5HD5A

Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein: 200 ns time delay photo-activated (light) structure
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
124
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
publication title Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 33
structure length 124
sequence length 125
ec nomenclature
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hd5A00
4I38A 3NJAA 5DKKA 2QHKA 3F1NA 1DP9A 5HWVA 1LL8A 2L1MA 3KX0X 3CAXA 5HWWA 3LIBA 1OTIA 5I5LA 2V0WA 4HI4A 1XJ6A 4PKYG 3F1PA 1S1YA 5J3WA 2KX6A 4LLOB 3F1OB 2L4RA 4L9EA 3H82A 4NXGA 4EQ1A 4XT2A 2KDKA 5F69A 5HDCA 3UB7A 3OLOA 5TBMB 3LIFA 5DJTA 3UMEA 2QWSA 3MXQA 4WUJA 1S1ZA 4HOIA 4PKYA 2CMNA 4I5SA 3MR0A 3A0RA 1OJGA 1S67L 4BBVA 2BASA 5DJUA 4BBTA 1WA9A 1UWPX 5DKLA 2WKRA 2A24A 4WN5A 1EW0A 2JHEA 3NOTC 3VOLA 2Z6CA 1D7EA 2J80A 3F1PB 3HJIA 4I3JA 3D72A 4MN5A 4LPZA 4NXFA 1GSVA 4L9GA 2JN7A 4EW7A 3E4QA 5G4ZA 1S66L 5A8BA 2HV1A 4GHIA 3NOPC 3CLOA 4HH3A 1XFQA 4LRZE 1S4SA 4EEPA 3A0SA 4HNBA 4MN6A 3K3DA 3NHQA 1OJ5A 3LUQA 1DP6A 4R3AA 1BYWA 2PR6A 1LSWA 5J7EA 3H7WA 5HD5A 2ZBBA 3MJQA 4GS9A 3C8CA 1T19A 2EA9A 4HHDA 5HSQA 1LT0A 3UB6A 2YKFA 1ODVA 1UWNX 1TS7A 2QJ7A 2W0NA 5KIZA 4RQ9A 5J4EA 4WF0A 4I3AA 2OWHA 1OTAA 1TS8A 3BWLA 4H6JA 2D01A 3IS2B 4I39A 1XJ2A 2M1CA 2ZOIA 3B33A 3ZQ5A 4HH2A 4GW9A 4R70A 2V1AA 4M4XA 1OTDA 3F1NB 1LSXA 5IS1A 4GS9B 1GSXA 3UB8A 4DJ3A 4EXOA 1OTEA 3H9WA 4YWZA 3FG8A 5G4YA 3E4OA 2H28A 4JGPA 4F3LA 1G28A 3LI9A 4NXEA 5AVFA 4I3IA 4L9FA 4BBUA 4EEUA 1V9ZA 2VV6A 5HD3A 5HDSA 4EERA 3H82B 4EETB 4JGQA 4XT2B 1VB6A 1T1BA 3PHYA 1DP8A 4HP4A 3E4PA 4HY8A 3VE3A 3K3CA 1NWZA 3HJKA 1Y28A 4HQAA 2PYPA 4KQDA 1D06A 1T18A 3A0VA 2K7SA 3G6OA 1N9LA 3LYXA 1XFNA 5F68A 3ULFA 1UGUA 1P0ZA 4R38A 1MZUA 4E04A 1F98A 2W27A 3RTYA 2Z6DA 1DRMA 1LSVA 4R6LA 2A24B 3P7NA 1X0OA 1T1CA 1TS6A 2PHYA 4EESA 2WKQA 3IBRA 2R78A 1N9OA 2L0WA 4NXBA 2PYRA 1S4RA 2V0UA 2D02A 4GHIB 1GSWA 3T50A 4B9OA 4HP9A 4LRXC 1OT6A 4LRYC 1OT9A 2PD7A 3UB9A 3PYPA 3EEHA 3BY9A 3BY8A 3EWKA 5AVEA 5HZHA 3LIDA 1TS0A 3H7WB 1T1AA 5HWTA 3LI8A 1F9IA 5F6AA 5HDDA 3MFXA 4DJ2A 1N9NA 2V1BA 3MQOA 4WL9A 3NOUC 3GECA 2P7JA 4WLAA 5F5YA 1XJ3A 2YKHA 2VV7A 3GDIA 2OWJA 3SW1A 3LIEA 4HJ6A 4KUKA 4H6JB 4KUOA 3LICA 1P97A 3LIAA 2PD8A 4JGRA 3UE6A 2ZOHA 3RH8B 2V9AA 3ICYA 3F1OA 2VLGA 2I9VA 3C2WA 2INWA 5IU1A 2QJ5A 4HJ3A 2B02A 1V9YA 1XJ4A 2OOLA 3CWFA 5EFWA 3UMDA 2WKPA 1KOUA 2VEAA 3IS2A 3VE4A 5TBMA 1JNUA 2PR5A 4HIAA 4K08A 2QKPA 1OTBA 3FC7A 4GCZA 4F3LB 2VV8A 4JGOA 3MQQA 2PDRA 2GJ3A 4HJ4A
chains in the Genus database with same CATH superfamily
4I38A 5DKKA 5FDHA 4Y0UA 1LL8A 3QP8A 4ARZB 1Y4OA 3A3FA 4GLQA 3BFGA 2A2LA 3O87A 4HI4A 1KVMA 2H0TA 4PKYG 3F1PA 3N8RA 5J3WA 5TR7A 2KX6A 4LLOB 3F1OB 2L4RA 2P9VB 4PMAA 3UDFA 1W7FA 1FILA 4MBKA 4PM7A 3H82A 3UPNA 2XEPA 1KE0A 3NY4A 3PBTA 4XT2A 4B4XA 3QHYA 5F69A 1W8YA 4WBGA 2Y79A 2W3DA 5DF9A 2V1ZA 3B3XA 3MS6A 3OLOA 3EQVA 3UMEA 1J3WA 2QWSA 3MFDA 2B5RA 3T4QA 4OPQA 4WUJA 3O88A 1S1ZA 3ZG5A 4PKYA 3UE0A 3QP2A 2HJEA 3NULA 3W4PA 1OJGA 3FWLA 3V5MA 3ITBA 3ISGA 2BASA 3P98A 2XQZA 1TVFA 1QMEA 1BUEA 2EFUA 4EBLA 1G6OA 2EWVA 2HP6A 5FSRA 1HLUP 4DE2A 3IF6C 4JXVA 4D60A 4HESA 3OCLA 1K4FA 4MN5A 4JLFA 5GLAA 2JN7A 5FL3A 4YNRA 4CLCE 1E3UD 1MKIA 1S66L 2W3HA 4S2OA 5DTTA 2H5SA 2Y2GA 3M2KA 3PR6A 3LR5A 3IHAA 4GHIA 5EUAA 1Q2PA 3NOPC 3P09A 3QP6A 1XFQA 1S4SA 5FA7A 3TG9A 3T1RA 3ZG8B 4KG2A 4R23A 2ZQ8A 3D3OA 1YQSA 3DTIA 4IBXA 4Q0IA 3FYZA 3LUQA 3CZDA 2Y91A 3TRCA 4KG6A 5J7EA 3H7WA 2XF3A 5AQAA 2ZBBA 3BLSA 3WS4A 3UY6A 2AVXA 4GS9A 3HBRA 3DTMA 1PNEA 3JVUA 1YMSA 1LT0A 3UB6A 1LI0A 1TS7A 3PTEA 4ZJ3A 4RQ9A 4P6BA 4YOFA 2IWBA 4WF0A 4KZAA 1PWGA 2HDQA 1CI8A 4R4RA 1TS8A 3BWLA 3T4JA 3IS2B 3QP4A 3KO6A 2GZAA 3BEBA 2W1RA 1XJ2A 4DN0A 4DRTA 1F2KA 2XDMA 3JPUA 1PWCA 2QMIA 2HPBA 1TF1A 4R70A 2WGIA 3NECA 5JYOA 3SH8A 1YLTA 1IFQA 1ERMA 4RA7A 4M4XA 4E6XA 3ITAA 4OONA 4UEYA 2Y2HA 1GSXA 4WZ5A 3UB8A 5A90A 3A3JA 3MZFA 2G2UA 5AQ9A 4KZ6A 1OTEA 3HLDA 1K57C 1M6KA 4WM9A 3WS2A 3NI9A 4LV1A 4JGPA 1G28A 4EUZA 3LI9A 4DE3A 5DVAA 3DAVA 1IYSA 4L9FA 3VOYA 4EEUA 5EPHA 5HD3A 1W8QA 4EERA 1OPXA 3H82B 5FATA 3N7WA 2EXBA 5HAPA 3IXGA 4XT2B 2HDUA 4OPZA 3TSGA 1J9MA 4IUKA 3HJKA 3HVFA 5L07A 4LGWA 2Y59A 2Y2NA 2W3EA 3GRJA 2PYPA 1Q2QA 1ES2A 2WKEA 1L0FA 3A0VA 2K7SA 3G6OA 3MMHA 5F68A 1YLJA 4R38A 1MZUA 4E3OA 4E04A 2Z6DA 3AGEA 5GHZA 3UPOA 1JWPA 5FQJA 1GHPA 1TDLA 5CERA 3UNWA 2JKTM 2JC7A 4OQIA 2VKSA 1XX2A 3A3IA 1JTDA 3IBRA 1BTLA 4X53A 1IKIA 2QZ6A 5K5BA 5JYPA 2L0WA 4NXBA 1K54C 1IOUA 1BLPA 4GHIB 3I7JA 4E3MA 4YFMA 1L3LA 1K4EA 2OSUA 2C6WB 3DW0A 4GD8A 2XD1A 3EEHA 1JVJA 4DDSA 3OPPA 5AVEA 3H7WB 1FIKA 1F9IA 4X55A 5GLCA 5EM0A 2KLIA 1BLSA 3OPLA 4ID4A 2LB5A 4XUZA 4NEED 4OQGA 5KZHA 2P7JA 1ERQA 1XJ3A 3GDIA 4IUHA 4H8RA 3SW1A 3GTCA 2ZMVA 3TW8A 4R1GA 4E6WA 4HJ6A 2UV0E 4WMCD 3MKFA 3LY4A 4FSFA 1YT4A 4JGRA 5IHVA 2HP9A 2K31A 4KZ3A 4Z1WA 2RL3A 4K0XA 3ICYA 3F1OA 3GSGA 5IU1A 4KZ4A 1PZOA 2ACGA 1TDGA 3TOIA 1VHMA 4ESPA 1KOUA 5TJJA 1FCMA 1JNUA 3CUEC 3CITA 2BG1A 3PBQA 1K6SA 3U4LP 5GLBA 3QP5A 1OTBA 3HLCA 3RXXA 2PDRA 4R3BA 3PAGA 2GJ3A 