5HD5A

Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein: 200 ns time delay photo-activated (light) structure
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
124
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 33
structure length 124
sequence length 125
ec nomenclature
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hd5A00
5AVFA 4LPZA 2YKFA 1S1ZA 5HWTA 4HHDA 5HDSA 2ZOIA 2V0WA 3FC7A 4HY8A 3UB7A 4HJ4A 3VE4A 4L9GA 1F98A 3VE3A 4KQDA 2V1BA 2J80A 1WA9A 1MZUA 2VV8A 1S4SA 3MJQA 3MFXA 3IBRA 5DJUA 2PD8A 3G6OA 2HV1A 4GHIB 3F1NB 2KDKA 1UGUA 2PDRA 5F68A 4WUJA 4I38A 4HP9A 2VV7A 2M1CA 5HWWA 5TBMA 1S67L 5AVEA 1D06A 3H82A 3K3CA 1DP9A 3KX0X 1T19A 4MN6A 4JGPA 1G28A 1XJ6A 1VB6A 1N9OA 4GCZA 3B33A 3H7WA 2QJ5A 3BY8A 1OTAA 2A24A 4LRYC 5IU1A 4L9FA 3HJIA 4I3JA 2PD7A 2PHYA 2D02A 1LSXA 2WKPA 2PYRA 3H9WA 5G4ZA 1OJGA 4LLOB 3F1OA 3VOLA 1OT9A 5HD5A 5TBMB 2YKHA 5J3WA 3LYXA 3H82B 3C8CA 3PYPA 5F5YA 1NWZA 4HNBA 2R78A 1T1BA 3RH8B 2CMNA 4WL9A 2EA9A 4GW9A 3UE6A 4XT2A 3LUQA 4KUKA 4EETB 3UMEA 1DRMA 2PR6A 3E4OA 1DP6A 2D01A 4HJ3A 1T1CA 1LT0A 1UWNX 4HJ6A 1OJ5A 2A24B 4NXGA 1N9NA 4EEUA 4I3IA 4B9OA 4H6JA 4DJ3A 3E4QA 2VLGA 1P0ZA 2VV6A 1D7EA 3F1PB 1BYWA 5F6AA 1OTDA 3F1OB 3EEHA 3IS2A 1GSXA 3NOPC 3NOTC 2WKRA 1S1YA 2JN7A 3CWFA 4I39A 3BWLA 4R6LA 2B02A 3D72A 3LIDA 2GJ3A 5G4YA 4GS9B 4EERA 4XT2B 3GECA 3E4PA 1T18A 1DP8A 1P97A 3OLOA 2L4RA 3UB6A 3UB8A 3K3DA 4R70A 1TS8A 4H6JB 1LSVA 1XJ3A 1S4RA 3PHYA 2OOLA 4DJ2A 2JHEA 2V0UA 4F3LA 3LICA 3LIEA 4NXFA 4L9EA 4BBVA 4I3AA 4R38A 4E04A 3FG8A 4YWZA 5DJTA 3MQQA 3NJAA 3IS2B 3HJKA 1Y28A 1ODVA 2BASA 3LIBA 3A0VA 1GSVA 5A8BA 4HOIA 4BBTA 1UWPX 4EW7A 3MXQA 2Z6DA 1V9YA 5J7EA 3BY9A 4HI4A 2W27A 4KUOA 3LIFA 2PR5A 4JGQA 2PYPA 2QKPA 4LRXC 1XFNA 3A0RA 3NOUC 3C2WA 2K7SA 5EFWA 4M4XA 4HH3A 4F3LB 3H7WB 3P7NA 2KX6A 4EXOA 1OTEA 3EWKA 3ICYA 4R3AA 4HH2A 5J4EA 3ZQ5A 3UMDA 1XJ4A 3NHQA 5KIZA 1TS0A 4WLAA 3GDIA 4HP4A 5IS1A 2ZOHA 2Z6CA 4WF0A 1OT6A 4JGRA 4MN5A 5DKLA 3CAXA 2V9AA 3A0SA 1XJ2A 1OTIA 1OTBA 3MQOA 2I9VA 3SW1A 3RTYA 4LRZE 2WKQA 1LL8A 4HQAA 1LSWA 5HZHA 3T50A 2W0NA 1N9LA 2INWA 2L0WA 3CLOA 2QJ7A 4HIAA 5I5LA 5F69A 5HDCA 4PKYA 1TS6A 1XFQA 4RQ9A 4JGOA 4PKYG 4EEPA 1GSWA 3MR0A 1V9ZA 1S66L 2L1MA 1JNUA 4NXEA 2QHKA 2QWSA 1KOUA 4I5SA 1X0OA 1TS7A 1F9IA 5HD3A 1T1AA 4NXBA 4BBUA 3ULFA 4K08A 3F1PA 4GHIA 5HDDA 3F1NA 2V1AA 5HSQA 4WN5A 3UB9A 4EQ1A 5DKKA 1EW0A 3LIAA 2VEAA 2P7JA 2OWJA 3LI8A 2OWHA 4EESA 2ZBBA 2H28A 5HWVA 3LI9A 4GS9A
chains in the Genus database with same CATH superfamily
5CGSA 5AVFA 4E6WA 1SDNA 2YKFA 5CERA 1NJ4A 2AVXA 3C7VA 3Q82A 2V0WA 3E2KA 3NC8A 3UB7A 2WAEA 1W63Q 4UA6A 2P9VA 4L9GA 3S4XA 3UDFA 3HUOA 2Y2LA 2V1BA 1MZUA 1YKDA 3KO6A 4LV1A 4OH0A 3MFXA 2BTFP 2WK0A 4XUXA 2PD8A 5FDSA 4GZBA 4OOYA 3B3XA 4GHIB 3F1NB 1VEUA 5BOHA 2ZC5B 1BT5A 3LR0A 4QY6A 3R4KA 2VGLS 1LHYA 3T4QA 3IF6A 4EBLA 3IX3A 4CJNA 3IX4A 4ZBEA 1DP9A 1T19A 2WGWB 2O9BA 1FCMA 1XJ6A 4OP5A 4DDSA 1ZTUA 3HLCA 3BW6A 5DF8A 3PBNA 2JKTI 2G7UA 2W3FA 3H7WA 3N4IA 3FPVA 1MC0A 2A24A 2MJ6A 2VX8A 4EUVA 4X68A 3HJIA 5E2GA 2PD7A 1FIKA 2PHYA 2Y2GA 3U4LP 4OOMA 3WS0A 4NEED 5AJGA 3F1OA 3HLEA 5GHYA 5TBMB 2OLUA 4YINA 3AGFA 2YKHA 5J3WA 4O01A 5I94A 3GMWA 1K4FA 3PR6A 4IJGA 1NWZA 2ZQCA 4RA7A 2R78A 1TDLA 1CI9A 2CMNA 4HEFA 2M7UA 1YLYA 1FQGA 1DRMA 3E4OA 3EGDC 3FKVA 1DP6A 1TEMA 1LT0A 1UWNX 2VKSA 1OJ5A 1PIOA 3NI9A 2PU2A 5GLDA 3OPLA 4R4RA 4X25A 1XGJA 3E4QA 5HX9A 2VV6A 1L0EA 4OOLA 1CJFA 2FZ0A 1D7EA 3F1PB 2B95A 1K54C 1KVLA 1GSXA 3NOPC 3D3OA 3QHYA 3OBFA 3IXHA 2V1ZA 1JWPA 2W1RA 4JF6A 5IHVA 1C3BA 1PI4A 4LV2A 2JN7A 2P04A 3ZG7B 3BWLA 2B02A 3D72A 4OPZA 3PBOA 3BRMA 4X1LA 1IKGA 3ZCZA 4ZDXA 4Y0TA 2ZQ7A 3NY4A 3P98A 4CLCA 3ZYTA 2PBYA 1KE0A 1BLHA 3DTIA 2L4RA 3UB8A 4FTXA 1JVJA 2ZC4B 4CLCD 1RCJA 3ZG0A 1TF1A 4DE2A 2HJ9C 3EQUA 4NXFA 3LIEA 4KZ4A 4L9EA 5FI2A 4ZRRA 2ZM2A 4Z1WA 2ZM0A 4FSFA 2UV0E 3P09A 4S2OA 1L0GA 1ODVA 3BFCA 2XF3A 1M6KA 4QPRA 3T1SA 1K55C 2RCXA 4Q8IA 5A8BA 3HUMA 3QP5A 4FUWA 4BENA 4S2NA 4OPRA 3MZFA 5L10A 2Y55A 1FILA 5J7EA 3BY9A 3KSFA 2VZWA 1XA1A 3DTMA 4OPYA 3ITAA 2PYPA 2LB5A 4Y0OA 3G34A 5FDHA 1YSPA 1XFNA 2JKRI 5F83A 2PAVP 4H8RA 3SOIA 4X55A 3P7NA 1BLPA 1DY6A 2HP5A 1YLZA 3CI6A 1MKMA 3WRZA 1LLBA 2XLNA 4R3AA 3EEAA 4GN2A 3HL9A 1PRQA 4HH2A 4JXSA 1PW1A 5K5BA 1YMSA 4ARZA 3DBAA 2A3UA 5EE8A 3VSKA 5AQ7A 3GDIA 5IS1A 3UPPA 2ZOHA 3SS4A 4S2LA 1W7FA 3TE8A 3OC2A 3W4QA 4QU3A 3QNCA 1F5MA 1HLUP 1NY0A 5FQQA 2C6WB 4N92A 2EFXA 1ALQA 4E3LA 4Z9QA 1OTIA 4YOFA 3MQOA 2IWBA 3SW1A 5FASA 4LRZE 1K6RA 2WKQA 3A3DA 4ZJ1A 2J3TD 4LV3A 5KSHA 2ZC7A 2W0NA 4Y15A 3V39A 3CLOA 2VGJA 2VGLM 4HIAA 3IXDA 4E3KA 3MKEA 3DTEA 4R4SA 5J8XA 4U3TA 3HLBA 1K57C 3RJUA 2H0TA 2E8IA 1CQAA 4JGOA 4CQHA 2Y2HA 2UWXA 4BWIA 1XXMA 3UO9A 3M2KA 3IF6C 4QWOA 3N8SA 4M3KA 1H0MA 2EWWA 4QD4A 3MS6A 2GNXA 1PWCA 1KOUA 1TS7A 1F2KA 2VK3A 4IVIA 3OCNA 3F1PA 1MWSA 5HDDA 3W4OA 3NBLA 1I5QA 3ZVTA 3JVVA 1CEFA 1G6OA 3S22A 1ZHHB 3ZNTA 2VEAA 4NG2A 3VP4A 3T4KA 2WKIA 5GHZA 4BMWA 3A3JA 2LB9A 5HWVA 1WYBA 2V0UA 4Q0HA 3G31A 2DCFA 4KENB 2DRWA 1KE3A 5HWTA 1H8YA 5HDSA 3FC7A 4HY8A 3G32A 4HJ4A 4IBRA 3VE3A 