  4YWZ A;  3GVB A;  2XR0 A;  3BWL A;  3KSH A;  2V2F F;  3LID A;  3UB7 A;  4LV1 A;  4MDZ A;  3WS0 A;  2PU2 A;  1QMF A;  1HLU P;  4KZA A;  3FWL A;  5FQ9 A;  5J8X A;  4H6J B;  3IX8 A;  2EX6 A;  1G28 A;  1SKO A;  5AJG A;  4GOG A;  4H6J A;  1ALQ A;  1TS0 A;  1ERQ A;  3HUO A;  3JPU A;  1Y28 A;  2Y2N A;  1SHV A;  2O9C A;  3BEB A;  2MJ6 A;  1K0K A;  2GX5 A;  3MJQ A;  3GV9 A;  2INW A;  5FAQ A;  4DMZ A;  1L0D A;  1ONG A;  3Q82 A;  1IYQ A;  3OZH A;  2KDK A;  1CJF A;  3DTE A;  4IJG A;  1K54 C;  5DKL A;  4EBL A;  4MBK A;  1IYP A;  4WEK A;  1GSW A;  3Q1F A;  1XJ3 A;  2EWV A;  4H8R A;  3E4O A;  2PYR A;  4C75 A;  4E6X A;  2QJ7 A;  3BM6 A;  2L4R A;  4CLC D;  1JTD A;  3BEC A;  3C5A A;  3VFH A;  1PW8 A;  1SKF A;  1IFQ A;  1XJ4 A;  1LSV A;  3E98 A;  3LGO A;  3AGD A;  2V1Z A;  5HWW A;  2E8J A;  3PAE A;  3KYQ A;  3C7U A;  5KSC A;  4WN5 A;  4FH2 A;  3IF6 B;  3N8R A;  3DWK A;  4MN7 A;  4ARZ A;  3ZNT A;  3E2K A;  4RQ9 A;  1ERM A;  2QJ5 A;  3A0S A;  1JNU A;  5TBM A;  1NRF A;  4L9F A;  2P7J A;  1S4S A;  3MZD A;  3CPT A;  3CWF A;  5EV0 A;  1G6A A;  5HPI A;  4EUZ A;  5L2F A;  2ZL1 B;  3G34 A;  4F3L B;  4GS9 B;  4EEU A;  4NEE D;  3MBZ A;  4I5S A;  4MN5 A;  3UB6 A;  3TRC A;  4GHI B;  4G3K A;  5HDD A;  1O07 A;  3VOL A;  1M6K A;  1IKG A;  5DKK A;  2JC7 A;  5CX7 A;  3GDI A;  3S7O A;  4L9G A;  2EWW A;  3D9Y A;  4JKT A;  4OP5 A;  2Z6C A;  4LGW A;  3UE0 A;  2WKH A;  4DE2 A;  3ITA A;  1NY0 A;  4X1L A;  1N4O A;  3V3S A;  1YSP A;  1PWD A;  2EA9 A;  2H5S A;  4GD8 A;  1XA1 A;  3SZT A;  4NKP A;  2EX8 A;  3ZGA B;  1Y54 A;  5U47 A;  5J3W A;  3N6I A;  4GJ4 A;  1E4D A;  2IWB A;  3T1X A;  4Y2F A;  5KSH A;  1S1Z A;  4BEN A;  1N9L A;  1NYY A;  5CEC A;  5TFQ A;  1D06 A;  3A3E A;  3JVU A;  5FI6 A;  1PZP A;  5GL9 A;  1LHY A;  3IXD A;  4DE1 A;  3B33 A;  4EES A;  2EFU A;  1F9I A;  5DF9 A;  5FAS A;  2A49 A;  4OPY A;  3VMA A;  4I3A A;  3GSG A;  3T1Q B;  4Z1W A;  2WGW A;  2Y2H A;  5FA7 A;  3H7W B;  5L07 A;  3KYE A;  2VLG A;  1E25 A;  4ZDX A;  2WKE A;  2DNS A;  2GNX A;  2VZW A;  5EM0 A;  3NCK A;  1ES5 A;  4NK3 A;  1L0F A;  1IOU A;  3HLC A;  4DE3 A;  1C3B A;  3A0R A;  1YT4 A;  1E3U A;  3VP3 A;  2Y2O A;  4RVA A;  1X0O A;  5EOE A;  1WYB A;  4KQQ A;  3V50 A;  4HEF A;  3IF6 A;  4BLM A;  1CI9 A;  3H82 A;  3F1N B;  4LRZ E;  1ESU A;  3W8K A;  5HDC A;  5A8B A;  2OOL A;  3UME A;  3RJU A;  1MC0 A;  1L3L A;  1KDW A;  1W79 A;  4LRX C;  1DY6 A;  5EPH A;  4QJG A;  2X71 A;  4BJP A;  3R4K A;  4ME4 A;  4N1X A;  3CIT A;  3QNC A;  1K55 A;  