2HDSA 2K2NA 3V50A 1M40A 4U0XA 4QJGA 1FSWA 3NJAA 4FCFA 4C3QA 4GNUA 5HAIA 3EGDC 3Q7ZA 2A3UA 5FEFA 2H10A 5EVIA 1Z09A 4WYYA 2V0WA 2QYBA 3CG5A 1XJ6A 1SZVA 1S1YA 3BYDA 3E2LA 4UAAA 1KGEA 3A3DA 3IXBA 2KDKA 3G32A 5HDCA 5F83A 1CQAA 3MBZA 3LIFA 2ZQ9A 5DJTA 2EWWA 4Y5FA 4Q8IA 4HOIA 4MMNA 2CMNA 3VMAA 2J3TD 4BBVA 2J7VA 3LR0A 4BBTA 5M19A 4CLCD 4OQ0A 4BQMA 3JYIA 5DF8A 2WKRA 1XKZA 1EW0A 2JHEA 1GHMA 1CEGA 4ZJ1A 3HJIA 4EU0A 4LPZA 1LI9A 4G3VA 5FAPA 4S2KA 2GNXA 4Y2FA 4EW7A 1H8ZA 4MN7A 2DRWA 1ALQA 1DJBA 2Z2LB 2Y2PA 5HAQA 5L09A 1IKGA 4GJ4A 1MY8A 2V2FF 1HVBA 4WEJA 2KOIA 3CLOA 1O07A 4E3IA 3T12B 4EEPA 4HNBA 1PI5A 3K3DA 1H5XA 3NHQA 3T1XA 2W1TB 3SS4A 2ZL1B 3N8LA 5FAOA 2CC1A 5TGFA 5HD5A 3KYEA 1YAXA 3MJQA 5HARA 5HX9A 1WE4A 2ZM0A 3C8CA 1YPRA 4N9KA 1T19A 3IQAA 5FQIA 5HSQA 1ZC2A 2YKFA 3BQ8A 5FAQA 3D9YA 3EOIA 4EV4A 2QJ7A 2Y55A 3R4KA 5FQ9A 5KIZA 2E8IA 3DTEA 2XA7M 1ES5A 3ZCZA 2BLSA 4I3AA 1GCEA 2OWHA 4PM6A 1OTAA 3IX3A 3NCKA 5KMWA 4H6JA 2R9XA 2OAQ1 4I39A 3IWOA 1KE3A 3G34A 3AGFA 4KZ9A 4UHUA 3B33A 3ZQ5A 2Y8HA 3B42A 5CXWA 1NXYA 2JCHA 3IF6A 4HH2A 2Q0OA 1PZPA 4DMZA 2X01A 5FQQA 4MLLA 4PPRA 4O0PA 1LL5A 5EVEA 1JTGA 1OTDA 2O9BA 1ZTUA 1VETA 3HLWA 4QPRA 2Y2OA 1L0GA 3PBSA 3MZDA 5EVIB 4YWZA 3B47A 5G4YA 3T1SA 5EOEA 5E2EA 4OLGA 5FI6A 3BQAA 5EOOA 4FOFA 2J3TC 3E0YA 3MXRA 4BBUA 4DF6A 2XROA 1BULA 5FDSA 4BJPA 5GHYA 4IVIA 4IVKA 4X69A 4HBUA 4OOYA 4CLCC 5FEGA 3VFHA 5EM1A 1GA9A 1T1BA 4HP4A 4DXCA 4ME4A 3K3CA 1PWDA 3PAEA 3S7PA 4S2PA 3VP0A 4R3JA 3UDXA 1CI9A 4KQDA 3C5AA 1D06A 1W5DA 2JE5A 4O01A 1T18A 3IXDA 1XFNA 4DKIA 3R7WA 3ULFA 1P0ZA 2WYXA 1PRQA 2IWDA 2V8CA 2Y2JA 1Z6FA 2HZ5A 3FPVA 2A49A 3P7NA 2GX5A 1IYQA 1X0OA 1EI5A 4P6ZM 3PBNA 1T1CA 3CHWP 3AGDA 1L0EA 1MKMA 4S2MA 3FKWA 1BT5A 1MWRA 3N8SA 3L9KA 1NLZA 2O99A 1ONHA 2VA0A 3T50A 4B9OA 4GZBA 4UA9A 1OT6A 4LRYC 3MKEA 3UB9A 4JPMA 3BJNA 3PYPA 5KSCA 4OVDA 3BY8A 2J8YA 3EWKA 4FD8A 4BL3A 2VGKA 2XR0A 3LFVA 3LIDA 5HZHA 4BLMA 4QB8A 5HWTA 3DBAA 3LI8A 5DTSA 2EX6A 4DJ2A 1N9NA 2PT7A 4BMWA 2PBYA 2G2WA 3MQOA 2ZC4B 3ZVTA 3O86A 4WL9A 1BLCA 3GECA 3WS0A 4WLAA 1H8MA 1E3UA 4OKPA 3G4PA 3U2AA 4H6JB 4MDZA 5CTMA 4KUOA 2ZMAA 4MBHA 5LBRA 1CK3A 3MF0A 3UE6A 2X71A 2ZLYA 4KG5A 4JKTA 3KYQA 2VLGA 3Q1FA 3IF6B 2ZM8A 2Q9MA 1ZKJA 2QPNA 2Y2LA 4HJ3A 5HFOA 1XJ4A 2OOLA 3CWFA 5EFWA 1K25A 2XRNA 3V67A 1RGYA 1PFLA 2VEAA 2WAEA 4B88A 2VGJA 2NUPC 1VETB 3NDEA 4QU3A 3IWQA 3GR2A 3W4OA 3G31A 1K54A 2QKPA 5J8XA 3G2YA 1PI4A 3RJUA 2VK3A 1K56D 2JKTI 4GCZA 3HLBA 1BZAA 4JGOA 3MQQA 5A92A 3CPTB 4LENA 4HJ4A 4Y17A 4LV0A 4X56A 2V8FA 1OMEA 1DJAA 2ZJ9A 3IXHA 3T4TA 1F5MA 1XGIA 2L1MA 1YMXA 3CAXA 5HWWA 3LIBA 4NETA 1SCWA 2ZM2A 5TFQA 2XA7S 4XUXA 1VM1A 4KZBA 3OBFA 3RXWA 4GN2A 3NIAA 1MWTA 4ETZA 3UE1A 5CEBA 1NRJA 2IA2A 2VGLM 1C3BA 1LL9A 2XK1A 3R7WB 4S2IA 3DWKA 3W2ZA 4EUVA 3EEAA 4QHCA 4RX2A 1NLYA 2HDRA 5D3OA 4F94A 3LCEA 3MR0A 4ZAMA 4OPRA 3UB5P 1FR6A 2ZC5B 2W1TA 1U60A 2ZL1A 3MSHA 5DJUA 4A5RA 2WGWA 1H8YA 4FUWA 3Q7VA 1O7EA 1UWPX 5DFXA 1K38A 2EX9A 4QY6A 1NRFA 1W63M 2J9OA 4WN5A 1SKOA 3CUEA 3NOTC 1G6AA 1YLYA 2Z6CA 1D7EA 5CGSA 4I3JA 4ETXA 3D72A 4KZ5A 1YLPA 4FH2A 1A0KA 2VX8A 1GSVA 3L7HA 5GL9A 3FZCA 5IT5A 2WK0A 5G4ZA 2ZMFA 2NUTC 1ESUA 2O0YA 2HP5A 4K0WA 4N92A 3LO7A 1Y54A 1YSPA 4HH3A 1P9WA 4LRZE 1AXBA 4P87A 3SS3A 4FH4A 1RP5A 3A0SA 1GHIA 4MN6A 1WYCA 4ZRRA 5F1FA 4D2OA 1DP6A 1BYWA 1KVLA 5E2FA 2ZC6B 1K55C 4P6ZS 2EX8A 1H0MA 4QWOA 2PBDP 2XH9A 3S7OA 3CMZA 2EA9A 4HHDA 3BRMA 4OH0A 3PBRA 3FPWA 3TJZC 4EQIA 4E3JA 2J3WA 4NK3A 1SDEA 4PM8A 4Y13A 4X68A 3PXPA 2D01A 2WAFA 2DNSA 2ZQCA 1FOFA 2WZZA 4EBPA 2M1CA 5FQMA 3IT9A 1SKFA 2ZOIA 3MZEA 4AFIA 4GW9A 2ZQDA 2B18A 2V1AA 4UA6A 1WYBA 3NC8A 3N6IA 5DFYA 5FASA 5FI2A 3ZNYA 3BFDA 5CHUA 2WGVA 1LSXA 3WS1A 5IS1A 3GQZA 4DJ3A 1XGJA 4LV3A 1TEMA 3H9WA 4WMCA 5CHMA 3EQUA 3FG8A 2VZWA 4QD4A 3E4OA 1N9BA 1CJFA 2H28A 4RVAA 5AVFA 4S2NA 2JKRM 4OLDA 4N9LA 3P01A 3KSGA 1IELA 1VEUA 5HDSA 5E43A 2ZC7A 3CI6A 4EETB 1VB6A 2OAP1 1PW1A 3ZG7B 4CJNA 3PHYA 1I2WA 5A93A 2Y2QA 3VP1A 5F82A 1H3QA 3CJMA 1Y28A 3M6BA 2WADA 4MEZA 4Q0JA 1S6RA 3JVVA 2WKIA 4U3TA 2ZD8A 2HJ9C 4R4SA 3UN7A 3HCYA 2W3GA 2UWXA 4BWIA 3FKVA 3LYXA 4ZTKA 5MC7A 1UGUA 2WGWB 1PW8A 3Q7VB 1F98A 4JF6A 3OPHA 1BLHA 1DRMA 4R6LA 2WZXA 1SKOB 2M7VA 2WKHA 3IH8A 4B93A 2OLVA 2PHYA 4Y15A 2WUQA 5KSHA 2WKQA 3G30A 1LHYA 2R78A 1N9OA 2HF6A 4G3WA 3K2NA 4BD1A 5HPFA 2FH5A 5HL1A 1W79A 3LEQA 1S4RA 2V0UA 5G18A 3VFFA 1GSWA 3PBOA 2VGLS 4LRXC 5FI7A 3TE8A 1IYPA 4GDNA 5L8MA 1AWIA 3BY9A 4P0MA 3M2JA 1VQQA 3SZTA 4CLCA 5L2FA 3EGXC 4MNRA 1T1AA 1EWZA 1KGFA 5F6AA 5L10A 2EFXA 4OOLA 3S7QA 4KQQA 4XXRA 5BOHA 4PM5A 2XD5A 4DDYA 3VSLA 4C75A 2J9PA 3CPTA 5AJGA 5F5YA 3MXSA 2VV7A 3ZG9B 3UPPA 2DMWA 3Q82A 3LICA 3WRZA 1P97A 1K6RA 4X25A 2B95A 2E8JA 3LIAA 2P74A 4UA7A 1RGZA 1YSQA 2O9CA 1STZA 2XSSA 5A91A 3C2WA 2I9VA 3C4OA 1XXMA 3W4QA 2PU4A 2QJ5A 3HUOA 2GDNA 5AQ7A 2B02A 1V9YA 1L2SA 3UMDA 3HLEA 3BFFA 2P08A 4QY5A 3S7NA 1W63Q 3VE4A 3D4FA 1MC0A 3GVBA 4R0QA 2XGNA 1XA1A 4IBRA 1ACFA 2I72A 3NDGA 2LB9A 4HIAA 1MXOA 4K08A 5CGXA 3LY3A 2R9WA 2XFSA 4ZDXA 3FC7A 2VV8A 3BFCA 1VEUB 2QHKA 3F1NA 1DP9A 5HWVA 3C7UA 5CX7A 4OPYA 4PHTA 3UO9A 5CTNA 