1CF0A 5CTNA 3GR2A 4NKPA 3UPOA 1WA9A 4LGWA 3MJQA 3V50A 1L0DA 5E2EA 2HV1A 1MKIA 1TD5A 4E3OA 1ES3A 3CPTA 1EWZA 4FOFA 2DNSA 1SDEA 1DJBA 3QP2A 2VV7A 4OKPA 2HGVA 2WAFA 4S2MA 3H82A 4B4ZA 3FYZA 3NCKA 4R1GA 1K6SA 3S7QA 1NYYA 2X02A 3LR4A 3T4OA 3NULA 4N9KA 5GHXA 4MDZA 2DMWA 1HVBA 1VETA 2K2NA 3NECA 4Y3IA 4LCLA 3B33A 1L2SA 3N6IA 4QB8A 4CLCC 5HL6A 2V8FA 4IUKA 1JTDA 4L9FA 4S2KA 5TJJA 4I3JA 2BLSA 3K2NA 1XP4A 2PU4A 2D02A 1G68A 1BSGA 3NDGA 4B4XA 1YQSA 1LI9A 1BTLA 1GHIA 3KSIA 4DRTA 4KQQA 2IWCA 3OPHA 4JF4A 4YFMA 5GLBA 1K56D 1AWIA 4LFUA 5D3OA 3G2ZA 2JCHA 2M7VA 4PAUA 4CPKA 3C8CA 1MY8A 4OONA 1T1BA 4E3JA 3MZDA 1J3WA 4NK3A 3UE6A 3G35A 4IEDA 3LUQA 3C5AA 3GSGA 3IX8A 2ZD8A 3MBZA 4HJ3A 3T1RA 5DFXA 3UY6A 1T1CA 3CHWP 4O8GA 5CHUA 2Z2MB 2Q0OA 4S2PA 1N9NA 5E43A 4I3IA 3MQ0A 4HESA 2ZQDA 1PI5A 1IELA 1Q2QA 3FWLA 2ZC6B 4FH2A 1P0ZA 3IHBA 3L7HA 3T1QB 4D2OA 2WGIA 2VGKA 3QP1A 1FSYA 4U0TA 3JVUA 2EX8A 3BFDA 1OTDA 2JKTM 3IS2A 4NETA 4WELA 5EVEA 1GCEA 5FQ9A 2ZMVA 4I39A 3Q7VB 1W8YA 2HZ5A 4R6LA 5EM0A 5EVIA 5LBRA 5AQ9A 1OMEA 5FSRA 5FQJA 1U60A 4XT2B 1I2WA 1SKOA 3C7UA 5EVID 4MLLA 1MXOA 3E4PA 4G3WA 1KGFA 4WZ5A 4GKUA 3IBJA 1P97A 3OLOA 4KZ7A 1Q2PA 3UB6A 3K3DA 4R70A 3V67A 1TS8A 3IF5A 4F94A 1EROA 2O0YA 4H6JB 3WS2A 1LSVA 1PZOA 1S4RA 1XJ3A 4MBHA 2QZ6A 3AGDA 5L07A 2J3TC 2J9PA 5EPHA 4GLQA 2HJEA 3LICA 3QP4A 1XPBA 4I3AA 3M2JA 4P87A 4E04A 4YWZA 5M1AA 3ZG9B 3HJKA 3O87A 1BZAA 1PFLA 4DXBA 5FAOA 4OP8A 4MBFA 3Q81A 1L0FA 3MMHA 1PWGA 4ESPA 2Z6DA 2ZMFA 1MPLA 4LV0A 1V9YA 3PBRA 4BJPA 1PWDA 3WS1A 1DJCA 2W27A 2IWDA 4GDNA 3DAVA 4K0WA 4UEYA 4G3KA 2HDRA 4LRXC 2WKEA 3NOUC 2W3HA 3W2ZA 2K7SA 3OCLA 2Y2JA 5EFWA 2XFTA 5GL9A 3G4PA 4M4XA 4F3LB 3DW0A 2W1TB 2KX6A 2ZQ8A 3ZG5A 3BM6A 4EXOA 1OTEA 2G2WA 3O86A 5J4EA 4MN7A 4KQRA 1XA7A 3UMDA 5EV0A 4CLCE 4IHQA 2BG1A 4DDYA 1TDGA 5L09A 4S2IA 2Y2MA 2XQZA 1TS0A 4HP4A 1NZOA 3MSHA 3IH9A 5CXWA 1ZG4A 4WF0A 1OT6A 4ID4A 4C6YA 1YLPA 3EGXC 3IH8A 5DKLA 3IXGA 3CAXA 1MWUA 1YLJA 3A0SA 4EBNA 4B93A 2PBDP 1HD8A 3UB5P 4IVKA 1OTBA 3UE3A 3RTYA 4MBKA 1LL8A 3T4JA 5HZHA 3ZGAB 4DXCA 3R7WA 3LO7A 5U47A 4R0QA 3KSHA 1N9LA 4WZ4A 1O7EA 2ZQ9A 5I5LA 5F69A 3HLDA 1QMEA 5HDCA 2JKRM 4PKYA 1A0KA 1TS6A 3TJZC 1GSWA 2HDSA 3MR0A 3BQ8A 3CUEA 3IT9A 2ZM8A 5DTTA 5C5KA 2HP6A 4RYEA 2L1MA 2JKGA 5CTMA 2QWSA 3FPWA 4X69A 5FQMA 4UHUA 3TSGA 1P9WA 4O7DA 3TW8A 1KDSA 3UE1A 4WEJA 3BEBA 3E2LA 3PBTA 3MXRA 3O88A 4GHIA 3N8LA 3F1NA 3HLWA 1NXYA 2KOIA 5HSQA 4WN5A 3UB9A 2JKFA 4PPRA 5DKKA 4EQ1A 1WYCA 2ACGA 4LCMA 3OPRA 2OAQ1 1NYMA 4P6ZM 1BUEA 2P7JA 2XROA 2OWJA 2OWHA 1LI0A 2ZBBA 2K31A 3BYDA 3LI9A 1ERQA 3VFFA 4LPZA 4HBTA 1S1ZA 4Y2FA 4ETXA 3N8RA 1SHVA 2EX2A 4HHDA 2WGWA 2ZQAA 1H8ZA 3CMZA 5KZHA 5G18A 3M6HA 4KZ6A 3HBRA 2XRNA 1F98A 3C4PA 4FCFA 5DTSA 1GHPA 3DWZA 2Y2KA 4OLGA 2VV8A 1S4SA 2Y4AA 4D60A 3SH8A 3IBRA 2Z2LB 5DJUA 1KVMA 3G6OA 1G6AA 2Y91A 3IWOA 1N9BA 2KDKA 1ESUA 2NUPC 1UGUA 4OPQA 2PDRA 3P01A 4JLFA 2Y59A 4OLDA 4WUJA 5FAPA 1YAXA 1ESIA 2J8YA 3D9YA 3Q07A 5TBMA 4Q0IA 1E3UA 2JBFA 3LY4A 5AVEA 1D06A 3K3CA 3KX0X 3ITBA 3MFDA 1CEGA 1G28A 1E3UD 1CK3A 5EVIC 1BLCA 4EWFA 5A93A 1N9OA 2WUQA 2QYBA 4BL3A 1FCNA 5FAQA 2QJ5A 2G2UA 3BY8A 1OTAA 4GNUA 4QY5A 3JPUA 5IU1A 3ZVWA 5CEBA 4GJ4A 5IT5A 4II7A 1VEUB 3DWKA 4WZ5C 3T4LA 1W8QA 2O9AA 1LSXA 2WKPA 5AQAA 3LY3A 2PYRA 3GVBA 5G4ZA 1NZUA 1OJGA 2XA7S 1G5UA 1QMFA 1SKFA 1OT9A 5HD5A 1YLTA 2OLVA 2J9OA 2WADA 3BECA 3LEQA 3IF6B 3QP8A 3UPNA 2X01A 3LYXA 3PYPA 2WGVA 3QNBA 4OQHA 4UQIS 5F5YA 3IWIA 4N9LA 1H8MA 4HNBA 4PM9A 5KSCA 3ZHHA 2WYXA 4EU0A 1PNEA 3RH8B 2JC7A 5JYOA 4WL9A 4GW9A 2Q9MA 1HZOA 4OQIA 2A49A 4KUKA 5F1GA 3A3EA 4EETB 3UMEA 4XXRA 4UA9A 4DN0A 1D1JA 1K54A 3M6BA 4HJ6A 1IYSA 1W63M 2B18A 2A24B 3HVFA 4JXVA 4EEUA 4B9OA 4DF6A 2IA2A 3CZDA 4QHCA 3TRCA 4DJ3A 3IXBA 3VV4A 3GRJA 2VLGA 2ZL1B 1GHMA 5FI7A 5TR7A 5F6AA 3F1OB 4KZ5A 3NOTC 1FSWA 1S1YA 3T4TA 2WZXA 5DVAA 2GJ3A 4EV4A 2WKHA 5G4YA 4GS9B 1Z09A 3VOYA 5FEFA 4KZAA 1RGZA 4Y7PA 3BFFA 2X71A 3Q7ZA 1K55A 4ZJ3A 3IWQA 3VMAA 1ACFA 3GQZA 1NRFA 4C3QA 4KZ3A 1ZC2A 5DJTA 4DE3A 3MQQA 3NJAA 1FR6A 1ES5A 4PM8A 2BASA 4WYYA 4JF5A 5FEGA 3IHAA 4WBGA 4HOIA 4BBTA 1UWPX 4EW7A 1J9MA 3HREA 3PXPA 3MKFA 2V20A 1K38A 1E4DA 4P0MA 2H0YA 4CLCB 2EXAA 4KUOA 3AGEA 3LIFA 4JGQA 3CUEC 3C30A 2GDNA 3ZDJA 4S2NC 4ME4A 1IFQA 1RP5A 4UAAA 4HH3A 2GX5A 1IKIA 5FL3A 1H5XA 5HFOA 1K4EA 3G30A 1DJAA 5L8MA 4O0PA 3OPPA 4FD8A 4ETZA 5CECA 1GA0A 1XJ4A 2E8JA 4KG2A 4R3JA 3T12B 5FQIA 3LGOA 3W4PA 3B42A 3RFBA 3G2YA 3NHQA 5KIZA 4WLAA 4MCWA 5FQKA 3U2AA 1LL5A 4JGRA 3T4SA 4GD8A 2NUTC 5A92A 4IBXA 2ZJ9A 3LR5A 1XJ2A 1K57A 2OSUA 2HF6A 2W3DA 4A5RA 4HQAA 4FH4A 4BQMA 5HAPA 2L0WA 3I7JA 5MC7A 5F1FA 1W5DA 3VOZA 4ARZB 5HL1A 1CI8A 3SS5A 1IOUA 3NDEA 4RQ9A 1FOFA 3Q1FA 4PKYG 2EXBA 3UE0A 3VFHA 5FA7A 1NRJA 4MNRA 3D4FA 1V9ZA 1S66L 1W79A 1OPXA 1MWTA 2Y2QA 4LENA 2P74A 1JNUA 2QHKA 2ZMAA 2ZLYA 4WMCA 4I5SA 3UDIA 2ZL1A 3OZHA 3PAEA 3E0YA 2ZC3B 2RL3A 1T1AA 4BBUA 3ULFA 2WZZA 4K08A 1JWVA 3WWXA 4WMCD 2V1AA 5E2HA 2HDUA 2PT7A 1EW0A 2XA7M 4PM6A 3A3IA 1O07A 3VP1A 4EBPA 5CX7A 1PYYA 3LCEA 3KYQA 4GS9A 4UQIM 3CJMA 4GDBA 2XK1A 3HLGA 2XGNA 2OV5A 3QP6A 3S7OA 5HPIA 1MBLA 