2GX5A

N-terminal gaf domain of transcriptional pleiotropic repressor cody
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
161
structure length
157
Chain Sequence
b'HMALLQKTRIINSMLQAAAGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDRMKKMLEDRQFPEEYTKNLFNVPETSSNLDINSFPVENRDLFQAGLTTIVPIIGGGERLGTLILSRLQDQFNDDDLILAEYGATVVGMEILREKAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-sensing transcriptional pleiotropic repressor codY
publication title The structure of CodY, a GTP- and isoleucine-responsive regulator of stationary phase and virulence in gram-positive bacteria.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 55
structure length 157
sequence length 161
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2gx5A00
3EEAA 2O0YA 3S7PA 2W3GA 4O01A 5HPIA 1VHMA 3NHQA 2W3HA 2KOIA 3NOTC 5HPFA 5HSQA 3W2ZA 3NOPC 3MMHA 4Q0JA 1TD5A 3O5YA 5DFYA 3IBJA 3R4KA 4ETZA 2W3EA 3NOUC 2ZMFA 3DBAA 4G3KA 2VZWA 2W1TB 2M7UA 4R70A 4O8GA 3KSFA 4ME4A 2IA2A 5AJGA 4Q0HA 3D3OA 4Z1WA 3S7NA 4ZRRA 2OOLA 5TJJA 2VEAA 2Y79A 4MCWA 2XRNA 4DN0A 2VJWA 1STZA 4GW9A 4GLQA 4IUKA 4Y3IA 2W1TA 3VV4A 2O9AA 4O0PA 4RQ9A 3IBRA 4DMZA 1F5MA 2B18A 5HL6A 1YSPA 2HGVA 2O9BA 4MN7A 3LFVA 3CITA 4YNRA 5C5KA 2GX5A 4IUHA 2W3DA 4IJGA 4FOFA 3MQ0A 3E98A 3S7QA 3C2WA 4LRXC 3OBFA 1YKDA 4MDZA 3RFBA 2QYBA 4G3VA 4Y5FA 5L8MA 3S7OA 2K31A 2G7UA 2XSSA 2W3FA 5LBRA 4BWIA 3OOVA 2M7VA 3KO6A 2LB5A 1MKMA 1YSQA 4Y2FA 3TRCA 4QPRA 4EUVA 3E0YA 3MF0A 3G6OA 2XROA 4ETXA 4G3WA 2KLIA 5DFXA 4LRYC 4PAUA 2O9CA 4CQHA 3KSGA 2K2NA 3BJNA 3CI6A 4E04A 2W1RA 2VKSA 4Q0IA 1ZTUA 1TF1A 4YOFA 3KSHA 5I5LA 3HCYA 2O99A 4EU0A 3KSIA 5K5BA 3K2NA 2LB9A 1MC0A 4LRZE 4R6LA 2Y8HA 3ZQ5A 4MMNA
chains in the Genus database with same CATH superfamily
5M1AA 5FSRA 1TS0A 2Y55A 3KYEA 2Z6CA 2WK0A 1WYBA 2XGNA 2XD1A 5A90A 4RA7A 2VGKA 4B93A 2X02A 3AGEA 2WGWA 4Y0OA 5HFOA 3T1QB 5HD5A 2W1TB 4ID4A 2WGVA 2M7UA 2IA2A 3G30A 2RL3A 2EXAA 1SKOA 4PM8A 5EE8A 3D4FA 3PYPA 2OWHA 4KZ6A 5AQ7A 3G4PA 3AGDA 3MQQA 3IWIA 1YSPA 2A2LA 4FH2A 1LT0A 3LY3A 4NEED 4LV0A 4GOGA 2W3DA 1TDGA 4KQOA 4FOFA 4QY6A 5DF9A 1S0WA 3N6IA 4BBTA 4N92A 1CK3A 1ERQA 1G6OA 4DE1A 3E2LA 3E4QA 3PBQA 1QMFA 4G3VA 4WL9A 1YM1A 2K31A 1KGFA 2ZOIA 4X69A 5FQIA 2XH9A 5FI7A 4BWIA 3B33A 3NDEA 2ZQDA 3WS1A 2INWA 3GECA 3IQAA 3PBNA 1MKIA 4ETXA 3QP8A 4IBRA 5CXWA 3BWLA 4P0MA 1FSYA 2V0WA 4GZBA 3QP1A 1VB6A 4YOFA 5A92A 2VGJA 5JYPA 3OPRA 1PZOA 3VP2A 4GJ4A 4E3NA 1BTLA 1VHMA 3OPHA 5EVEA 3JPUA 4GS9B 3MBZA 5EV0A 2PU4A 3N8LA 3FZCA 2EWVA 4WZ4A 3IF6B 5GHYA 4GB7A 1AWIA 1W63Q 2ZMFA 3VP1A 1KE0A 5KSHA 1DJAA 3HJKA 1QMEA 1TS8A 3WS2A 3S7NA 2J3WA 2PYPA 2OOLA 2H0TA 3FG8A 2XRNA 5J8XA 5EOOA 4GNUA 4NETA 2GJ3A 2QPNA 4JF4A 1MXOA 2XF3A 1H0MA 3OPPA 5FL3A 4O0PA 4RQ9A 3MFDA 2Y2GA 3ZNYA 4DDYA 1YLJA 2OLUA 5EM1A 4D60A 3ZG7B 5HARA 4I3JA 4JF5A 4HP9A 2P08A 2WADA 2PBDP 3H82B 3ZG0A 3WRZA 4DE0A 3T12B 4F3LB 1P9RA 3SH9A 1XGIA 1V9YA 2ZL1B 1K57A 4EERA 4MLLA 3G6OA 4IBXA 2V1BA 4WEKA 2HP9A 5KZHA 1OPXA 4X55A 4MN5A 5FQJA 1ALQA 4EBLA 2QJ5A 4L9EA 3LR4A 3W4OA 1FOFA 4QY5A 1RP5A 4R6LA 1FILA 1HTZA 4OQHA 1OTEA 5EM0A 5AQAA 5D3OA 2VV6A 3NI9A 2OWJA 2A24A 2FFFB 2J80A 1MBLA 1D7EA 4EESA 3SS4A 5L2FA 1VETA 1KGEA 4PKYG 3T4LA 3UMDA 1XJ6A 3UB7A 3T4TA 5E43A 4ME4A 2H10A 4KG2A 5AJGA 4HQAA 3D3OA 2XLNA 4WBGA 4XUZA 5KMWA 3ZVTA 3PAEA 4GW9A 5FAPA 3TG9A 4RX2A 3TJZC 3LR0A 4GLQA 5EVID 4Y3IA 3VP4A 2W1TA 2L1MA 2FH5A 3TSGA 4DMZA 1XJ2A 2B18A 2O9BA 3G32A 3C4OA 1PW8A 3Q7ZA 1LSWA 4C3QA 1PW1A 1NZOA 3Q81A 3VSLA 2JKTI 4GHIB 2XSSA 1FCOA 5KSCA 1JWZA 4X53A 4DE3A 3ZCZA 2WKEA 1EI5A 4HESA 4LENA 2KLIA 1K56A 3ZYTA 2J3TC 3VP0A 3HUNA 3BM6A 2PU2A 4E3JA 5A8BA 5M19A 5I5LA 3HLCA 5CEDA 2PHYA 5CHMA 5K5BA 2QWSA 4X1LA 3TW8A 4WMCA 3PHYA 1SKFA 4HBTA 4S2NC 5HX9A 1WYCA 5AQBA 4X1MA 1GCEA 1L0DA 3V67A 3IF6C 1OTDA 4GS9A 1N9BA 4P6BA 5FQQA 3BFFA 3IHAA 3IF6A 4FH4A 2XFSA 3HUOA 4OQGA 1MWTA 3A3DA 3QP2A 1P0ZA 5HWVA 3GDIA 2YKFA 4EWFA 3A3IA 4HNBA 4MN7A 2AVXA 1FR1A 3FPVA 5JYOA 3B42A 2B02A 3BFEA 4KQDA 3ZDJA 4QHCA 1CEFA 2MJ6A 1GHIA 2QHKA 3D9YA 3VOYA 4JLFA 4JGQA 3VFHA 5L8MA 1TVFA 3VSKA 3KYQA 2VGLS 3V5MA 2PR5A 1CI8A 1Q2QA 4PMAA 4KZ7A 3H82A 1DP9A 4XXRA 1DRMA 3LEQA 4FTXA 4UA9A 3QHYA 4F3LA 1YQSA 2GZAA 2O9CA 2K7SA 3RH8B 1MWSA 2K2NA 4OPRA 3H7WB 1BZAA 3AGFA 1JVJA 2J9PA 4O7DA 2UV0E 3UY6A 3MXSA 3DWKA 2V0UA 4JGOA 3PR6A 4WMCD 4QD4A 4BLMA 4I3AA 3A3FA 2R9WA 4BBVA 1KVMA 4OQIA 3GTCA 1S1YA 1LL8A 3GR2A 1IYSA 3IH8A 3ZVWA 1PWDA 3IXHA 4YFMA 2L4RA 3FC7A 2FZ0A 3UB6A 5DJTA 4MBHA 1K4EA 3W2ZA 4E3LA 1W5DA 3EEHA 3MZFA 4BQMA 3CMZA 2W3EA 3SS3A 5F1GA 1OTBA 5J4EA 1N4OA 5L10A 1NYYA 2EFXA 1WA9A 1H5XA 1ES5A 4M3KA 4L0LA 1LI0A 1D1JA 1NYMA 2V8CA 1SDEA 3LICA 3OCLA 1STZA 4EBNA 2J9OA 2Y2QA 4KZAA 2Y2LA 1F5MA 5DKKA 3ITBA 4NKPA 1YLWA 3HLDA 3T1RA 