2RCX A;  4K08 A;  3IS2 B;  3MKE A;  4E6W A;  4DXC A;  3T4Q A;  5L10 A;  2PT7 A;  1W63 Q;  2ZC4 B;  1TF1 A;  5FI2 A;  1L0E A;  2FFY A;  4XT2 A;  2ZMF A;  2FFF B;  1FSY A;  1JTG A;  2XFS A;  3LR0 A;  3N8L A;  5EVI D;  4B4Z A;  1EW0 A;  3QP8 A;  4CLC B;  1PI5 A;  4M3K A;  4PM6 A;  4ZRR A;  3NDE A;  3KSF A;  4FSF A;  2WGI A;  4LFU A;  3SH7 A;  3QP6 A;  1SCW A;  5FQM A;  1ESI A;  1P9W A;  2WGV A;  3WS4 A;  3ZVT A;  3C4P A;  1ACF A;  4UAA A;  1S6R A;  1ES4 A;  3T1R A;  5DFX A;  2OLV A;  4EXO A;  3MQQ A;  4MN6 A;  4S2K A;  4Y5F A;  3MR0 A;  3CMZ A;  4R0Q A;  2AVX A;  3UE3 A;  3ZHH A;  1TVF A;  4L0L A;  1DP8 A;  3AGF A;  3HJK A;  1MPL A;  1ZTU A;  1MWT A;  3NJA A;  3OLO A;  3IHB A;  3S7P A;  3MFD A;  4OPQ A;  2CMN A;  2V9A A;  2ZL1 A;  2HGV A;  3A3I A;  2W0N A;  2B18 A;  4NET A;  5EVI A;  1YLT A;  5L8M A;  4EEP A;  2UWX A;  3G4P A;  2Y2I A;  3EQV A;  1T1A A;  1PNE A;  3DTI A;  3NY4 A;  3VP0 A;  1CF0 A;  2VV8 A;  3SS4 A;  2ZQ8 A;  4XUZ A;  4CJN A;  5AQA A;  4OOM A;  3EEA A;  4D2O A;  3O86 A;  1TDG A;  4KZ7 A;  5K5B A;  1FOF A;  5KMW A;  5KZH A;  3K2N A;  3ZG7 B;  4WEJ A;  1K54 A;  3GQZ A;  5IS1 A;  4HH3 A;  5LBR A;  5HD3 A;  2K7S A;  2W3F A;  2LB5 A;  2HDS A;  3LFV A;  1CEG A;  4L9E A;  3BJN A;  2BLS A;  1F5M A;  3GEC A;  3TOI A;  3H7W A;  2WKQ A;  4KZ8 A;  4YOF A;  2J9O A;  1OT6 A;  5F69 A;  3GTC A;  2B02 A;  1RGY A;  5FQJ A;  2P04 A;  3M6B A;  3LI8 A;  1FCO A;  1ZKJ A;  5HD5 A;  4MBH A;  1KE4 A;  1YMX A;  1WE4 A;  1PFL A;  2ZM0 A;  3CZD A;  2YKH A;  5AVE A;  3IX3 A;  4XT2 B;  4HBT A;  4OH0 A;  2L1M A;  2VK3 A;  2W3H A;  2A24 A;  3A3F A;  4ARZ B;  3CAX A;  4R38 A;  3DWZ A;  1J3W A;  2GZA A;  1BLS A;  1W8Q A;  4WL9 A;  2R9X A;  2YKF A;  1H8M A;  1GSV A;  4OQG A;  5FL3 A;  2B95 A;  4X56 A;  4MBF A;  4Y0U A;  1PZO A;  2PHY A;  4WZ4 A;  2XFT A;  3MF0 A;  5A91 A;  5C5K A;  3OPL A;  1JWZ A;  3VP4 A;  1LSX A;  4E3M A;  1NRJ A;  2WKI A;  5FDS A;  1S67 L;  2W3E A;  2P9V A;  3Q7V B;  5HWV A;  2J8Y A;  2K2N A;  3ZG8 B;  3B3X A;  4CLC C;  2PBD P;  1XKZ A;  3ZVW A;  2VJW A;  5EE8 A;  1H3Q A;  3F1P B;  1RP5 A;  5EUA A;  4HNB A;  4IBX A;  4R6L A;  4ETZ A;  4KQR A;  5TGF A;  4BWI A;  1OTI A;  1CI8 A;  4UEY A;  4N92 A;  1PW1 A;  5DFY A;  3LYX A;  3DTK A;  5CED A;  4I38 A;  4WYY A;  3RFB A;  3OC2 A;  3MXR A;  3RXW A;  3T4K A;  3UE6 A;  1NZO A;  2Z2L B;  3A3J A;  1NXY A;  4PKY A;  4JBF A;  5GLB A;  1IYO A;  1K25 A;  3WRZ A;  5FEG A;  1MY8 A;  4PM7 A;  2W1T A;  5J4E A;  2O0Y A;  3LY3 A;  