2ZOIA 3BFGA 3MF0A 3VE4A 5EOEA 2OAP1 1GA9A 1M40A 4KQDA 3VP0A 2J80A 3FZCA 2H10A 4BL2A 3EOIA 1XKZA 3PTEA 1VQQA 2FFFB 2R9WA 2W3EA 1P9RA 4X56A 1RGYA 5DF9A 5E2FA 2EWVA 4DMZA 5F68A 2GZAA 4DE1A 4X6TA 4GD6A 2EX6A 4I38A 4HP9A 5A91A 5HARA 2M1CA 5HWWA 4XUZA 1S67L 5EVLA 3GTCA 4YNRA 2JE5A 2XD1A 1BLSA 1PZPA 5GLCA 2XD5A 4MN6A 2O9CA 2Y2IA 4JGPA 4BD0A 4KQOA 3KSGA 1JWZA 1VB6A 5L2FA 4JKTA 2V8CA 4GCZA 3HUNA 1NLYA 5KMWA 3VP2A 4OQGA 2J7VA 4K91A 4Y17A 4LRYC 3OOVA 4RX2A 1KE4A 3SH9A 1KGGA 4ZAMA 3CPTB 4MMNA 2FH5A 3H9WA 3BJNA 4N1XA 3TG9A 4LLOB 4L0LA 3VOLA 3CITA 3JYIA 4PM5A 1STZA 2Y8HA 1YLWA 3FKWA 3RXXA 4G3VA 3H82B 3Q7VA 5M19A 1ES2A 1VHMA 1MWRA 5CHMA 4E3NA 4GOGA 3IQAA 1Y4OA 2A2LA 2EA9A 2Y79A 3B47A 4XT2A 1VETB 3KYZA 5FATA 4X1MA 4WEKA 2PR6A 4UA7A 4DKIA 2B5RA 2D01A 4ZTKA 3N7WA 4PMAA 3ZFZA 2XH9A 4NXGA 4H6JA 1ZG6A 3S7NA 3VSLA 1L3LA 1H3QA 3BLMA 3O3VA 3ZG8B 4BLMA 1KDWA 1K0KA 1ES4A 1KGEA 1BYWA 1VM1A 4B88A 3EEHA 4S2JA 5CGXA 5FI6A 4MEZA 1XX2A 3FV7A 5A90A 4IUHA 5GLAA 2WKRA 3DTKA 3ISGA 3CWFA 1S6RA 4WM9A 3KYEA 5EUAA 3C4OA 4JXWA 3LIDA 1ONHA 5CGWA 4KG6A 3ZNYA 3VP3A 4EERA 3GECA 4OQ0A 4PM7A 1YM1A 2Y2PA 2QPNA 1T18A 1DP8A 1FR1A 2EFUA 2CC1A 4KG5A 2PRFA 2Y2NA 2P9VB 2XR0A 3CG5A 3SZTA 4C75A 3BLSA 3PHYA 4JXGA 2OOLA 2H5SA 4DJ2A 2JHEA 3V3SA 1YSQA 4F3LA 2QMIA 2W1TA 4BBVA 1N4OA 4R38A 3FG8A 4GB7A 3IS2B 3SS3A 1HTZA 4RVAA 4OVDA 4R3BA 1Y28A 3LIBA 3A0VA 1GSVA 2Q9NA 5DF7A 1IYQA 1E25A 2VJWA 5EVIB 3MXSA 3L9KA 3MXQA 4P6BA 1SZVA 4K0XA 1JTGA 1IEMA 4JPMA 3V5MA 4HI4A 1SKOB 5M18A 1WE4A 3C38A 2PR5A 2Y2OA 3T1XA 1SCWA 2QKPA 1FCOA 3A0RA 3C2WA 2J3WA 5AQBA 5HPFA 3H7WB 4KZ8A 1K25A 1I2SA 3EWKA 3EQVA 3PAGA 4RX3A 4Q0JA 3ICYA 3BQAA 5TGFA 1IYOA 3E98A 4KZ9A 4BD1A 3ZQ5A 5DFYA 2FFYA 3LEZA 3WRTA 2VA0A 2XDMA 3W8KA 5F82A 3LR3A 2C5WB 2HP9A 1YPRA 2O99A 2XFSA 2Z6CA 5CHJA 4PHTA 4E6XA 4MN5A 3S1YA 2V9AA 4R23A 3O5YA 3UN7A 3WS5A 3UDXA 4AFIA 1AXBA 2I72A 2KLIA 5TFQA 4HBUA 2I9VA 1ZKJA 5EM1A 4QJGA 1YMXA 5JYPA 1LSWA 2HDQA 3T50A 1ERMA 2INWA 1Z6FA 3WS4A 4DE0A 5CEDA 5HW3A 3TOIA 4E3MA 2W3GA 2XEPA 2QJ7A 4E3IA 4X53A 2R9XA 4JBFA 4EUZA 1PW8A 5HAQA 1NLZA 2HPBA 4KZBA 5HAIA 1XFQA 3V3RA 3A3FA 4N1HA 1S0WA 3RXWA 4EEPA 4Y5FA 1Y54A 3PBSA 3SH7A 4NXEA 1TVFA 3HCYA 3NIAA 1XGIA 3MZEA 5EECA 1X0OA 3LFVA 1IYPA 3GV9A 5CRFA 1EI5A 4U0XA 1K56A 1F9IA 5HD3A 4EQIA 1YT4A 4NXBA 2V2FF 4P85A 1LL9A 2EX9A 3R7WB 4ZJ2A 4P6ZS 5DTKA 1BULA 2P08A 3LIAA 3HLFA 3S7PA 1ONGA 5EOOA 3UNWA 4Y13A 3LI8A 3BFEA 4EESA 3PBQA 4Y0UA 2H28A 2XSSA
chains in the Genus database with same CATH topology
4UQIM 4Q0HA 5AVFA 4LPZA 2YKFA 1S1ZA 4Y2FA 4ETXA 5HWTA 3S7OA 4HHDA 5HPIA 5HDSA 2ZOIA 2V0WA 3FC7A 4HY8A 3MF0A 3UB7A 4HJ4A 3VE4A 1W63Q 2XRNA 4L9GA 1F98A 3VE3A 2OAP1 4NKPA 4KQDA 2V1BA 2J80A 1WA9A 1MZUA 1YKDA 2VV8A 1S4SA 3KO6A 3MJQA 3MFXA 3IBRA 5DJUA 3EOIA 2PD8A 3G6OA 2HV1A 4GHIB 3F1NB 1TD5A 2W3EA 2KDKA 1P9RA 2NUPC 1UGUA 5DF9A 2EWVA 3LR0A 2PDRA 3P01A 3R4KA 4DMZA 4FOFA 5F68A 4WUJA 2GZAA 1YAXA 4I38A 4HP9A 2VV7A 2M1CA 2VGLS 2HGVA 5TBMA 3T4QA 4Q0IA 1S67L 5HWWA 4YNRA 5AVEA 1D06A 3H82A 3K3CA 1DP9A 3KX0X 1T19A 4MN6A 2O9BA 2O9CA 4JGPA 3S7QA 1G28A 3LI9A 4KQOA 3LR4A 1XJ6A 3KSGA 3T4OA 1VB6A 1N9OA 4MDZA 1ZTUA 2DMWA 3BW6A 4GCZA 2QYBA 2K2NA 1NLYA 3PBNA 4Y3IA 3B33A 2JKTI 2G7UA 2W3FA 3H7WA 3FPVA 2QJ5A 3BY8A 4CLCC 1OTAA 1MC0A 2A24A 5HL6A 2MJ6A 4IUKA 4LRYC 2VX8A 5IU1A 4EUVA 3OOVA 4L9FA 4GJ4A 5IT5A 5TJJA 3HJIA 4I3JA 4II7A 2PD7A 3K2NA 3T4LA 2PHYA 2D02A 2O9AA 1LSXA 2WKPA 4MMNA 2PYRA 2FH5A 4OOMA 3H9WA 5G4ZA 4NEED 3BJNA 1OJGA 2XA7S 4LLOB 5AJGA 3KSIA 4L0LA 3F1OA 3VOLA 3CITA 1OT9A 5HD5A 5TBMB 1STZA 2Y8HA 2M7VA 2YKHA 5J3WA 3LYXA 4G3VA 3H82B 4O01A 4PAUA 3C8CA 3PYPA 3PR6A 4IJGA 4UQIS 5F5YA 1NWZA 1H8MA 1VHMA 4HNBA 2R78A 1T1BA 4EU0A 3RH8B 2CMNA 2M7UA 4WL9A 2A2LA 2EA9A 4GW9A 2Y79A 3B47A 3UE6A 4XT2A 3LUQA 4KUKA 4EETB 3KYZA 3UMEA 4WEKA 4DN0A 1DRMA 2PR6A 3E4OA 3EGDC 1DP6A 2D01A 4HJ3A 5DFXA 1T1CA 1LT0A 1UWNX 2VKSA 1OJ5A 4HJ6A 1W63M 4O8GA 2B18A 2A24B 4NXGA 1N9NA 4EEUA 4I3IA 4B9OA 2IA2A 3MQ0A 4H6JA 3TRCA 4DJ3A 3E4QA 3S7NA 2VLGA 3VV4A 1P0ZA 2VV6A 1H3QA 4OOLA 5HWVA 2FZ0A 1D7EA 3F1PB 3JVUA 1BYWA 5F6AA 1OTDA 3F1OB 2JKTM 3EEHA 3IS2A 1GSXA 3NOPC 3D3OA 3NOTC 3OBFA 4WELA 4IUHA 2W1RA 1S1YA 2WKRA 2JN7A 2P04A 2ZMVA 3CWFA 4I39A 3T4TA 3BWLA 4R6LA 2B02A 3D72A 5LBRA 3PBOA 3LIDA 2GJ3A 5G4YA 4GS9B 4EERA 4XT2B 4CLCA 3GECA 3ZYTA 3E4PA 4G3WA 1T18A 1DP8A 3IBJA 1P97A 3OLOA 2L4RA 3UB8A 3UB6A 3K3DA 4R70A 3V67A 1TS8A 2O0YA 4H6JB 4CLCD 1LSVA 1XJ3A 1S4RA 1TF1A 3PHYA 2OOLA 2J3TC 4DJ2A 2JHEA 1YSQA 2HJ9C 4GLQA 2HJEA 4F3LA 3EQUA 3LICA 3LIEA 4NXFA 2W1TA 4L9EA 4BBVA 4I3AA 4R38A 4ZRRA 4E04A 3FG8A 4Z1WA 4YWZA 4FSFA 5DJTA 3MQQA 3NJAA 3IS2B 3HJKA 1Y28A 1ODVA 2BASA 3LIBA 3A0VA 1GSVA 4QPRA 5A8BA 4HOIA 4BBTA 2VJWA 1UWPX 4EW7A 3PXPA 3MXQA 3MMHA 2Z6DA 2ZMFA 1V9YA 3PBRA 4BJPA 5J7EA 3BY9A 3KSFA 2VZWA 4CLCB 4HI4A 2W27A 3C38A 4KUOA 3LIFA 2PR5A 4JGQA 2PYPA 3CUEC 2LB5A 4UEYA 3C30A 4G3KA 2QKPA 4LRXC 1YSPA 1XFNA 3A0RA 3NOUC 2W3HA 3C2WA 3W2ZA 2K7SA 3OCLA 4ME4A 1IFQA 2JKRI 2J3WA 5EFWA 4M4XA 4HH3A 2GX5A 5HPFA 4F3LB 3H7WB 2W1TB 5FL3A 3P7NA 2KX6A 3CI6A 1MKMA 