2OLUA 4YINA 4MCWA 3KX0X 3HL9A 1OTIA 4JXGA 5I5LA 4KQRA 1FCOA 5E2GA 5M1AA 1DY6A 2Y4AA 3GV9A 4X1LA 5DTKA 4CQHA 1KE4A 1K57A 4L9EA 4HBTA 1JWVA 2W3FA 3WRTA 1E4DA 5FQKA 4NXGA 4EQ1A 5HW3A 3QNBA 3UB7A 5TBMB 1SDNA 1K0KA 1GA0A 1HTZA 4BL2A 3QNCA 4OOMA 4WELA 3MXQA 4K91A 4OP8A 1PYYA 3C30A 1G5UA 4I5SA 3A0RA 3LGOA 1MPLA 1S67L 3UE3A 3S4XA 3SS5A 4WZ4A 4GKUA 4N1XA 3HREA 3UDIA 1WA9A 1D1JA 5CECA 5DKLA 2A24A 5EE8A 3WWXA 3VOLA 2J80A 3F1PB 2Y2IA 3Q81A 1XA7A 4X1MA 3GMWA 1JWZA 4X6TA 4NXFA 1LLBA 4L9GA 4B4ZA 1P9RA 4WZ5C 3E4QA 3SOIA 3M6HA 5A8BA 2PAVP 4CLCB 3FV7A 3BW6A 1CF0A 2HV1A 3HUNA 3NBLA 2C5WB 4U0TA 1L0DA 4Y0TA 5C5KA 3V3SA 1OJ5A 3T4OA 3HLGA 4R3AA 4FTXA 5AQBA 2PR6A 1LSWA 2Y2KA 5CGWA 2RCXA 4LV2A 1EROA 2OV5A 1QMFA 1YLZA 4UQIM 5HPIA 4EWFA 4KENB 3IX8A 1G68A 4Z9QA 4JF4A 3OOVA 1ESIA 4II7A 1ODVA 1NYYA 2BTFP 1UWNX 2M7UA 4JXWA 3LR4A 2W0NA 5I94A 3DWZA 1ZHHB 3IH9A 3T4KA 1NZUA 4Y0OA 5J4EA 4Y7PA 4RX3A 4IEDA 4C6YA 3VOZA 3OPRA 1NZOA 1FR1A 1S0WA 2Z2MB 4LCMA 1FSYA 4GOGA 1SHVA 2ZQ7A 2H0YA 5EVID 2FFFB 4IJGA 4LFUA 5DF7A 4E3KA 5GLDA 1KDSA 4GD6A 3VSKA 1FCNA 4JF5A 3KYZA 1DJCA 4JXSA 3F1NB 4GS9B 4EBNA 3ZVWA 3W8KA 4E3LA 4RYEA 4EXOA 3MQ0A 3VV4A 2JBFA 4G3KA 1YM1A 3G35A 4L0LA 3C38A 4F3LA 1ZG4A 1KGGA 4NXEA 4I3IA 4M3KA 1I5QA 3ZDJA 1V9ZA 3ZFZA 2VV6A 1XPBA 3BM6A 3ZNTA 4BD0A 5M18A 1ONGA 4ARZA 4JGQA 2O9AA 4LCLA 1K55A 4Y3IA 1FQGA 1IYOA 1DP8A 3ZHHA 3E4PA 3VP2A 4HY8A 3VE3A 1CEFA 1NWZA 3IBJA 3VP3A 4S2LA 4BENA 1K56A 2P9VA 4ZJ2A 3HUMA 3KSFA 4HQAA 2G7UA 3QP1A 2X02A 4DXBA 3IX4A 4KZ8A 4CPKA 3IHBA 2JKGA 1N9LA 1ZG6A 2PU2A 1KDWA 3O3VA 3ZYTA 3C7VA 1TD5A 4KZ7A 5HL6A 1ES4A 1NY0A 2W27A 3RTYA 2XFTA 1NYMA 3KSHA 1LSVA 2A24B 1XP4A 2JKFA 2ZC3B 3E98A 4MBFA 1E25A 1TS6A 3G2ZA 5EVLA 4O7DA 5EECA 3ZG0A 4EESA 1IEMA 2V20A 1HZOA 4P85A 1ES3A 5GHXA 3DTKA 3C4PA 2XLNA 4O8GA 3T1QB 3SH7A 1MBLA 2PYRA 3IWIA 1RCJA 2D02A 3LR3A 4HP9A 1PIOA 3V3RA 1MWSA 3Q07A 1OT9A 2PD7A 5F1GA 3IF5A 1HD8A 2Y2MA 3BFEA 3OC2A 5CEDA 4HEFA 4ZBEA 1TS0A 3RFBA 1BSGA 2Q9NA 5EVIC 2ZQAA 3A3EA 3T4LA 3SH9A 1NJ4A 1YLWA 5HDDA 3MFXA 3V39A 4GDBA 3KSIA 2V1BA 4DE0A 1I2SA 4E3NA 3S1YA 3O5YA 2FZ0A 3S22A 2JKRI 3NOUC 4N1HA 5CRFA 4PAUA 2YKHA 2OWJA 3BECA 3LIEA 4KUKA 1MWUA 3N4IA 3VP4A 4NG2A 2PD8A 2HGVA 2EX2A 5EV0A 2EXAA 3OZHA 2ZOHA 3OCNA 3BLMA 3RH8B 2V9AA 2INWA 5CHJA 4GB7A 2IWCA 3ZGAB 4NKPA 3LEZA 3E2KA 4WEKA 1YKDA 4KQOA 2WKPA 4Q0HA 4OQHA 3T4SA 2FFYA 3IS2A 4S2JA 2MJ6A 4IHQA 5TBMA 1N4OA 4DE1A 2P04A 4JBFA 5U47A 2PR5A 4OP5A 2VJWA 2PRFA 4S2NC 3WS5A 3HLFA 2DCFA 5E2HA 4PM9A 4F3LB 4UQIS
chains in the Genus database with same CATH topology
4I38A 3NJAA 5DKKA 2QHKA 3F1NA 3T4TA 1DP9A 5HWVA 1F5MA 1LL8A 4PHTA 5CX7A 3EGDC 2L1MA 4ARZB 4MCWA 3KX0X 3CAXA 5HWWA 3LIBA 1OTIA 4GLQA 5I5LA 2XA7S 2V0WA 2QYBA 2A2LA 4HI4A 1XJ6A 3OBFA 4PKYG 3F1PA 1S1YA 5J3WA 4CQHA 2KX6A 4LLOB 3F1OB 2L4RA 4L9EA 4ETZA 2W3FA 3H82A 1NRJA 4NXGA 2IA2A 2VGLM 3PBTA 4EQ1A 4XT2A 2KDKA 5F69A 2Y79A 2W3DA 3R7WB 5HDCA 3UB7A 5DF9A 3OLOA 5TBMB 3W2ZA 4EUVA 3EEAA 3EQVA 3LIFA 1NLYA 5DJTA 3UMEA 2QWSA 4OOMA 4WELA 2EWWA 3MXQA 4Y5FA 3T4QA 4WUJA 3C30A 1S1ZA 4HOIA 4PKYA 4MMNA 2CMNA 4I5SA 3MR0A 2HJEA 2J3TD 3A0RA 1OJGA 1S67L 3UE3A 2W1TA 4BBVA 2BASA 5DJUA 3LR0A 4BBTA 1WA9A 4CLCD 1UWPX 5DFXA 1G6OA 5DKLA 2WKRA 2EWVA 2A24A 1W63M 4WN5A 1EW0A 2JHEA 3CUEA 3NOTC 3VOLA 2Z6CA 1D7EA 2J80A 3F1PB 3HJIA 4I3JA 4ETXA 3OCLA 3D72A 4MN5A 4EU0A 4LPZA 4NXFA 4G3VA 2VX8A 1GSVA 4L9GA 2JN7A 2GNXA 4Y2FA 5FL3A 4EW7A 5IT5A 4YNRA 1P9RA 4CLCE 3E4QA 4MN7A 5G4ZA 1S66L 2W3HA 5A8BA 2ZMFA 4CLCB 2NUTC 2O0YA 3PR6A 3LR5A 3BW6A 2HV1A 4GHIA 3NOPC 4GJ4A 4WEJA 2KOIA 3CLOA 1YSPA 4HH3A 1P9WA 1XFQA 4LRZE 5C5KA 1S4SA 4EEPA 3A0SA 4HNBA 4MN6A 3K3DA 4ZRRA 3D3OA 3NHQA 1OJ5A 3T4OA 4Q0IA 2W1TB 3LUQA 1DP6A 4R3AA 3TRCA 1BYWA 2PR6A 1LSWA 5J7EA 3H7WA 5HD5A 2ZBBA 1YAXA 3MJQA 4P6ZS 4GS9A 4UQIM 5HPIA 3C8CA 3S7OA 1T19A 3JVUA 2EA9A 4HHDA 5HSQA 1LT0A 3OOVA 3UB6A 2YKFA 3BQ8A 1ODVA 4II7A 3EOIA 3PBRA 1UWNX 1TS7A 2M7UA 2QJ7A 3LR4A 3R4KA 2W0NA 3FPWA 1ZHHB 3TJZC 5KIZA 4RQ9A 3T4KA 2J3WA 4YOFA 5J4EA 2XA7M 4WF0A 4I3AA 2OWHA 1OTAA 1TS8A 3BWLA 3T4JA 3PXPA 4H6JA 2OAQ1 2D01A 3IS2B 3KO6A 4I39A 2GZAA 2W1RA 1XJ2A 2M1CA 4DN0A 2ZOIA 3B33A 4IJGA 3ZQ5A 2Y8HA 3B42A 4AFIA 4HH2A 4GW9A 4DMZA 1TF1A 2B18A 2V1AA 4R70A 5DFYA 3KYZA 4O0PA 1IFQA 1OTDA 2O9BA 4M4XA 3F1NB 1ZTUA 4UEYA 1LSXA 5IS1A 4GS9B 1GSXA 3UB8A 4QPRA 4DJ3A 4EXOA 3PBSA 1OTEA 3H9WA 3MQ0A 3VV4A 3EQUA 4YWZA 4G3KA 3FG8A 2VZWA 3B47A 5G4YA 3E4OA 4L0LA 2H28A 3C38A 4JGPA 4F3LA 1G28A 3LI9A 4NXEA 5AVFA 4I3IA 3BQAA 4FOFA 2J3TC 2JKRM 4L9FA 3E0YA 4BBUA 2XROA 4EEUA 1V9ZA 3P01A 3KSGA 2VV6A 4BJPA 5HD3A 5HDSA 4EERA 1OPXA 3H82B 4CLCC 3CI6A 4ARZA 4EETB 4JGQA 4XT2B 1VB6A 2O9AA 2OAP1 1T1BA 4Y3IA 3PHYA 1DP8A 4HP4A 3E4PA 1H3QA 4HY8A 4ME4A 3VE3A 3K3CA 1NWZA 4IUKA 3HJKA 3IBJA 3S7PA 1Y28A 2W3EA 3KSFA 4Q0JA 4HQAA 3JVVA 2G7UA 2PYPA 4KQDA 2HJ9C 1D06A 4O01A 3HCYA 2W3GA 1T18A 3A0VA 2K7SA 4BWIA 3G6OA 1N9LA 3LYXA 5MC7A 1XFNA 3MMHA 3ZYTA 5F68A 3R7WA 1UGUA 1P0ZA 3ULFA 1TD5A 5HL6A 4R38A 1MZUA 4E04A 1F98A 2W27A 3FPVA 3RTYA 2Z6DA 1DRMA 3KSHA 1LSVA 4R6LA 2A24B 3P7NA 2GX5A 2M7VA 1X0OA 