1BUL A;  5HPF A;  4LEN A;  5CGW A;  1SDN A;  1W63 M;  2X01 A;  3ITB A;  1MKI A;  5IU1 A;  4OOL A;  3K3D A;  2E8I A;  1D7E A;  4ZBE A;  1K57 A;  5TJJ A;  2XSS A;  2Q9M A;  1OJ5 A;  3A3D A;  3G2Y A;  2X02 A;  2JKR M;  3BFE A;  3UNW A;  5E43 A;  3W4Q A;  2NUP C;  3NOT C;  5GLA A;  1DP9 A;  1GHP A;  1F2K A;  4EER A;  4RA7 A;  3SH8 A;  4Y13 A;  4KG5 A;  2Y2K A;  5F1G A;  5EFW A;  1VET B;  1BLP A;  2XLN A;  2O9A A;  2XF3 A;  4JPM A;  2BG1 A;  2XD5 A;  1UWP X;  1XP4 A;  4GKU A;  1FR1 A;  2PR5 A;  3PXP A;  2ZQD A;  3LIF A;  4NXB A;  4GNU A;  1DP6 A;  1XPB A;  3MXQ A;  4BQM A;  1AWI A;  1OPX A;  3Q81 A;  4IUH A;  3EGX C;  2DCF A;  1S0W A;  1TD5 A;  4WZ5 A;  3IHA A;  4P87 A;  3M6H A;  3VV4 A;  3ZG9 B;  2PAV P;  4HJ4 A;  4JXV A;  3F1O A;  2J9P A;  3BFF A;  5CHJ A;  2HP5 A;  4JXS A;  2ZC6 B;  3LR3 A;  3S7N A;  3CG5 A;  1Q2P A;  3Q7V A;  4G3V A;  5A92 A;  4WUJ A;  1FR6 A;  1F98 A;  3V39 A;  5FAP A;  3NBL A;  4IUK A;  3QP5 A;  2EXB A;  3V67 A;  3ZDJ A;  4A5R A;  2V1A A;  1IEL A;  1VQQ A;  3MFX A;  4QU3 A;  1YM1 A;  5DVA A;  3CUE C;  2Z6D A;  2V8C A;  1EWZ A;  1W5D A;  3G35 A;  4WMC A;  3ZFZ A;  4FCF A;  1GHM A;  2WKR A;  2D02 A;  5HFO A;  3FKV A;  3HLD A;  4PHT A;  2WAF A;  3PBO A;  4FD8 A;  5EVL A;  2ZMV A;  1VHM A;  1IYS A;  4QD4 A;  2PR6 A;  3FPV A;  3UO9 A;  3GMW A;  2EX2 A;  1P97 A;  2OWH A;  1YSQ A;  3FG8 A;  4M4X A;  4R4S A;  3ZYT A;  1G68 A;  1NWZ A;  1FIL A;  1K6R A;  2H0Y A;  2H0T A;  2ZQC A;  2W1R A;  5HAR A;  4N1H A;  1KGG A;  4KZ5 A;  4U3T A;  4UHU A;  2QHK A;  2GDN A;  2EXA A;  2DMW A;  1J9M A;  4IVK A;  4JGR A;  5F1F A;  1JWP A;  5FI7 A;  5CTN A;  2Y2J A;  3LO7 A;  3DBA A;  4QB8 A;  3C8C A;  4Z9Q A;  3GR2 A;  1K57 C;  4RX3 A;  4WBG A;  2VX8 A;  1BLH A;  1ES2 A;  4IVI A;  3IBR A;  4YFM A;  4JF4 A;  2V1B A;  2V8F A;  3WS1 A;  2IA2 A;  3N4I A;  1CEF A;  4D60 A;  3NDG A;  3LY4 A;  4NXE A;  1YLZ A;  2PYP A;  5JYP A;  3T12 B;  3IBJ A;  4ESP A;  3UPN A;  4P6Z S;  2KOI A;  3SH9 A;  5GHX A;  5M19 A;  4BL3 A;  4HHD A;  2P08 A;  2VV6 A;  3B47 A;  3U2A A;  4HP4 A;  3C4O A;  5IT5 A;  2JCH A;  1VM1 A;  4X69 A;  1D1J A;  4B88 A;  3EGD C;  4EQ1 A;  3BQ8 A;  4O8G A;  4S2O A;  3MS6 A;  4KZB A;  4IBR A;  5E2E A;  1T1B A;  1KDS A;  4KG6 A;  1STZ A;  4K0W A;  3LEZ A;  4KZ4 A;  4X6T A;  3O5Y A;  5CTM A;  3IF5 A;  1XGJ A;  2ZQ9 A;  4S2M A;  3P01 A;  1H0M A;  4X25 A;  2WAD A;  1N9B A;  3H9W A;  2HJ9 C;  3HUN A;  4Y17 A;  4ID4 A;  5EOO A;  2VEA A;  1TS6 A;  4E3L A;  2HDU A;  4Y3I A;  