4EXOA 1OTEA 3EWKA 3EQVA 4Q0JA 5L8MA 3ICYA 3EEAA 4O0PA 3BQAA 4R3AA 4ETZA 3E98A 4HH2A 5J4EA 3ZQ5A 5DFYA 4MN7A 2VA0A 5K5BA 4ARZA 3UMDA 3DBAA 1XJ4A 4CLCE 4IHQA 3LR3A 3B42A 3RFBA 3NHQA 5KIZA 1TS0A 4WLAA 3GDIA 4HP4A 4MCWA 5IS1A 2ZOHA 2O99A 2Z6CA 4WF0A 4PHTA 1OT6A 3U2AA 3TE8A 3OC2A 4JGRA 4MN5A 3T4SA 1F5MA 2NUTC 3EGXC 5DKLA 3CAXA 2V9AA 3A0SA 3O5YA 4B93A 3LR5A 1XJ2A 4AFIA 1OTIA 1OTBA 2KLIA 4YOFA 2W3DA 2HF6A 3MQOA 2I9VA 3SW1A 3UE3A 3RTYA 4LRZE 2WKQA 1LL8A 4HQAA 2J3TD 3T4JA 1LSWA 5HZHA 3T50A 5KSHA 3R7WA 2W0NA 1N9LA 2INWA 2L0WA 3KSHA 5MC7A 3CLOA 2W3GA 2QJ7A 4HIAA 2VGLM 5I5LA 5F69A 4ARZB 5HDCA 2JKRM 4PKYA 1NLZA 1TS6A 3TJZC 1IOUA 1XFQA 4RQ9A 4JGOA 4PKYG 4EEPA 1GSWA 3MR0A 3BQ8A 3CUEA 1NRJA 4CQHA 1V9ZA 4BWIA 1S66L 5C5KA 4Y5FA 1OPXA 2L1MA 1JNUA 3PBSA 4NXEA 2EWWA 2QHKA 3HCYA 2QWSA 2GNXA 3FPWA 1KOUA 4I5SA 1P9WA 1X0OA 1TS7A 3LFVA 3TW8A 1F9IA 5HD3A 4WEJA 3E0YA 1T1AA 4NXBA 4BBUA 3PBTA 3ULFA 3OCNA 4K08A 3F1PA 4GHIA 5HDDA 3F1NA 2KOIA 2V1AA 5HSQA 4WN5A 3UB9A 2PT7A 4EQ1A 5DKKA 3R7WB 1EW0A 4P6ZS 2XA7M 2P08A 3LIAA 3JVVA 1G6OA 3S7PA 1ZHHB 2OAQ1 2VEAA 4P6ZM 2P7JA 2XROA 3T4KA 2OWJA 3LI8A 2OWHA 4BMWA 4EESA 2ZBBA 3PBQA 5CX7A 2K31A 2H28A 3KYQA 2XSSA 2LB9A 2V0UA 4GS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVF A;  4LPZ A;  2YKF A;  1S1Z A;  5HWT A;  4HHD A;  5HDS A;  2ZOI A;  2V0W A;  3FC7 A;  4HY8 A;  3UB7 A;  4HJ4 A;  3VE4 A;  4L9G A;  1F98 A;  3VE3 A;  4KQD A;  2V1B A;  2J80 A;  1WA9 A;  1MZU A;  2VV8 A;  1S4S A;  3MJQ A;  3MFX A;  3IBR A;  5DJU A;  2PD8 A;  3G6O A;  2HV1 A;  4GHI B;  3F1N B;  2KDK A;  1UGU A;  2PDR A;  5F68 A;  4WUJ A;  4I38 A;  4HP9 A;  2VV7 A;  2M1C A;  5HWW A;  5TBM A;  1S67 L;  5AVE A;  1D06 A;  3H82 A;  3K3C A;  1DP9 A;  3KX0 X;  1T19 A;  4MN6 A;  4JGP A;  1G28 A;  1XJ6 A;  1VB6 A;  1N9O A;  4GCZ A;  3B33 A;  3H7W A;  2QJ5 A;  3BY8 A;  1OTA A;  2A24 A;  4LRY C;  5IU1 A;  4L9F A;  3HJI A;  4I3J A;  2PD7 A;  2PHY A;  2D02 A;  1LSX A;  2WKP A;  2PYR A;  3H9W A;  5G4Z A;  1OJG A;  4LLO B;  3F1O A;  3VOL A;  1OT9 A;  5HD5 A;  5TBM B;  2YKH A;  5J3W A;  3LYX A;  3H82 B;  3C8C A;  3PYP A;  5F5Y A;  1NWZ A;  4HNB A;  2R78 A;  1T1B A;  3RH8 B;  2CMN A;  4WL9 A;  2EA9 A;  4GW9 A;  3UE6 A;  4XT2 A;  3LUQ A;  4KUK A;  4EET B;  3UME A;  1DRM A;  2PR6 A;  3E4O A;  1DP6 A;  2D01 A;  4HJ3 A;  1T1C A;  1LT0 A;  1UWN X;  4HJ6 A;  1OJ5 A;  2A24 B;  4NXG A;  1N9N A;  4EEU A;  4I3I A;  4B9O A;  4H6J A;  4DJ3 A;  3E4Q A;  2VLG A;  1P0Z A;  2VV6 A;  1D7E A;  3F1P B;  1BYW A;  5F6A A;  1OTD A;  3F1O B;  3EEH A;  3IS2 A;  1GSX A;  3NOP C;  3NOT C;  2WKR A;  1S1Y A;  2JN7 A;  3CWF A;  4I39 A;  3BWL A;  4R6L A;  2B02 A;  3D72 A;  3LID A;  2GJ3 A;  5G4Y A;  4GS9 B;  4EER A;  4XT2 B;  3GEC A;  3E4P A;  1T18 A;  1DP8 A;  1P97 A;  3OLO A;  2L4R A;  3UB6 A;  3UB8 A;  3K3D A;  4R70 A;  1TS8 A;  4H6J B;  1LSV A;  1XJ3 A;  1S4R A;  3PHY A;  2OOL A;  4DJ2 A;  2JHE A;  2V0U A;  4F3L A;  3LIC A;  3LIE A;  4NXF A;  4L9E A;  4BBV A;  4I3A A;  4R38 A;  4E04 A;  3FG8 A;  4YWZ A;  5DJT A;  3MQQ A;  3NJA A;  3IS2 B;  3HJK A;  1Y28 A;  1ODV A;  2BAS A;  3LIB A;  3A0V A;  1GSV A;  5A8B A;  4HOI A;  4BBT A;  1UWP X;  4EW7 A;  3MXQ A;  2Z6D A;  1V9Y A;  5J7E A;  3BY9 A;  4HI4 A;  2W27 A;  4KUO A;  3LIF A;  2PR5 A;  4JGQ A;  2PYP A;  2QKP A;  4LRX C;  1XFN A;  3A0R A;  3NOU C;  3C2W A;  2K7S A;  5EFW A;  4M4X A;  4HH3 A;  4F3L B;  3H7W B;  3P7N A;  2KX6 A;  4EXO A;  1OTE A;  3EWK A;  3ICY A;  4R3A A;  4HH2 A;  5J4E A;  3ZQ5 A;  3UMD A;  1XJ4 A;  3NHQ A;  5KIZ A;  1TS0 A;  4WLA A;  3GDI A;  4HP4 A;  5IS1 A;  2ZOH A;  2Z6C A;  4WF0 A;  1OT6 A;  4JGR A;  4MN5 A;  5DKL A;  3CAX A;  2V9A A;  3A0S A;  1XJ2 A;  1OTI A;  1OTB A;  3MQO A;  2I9V A;  3SW1 A;  3RTY A;  4LRZ E;  2WKQ A;  1LL8 A;  4HQA A;  1LSW A;  5HZH A;  3T50 A;  2W0N A;  1N9L A;  2INW A;  2L0W A;  3CLO A;  2QJ7 A;  4HIA A;  5I5L A;  5F69 A;  5HDC A;  4PKY A;  1TS6 A;  1XFQ A;  4RQ9 A;  4JGO A;  4PKY G;  4EEP A;  1GSW A;  3MR0 A;  1V9Z A;  1S66 L;  2L1M A;  1JNU A;  4NXE A;  2QHK A;  2QWS A;  1KOU A;  4I5S A;  1X0O A;  1TS7 A;  1F9I A;  5HD3 A;  1T1A A;  4NXB A;  4BBU A;  3ULF A;  4K08 A;  3F1P A;  4GHI A;  5HDD A;  3F1N A;  2V1A A;  5HSQ A;  4WN5 A;  3UB9 A;  4EQ1 A;  5DKK A;  1EW0 A;  3LIA A;  2VEA A;  2P7J A;  2OWJ A;  3LI8 A;  2OWH A;  4EES A;  2ZBB A;  2H28 A;  5HWV A;  3LI9 A;  4GS9 A; 
#chains in the Genus database with same CATH topology
