2GX5A

N-terminal gaf domain of transcriptional pleiotropic repressor cody
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
161
structure length
157
Chain Sequence
HMALLQKTRIINSMLQAAAGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDRMKKMLEDRQFPEEYTKNLFNVPETSSNLDINSFPVENRDLFQAGLTTIVPIIGGGERLGTLILSRLQDQFNDDDLILAEYGATVVGMEILREKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of CodY, a GTP- and isoleucine-responsive regulator of stationary phase and virulence in gram-positive bacteria.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords GTP-sensing transcriptional pleiotropic repressor codY
total genus 55
structure length 157
sequence length 161
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2gx5A00
3D3OA 3NOUC 4G3KA 4O0PA 2KOIA 3BJNA 4O8GA 4ZRRA 3OBFA 5K5BA 2W3DA 4PAUA 5DFYA 2M7VA 3MQ0A 3VV4A 4MCWA 5HSQA 5DFXA 2O9BA 4LRYC 4Y3IA 3OOVA 4GW9A 4G3WA 1YSPA 4MMNA 4Q0HA 4RQ9A 4ME4A 4G3VA 3C2WA 2O0YA 3IBJA 3KSGA 2W3EA 5TJJA 2W3GA 1VHMA 4ETZA 4R6LA 1MC0A 1YSQA 3KSHA 1TD5A 2VEAA 4DMZA 4YOFA 2VKSA 4MDZA 4DN0A 4QPRA 2KLIA 5AJGA 2XRNA 4LRXC 5HPFA 3IBRA 1MKMA 3LFVA 3MF0A 4MN7A 4Y5FA 2K31A 4Z1WA 1F5MA 2G7UA 3EEAA 2K2NA 4Q0JA 3E0YA 4IUKA 2XROA 2LB9A 2VZWA 4FOFA 4IUHA 1YKDA 2O99A 5LBRA 2VJWA 5HPIA 2LB5A 2IA2A 3ZQ5A 2QYBA 3KSFA 2Y79A 3KSIA 3G6OA 2W1RA 3S7QA 3W2ZA 1ZTUA 3S7NA 3O5YA 4Y2FA 2W3FA 5L8MA 1STZA 2HGVA 3NOTC 4EU0A 3S7OA 3MMHA 3RFBA 4EUVA 5I5LA 5C5KA 3HCYA 2OOLA 2M7UA 4Q0IA 3CITA 4R70A 2O9AA 4LRZE 4IJGA 4E04A 2ZMFA 1TF1A 3DBAA 3KO6A 2W3HA 2W1TA 3NHQA 3NOPC 2XSSA 3S7PA 4YNRA 4CQHA 2B18A 4O01A 4BWIA 3K2NA 2W1TB 3R4KA 4GLQA 3CI6A 3TRCA 2Y8HA 3E98A 2O9CA 5HL6A 4ETXA 2GX5A
chains in the Genus database with same CATH superfamily
3IT9A 1YMXA 2KOIA 4P87A 3OBFA 4DJ3A 1Z6FA 4R3AA 4MCWA 4GNUA 4BQMA 4HP9A 5KZHA 2CC1A 4Q0HA 3N8RA 4FSFA 5EFWA 1GSWA 2EXBA 5F1FA 4FH4A 4Y7PA 3HUNA 1BT5A 4KZ5A 1YLWA 4PKYA 5HL1A 5EVIA 4QWOA 2Y2LA 4CPKA 3PBRA 3SS4A 5G4ZA 5DJTA 2Y2PA 1YT4A 3C30A 3LR5A 5CECA 4KG2A 3C4PA 2Z6CA 2Y59A 3QP1A 2ZOIA 4I3IA 2ZJ9A 3B3XA 2X01A 5EPHA 4S2IA 2IA2A 2Y2NA 3N6IA 5HAIA 3HJKA 5HD3A 1CJFA 4PM7A 4WYYA 3UE6A 3T4KA 5CEDA 4H6JB 5AQBA 1W63M 4CLCE 2GNXA 2WAFA 3CITA 3RJUA 2W3HA 1E4DA 3ZNYA 3NHQA 4PM9A 4MLLA 2B18A 1LT0A 3BY8A 3C8CA 1FCMA 1ZKJA 4E3KA 3UPOA 5EVLA 5HFOA 2HDRA 3H9WA 3MFXA 2ZC4B 3BEBA 1XJ2A 3ITBA 1H0MA 1OTIA 1VB6A 1TS7A 4JGOA 4QHCA 2JKTI 1W7FA 3GECA 5EM1A 3OOVA 3NI9A 4R1GA 1K6RA 4KZ3A 4MBFA 5E2GA 2PAVP 3FKVA 1H8MA 3K3CA 3D4FA 4BBVA 3BQAA 3C4OA 1YSQA 4KZBA 1FILA 4MDZA 2B5RA 2X71A 4OKPA 5EVIB 5HPFA 3H7WB 1MKMA 5E2FA 4PHTA 2XDMA 3VP1A 1JWZA 4ARZB 5E2EA 3IHBA 3OC2A 1I5QA 5CHJA 1G6AA 3GQZA 3N4IA 4IUHA 4BJPA 4E3NA 4JXGA 4JXWA 1K4EA 5KSCA 3MKFA 2LB5A 2HDUA 2VGJA 1QMEA 1JVJA 5AQ7A 3MQOA 3CLOA 2K7SA 3FC7A 2QHKA 5BOHA 5IHVA 3R7WA 3NOTC 1L0DA 3NBLA 3B42A 5FDHA 2QMIA 3HLDA 4E04A 3KO6A 4EQ1A 4UAAA 5E2HA 4OOYA 3UB5P 3OZHA 3F1OB 2KX6A 4ESPA 4BBUA 4DE3A 2QWSA 5CX7A 4LGWA 1SHVA 2BASA 3NOUC 5K5BA 1GSXA 3GMWA 3K3DA 2P7JA 1K55C 1NZUA 1K54A 2R9XA 3PXPA 1BYWA 2M7VA 2VGKA 3WS5A 4JXSA 1AWIA 1PI4A 1F9IA 2OWHA 2XD5A 3V50A 2J3TD 2Y91A 3U2AA 1PW8A 4OONA 1TD5A 5HARA 4DN0A 3L9KA 4MNRA 3UB9A 4BD0A 3NDEA 2RL3A 3G32A 3GSGA 1YLJA 4Y5FA 2EX2A 4PMAA 3CAXA 3EEAA 4PKYG 4RA7A 1HLUP 2Z6DA 4M3KA 2A2LA 5FI2A 5FI6A 5L09A 1D1JA 3Q7VA 4X56A 5FEGA 1EWZA 1VETB 4GOGA 4L0LA 1ES3A 4LV0A 5AQAA 4KQRA 2VV8A 3ZQ5A 3VOYA 1S4RA 3PBQA 3Q82A 3W4OA 2Y2KA 2W3FA 1G6OA 3SOIA 2PR6A 5HDSA 4JLFA 3EQUA 1I2WA 1W8YA 1NRJA 2PD7A 2PU2A 4HOIA 1CK3A 3HLWA 1VETA 2NUPC 3WRZA 4DDYA 1T19A 1T1CA 3DTEA 4S2KA 4GLQA 1XKZA 4NK3A 3IH8A 1DP9A 5IU1A 4RX2A 2W0NA 5L2FA 3BJNA 3O87A 3UB8A 5FEFA 4UA6A 1S1ZA 3MJQA 5DFXA 5A8BA 3C7UA 2HP6A 3HL9A 4NXGA 4ZAMA 3T4LA 4MMNA 3TSGA 1KDSA 4ME4A 3E2LA 4KQDA 4KENB 4R0QA 1O7EA 2C6WB 3PBNA 4HJ4A 4X55A 2W3EA 1VHMA 5TFQA 2XH9A 3PYPA 1K57C 3FZCA 1ES4A 5KMWA 3WS2A 5AJGA 1K54C 4GD8A 2JC7A 1XXMA 4N1XA 2Z2LB 3VOLA 2QJ5A 4QU3A 3DAVA 5HX9A 4DKIA 2B02A 1Y28A 5L10A 2DCFA 3G2YA 1YQSA 1ERQA 4IBRA 1S4SA 2PU4A 1YKDA 3ULFA 4P6ZM 2ACGA 2VJWA 1Z09A 3G34A 3Q1FA 3KSFA 2Y79A 2HJ9C 3UE3A 1L0GA 2ZMVA 3W8KA 2V0WA 4LV2A 1N9NA 3UNWA 1S0WA 1S6RA 3ZG9B 4KZ4A 3LR3A 2O9AA 3L7HA 4BLMA 4IJGA 1JNUA 1SCWA 3U4LP 3NOPC 1GCEA 4YNRA 3VOZA 1W8QA 2UWXA 4RYEA 5F69A 4F3LA 2H28A 4GS9A 2WKIA 2JN7A 1KE4A 3CUEC 3UB6A 4ETXA 2GJ3A 4HJ6A 4O0PA 1T18A 4O8GA 1DY6A 4XUXA 3V5MA 4EEUA 3C38A 2BLSA 4Y3IA 1PIOA 1G28A 3ZG7B 1O07A 3LUQA 4EQIA 3EGDC 3KSGA 3BW6A 4EUZA 3JVUA 3LICA 2Q9NA 1VM1A 4LCMA 1IFQA 4OPZA 2HDQA 4OP8A 4PM8A 2VA0A 4OVDA 2QKPA 1H3QA 4EXOA 2G7UA 1OTEA 1SDEA 2K2NA 2JKFA 3CWFA 5G4YA 5FDSA 3Q07A 2ZC6B 4OOLA 5DKLA 2O99A 3MS6A 4EW7A 1ESUA 4MN5A 1BLHA 2QYBA 2WGIA 3P01A 4OPQA 1A0KA 2XR0A 2DNSA 4WF0A 