1LL5A 2BTFP 2WAFA 1IFQA 2XEPA 4JPMA 4Y13A 3V39A 1HD8A 2GDNA 1LSXA 3BW6A 2H0YA 3LYXA 4HH3A 4KZ3A 2HF6A 5E2GA 4KQRA 5F6AA 1GSXA 1PWCA 1IYOA 3NDGA 4ARZB 4EUVA 1TDLA 3C30A 2I9VA 1E25A 3EWKA 1H8MA 4BD0A 4GHIA 2WKRA 4U3TA 4L9GA 3C5AA 1T1CA 1WE4A 4Q0IA 3S1YA 4XT2A 4U0XA 2JBFA 2EX6A 3PXPA 4PM9A 3NIAA 3E4PA 3O3VA 1DP8A 4F94A 3MS6A 3BFCA 3ZGAB 4B88A 4H6JB 1RGZA 4D2OA 1ES3A 2Z6DA 1FCMA 1FQGA 4LPZA 5FAQA 4DJ3A 1SCWA 5F68A 4IVIA 3I7JA 1BT5A 4ESPA 2HP6A 1YPRA 3P01A 4MBFA 3WRTA 1SDNA 1EROA 5F5YA 4OOMA 2PRFA 4R4RA 1JWVA 1NZUA 3UE0A 5DKLA 3FPWA 4S2IA 3UDFA 1IKIA 5KIZA 1M6KA 1K38A 4K0WA 2ZQ9A 5EUAA 3UB9A 3C2WA 1PI5A 1NLZA 1HLUP 3FWLA 1XJ4A 5MC7A 1L0FA 3IT9A 5E2FA 4GDNA 2ZC3B 3UPPA 4IHQA 4OOLA 1E3UD 2DRWA 2P7JA 1YSQA 1KGGA 5HDDA 4K0XA 5IT5A 1ESUA 2Z2LB 4Y0TA 1ZHHB 3C8CA 4PAUA 2V2FF 4CQHA 3KSGA 4I38A 4E04A 2V20A 2XQZA 3L9KA 4EETB 4OLDA 3KSIA 2XK1A 1PI4A 2LB9A 1PRQA 3Q82A 3H7WA 2R78A 3RXWA 4OLGA 1T19A 4EQIA 4KUOA 5A93A 3WS5A 2EX8A 2V1ZA 3IX8A 3K3DA 4Q0JA 3ZG8B 3IBJA 3GQZA 2WZXA 5HAPA 1IOUA 3UPOA 4DXCA 3CHWP 1S67L 4DKIA 2OV5A 4WM9A 2ZQ8A 5FEGA 3PAGA 2Y79A 1G28A 5GHZA 3IF5A 3EGXC 4L9FA 1K55C 1MZUA 2PR6A 3HLEA 1L3LA 4P6ZS 1K55A 1TS6A 2W0NA 4UHUA 4HBUA 4KG6A 2EX9A 1FR6A 2ACGA 2QZ6A 3OZHA 2VLGA 3JVUA 5FASA 2Y2KA 3FKWA 3CWFA 4PM7A 3KO6A 1CEGA 3T4SA 4ZJ2A 1S4SA 2I72A 3CPTB 4BL2A 5HD3A 2X01A 4ARZA 4HOIA 4WLAA 2Y2JA 1NRJA 3EOIA 1NXYA 1BLCA 2JKRI 4X6TA 3LGOA 3GRJA 3O88A 4QWOA 4OP5A 1A0KA 4OPYA 3T4OA 4S2KA 3QP5A 5GLBA 4AFIA 3FYZA 1K6SA 2JE5A 1BULA 4I5SA 1F9IA 4XUXA 4ZJ1A 2XFTA 1ES2A 1TEMA 2ZJ9A 4WELA 1U60A 1GSWA 1JNUA 3HUMA 1K0KA 1CF0A 4JXSA 3G35A 4WEJA 5HDSA 3DWZA 2P74A 4HP4A 1KVLA 3JYIA 3ZFZA 1RGYA 4CLCE 1K6RA 5CERA 5F83A 3VE4A 3EGDC 3S7QA 5E2EA 1M40A 4HH2A 3F1NB 2HDUA 2JC7A 3NULA 4X56A 4KENB 3OOVA 5CTNA 1CI9A 2OSUA 3T4KA 5CTMA 2RCXA 3KX0X 2XROA 2QJ7A 3IHBA 4NXEA 3QNCA 3S4XA 1N9OA 5GHXA 3LO7A 1KDSA 2YKHA 3BLSA 4ZDXA 1GA9A 1XP4A 5F1FA 2WYXA 1XFQA 4LCMA 2VX8A 1Z09A 4JF6A 2Y2OA 1OJ5A 4HJ4A 2Y8HA 4UA7A 5GL9A 3L7HA 4R0QA 3E2KA 2WKIA 2B95A 2EX2A 2W3HA 3SZTA 4R3JA 5HPFA 2J8YA 3NOPC 2EFUA 1KE4A 1X0OA 3V3SA 4ZJ3A 3P09A 2XR0A 1GHPA 4KZ4A 1IYQA 4BL3A 3P98A 5IU1A 3C7VA 4BJPA 3BEBA 5TR7A 5DTSA 4KG5A 2Y2NA 3VV4A 2HDRA 3NJAA 3NC8A 1EW0A 2CC1A 4S2NA 2VGLM 2JKRM 5AQ9A 3SH7A 1YKDA 1ES4A 2QMIA 3MJQA 3EQUA 4YWZA 5HWTA 1MY8A 2KX6A 4BMWA 1F98A 3M6HA 2M7VA 5U47A 1MKMA 4RVAA 4DJ2A 4MEZA 2V8FA 3E0YA 2ZBBA 1ODVA 2JN7A 4OVDA 3MQOA 4NK3A 4JGRA 4S2OA 2Q0OA 3VOZA 1CQAA 2WGWB 2NUTC 5DFXA 2QKPA 1XJ3A 3DTKA 2GNXA 4IVKA 3UN7A 5G4ZA 3KSHA 3HCYA 1Y54A 2ZC7A 1K56D 3RJUA 3K2NA 1F2KA 3F1OB 3CPTA 3ZHHA 2DCFA 1T1BA 2J3TD 4ZTKA 1VM1A 1Q2PA 3WWXA 2Y59A 2C5WB 2A49A 2ZL1A 2WKQA 3QP6A 1W8QA 3O87A 2ZMVA 5DFYA 4HEFA 5CECA 1G68A 4X68A 4HY8A 4ZBEA 2VZWA 1EWZA 3QP4A 5HW3A 4H8RA 2PD8A 1W63M 3SH8A 4ZRRA 2ZLYA 2JKFA 1RCJA 2B5RA 1IELA 2IWCA 3CJMA 3RTYA 4U0TA 3NY4A 2JKTM 3IWOA 2PYRA 3IS2B 4WUJA 3UNWA 1ACFA 1ONHA 4B4ZA 4OKPA 5EPHA 3MQ0A 1BSGA 3FKVA 4P85A 4EQ1A 1IYPA 3M2KA 3OC2A 1FIKA 3HBRA 2G7UA 3PBOA 4R3BA 2DMWA 2H5SA 4Z9QA 1GA0A 2BLSA 2IWDA 4QJGA 5CGWA 2HV1A 1H8YA 3F1NA 3SOIA 2EXBA 1KOUA 4E6WA 3T1XA 4UA6A 4B9OA 3BYDA 3MR0A 4JKTA 3SS5A 1O07A 1NLYA 4JBFA 3N4IA 1I2SA 4IEDA 4E3KA 2IWBA 5TFQA 1T1AA 5AVFA 5DJUA 2PD7A 4II7A 5FDHA 1UWNX 3CAXA 5FDSA 5HAQA 4LV3A 1GSVA 1N9NA 4UQIS 3NHQA 5EVIB 4I39A 1ESIA 3NOTC 1AXBA 4NG2A 2HJEA 4PM5A 5FQKA 3UB5P 3PTEA 4E3IA 3R4KA 1VEUB 3DBAA 1LL9A 3KSFA 5FAOA 1OJGA 1YLPA 3UDXA 5TJJA 2CMNA 4MCWA 2VJWA 4RYEA 1YT4A 1SHVA 2ZD8A 3HLGA 1TS7A 1I2WA 2HGVA 5CHUA 2Y2PA 3LFVA 3VP3A 1W8YA 5L09A 3SW1A 1C3BA 2ZQAA 4OH0A 2D01A 3BECA 3ZNTA 1K4FA 5GLCA 2KDKA 3HL9A 4A5RA 5HWWA 2QYBA 3UMEA 4QU3A 3S7OA 1XFNA 2PBYA 2W3FA 3PBRA 2Z2MB 3Q7VB 4HIAA 2LB5A 2WKPA 2V9AA 4NXGA 3E4OA 3JVVA 2PT7A 1W7FA 4QB8A 3DTEA 1PWGA 2E8JA 4KUKA 1PFLA 3LR5A 4JXWA 5IHVA 5DVAA 2XA7S 4Y0UA 3S22A 4FD8A 3UE3A 1ZTUA 4HI4A 1JTGA 4EBPA 3ITAA 3TE8A 5FQ9A 4UEYA 1NJ4A 1NWZA 1XX2A 4N1HA 3WS0A 1NRFA 4EEUA 1DJCA 3P7NA 3M2JA 4DF6A 1XKZA 2ZM8A 1Y4OA 3DTMA 3F1OA 2ZM2A 3MMHA 3G2ZA 3QNBA 3T4QA 4OOYA 2JKGA 2XDMA 3M6BA 1YMSA 1ZKJA 4OQ0A 5FEFA 4PPRA 1J9MA 4X25A 3ZG5A 3LUQA 4P6ZM 3IXDA 1FSWA 5HDCA 3T50A 3Q07A 3LCEA 1S4RA 3BFGA 5CRFA 3HVFA 1L0EA 2UWXA 3H9WA 3LI9A 5FA7A 3MFXA 4GN2A 4LV1A 1H3QA 2EWWA 4LGWA 5HL6A 1IKGA 3F1PB 5HL1A 4C6YA 3WS4A 1IEMA 5F82A 4JXVA 3E98A 4CJNA 4CLCB 4S2LA 1ZC2A 3IS2A 2OAP1 5CX7A 3W4QA 3FV7A 1MWRA 2PDRA 2FFYA 3BLMA 2ZOHA 3PBSA 1OT6A 1UGUA 3PBTA 3MF0A 1Z6FA 3N7WA 4K91A 3BQAA 5CGXA 1PNEA 3CI6A 3A3EA 2EA9A 4E6XA 3ISGA 2BG1A 3OPLA 1BYWA 1OTIA 4R38A 1YLYA 5F69A 3ZQ5A 5GLAA 3EEAA 2O0YA 1LSVA 3VE3A 1S66L 3BQ8A 4EV4A 5DF7A 1HVBA 5FI2A 4GD8A 4PHTA 1TD5A 3O5YA 4C75A 5EVIC 2NUPC 1YAXA 3NBLA 4HJ3A 5EVIA 3VFFA 3MKEA 2PAVP 4R70A 