 5CGS A;  5AVF A;  4E6W A;  1SDN A;  2YKF A;  5CER A;  1NJ4 A;  2AVX A;  3C7V A;  3Q82 A;  2V0W A;  3E2K A;  3NC8 A;  3UB7 A;  2WAE A;  1W63 Q;  4UA6 A;  2P9V A;  4L9G A;  3S4X A;  3UDF A;  3HUO A;  2Y2L A;  2V1B A;  1MZU A;  1YKD A;  3KO6 A;  4LV1 A;  4OH0 A;  3MFX A;  2BTF P;  2WK0 A;  4XUX A;  2PD8 A;  5FDS A;  4GZB A;  4OOY A;  3B3X A;  4GHI B;  3F1N B;  1VEU A;  5BOH A;  2ZC5 B;  1BT5 A;  3LR0 A;  4QY6 A;  3R4K A;  2VGL S;  1LHY A;  3T4Q A;  3IF6 A;  4EBL A;  3IX3 A;  4CJN A;  3IX4 A;  4ZBE A;  1DP9 A;  1T19 A;  2WGW B;  2O9B A;  1FCM A;  1XJ6 A;  4OP5 A;  4DDS A;  1ZTU A;  3HLC A;  3BW6 A;  5DF8 A;  3PBN A;  2JKT I;  2G7U A;  2W3F A;  3H7W A;  3N4I A;  3FPV A;  1MC0 A;  2A24 A;  2MJ6 A;  2VX8 A;  4EUV A;  4X68 A;  3HJI A;  5E2G A;  2PD7 A;  1FIK A;  2PHY A;  2Y2G A;  3U4L P;  4OOM A;  3WS0 A;  4NEE D;  5AJG A;  3F1O A;  3HLE A;  5GHY A;  5TBM B;  2OLU A;  4YIN A;  3AGF A;  2YKH A;  5J3W A;  4O01 A;  5I94 A;  3GMW A;  1K4F A;  3PR6 A;  4IJG A;  1NWZ A;  2ZQC A;  4RA7 A;  2R78 A;  1TDL A;  1CI9 A;  2CMN A;  4HEF A;  2M7U A;  1YLY A;  1FQG A;  1DRM A;  3E4O A;  3EGD C;  3FKV A;  1DP6 A;  1TEM A;  1LT0 A;  1UWN X;  2VKS A;  1OJ5 A;  1PIO A;  3NI9 A;  2PU2 A;  5GLD A;  3OPL A;  4R4R A;  4X25 A;  1XGJ A;  3E4Q A;  5HX9 A;  2VV6 A;  1L0E A;  4OOL A;  1CJF A;  2FZ0 A;  1D7E A;  3F1P B;  2B95 A;  1K54 C;  1KVL A;  1GSX A;  3NOP C;  3D3O A;  3QHY A;  3OBF A;  3IXH A;  2V1Z A;  1JWP A;  2W1R A;  4JF6 A;  5IHV A;  1C3B A;  1PI4 A;  4LV2 A;  2JN7 A;  2P04 A;  3ZG7 B;  3BWL A;  2B02 A;  3D72 A;  4OPZ A;  3PBO A;  3BRM A;  4X1L A;  1IKG A;  3ZCZ A;  4ZDX A;  4Y0T A;  2ZQ7 A;  3NY4 A;  3P98 A;  4CLC A;  3ZYT A;  2PBY A;  1KE0 A;  1BLH A;  3DTI A;  2L4R A;  3UB8 A;  4FTX A;  1JVJ A;  2ZC4 B;  4CLC D;  1RCJ A;  3ZG0 A;  1TF1 A;  4DE2 A;  2HJ9 C;  3EQU A;  4NXF A;  3LIE A;  4KZ4 A;  4L9E A;  5FI2 A;  4ZRR A;  2ZM2 A;  4Z1W A;  2ZM0 A;  4FSF A;  2UV0 E;  3P09 A;  4S2O A;  1L0G A;  1ODV A;  3BFC A;  2XF3 A;  1M6K A;  4QPR A;  3T1S A;  1K55 C;  2RCX A;  4Q8I A;  5A8B A;  3HUM A;  3QP5 A;  4FUW A;  4BEN A;  4S2N A;  4OPR A;  3MZF A;  5L10 A;  2Y55 A;  1FIL A;  5J7E A;  3BY9 A;  3KSF A;  2VZW A;  1XA1 A;  3DTM A;  4OPY A;  3ITA A;  2PYP A;  2LB5 A;  4Y0O A;  3G34 A;  5FDH A;  1YSP A;  1XFN A;  2JKR I;  5F83 A;  2PAV P;  4H8R A;  3SOI A;  4X55 A;  3P7N A;  1BLP A;  1DY6 A;  2HP5 A;  1YLZ A;  3CI6 A;  1MKM A;  3WRZ A;  1LLB A;  2XLN A;  4R3A A;  3EEA A;  4GN2 A;  3HL9 A;  1PRQ A;  4HH2 A;  4JXS A;  1PW1 A;  5K5B A;  1YMS A;  4ARZ A;  3DBA A;  2A3U A;  5EE8 A;  3VSK A;  5AQ7 A;  3GDI A;  5IS1 A;  3UPP A;  2ZOH A;  3SS4 A;  4S2L A;  1W7F A;  3TE8 A;  3OC2 A;  3W4Q A;  4QU3 A;  3QNC A;  1F5M A;  1HLU P;  1NY0 A;  5FQQ A;  2C6W B;  4N92 A;  2EFX A;  1ALQ A;  4E3L A;  4Z9Q A;  1OTI A;  4YOF A;  3MQO A;  2IWB A;  3SW1 A;  5FAS A;  4LRZ E;  1K6R A;  2WKQ A;  3A3D A;  4ZJ1 A;  2J3T D;  4LV3 A;  5KSH A;  2ZC7 A;  2W0N A;  4Y15 A;  3V39 A;  3CLO A;  2VGJ A;  2VGL M;  4HIA A;  3IXD A;  4E3K A;  3MKE A;  3DTE A;  4R4S A;  5J8X A;  4U3T A;  3HLB A;  1K57 C;  3RJU A;  2H0T A;  2E8I A;  1CQA A;  4JGO A;  4CQH A;  2Y2H A;  2UWX A;  4BWI A;  1XXM A;  3UO9 A;  3M2K A;  3IF6 C;  4QWO A;  3N8S A;  4M3K A;  1H0M A;  2EWW A;  4QD4 A;  3MS6 A;  2GNX A;  1PWC A;  1KOU A;  1TS7 A;  1F2K A;  2VK3 A;  4IVI A;  3OCN A;  3F1P A;  1MWS A;  5HDD A;  3W4O A;  3NBL A;  1I5Q A;  3ZVT A;  3JVV A;  1CEF A;  1G6O A;  3S22 A;  1ZHH B;  3ZNT A;  2VEA A;  4NG2 A;  3VP4 A;  3T4K A;  2WKI A;  5GHZ A;  4BMW A;  3A3J A;  2LB9 A;  5HWV A;  1WYB A;  2V0U A;  4Q0H A;  3G31 A;  2DCF A;  4KEN B;  2DRW A;  1KE3 A;  5HWT A;  1H8Y A;  5HDS A;  3FC7 A;  4HY8 A;  3G32 A;  4HJ4 A;  4IBR A;  3VE3 A;  1CF0 A;  5CTN A;  3GR2 A;  4NKP A;  3UPO A;  1WA9 A;  4LGW A;  3MJQ A;  3V50 A;  1L0D A;  5E2E A;  2HV1 A;  1MKI A;  1TD5 A;  4E3O A;  1ES3 A;  3CPT A;  1EWZ A;  4FOF A;  2DNS A;  1SDE A;  1DJB A;  3QP2 A;  2VV7 A;  4OKP A;  2HGV A;  2WAF A;  4S2M A;  3H82 A;  4B4Z A;  3FYZ A;  3NCK A;  4R1G A;  1K6S A;  3S7Q A;  1NYY A;  2X02 A;  3LR4 A;  3T4O A;  3NUL A;  4N9K A;  5GHX A;  4MDZ A;  2DMW A;  1HVB A;  1VET A;  2K2N A;  3NEC A;  4Y3I A;  4LCL A;  3B33 A;  1L2S A;  3N6I A;  4QB8 A;  4CLC C;  5HL6 A;  2V8F A;  4IUK A;  1JTD A;  4L9F A;  4S2K A;  5TJJ A;  4I3J A;  2BLS A;  3K2N A;  1XP4 A;  2PU4 A;  2D02 A;  1G68 A;  1BSG A;  3NDG A;  4B4X A;  1YQS A;  1LI9 A;  1BTL A;  1GHI A;  3KSI A;  4DRT A;  4KQQ A;  2IWC A;  3OPH A;  4JF4 A;  4YFM A;  5GLB A;  1K56 D;  1AWI A;  4LFU A;  5D3O A;  3G2Z A;  2JCH A;  2M7V A;  4PAU A;  4CPK A;  3C8C A;  1MY8 A;  4OON A;  1T1B A;  4E3J A;  3MZD A;  1J3W A;  4NK3 A;  3UE6 A;  3G35 A;  4IED A;  3LUQ A;  3C5A A;  3GSG A;  3IX8 A;  2ZD8 A;  3MBZ A;  4HJ3 A;  3T1R A;  5DFX A;  3UY6 A;  1T1C A;  3CHW P;  4O8G A;  5CHU A;  2Z2M B;  2Q0O A;  4S2P A;  1N9N A;  5E43 A;  4I3I A;  3MQ0 A;  4HES A;  2ZQD A;  1PI5 A;  1IEL A;  1Q2Q A;  3FWL A;  2ZC6 B;  4FH2 A;  1P0Z A;  3IHB A;  3L7H A;  3T1Q B;  4D2O A;  2WGI A;  2VGK A;  3QP1 A;  1FSY A;  4U0T A;  3JVU A;  2EX8 A;  3BFD A;  1OTD A;  2JKT M;  3IS2 A;  4NET A;  4WEL A;  5EVE A;  1GCE A;  5FQ9 A;  2ZMV A;  4I39 A;  3Q7V B;  1W8Y A;  2HZ5 A;  4R6L A;  5EM0 A;  5EVI A;  5LBR A;  5AQ9 A;  1OME A;  5FSR A;  5FQJ A;  1U60 A;  4XT2 B;  1I2W A;  1SKO A;  3C7U A;  5EVI D;  4MLL A;  1MXO A;  3E4P A;  4G3W A;  1KGF A;  4WZ5 A;  4GKU A;  3IBJ A;  1P97 A;  3OLO A;  4KZ7 A;  1Q2P A;  3UB6 A;  3K3D A;  4R70 A;  3V67 A;  1TS8 A;  3IF5 A;  4F94 A;  1ERO A;  2O0Y A;  4H6J B;  