5E2F A;  3SS3 A;  4Y15 A;  1GCE A;  4BD0 A;  5DTK A;  1YLJ A;  4NXG A;  5G4Z A;  1NZU A;  4B4X A;  2HP9 A;  1XJ2 A;  2K31 A;  3S22 A;  4QHC A;  4HOI A;  4N9K A;  4HES A;  1TEM A;  2V0U A;  3VOZ A;  1IKI A;  3BYD A;  3JVV A;  4KQD A;  2W1T B;  1N9N A;  4B9O A;  2O9B A;  2ZOH A;  5F82 A;  4JF6 A;  3HLW A;  1OT9 A;  4MEZ A;  3W2Z A;  3HVF A;  1H8Z A;  4Y0O A;  3VE4 A;  4WEL A;  1L0G A;  1XFQ A;  1KGF A;  2ZJ9 A;  3N8S A;  2VGL S;  2XEP A;  1JWV A;  3PBS A;  4E3J A;  1PYY A;  2KLI A;  3PBR A;  1OME A;  4S2J A;  3ZG0 A;  5HSQ A;  3ZG5 A;  3LIB A;  1HVB A;  3PHY A;  4HI4 A;  3GRJ A;  2R78 A;  3DTM A;  3RTY A;  5FAT A;  4LV0 A;  5JYO A;  4X1M A;  4X53 A;  3T4T A;  3MKF A;  2QYB A;  3DW0 A;  1DJC A;  4LCL A;  4O01 A;  1VB6 A;  1NLY A;  2JKF A;  3FC7 A;  2HP6 A;  4WZ5 C;  1Y4O A;  3BFD A;  3O88 A;  4P6B A;  4KEN B;  4BMW A;  3CUE A;  1S4R A;  4KZ3 A;  2OWJ A;  4Q0H A;  4YIN A;  5GLC A;  3IH8 A;  2QKP A;  5F83 A;  1V9Y A;  4BL2 A;  1WA9 A;  4NG2 A;  4MLL A;  3RXX A;  3T4J A;  1MKM A;  3VFF A;  2XRO A;  1Z09 A;  5L09 A;  4WF0 A;  4EUV A;  2Y55 A;  4OPZ A;  4E3N A;  4OKP A;  4I3I A;  4DJ3 A;  3UY6 A;  2WK0 A;  1MBL A;  2ZC5 B;  1FIK A;  3W4O A;  1DJB A;  2L0W A;  1XJ6 A;  5CXW A;  3OPH A;  1BT5 A;  2R9W A;  3WWX A;  1LI9 A;  2XA7 M;  3HLB A;  2OV5 A;  3F1N A;  3LEQ A;  1LL9 A;  2H10 A;  2OLU A;  3M2J A;  1XGI A;  4HP9 A;  1XA7 A;  3IWI A;  2W3G A;  1RGZ A;  2J80 A;  3SOI A;  1FSW A;  4JF5 A;  5DF7 A;  3Q7Z A;  2I9V A;  5GHY A;  2WZZ A;  1DRM A;  4I3J A;  3BFC A;  4MMN A;  1HTZ A;  1WYC A;  5HL6 A;  3D4F A;  5I5L A;  3P09 A;  3IXB A;  4DJ2 A;  3QP1 A;  4K0X A;  5MC7 A;  4DN0 A;  1YLW A;  4R1G A;  1CQA A;  3PBN A;  5F6A A;  4HBU A;  2XA7 S;  4CLC A;  3IXG A;  4Q0J A;  3NOP C;  5G4Y A;  4QWO A;  5FDH A;  5FAO A;  3PAG A;  2M7U A;  2ZQA A;  4F3L A;  1BZA A;  5TR7 A;  1K55 C;  4KUO A;  4X55 A;  4Y0T A;  2ZC3 B;  3PYP A;  1ZC2 A;  4OVD A;  5FSR A;  4PM5 A;  3MMH A;  2ZMA A;  1PRQ A;  1VEU A;  2ACG A;  1MWR A;  1H5X A;  4F94 A;  3BW6 A;  5CHM A;  2J7V A;  2UV0 E;  1SZV A;  4OOY A;  4HJ6 A;  4WM9 A;  3S4X A;  1E3U D;  4DRT A;  3BY8 A;  3EEH A;  2G2W A;  4BBV A;  5DJU A;  4QY5 A;  3S1Y A;  4UQI S;  2Y2L A;  3O3V A;  5I94 A;  4KQO A;  4X68 A;  1I5Q A;  3ZNY A;  1JVJ A;  5M18 A;  1TS8 A;  2ZLY A;  1YQS A;  3E0Y A;  3NC8 A;  3G32 A;  1SKO B;  4R23 A;  4E3O A;  3G31 A;  3MZE A;  4WLA A;  2J3W A;  3UDF A;  3A0V A;  4JGO A;  3LUQ A;  5CEB A;  3CHW P;  5CHU A;  4OP8 A;  5GHZ A;  3H82 B;  