4Y15A 1SZVA 1ZG6A 2D02A 2VEAA 3MXQA 4DN0A 4M4XA 1VEUA 4HHDA 2HPBA 1PIOA 2WGIA 3IXBA 5DTKA 3R7WB 1K57C 2JCHA 3W4PA 4R23A 2ZQ7A 3CITA 1PZPA 2GX5A 4IUHA 2J7VA 3U4LP 3GMWA 4LLOB 4N9LA 4BD1A 4H6JA 3LR3A 5EFWA 3UDIA 4JXGA 4I3IA 5CHJA 5LBRA 1OTAA 5IS1A 3U2AA 4QPRA 1VQQA 3DAVA 3IH9A 5CEBA 1XPBA 3LIAA 3Q7VA 3T4JA 2ZC6B 2HDQA 3C4PA 1XGJA 4KZ9A 2M1CA 4NXBA 1O7EA 4HJ6A 2W1RA 2Y2IA 4B4XA 1E4DA 2O99A 2HP5A 3D72A 1S6RA 1YMXA 2L0WA 1V9ZA 5A91A 4O01A 1S1ZA 1BUEA 2JHEA 3OCNA 3BY8A 4NXFA 4PM6A 1LLBA 5FATA 1ERMA 4DXBA 4LV2A 3A0RA 4ETZA 3NOUC 2X71A 2Q9NA 5TBMB 3TOIA 4LCLA 2VV8A 2G2WA 1YLZA 2G2UA 4FCFA 1DJBA 4BBUA 4IUKA 1G6AA 2DNSA 1XXMA 3DTIA 3LEZA 3LIDA 2Y2HA 2ZC4B 1LHYA 3LY4A 3GV9A 1BLHA 4FSFA 2VK3A 4LRXC 2E8IA 3GSGA 4XT2B 3OBFA 3NECA 4R1GA 2P9VB 3F1PA 4PKYA 4E3MA 4Y5FA 1MWUA 5G4YA 2Y91A 1HZOA 2ZM0A 4CLCC 4CPKA 3B47A 4GDBA 2Y2MA 5CGSA 4CLCA 3TRCA 4MN6A 2WZZA 1ZG4A 5BOHA 4G3WA 1PYYA 4EW7A 3BJNA 2C6WB 4P87A 5EVLA 5TGFA 4ZAMA 3A3JA 3O86A 2H28A 1XA7A 4LFUA 3MXRA 3IWQA 1D06A 5EECA 3V3RA 2Q9MA 5DF8A 3S7PA 5HPIA 1GHMA 2ZMAA 2KOIA 2WKHA 1Y28A 1SKOB 1W79A 4OPZA 5L07A 4DDSA 4G3KA 4Y17A 3T1SA 5HZHA 2Y4AA 3UO9A 4Q0HA 3CZDA 2R9XA 3C38A 3ZG9B 5M18A 1LI9A 4RX3A 2HZ5A 1L2SA 4UAAA 3G31A 3RXXA 1KDWA 1OT9A 5FQMA 3B3XA 3UE1A 3IBRA 3G34A 3VMAA 2OLVA 2HJ9C 4GCZA 4YNRA 5C5KA 3Q1FA 5E2HA 1P9WA 4IJGA 3HJIA 4JGPA 3HLFA 3R7WA 5G18A 1FCNA 3MZDA 2W27A 1L0GA 5I94A 4CLCD 3HLBA 1BLPA 3K3CA 1J3WA 3KYZA 4MNRA 3N8SA 1CJFA 3LI8A 1DP6A 3LIBA 1P97A 3G2YA 1NY0A 3BFDA 4FUWA 4LRYC 3OLOA 4Y7PA 2OAQ1 5HAIA 1KE3A 3UE6A 4UQIM 4WYYA 1N9LA 2ZC5B 3EQVA 4EU0A 1K25A 2WUQA 3LIEA 1MC0A 3BY9A 2A3UA 1ONGA 4K08A 2VA0A 2W3GA 3UPNA 1K54C 1MPLA 4S2JA 5HSQA 3LIFA 1K54A 3V50A 5DTTA 1DY6A 4Q8IA 4O8GA 3IXGA 2VV7A 4WZ5C 5J7EA 3ICYA 1BLSA 4E3OA 4Z1WA 3MZEA 4MBKA 4WZ5A 3DW0A 5TBMA 2O9AA 1JWPA 4KQQA 4S2PA 1YLTA 3ULFA 2HDSA 2ZQCA 3CUEC 4N9KA 5GLDA 4OP8A 3CUEA 1G5UA 3CLOA 3HLWA 4YINA 1E3UA 3C7UA 3VOLA 3HREA 2BASA 4MDZA 3RFBA 5FI6A 1XA1A 2XD5A 1UWPX 4EUZA 4GKUA 3W8KA 3CG5A 4EXOA 2XA7M 4Y2FA 3A0SA 2P04A 4OONA 2P9VA 4DE2A 3MKFA 4WF0A 1H8ZA 3BRMA 4KZ5A 4WN5A 4EEPA 1OMEA 3UB8A 3N8RA 4S2MA 1I5QA 5J3WA 1JTDA 3IX3A 2V1AA 3MSHA 4DRTA 5AVEA 2VKSA 3IX4A 4N1XA 1TF1A 4R4SA 4OPQA 2WAEA 2A24B 3NCKA 3GVBA 4R3AA 4BENA 1T18A 4KZBA 4GD6A 4KZ8A 4LRZE 3A0VA 1VETB 4MMNA 5EOEA
chains in the Genus database with same CATH topology
3EEAA 2O0YA 1TS0A 1LSVA 3VE3A 1S66L 2L4RA 3BQ8A 3FC7A 2FZ0A 2W3HA 2Z6CA 3UB6A 5DJTA 5HPFA 3W2ZA 3NOPC 4PHTA 1X0OA 3EEHA 1TD5A 3O5YA 4B93A 2W3EA 1YAXA 2NUPC 1OTBA 4HJ3A 5HD5A 5J4EA 5IU1A 2W1TB 2M7UA 4R70A 4BJPA 1WA9A 2IA2A 4L0LA 2D02A 2VEAA 3MXQA 3OCLA 3LICA 4DN0A 1STZA 3PYPA 2OWHA 4M4XA 4HHDA 3VV4A 3R7WB 3NJAA 3MQQA 1F5MA 5DKKA 1YSPA 2A2LA 1EW0A 1LT0A 4NKPA 4NEED 3CITA 2GX5A 4IUHA 2VGLM 2W3DA 4KQOA 4FOFA 5DF9A 4LLOB 4BBTA 2JKRM 1IFQA 1G6OA 1YKDA 3E4QA 3PBQA 4G3VA 4WL9A 4H6JA 3BW6A 1LSXA 3LR3A 3LYXA 3EQUA 3MJQA 4HH3A 4YWZA 2HF6A 5EFWA 2K31A 5HWTA 2ZOIA 5F6AA 4I3IA 5LBRA 4BMWA 2KX6A 4BWIA 1F98A 1OTAA 5IS1A 2M7VA 3B33A 1GSXA 3U2AA 1MKMA 2INWA 4QPRA 4ARZB 4DJ2A 4EUVA 3E0YA 2ZBBA 1ODVA 2JN7A 3GECA 3C30A 2I9VA 3MQOA 3PBNA 3EWKA 4JGRA 1H8MA 4GHIA 4ETXA 2NUTC 5DFXA 3LIAA 2QKPA 1XJ3A 2WKRA 3T4JA 2GNXA 3BWLA 2M1CA 4NXBA 4L9GA 2V0WA 4HJ6A 1T1CA 2W1RA 1VB6A 4Q0IA 4YOFA 5G4ZA 3KSHA 3HCYA 2O99A 3K2NA 4XT2A 3F1OB 3D72A 4GJ4A 2L0WA 1T1BA 1V9ZA 4O01A 3PXPA 1S1ZA 2J3TD 1VHMA 2JHEA 3E4PA 3OCNA 3BY8A 4NXFA 4GS9B 1DP8A 2EWVA 2WKQA 2ZMVA 5DFYA 3A0RA 4ETZA 1W63Q 3NOUC 4HY8A 4H6JB 2ZMFA 2VZWA 5TBMB 2Z6DA 5KSHA 4LPZA 4DJ3A 3HJKA 2PD8A 1W63M 5F68A 1TS8A 3S7NA 2VV8A 4ZRRA 2J3WA 2PYPA 2OOLA 3FG8A 2XRNA 4BBUA 4IUKA 2GJ3A 3RTYA 3P01A 5F5YA 4OOMA 5FL3A 4O0PA 4RQ9A 2JKTM 2PYRA 3IS2B 4WUJA 3LIDA 5DKLA 3FPWA 5KIZA 3MQ0A 4FSFA 3UB9A 3C2WA 4LRXC 1NLZA 4XT2B 3OBFA 1XJ4A 4EQ1A 4I3JA 5MC7A 3OC2A 3F1PA 4PKYA 4HP9A 2P08A 4Y5FA 5G4YA 3H82B 2G7UA 3PBOA 4CLCC 4F3LB 2DMWA 1P9RA 3B47A 4IHQA 4OOLA 1V9YA 2P7JA 1YSQA 4CLCA 3TRCA 4MN6A 2HV1A 4EERA 5HDDA 3F1NA 3G6OA 2V1BA 5IT5A 1KOUA 4WEKA 1ZHHB 3C8CA 4G3WA 4B9OA 4PAUA 3MR0A 1OPXA 4CQHA 4MN5A 3KSGA 4EW7A 3BJNA 4I38A 1NLYA 4E04A 2QJ5A 4L9EA 3LR4A 2H28A 4EETB 3KSIA 1T1AA 5AVFA 2LB9A 5DJUA 1D06A 2PD7A 4R6LA 3H7WA 1OTEA 4II7A 1UWNX 2R78A 3S7PA 3CAXA 5HPIA 2VV6A 1GSVA 2OWJA 1T19A 1N9NA 4UQIS 4KUOA 2A24A 3NHQA 4I39A 2J80A 2KOIA 3NOTC 1D7EA 4EESA 3K3DA 2HJEA 1Y28A 4Q0JA 3IBJA 4PKYG 3R4KA 3T4LA 3UMDA 1XJ6A 3DBAA 4G3KA 5HZHA 3UB7A 1IOUA 3T4TA 3KSFA 4ME4A 5AJGA 1OJGA 4HQAA 4Q0HA 3D3OA 1S67L 3C38A 5TJJA 2CMNA 2Y79A 4MCWA 2VJWA 1G28A 4GW9A 3TJZC 3LR0A 4GLQA 3EGXC 4L9FA 4Y3IA 2W1TA 1MZUA 2PR6A 2L1MA 1OT9A 2FH5A 3IBRA 4P6ZS 4DMZA 1TS7A 1XJ2A 2B18A 2O9BA 2HGVA 1TS6A 2W0NA 2HJ9C 3LFVA 4GCZA 4YNRA 5C5KA 1LSWA 