4IHQA 3I7JA 1M40A 5L8MA 2HGVA 2V1AA 3VSLA 3A3EA 3P98A 5I5LA 5C5KA 1G68A 1ONHA 4FUWA 3SH8A 1MKIA 3NIAA 2W1TB 5EVIC 4LV1A 4L9GA 4WZ4A 1MWUA 4B88A 3T4TA 4G3KA 4WBGA 3CPTA 2GZAA 4NXFA 5IS1A 2OAQ1 2EX9A 1YLTA 1IELA 5GLCA 2EX6A 4G3VA 3C2WA 5DF7A 3LCEA 2W3GA 4ETZA 3FWLA 3A3IA 3M6BA 2H0YA 1OT6A 3JVVA 4LV3A 5CGWA 3EWKA 2BG1A 3IBRA 2QJ7A 3QP6A 2JHEA 1W5DA 1MY8A 4Z1WA 4S2JA 3H7WA 3D72A 2EWVA 4F3LB 1PZPA 1AXBA 4ZDXA 1W63Q 5HAPA 2XROA 4L9FA 3HBRA 4BL3A 1N9OA 4QJGA 2WZZA 3LI9A 1PZOA 3VSKA 1NYMA 3O88A 4LLOB 2G2UA 5DKKA 2ZMAA 2XLNA 3HLFA 3T4JA 5FAQA 3OPRA 2PBYA 2DMWA 4KQOA 4CLCD 3IF6A 3IWIA 1K25A 1NJ4A 2ZC7A 1HTZA 4K0WA 4I39A 1ALQA 1OMEA 3BLMA 3HLBA 1WYBA 4GJ4A 3D9YA 4ZTKA 3PBTA 4HH3A 5TGFA 1RGYA 5FL3A 3O86A 3OPHA 5L07A 3H82B 2GX5A 3D3OA 1LSWA 2Y2MA 3EQVA 1D06A 3KYEA 1Q2QA 1IYQA 2JKGA 5AQ9A 1SKOA 4G3WA 4KG6A 5G18A 4Y0UA 1LI9A 2I72A 4MN6A 2ZBBA 1XGJA 1MC0A 1K56D 3CMZA 1SKFA 5FQMA 4DDSA 2VGLS 3G4PA 3BYDA 3MZDA 3BWLA 3GRJA 2Y2OA 1ES5A 4WMCA 4EBLA 4E3LA 2Q0OA 3UMEA 4EBPA 4IUKA 3T1XA 1IYSA 1GSVA 3BFCA 5HD5A 1HD8A 4NXEA 3UDIA 4JKTA 4II7A 4Y17A 1LSVA 1PWCA 3IX3A 4WM9A 1TS6A 1P97A 1F98A 3MQQA 2W1RA 3F1OA 3PBOA 4HI4A 4UEYA 3HLGA 3A0RA 2PBDP 1KOUA 1MXOA 2OOLA 1BZAA 3UB7A 3IWOA 3VP0A 4LENA 3NDGA 4P0MA 3S7PA 2JKRI 3GV9A 2E8JA 4O01A 3E4OA 3B33A 2WGWA 1FR6A 3CI6A 2J80A 3IWQA 5EV0A 1W79A 1PI5A 4BMWA 5F82A 1XFNA 3HVFA 3JPUA 3PAEA 3MSHA 1PRQA 1XJ4A 4A5RA 3DTKA 1LHYA 3G35A 2O9BA 5CERA 4LRYC 1RP5A 4QB8A 4HIAA 5HDDA 4ARZA 2ZL1B 5EM0A 1SKOB 4OQHA 3CZDA 1K56A 1L0FA 5DTKA 4OQIA 3Q7VB 1DJAA 3UDFA 1KGEA 2UV0E 3T50A 3VP4A 3QHYA 2XA7S 4GHIB 3V67A 5I94A 4O7DA 1L0EA 3PTEA 1YLYA 1IKIA 3IXDA 1M6KA 2I9VA 1TS8A 2NUTC 4GN2A 2ZL1A 2PHYA 5HPIA 3ISGA 1TDGA 1LLBA 1ZTUA 1ONGA 4DXCA 2H10A 4EERA 4IVKA 1K4FA 5CHMA 3ZG8B 4DJ2A 3T1QB 3AGFA 3LEQA 1TF1A 3UPPA 3MBZA 2W1TA 1ACFA 5A93A 1KVMA 4JF5A 4N9KA 4EBNA 3LYXA 2Z2MB 4N9LA 5HL6A 3DW0A 2Q9MA 1OPXA 3RTYA 1OTBA 3F1PB 4K91A 3BY9A 3WRTA 1OJGA 3O3VA 2V9AA 4NXBA 4OPYA 1YAXA 3IF6B 1XFQA 1MZUA 3S4XA 1YSPA 2VLGA 2JE5A 4HHDA 3GDIA 1DJBA 4C75A 4N1HA 3G2ZA 4BENA 2Y2QA 1XA1A 4XT2A 4K08A 5TR7A 1FCNA 4OLDA 2INWA 2WKRA 1P9WA 4QPRA 4KUKA 3LR4A 1YMSA 3RH8B 3MF0A 3UY6A 2ZQ7A 1E3UD 1BLCA 4UQIM 2JKRM 3BFFA 3V3SA 3BLSA 3WS4A 4JF6A 3TG9A 5U47A 2OLUA 4BL2A 4E6XA 3OLOA 4P6BA 4JGPA 5TBMB 4E3OA 3ZFZA 2WZXA 2PRFA 1MWSA 4FH2A 4RX3A 1Q2PA 2OV5A 4E6WA 2FFFB 4P6ZS 3KSIA 2CMNA 4HBUA 3W2ZA 1JWVA 3M2KA 2PDRA 4YFMA 3NJAA 2D02A 3UO9A 4Q0IA 1YLPA 4EETB 1NLZA 4LRZE 4JXVA 2JBFA 3ICYA 4OQGA 4X53A 3HLEA 5JYOA 1FCOA 1JWPA 3TRCA 1FIKA 4E3MA 3N7WA 2Y8HA 5HWTA 3G30A 3PBSA 3LY3A 5AVEA 1S66L 4IBXA 4KQQA 3HLCA 1TEMA 1GA9A 4OP5A 1N9LA 4Q8IA 5FSRA 2DRWA 5HSQA 1H5XA 4MBHA 2H0TA 2L1MA 5DF8A 1XJ3A 4JPMA 1BUEA 3BECA 2VV6A 4S2NC 2ZQDA 1U60A 4PM6A 2C5WB 3ZYTA 2XQZA 4R6LA 3S22A 3SS3A 2V8FA 3HUOA 4DE1A 4K0XA 4EESA 4JGQA 3MR0A 5CEBA 1CF0A 4PPRA 3SH7A 1OTDA 2E8IA 5FQKA 3E0YA 1ZG4A 2ZQ8A 1IKGA 1ZC2A 3SW1A 2VZWA 4FOFA 1HVBA 4BBTA 3Q7ZA 4UHUA 4WL9A 3GVBA 5EUAA 2ZM8A 4CLCB 1JTGA 2L0WA 3EEHA 3S7QA 4U0XA 3S7NA 4HY8A 3IX4A 4KZ6A 5DJUA 4NKPA 2YKHA 3IH9A 1N9BA 2HJEA 3Q81A 2FFYA 4H6JA 1UWNX 1ZG6A 4GHIA 3K2NA 3P09A 3ZVTA 1VEUA 1IOUA 4C6YA 1E3UA 1ES2A 4CLCC 3SS5A 3H82A 1FOFA 2W3DA 3AGDA 1WE4A 1YPRA 1T1BA 1GHMA 5E43A 2IWCA 2FZ0A 1K55A 1L2SA 2OLVA 4Y15A 2HV1A 5F6AA 4UA9A 1KGFA 3A3JA 2V20A 1S1YA 3DWZA 3PAGA 4UQIS 1NY0A 3NULA 3UE1A 1XJ6A 1KGGA 3IS2B 4DRTA 1XGIA 2V1BA 3W4QA 5M19A 1BSGA 2ZC3B 2P04A 4LPZA 3WWXA 4WN5A 2WKHA 4MBKA 3ZVWA 2WGWB 1X0OA 2KDKA 1TVFA 3MXQA 3CPTB 3PR6A 2EX8A 4B4ZA 4X1MA 2LB9A 2WGVA 5M1AA 4I38A 1MBLA 1BLSA 1TS0A 2Y2JA 5FQIA 1IEMA 4B4XA 2EFXA 5JYPA 4XUZA 5KIZA 4R23A 1FQGA 2J3WA 3ITAA 3TOIA 4JF4A 4DE0A 3FV7A 1H8ZA 4ID4A 3UN7A 1C3BA 1WA9A 4OQ0A 4HNBA 3VE3A 5KSHA 3DTIA 3A3FA 4HQAA 4OOMA 2A24B 2XSSA 3OCNA 2HDSA 3C5AA 2Y2GA 1OTAA 3VFFA 3BRMA 1OJ5A 3E98A 5FAPA 4L9EA 2ZLYA 2R9WA 3LIAA 3UDXA 2XEPA 5EVEA 3S1YA 4PAUA 1GHPA 3MKEA 5CHUA 2V8CA 3HJIA 3BFGA 5J4EA 4GKUA 1PWDA 2WADA 3NY4A 1D7EA 1H8YA 4KG5A 2OAP1 2PR5A 4Y0OA 3BM6A 1IYOA 2XA7M 4EWFA 2RCXA 3KSHA 4DMZA 4YOFA 5J8XA 2KLIA 4I3AA 1YLZA 3EGXC 3FPWA 2Y55A 1V9ZA 3LFVA 2XD1A 3UE0A 5FQQA 5CGSA 5CTNA 1F5MA 1S67L 1UWPX 1RGZA 3MZFA 3T12B 2AVXA 1KE3A 4WLAA 3T4OA 3TJZC 4S2OA 1FSYA 3IX8A 4P85A 3IF5A 5GL9A 4DE2A 5HW3A 4GDBA 3F1NA 5EOOA 3ZNTA 1RCJA 1YM1A 2ZQ9A 1NWZA 2MJ6A 1NXYA 3DTMA 4HP4A 4EV4A 3N8SA 3ZGAB 3VP2A 2IWDA 4WZ5A 3TE8A 3VE4A 3B47A 3LGOA 5GLBA 1T1AA 2ZMFA 4Y13A 3A0SA 4KZ7A 5FI7A 4HH2A 1N4OA 4BWIA 4KZ8A 2A24A 5GHZA 4OH0A 2O9CA 3IQAA 3V39A 3F1PA 2X02A 4NETA 1SDNA 2J8YA 2JKTM 4ZRRA 2XK1A 2L4RA 5D3OA 5DFYA 5TBMA 5EE8A 4GS9B 1G5UA 1EROA 1MWRA 4QY6A 2Y2IA 3SH9A 3UPNA 4NEED 4RQ9A 1OT9A 2O0YA 5HWWA 4EEPA 3ZDJA 1WYCA 2PD8A 2EA9A 1K0KA 1PNEA 