4ZJ1 A;  4PPR A;  4S2N A;  3CLO A;  3BLS A;  1S66 L;  3PBT A;  1RCJ A;  1BSG A;  5DF8 A;  4YNR A;  3OBF A;  5HZH A;  2XK1 A;  4GCZ A;  4UQI M;  4JXG A;  2Y91 A;  1H8Y A;  4GDB A;  4UA9 A;  2P9V B;  1Q2Q A;  1KOU A;  3MZF A;  4GHI A;  1W7F A;  3ZQ5 A;  3ULF A;  1MWU A;  5FEF A;  3HJI A;  3P7N A;  4GDN A;  1VET A;  3T50 A;  2JE5 A;  3AGE A;  4XXR A;  4HJ3 A;  2HV1 A;  3QNB A;  5F5Y A;  1OTB A;  4JLF A;  2EX9 A;  1ODV A;  4CPK A;  1ONH A;  4UA7 A;  4XUX A;  5FQI A;  2QWS A;  3BQA A;  2CC1 A;  4Y7P A;  3TG9 A;  1GA9 A;  5G18 A;  3HLF A;  1ZG4 A;  3TSG A;  3O87 A;  2GJ3 A;  1NLZ A;  3NEC A;  4II7 A;  4KZ6 A;  4GB7 A;  5A93 A;  3FZC A;  1PIO A;  2JHE A;  3D3O A;  2PD8 A;  4HQA A;  1YAX A;  4PAU A;  4S2L A;  5CRF A;  3NHQ A;  3R7W B;  3ISG A;  4PMA A;  4C6Y A;  3Q07 A;  2IWD A;  1BUE A;  5HAQ A;  2WZX A;  3HBR A;  3LR5 A;  5FQK A;  3EOI A;  4EBP A;  3UPO A;  5E2G A;  2JKT M;  3KO6 A;  4EET B;  3LIC A;  1PWG A;  4ZTK A;  4NXF A;  3WRT A;  2ZOI A;  3OCN A;  3T4O A;  2QZ6 A;  2Y2G A;  2VV7 A;  2NUT C;  1LI0 A;  3ZCZ A;  4EW7 A;  5DJT A;  4FTX A;  3T4S A;  4FOF A;  1DJA A;  4EWF A;  3WS2 A;  2VGK A;  1G6O A;  5EVI B;  1MXO A;  2ZC7 A;  2HDQ A;  5KIZ A;  2ZD8 A;  3UB8 A;  3SS5 A;  1P9R A;  2WYX A;  4OPR A;  3TE8 A;  1FCN A;  3LCE A;  4LV3 A;  3UPP A;  3VP1 A;  4R3B A;  1BYW A;  4OQ0 A;  4G3W A;  4OON A;  4R4R A;  2WKP A;  2LB9 A;  1S1Y A;  1MZU A;  5DTT A;  2W27 A;  2OAQ 1;  3IX4 A;  3FKW A;  3IWQ A;  2PBY A;  2H28 A;  4OQH A;  4JXW A;  2VGJ A;  3N7W A;  4R70 A;  3KSI A;  3MQO A;  1YLP A;  1AXB A;  3JYI A;  4PKY G;  2Y59 A;  2J3T D;  4P0M A;  3HUM A;  2BTF P;  1G5U A;  3UE1 A;  2Y2M A;  3V5M A;  2Y4A A;  3NIA A;  3LR4 A;  4HH2 A;  2IWC A;  3HLE A;  3PR6 A;  4HIA A;  2PDR A;  1KGE A;  2Y2Q A;  4IED A;  2VA0 A;  2G2U A;  4OLD A;  4QY6 A;  5AQ9 A;  1OTE A;  1Z6F A;  2EFX A;  1SDE A;  4WMC D;  3KSG A;  4E3I A;  1MWS A;  3KYZ A;  5EM1 A;  4S2I A;  3L7H A;  1LL8 A;  3E4P A;  2JN7 A;  4PM9 A;  1O7E A;  2V20 A;  3E4Q A;  3NUL A;  3R7W A;  2VGL M;  2QMI A;  1XFN A;  3PTE A;  4GN2 A;  5HDS A;  2XQZ A;  1K56 A;  2FH5 A;  1GHI A;  3UDI A;  1YMS A;  3VSK A;  3T4L A;  4LRY C;  3IXH A;  4KZ9 A;  1OTD A;  2O99 A;  4PM8 A;  2FZ0 A;  1U60 A;  1NYM A;  5CGX A;  4O7D A;  1YPR A;  1P0Z A;  2HJE A;  4EQI A;  3IS2 A;  1T19 A;  4LV2 A;  5EVI C;  4EBN A;  2ZM8 A;  3QHY A;  3DAV A;  3F1P A;  4O0P A;  1TDL A;  4Q0I A;  2ZBB A;  3UN7 A;  2JBF A;  5FQQ A;  3UMD A;  3WS5 A;  2G7U A;  3ICY A;  4CQH A;  4U0T