4P6ZM 3PBNA 1T1CA 4B93A 3E98A 2JKTM 1TS6A 2PHYA 4EESA 2VKSA 5KSHA 1MKMA 2WKQA 3IBRA 2R78A 1N9OA 2HF6A 4O8GA 4G3WA 3K2NA 5HPFA 5K5BA 2FH5A 2L0WA 4NXBA 1IOUA 2PYRA 1S4RA 2V0UA 2D02A 1NLZA 2O99A 4GHIB 1GSWA 2VA0A 3PBOA 2VGLS 3LR3A 4HP9A 3T50A 4B9OA 4LRXC 3TE8A 1OT6A 4LRYC 1OT9A 2PD7A 3UB9A 3BJNA 3EEHA 3PYPA 3OC2A 5L8MA 3BY9A 3BY8A 3EWKA 5AVEA 3LFVA 3LIDA 5HZHA 1TS0A 3H7WB 4CLCA 3RFBA 3EGXC 1T1AA 5HWTA 3DBAA 3T4LA 3LI8A 1F9IA 5F6AA 2KLIA 5HDDA 3MFXA 3KSIA 4DJ2A 1N9NA 2V1BA 2PT7A 4BMWA 4OOLA 3MQOA 3S7QA 3O5YA 2FZ0A 4WL9A 2JKRI 3NOUC 3GECA 2LB5A 5AJGA 4NEED 2P7JA 4PAUA 4WLAA 5F5YA 1XJ3A 2YKHA 2VV7A 3GDIA 1H8MA 2OWJA 4IUHA 3SW1A 2ZMVA 3TW8A 3LIEA 4HJ6A 2DMWA 4KUKA 3U2AA 4H6JB 4MDZA 4KUOA 3LICA 1P97A 5LBRA 3LIAA 4FSFA 2PD8A 3MF0A 4JGRA 2HGVA 3UE6A 2K31A 4Z1WA 1YSQA 2O9CA 2ZOHA 1STZA 3OCNA 3RH8B 2V9AA 2XSSA 3ICYA 3KYQA 3F1OA 2VLGA 2I9VA 3C2WA 2INWA 5IU1A 2QJ5A 4HJ3A 4NKPA 4HJ4A 2B02A 1V9YA 4WEKA 1YKDA 1XJ4A 2OOLA 3CWFA 4KQOA 5EFWA 2XRNA 1VHMA 3UMDA 3V67A 2WKPA 4Q0HA 2P08A 1KOUA 3S7NA 1W63Q 3T4SA 5TJJA 2VEAA 3IS2A 2MJ6A 3VE4A 2NUPC 4IHQA 5TBMA 1MC0A 2P04A 1JNUA 3CUEC 3CITA 2PR5A 2LB9A 4HIAA 3PBQA 2VJWA 4K08A 2QKPA 1OTBA 2JKTI 3FC7A 4GCZA 4F3LB 2VV8A 4JGOA 3MQQA 2PDRA 2GJ3A 4UQIS 2K2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I38 A;  3NJA A;  5DKK A;  2QHK A;  3F1N A;  1DP9 A;  5HWV A;  1LL8 A;  2L1M A;  3KX0 X;  3CAX A;  5HWW A;  3LIB A;  1OTI A;  5I5L A;  2V0W A;  4HI4 A;  1XJ6 A;  4PKY G;  3F1P A;  1S1Y A;  5J3W A;  2KX6 A;  4LLO B;  3F1O B;  2L4R A;  4L9E A;  3H82 A;  4NXG A;  4EQ1 A;  4XT2 A;  2KDK A;  5F69 A;  5HDC A;  3UB7 A;  3OLO A;  5TBM B;  3LIF A;  5DJT A;  3UME A;  2QWS A;  3MXQ A;  4WUJ A;  1S1Z A;  4HOI A;  4PKY A;  2CMN A;  4I5S A;  3MR0 A;  3A0R A;  1OJG A;  1S67 L;  4BBV A;  2BAS A;  5DJU A;  4BBT A;  1WA9 A;  1UWP X;  5DKL A;  2WKR A;  2A24 A;  4WN5 A;  1EW0 A;  2JHE A;  3NOT C;  3VOL A;  2Z6C A;  1D7E A;  2J80 A;  3F1P B;  3HJI A;  4I3J A;  3D72 A;  4MN5 A;  4LPZ A;  4NXF A;  1GSV A;  4L9G A;  2JN7 A;  4EW7 A;  3E4Q A;  5G4Z A;  1S66 L;  5A8B A;  2HV1 A;  4GHI A;  3NOP C;  3CLO A;  4HH3 A;  1XFQ A;  4LRZ E;  1S4S A;  4EEP A;  3A0S A;  4HNB A;  4MN6 A;  3K3D A;  3NHQ A;  1OJ5 A;  3LUQ A;  1DP6 A;  4R3A A;  1BYW A;  2PR6 A;  1LSW A;  5J7E A;  3H7W A;  5HD5 A;  2ZBB A;  3MJQ A;  4GS9 A;  3C8C A;  1T19 A;  2EA9 A;  4HHD A;  5HSQ A;  1LT0 A;  3UB6 A;  2YKF A;  1ODV A;  1UWN X;  1TS7 A;  2QJ7 A;  2W0N A;  5KIZ A;  4RQ9 A;  5J4E A;  4WF0 A;  4I3A A;  2OWH A;  1OTA A;  1TS8 A;  3BWL A;  4H6J A;  2D01 A;  3IS2 B;  4I39 A;  1XJ2 A;  2M1C A;  2ZOI A;  3B33 A;  3ZQ5 A;  4HH2 A;  4GW9 A;  4R70 A;  2V1A A;  4M4X A;  1OTD A;  3F1N B;  1LSX A;  5IS1 A;  4GS9 B;  1GSX A;  3UB8 A;  4DJ3 A;  4EXO A;  1OTE A;  3H9W A;  4YWZ A;  3FG8 A;  5G4Y A;  3E4O A;  2H28 A;  4JGP A;  4F3L A;  1G28 A;  3LI9 A;  4NXE A;  5AVF A;  4I3I A;  4L9F A;  4BBU A;  4EEU A;  1V9Z A;  2VV6 A;  5HD3 A;  5HDS A;  4EER A;  3H82 B;  4EET B;  4JGQ A;  4XT2 B;  1VB6 A;  1T1B A;  3PHY A;  1DP8 A;  4HP4 A;  3E4P A;  4HY8 A;  3VE3 A;  3K3C A;  1NWZ A;  3HJK A;  1Y28 A;  4HQA A;  2PYP A;  4KQD A;  1D06 A;  1T18 A;  3A0V A;  2K7S A;  3G6O A;  1N9L A;  3LYX A;  1XFN A;  5F68 A;  3ULF A;  1UGU A;  1P0Z A;  4R38 A;  1MZU A;  4E04 A;  1F98 A;  2W27 A;  3RTY A;  2Z6D A;  1DRM A;  1LSV A;  4R6L A;  2A24 B;  3P7N A;  1X0O A;  1T1C A;  1TS6 A;  2PHY A;  4EES A;  2WKQ A;  3IBR A;  2R78 A;  1N9O A;  2L0W A;  4NXB A;  2PYR A;  1S4R A;  2V0U A;  2D02 A;  4GHI B;  1GSW A;  3T50 A;  4B9O A;  4HP9 A;  4LRX C;  1OT6 A;  4LRY C;  1OT9 A;  2PD7 A;  3UB9 A;  3PYP A;  3EEH A;  3BY9 A;  3BY8 A;  3EWK A;  5AVE A;  5HZH A;  3LID A;  1TS0 A;  3H7W B;  1T1A A;  5HWT A;  3LI8 A;  1F9I A;  5F6A A;  5HDD A;  3MFX A;  4DJ2 A;  1N9N A;  2V1B A;  3MQO A;  4WL9 A;  3NOU C;  3GEC A;  2P7J A;  4WLA A;  5F5Y A;  1XJ3 A;  2YKH A;  2VV7 A;  3GDI A;  2OWJ A;  3SW1 A;  3LIE A;  4HJ6 A;  4KUK A;  4H6J B;  4KUO A;  3LIC A;  1P97 A;  3LIA A;  2PD8 A;  4JGR A;  3UE6 A;  2ZOH A;  3RH8 B;  2V9A A;  3ICY A;  3F1O A;  2VLG A;  2I9V A;  3C2W A;  2INW A;  5IU1 A;  2QJ5 A;  4HJ3 A;  2B02 A;  1V9Y A;  1XJ4 A;  2OOL A;  3CWF A;  5EFW A;  3UMD A;  2WKP A;  1KOU A;  2VEA A;  3IS2 A;  3VE4 A;  5TBM A;  1JNU A;  2PR5 A;  4HIA A;  4K08 A;  2QKP A;  1OTB A;  3FC7 A;  4GCZ A;  4F3L B;  2VV8 A;  4JGO A;  3MQQ A;  2PDR A;  2GJ3 A;  4HJ4 A; 
#chains in the Genus database with same CATH topology