3ZCZA 1I2SA 5GLAA 4HEFA 1KE0A 1DP8A 2J9OA 2VEAA 1PYYA 4I3JA 2ZD8A 5F1GA 2HPBA 2V1ZA 4YWZA 1NLYA 3NECA 2Y2HA 4H8RA 4R3JA 4MN7A 2R78A 1PFLA 1K38A 3MXSA 4WUJA 5DTTA 4M4XA 5EVID 3GR2A 2A3UA 1PWGA 3LEZA 3T4QA 4N92A 1K57A 2FH5A 2P9VA 1V9YA 3KYQA 2ZOHA 3E4QA 4Y2FA 4S2PA 2EXAA 3TW8A 3LIFA 4HESA 4EU0A 1TDLA 1KVLA 3M6HA 1GA0A 2BTFP 1IYPA 4WEKA 2EWWA 3MZEA 3C7VA 2OSUA 4X6TA 4CQHA 4QY5A 4HBTA 1MPLA 2V2FF 5GHXA 3FG8A 5CGXA 3BQ8A 1P0ZA 4ZJ1A 3GTCA 4F94A 1J3WA 3W4PA 3T1SA 3IXHA 2J9PA 3QNCA 4E3JA 1Y54A 3LR0A 3MQ0A 1P9RA 5GLDA 3QNBA 3OCLA 4B9OA 4OPRA 2P9VB 5DVAA 3QP8A 2WYXA 5CTMA 2VV7A 4R4RA 2XFSA 2PYPA 3IF6C 5A92A 2VKSA 4BD1A 2ZC5B 2D01A 3LO7A 4OLGA 3ZG0A 4R38A 2XRNA 4LRXC 4ZJ3A 1VQQA 3VMAA 2H5SA 3RXWA 4B93A 1CEFA 3JYIA 1LI0A 2M1CA 1PW1A 2VGLM 3MXRA 2YKFA 1XA7A 1GHIA 5HZHA 3FYZA 2VK3A 4ZBEA 5DF9A 5FATA 3WS0A 3G6OA 5F83A 4QD4A 2HZ5A 3FKWA 3DWKA 3IXBA 1DRMA 5EOEA 3MMHA 4EUVA 1ODVA 3HCYA 5A91A 4NG2A 3DBAA 3M2JA 2V0UA 3E4PA 3QP5A 4X69A 3LY4A 2ZM0A 3CJMA 4GB7A 1ESIA 5FQ9A 3V3RA 1DJCA 2G2WA 4C3QA 2VX8A 4WZ5C 3T4SA 2EFUA 3HUMA 4FD8A 2ZQCA 1LL9A 5A90A 3E2KA 4JBFA 3WS1A 2QPNA 5DTSA 5FA7A 1QMFA 3RXXA 2ZQAA 1SZVA 1XX2A 1DP6A 3VFHA 3ZHHA 2GDNA 1NYYA 1XPBA 2WKPA 1KDWA 3KYZA 3NCKA 4E3IA 3LIBA 3HREA 4UA7A 1NZOA 2W27A 4Y0TA 2B95A 3CUEA 4FCFA 2HP9A 4Q0JA 5FQJA 3PHYA 2J3TC 3IS2A 5IT5A 4KZ9A 4U3TA 3T1RA 4GDNA 4KZAA 3VP3A 3QP4A 1EW0A 1E25A 2WKEA 4JGRA 1FSWA 4D60A 5F5YA 1CQAA 1CI8A 1NRFA 5HDCA 4MEZA 4YINA 1CI9A 4CJNA 4IEDA 3A0VA 4XXRA 3S7OA 3G31A 4I5SA 5EECA 1UGUA 2XFTA 5M18A 4AFIA 1VEUB 1Y4OA 5GHYA 3AGEA 5CRFA 5J7EA 1FR1A 3R4KA 2ZM2A 2WK0A 4PM5A 3UMDA 3F1NB 3BFDA 4D2OA 3OPLA 3IXGA 5FAOA 5MC7A 3LIDA 1XP4A 2JCHA 4LCLA 1BTLA 3KX0X 1ZHHB 3VV4A 1MWTA 4IVIA 1BULA 4RVAA 4U0TA 4HJ3A 4GW9A 5J3WA 1ERMA 4GD6A 3MFDA 4LFUA 1LL5A 1J9MA 3IBJA 1HZOA 5TJJA 2HF6A 2Y4AA 2WUQA 3NC8A 4WEJA 3P7NA 5HAQA 4R3BA 1BLPA 4FTXA 2K31A 4GCZA 1L3LA 3A3DA 4S2LA 2PT7A 2QZ6A 4DXBA 1JTDA 2J7VA 1LSXA 4KUOA 4WMCD 4DF6A 4Z9QA 3CG5A 1CEGA 2WAEA 5LBRA 1F2KA 3R7WB 4GZBA 5HWVA 3ZG5A 2A49A 4R4SA 2OWJA 2XGNA 1K6SA 2PYRA 4X1LA 5CXWA 2HP5A 3O5YA 4CLCA 4XT2B 1STZA 3IHAA 2P08A 4ZJ2A 4X25A 3RFBA 2M7UA 5F68A 3CHWP 3QP2A 4R70A 4WELA 2P74A 5FASA 1LL8A 4S2MA 3EOIA 2IWBA 3LI8A 5AVFA 1EI5A 3SZTA 3BFEA 3LIEA 2WKQA 3N8LA 2XF3A 4S2NA 3FPVA 3OPPA 4X68A
chains in the Genus database with same CATH topology
1OPXA 3RTYA 2JKTM 2GJ3A 4HJ6A 4O0PA 1T18A 1OTBA 2KOIA 3F1PB 4O8GA 4ZRRA 3OBFA 4ETXA 2L4RA 3BY9A 5DFYA 5TBMA 4DJ3A 4GS9B 4EEUA 4R3AA 1OJGA 4MCWA 3C38A 2V9AA 4NXBA 1YAXA 4HP9A 4Y3IA 1XFQA 1MZUA 1G28A 1YSPA 4NEED 2VLGA 3LUQA 4Q0HA 4RQ9A 1OT9A 4HHDA 2O0YA 3GDIA 5HWWA 4EEPA 3EGDC 2PD8A 2EA9A 3KSGA 3BW6A 3JVUA 3LICA 4FSFA 5EFWA 1GSWA 1DP8A 4XT2A 4K08A 2VEAA 1IFQA 4I3JA 2INWA 2WKRA 1P9WA 2VA0A 4QPRA 4KUKA 3LR4A 4YWZA 1NLYA 2QKPA 3RH8B 3MF0A 1H3QA 4MN7A 2R78A 4EXOA 4UQIM 2G7UA 1OTEA 2JKRM 2K2NA 3CWFA 5G4YA 4WUJA 4M4XA 4PKYA 4OOLA 3PBRA 5G4ZA 3OLOA 5DJTA 3LR5A 3C30A 4JGPA 5DKLA 5TBMB 3T4QA 2Z6CA 2O99A 4EW7A 2ZOIA 4I3IA 4MN5A 2IA2A 4P6ZS 2QYBA 2FH5A 3KSIA 3P01A 1V9YA 2CMNA 3W2ZA 3HJKA 4WF0A 3KYQA 4IHQA 2ZOHA 3E4QA 4Y2FA 5HD3A 5L8MA 3LIFA 3T4KA 2HGVA 4H6JB 3TW8A 2PDRA 3UE6A 1W63M 2V1AA 4CLCE 4EU0A 3NJAA 2GNXA 2D02A 5I5LA 5C5KA 4Q0IA 4EETB 3CITA 1NLZA 4LRZE 4WEKA 2EWWA 3ICYA 2W3HA 3NHQA 4CQHA 2B18A 1LT0A 2W1TB 3TRCA 3BY8A 3C8CA 3FG8A 2Y8HA 5HWTA 3BQ8A 3PBSA 4L9GA 1P0ZA 3H9WA 3MFXA 3T4TA 5AVEA 1S66L 4G3KA 1XJ2A 1OTIA 1N9LA 1VB6A 1TS7A 4JGOA 3LR0A 2GZAA 3MQ0A 1P9RA 2JKTI 5HSQA 4NXFA 2L1MA 3OCLA 2OAQ1 5IS1A 1XJ3A 3GECA 3OOVA 4B9OA 2VV6A 4G3VA 3C2WA 1H8MA 2VV7A 3K3CA 3ZYTA 4BBVA 2W3GA 4ETZA 3BQAA 4R6LA 1YSQA 2PYPA 2VKSA 4MDZA 2D01A 4EESA 4R38A 2XRNA 1OT6A 4JGQA 4LRXC 3JVVA 5HPFA 3EWKA 3IBRA 3H7WB 3MR0A 2QJ7A 1MKMA 2JHEA 4Z1WA 4PHTA 3H7WA 3D72A 1OTDA 2EWVA 4F3LB 4B93A 4ARZB 2M1CA 3E0YA 1W63Q 2XROA 4L9FA 3OC2A 1N9OA 3SW1A 2VGLM 2VZWA 2YKFA 4FOFA 4IUHA 3LI9A 5HZHA 4BBTA 4BJPA 4LLOB 4WL9A 5DKKA 5DF9A 3T4JA 2LB5A 4CLCB 2DMWA 3G6OA 2L0WA 3EEHA 4KQOA 3S7QA 4CLCD 3MQOA 3CLOA 2K7SA 3FC7A 3S7NA 2QHKA 4HY8A 3R7WA 5DJUA 4I39A 1DRMA 3NOTC 4NKPA 3MMHA 2YKHA 4EUVA 1ODVA 3HCYA 3B42A 2HJEA 4E04A 4H6JA 3DBAA 3KO6A 4GJ4A 4EQ1A 1UWNX 2V0UA 3E4PA 3F1OB 4GHIA 3PBTA 4HH3A 3K2NA 5FL3A 1IOUA 2KX6A 4BBUA 2QWSA 3H82B 5CX7A 2GX5A 3D3OA 2BASA 2VX8A 3NOUC 1LSWA 4CLCC 3H82A 5K5BA 1GSXA 3EQVA 2W3DA 3T4SA 3K3DA 2P7JA 3PXPA 1D06A 1BYWA 2M7VA 1T1BA 2FZ0A 2HV1A 4G3WA 1F9IA 5F6AA 2OWHA 1S1YA 4MN6A 2J3TD 3U2AA 2ZBBA 4UQIS 1MC0A 1DP6A 1XJ6A 1TD5A 3IS2B 2V1BA 4DN0A 3UB9A 2VGLS 2P04A 2WKPA 3KYZA 3LIBA 4LPZA 4Y5FA 4WN5A 2W27A 3BWLA 3CUEA 3CAXA 3EEAA 4PKYG 4Q0JA 1X0OA 3PHYA 2Z6DA 2KDKA 2A2LA 3UMEA 2J3TC 3IS2A 3MXQA 4IUKA 3PR6A 5IT5A 1GSVA 5HD5A 4L0LA 2LB9A 