A;  2ZQ7 A;  1K38 A;  1XX2 A;  2A24 B;  4FUW A;  1YLY A;  3OCL A;  3QP2 A;  5M1A A;  4S2P A;  5AQ7 A;  3CI6 A;  1T1C A;  2DRW A;  3FPW A;  4HY8 A;  4R3A A;  3TW8 A;  3T1S A;  2I72 A;  3UB9 A;  1HZO A;  1N9O A;  1L2S A;  4JGQ A;  4P6Z M;  4ETX A;  1KVL A;  3MXS A;  3NOU C;  5HW3 A;  3G2Z A;  3UDX A;  3EWK A;  1M40 A;  1LSW A;  2VKS A;  1OTA A;  3RH8 B;  3HRE A;  1XXM A;  4DDS A;  1GA0 A;  4BBT A;  4ZJ3 A;  1KE0 A;  2WGW B;  2C5W B;  2HDR A;  3M2K A;  4MCW A;  2XDM A;  1I2W A;  2M7V A;  4LCM A;  4DE0 A;  1I2S A;  2Q0O A;  4Q8I A;  2JKT I;  3IT9 A;  1OJG A;  4KUK A;  1ES3 A;  3VE3 A;  2Z2M B;  5A90 A;  4MNR A;  1PWC A;  1BLC A;  3UB5 P;  3LI9 A;  5AVF A;  2QPN A;  2WUQ A;  1BTL A;  2KX6 A;  3IWO A;  3BLM A;  4DKI A;  4JGP A;  3L9K A;  3MSH A;  1W8Y A;  3VSL A;  4EV4 A;  1LLB A;  1TS7 A;  3IH9 A;  4K91 A;  4B93 A;  4AFI A;  4GW9 A;  1IEM A;  2PRF A;  3B42 A;  4IHQ A;  4OQI A;  4DXB A;  1KE3 A;  4RYE A;  1A0K A;  2JKR I;  3IQA A;  5CGS A;  3S7Q A;  1EI5 A;  3W4P A;  3SW1 A;  4S2N C;  1ZG6 A;  3LIA A;  4EU0 A;  5AQB A;  3OPP A;  5GLD A;  3BFG A;  2BAS A;  4UA6 A;  3TJZ C;  3G6O A;  4BBU A;  2M1C A;  4C3Q A;  4GZB A;  3E2L A;  3HL9 A;  4LLO B;  4I39 A;  1PI4 A;  3C7V A;  1UWN X;  5D3O A;  5F68 A;  5CER A;  4DF6 A;  3FV7 A;  3D72 A;  3VP2 A;  5HAI A;  4LPZ A;  3IF6 C;  1CK3 A;  5EVE A;  2XD1 A;  2XRN A;  3P98 A;  3CJM A;  4R3J A;  1KVM A;  5HAP A;  5HL1 A;  4U0X A;  1K4F A;  4GS9 A;  4QPR A;  2PD7 A;  4P85 A;  2WAE A;  3C2W A;  4KG2 A;  2Y2P A;  3BRM A;  3HCY A;  3V3R A;  2J3T C;  5HWT A;  4OLG A;  3K3C A;  2ZM2 A;  3NI9 A;  4ZAM A;  1K4E A;  1QME A;  3F1O B;  3EQU A;  1T18 A;  2D01 A;  2Y8H A;  3VOY A;  1UGU A;  5J7E A;  2A2L A;  4ZJ2 A;  2HF6 A;  3FYZ A;  4GD6 A;  2PU4 A;  1LT0 A;  2XH9 A;  4BD1 A;  1ERO A;  2XGN A;  1GSX A;  2HPB A;  3C30 A; 
#chains in the Genus database with same CATH homology
 3C8C A;  2GJ3 A;  1NLZ A;  5TBM B;  4EXO A;  4II7 A;  3MQQ A;  4MN6 A;  4Y5F A;  3MR0 A;  1ZHH B;  3BY9 A;  4GLQ A;  2VX8 A;  1YKD A;  3IBR A;  2JHE A;  3D3O A;  2PD8 A;  4HQA A;  2V1B A;  3C38 A;  3UE3 A;  1YAX A;  4PAU A;  3NHQ A;  3R7W B;  4L0L A;  1DP8 A;  2IA2 A;  2W3D A;  3HJK A;  1ZTU A;  3NJA A;  3OLO A;  3PBQ A;  4CLC E;  4E04 A;  3LR5 A;  3S7P A;  3EOI A;  4NXE A;  2PYP A;  2CMN A;  2V9A A;  2JKT M;  3KO6 A;  4EET B;  2HGV A;  3IBJ A;  3LIC A;  4P6Z S;  3OOV A;  2KOI A;  2W0N A;  2B18 A;  4NXF A;  4HHD A;  5L8M A;  2P08 A;  2VV6 A;  2V0W A;  3B47 A;  3U2A A;  2ZOI