 4I38 A;  5DKK A;  5FDH A;  4Y0U A;  1LL8 A;  3QP8 A;  4ARZ B;  1Y4O A;  3A3F A;  4GLQ A;  3BFG A;  2A2L A;  3O87 A;  4HI4 A;  1KVM A;  2H0T A;  4PKY G;  3F1P A;  3N8R A;  5J3W A;  5TR7 A;  2KX6 A;  4LLO B;  3F1O B;  2L4R A;  2P9V B;  4PMA A;  3UDF A;  1W7F A;  1FIL A;  4MBK A;  4PM7 A;  3H82 A;  3UPN A;  2XEP A;  1KE0 A;  3NY4 A;  3PBT A;  4XT2 A;  4B4X A;  3QHY A;  5F69 A;  1W8Y A;  4WBG A;  2Y79 A;  2W3D A;  5DF9 A;  2V1Z A;  3B3X A;  3MS6 A;  3OLO A;  3EQV A;  3UME A;  1J3W A;  2QWS A;  3MFD A;  2B5R A;  3T4Q A;  4OPQ A;  4WUJ A;  3O88 A;  1S1Z A;  3ZG5 A;  4PKY A;  3UE0 A;  3QP2 A;  2HJE A;  3NUL A;  3W4P A;  1OJG A;  3FWL A;  3V5M A;  3ITB A;  3ISG A;  2BAS A;  3P98 A;  2XQZ A;  1TVF A;  1QME A;  1BUE A;  2EFU A;  4EBL A;  1G6O A;  2EWV A;  2HP6 A;  5FSR A;  1HLU P;  4DE2 A;  3IF6 C;  4JXV A;  4D60 A;  4HES A;  3OCL A;  1K4F A;  4MN5 A;  4JLF A;  5GLA A;  2JN7 A;  5FL3 A;  4YNR A;  4CLC E;  1E3U D;  1MKI A;  1S66 L;  2W3H A;  4S2O A;  5DTT A;  2H5S A;  2Y2G A;  3M2K A;  3PR6 A;  3LR5 A;  3IHA A;  4GHI A;  5EUA A;  1Q2P A;  3NOP C;  3P09 A;  3QP6 A;  1XFQ A;  1S4S A;  5FA7 A;  3TG9 A;  3T1R A;  3ZG8 B;  4KG2 A;  4R23 A;  2ZQ8 A;  3D3O A;  1YQS A;  3DTI A;  4IBX A;  4Q0I A;  3FYZ A;  3LUQ A;  3CZD A;  2Y91 A;  3TRC A;  4KG6 A;  5J7E A;  3H7W A;  2XF3 A;  5AQA A;  2ZBB A;  3BLS A;  3WS4 A;  3UY6 A;  2AVX A;  4GS9 A;  3HBR A;  3DTM A;  1PNE A;  3JVU A;  1YMS A;  1LT0 A;  3UB6 A;  1LI0 A;  1TS7 A;  3PTE A;  4ZJ3 A;  4RQ9 A;  4P6B A;  4YOF A;  2IWB A;  4WF0 A;  4KZA A;  1PWG A;  2HDQ A;  1CI8 A;  4R4R A;  1TS8 A;  3BWL A;  3T4J A;  3IS2 B;  3QP4 A;  3KO6 A;  2GZA A;  3BEB A;  2W1R A;  1XJ2 A;  4DN0 A;  4DRT A;  1F2K A;  2XDM A;  3JPU A;  1PWC A;  2QMI A;  2HPB A;  1TF1 A;  4R70 A;  2WGI A;  3NEC A;  5JYO A;  3SH8 A;  1YLT A;  1IFQ A;  1ERM A;  4RA7 A;  4M4X A;  4E6X A;  3ITA A;  4OON A;  4UEY A;  2Y2H A;  1GSX A;  4WZ5 A;  3UB8 A;  5A90 A;  3A3J A;  3MZF A;  2G2U A;  5AQ9 A;  4KZ6 A;  1OTE A;  3HLD A;  1K57 C;  1M6K A;  4WM9 A;  3WS2 A;  3NI9 A;  4LV1 A;  4JGP A;  1G28 A;  4EUZ A;  3LI9 A;  4DE3 A;  5DVA A;  3DAV A;  1IYS A;  4L9F A;  3VOY A;  4EEU A;  5EPH A;  5HD3 A;  1W8Q A;  4EER A;  1OPX A;  3H82 B;  5FAT A;  3N7W A;  2EXB A;  5HAP A;  3IXG A;  4XT2 B;  2HDU A;  4OPZ A;  3TSG A;  1J9M A;  4IUK A;  3HJK A;  3HVF A;  5L07 A;  4LGW A;  2Y59 A;  2Y2N A;  2W3E A;  3GRJ A;  2PYP A;  1Q2Q A;  1ES2 A;  2WKE A;  1L0F A;  3A0V A;  2K7S A;  3G6O A;  3MMH A;  5F68 A;  1YLJ A;  4R38 A;  1MZU A;  4E3O A;  4E04 A;  2Z6D A;  3AGE A;  5GHZ A;  3UPO A;  1JWP A;  5FQJ A;  1GHP A;  1TDL A;  5CER A;  3UNW A;  2JKT M;  2JC7 A;  4OQI A;  2VKS A;  1XX2 A;  3A3I A;  1JTD A;  3IBR A;  1BTL A;  4X53 A;  1IKI A;  2QZ6 A;  5K5B A;  5JYP A;  2L0W A;  4NXB A;  1K54 C;  1IOU A;  1BLP A;  4GHI B;  3I7J A;  4E3M A;  4YFM A;  1L3L A;  1K4E A;  2OSU A;  2C6W B;  3DW0 A;  4GD8 A;  2XD1 A;  3EEH A;  1JVJ A;  4DDS A;  3OPP A;  5AVE A;  3H7W B;  1FIK A;  1F9I A;  4X55 A;  5GLC A;  5EM0 A;  2KLI A;  1BLS A;  3OPL A;  4ID4 A;  2LB5 A;  4XUZ A;  4NEE D;  4OQG A;  5KZH A;  2P7J A;  1ERQ A;  1XJ3 A;  3GDI A;  4IUH A;  4H8R A;  3SW1 A;  3GTC A;  2ZMV A;  3TW8 A;  4R1G A;  4E6W A;  4HJ6 A;  2UV0 E;  4WMC D;  3MKF A;  3LY4 A;  4FSF A;  1YT4 A;  4JGR A;  5IHV A;  2HP9 A;  2K31 A;  4KZ3 A;  4Z1W A;  2RL3 A;  4K0X A;  3ICY A;  3F1O A;  3GSG A;  5IU1 A;  4KZ4 A;  1PZO A;  2ACG A;  1TDG A;  3TOI A;  1VHM A;  4ESP A;  1KOU A;  5TJJ A;  1FCM A;  1JNU A;  3CUE C;  3CIT A;  2BG1 A;  3PBQ A;  1K6S A;  3U4L P;  5GLB A;  3QP5 A;  1OTB A;  3HLC A;  3RXX A;  2PDR A;  4R3B A;  3PAG A;  2GJ3 A;  2HDS A;  2K2N A;  3V50 A;  1M40 A;  4U0X A;  4QJG A;  1FSW A;  3NJA A;  4FCF A;  4C3Q A;  4GNU A;  5HAI A;  3EGD C;  3Q7Z A;  2A3U A;  5FEF A;  2H10 A;  5EVI A;  1Z09 A;  4WYY A;  2V0W A;  2QYB A;  3CG5 A;  1XJ6 A;  1SZV A;  1S1Y A;  3BYD A;  3E2L A;  4UAA A;  1KGE A;  3A3D A;  3IXB A;  2KDK A;  3G32 A;  5HDC A;  5F83 A;  1CQA A;  3MBZ A;  3LIF A;  2ZQ9 A;  5DJT A;  2EWW A;  4Y5F A;  4Q8I A;  4HOI A;  4MMN A;  2CMN A;  3VMA A;  2J3T D;  4BBV A;  2J7V A;  3LR0 A;  4BBT A;  5M19 A;  4CLC D;  4OQ0 A;  4BQM A;  3JYI A;  5DF8 A;  2WKR A;  1XKZ A;  1EW0 A;  2JHE A;  1GHM A;  1CEG A;  4ZJ1 A;  3HJI A;  4EU0 A;  4LPZ A;  1LI9 A;  4G3V A;  5FAP A;  4S2K A;  2GNX A;  4Y2F A;  4EW7 A;  1H8Z A;  4MN7 A;  2DRW A;  1ALQ A;  1DJB A;  2Z2L B;  2Y2P A;  5HAQ A;  5L09 A;  1IKG A;  4GJ4 A;  1MY8 A;  2V2F F;  1HVB A;  4WEJ A;  2KOI A;  3CLO A;  1O07 A;  4E3I A;  3T12 B;  4EEP A;  4HNB A;  1PI5 A;  3K3D A;  1H5X A;  3NHQ A;  3T1X A;  2W1T B;  3SS4 A;  2ZL1 B;  3N8L A;  5FAO A;  2CC1 A;  5TGF A;  5HD5 A;  3KYE A;  1YAX A;  3MJQ A;  5HAR A;  5HX9 A;  1WE4 A;  2ZM0 A;  3C8C A;  1YPR A;  4N9K A;  1T19 A;  3IQA A;  5FQI A;  5HSQ A;  1ZC2 A;  2YKF A;  3BQ8 A;  5FAQ A;  3D9Y A;  3EOI A;  4EV4 A;  2QJ7 A;  2Y55 A;  3R4K A;  5FQ9 A;  5KIZ A;  2E8I A;  3DTE A;  2XA7 M;  1ES5 A;  3ZCZ A;  2BLS A;  4I3A A;  1GCE A;  2OWH A;  4PM6 A;  1OTA A;  3IX3 A;  3NCK A;  5KMW A;  4H6J A;  2R9X A;  2OAQ 1;  4I39 A;  3IWO A;  1KE3 A;  3G34 A;  3AGF A;  4KZ9 A;  4UHU A;  3B33 A;  3ZQ5 A;  2Y8H A;  3B42 A;  5CXW A;  1NXY A;  2JCH A;  3IF6 A;  4HH2 A;  2Q0O A;  1PZP A;  4DMZ A;  2X01 A;  5FQQ A;  4MLL A;  4PPR A;  4O0P A;  1LL5 A;  5EVE A;  1JTG A;  1OTD A;  2O9B A;  1ZTU A;  1VET A;  3HLW A;  4QPR A;  2Y2O A;  1L0G A;  3PBS A;  3MZD A;  5EVI B;  4YWZ A;  3B47 A;  5G4Y A;  3T1S A;  5EOE A;  5E2E A;  4OLG A;  5FI6 A;  3BQA A;  5EOO A;  