4NXEA 4I38A 4II7A 1TS0A 5KIZA 1LSVA 2VV8A 3ZQ5A 1EW0A 1TS6A 2J3WA 1P97A 1F98A 3MQQA 1S4RA 2W1RA 4JGRA 3PBQA 3F1OA 3PBOA 4HI4A 5F5YA 4UEYA 5HDCA 3A0RA 2W3FA 1G6OA 2PR6A 5HDSA 3A0VA 1KOUA 3S7OA 1WA9A 3EQUA 5KSHA 1NRJA 2PD7A 4HNBA 2OOLA 4I5SA 3VE3A 4HOIA 1UGUA 3UB7A 4HQAA 4OOMA 4AFIA 2NUPC 2A24B 2XSSA 3S7PA 2JKRI 3OCNA 4O01A 3E4OA 1T19A 1OTAA 1T1CA 3B33A 3R4KA 5J7EA 4GLQA 3CI6A 2J80A 3UMDA 1OJ5A 3F1NB 3E98A 4BMWA 4L9EA 1XFNA 1DP9A 5IU1A 5MC7A 3LIAA 1XJ4A 3LIDA 2W0NA 3BJNA 4PAUA 3KX0X 3UB8A 1ZHHB 1S1ZA 3VV4A 3MJQA 5DFXA 2O9BA 5A8BA 4LRYC 3HJIA 4HJ3A 5J4EA 4HIAA 4GW9A 5HDDA 4NXGA 4ARZA 3T4LA 5J3WA 4MMNA 4ME4A 4KQDA 1D7EA 2OAP1 2PR5A 3IBJA 4HJ4A 3PBNA 2W3EA 2XA7M 5TJJA 1VHMA 3KSHA 3PYPA 4DMZA 2HF6A 4YOFA 4WEJA 2KLIA 4I3AA 3P7NA 5AJGA 3EGXC 3FPWA 1V9ZA 3T50A 3LFVA 2K31A 1F5MA 4GCZA 1S67L 1UWPX 2PT7A 2XA7S 4GHIB 3VOLA 2QJ5A 3V67A 2B02A 4WLAA 1Y28A 1LSXA 4KUOA 3T4OA 3TJZC 1S4SA 2I9VA 1YKDA 1TS8A 2NUTC 5LBRA 3ULFA 4P6ZM 3R7WB 5HWVA 2PHYA 2VJWA 5HPIA 3F1NA 3KSFA 2Y79A 2HJ9C 1NWZA 3UE3A 2MJ6A 2ZMVA 2OWJA 1ZTUA 2PYRA 4HP4A 3O5YA 4EERA 4CLCA 4XT2B 2V0WA 1STZA 3TE8A 2P08A 4DJ2A 1N9NA 3VE4A 3RFBA 3B47A 2M7UA 5F68A 3LR3A 4WELA 4R70A 1T1AA 2O9AA 4IJGA 1JNUA 2ZMFA 1TF1A 3A0SA 1LL8A 2W1TA 4HH2A 3NOPC 3EOIA 4YNRA 3LI8A 5AVFA 4BWIA 5F69A 4F3LA 2H28A 3LYXA 2A24A 4GS9A 3LIEA 2JN7A 2O9CA 2WKQA 3CUEC 5HL6A 3F1PA 3UB6A 3FPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D3O A;  3NOU C;  4G3K A;  4O0P A;  2KOI A;  3BJN A;  4O8G A;  4ZRR A;  3OBF A;  5K5B A;  2W3D A;  4PAU A;  5DFY A;  2M7V A;  3MQ0 A;  3VV4 A;  4MCW A;  5HSQ A;  5DFX A;  2O9B A;  4LRY C;  4Y3I A;  3OOV A;  4GW9 A;  4G3W A;  1YSP A;  4MMN A;  4Q0H A;  4RQ9 A;  4ME4 A;  4G3V A;  3C2W A;  2O0Y A;  3IBJ A;  3KSG A;  2W3E A;  5TJJ A;  2W3G A;  1VHM A;  4ETZ A;  4R6L A;  1MC0 A;  1YSQ A;  3KSH A;  1TD5 A;  2VEA A;  4DMZ A;  4YOF A;  2VKS A;  4MDZ A;  4DN0 A;  4QPR A;  2KLI A;  5AJG A;  2XRN A;  4LRX C;  5HPF A;  3IBR A;  1MKM A;  3LFV A;  3MF0 A;  4MN7 A;  4Y5F A;  2K31 A;  4Z1W A;  1F5M A;  2G7U A;  3EEA A;  2K2N A;  4Q0J A;  3E0Y A;  4IUK A;  2XRO A;  2LB9 A;  2VZW A;  4FOF A;  4IUH A;  1YKD A;  2O99 A;  5LBR A;  2VJW A;  5HPI A;  2LB5 A;  2IA2 A;  3ZQ5 A;  2QYB A;  3KSF A;  2Y79 A;  3KSI A;  3G6O A;  2W1R A;  3S7Q A;  3W2Z A;  1ZTU A;  3S7N A;  3O5Y A;  4Y2F A;  2W3F A;  5L8M A;  1STZ A;  2HGV A;  3NOT C;  4EU0 A;  3S7O A;  3MMH A;  3RFB A;  4EUV A;  5I5L A;  5C5K A;  3HCY A;  2OOL A;  2M7U A;  4Q0I A;  3CIT A;  4R70 A;  2O9A A;  4LRZ E;  4IJG A;  4E04 A;  2ZMF A;  1TF1 A;  3DBA A;  3KO6 A;  2W3H A;  2W1T A;  3NHQ A;  3NOP C;  2XSS A;  3S7P A;  4YNR A;  4CQH A;  2B18 A;  4O01 A;  4BWI A;  3K2N A;  2W1T B;  3R4K A;  4GLQ A;  3CI6 A;  3TRC A;  2Y8H A;  3E98 A;  2O9C A;  5HL6 A;  4ETX A;  2GX5 A; 
#chains in the Genus database with same CATH topology
 3IT9 A;  1YMX A;  2KOI A;  4P87 A;  3OBF A;  4DJ3 A;  1Z6F A;  4R3A A;  4MCW A;  4GNU A;  4BQM A;  4HP9 A;  5KZH A;  2CC1 A;  4Q0H A;  3N8R A;  4FSF A;  5EFW A;  1GSW A;  2EXB A;  5F1F A;  4FH4 A;  4Y7P A;  3HUN A;  1BT5 A;  4KZ5 A;  1YLW A;  4PKY A;  5HL1 A;  5EVI A;  4QWO A;  2Y2L A;  4CPK A;  3PBR A;  3SS4 A;  5G4Z A;  5DJT A;  2Y2P A;  1YT4 A;  3C30 A;  3LR5 A;  5CEC A;  4KG2 A;  3C4P A;  2Z6C A;  2Y59 A;  3QP1 A;  2ZOI A;  4I3I A;  2ZJ9 A;  3B3X A;  2X01 A;  5EPH A;  4S2I A;  2IA2 A;  2Y2N A;  3N6I A;  5HAI A;  3HJK A;  5HD3 A;  1CJF A;  4PM7 A;  4WYY A;  3UE6 A;  3T4K A;  5CED A;  4H6J B;  5AQB A;  1W63 M;  4CLC E;  2GNX A;  2WAF A;  3CIT A;  3RJU A;  2W3H A;  1E4D A;  3ZNY A;  3NHQ A;  4PM9 A;  4MLL A;  2B18 A;  1LT0 A;  3BY8 A;  3C8C A;  1FCM A;  1ZKJ A;  4E3K A;  3UPO A;  5EVL A;  5HFO A;  2HDR A;  3H9W A;  3MFX A;  2ZC4 B;  3BEB A;  1XJ2 A;  3ITB A;  1H0M A;  1OTI A;  1VB6 A;  1TS7 A;  4JGO A;  4QHC A;  2JKT I;  1W7F A;  3GEC A;  5EM1 A;  3OOV A;  3NI9 A;  4R1G A;  1K6R A;  4KZ3 A;  4MBF A;  5E2G A;  2PAV P;  3FKV A;  1H8M A;  3K3C A;  3D4F A;  4BBV A;  3BQA A;  3C4O A;  1YSQ A;  4KZB A;  1FIL A;  4MDZ A;  2B5R A;  2X71 A;  4OKP A;  5EVI B;  5HPF A;  3H7W B;  1MKM A;  5E2F A;  4PHT A;  2XDM A;  3VP1 A;  1JWZ A;  4ARZ B;  5E2E A;  3IHB A;  3OC2 A;  1I5Q A;  5CHJ A;  1G6A A;  3GQZ A;  3N4I A;  4IUH A;  4BJP A;  4E3N A;  4JXG A;  4JXW A;  1K4E A;  5KSC A;  3MKF A;  2LB5 A;  2HDU A;  2VGJ A;  1QME A;  1JVJ A;  5AQ7 A;  3MQO A;  3CLO A;  2K7S A;  3FC7 A;  2QHK A;  5BOH A;  5IHV A;  3R7W A;  3NOT C;  1L0D A;  3NBL A;  3B42 A;  5FDH A;  2QMI A;  3HLD A;  4E04 A;  3KO6 A;  4EQ1 A;  4UAA A;  5E2H A;  4OOY A;  3UB5 P;  3OZH A;  3F1O B;  2KX6 A;  4ESP A;  4BBU A;  4DE3 A;  2QWS A;  5CX7 A;  4LGW A;  1SHV A;  2BAS A;  3NOU