3SW1A 1P9WA 4IJGA 3HJIA 4JGPA 2D01A 3R7WA 2W27A 2KDKA 5HWWA 4CLCD 2QYBA 2JKTI 2VLGA 3JVUA 3K3CA 3UMEA 3S7OA 1XFNA 4GHIB 2XSSA 2W3FA 3PBRA 3KYZA 3CWFA 4HIAA 3KO6A 2LB5A 3T4SA 3LI8A 2WKPA 2V9AA 1DP6A 4NXGA 3E4OA 3JVVA 2PT7A 1S4SA 1P97A 3LIBA 2KLIA 4LRYC 3OLOA 2OAQ1 4KUKA 3ZYTA 3LR5A 2J3TC 2XA7S 5HD3A 4ARZA 3UE3A 3UE6A 5A8BA 4HOIA 1ZTUA 4HI4A 4UQIM 4WLAA 1NRJA 5I5LA 1N9LA 3EQVA 2PHYA 4EU0A 3TE8A 4UEYA 3EOIA 5K5BA 1NWZA 3LIEA 1MC0A 2JKRI 3BY9A 2QWSA 4K08A 2VA0A 2W3GA 3TW8A 4EEUA 3P7NA 3T4OA 3PHYA 5HSQA 3F1OA 3LIFA 4AFIA 3MMHA 3T4QA 3V67A 4I5SA 1OTDA 4GS9A 1F9IA 3LUQA 4O8GA 4P6ZM 2VV7A 5HDCA 3T50A 5J7EA 3ICYA 4Z1WA 1S4RA 4WELA 1GSWA 1P0ZA 1JNUA 5HWVA 5TBMA 3H9WA 3GDIA 2YKFA 2O9AA 3LI9A 3MFXA 4WEJA 5HDSA 1H3QA 4HP4A 3ULFA 2EWWA 5HL6A 3CUEC 3F1PB 4HNBA 4CLCE 4MN7A 3FPVA 3B42A 3CUEA 3CLOA 2B02A 4KQDA 3VE4A 3E98A 3EGDC 3S7QA 3VOLA 2MJ6A 4CLCB 2BASA 2QHKA 4MDZA 3RFBA 3IS2A 2OAP1 5CX7A 4JGQA 4HH2A 1UWPX 5L8MA 3F1NB 2PDRA 2ZOHA 3PBSA 3OOVA 1OT6A 4EXOA 3KYQA 2VGLS 2PR5A 2XA7M 1UGUA 3T4KA 4Y2FA 3A0SA 2P04A 3KX0X 3PBTA 4WF0A 3MF0A 2XROA 2QJ7A 3H82A 1DP9A 4NXEA 4WN5A 4EEPA 3UB8A 1DRMA 4F3LA 3BQAA 1N9OA 2GZAA 2O9CA 2K7SA 3RH8B 2YKHA 2K2NA 3H7WB 5J3WA 3CI6A 2V1AA 5AVEA 2EA9A 2VKSA 1TF1A 2V0UA 4JGOA 3PR6A 2A24B 1BYWA 1XFQA 4I3AA 1OTIA 4R3AA 1T18A 4BBVA 2VX8A 4R38A 1S1YA 4LRZE 1OJ5A 4HJ4A 3A0VA 2Y8HA 5F69A 1LL8A 3ZQ5A 4MMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EEA A;  2O0Y A;  3S7P A;  2W3G A;  4O01 A;  5HPI A;  1VHM A;  3NHQ A;  2W3H A;  2KOI A;  3NOT C;  5HPF A;  5HSQ A;  3W2Z A;  3NOP C;  3MMH A;  4Q0J A;  1TD5 A;  3O5Y A;  5DFY A;  3IBJ A;  3R4K A;  4ETZ A;  2W3E A;  3NOU C;  2ZMF A;  3DBA A;  4G3K A;  2VZW A;  2W1T B;  2M7U A;  4R70 A;  4O8G A;  3KSF A;  4ME4 A;  2IA2 A;  5AJG A;  4Q0H A;  3D3O A;  4Z1W A;  3S7N A;  4ZRR A;  2OOL A;  5TJJ A;  2VEA A;  2Y79 A;  4MCW A;  2XRN A;  4DN0 A;  2VJW A;  1STZ A;  4GW9 A;  4GLQ A;  4IUK A;  4Y3I A;  2W1T A;  3VV4 A;  2O9A A;  4O0P A;  4RQ9 A;  3IBR A;  4DMZ A;  1F5M A;  2B18 A;  5HL6 A;  1YSP A;  2HGV A;  2O9B A;  4MN7 A;  3LFV A;  3CIT A;  4YNR A;  5C5K A;  2GX5 A;  4IUH A;  2W3D A;  4IJG A;  4FOF A;  3MQ0 A;  3E98 A;  3S7Q A;  3C2W A;  4LRX C;  3OBF A;  1YKD A;  4MDZ A;  3RFB A;  2QYB A;  4G3V A;  4Y5F A;  5L8M A;  3S7O A;  2K31 A;  2G7U A;  2XSS A;  2W3F A;  5LBR A;  4BWI A;  3OOV A;  2M7V A;  3KO6 A;  2LB5 A;  1MKM A;  1YSQ A;  4Y2F A;  3TRC A;  4QPR A;  4EUV A;  3E0Y A;  3MF0 A;  3G6O A;  2XRO A;  4ETX A;  4G3W A;  2KLI A;  5DFX A;  4LRY C;  4PAU A;  2O9C A;  4CQH A;  3KSG A;  2K2N A;  3BJN A;  3CI6 A;  4E04 A;  2W1R A;  2VKS A;  4Q0I A;  1ZTU A;  1TF1 A;  4YOF A;  3KSH A;  5I5L A;  3HCY A;  2O99 A;  4EU0 A;  3KSI A;  5K5B A;  3K2N A;  2LB9 A;  1MC0 A;  4LRZ E;  4R6L A;  2Y8H A;  3ZQ5 A;  4MMN A; 
#chains in the Genus database with same CATH topology
 5M1A A;  5FSR A;  1TS0 A;  2Y55 A;  3KYE A;  2Z6C A;  2WK0 A;  1WYB A;  2XGN A;  2XD1 A;  5A90 A;  4RA7 A;  2VGK A;  4B93 A;  2X02 A;  3AGE A;  2WGW A;  4Y0O A;  5HFO A;  3T1Q B;  5HD5 A;  2W1T B;  4ID4 A;  2WGV A;  2M7U A;  2IA2 A;  3G30 A;  2RL3 A;  2EXA A;  1SKO A;  4PM8 A;  5EE8 A;  3D4F A;  3PYP A;  2OWH A;  4KZ6 A;  5AQ7 A;  3G4P A;  3AGD A;  3MQQ A;  3IWI A;  1YSP A;  2A2L A;  4FH2 A;  1LT0 A;  3LY3 A;  4NEE D;  4LV0 A;  4GOG A;  2W3D A;  1TDG A;  4KQO A;  4FOF A;  4QY6 A;  5DF9 A;  1S0W A;  3N6I A;  4BBT A;  4N92 A;  1CK3 A;  1ERQ A;  1G6O A;  4DE1 A;  3E2L A;  3E4Q A;  3PBQ A;  1QMF A;  4G3V A;  4WL9 A;  1YM1 A;  2K31 A;  1KGF A;  2ZOI A;  4X69 A;  5FQI A;  2XH9 A;  5FI7 A;  4BWI A;  3B33 A;  3NDE A;  2ZQD A;  3WS1 A;  2INW A;  3GEC A;  3IQA A;  3PBN A;  1MKI A;  4ETX A;  3QP8 A;  4IBR A;  5CXW A;  3BWL A;  4P0M A;  1FSY A;  2V0W A;  4GZB A;  3QP1 A;  1VB6 A;  4YOF A;  5A92 A;  2VGJ A;  5JYP A;  3OPR A;  1PZO A;  3VP2 A;  4GJ4 A;  4E3N A;  1BTL A;  1VHM A;  3OPH A;  5EVE A;  3JPU A;  4GS9 B;  3MBZ A;  5EV0 A;  2PU4 A;  3N8L A;  3FZC A;  2EWV A;  4WZ4 A;  3IF6 B;  5GHY A;  4GB7 A;  1AWI A;  1W63 Q;  2ZMF A;  3VP1 A;  1KE0 A;  5KSH A;  1DJA A;  3HJK A;  1QME A;  1TS8 A;  3WS2 A;  3S7N A;  2J3W A;  2PYP A;  2OOL A;  2H0T A;  3FG8 A;  2XRN A;  5J8X A;  5EOO A;  4GNU A;  4NET A;  2GJ3 A;  2QPN A;  4JF4 A;  1MXO A;  2XF3 A;  1H0M A;  3OPP A;  5FL3 A;  4O0P A;  4RQ9 A;  3MFD A;  2Y2G A;  3ZNY A;  4DDY A;  1YLJ A;  2OLU A;  5EM1 A;  4D60 A;  3ZG7 B;  5HAR A;  4I3J A;  4JF5 A;  4HP9 A;  2P08 A;  2WAD A;  2PBD P;  3H82 B;  3ZG0 A;  3WRZ A;  4DE0 A;  3T12 B;  4F3L B;  1P9R A;  3SH9 A;  1XGI A;  1V9Y A;  2ZL1 B;  1K57 A;  4EER A;  4MLL A;  3G6O A;  4IBX A;  2V1B A;  4WEK A;  2HP9 A;  5KZH A;  1OPX A;  4X55 A;  4MN5 