A;  4HP4 A;  2OAP 1;  1V9Z A;  4EEP A;  3LIE A;  5IT5 A;  3OCN A;  3EQV A;  2Y79 A;  3EGD C;  4EQ1 A;  1T1A A;  3T4O A;  3BQ8 A;  4O8G A;  3KX0 X;  2VV7 A;  2VV8 A;  2NUT C;  3MQ0 A;  1T1B A;  4YWZ A;  4EW7 A;  5DJT A;  1STZ A;  4OOM A;  3BWL A;  3T4S A;  3EEA A;  3KSH A;  3LID A;  4FOF A;  3O5Y A;  3UB7 A;  4MDZ A;  1G6O A;  3P01 A;  5K5B A;  5KIZ A;  3UB8 A;  3K2N A;  3H9W A;  4WEJ A;  1P9R A;  2HJ9 C;  4H6J B;  3TE8 A;  5IS1 A;  4HH3 A;  2VEA A;  5LBR A;  1TS6 A;  1G28 A;  5AJG A;  5HD3 A;  2K7S A;  2W3F A;  4H6J A;  4Y3I A;  2LB5 A;  1TS0 A;  3LFV A;  1BYW A;  4L9E A;  4G3W A;  3BJN A;  1Y28 A;  1F5M A;  3GEC A;  3H7W A;  2O9C A;  2MJ6 A;  2WKQ A;  2LB9 A;  2WKP A;  4NXG A;  5G4Z A;  2GX5 A;  1S1Y A;  3MJQ A;  4YOF A;  1XJ2 A;  2K31 A;  1OT6 A;  2INW A;  1MZU A;  4HOI A;  5F69 A;  2W27 A;  4DMZ A;  2OAQ 1;  2V0U A;  2B02 A;  3JVV A;  4KQD A;  2P04 A;  2W1T B;  1N9N A;  3LI8 A;  2KDK A;  4B9O A;  5HD5 A;  2O9B A;  2ZOH A;  2H28 A;  4IJG A;  5DKL A;  5AVE A;  2YKH A;  4WEK A;  1GSW A;  4R70 A;  1OT9 A;  4XT2 B;  3KSI A;  1XJ3 A;  2EWV A;  3MQO A;  3W2Z A;  2L1M A;  2W3H A;  3VE4 A;  4WEL A;  1XFQ A;  2A24 A;  3E4O A;  4PKY G;  4ARZ B;  2J3T D;  3CAX A;  4R38 A;  2VGL S;  2PYR A;  3PBS A;  2GZA A;  4WL9 A;  2QJ7 A;  2KLI A;  3PBR A;  2L4R A;  2YKF A;  1H8M A;  4CLC D;  3LR4 A;  4HH2 A;  1GSV A;  5HSQ A;  5FL3 A;  3LIB A;  3PHY A;  3PR6 A;  2PDR A;  4HI4 A;  1IFQ A;  1XJ4 A;  2R78 A;  4HIA A;  1LSV A;  3E98 A;  2VA0 A;  2PHY A;  3RTY A;  3MF0 A;  5HWW A;  5C5K A;  1OTE A;  1LSX A;  3KYQ A;  3T4T A;  1NRJ A;  1S67 L;  2QYB A;  4WN5 A;  2W3E A;  3KSG A;  5HWV A;  3KYZ A;  2K2N A;  4MN7 A;  4O01 A;  4ARZ A;  1VB6 A;  4CLC C;  4RQ9 A;  2QJ5 A;  1LL8 A;  1NLY A;  3E4P A;  3FC7 A;  2JN7 A;  3A0S A;  1JNU A;  5TBM A;  3E4Q A;  4L9F A;  2VJW A;  3R7W A;  4BMW A;  1H3Q A;  1S4R A;  3CUE A;  2P7J A;  3F1P B;  2VGL M;  1S4S A;  4HNB A;  2OWJ A;  4R6L A;  1XFN A;  5HDS A;  4ETZ A;  4Q0H A;  3CWF A;  5HPI A;  4BWI A;  2QKP A;  2FH5 A;  1OTI A;  4UEY A;  5DFY A;  1V9Y A;  3LYX A;  3T4L A;  1WA9 A;  4LRY C;  1OTD A;  2O99 A;  4F3L B;  4GS9 B;  4EEU A;  2FZ0 A;  4NEE D;  4I38 A;  3RFB A;  4I5S A;  4MN5 A;  3OC2 A;  1P0Z A;  3T4J A;  3UB6 A;  1MKM A;  3T4K A;  2XRO A;  2HJE A;  3UE6 A;  3TRC A;  4GHI B;  3IS2 A;  1T19 A;  4WF0 A;  4G3K A;  5HDD A;  4EUV A;  4PKY A;  3VOL A;  4I3I A;  4DJ3 A;  3F1P A;  4O0P A;  2W1T A;  5J4E A;  4Q0I A;  2ZBB A;  2O0Y A;  5HPF A;  3UMD A;  2G7U