C;  5K5B A;  1GSX A;  3GMW A;  3K3D A;  2P7J A;  1K55 C;  1NZU A;  1K54 A;  2R9X A;  3PXP A;  1BYW A;  2M7V A;  2VGK A;  3WS5 A;  4JXS A;  1AWI A;  1PI4 A;  1F9I A;  2OWH A;  2XD5 A;  3V50 A;  2J3T D;  2Y91 A;  3U2A A;  1PW8 A;  4OON A;  1TD5 A;  5HAR A;  4DN0 A;  3L9K A;  4MNR A;  3UB9 A;  4BD0 A;  3NDE A;  2RL3 A;  3G32 A;  3GSG A;  1YLJ A;  4Y5F A;  2EX2 A;  4PMA A;  3CAX A;  3EEA A;  4PKY G;  4RA7 A;  1HLU P;  2Z6D A;  4M3K A;  2A2L A;  5FI2 A;  5FI6 A;  5L09 A;  1D1J A;  3Q7V A;  4X56 A;  5FEG A;  1EWZ A;  1VET B;  4GOG A;  4L0L A;  1ES3 A;  4LV0 A;  5AQA A;  4KQR A;  2VV8 A;  3ZQ5 A;  3VOY A;  1S4R A;  3PBQ A;  3Q82 A;  3W4O A;  2Y2K A;  2W3F A;  1G6O A;  3SOI A;  2PR6 A;  5HDS A;  4JLF A;  3EQU A;  1I2W A;  1W8Y A;  1NRJ A;  2PD7 A;  2PU2 A;  4HOI A;  1CK3 A;  3HLW A;  1VET A;  2NUP C;  3WRZ A;  4DDY A;  1T19 A;  1T1C A;  3DTE A;  4S2K A;  4GLQ A;  1XKZ A;  4NK3 A;  3IH8 A;  1DP9 A;  5IU1 A;  4RX2 A;  2W0N A;  5L2F A;  3BJN A;  3O87 A;  3UB8 A;  5FEF A;  4UA6 A;  1S1Z A;  3MJQ A;  5DFX A;  5A8B A;  3C7U A;  2HP6 A;  3HL9 A;  4NXG A;  4ZAM A;  3T4L A;  4MMN A;  3TSG A;  1KDS A;  4ME4 A;  3E2L A;  4KQD A;  4KEN B;  4R0Q A;  1O7E A;  2C6W B;  3PBN A;  4HJ4 A;  4X55 A;  2W3E A;  1VHM A;  5TFQ A;  2XH9 A;  3PYP A;  1K57 C;  3FZC A;  1ES4 A;  5KMW A;  3WS2 A;  5AJG A;  1K54 C;  4GD8 A;  2JC7 A;  1XXM A;  4N1X A;  2Z2L B;  3VOL A;  2QJ5 A;  4QU3 A;  3DAV A;  5HX9 A;  4DKI A;  2B02 A;  1Y28 A;  5L10 A;  2DCF A;  3G2Y A;  1YQS A;  1ERQ A;  4IBR A;  1S4S A;  2PU4 A;  1YKD A;  3ULF A;  4P6Z M;  2ACG A;  2VJW A;  1Z09 A;  3G34 A;  3Q1F A;  3KSF A;  2Y79 A;  2HJ9 C;  3UE3 A;  1L0G A;  2ZMV A;  3W8K A;  2V0W A;  4LV2 A;  1N9N A;  3UNW A;  1S0W A;  1S6R A;  3ZG9 B;  4KZ4 A;  3LR3 A;  2O9A A;  3L7H A;  4BLM A;  4IJG A;  1JNU A;  1SCW A;  3U4L P;  3NOP C;  1GCE A;  4YNR A;  3VOZ A;  1W8Q A;  2UWX A;  4RYE A;  5F69 A;  4F3L A;  2H28 A;  4GS9 A;  2WKI A;  2JN7 A;  1KE4 A;  3CUE C;  3UB6 A;  4ETX A;  2GJ3 A;  4HJ6 A;  4O0P A;  1T18 A;  4O8G A;  1DY6 A;  4XUX A;  3V5M A;  4EEU A;  3C38 A;  2BLS A;  4Y3I A;  1PIO A;  1G28 A;  3ZG7 B;  1O07 A;  3LUQ A;  4EQI A;  3EGD C;  3KSG A;  3BW6 A;  4EUZ A;  3JVU A;  3LIC A;  2Q9N A;  1VM1 A;  4LCM A;  1IFQ A;  4OPZ A;  2HDQ A;  4OP8 A;  4PM8 A;  2VA0 A;  4OVD A;  2QKP A;  1H3Q A;  4EXO A;  2G7U A;  1OTE A;  1SDE A;  2K2N A;  2JKF A;  3CWF A;  5G4Y A;  5FDS A;  3Q07 A;  2ZC6 B;  4OOL A;  5DKL A;  2O99 A;  3MS6 A;  4EW7 A;  1ESU A;  4MN5 A;  1BLH A;  2QYB A;  2WGI A;  3P01 A;  4OPQ A;  1A0K A;  2XR0 A;  2DNS A;  4WF0 A;  4IHQ A;  3I7J A;  1M40 A;  5L8M A;  2HGV A;  2V1A A;  3VSL A;  3A3E A;  3P98 A;  5I5L A;  5C5K A;  1G68 A;  1ONH A;  4FUW A;  3SH8 A;  1MKI A;  3NIA A;  2W1T B;  5EVI C;  4LV1 A;  4L9G A;  4WZ4 A;  1MWU A;  4B88 A;  3T4T A;  4G3K A;  4WBG A;  3CPT A;  2GZA A;  4NXF A;  5IS1 A;  2OAQ 1;  2EX9 A;  1YLT A;  1IEL A;  5GLC A;  2EX6 A;  4G3V A;  3C2W A;  5DF7 A;  3LCE A;  2W3G A;  4ETZ A;  3FWL A;  3A3I A;  3M6B A;  2H0Y A;  1OT6 A;  3JVV A;  4LV3 A;  5CGW A;  3EWK A;  2BG1 A;  3IBR A;  2QJ7 A;  3QP6 A;  2JHE A;  1W5D A;  1MY8 A;  4Z1W A;  4S2J A;  3H7W A;  3D72 A;  2EWV A;  4F3L B;  1PZP A;  1AXB A;  4ZDX A;  1W63 Q;  5HAP A;  2XRO A;  4L9F A;  3HBR A;  4BL3 A;  1N9O A;  4QJG A;  2WZZ A;  3LI9 A;  1PZO A;  3VSK A;  1NYM A;  3O88 A;  4LLO B;  2G2U A;  5DKK A;  2ZMA A;  2XLN A;  3HLF A;  3T4J A;  5FAQ A;  3OPR A;  2PBY A;  2DMW A;  4KQO A;  4CLC D;  3IF6 A;  3IWI A;  1K25 A;  1NJ4 A;  2ZC7 A;  1HTZ A;  4K0W A;  4I39 A;  1ALQ A;  1OME A;  3BLM A;  3HLB A;  1WYB A;  4GJ4 A;  3D9Y A;  4ZTK A;  3PBT A;  4HH3 A;  5TGF A;  1RGY A;  5FL3 A;  3O86 A;  3OPH A;  5L07 A;  3H82 B;  2GX5 A;  3D3O A;  1LSW A;  2Y2M A;  3EQV A;  1D06 A;  3KYE A;  1Q2Q A;  1IYQ A;  2JKG A;  5AQ9 A;  1SKO A;  4G3W A;  4KG6 A;  5G18 A;  4Y0U A;  1LI9 A;  2I72 A;  4MN6 A;  2ZBB A;  1XGJ A;  1MC0 A;  1K56 D;  3CMZ A;  1SKF A;  5FQM A;  4DDS A;  2VGL S;  3G4P A;  3BYD A;  3MZD A;  3BWL A;  3GRJ A;  2Y2O A;  1ES5 A;  4WMC A;  4EBL A;  4E3L A;  2Q0O A;  3UME A;  4EBP A;  4IUK A;  3T1X A;  1IYS A;  1GSV A;  3BFC A;  5HD5 A;  1HD8 A;  4NXE A;  3UDI A;  4JKT A;  4II7 A;  4Y17 A;  1LSV A;  1PWC A;  3IX3 A;  4WM9 A;  1TS6 A;  1P97 A;  1F98 A;  3MQQ A;  2W1R A;  3F1O A;  3PBO A;  4HI4 A;  4UEY A;  3HLG A;  3A0R A;  2PBD P;  1KOU A;  1MXO A;  2OOL A;  1BZA A;  3UB7 A;  3IWO A;  3VP0 A;  4LEN A;  3NDG A;  4P0M A;  3S7P A;  2JKR I;  3GV9 A;  2E8J A;  4O01 A;  3E4O A;  3B33 A;  2WGW A;  1FR6 A;  3CI6 A;  2J80 A;  3IWQ A;  5EV0 A;  1W79 A;  1PI5 A;  4BMW A;  5F82 A;  1XFN A;  3HVF A;  3JPU A;  3PAE A;  3MSH A;  1PRQ A;  1XJ4 