A;  5FQJ A;  1ALQ A;  4EBL A;  2QJ5 A;  4L9E A;  3LR4 A;  3W4O A;  1FOF A;  4QY5 A;  1RP5 A;  4R6L A;  1FIL A;  1HTZ A;  4OQH A;  1OTE A;  5EM0 A;  5AQA A;  5D3O A;  2VV6 A;  3NI9 A;  2OWJ A;  2A24 A;  2FFF B;  2J80 A;  1MBL A;  1D7E A;  4EES A;  3SS4 A;  5L2F A;  1VET A;  1KGE A;  4PKY G;  3T4L A;  3UMD A;  1XJ6 A;  3UB7 A;  3T4T A;  5E43 A;  4ME4 A;  2H10 A;  4KG2 A;  5AJG A;  4HQA A;  3D3O A;  2XLN A;  4WBG A;  4XUZ A;  5KMW A;  3ZVT A;  3PAE A;  4GW9 A;  5FAP A;  3TG9 A;  4RX2 A;  3TJZ C;  3LR0 A;  4GLQ A;  5EVI D;  4Y3I A;  3VP4 A;  2W1T A;  2L1M A;  2FH5 A;  3TSG A;  4DMZ A;  1XJ2 A;  2B18 A;  2O9B A;  3G32 A;  3C4O A;  1PW8 A;  3Q7Z A;  1LSW A;  4C3Q A;  1PW1 A;  1NZO A;  3Q81 A;  3VSL A;  2JKT I;  4GHI B;  2XSS A;  1FCO A;  5KSC A;  1JWZ A;  4X53 A;  4DE3 A;  3ZCZ A;  2WKE A;  1EI5 A;  4HES A;  4LEN A;  2KLI A;  1K56 A;  3ZYT A;  2J3T C;  3VP0 A;  3HUN A;  3BM6 A;  2PU2 A;  4E3J A;  5A8B A;  5M19 A;  5I5L A;  3HLC A;  5CED A;  2PHY A;  5CHM A;  5K5B A;  2QWS A;  4X1L A;  3TW8 A;  4WMC A;  3PHY A;  1SKF A;  4HBT A;  4S2N C;  5HX9 A;  1WYC A;  5AQB A;  4X1M A;  1GCE A;  1L0D A;  3V67 A;  3IF6 C;  1OTD A;  4GS9 A;  1N9B A;  4P6B A;  5FQQ A;  3BFF A;  3IHA A;  3IF6 A;  4FH4 A;  2XFS A;  3HUO A;  4OQG A;  1MWT A;  3A3D A;  3QP2 A;  1P0Z A;  5HWV A;  3GDI A;  2YKF A;  4EWF A;  3A3I A;  4HNB A;  4MN7 A;  2AVX A;  1FR1 A;  3FPV A;  5JYO A;  3B42 A;  2B02 A;  3BFE A;  4KQD A;  3ZDJ A;  4QHC A;  1CEF A;  2MJ6 A;  1GHI A;  2QHK A;  3D9Y A;  3VOY A;  4JLF A;  4JGQ A;  3VFH A;  5L8M A;  1TVF A;  3VSK A;  3KYQ A;  2VGL S;  3V5M A;  2PR5 A;  1CI8 A;  1Q2Q A;  4PMA A;  4KZ7 A;  3H82 A;  1DP9 A;  4XXR A;  1DRM A;  3LEQ A;  4FTX A;  4UA9 A;  3QHY A;  4F3L A;  1YQS A;  2GZA A;  2O9C A;  2K7S A;  3RH8 B;  1MWS A;  2K2N A;  4OPR A;  3H7W B;  1BZA A;  3AGF A;  1JVJ A;  2J9P A;  4O7D A;  2UV0 E;  3UY6 A;  3MXS A;  3DWK A;  2V0U A;  4JGO A;  3PR6 A;  4WMC D;  4QD4 A;  4BLM A;  4I3A A;  3A3F A;  2R9W A;  4BBV A;  1KVM A;  4OQI A;  3GTC A;  1S1Y A;  1LL8 A;  3GR2 A;  1IYS A;  3IH8 A;  3ZVW A;  1PWD A;  3IXH A;  4YFM A;  2L4R A;  3FC7 A;  2FZ0 A;  3UB6 A;  5DJT A;  4MBH A;  1K4E A;  3W2Z A;  4E3L A;  1W5D A;  3EEH A;  3MZF A;  4BQM A;  3CMZ A;  2W3E A;  3SS3 A;  5F1G A;  1OTB A;  5J4E A;  1N4O A;  5L10 A;  1NYY A;  2EFX A;  1WA9 A;  1H5X A;  1ES5 A;  4M3K A;  4L0L A;  1LI0 A;  1D1J A;  1NYM A;  2V8C A;  1SDE A;  3LIC A;  3OCL A;  1STZ A;  4EBN A;  2J9O A;  2Y2Q A;  4KZA A;  2Y2L A;  1F5M A;  5DKK A;  3ITB A;  4NKP A;  1YLW A;  3HLD A;  3T1R A;  1LL5 A;  2BTF P;  2WAF A;  1IFQ A;  2XEP A;  4JPM A;  4Y13 A;  3V39 A;  1HD8 A;  2GDN A;  1LSX A;  3BW6 A;  2H0Y A;  3LYX A;  4HH3 A;  4KZ3 A;  2HF6 A;  5E2G A;  4KQR A;  5F6A A;  1GSX A;  1PWC A;  1IYO A;  3NDG A;  4ARZ B;  4EUV A;  1TDL A;  3C30 A;  2I9V A;  1E25 A;  3EWK A;  1H8M A;  4BD0 A;  4GHI A;  2WKR A;  4U3T A;  4L9G A;  3C5A A;  1T1C A;  1WE4 A;  4Q0I A;  3S1Y A;  4XT2 A;  4U0X A;  2JBF A;  2EX6 A;  3PXP A;  4PM9 A;  3NIA A;  3E4P A;  3O3V A;  1DP8 A;  4F94 A;  3MS6 A;  3BFC A;  3ZGA B;  4B88 A;  4H6J B;  1RGZ A;  4D2O A;  1ES3 A;  2Z6D A;  1FCM A;  1FQG A;  4LPZ A;  5FAQ A;  4DJ3 A;  1SCW A;  5F68 A;  4IVI A;  3I7J A;  1BT5 A;  4ESP A;  2HP6 A;  1YPR A;  3P01 A;  4MBF A;  3WRT A;  1SDN A;  1ERO A;  5F5Y A;  4OOM A;  2PRF A;  4R4R A;  1JWV A;  1NZU A;  3UE0 A;  5DKL A;  3FPW A;  4S2I A;  3UDF A;  1IKI A;  5KIZ A;  1M6K A;  1K38 A;  4K0W A;  2ZQ9 A;  5EUA A;  3UB9 A;  3C2W A;  1PI5 A;  1NLZ A;  1HLU P;  3FWL A;  1XJ4 A;  5MC7 A;  1L0F A;  3IT9 A;  5E2F A;  4GDN A;  2ZC3 B;  3UPP A;  4IHQ A;  4OOL A;  1E3U D;  2DRW A;  2P7J A;  1YSQ A;  1KGG A;  5HDD A;  4K0X A;  5IT5 A;  1ESU A;  2Z2L B;  4Y0T A;  1ZHH B;  3C8C A;  4PAU A;  2V2F F;  4CQH A;  3KSG A;  4I38 A;  4E04 A;  2V20 A;  2XQZ A;  3L9K A;  4EET B;  4OLD A;  3KSI A;  2XK1 A;  1PI4 A;  2LB9 A;  1PRQ A;  3Q82 A;  3H7W A;  2R78 A;  3RXW A;  4OLG A;  1T19 A;  4EQI A;  4KUO A;  5A93 A;  3WS5 A;  2EX8 A;  2V1Z A;  3IX8 A;  3K3D A;  4Q0J A;  3ZG8 B;  3IBJ A;  3GQZ A;  2WZX A;  5HAP A;  1IOU A;  3UPO A;  4DXC A;  3CHW P;  1S67 L;  4DKI A;  2OV5 A;  4WM9 A;  2ZQ8 A;  5FEG A;  3PAG A;  2Y79 A;  1G28 A;  5GHZ A;  3IF5 A;  3EGX C;  4L9F A;  1K55 C;  1MZU A;  2PR6 A;  3HLE A;  1L3L A;  4P6Z S;  1K55 A;  1TS6 A;  2W0N A;  4UHU A;  4HBU A;  4KG6 A;  2EX9 A;  1FR6 A;  2ACG A;  2QZ6 A;  3OZH A;  2VLG A;  3JVU A;  5FAS A;  2Y2K A;  3FKW A;  3CWF A;  4PM7 A;  3KO6 A;  1CEG A;  3T4S A;  4ZJ2 A;  1S4S A;  2I72 A;  3CPT B;  4BL2 A;  5HD3 A;  2X01 A;  4ARZ A;  4HOI A;  4WLA A;  2Y2J A;  1NRJ A;  3EOI A;  1NXY A;  1BLC A;  2JKR I;  4X6T A;  3LGO