3WS2 A;  1LSV A;  1PZO A;  1S4R A;  1XJ3 A;  4MBH A;  2QZ6 A;  3AGD A;  5L07 A;  2J3T C;  2J9P A;  5EPH A;  4GLQ A;  2HJE A;  3LIC A;  3QP4 A;  1XPB A;  4I3A A;  3M2J A;  4P87 A;  4E04 A;  4YWZ A;  5M1A A;  3ZG9 B;  3HJK A;  3O87 A;  1BZA A;  1PFL A;  4DXB A;  5FAO A;  4OP8 A;  4MBF A;  3Q81 A;  1L0F A;  3MMH A;  1PWG A;  4ESP A;  2Z6D A;  2ZMF A;  1MPL A;  4LV0 A;  1V9Y A;  3PBR A;  4BJP A;  1PWD A;  3WS1 A;  1DJC A;  2W27 A;  2IWD A;  4GDN A;  3DAV A;  4K0W A;  4UEY A;  4G3K A;  2HDR A;  4LRX C;  2WKE A;  3NOU C;  2W3H A;  3W2Z A;  2K7S A;  3OCL A;  2Y2J A;  5EFW A;  2XFT A;  5GL9 A;  3G4P A;  4M4X A;  4F3L B;  3DW0 A;  2W1T B;  2KX6 A;  2ZQ8 A;  3ZG5 A;  3BM6 A;  4EXO A;  1OTE A;  2G2W A;  3O86 A;  5J4E A;  4MN7 A;  4KQR A;  1XA7 A;  3UMD A;  5EV0 A;  4CLC E;  4IHQ A;  2BG1 A;  4DDY A;  1TDG A;  5L09 A;  4S2I A;  2Y2M A;  2XQZ A;  1TS0 A;  4HP4 A;  1NZO A;  3MSH A;  3IH9 A;  5CXW A;  1ZG4 A;  4WF0 A;  1OT6 A;  4ID4 A;  4C6Y A;  1YLP A;  3EGX C;  3IH8 A;  5DKL A;  3IXG A;  3CAX A;  1MWU A;  1YLJ A;  3A0S A;  4EBN A;  4B93 A;  2PBD P;  1HD8 A;  3UB5 P;  4IVK A;  1OTB A;  3UE3 A;  3RTY A;  4MBK A;  1LL8 A;  3T4J A;  5HZH A;  3ZGA B;  4DXC A;  3R7W A;  3LO7 A;  5U47 A;  4R0Q A;  3KSH A;  1N9L A;  4WZ4 A;  1O7E A;  2ZQ9 A;  5I5L A;  5F69 A;  3HLD A;  1QME A;  5HDC A;  2JKR M;  4PKY A;  1A0K A;  1TS6 A;  3TJZ C;  1GSW A;  2HDS A;  3MR0 A;  3BQ8 A;  3CUE A;  3IT9 A;  2ZM8 A;  5DTT A;  5C5K A;  2HP6 A;  4RYE A;  2L1M A;  2JKG A;  5CTM A;  2QWS A;  3FPW A;  4X69 A;  5FQM A;  4UHU A;  3TSG A;  1P9W A;  4O7D A;  3TW8 A;  1KDS A;  3UE1 A;  4WEJ A;  3BEB A;  3E2L A;  3PBT A;  3MXR A;  3O88 A;  4GHI A;  3N8L A;  3F1N A;  3HLW A;  1NXY A;  2KOI A;  5HSQ A;  4WN5 A;  3UB9 A;  2JKF A;  4PPR A;  5DKK A;  4EQ1 A;  1WYC A;  2ACG A;  4LCM A;  3OPR A;  2OAQ 1;  1NYM A;  4P6Z M;  1BUE A;  2P7J A;  2XRO A;  2OWJ A;  2OWH A;  1LI0 A;  2ZBB A;  2K31 A;  3BYD A;  3LI9 A;  1ERQ A;  3VFF A;  4LPZ A;  4HBT A;  1S1Z A;  4Y2F A;  4ETX A;  3N8R A;  1SHV A;  2EX2 A;  4HHD A;  2WGW A;  2ZQA A;  1H8Z A;  3CMZ A;  5KZH A;  5G18 A;  3M6H A;  4KZ6 A;  3HBR A;  2XRN A;  1F98 A;  3C4P A;  4FCF A;  5DTS A;  1GHP A;  3DWZ A;  2Y2K A;  4OLG A;  2VV8 A;  1S4S A;  2Y4A A;  4D60 A;  3SH8 A;  3IBR A;  2Z2L B;  5DJU A;  1KVM A;  3G6O A;  1G6A A;  2Y91 A;  3IWO A;  1N9B A;  2KDK A;  1ESU A;  2NUP C;  1UGU A;  4OPQ A;  2PDR A;  3P01 A;  4JLF A;  2Y59 A;  4OLD A;  4WUJ A;  5FAP A;  1YAX A;  1ESI A;  2J8Y A;  3D9Y A;  3Q07 A;  5TBM A;  4Q0I A;  1E3U A;  2JBF A;  3LY4 A;  5AVE A;  1D06 A;  3K3C A;  3KX0 X;  3ITB A;  3MFD A;  1CEG A;  1G28 A;  1E3U D;  1CK3 A;  5EVI C;  1BLC A;  4EWF A;  5A93 A;  1N9O A;  2WUQ A;  2QYB A;  4BL3 A;  1FCN A;  5FAQ A;  2QJ5 A;  2G2U A;  3BY8 A;  1OTA A;  4GNU A;  4QY5 A;  3JPU A;  5IU1 A;  3ZVW A;  5CEB A;  4GJ4 A;  5IT5 A;  4II7 A;  1VEU B;  3DWK A;  4WZ5 C;  3T4L A;  1W8Q A;  2O9A A;  1LSX A;  2WKP A;  5AQA A;  3LY3 A;  2PYR A;  3GVB A;  5G4Z A;  1NZU A;  1OJG A;  2XA7 S;  1G5U A;  1QMF A;  1SKF A;  1OT9 A;  5HD5 A;  1YLT A;  2OLV A;  2J9O A;  2WAD A;  3BEC A;  3LEQ A;  3IF6 B;  3QP8 A;  3UPN A;  2X01 A;  3LYX A;  3PYP A;  2WGV A;  3QNB A;  4OQH A;  4UQI S;  5F5Y A;  3IWI A;  4N9L A;  1H8M A;  4HNB A;  4PM9 A;  5KSC A;  3ZHH A;  2WYX A;  4EU0 A;  1PNE A;  3RH8 B;  2JC7 A;  5JYO A;  4WL9 A;  4GW9 A;  2Q9M A;  1HZO A;  4OQI A;  2A49 A;  4KUK A;  5F1G A;  3A3E A;  4EET B;  3UME A;  4XXR A;  4UA9 A;  4DN0 A;  1D1J A;  1K54 A;  3M6B A;  4HJ6 A;  1IYS A;  1W63 M;  2B18 A;  2A24 B;  3HVF A;  4JXV A;  4EEU A;  4B9O A;  4DF6 A;  2IA2 A;  3CZD A;  4QHC A;  3TRC A;  4DJ3 A;  3IXB A;  3VV4 A;  3GRJ A;  2VLG A;  2ZL1 B;  1GHM A;  5FI7 A;  5TR7 A;  5F6A A;  3F1O B;  4KZ5 A;  3NOT C;  1FSW A;  1S1Y A;  3T4T A;  2WZX A;  5DVA A;  2GJ3 A;  4EV4 A;  2WKH A;  5G4Y A;  4GS9 B;  1Z09 A;  3VOY A;  5FEF A;  4KZA A;  1RGZ A;  4Y7P A;  3BFF A;  2X71 A;  3Q7Z A;  1K55 A;  4ZJ3 A;  3IWQ A;  3VMA A;  1ACF A;  3GQZ A;  1NRF A;  4C3Q A;  4KZ3 A;  1ZC2 A;  5DJT A;  4DE3 A;  3MQQ A;  3NJA A;  1FR6 A;  1ES5 A;  4PM8 A;  2BAS A;  4WYY A;  4JF5 A;  5FEG A;  3IHA A;  4WBG A;  4HOI A;  4BBT A;  1UWP X;  4EW7 A;  1J9M A;  3HRE A;  3PXP A;  3MKF A;  2V20 A;  1K38 A;  1E4D A;  4P0M A;  2H0Y A;  4CLC B;  2EXA A;  4KUO A;  3AGE A;  3LIF A;  4JGQ A;  3CUE C;  3C30 A;  2GDN A;  3ZDJ A;  4S2N C;  4ME4 A;  1IFQ A;  1RP5 A;  4UAA A;  4HH3 A;  2GX5 A;  1IKI A;  5FL3 A;  1H5X A;  5HFO A;  1K4E A;  3G30 A;  1DJA A;  5L8M A;  4O0P A;  3OPP A;  4FD8 A;  4ETZ A;  5CEC A;  1GA0 A;  1XJ4 A;  2E8J A;  4KG2 A;  4R3J A;  3T12 B;  5FQI A;  3LGO A;  3W4P A;  3B42 A;  3RFB A;  3G2Y A;  3NHQ A;  5KIZ A;  4WLA A;  4MCW A;  5FQK A;  3U2A A;  1LL5 A;  4JGR A;  3T4S A;  4GD8 A;  2NUT C;  5A92 A;  4IBX A;  2ZJ9 A;  3LR5 A;  1XJ2 A;  1K57 A;  2OSU A;  2HF6 A;  2W3D A;  4A5R A;  4HQA A;  4FH4 A;  4BQM A;  5HAP A;  2L0W A;  3I7J A;  5MC7 A;  5F1F A;  1W5D A;  3VOZ A;  4ARZ B;  5HL1 