A;  4A5R A;  3DTK A;  1LHY A;  3G35 A;  2O9B A;  5CER A;  4LRY C;  1RP5 A;  4QB8 A;  4HIA A;  5HDD A;  4ARZ A;  2ZL1 B;  5EM0 A;  1SKO B;  4OQH A;  3CZD A;  1K56 A;  1L0F A;  5DTK A;  4OQI A;  3Q7V B;  1DJA A;  3UDF A;  1KGE A;  2UV0 E;  3T50 A;  3VP4 A;  3QHY A;  2XA7 S;  4GHI B;  3V67 A;  5I94 A;  4O7D A;  1L0E A;  3PTE A;  1YLY A;  1IKI A;  3IXD A;  1M6K A;  2I9V A;  1TS8 A;  2NUT C;  4GN2 A;  2ZL1 A;  2PHY A;  5HPI A;  3ISG A;  1TDG A;  1LLB A;  1ZTU A;  1ONG A;  4DXC A;  2H10 A;  4EER A;  4IVK A;  1K4F A;  5CHM A;  3ZG8 B;  4DJ2 A;  3T1Q B;  3AGF A;  3LEQ A;  1TF1 A;  3UPP A;  3MBZ A;  2W1T A;  1ACF A;  5A93 A;  1KVM A;  4JF5 A;  4N9K A;  4EBN A;  3LYX A;  2Z2M B;  4N9L A;  5HL6 A;  3DW0 A;  2Q9M A;  1OPX A;  3RTY A;  1OTB A;  3F1P B;  4K91 A;  3BY9 A;  3WRT A;  1OJG A;  3O3V A;  2V9A A;  4NXB A;  4OPY A;  1YAX A;  3IF6 B;  1XFQ A;  1MZU A;  3S4X A;  1YSP A;  2VLG A;  2JE5 A;  4HHD A;  3GDI A;  1DJB A;  4C75 A;  4N1H A;  3G2Z A;  4BEN A;  2Y2Q A;  1XA1 A;  4XT2 A;  4K08 A;  5TR7 A;  1FCN A;  4OLD A;  2INW A;  2WKR A;  1P9W A;  4QPR A;  4KUK A;  3LR4 A;  1YMS A;  3RH8 B;  3MF0 A;  3UY6 A;  2ZQ7 A;  1E3U D;  1BLC A;  4UQI M;  2JKR M;  3BFF A;  3V3S A;  3BLS A;  3WS4 A;  4JF6 A;  3TG9 A;  5U47 A;  2OLU A;  4BL2 A;  4E6X A;  3OLO A;  4P6B A;  4JGP A;  5TBM B;  4E3O A;  3ZFZ A;  2WZX A;  2PRF A;  1MWS A;  4FH2 A;  4RX3 A;  1Q2P A;  2OV5 A;  4E6W A;  2FFF B;  4P6Z S;  3KSI A;  2CMN A;  4HBU A;  3W2Z A;  1JWV A;  3M2K A;  2PDR A;  4YFM A;  3NJA A;  2D02 A;  3UO9 A;  4Q0I A;  1YLP A;  4EET B;  1NLZ A;  4LRZ E;  4JXV A;  2JBF A;  3ICY A;  4OQG A;  4X53 A;  3HLE A;  5JYO A;  1FCO A;  1JWP A;  3TRC A;  1FIK A;  4E3M A;  3N7W A;  2Y8H A;  5HWT A;  3G30 A;  3PBS A;  3LY3 A;  5AVE A;  1S66 L;  4IBX A;  4KQQ A;  3HLC A;  1TEM A;  1GA9 A;  4OP5 A;  1N9L A;  4Q8I A;  5FSR A;  2DRW A;  5HSQ A;  1H5X A;  4MBH A;  2H0T A;  2L1M A;  5DF8 A;  1XJ3 A;  4JPM A;  1BUE A;  3BEC A;  2VV6 A;  4S2N C;  2ZQD A;  1U60 A;  4PM6 A;  2C5W B;  3ZYT A;  2XQZ A;  4R6L A;  3S22 A;  3SS3 A;  2V8F A;  3HUO A;  4DE1 A;  4K0X A;  4EES A;  4JGQ A;  3MR0 A;  5CEB A;  1CF0 A;  4PPR A;  3SH7 A;  1OTD A;  2E8I A;  5FQK A;  3E0Y A;  1ZG4 A;  2ZQ8 A;  1IKG A;  1ZC2 A;  3SW1 A;  2VZW A;  4FOF A;  1HVB A;  4BBT A;  3Q7Z A;  4UHU A;  4WL9 A;  3GVB A;  5EUA A;  2ZM8 A;  4CLC B;  1JTG A;  2L0W A;  3EEH A;  3S7Q A;  4U0X A;  3S7N A;  4HY8 A;  3IX4 A;  4KZ6 A;  5DJU A;  4NKP A;  2YKH A;  3IH9 A;  1N9B A;  2HJE A;  3Q81 A;  2FFY A;  4H6J A;  1UWN X;  1ZG6 A;  4GHI A;  3K2N A;  3P09 A;  3ZVT A;  1VEU A;  1IOU A;  4C6Y A;  1E3U A;  1ES2 A;  4CLC C;  3SS5 A;  3H82 A;  1FOF A;  2W3D A;  3AGD A;  1WE4 A;  1YPR A;  1T1B A;  1GHM A;  5E43 A;  2IWC A;  2FZ0 A;  1K55 A;  1L2S A;  2OLV A;  4Y15 A;  2HV1 A;  5F6A A;  4UA9 A;  1KGF A;  3A3J A;  2V20 A;  1S1Y A;  3DWZ A;  3PAG A;  4UQI S;  1NY0 A;  3NUL A;  3UE1 A;  1XJ6 A;  1KGG A;  3IS2 B;  4DRT A;  1XGI A;  2V1B A;  3W4Q A;  5M19 A;  1BSG A;  2ZC3 B;  2P04 A;  4LPZ A;  3WWX A;  4WN5 A;  2WKH A;  4MBK A;  3ZVW A;  2WGW B;  1X0O A;  2KDK A;  1TVF A;  3MXQ A;  3CPT B;  3PR6 A;  2EX8 A;  4B4Z A;  4X1M A;  2LB9 A;  2WGV A;  5M1A A;  4I38 A;  1MBL A;  1BLS A;  1TS0 A;  2Y2J A;  5FQI A;  1IEM A;  4B4X A;  2EFX A;  5JYP A;  4XUZ A;  5KIZ A;  4R23 A;  1FQG A;  2J3W A;  3ITA A;  3TOI A;  4JF4 A;  4DE0 A;  3FV7 A;  1H8Z A;  4ID4 A;  3UN7 A;  1C3B A;  1WA9 A;  4OQ0 A;  4HNB A;  3VE3 A;  5KSH A;  3DTI A;  3A3F A;  4HQA A;  4OOM A;  2A24 B;  2XSS A;  3OCN A;  2HDS A;  3C5A A;  2Y2G A;  1OTA A;  3VFF A;  3BRM A;  1OJ5 A;  3E98 A;  5FAP A;  4L9E A;  2ZLY A;  2R9W A;  3LIA A;  3UDX A;  2XEP A;  5EVE A;  3S1Y A;  4PAU A;  1GHP A;  3MKE A;  5CHU A;  2V8C A;  3HJI A;  3BFG A;  5J4E A;  4GKU A;  1PWD A;  2WAD A;  3NY4 A;  1D7E A;  1H8Y A;  4KG5 A;  2OAP 1;  2PR5 A;  4Y0O A;  3BM6 A;  1IYO A;  2XA7 M;  4EWF A;  2RCX A;  3KSH A;  4DMZ A;  4YOF A;  5J8X A;  2KLI A;  4I3A A;  1YLZ A;  3EGX C;  3FPW A;  2Y55 A;  1V9Z A;  3LFV A;  2XD1 A;  3UE0 A;  5FQQ A;  5CGS A;  5CTN A;  1F5M A;  1S67 L;  1UWP X;  1RGZ A;  3MZF A;  3T12 B;  2AVX A;  1KE3 A;  4WLA A;  3T4O A;  3TJZ C;  4S2O A;  1FSY A;  3IX8 A;  4P85 A;  3IF5 A;  5GL9 A;  4DE2 A;  5HW3 A;  4GDB A;  3F1N A;  5EOO A;  3ZNT A;  1RCJ A;  1YM1 A;  2ZQ9 A;  1NWZ A;  2MJ6 A;  1NXY A;  3DTM A;  4HP4 A;  4EV4 A;  3N8S A;  3ZGA B;  3VP2 A;  2IWD A;  4WZ5 A;  3TE8 A;  3VE4 A;  3B47 A;  3LGO A;  5GLB A;  1T1A A;  2ZMF A;  4Y13 A;  3A0S A;  4KZ7 A;  5FI7 A;  4HH2 A;  1N4O A;  4BWI A;  4KZ8 A;  2A24 A;  5GHZ A;  4OH0 A;  2O9C A;  3IQA A;  3V39 A;  3F1P A;  2X02 A;  4NET A;  1SDN A;  2J8Y A;  2JKT M;  