4FOF A;  2J3T C;  3E0Y A;  3MXR A;  4BBU A;  4DF6 A;  2XRO A;  1BUL A;  5FDS A;  4BJP A;  5GHY A;  4IVI A;  4IVK A;  4X69 A;  4HBU A;  4OOY A;  4CLC C;  5FEG A;  3VFH A;  5EM1 A;  1GA9 A;  1T1B A;  4HP4 A;  4DXC A;  4ME4 A;  3K3C A;  1PWD A;  3PAE A;  3S7P A;  4S2P A;  3VP0 A;  4R3J A;  3UDX A;  1CI9 A;  4KQD A;  3C5A A;  1D06 A;  1W5D A;  2JE5 A;  4O01 A;  1T18 A;  3IXD A;  1XFN A;  4DKI A;  3R7W A;  3ULF A;  1P0Z A;  2WYX A;  1PRQ A;  2IWD A;  2V8C A;  2Y2J A;  1Z6F A;  2HZ5 A;  3FPV A;  2A49 A;  3P7N A;  2GX5 A;  1IYQ A;  1X0O A;  1EI5 A;  4P6Z M;  3PBN A;  1T1C A;  3CHW P;  3AGD A;  1L0E A;  1MKM A;  4S2M A;  3FKW A;  1BT5 A;  1MWR A;  3N8S A;  3L9K A;  1NLZ A;  2O99 A;  1ONH A;  2VA0 A;  3T50 A;  4B9O A;  4GZB A;  4UA9 A;  1OT6 A;  4LRY C;  3MKE A;  3UB9 A;  4JPM A;  3BJN A;  3PYP A;  5KSC A;  4OVD A;  3BY8 A;  2J8Y A;  3EWK A;  4FD8 A;  4BL3 A;  2VGK A;  2XR0 A;  3LFV A;  3LID A;  5HZH A;  4BLM A;  4QB8 A;  5HWT A;  3DBA A;  3LI8 A;  5DTS A;  2EX6 A;  4DJ2 A;  1N9N A;  2PT7 A;  4BMW A;  2PBY A;  2G2W A;  3MQO A;  2ZC4 B;  3ZVT A;  3O86 A;  4WL9 A;  1BLC A;  3GEC A;  3WS0 A;  4WLA A;  1H8M A;  1E3U A;  4OKP A;  3G4P A;  3U2A A;  4H6J B;  4MDZ A;  5CTM A;  4KUO A;  2ZMA A;  4MBH A;  5LBR A;  1CK3 A;  3MF0 A;  3UE6 A;  2X71 A;  2ZLY A;  4KG5 A;  4JKT A;  3KYQ A;  2VLG A;  3Q1F A;  3IF6 B;  2ZM8 A;  2Q9M A;  1ZKJ A;  2QPN A;  2Y2L A;  4HJ3 A;  5HFO A;  1XJ4 A;  2OOL A;  3CWF A;  5EFW A;  1K25 A;  2XRN A;  3V67 A;  1RGY A;  1PFL A;  2VEA A;  2WAE A;  4B88 A;  2VGJ A;  2NUP C;  1VET B;  3NDE A;  4QU3 A;  3IWQ A;  3GR2 A;  3W4O A;  3G31 A;  1K54 A;  2QKP A;  5J8X A;  3G2Y A;  1PI4 A;  3RJU A;  2VK3 A;  1K56 D;  2JKT I;  4GCZ A;  3HLB A;  1BZA A;  4JGO A;  3MQQ A;  5A92 A;  3CPT B;  4LEN A;  4HJ4 A;  4Y17 A;  4LV0 A;  4X56 A;  2V8F A;  1OME A;  1DJA A;  2ZJ9 A;  3IXH A;  3T4T A;  1F5M A;  1XGI A;  2L1M A;  1YMX A;  3CAX A;  5HWW A;  3LIB A;  4NET A;  1SCW A;  2ZM2 A;  5TFQ A;  2XA7 S;  4XUX A;  1VM1 A;  4KZB A;  3OBF A;  3RXW A;  4GN2 A;  3NIA A;  1MWT A;  4ETZ A;  3UE1 A;  5CEB A;  1NRJ A;  2IA2 A;  2VGL M;  1C3B A;  1LL9 A;  2XK1 A;  3R7W B;  4S2I A;  3DWK A;  3W2Z A;  4EUV A;  3EEA A;  4QHC A;  4RX2 A;  1NLY A;  2HDR A;  5D3O A;  4F94 A;  3LCE A;  3MR0 A;  4ZAM A;  4OPR A;  3UB5 P;  1FR6 A;  2ZC5 B;  2W1T A;  1U60 A;  2ZL1 A;  3MSH A;  5DJU A;  4A5R A;  2WGW A;  1H8Y A;  4FUW A;  3Q7V A;  1O7E A;  1UWP X;  5DFX A;  1K38 A;  2EX9 A;  4QY6 A;  1NRF A;  1W63 M;  2J9O A;  4WN5 A;  1SKO A;  3CUE A;  3NOT C;  1G6A A;  1YLY A;  2Z6C A;  1D7E A;  5CGS A;  4I3J A;  4ETX A;  3D72 A;  4KZ5 A;  1YLP A;  4FH2 A;  1A0K A;  2VX8 A;  1GSV A;  3L7H A;  5GL9 A;  3FZC A;  5IT5 A;  2WK0 A;  5G4Z A;  2ZMF A;  2NUT C;  1ESU A;  2O0Y A;  2HP5 A;  4K0W A;  4N92 A;  3LO7 A;  1Y54 A;  1YSP A;  4HH3 A;  1P9W A;  4LRZ E;  1AXB A;  4P87 A;  3SS3 A;  4FH4 A;  1RP5 A;  3A0S A;  1GHI A;  4MN6 A;  1WYC A;  4ZRR A;  5F1F A;  4D2O A;  1DP6 A;  1BYW A;  1KVL A;  5E2F A;  2ZC6 B;  1K55 C;  4P6Z S;  2EX8 A;  1H0M A;  4QWO A;  2PBD P;  2XH9 A;  3S7O A;  3CMZ A;  2EA9 A;  4HHD A;  3BRM A;  4OH0 A;  3PBR A;  3FPW A;  3TJZ C;  4EQI A;  4E3J A;  2J3W A;  4NK3 A;  1SDE A;  4PM8 A;  4Y13 A;  4X68 A;  3PXP A;  2D01 A;  2WAF A;  2DNS A;  2ZQC A;  1FOF A;  2WZZ A;  4EBP A;  2M1C A;  5FQM A;  3IT9 A;  1SKF A;  2ZOI A;  3MZE A;  4AFI A;  4GW9 A;  2ZQD A;  2B18 A;  2V1A A;  4UA6 A;  1WYB A;  3NC8 A;  3N6I A;  5DFY A;  5FAS A;  5FI2 A;  3ZNY A;  3BFD A;  5CHU A;  2WGV A;  1LSX A;  3WS1 A;  5IS1 A;  3GQZ A;  4DJ3 A;  1XGJ A;  4LV3 A;  1TEM A;  3H9W A;  4WMC A;  5CHM A;  3EQU A;  3FG8 A;  2VZW A;  4QD4 A;  3E4O A;  1N9B A;  1CJF A;  2H28 A;  4RVA A;  5AVF A;  4S2N A;  2JKR M;  4OLD A;  4N9L A;  3P01 A;  3KSG A;  1IEL A;  1VEU A;  5HDS A;  5E43 A;  2ZC7 A;  3CI6 A;  4EET B;  1VB6 A;  2OAP 1;  1PW1 A;  3ZG7 B;  4CJN A;  3PHY A;  1I2W A;  5A93 A;  2Y2Q A;  3VP1 A;  5F82 A;  1H3Q A;  3CJM A;  1Y28 A;  3M6B A;  2WAD A;  4MEZ A;  4Q0J A;  1S6R A;  3JVV A;  2WKI A;  4U3T A;  2ZD8 A;  2HJ9 C;  4R4S A;  3UN7 A;  3HCY A;  2W3G A;  2UWX A;  4BWI A;  3FKV A;  3LYX A;  4ZTK A;  5MC7 A;  1UGU A;  2WGW B;  1PW8 A;  3Q7V B;  1F98 A;  4JF6 A;  3OPH A;  1BLH A;  1DRM A;  4R6L A;  2WZX A;  1SKO B;  2M7V A;  2WKH A;  3IH8 A;  4B93 A;  2OLV A;  2PHY A;  4Y15 A;  2WUQ A;  5KSH A;  2WKQ A;  3G30 A;  1LHY A;  2R78 A;  1N9O A;  2HF6 A;  4G3W A;  3K2N A;  4BD1 A;  5HPF A;  2FH5 A;  5HL1 A;  1W79 A;  3LEQ A;  1S4R A;  2V0U A;  5G18 A;  3VFF A;  1GSW A;  3PBO A;  2VGL S;  4LRX C;  5FI7 A;  3TE8 A;  1IYP A;  4GDN A;  5L8M A;  1AWI A;  3BY9 A;  4P0M A;  3M2J A;  1VQQ A;  3SZT A;  4CLC A;  5L2F A;  3EGX C;  4MNR A;  1T1A A;  1EWZ A;  1KGF A;  5F6A A;  5L10 A;  2EFX A;  4OOL A;  3S7Q A;  4KQQ A;  4XXR A;  5BOH A;  4PM5 A;  2XD5 A;  4DDY A;  3VSL A;  4C75 A;  2J9P A;  3CPT A;  5AJG A;  5F5Y A;  3MXS A;  2VV7 A;  3ZG9 B;  3UPP A;  2DMW A;  3Q82 A;  3LIC A;  3WRZ A;  1P97 A;  1K6R A;  4X25 