A;  3GRJ A;  3O88 A;  4QWO A;  4OP5 A;  1A0K A;  4OPY A;  3T4O A;  4S2K A;  3QP5 A;  5GLB A;  4AFI A;  3FYZ A;  1K6S A;  2JE5 A;  1BUL A;  4I5S A;  1F9I A;  4XUX A;  4ZJ1 A;  2XFT A;  1ES2 A;  1TEM A;  2ZJ9 A;  4WEL A;  1U60 A;  1GSW A;  1JNU A;  3HUM A;  1K0K A;  1CF0 A;  4JXS A;  3G35 A;  4WEJ A;  5HDS A;  3DWZ A;  2P74 A;  4HP4 A;  1KVL A;  3JYI A;  3ZFZ A;  1RGY A;  4CLC E;  1K6R A;  5CER A;  5F83 A;  3VE4 A;  3EGD C;  3S7Q A;  5E2E A;  1M40 A;  4HH2 A;  3F1N B;  2HDU A;  2JC7 A;  3NUL A;  4X56 A;  4KEN B;  3OOV A;  5CTN A;  1CI9 A;  2OSU A;  3T4K A;  5CTM A;  2RCX A;  3KX0 X;  2XRO A;  2QJ7 A;  3IHB A;  4NXE A;  3QNC A;  3S4X A;  1N9O A;  5GHX A;  3LO7 A;  1KDS A;  2YKH A;  3BLS A;  4ZDX A;  1GA9 A;  1XP4 A;  5F1F A;  2WYX A;  1XFQ A;  4LCM A;  2VX8 A;  1Z09 A;  4JF6 A;  2Y2O A;  1OJ5 A;  4HJ4 A;  2Y8H A;  4UA7 A;  5GL9 A;  3L7H A;  4R0Q A;  3E2K A;  2WKI A;  2B95 A;  2EX2 A;  2W3H A;  3SZT A;  4R3J A;  5HPF A;  2J8Y A;  3NOP C;  2EFU A;  1KE4 A;  1X0O A;  3V3S A;  4ZJ3 A;  3P09 A;  2XR0 A;  1GHP A;  4KZ4 A;  1IYQ A;  4BL3 A;  3P98 A;  5IU1 A;  3C7V A;  4BJP A;  3BEB A;  5TR7 A;  5DTS A;  4KG5 A;  2Y2N A;  3VV4 A;  2HDR A;  3NJA A;  3NC8 A;  1EW0 A;  2CC1 A;  4S2N A;  2VGL M;  2JKR M;  5AQ9 A;  3SH7 A;  1YKD A;  1ES4 A;  2QMI A;  3MJQ A;  3EQU A;  4YWZ A;  5HWT A;  1MY8 A;  2KX6 A;  4BMW A;  1F98 A;  3M6H A;  2M7V A;  5U47 A;  1MKM A;  4RVA A;  4DJ2 A;  4MEZ A;  2V8F A;  3E0Y A;  2ZBB A;  1ODV A;  2JN7 A;  4OVD A;  3MQO A;  4NK3 A;  4JGR A;  4S2O A;  2Q0O A;  3VOZ A;  1CQA A;  2WGW B;  2NUT C;  5DFX A;  2QKP A;  1XJ3 A;  3DTK A;  2GNX A;  4IVK A;  3UN7 A;  5G4Z A;  3KSH A;  3HCY A;  1Y54 A;  2ZC7 A;  1K56 D;  3RJU A;  3K2N A;  1F2K A;  3F1O B;  3CPT A;  3ZHH A;  2DCF A;  1T1B A;  2J3T D;  4ZTK A;  1VM1 A;  1Q2P A;  3WWX A;  2Y59 A;  2C5W B;  2A49 A;  2ZL1 A;  2WKQ A;  3QP6 A;  1W8Q A;  3O87 A;  2ZMV A;  5DFY A;  4HEF A;  5CEC A;  1G68 A;  4X68 A;  4HY8 A;  4ZBE A;  2VZW A;  1EWZ A;  3QP4 A;  5HW3 A;  4H8R A;  2PD8 A;  1W63 M;  3SH8 A;  4ZRR A;  2ZLY A;  2JKF A;  1RCJ A;  2B5R A;  1IEL A;  2IWC A;  3CJM A;  3RTY A;  4U0T A;  3NY4 A;  2JKT M;  3IWO A;  2PYR A;  3IS2 B;  4WUJ A;  3UNW A;  1ACF A;  1ONH A;  4B4Z A;  4OKP A;  5EPH A;  3MQ0 A;  1BSG A;  3FKV A;  4P85 A;  4EQ1 A;  1IYP A;  3M2K A;  3OC2 A;  1FIK A;  3HBR A;  2G7U A;  3PBO A;  4R3B A;  2DMW A;  2H5S A;  4Z9Q A;  1GA0 A;  2BLS A;  2IWD A;  4QJG A;  5CGW A;  2HV1 A;  1H8Y A;  3F1N A;  3SOI A;  2EXB A;  1KOU A;  4E6W A;  3T1X A;  4UA6 A;  4B9O A;  3BYD A;  3MR0 A;  4JKT A;  3SS5 A;  1O07 A;  1NLY A;  4JBF A;  3N4I A;  1I2S A;  4IED A;  4E3K A;  2IWB A;  5TFQ A;  1T1A A;  5AVF A;  5DJU A;  2PD7 A;  4II7 A;  5FDH A;  1UWN X;  3CAX A;  5FDS A;  5HAQ A;  4LV3 A;  1GSV A;  1N9N A;  4UQI S;  3NHQ A;  5EVI B;  4I39 A;  1ESI A;  3NOT C;  1AXB A;  4NG2 A;  2HJE A;  4PM5 A;  5FQK A;  3UB5 P;  3PTE A;  4E3I A;  3R4K A;  1VEU B;  3DBA A;  1LL9 A;  3KSF A;  5FAO A;  1OJG A;  1YLP A;  3UDX A;  5TJJ A;  2CMN A;  4MCW A;  2VJW A;  4RYE A;  1YT4 A;  1SHV A;  2ZD8 A;  3HLG A;  1TS7 A;  1I2W A;  2HGV A;  5CHU A;  2Y2P A;  3LFV A;  3VP3 A;  1W8Y A;  5L09 A;  3SW1 A;  1C3B A;  2ZQA A;  4OH0 A;  2D01 A;  3BEC A;  3ZNT A;  1K4F A;  5GLC A;  2KDK A;  3HL9 A;  4A5R A;  5HWW A;  2QYB A;  3UME A;  4QU3 A;  3S7O A;  1XFN A;  2PBY A;  2W3F A;  3PBR A;  2Z2M B;  3Q7V B;  4HIA A;  2LB5 A;  2WKP A;  2V9A A;  4NXG A;  3E4O A;  3JVV A;  2PT7 A;  1W7F A;  4QB8 A;  3DTE A;  1PWG A;  2E8J A;  4KUK A;  1PFL A;  3LR5 A;  4JXW A;  5IHV A;  5DVA A;  2XA7 S;  4Y0U A;  3S22 A;  4FD8 A;  3UE3 A;  1ZTU A;  4HI4 A;  1JTG A;  4EBP A;  3ITA A;  3TE8 A;  5FQ9 A;  4UEY A;  1NJ4 A;  1NWZ A;  1XX2 A;  4N1H A;  3WS0 A;  1NRF A;  4EEU A;  1DJC A;  3P7N A;  3M2J A;  4DF6 A;  1XKZ A;  2ZM8 A;  1Y4O A;  3DTM A;  3F1O A;  2ZM2 A;  3MMH A;  3G2Z A;  3QNB A;  3T4Q A;  4OOY A;  2JKG A;  2XDM A;  3M6B A;  1YMS A;  1ZKJ A;  4OQ0 A;  5FEF A;  4PPR A;  1J9M A;  4X25 A;  3ZG5 A;  3LUQ A;  4P6Z M;  3IXD A;  1FSW A;  5HDC A;  3T50 A;  3Q07 A;  3LCE A;  1S4R A;  3BFG A;  5CRF A;  3HVF A;  1L0E A;  2UWX A;  3H9W A;  3LI9 A;  5FA7 A;  3MFX A;  4GN2 A;  4LV1 A;  1H3Q A;  2EWW A;  4LGW A;  5HL6 A;  1IKG A;  3F1P B;  5HL1 A;  4C6Y A;  3WS4 A;  1IEM A;  5F82 A;  4JXV A;  3E98 A;  4CJN A;  4CLC B;  4S2L A;  1ZC2 A;  3IS2 A;  2OAP 1;  5CX7 A;  3W4Q A;  3FV7 A;  1MWR A;  2PDR A;  2FFY A;  3BLM A;  2ZOH A;  3PBS A;  1OT6 A;  1UGU A;  3PBT A;  3MF0 A;  1Z6F A;  3N7W A;  4K91 A;  3BQA A;  5CGX A;  1PNE A;  3CI6 A;  3A3E A;  2EA9 A;  4E6X A;  3ISG A;  2BG1 A;  3OPL A;  1BYW A;  1OTI A;  4R38 A;  1YLY A;  5F69 A;  3ZQ5 A;  5GLA