4ZRR A;  2XK1 A;  2L4R A;  5D3O A;  5DFY A;  5TBM A;  5EE8 A;  4GS9 B;  1G5U A;  1ERO A;  1MWR A;  4QY6 A;  2Y2I A;  3SH9 A;  3UPN A;  4NEE D;  4RQ9 A;  1OT9 A;  2O0Y A;  5HWW A;  4EEP A;  3ZDJ A;  1WYC A;  2PD8 A;  2EA9 A;  1K0K A;  1PNE A;  3ZCZ A;  1I2S A;  5GLA A;  4HEF A;  1KE0 A;  1DP8 A;  2J9O A;  2VEA A;  1PYY A;  4I3J A;  2ZD8 A;  5F1G A;  2HPB A;  2V1Z A;  4YWZ A;  1NLY A;  3NEC A;  2Y2H A;  4H8R A;  4R3J A;  4MN7 A;  2R78 A;  1PFL A;  1K38 A;  3MXS A;  4WUJ A;  5DTT A;  4M4X A;  5EVI D;  3GR2 A;  2A3U A;  1PWG A;  3LEZ A;  3T4Q A;  4N92 A;  1K57 A;  2FH5 A;  2P9V A;  1V9Y A;  3KYQ A;  2ZOH A;  3E4Q A;  4Y2F A;  4S2P A;  2EXA A;  3TW8 A;  3LIF A;  4HES A;  4EU0 A;  1TDL A;  1KVL A;  3M6H A;  1GA0 A;  2BTF P;  1IYP A;  4WEK A;  2EWW A;  3MZE A;  3C7V A;  2OSU A;  4X6T A;  4CQH A;  4QY5 A;  4HBT A;  1MPL A;  2V2F F;  5GHX A;  3FG8 A;  5CGX A;  3BQ8 A;  1P0Z A;  4ZJ1 A;  3GTC A;  4F94 A;  1J3W A;  3W4P A;  3T1S A;  3IXH A;  2J9P A;  3QNC A;  4E3J A;  1Y54 A;  3LR0 A;  3MQ0 A;  1P9R A;  5GLD A;  3QNB A;  3OCL A;  4B9O A;  4OPR A;  2P9V B;  5DVA A;  3QP8 A;  2WYX A;  5CTM A;  2VV7 A;  4R4R A;  2XFS A;  2PYP A;  3IF6 C;  5A92 A;  2VKS A;  4BD1 A;  2ZC5 B;  2D01 A;  3LO7 A;  4OLG A;  3ZG0 A;  4R38 A;  2XRN A;  4LRX C;  4ZJ3 A;  1VQQ A;  3VMA A;  2H5S A;  3RXW A;  4B93 A;  1CEF A;  3JYI A;  1LI0 A;  2M1C A;  1PW1 A;  2VGL M;  3MXR A;  2YKF A;  1XA7 A;  1GHI A;  5HZH A;  3FYZ A;  2VK3 A;  4ZBE A;  5DF9 A;  5FAT A;  3WS0 A;  3G6O A;  5F83 A;  4QD4 A;  2HZ5 A;  3FKW A;  3DWK A;  3IXB A;  1DRM A;  5EOE A;  3MMH A;  4EUV A;  1ODV A;  3HCY A;  5A91 A;  4NG2 A;  3DBA A;  3M2J A;  2V0U A;  3E4P A;  3QP5 A;  4X69 A;  3LY4 A;  2ZM0 A;  3CJM A;  4GB7 A;  1ESI A;  5FQ9 A;  3V3R A;  1DJC A;  2G2W A;  4C3Q A;  2VX8 A;  4WZ5 C;  3T4S A;  2EFU A;  3HUM A;  4FD8 A;  2ZQC A;  1LL9 A;  5A90 A;  3E2K A;  4JBF A;  3WS1 A;  2QPN A;  5DTS A;  5FA7 A;  1QMF A;  3RXX A;  2ZQA A;  1SZV A;  1XX2 A;  1DP6 A;  3VFH A;  3ZHH A;  2GDN A;  1NYY A;  1XPB A;  2WKP A;  1KDW A;  3KYZ A;  3NCK A;  4E3I A;  3LIB A;  3HRE A;  4UA7 A;  1NZO A;  2W27 A;  4Y0T A;  2B95 A;  3CUE A;  4FCF A;  2HP9 A;  4Q0J A;  5FQJ A;  3PHY A;  2J3T C;  3IS2 A;  5IT5 A;  4KZ9 A;  4U3T A;  3T1R A;  4GDN A;  4KZA A;  3VP3 A;  3QP4 A;  1EW0 A;  1E25 A;  2WKE A;  4JGR A;  1FSW A;  4D60 A;  5F5Y A;  1CQA A;  1CI8 A;  1NRF A;  5HDC A;  4MEZ A;  4YIN A;  1CI9 A;  4CJN A;  4IED A;  3A0V A;  4XXR A;  3S7O A;  3G31 A;  4I5S A;  5EEC A;  1UGU A;  2XFT A;  5M18 A;  4AFI A;  1VEU B;  1Y4O A;  5GHY A;  3AGE A;  5CRF A;  5J7E A;  1FR1 A;  3R4K A;  2ZM2 A;  2WK0 A;  4PM5 A;  3UMD A;  3F1N B;  3BFD A;  4D2O A;  3OPL A;  3IXG A;  5FAO A;  5MC7 A;  3LID A;  1XP4 A;  2JCH A;  4LCL A;  1BTL A;  3KX0 X;  1ZHH B;  3VV4 A;  1MWT A;  4IVI A;  1BUL A;  4RVA A;  4U0T A;  4HJ3 A;  4GW9 A;  5J3W A;  1ERM A;  4GD6 A;  3MFD A;  4LFU A;  1LL5 A;  1J9M A;  3IBJ A;  1HZO A;  5TJJ A;  2HF6 A;  2Y4A A;  2WUQ A;  3NC8 A;  4WEJ A;  3P7N A;  5HAQ A;  4R3B A;  1BLP A;  4FTX A;  2K31 A;  4GCZ A;  1L3L A;  3A3D A;  4S2L A;  2PT7 A;  2QZ6 A;  4DXB A;  1JTD A;  2J7V A;  1LSX A;  4KUO A;  4WMC D;  4DF6 A;  4Z9Q A;  3CG5 A;  1CEG A;  2WAE A;  5LBR A;  1F2K A;  3R7W B;  4GZB A;  5HWV A;  3ZG5 A;  2A49 A;  4R4S A;  2OWJ A;  2XGN A;  1K6S A;  2PYR A;  4X1L A;  5CXW A;  2HP5 A;  3O5Y A;  4CLC A;  4XT2 B;  1STZ A;  3IHA A;  2P08 A;  4ZJ2 A;  4X25 A;  3RFB A;  2M7U A;  5F68 A;  3CHW P;  3QP2 A;  4R70 A;  4WEL A;  2P74 A;  5FAS A;  1LL8 A;  4S2M A;  3EOI A;  2IWB A;  3LI8 A;  5AVF A;  1EI5 A;  3SZT A;  3BFE A;  3LIE A;  2WKQ A;  3N8L A;  2XF3 A;  4S2N A;  3FPV A;  3OPP A;  4X68 A; 
#chains in the Genus database with same CATH homology
 1OPX A;  3RTY A;  2JKT M;  2GJ3 A;  4HJ6 A;  4O0P A;  1T18 A;  1OTB A;  2KOI A;  3F1P B;  4O8G A;  4ZRR A;  3OBF A;  4ETX A;  2L4R A;  3BY9 A;  5DFY A;  5TBM A;  4DJ3 A;  4GS9 B;  4EEU A;  4R3A A;  1OJG A;  4MCW A;  3C38 A;  2V9A A;  4NXB A;  1YAX A;  4HP9 A;  4Y3I A;  1XFQ A;  1MZU A;  1G28 A;  1YSP A;  4NEE D;  2VLG A;  3LUQ A;  4Q0H A;  4RQ9 A;  1OT9 A;  4HHD A;  2O0Y A;  3GDI A;  5HWW A;  4EEP A;  3EGD C;  2PD8 A;  2EA9 A;  3KSG A;  3BW6 A;  3JVU A;  3LIC A;  4FSF A;  5EFW A;  1GSW A;  1DP8 A;  4XT2 A;  4K08 A;  2VEA A;  1IFQ A;  4I3J A;  2INW A;  2WKR A;  1P9W A;  2VA0 A;  4QPR A;  4KUK A;  3LR4 A;  4YWZ A;  1NLY A;  2QKP A;  3RH8 B;  3MF0 A;  1H3Q A;  4MN7 A;  2R78 A;  4EXO A;  4UQI M;  2G7U A;  1OTE A;  2JKR M;  2K2N A;  3CWF A;  5G4Y A;  4WUJ A;  4M4X A;  4PKY A;  4OOL A;  3PBR A;  5G4Z A;  3OLO A;  5DJT A;  3LR5 A;  3C30 A;  4JGP A;  5DKL A;  5TBM B;  3T4Q A;  2Z6C A;  2O99 A;  