A;  5DKK A;  5CX7 A;  3GDI A;  3ICY A;  3S7O A;  4L9G A;  2EWW A;  4CQH A;  1W63 M;  2L0W A;  1XJ6 A;  2Z6C A;  5IU1 A;  2A24 B;  4OOL A;  3OCL A;  2XA7 M;  3K3D A;  1D7E A;  3F1N A;  3CI6 A;  1T1C A;  1YSP A;  5TJJ A;  2XSS A;  2EA9 A;  4HP9 A;  3FPW A;  4HY8 A;  4R3A A;  2W3G A;  1OJ5 A;  2J80 A;  4NKP A;  3TW8 A;  3UB9 A;  1N9O A;  2JKR M;  2I9V A;  5J3W A;  4JGQ A;  4P6Z M;  4ETX A;  1DRM A;  4I3J A;  4GJ4 A;  4MMN A;  2NUP C;  3NOT C;  1DP9 A;  3NOU C;  4Y2F A;  5HL6 A;  5I5L A;  1S1Z A;  5KSH A;  4DJ2 A;  1N9L A;  4EER A;  3EWK A;  5EFW A;  1D06 A;  5MC7 A;  2O9A A;  4DN0 A;  1LSW A;  2VKS A;  1OTA A;  3JVU A;  3RH8 B;  3PBN A;  5F6A A;  4EES A;  3B33 A;  1UWP X;  4BBT A;  2PR5 A;  1F9I A;  2XA7 S;  4CLC A;  4Q0J A;  3PXP A;  5DF9 A;  3LIF A;  4NXB A;  4I3A A;  1DP6 A;  3MXQ A;  3NOP C;  5G4Y A;  4MCW A;  2M7V A;  4Z1W A;  1OPX A;  2M7U A;  3H7W B;  4IUH A;  4F3L A;  2VLG A;  2JKT I;  1OJG A;  3EGX C;  4KUK A;  1TD5 A;  3VE3 A;  2GNX A;  2VZW A;  4KUO A;  3PYP A;  3VV4 A;  3LI9 A;  4HJ4 A;  5AVF A;  3F1O A;  2KX6 A;  3MMH A;  1IOU A;  3A0R A;  3BW6 A;  4JGP A;  3LR3 A;  1X0O A;  3S7N A;  1TS7 A;  4B93 A;  4AFI A;  4HJ6 A;  4GW9 A;  3BY8 A;  3B42 A;  3EEH A;  4IHQ A;  4BBV A;  5DJU A;  3H82 A;  4UQI S;  2JKR I;  3F1N B;  3S7Q A;  4G3V A;  4LRZ E;  4KQO A;  3SW1 A;  4WUJ A;  3LIA A;  4EU0 A;  5HDC A;  5A8B A;  1F98 A;  2OOL A;  3UME A;  4IUK A;  1TS8 A;  3E0Y A;  1MC0 A;  2BAS A;  4LRX C;  3V67 A;  2V1A A;  3TJZ C;  3MFX A;  3G6O A;  4BBU A;  2M1C A;  4WLA A;  2J3W A;  3CUE C;  2Z6D A;  3A0V A;  4JGO A;  4LLO B;  4BJP A;  4I39 A;  3LUQ A;  3R4K A;  4ME4 A;  3CIT A;  4K08 A;  3H82 B;  2WKR A;  2D02 A;  1UWN X;  3IS2 B;  3T4Q A;  5F68 A;  4PHT A;  2PT7 A;  3CLO A;  3D72 A;  1S66 L;  4LPZ A;  3PBO A;  1W63 Q;  3PBT A;  2ZMV A;  1TF1 A;  1VHM A;  4YNR A;  3OBF A;  5HZH A;  4GCZ A;  4UQI M;  2XRN A;  2PR6 A;  4XT2 A;  3FPV A;  2ZMF A;  1P97 A;  3LR0 A;  4GS9 A;  2OWH A;  1YSQ A;  3FG8 A;  4M4X A;  4QPR A;  2PD7 A;  3C2W A;  1EW0 A;  3HCY A;  1KOU A;  2J3T C;  3ZYT A;  4GHI A;  1NWZ A;  5HWT A;  3ZQ5 A;  3K3C A;  3ULF A;  4CLC B;  3HJI A;  2W1R A;  3P7N A;  4ZRR A;  3T50 A;  3KSF A;  4HJ3 A;  2HV1 A;  5F5Y A;  4FSF A;  3F1O B;  3EQU A;  1OTB A;  2QHK A;  1T18 A;  2D01 A;  2DMW A;  2Y8H A;  1ODV A;  1UGU A;  5J7E A;  2A2L A;  2HF6 A;  4JGR A;  1P9W A;  3DBA A;  1LT0 A;  2QWS A;  3BQA A;  1GSX A;  3C30 A;  5DFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...