A;  1CI8 A;  3SS5 A;  1IOU A;  3NDE A;  4RQ9 A;  1FOF A;  3Q1F A;  4PKY G;  2EXB A;  3UE0 A;  3VFH A;  5FA7 A;  1NRJ A;  4MNR A;  3D4F A;  1V9Z A;  1S66 L;  1W79 A;  1OPX A;  1MWT A;  2Y2Q A;  4LEN A;  2P74 A;  1JNU A;  2QHK A;  2ZMA A;  2ZLY A;  4WMC A;  4I5S A;  3UDI A;  2ZL1 A;  3OZH A;  3PAE A;  3E0Y A;  2ZC3 B;  2RL3 A;  1T1A A;  4BBU A;  3ULF A;  2WZZ A;  4K08 A;  1JWV A;  3WWX A;  4WMC D;  2V1A A;  5E2H A;  2HDU A;  2PT7 A;  1EW0 A;  2XA7 M;  4PM6 A;  3A3I A;  1O07 A;  3VP1 A;  4EBP A;  5CX7 A;  1PYY A;  3LCE A;  3KYQ A;  4GS9 A;  4UQI M;  3CJM A;  4GDB A;  2XK1 A;  3HLG A;  2XGN A;  2OV5 A;  3QP6 A;  3S7O A;  5HPI A;  1MBL A;  2ZOI A;  3BFG A;  3MF0 A;  3VE4 A;  5EOE A;  2OAP 1;  1GA9 A;  1M40 A;  4KQD A;  3VP0 A;  2J80 A;  3FZC A;  2H10 A;  4BL2 A;  3EOI A;  1XKZ A;  3PTE A;  1VQQ A;  2FFF B;  2R9W A;  2W3E A;  1P9R A;  4X56 A;  1RGY A;  5DF9 A;  5E2F A;  2EWV A;  4DMZ A;  5F68 A;  2GZA A;  4DE1 A;  4X6T A;  4GD6 A;  2EX6 A;  4I38 A;  4HP9 A;  5A91 A;  5HAR A;  2M1C A;  5HWW A;  4XUZ A;  1S67 L;  5EVL A;  3GTC A;  4YNR A;  2JE5 A;  2XD1 A;  1BLS A;  1PZP A;  5GLC A;  2XD5 A;  4MN6 A;  2O9C A;  2Y2I A;  4JGP A;  4BD0 A;  4KQO A;  3KSG A;  1JWZ A;  1VB6 A;  5L2F A;  4JKT A;  2V8C A;  4GCZ A;  3HUN A;  1NLY A;  5KMW A;  3VP2 A;  4OQG A;  2J7V A;  4K91 A;  4Y17 A;  4LRY C;  3OOV A;  4RX2 A;  1KE4 A;  3SH9 A;  1KGG A;  4ZAM A;  3CPT B;  4MMN A;  2FH5 A;  3H9W A;  3BJN A;  4N1X A;  3TG9 A;  4LLO B;  4L0L A;  3VOL A;  3CIT A;  3JYI A;  4PM5 A;  1STZ A;  2Y8H A;  1YLW A;  3FKW A;  3RXX A;  4G3V A;  3H82 B;  3Q7V A;  5M19 A;  1ES2 A;  1VHM A;  1MWR A;  5CHM A;  4E3N A;  4GOG A;  3IQA A;  1Y4O A;  2A2L A;  2EA9 A;  2Y79 A;  3B47 A;  4XT2 A;  1VET B;  3KYZ A;  5FAT A;  4X1M A;  4WEK A;  2PR6 A;  4UA7 A;  4DKI A;  2B5R A;  2D01 A;  4ZTK A;  3N7W A;  4PMA A;  3ZFZ A;  2XH9 A;  4NXG A;  4H6J A;  1ZG6 A;  3S7N A;  3VSL A;  1L3L A;  1H3Q A;  3BLM A;  3O3V A;  3ZG8 B;  4BLM A;  1KDW A;  1K0K A;  1ES4 A;  1KGE A;  1BYW A;  1VM1 A;  4B88 A;  3EEH A;  4S2J A;  5CGX A;  5FI6 A;  4MEZ A;  1XX2 A;  3FV7 A;  5A90 A;  4IUH A;  5GLA A;  2WKR A;  3DTK A;  3ISG A;  3CWF A;  1S6R A;  4WM9 A;  3KYE A;  5EUA A;  3C4O A;  4JXW A;  3LID A;  1ONH A;  5CGW A;  4KG6 A;  3ZNY A;  3VP3 A;  4EER A;  3GEC A;  4OQ0 A;  4PM7 A;  1YM1 A;  2Y2P A;  2QPN A;  1T18 A;  1DP8 A;  1FR1 A;  2EFU A;  2CC1 A;  4KG5 A;  2PRF A;  2Y2N A;  2P9V B;  2XR0 A;  3CG5 A;  3SZT A;  4C75 A;  3BLS A;  3PHY A;  4JXG A;  2OOL A;  2H5S A;  4DJ2 A;  2JHE A;  3V3S A;  1YSQ A;  4F3L A;  2QMI A;  2W1T A;  4BBV A;  1N4O A;  4R38 A;  3FG8 A;  4GB7 A;  3IS2 B;  3SS3 A;  1HTZ A;  4RVA A;  4OVD A;  4R3B A;  1Y28 A;  3LIB A;  3A0V A;  1GSV A;  2Q9N A;  5DF7 A;  1IYQ A;  1E25 A;  2VJW A;  5EVI B;  3MXS A;  3L9K A;  3MXQ A;  4P6B A;  1SZV A;  4K0X A;  1JTG A;  1IEM A;  4JPM A;  3V5M A;  4HI4 A;  1SKO B;  5M18 A;  1WE4 A;  3C38 A;  2PR5 A;  2Y2O A;  3T1X A;  1SCW A;  2QKP A;  1FCO A;  3A0R A;  3C2W A;  2J3W A;  5AQB A;  5HPF A;  3H7W B;  4KZ8 A;  1K25 A;  1I2S A;  3EWK A;  3EQV A;  3PAG A;  4RX3 A;  4Q0J A;  3ICY A;  3BQA A;  5TGF A;  1IYO A;  3E98 A;  4KZ9 A;  4BD1 A;  3ZQ5 A;  5DFY A;  2FFY A;  3LEZ A;  3WRT A;  2VA0 A;  2XDM A;  3W8K A;  5F82 A;  3LR3 A;  2C5W B;  2HP9 A;  1YPR A;  2O99 A;  2XFS A;  2Z6C A;  5CHJ A;  4PHT A;  4E6X A;  4MN5 A;  3S1Y A;  2V9A A;  4R23 A;  3O5Y A;  3UN7 A;  3WS5 A;  3UDX A;  4AFI A;  1AXB A;  2I72 A;  2KLI A;  5TFQ A;  4HBU A;  2I9V A;  1ZKJ A;  5EM1 A;  4QJG A;  1YMX A;  5JYP A;  1LSW A;  2HDQ A;  3T50 A;  1ERM A;  2INW A;  1Z6F A;  3WS4 A;  4DE0 A;  5CED A;  5HW3 A;  3TOI A;  4E3M A;  2W3G A;  2XEP A;  2QJ7 A;  4E3I A;  4X53 A;  2R9X A;  4JBF A;  4EUZ A;  1PW8 A;  5HAQ A;  1NLZ A;  2HPB A;  4KZB A;  5HAI A;  1XFQ A;  3V3R A;  3A3F A;  4N1H A;  1S0W A;  3RXW A;  4EEP A;  4Y5F A;  1Y54 A;  3PBS A;  3SH7 A;  4NXE A;  1TVF A;  3HCY A;  3NIA A;  1XGI A;  3MZE A;  5EEC A;  1X0O A;  3LFV A;  1IYP A;  3GV9 A;  5CRF A;  1EI5 A;  4U0X A;  1K56 A;  1F9I A;  5HD3 A;  4EQI A;  1YT4 A;  4NXB A;  2V2F F;  4P85 A;  1LL9 A;  2EX9 A;  3R7W B;  4ZJ2 A;  4P6Z S;  5DTK A;  1BUL A;  2P08 A;  3LIA A;  3HLF A;  3S7P A;  1ONG A;  5EOO A;  3UNW A;  4Y13 A;  3LI8 A;  3BFE A;  4EES A;  3PBQ A;  4Y0U A;  2H28 A;  2XSS A; 
#chains in the Genus database with same CATH homology