4EW7 A;  2ZOI A;  4I3I A;  4MN5 A;  2IA2 A;  4P6Z S;  2QYB A;  2FH5 A;  3KSI A;  3P01 A;  1V9Y A;  2CMN A;  3W2Z A;  3HJK A;  4WF0 A;  3KYQ A;  4IHQ A;  2ZOH A;  3E4Q A;  4Y2F A;  5HD3 A;  5L8M A;  3LIF A;  3T4K A;  2HGV A;  4H6J B;  3TW8 A;  2PDR A;  3UE6 A;  1W63 M;  2V1A A;  4CLC E;  4EU0 A;  3NJA A;  2GNX A;  2D02 A;  5I5L A;  5C5K A;  4Q0I A;  4EET B;  3CIT A;  1NLZ A;  4LRZ E;  4WEK A;  2EWW A;  3ICY A;  2W3H A;  3NHQ A;  4CQH A;  2B18 A;  1LT0 A;  2W1T B;  3TRC A;  3BY8 A;  3C8C A;  3FG8 A;  2Y8H A;  5HWT A;  3BQ8 A;  3PBS A;  4L9G A;  1P0Z A;  3H9W A;  3MFX A;  3T4T A;  5AVE A;  1S66 L;  4G3K A;  1XJ2 A;  1OTI A;  1N9L A;  1VB6 A;  1TS7 A;  4JGO A;  3LR0 A;  2GZA A;  3MQ0 A;  1P9R A;  2JKT I;  5HSQ A;  4NXF A;  2L1M A;  3OCL A;  2OAQ 1;  5IS1 A;  1XJ3 A;  3GEC A;  3OOV A;  4B9O A;  2VV6 A;  4G3V A;  3C2W A;  1H8M A;  2VV7 A;  3K3C A;  3ZYT A;  4BBV A;  2W3G A;  4ETZ A;  3BQA A;  4R6L A;  1YSQ A;  2PYP A;  2VKS A;  4MDZ A;  2D01 A;  4EES A;  4R38 A;  2XRN A;  1OT6 A;  4JGQ A;  4LRX C;  3JVV A;  5HPF A;  3EWK A;  3IBR A;  3H7W B;  3MR0 A;  2QJ7 A;  1MKM A;  2JHE A;  4Z1W A;  4PHT A;  3H7W A;  3D72 A;  1OTD A;  2EWV A;  4F3L B;  4B93 A;  4ARZ B;  2M1C A;  3E0Y A;  1W63 Q;  2XRO A;  4L9F A;  3OC2 A;  1N9O A;  3SW1 A;  2VGL M;  2VZW A;  2YKF A;  4FOF A;  4IUH A;  3LI9 A;  5HZH A;  4BBT A;  4BJP A;  4LLO B;  4WL9 A;  5DKK A;  5DF9 A;  3T4J A;  2LB5 A;  4CLC B;  2DMW A;  3G6O A;  2L0W A;  3EEH A;  4KQO A;  3S7Q A;  4CLC D;  3MQO A;  3CLO A;  2K7S A;  3FC7 A;  3S7N A;  2QHK A;  4HY8 A;  3R7W A;  5DJU A;  4I39 A;  1DRM A;  3NOT C;  4NKP A;  3MMH A;  2YKH A;  4EUV A;  1ODV A;  3HCY A;  3B42 A;  2HJE A;  4E04 A;  4H6J A;  3DBA A;  3KO6 A;  4GJ4 A;  4EQ1 A;  1UWN X;  2V0U A;  3E4P A;  3F1O B;  4GHI A;  3PBT A;  4HH3 A;  3K2N A;  5FL3 A;  1IOU A;  2KX6 A;  4BBU A;  2QWS A;  3H82 B;  5CX7 A;  2GX5 A;  3D3O A;  2BAS A;  2VX8 A;  3NOU C;  1LSW A;  4CLC C;  3H82 A;  5K5B A;  1GSX A;  3EQV A;  2W3D A;  3T4S A;  3K3D A;  2P7J A;  3PXP A;  1D06 A;  1BYW A;  2M7V A;  1T1B A;  2FZ0 A;  2HV1 A;  4G3W A;  1F9I A;  5F6A A;  2OWH A;  1S1Y A;  4MN6 A;  2J3T D;  3U2A A;  2ZBB A;  4UQI S;  1MC0 A;  1DP6 A;  1XJ6 A;  1TD5 A;  3IS2 B;  2V1B A;  4DN0 A;  3UB9 A;  2VGL S;  2P04 A;  2WKP A;  3KYZ A;  3LIB A;  4LPZ A;  4Y5F A;  4WN5 A;  2W27 A;  3BWL A;  3CUE A;  3CAX A;  3EEA A;  4PKY G;  4Q0J A;  1X0O A;  3PHY A;  2Z6D A;  2KDK A;  2A2L A;  3UME A;  2J3T C;  3IS2 A;  3MXQ A;  4IUK A;  3PR6 A;  5IT5 A;  1GSV A;  5HD5 A;  4L0L A;  2LB9 A;  4NXE A;  4I38 A;  4II7 A;  1TS0 A;  5KIZ A;  1LSV A;  2VV8 A;  3ZQ5 A;  1EW0 A;  1TS6 A;  2J3W A;  1P97 A;  1F98 A;  3MQQ A;  1S4R A;  2W1R A;  4JGR A;  3PBQ A;  3F1O A;  3PBO A;  4HI4 A;  5F5Y A;  4UEY A;  5HDC A;  3A0R A;  2W3F A;  1G6O A;  2PR6 A;  5HDS A;  3A0V A;  1KOU A;  3S7O A;  1WA9 A;  3EQU A;  5KSH A;  1NRJ A;  2PD7 A;  4HNB A;  2OOL A;  4I5S A;  3VE3 A;  4HOI A;  1UGU A;  3UB7 A;  4HQA A;  4OOM A;  4AFI A;  2NUP C;  2A24 B;  2XSS A;  3S7P A;  2JKR I;  3OCN A;  4O01 A;  3E4O A;  1T19 A;  1OTA A;  1T1C A;  3B33 A;  3R4K A;  5J7E A;  4GLQ A;  3CI6 A;  2J80 A;  3UMD A;  1OJ5 A;  3F1N B;  3E98 A;  4BMW A;  4L9E A;  1XFN A;  1DP9 A;  5IU1 A;  5MC7 A;  3LIA A;  1XJ4 A;  3LID A;  2W0N A;  3BJN A;  4PAU A;  3KX0 X;  3UB8 A;  1ZHH B;  1S1Z A;  3VV4 A;  3MJQ A;  5DFX A;  2O9B A;  5A8B A;  4LRY C;  3HJI A;  4HJ3 A;  5J4E A;  4HIA A;  4GW9 A;  5HDD A;  4NXG A;  4ARZ A;  3T4L A;  5J3W A;  4MMN A;  4ME4 A;  4KQD A;  1D7E A;  2OAP 1;  2PR5 A;  3IBJ A;  4HJ4 A;  3PBN A;  2W3E A;  2XA7 M;  5TJJ A;  1VHM A;  3KSH A;  3PYP A;  4DMZ A;  2HF6 A;  4YOF A;  4WEJ A;  2KLI A;  4I3A A;  3P7N A;  5AJG A;  3EGX C;  3FPW A;  1V9Z A;  3T50 A;  3LFV A;  2K31 A;  1F5M A;  4GCZ A;  1S67 L;  1UWP X;  2PT7 A;  2XA7 S;  4GHI B;  3VOL A;  2QJ5 A;  3V67 A;  2B02 A;  4WLA A;  1Y28 A;  1LSX A;  4KUO A;  3T4O A;  3TJZ C;  1S4S A;  2I9V A;  1YKD A;  1TS8 A;  2NUT C;  5LBR A;  3ULF A;  4P6Z M;  3R7W B;  5HWV A;  2PHY A;  2VJW A;  5HPI A;  3F1N A;  3KSF A;  2Y79 A;  2HJ9 C;  1NWZ A;  3UE3 A;  2MJ6 A;  2ZMV A;  2OWJ A;  1ZTU A;  2PYR A;  4HP4 A;  3O5Y A;  4EER A;  4CLC A;  4XT2 B;  2V0W A;  1STZ A;  3TE8 A;  2P08 A;  4DJ2 A;  1N9N A;  3VE4 A;  3RFB A;  3B47 A;  2M7U A;  5F68 A;  3LR3 A;  4WEL A;  4R70 A;  1T1A A;  2O9A A;  4IJG A;  1JNU A;  2ZMF A;  1TF1 A;  3A0S A;  1LL8 A;  2W1T A;  4HH2 A;  3NOP C;  3EOI A;  4YNR A;  3LI8 A;  5AVF A;  4BWI A;  5F69 A;  4F3L A;  2H28 A;  3LYX A;  2A24 A;  4GS9 A;  3LIE A;  2JN7 A;  2O9C A;  2WKQ A;  3CUE C;  5HL6 A;  3F1P A;  3UB6 A;  3FPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...