A;  3EEA A;  2O0Y A;  1LSV A;  3VE3 A;  1S66 L;  3BQ8 A;  4EV4 A;  5DF7 A;  1HVB A;  5FI2 A;  4GD8 A;  4PHT A;  1TD5 A;  3O5Y A;  4C75 A;  5EVI C;  2NUP C;  1YAX A;  3NBL A;  4HJ3 A;  5EVI A;  3VFF A;  3MKE A;  2PAV P;  4R70 A;  4Y15 A;  1SZV A;  1ZG6 A;  2D02 A;  2VEA A;  3MXQ A;  4DN0 A;  4M4X A;  1VEU A;  4HHD A;  2HPB A;  1PIO A;  2WGI A;  3IXB A;  5DTK A;  3R7W B;  1K57 C;  2JCH A;  3W4P A;  4R23 A;  2ZQ7 A;  3CIT A;  1PZP A;  2GX5 A;  4IUH A;  2J7V A;  3U4L P;  3GMW A;  4LLO B;  4N9L A;  4BD1 A;  4H6J A;  3LR3 A;  5EFW A;  3UDI A;  4JXG A;  4I3I A;  5CHJ A;  5LBR A;  1OTA A;  5IS1 A;  3U2A A;  4QPR A;  1VQQ A;  3DAV A;  3IH9 A;  5CEB A;  1XPB A;  3LIA A;  3Q7V A;  3T4J A;  2ZC6 B;  2HDQ A;  3C4P A;  1XGJ A;  4KZ9 A;  2M1C A;  4NXB A;  1O7E A;  4HJ6 A;  2W1R A;  2Y2I A;  4B4X A;  1E4D A;  2O99 A;  2HP5 A;  3D72 A;  1S6R A;  1YMX A;  2L0W A;  1V9Z A;  5A91 A;  4O01 A;  1S1Z A;  1BUE A;  2JHE A;  3OCN A;  3BY8 A;  4NXF A;  4PM6 A;  1LLB A;  5FAT A;  1ERM A;  4DXB A;  4LV2 A;  3A0R A;  4ETZ A;  3NOU C;  2X71 A;  2Q9N A;  5TBM B;  3TOI A;  4LCL A;  2VV8 A;  2G2W A;  1YLZ A;  2G2U A;  4FCF A;  1DJB A;  4BBU A;  4IUK A;  1G6A A;  2DNS A;  1XXM A;  3DTI A;  3LEZ A;  3LID A;  2Y2H A;  2ZC4 B;  1LHY A;  3LY4 A;  3GV9 A;  1BLH A;  4FSF A;  2VK3 A;  4LRX C;  2E8I A;  3GSG A;  4XT2 B;  3OBF A;  3NEC A;  4R1G A;  2P9V B;  3F1P A;  4PKY A;  4E3M A;  4Y5F A;  1MWU A;  5G4Y A;  2Y91 A;  1HZO A;  2ZM0 A;  4CLC C;  4CPK A;  3B47 A;  4GDB A;  2Y2M A;  5CGS A;  4CLC A;  3TRC A;  4MN6 A;  2WZZ A;  1ZG4 A;  5BOH A;  4G3W A;  1PYY A;  4EW7 A;  3BJN A;  2C6W B;  4P87 A;  5EVL A;  5TGF A;  4ZAM A;  3A3J A;  3O86 A;  2H28 A;  1XA7 A;  4LFU A;  3MXR A;  3IWQ A;  1D06 A;  5EEC A;  3V3R A;  2Q9M A;  5DF8 A;  3S7P A;  5HPI A;  1GHM A;  2ZMA A;  2KOI A;  2WKH A;  1Y28 A;  1SKO B;  1W79 A;  4OPZ A;  5L07 A;  4DDS A;  4G3K A;  4Y17 A;  3T1S A;  5HZH A;  2Y4A A;  3UO9 A;  4Q0H A;  3CZD A;  2R9X A;  3C38 A;  3ZG9 B;  5M18 A;  1LI9 A;  4RX3 A;  2HZ5 A;  1L2S A;  4UAA A;  3G31 A;  3RXX A;  1KDW A;  1OT9 A;  5FQM A;  3B3X A;  3UE1 A;  3IBR A;  3G34 A;  3VMA A;  2OLV A;  2HJ9 C;  4GCZ A;  4YNR A;  5C5K A;  3Q1F A;  5E2H A;  1P9W A;  4IJG A;  3HJI A;  4JGP A;  3HLF A;  3R7W A;  5G18 A;  1FCN A;  3MZD A;  2W27 A;  1L0G A;  5I94 A;  4CLC D;  3HLB A;  1BLP A;  3K3C A;  1J3W A;  3KYZ A;  4MNR A;  3N8S A;  1CJF A;  3LI8 A;  1DP6 A;  3LIB A;  1P97 A;  3G2Y A;  1NY0 A;  3BFD A;  4FUW A;  4LRY C;  3OLO A;  4Y7P A;  2OAQ 1;  5HAI A;  1KE3 A;  3UE6 A;  4UQI M;  4WYY A;  1N9L A;  2ZC5 B;  3EQV A;  4EU0 A;  1K25 A;  2WUQ A;  3LIE A;  1MC0 A;  3BY9 A;  2A3U A;  1ONG A;  4K08 A;  2VA0 A;  2W3G A;  3UPN A;  1K54 C;  1MPL A;  4S2J A;  5HSQ A;  3LIF A;  1K54 A;  3V50 A;  5DTT A;  1DY6 A;  4Q8I A;  4O8G A;  3IXG A;  2VV7 A;  4WZ5 C;  5J7E A;  3ICY A;  1BLS A;  4E3O A;  4Z1W A;  3MZE A;  4MBK A;  4WZ5 A;  3DW0 A;  5TBM A;  2O9A A;  1JWP A;  4KQQ A;  4S2P A;  1YLT A;  3ULF A;  2HDS A;  2ZQC A;  3CUE C;  4N9K A;  5GLD A;  4OP8 A;  3CUE A;  1G5U A;  3CLO A;  3HLW A;  4YIN A;  1E3U A;  3C7U A;  3VOL A;  3HRE A;  2BAS A;  4MDZ A;  3RFB A;  5FI6 A;  1XA1 A;  2XD5 A;  1UWP X;  4EUZ A;  4GKU A;  3W8K A;  3CG5 A;  4EXO A;  2XA7 M;  4Y2F A;  3A0S A;  2P04 A;  4OON A;  2P9V A;  4DE2 A;  3MKF A;  4WF0 A;  1H8Z A;  3BRM A;  4KZ5 A;  4WN5 A;  4EEP A;  1OME A;  3UB8 A;  3N8R A;  4S2M A;  1I5Q A;  5J3W A;  1JTD A;  3IX3 A;  2V1A A;  3MSH A;  4DRT A;  5AVE A;  2VKS A;  3IX4 A;  4N1X A;  1TF1 A;  4R4S A;  4OPQ A;  2WAE A;  2A24 B;  3NCK A;  3GVB A;  4R3A A;  4BEN A;  1T18 A;  4KZB A;  4GD6 A;  4KZ8 A;  4LRZ E;  3A0V A;  1VET B;  4MMN A;  5EOE A; 
#chains in the Genus database with same CATH homology
 3EEA A;  2O0Y A;  1TS0 A;  1LSV A;  3VE3 A;  1S66 L;  2L4R A;  3BQ8 A;  3FC7 A;  2FZ0 A;  2W3H A;  2Z6C A;  3UB6 A;  5DJT A;  5HPF A;  3W2Z A;  3NOP C;  4PHT A;  1X0O A;  3EEH A;  1TD5 A;  3O5Y A;  4B93 A;  2W3E A;  1YAX A;  2NUP C;  1OTB A;  4HJ3 A;  5HD5 A;  5J4E A;  5IU1 A;  2W1T B;  2M7U A;  4R70 A;  4BJP A;  1WA9 A;  2IA2 A;  4L0L A;  2D02 A;  2VEA A;  3MXQ A;  3OCL A;  3LIC A;  4DN0 A;  1STZ A;  3PYP A;  2OWH A;  4M4X A;  4HHD A;  3VV4 A;  3R7W B;  3NJA A;  3MQQ A;  1F5M A;  5DKK A;  1YSP A;  2A2L A;  1EW0 A;  1LT0 A;  4NKP A;  4NEE D;  3CIT A;  2GX5 A;  4IUH A;  2VGL M;  2W3D A;  4KQO A;  4FOF A;  5DF9 A;  4LLO B;  4BBT A;  2JKR M;  1IFQ A;  1G6O A;  1YKD A;  3E4Q A;  3PBQ A;  4G3V A;  4WL9 A;  4H6J A;  3BW6 A;  1LSX A;  3LR3 A;  3LYX A;  3EQU A;  3MJQ A;  4HH3 A;  4YWZ A;  2HF6 A;  5EFW A;  2K31 A;  5HWT A;  2ZOI A;  5F6A A;  4I3I A;  5LBR A;  4BMW A;  2KX6 A;  4BWI A;  1F98 