 4UQI M;  4Q0H A;  5AVF A;  4LPZ A;  2YKF A;  1S1Z A;  4Y2F A;  4ETX A;  5HWT A;  3S7O A;  4HHD A;  5HPI A;  5HDS A;  2ZOI A;  2V0W A;  3FC7 A;  4HY8 A;  3MF0 A;  3UB7 A;  4HJ4 A;  3VE4 A;  1W63 Q;  2XRN A;  4L9G A;  1F98 A;  3VE3 A;  2OAP 1;  4NKP A;  4KQD A;  2V1B A;  2J80 A;  1WA9 A;  1MZU A;  1YKD A;  2VV8 A;  1S4S A;  3KO6 A;  3MJQ A;  3MFX A;  3IBR A;  5DJU A;  3EOI A;  2PD8 A;  3G6O A;  2HV1 A;  4GHI B;  3F1N B;  1TD5 A;  2W3E A;  2KDK A;  1P9R A;  2NUP C;  1UGU A;  5DF9 A;  2EWV A;  3LR0 A;  2PDR A;  3P01 A;  3R4K A;  4DMZ A;  4FOF A;  5F68 A;  4WUJ A;  2GZA A;  1YAX A;  4I38 A;  4HP9 A;  2VV7 A;  2M1C A;  2VGL S;  2HGV A;  5TBM A;  3T4Q A;  4Q0I A;  1S67 L;  5HWW A;  4YNR A;  5AVE A;  1D06 A;  3H82 A;  3K3C A;  1DP9 A;  3KX0 X;  1T19 A;  4MN6 A;  2O9B A;  2O9C A;  4JGP A;  3S7Q A;  1G28 A;  3LI9 A;  4KQO A;  3LR4 A;  1XJ6 A;  3KSG A;  3T4O A;  1VB6 A;  1N9O A;  4MDZ A;  1ZTU A;  2DMW A;  3BW6 A;  4GCZ A;  2QYB A;  2K2N A;  1NLY A;  3PBN A;  4Y3I A;  3B33 A;  2JKT I;  2G7U A;  2W3F A;  3H7W A;  3FPV A;  2QJ5 A;  3BY8 A;  4CLC C;  1OTA A;  1MC0 A;  2A24 A;  5HL6 A;  2MJ6 A;  4IUK A;  4LRY C;  2VX8 A;  5IU1 A;  4EUV A;  3OOV A;  4L9F A;  4GJ4 A;  5IT5 A;  5TJJ A;  3HJI A;  4I3J A;  4II7 A;  2PD7 A;  3K2N A;  3T4L A;  2PHY A;  2D02 A;  2O9A A;  1LSX A;  2WKP A;  4MMN A;  2PYR A;  2FH5 A;  4OOM A;  3H9W A;  5G4Z A;  4NEE D;  3BJN A;  1OJG A;  2XA7 S;  4LLO B;  5AJG A;  3KSI A;  4L0L A;  3F1O A;  3VOL A;  3CIT A;  1OT9 A;  5HD5 A;  5TBM B;  1STZ A;  2Y8H A;  2M7V A;  2YKH A;  5J3W A;  3LYX A;  4G3V A;  3H82 B;  4O01 A;  4PAU A;  3C8C A;  3PYP A;  3PR6 A;  4IJG A;  4UQI S;  5F5Y A;  1NWZ A;  1H8M A;  1VHM A;  4HNB A;  2R78 A;  1T1B A;  4EU0 A;  3RH8 B;  2CMN A;  2M7U A;  4WL9 A;  2A2L A;  2EA9 A;  4GW9 A;  2Y79 A;  3B47 A;  3UE6 A;  4XT2 A;  3LUQ A;  4KUK A;  4EET B;  3KYZ A;  3UME A;  4WEK A;  4DN0 A;  1DRM A;  2PR6 A;  3E4O A;  3EGD C;  1DP6 A;  2D01 A;  4HJ3 A;  5DFX A;  1T1C A;  1LT0 A;  1UWN X;  2VKS A;  1OJ5 A;  4HJ6 A;  1W63 M;  4O8G A;  2B18 A;  2A24 B;  4NXG A;  1N9N A;  4EEU A;  4I3I A;  4B9O A;  2IA2 A;  3MQ0 A;  4H6J A;  3TRC A;  4DJ3 A;  3E4Q A;  3S7N A;  2VLG A;  3VV4 A;  1P0Z A;  2VV6 A;  1H3Q A;  4OOL A;  5HWV A;  2FZ0 A;  1D7E A;  3F1P B;  3JVU A;  1BYW A;  5F6A A;  1OTD A;  3F1O B;  2JKT M;  3EEH A;  3IS2 A;  1GSX A;  3NOP C;  3D3O A;  3NOT C;  3OBF A;  4WEL A;  4IUH A;  2W1R A;  1S1Y A;  2WKR A;  2JN7 A;  2P04 A;  2ZMV A;  3CWF A;  4I39 A;  3T4T A;  3BWL A;  4R6L A;  2B02 A;  3D72 A;  5LBR A;  3PBO A;  3LID A;  2GJ3 A;  5G4Y A;  4GS9 B;  4EER A;  4XT2 B;  4CLC A;  3GEC A;  3ZYT A;  3E4P A;  4G3W A;  1T18 A;  1DP8 A;  3IBJ A;  1P97 A;  3OLO A;  2L4R A;  3UB8 A;  3UB6 A;  3K3D A;  4R70 A;  3V67 A;  1TS8 A;  2O0Y A;  4H6J B;  4CLC D;  1LSV A;  1XJ3 A;  1S4R A;  1TF1 A;  3PHY A;  2OOL A;  2J3T C;  4DJ2 A;  2JHE A;  1YSQ A;  2HJ9 C;  4GLQ A;  2HJE A;  4F3L A;  3EQU A;  3LIC A;  3LIE A;  4NXF A;  2W1T A;  4L9E A;  4BBV A;  4I3A A;  4R38 A;  4ZRR A;  4E04 A;  3FG8 A;  4Z1W A;  4YWZ A;  4FSF A;  5DJT A;  3MQQ A;  3NJA A;  3IS2 B;  3HJK A;  1Y28 A;  1ODV A;  2BAS A;  3LIB A;  3A0V A;  1GSV A;  4QPR A;  5A8B A;  4HOI A;  4BBT A;  2VJW A;  1UWP X;  4EW7 A;  3PXP A;  3MXQ A;  3MMH A;  2Z6D A;  2ZMF A;  1V9Y A;  3PBR A;  4BJP A;  5J7E A;  3BY9 A;  3KSF A;  2VZW A;  4CLC B;  4HI4 A;  2W27 A;  3C38 A;  4KUO A;  3LIF A;  2PR5 A;  4JGQ A;  2PYP A;  3CUE C;  2LB5 A;  4UEY A;  3C30 A;  4G3K A;  2QKP A;  4LRX C;  1YSP A;  1XFN A;  3A0R A;  3NOU C;  2W3H A;  3C2W A;  3W2Z A;  2K7S A;  3OCL A;  4ME4 A;  1IFQ A;  2JKR I;  2J3W A;  5EFW A;  4M4X A;  4HH3 A;  2GX5 A;  5HPF A;  4F3L B;  3H7W B;  2W1T B;  5FL3 A;  3P7N A;  2KX6 A;  3CI6 A;  1MKM A;  4EXO A;  1OTE A;  3EWK A;  3EQV A;  4Q0J A;  5L8M A;  3ICY A;  3EEA A;  4O0P A;  3BQA A;  4R3A A;  4ETZ A;  3E98 A;  4HH2 A;  5J4E A;  3ZQ5 A;  5DFY A;  4MN7 A;  2VA0 A;  5K5B A;  4ARZ A;  3UMD A;  3DBA A;  1XJ4 A;  4CLC E;  4IHQ A;  3LR3 A;  3B42 A;  3RFB A;  3NHQ A;  5KIZ A;  1TS0 A;  4WLA A;  3GDI A;  4HP4 A;  4MCW A;  5IS1 A;  2ZOH A;  2O99 A;  2Z6C A;  4WF0 A;  4PHT A;  1OT6 A;  3U2A A;  3TE8 A;  3OC2 A;  4JGR A;  4MN5 A;  3T4S A;  1F5M A;  2NUT C;  3EGX C;  5DKL A;  3CAX A;  2V9A A;  3A0S A;  3O5Y A;  4B93 A;  3LR5 A;  1XJ2 A;  4AFI A;  1OTI A;  1OTB A;  2KLI A;  4YOF A;  2W3D A;  2HF6 A;  3MQO A;  2I9V A;  3SW1 A;  3UE3 A;  3RTY A;  4LRZ E;  2WKQ A;  1LL8 A;  4HQA A;  2J3T D;  3T4J A;  1LSW A;  5HZH A;  3T50 A;  5KSH A;  3R7W A;  2W0N A;  1N9L A;  2INW A;  2L0W A;  3KSH A;  5MC7 A;  3CLO A;  2W3G A;  2QJ7 A;  4HIA A;  2VGL M;  5I5L A;  5F69 A;  4ARZ B;  5HDC A;  2JKR M;  4PKY A;  1NLZ A;  1TS6 A;  3TJZ C;  1IOU A;  1XFQ A;  4RQ9 A;  4JGO A;  4PKY G;  4EEP A;  1GSW A;  3MR0 A;  3BQ8 A;  3CUE A;  1NRJ A;  4CQH A;  1V9Z A;  4BWI A;  1S66 L;  5C5K A;  4Y5F A;  1OPX A;  2L1M A;  1JNU A;  3PBS A;  4NXE A;  2EWW A;  2QHK A;  3HCY A;  2QWS A;  2GNX A;  3FPW A;  1KOU A;  4I5S A;  1P9W A;  1X0O A;  1TS7 A;  3LFV A;  3TW8 A;  1F9I A;  5HD3 A;  4WEJ A;  3E0Y A;  1T1A A;  4NXB A;  4BBU A;  3PBT A;  3ULF A;  3OCN A;  4K08 A;  3F1P A;  4GHI A;  5HDD A;  3F1N A;  2KOI A;  2V1A A;  5HSQ A;  4WN5 A;  3UB9 A;  2PT7 A;  4EQ1 A;  5DKK A;  3R7W B;  1EW0 A;  4P6Z S;  2XA7 M;  2P08 A;  3LIA A;  3JVV A;  1G6O A;  3S7P A;  1ZHH B;  2OAQ 1;  2VEA A;  4P6Z M;  2P7J A;  2XRO A;  3T4K A;  2OWJ A;  3LI8 A;  2OWH A;  4BMW A;  4EES A;  2ZBB A;  3PBQ A;  5CX7 A;  2K31 A;  2H28 A;  3KYQ A;  2XSS A;  2LB9 A;  2V0U A;  4GS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...