A;  2B95 A;  2E8J A;  3LIA A;  2P74 A;  4UA7 A;  1RGZ A;  1YSQ A;  2O9C A;  1STZ A;  2XSS A;  5A91 A;  3C2W A;  2I9V A;  3C4O A;  1XXM A;  3W4Q A;  2PU4 A;  2QJ5 A;  3HUO A;  2GDN A;  5AQ7 A;  2B02 A;  1V9Y A;  1L2S A;  3UMD A;  3HLE A;  3BFF A;  2P08 A;  4QY5 A;  3S7N A;  1W63 Q;  3VE4 A;  3D4F A;  1MC0 A;  3GVB A;  4R0Q A;  2XGN A;  1XA1 A;  4IBR A;  1ACF A;  2I72 A;  3NDG A;  2LB9 A;  4HIA A;  1MXO A;  4K08 A;  5CGX A;  3LY3 A;  2R9W A;  2XFS A;  4ZDX A;  3FC7 A;  2VV8 A;  3BFC A;  1VEU B;  2QHK A;  3F1N A;  1DP9 A;  5HWV A;  3C7U A;  5CX7 A;  4OPY A;  4PHT A;  3UO9 A;  5CTN A;  2OLU A;  4YIN A;  4MCW A;  3KX0 X;  3HL9 A;  1OTI A;  4JXG A;  5I5L A;  4KQR A;  1FCO A;  5E2G A;  5M1A A;  1DY6 A;  2Y4A A;  3GV9 A;  4X1L A;  5DTK A;  4CQH A;  1KE4 A;  1K57 A;  4L9E A;  4HBT A;  1JWV A;  2W3F A;  3WRT A;  1E4D A;  5FQK A;  4NXG A;  4EQ1 A;  5HW3 A;  3QNB A;  3UB7 A;  5TBM B;  1SDN A;  1K0K A;  1GA0 A;  1HTZ A;  4BL2 A;  3QNC A;  4OOM A;  4WEL A;  3MXQ A;  4K91 A;  4OP8 A;  1PYY A;  3C30 A;  1G5U A;  4I5S A;  3A0R A;  3LGO A;  1MPL A;  1S67 L;  3UE3 A;  3S4X A;  3SS5 A;  4WZ4 A;  4GKU A;  4N1X A;  3HRE A;  3UDI A;  1WA9 A;  1D1J A;  5CEC A;  5DKL A;  2A24 A;  5EE8 A;  3WWX A;  3VOL A;  2J80 A;  3F1P B;  2Y2I A;  3Q81 A;  1XA7 A;  4X1M A;  3GMW A;  1JWZ A;  4X6T A;  4NXF A;  1LLB A;  4L9G A;  4B4Z A;  1P9R A;  4WZ5 C;  3E4Q A;  3SOI A;  3M6H A;  5A8B A;  2PAV P;  4CLC B;  3FV7 A;  3BW6 A;  1CF0 A;  2HV1 A;  3HUN A;  3NBL A;  2C5W B;  4U0T A;  1L0D A;  4Y0T A;  5C5K A;  3V3S A;  1OJ5 A;  3T4O A;  3HLG A;  4R3A A;  4FTX A;  5AQB A;  2PR6 A;  1LSW A;  2Y2K A;  5CGW A;  2RCX A;  4LV2 A;  1ERO A;  2OV5 A;  1QMF A;  1YLZ A;  4UQI M;  5HPI A;  4EWF A;  4KEN B;  3IX8 A;  1G68 A;  4Z9Q A;  4JF4 A;  3OOV A;  1ESI A;  4II7 A;  1ODV A;  1NYY A;  2BTF P;  1UWN X;  2M7U A;  4JXW A;  3LR4 A;  2W0N A;  5I94 A;  3DWZ A;  1ZHH B;  3IH9 A;  3T4K A;  1NZU A;  4Y0O A;  5J4E A;  4Y7P A;  4RX3 A;  4IED A;  4C6Y A;  3VOZ A;  3OPR A;  1NZO A;  1FR1 A;  1S0W A;  2Z2M B;  4LCM A;  1FSY A;  4GOG A;  1SHV A;  2ZQ7 A;  2H0Y A;  5EVI D;  2FFF B;  4IJG A;  4LFU A;  5DF7 A;  4E3K A;  5GLD A;  1KDS A;  4GD6 A;  3VSK A;  1FCN A;  4JF5 A;  3KYZ A;  1DJC A;  4JXS A;  3F1N B;  4GS9 B;  4EBN A;  3ZVW A;  3W8K A;  4E3L A;  4RYE A;  4EXO A;  3MQ0 A;  3VV4 A;  2JBF A;  4G3K A;  1YM1 A;  3G35 A;  4L0L A;  3C38 A;  4F3L A;  1ZG4 A;  1KGG A;  4NXE A;  4I3I A;  4M3K A;  1I5Q A;  3ZDJ A;  1V9Z A;  3ZFZ A;  2VV6 A;  1XPB A;  3BM6 A;  3ZNT A;  4BD0 A;  5M18 A;  1ONG A;  4ARZ A;  4JGQ A;  2O9A A;  4LCL A;  1K55 A;  4Y3I A;  1FQG A;  1IYO A;  1DP8 A;  3ZHH A;  3E4P A;  3VP2 A;  4HY8 A;  3VE3 A;  1CEF A;  1NWZ A;  3IBJ A;  3VP3 A;  4S2L A;  4BEN A;  1K56 A;  2P9V A;  4ZJ2 A;  3HUM A;  3KSF A;  4HQA A;  2G7U A;  3QP1 A;  2X02 A;  4DXB A;  3IX4 A;  4KZ8 A;  4CPK A;  3IHB A;  2JKG A;  1N9L A;  1ZG6 A;  2PU2 A;  1KDW A;  3O3V A;  3ZYT A;  3C7V A;  1TD5 A;  4KZ7 A;  5HL6 A;  1ES4 A;  1NY0 A;  2W27 A;  3RTY A;  2XFT A;  1NYM A;  3KSH A;  1LSV A;  2A24 B;  1XP4 A;  2JKF A;  2ZC3 B;  3E98 A;  4MBF A;  1E25 A;  1TS6 A;  3G2Z A;  5EVL A;  4O7D A;  5EEC A;  3ZG0 A;  4EES A;  1IEM A;  2V20 A;  1HZO A;  4P85 A;  1ES3 A;  5GHX A;  3DTK A;  3C4P A;  2XLN A;  4O8G A;  3T1Q B;  3SH7 A;  1MBL A;  2PYR A;  3IWI A;  1RCJ A;  2D02 A;  3LR3 A;  4HP9 A;  1PIO A;  3V3R A;  1MWS A;  3Q07 A;  1OT9 A;  2PD7 A;  5F1G A;  3IF5 A;  1HD8 A;  2Y2M A;  3BFE A;  3OC2 A;  5CED A;  4HEF A;  4ZBE A;  1TS0 A;  3RFB A;  1BSG A;  2Q9N A;  5EVI C;  2ZQA A;  3A3E A;  3T4L A;  3SH9 A;  1NJ4 A;  1YLW A;  5HDD A;  3MFX A;  3V39 A;  4GDB A;  3KSI A;  2V1B A;  4DE0 A;  1I2S A;  4E3N A;  3S1Y A;  3O5Y A;  2FZ0 A;  3S22 A;  2JKR I;  3NOU C;  4N1H A;  5CRF A;  4PAU A;  2YKH A;  2OWJ A;  3BEC A;  3LIE A;  4KUK A;  1MWU A;  3N4I A;  3VP4 A;  4NG2 A;  2PD8 A;  2HGV A;  2EX2 A;  5EV0 A;  2EXA A;  3OZH A;  2ZOH A;  3OCN A;  3BLM A;  3RH8 B;  2V9A A;  2INW A;  5CHJ A;  4GB7 A;  2IWC A;  3ZGA B;  4NKP A;  3LEZ A;  3E2K A;  4WEK A;  1YKD A;  4KQO A;  2WKP A;  4Q0H A;  4OQH A;  3T4S A;  2FFY A;  3IS2 A;  4S2J A;  2MJ6 A;  4IHQ A;  5TBM A;  1N4O A;  4DE1 A;  2P04 A;  4JBF A;  5U47 A;  2PR5 A;  4OP5 A;  2VJW A;  2PRF A;  4S2N C;  3WS5 A;  3HLF A;  2DCF A;  5E2H A;  4PM9 A;  4F3L B;  4UQI S; 
#chains in the Genus database with same CATH homology