A;  1OTA A;  5IS1 A;  2M7V A;  3B33 A;  1GSX A;  3U2A A;  1MKM A;  2INW A;  4QPR A;  4ARZ B;  4DJ2 A;  4EUV A;  3E0Y A;  2ZBB A;  1ODV A;  2JN7 A;  3GEC A;  3C30 A;  2I9V A;  3MQO A;  3PBN A;  3EWK A;  4JGR A;  1H8M A;  4GHI A;  4ETX A;  2NUT C;  5DFX A;  3LIA A;  2QKP A;  1XJ3 A;  2WKR A;  3T4J A;  2GNX A;  3BWL A;  2M1C A;  4NXB A;  4L9G A;  2V0W A;  4HJ6 A;  1T1C A;  2W1R A;  1VB6 A;  4Q0I A;  4YOF A;  5G4Z A;  3KSH A;  3HCY A;  2O99 A;  3K2N A;  4XT2 A;  3F1O B;  3D72 A;  4GJ4 A;  2L0W A;  1T1B A;  1V9Z A;  4O01 A;  3PXP A;  1S1Z A;  2J3T D;  1VHM A;  2JHE A;  3E4P A;  3OCN A;  3BY8 A;  4NXF A;  4GS9 B;  1DP8 A;  2EWV A;  2WKQ A;  2ZMV A;  5DFY A;  3A0R A;  4ETZ A;  1W63 Q;  3NOU C;  4HY8 A;  4H6J B;  2ZMF A;  2VZW A;  5TBM B;  2Z6D A;  5KSH A;  4LPZ A;  4DJ3 A;  3HJK A;  2PD8 A;  1W63 M;  5F68 A;  1TS8 A;  3S7N A;  2VV8 A;  4ZRR A;  2J3W A;  2PYP A;  2OOL A;  3FG8 A;  2XRN A;  4BBU A;  4IUK A;  2GJ3 A;  3RTY A;  3P01 A;  5F5Y A;  4OOM A;  5FL3 A;  4O0P A;  4RQ9 A;  2JKT M;  2PYR A;  3IS2 B;  4WUJ A;  3LID A;  5DKL A;  3FPW A;  5KIZ A;  3MQ0 A;  4FSF A;  3UB9 A;  3C2W A;  4LRX C;  1NLZ A;  4XT2 B;  3OBF A;  1XJ4 A;  4EQ1 A;  4I3J A;  5MC7 A;  3OC2 A;  3F1P A;  4PKY A;  4HP9 A;  2P08 A;  4Y5F A;  5G4Y A;  3H82 B;  2G7U A;  3PBO A;  4CLC C;  4F3L B;  2DMW A;  1P9R A;  3B47 A;  4IHQ A;  4OOL A;  1V9Y A;  2P7J A;  1YSQ A;  4CLC A;  3TRC A;  4MN6 A;  2HV1 A;  4EER A;  5HDD A;  3F1N A;  3G6O A;  2V1B A;  5IT5 A;  1KOU A;  4WEK A;  1ZHH B;  3C8C A;  4G3W A;  4B9O A;  4PAU A;  3MR0 A;  1OPX A;  4CQH A;  4MN5 A;  3KSG A;  4EW7 A;  3BJN A;  4I38 A;  1NLY A;  4E04 A;  2QJ5 A;  4L9E A;  3LR4 A;  2H28 A;  4EET B;  3KSI A;  1T1A A;  5AVF A;  2LB9 A;  5DJU A;  1D06 A;  2PD7 A;  4R6L A;  3H7W A;  1OTE A;  4II7 A;  1UWN X;  2R78 A;  3S7P A;  3CAX A;  5HPI A;  2VV6 A;  1GSV A;  2OWJ A;  1T19 A;  1N9N A;  4UQI S;  4KUO A;  2A24 A;  3NHQ A;  4I39 A;  2J80 A;  2KOI A;  3NOT C;  1D7E A;  4EES A;  3K3D A;  2HJE A;  1Y28 A;  4Q0J A;  3IBJ A;  4PKY G;  3R4K A;  3T4L A;  3UMD A;  1XJ6 A;  3DBA A;  4G3K A;  5HZH A;  3UB7 A;  1IOU A;  3T4T A;  3KSF A;  4ME4 A;  5AJG A;  1OJG A;  4HQA A;  4Q0H A;  3D3O A;  1S67 L;  3C38 A;  5TJJ A;  2CMN A;  2Y79 A;  4MCW A;  2VJW A;  1G28 A;  4GW9 A;  3TJZ C;  3LR0 A;  4GLQ A;  3EGX C;  4L9F A;  4Y3I A;  2W1T A;  1MZU A;  2PR6 A;  2L1M A;  1OT9 A;  2FH5 A;  3IBR A;  4P6Z S;  4DMZ A;  1TS7 A;  1XJ2 A;  2B18 A;  2O9B A;  2HGV A;  1TS6 A;  2W0N A;  2HJ9 C;  3LFV A;  4GCZ A;  4YNR A;  5C5K A;  1LSW A;  3SW1 A;  1P9W A;  4IJG A;  3HJI A;  4JGP A;  2D01 A;  3R7W A;  2W27 A;  2KDK A;  5HWW A;  4CLC D;  2QYB A;  2JKT I;  2VLG A;  3JVU A;  3K3C A;  3UME A;  3S7O A;  1XFN A;  4GHI B;  2XSS A;  2W3F A;  3PBR A;  3KYZ A;  3CWF A;  4HIA A;  3KO6 A;  2LB5 A;  3T4S A;  3LI8 A;  2WKP A;  2V9A A;  1DP6 A;  4NXG A;  3E4O A;  3JVV A;  2PT7 A;  1S4S A;  1P97 A;  3LIB A;  2KLI A;  4LRY C;  3OLO A;  2OAQ 1;  4KUK A;  3ZYT A;  3LR5 A;  2J3T C;  2XA7 S;  5HD3 A;  4ARZ A;  3UE3 A;  3UE6 A;  5A8B A;  4HOI A;  1ZTU A;  4HI4 A;  4UQI M;  4WLA A;  1NRJ A;  5I5L A;  1N9L A;  3EQV A;  2PHY A;  4EU0 A;  3TE8 A;  4UEY A;  3EOI A;  5K5B A;  1NWZ A;  3LIE A;  1MC0 A;  2JKR I;  3BY9 A;  2QWS A;  4K08 A;  2VA0 A;  2W3G A;  3TW8 A;  4EEU A;  3P7N A;  3T4O A;  3PHY A;  5HSQ A;  3F1O A;  3LIF A;  4AFI A;  3MMH A;  3T4Q A;  3V67 A;  4I5S A;  1OTD A;  4GS9 A;  1F9I A;  3LUQ A;  4O8G A;  4P6Z M;  2VV7 A;  5HDC A;  3T50 A;  5J7E A;  3ICY A;  4Z1W A;  1S4R A;  4WEL A;  1GSW A;  1P0Z A;  1JNU A;  5HWV A;  5TBM A;  3H9W A;  3GDI A;  2YKF A;  2O9A A;  3LI9 A;  3MFX A;  4WEJ A;  5HDS A;  1H3Q A;  4HP4 A;  3ULF A;  2EWW A;  5HL6 A;  3CUE C;  3F1P B;  4HNB A;  4CLC E;  4MN7 A;  3FPV A;  3B42 A;  3CUE A;  3CLO A;  2B02 A;  4KQD A;  3VE4 A;  3E98 A;  3EGD C;  3S7Q A;  3VOL A;  2MJ6 A;  4CLC B;  2BAS A;  2QHK A;  4MDZ A;  3RFB A;  3IS2 A;  2OAP 1;  5CX7 A;  4JGQ A;  4HH2 A;  1UWP X;  5L8M A;  3F1N B;  2PDR A;  2ZOH A;  3PBS A;  3OOV A;  1OT6 A;  4EXO A;  3KYQ A;  2VGL S;  2PR5 A;  2XA7 M;  1UGU A;  3T4K A;  4Y2F A;  3A0S A;  2P04 A;  3KX0 X;  3PBT A;  4WF0 A;  3MF0 A;  2XRO A;  2QJ7 A;  3H82 A;  1DP9 A;  4NXE A;  4WN5 A;  4EEP A;  3UB8 A;  1DRM A;  4F3L A;  3BQA A;  1N9O A;  2GZA A;  2O9C A;  2K7S A;  3RH8 B;  2YKH A;  2K2N A;  3H7W B;  5J3W A;  3CI6 A;  2V1A A;  5AVE A;  2EA9 A;  2VKS A;  1TF1 A;  2V0U A;  4JGO A;  3PR6 A;  2A24 B;  1BYW A;  1XFQ A;  4I3A A;  1OTI A;  4R3A A;  1T18 A;  4BBV A;  2VX8 A;  4R38 A;  1S1Y A;  4LRZ E;  1OJ5 A;  4HJ4 A;  3A0V A;  2Y8H A;  5F69 A;  1LL8 A;  3ZQ5 A;  4MMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...