 4I38 A;  3NJA A;  5DKK A;  2QHK A;  3F1N A;  3T4T A;  1DP9 A;  5HWV A;  1F5M A;  1LL8 A;  4PHT A;  5CX7 A;  3EGD C;  2L1M A;  4ARZ B;  4MCW A;  3KX0 X;  3CAX A;  5HWW A;  3LIB A;  1OTI A;  4GLQ A;  5I5L A;  2XA7 S;  2V0W A;  2QYB A;  2A2L A;  4HI4 A;  1XJ6 A;  3OBF A;  4PKY G;  3F1P A;  1S1Y A;  5J3W A;  4CQH A;  2KX6 A;  4LLO B;  3F1O B;  2L4R A;  4L9E A;  4ETZ A;  2W3F A;  3H82 A;  1NRJ A;  4NXG A;  2IA2 A;  2VGL M;  3PBT A;  4EQ1 A;  4XT2 A;  2KDK A;  5F69 A;  2Y79 A;  2W3D A;  3R7W B;  5HDC A;  3UB7 A;  5DF9 A;  3OLO A;  5TBM B;  3W2Z A;  4EUV A;  3EEA A;  3EQV A;  3LIF A;  1NLY A;  5DJT A;  3UME A;  2QWS A;  4OOM A;  4WEL A;  2EWW A;  3MXQ A;  4Y5F A;  3T4Q A;  4WUJ A;  3C30 A;  1S1Z A;  4HOI A;  4PKY A;  4MMN A;  2CMN A;  4I5S A;  3MR0 A;  2HJE A;  2J3T D;  3A0R A;  1OJG A;  1S67 L;  3UE3 A;  2W1T A;  4BBV A;  2BAS A;  5DJU A;  3LR0 A;  4BBT A;  1WA9 A;  4CLC D;  1UWP X;  5DFX A;  1G6O A;  5DKL A;  2WKR A;  2EWV A;  2A24 A;  1W63 M;  4WN5 A;  1EW0 A;  2JHE A;  3CUE A;  3NOT C;  3VOL A;  2Z6C A;  1D7E A;  2J80 A;  3F1P B;  3HJI A;  4I3J A;  4ETX A;  3OCL A;  3D72 A;  4MN5 A;  4EU0 A;  4LPZ A;  4NXF A;  4G3V A;  2VX8 A;  1GSV A;  4L9G A;  2JN7 A;  2GNX A;  4Y2F A;  5FL3 A;  4EW7 A;  5IT5 A;  4YNR A;  1P9R A;  4CLC E;  3E4Q A;  4MN7 A;  5G4Z A;  1S66 L;  2W3H A;  5A8B A;  2ZMF A;  4CLC B;  2NUT C;  2O0Y A;  3PR6 A;  3LR5 A;  3BW6 A;  2HV1 A;  4GHI A;  3NOP C;  4GJ4 A;  4WEJ A;  2KOI A;  3CLO A;  1YSP A;  4HH3 A;  1P9W A;  1XFQ A;  4LRZ E;  5C5K A;  1S4S A;  4EEP A;  3A0S A;  4HNB A;  4MN6 A;  3K3D A;  4ZRR A;  3D3O A;  3NHQ A;  1OJ5 A;  3T4O A;  4Q0I A;  2W1T B;  3LUQ A;  1DP6 A;  4R3A A;  3TRC A;  1BYW A;  2PR6 A;  1LSW A;  5J7E A;  3H7W A;  5HD5 A;  2ZBB A;  1YAX A;  3MJQ A;  4P6Z S;  4GS9 A;  4UQI M;  5HPI A;  3C8C A;  3S7O A;  1T19 A;  3JVU A;  2EA9 A;  4HHD A;  5HSQ A;  1LT0 A;  3OOV A;  3UB6 A;  2YKF A;  3BQ8 A;  1ODV A;  4II7 A;  3EOI A;  3PBR A;  1UWN X;  1TS7 A;  2M7U A;  2QJ7 A;  3LR4 A;  3R4K A;  2W0N A;  3FPW A;  1ZHH B;  3TJZ C;  5KIZ A;  4RQ9 A;  3T4K A;  2J3W A;  4YOF A;  5J4E A;  2XA7 M;  4WF0 A;  4I3A A;  2OWH A;  1OTA A;  1TS8 A;  3BWL A;  3T4J A;  3PXP A;  4H6J A;  2OAQ 1;  2D01 A;  3IS2 B;  3KO6 A;  4I39 A;  2GZA A;  2W1R A;  1XJ2 A;  2M1C A;  4DN0 A;  2ZOI A;  3B33 A;  4IJG A;  3ZQ5 A;  2Y8H A;  3B42 A;  4AFI A;  4HH2 A;  4GW9 A;  4DMZ A;  1TF1 A;  2B18 A;  2V1A A;  4R70 A;  5DFY A;  3KYZ A;  4O0P A;  1IFQ A;  1OTD A;  2O9B A;  4M4X A;  3F1N B;  1ZTU A;  4UEY A;  1LSX A;  5IS1 A;  4GS9 B;  1GSX A;  3UB8 A;  4QPR A;  4DJ3 A;  4EXO A;  3PBS A;  1OTE A;  3H9W A;  3MQ0 A;  3VV4 A;  3EQU A;  4YWZ A;  4G3K A;  3FG8 A;  2VZW A;  3B47 A;  5G4Y A;  3E4O A;  4L0L A;  2H28 A;  3C38 A;  4JGP A;  4F3L A;  1G28 A;  3LI9 A;  4NXE A;  5AVF A;  4I3I A;  3BQA A;  4FOF A;  2J3T C;  2JKR M;  4L9F A;  3E0Y A;  4BBU A;  2XRO A;  4EEU A;  1V9Z A;  3P01 A;  3KSG A;  2VV6 A;  4BJP A;  5HD3 A;  5HDS A;  4EER A;  1OPX A;  3H82 B;  4CLC C;  3CI6 A;  4ARZ A;  4EET B;  4JGQ A;  4XT2 B;  1VB6 A;  2O9A A;  2OAP 1;  1T1B A;  4Y3I A;  3PHY A;  1DP8 A;  4HP4 A;  3E4P A;  1H3Q A;  4HY8 A;  4ME4 A;  3VE3 A;  3K3C A;  1NWZ A;  4IUK A;  3HJK A;  3IBJ A;  3S7P A;  1Y28 A;  2W3E A;  3KSF A;  4Q0J A;  4HQA A;  3JVV A;  2G7U A;  2PYP A;  4KQD A;  2HJ9 C;  1D06 A;  4O01 A;  3HCY A;  2W3G A;  1T18 A;  3A0V A;  2K7S A;  4BWI A;  3G6O A;  1N9L A;  3LYX A;  5MC7 A;  1XFN A;  3MMH A;  3ZYT A;  5F68 A;  3R7W A;  1UGU A;  1P0Z A;  3ULF A;  1TD5 A;  5HL6 A;  4R38 A;  1MZU A;  4E04 A;  1F98 A;  2W27 A;  3FPV A;  3RTY A;  2Z6D A;  1DRM A;  3KSH A;  1LSV A;  4R6L A;  2A24 B;  3P7N A;  2GX5 A;  2M7V A;  1X0O A;  4P6Z M;  3PBN A;  1T1C A;  4B93 A;  3E98 A;  2JKT M;  1TS6 A;  2PHY A;  4EES A;  2VKS A;  5KSH A;  1MKM A;  2WKQ A;  3IBR A;  2R78 A;  1N9O A;  2HF6 A;  4O8G A;  4G3W A;  3K2N A;  5HPF A;  5K5B A;  2FH5 A;  2L0W A;  4NXB A;  1IOU A;  2PYR A;  1S4R A;  2V0U A;  2D02 A;  1NLZ A;  2O99 A;  4GHI B;  1GSW A;  2VA0 A;  3PBO A;  2VGL S;  3LR3 A;  4HP9 A;  3T50 A;  4B9O A;  4LRX C;  3TE8 A;  1OT6 A;  4LRY C;  1OT9 A;  2PD7 A;  3UB9 A;  3BJN A;  3EEH A;  3PYP A;  3OC2 A;  5L8M A;  3BY9 A;  3BY8 A;  3EWK A;  5AVE A;  3LFV A;  3LID A;  5HZH A;  1TS0 A;  3H7W B;  4CLC A;  3RFB A;  3EGX C;  1T1A A;  5HWT A;  3DBA A;  3T4L A;  3LI8 A;  1F9I A;  5F6A A;  2KLI A;  5HDD A;  3MFX A;  3KSI A;  4DJ2 A;  1N9N A;  2V1B A;  2PT7 A;  4BMW A;  4OOL A;  3MQO A;  3S7Q A;  3O5Y A;  2FZ0 A;  4WL9 A;  2JKR I;  3NOU C;  3GEC A;  2LB5 A;  5AJG A;  4NEE D;  2P7J A;  4PAU A;  4WLA A;  5F5Y A;  1XJ3 A;  2YKH A;  2VV7 A;  3GDI A;  1H8M A;  2OWJ A;  4IUH A;  3SW1 A;  2ZMV A;  3TW8 A;  3LIE A;  4HJ6 A;  2DMW A;  4KUK A;  3U2A A;  4H6J B;  4MDZ A;  4KUO A;  3LIC A;  1P97 A;  5LBR A;  3LIA A;  4FSF A;  2PD8 A;  3MF0 A;  4JGR A;  2HGV A;  3UE6 A;  2K31 A;  4Z1W A;  1YSQ A;  2O9C A;  2ZOH A;  1STZ A;  3OCN A;  3RH8 B;  2V9A A;  2XSS A;  3ICY A;  3KYQ A;  3F1O A;  2VLG A;  2I9V A;  3C2W A;  2INW A;  5IU1 A;  2QJ5 A;  4HJ3 A;  4NKP A;  4HJ4 A;  2B02 A;  1V9Y A;  4WEK A;  1YKD A;  1XJ4 A;  2OOL A;  3CWF A;  4KQO A;  5EFW A;  2XRN A;  1VHM A;  3UMD A;  3V67 A;  2WKP A;  4Q0H A;  2P08 A;  1KOU A;  3S7N A;  1W63 Q;  3T4S A;  5TJJ A;  2VEA A;  3IS2 A;  2MJ6 A;  3VE4 A;  2NUP C;  4IHQ A;  5TBM A;  1MC0 A;  2P04 A;  1JNU A;  3CUE C;  3CIT A;  2PR5 A;  2LB9 A;  4HIA A;  3PBQ A;  2VJW A;  4K08 A;  2QKP A;  1OTB A;  2JKT I;  3FC7 A;  4GCZ A;  4F3L B;  2VV8 A;  4JGO A;  3MQQ A;  2PDR A;  2GJ3 A;  4UQI S;  2K2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...