2GX5A

N-terminal gaf domain of transcriptional pleiotropic repressor cody
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
161
structure length
157
Chain Sequence
HMALLQKTRIINSMLQAAAGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDRMKKMLEDRQFPEEYTKNLFNVPETSSNLDINSFPVENRDLFQAGLTTIVPIIGGGERLGTLILSRLQDQFNDDDLILAEYGATVVGMEILREKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords GTP-sensing transcriptional pleiotropic repressor codY
publication title The structure of CodY, a GTP- and isoleucine-responsive regulator of stationary phase and virulence in gram-positive bacteria.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 55
structure length 157
sequence length 161
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2gx5A00
4IUHA 5DFYA 3MF0A 5L8MA 4Q0JA 3EEAA 4EU0A 4O0PA 1TF1A 4EUVA 2W3HA 3IBRA 4G3WA 4O01A 4Q0HA 2M7VA 2VZWA 2W3EA 1F5MA 4GW9A 3O5YA 4Y3IA 2HGVA 3S7NA 2Y79A 4GLQA 3S7OA 4MCWA 1STZA 4O8GA 5DFXA 2O0YA 4E04A 4DMZA 2VEAA 5K5BA 3BJNA 4DN0A 2W3GA 3KSFA 2VKSA 2O99A 4ME4A 1MKMA 4QPRA 3CI6A 3NOUC 3K2NA 5AJGA 2K31A 3C2WA 2OOLA 4ETZA 2G7UA 5HPFA 2KOIA 4G3KA 4LRYC 4R6LA 4R70A 3MMHA 1ZTUA 2IA2A 2VJWA 4YOFA 3NOPC 5LBRA 4Y2FA 2KLIA 5C5KA 2W3FA 4LRZE 3OBFA 3E0YA 4CQHA 4FOFA 3R4KA 4Y5FA 4BWIA 1YKDA 3NHQA 1YSPA 3KSIA 4Z1WA 2O9BA 3TRCA 3CITA 2LB9A 3VV4A 3G6OA 3DBAA 5HL6A 1YSQA 3KO6A 4MN7A 2LB5A 2QYBA 3KSHA 3S7PA 4G3VA 3ZQ5A 2GX5A 4Q0IA 2K2NA 4RQ9A 3D3OA 3LFVA 5HPIA 4YNRA 2W1RA 2W3DA 4ZRRA 5HSQA 2W1TB 1VHMA 3IBJA 4PAUA 4MMNA 4IUKA 4MDZA 5I5LA 3RFBA 2O9CA 3NOTC 4IJGA 2Y8HA 5TJJA 3OOVA 3W2ZA 3MQ0A 2W1TA 3KSGA 2M7UA 2O9AA 2B18A 2ZMFA 2XROA 2XRNA 2XSSA 3S7QA 3HCYA 1MC0A 1TD5A 4LRXC 3E98A 4ETXA
chains in the Genus database with same CATH superfamily
4IUHA 5L10A 2FFFB 4Q0JA 1RP5A 3V50A 3VP1A 4GB7A 5A91A 4O01A 2Y2OA 5FQQA 3S1YA 5DJUA 1K56A 4QHCA 3JVVA 4QD4A 3SS5A 4B4ZA 4I39A 3PBRA 1O7EA 3PXPA 3VP2A 3QP1A 2VKSA 2Q0OA 3C8CA 3BY8A 2QZ6A 1FCMA 2P9VB 3GQZA 1GCEA 3LIAA 4MBHA 4KENB 1PZOA 2ZL1B 3T4KA 3WS5A 2CMNA 3FG8A 5DF9A 2W3FA 4ARZA 4EXOA 4QJGA 4B88A 4RA7A 5G4YA 2OWJA 3N7WA 1Q2QA 2OSUA 1P97A 3TE8A 3NHQA 2Y2NA 3LI9A 2XGNA 4QU3A 4GCZA 2PU4A 2ZC5B 1BLHA 5A93A 2J7VA 2DMWA 4L9FA 3UE0A 1LSVA 2PT7A 3B3XA 4HY8A 3LGOA 4GN2A 3W4QA 4E3IA 4MLLA 4X6TA 3VFFA 1XJ6A 4II7A 3UB9A 2EWWA 4CPKA 1DP6A 3GV9A 3NOTC 2WKHA 2NUTC 4D60A 3A3IA 3LYXA 3MKEA 3RTYA 3WRTA 4EUZA 1K4FA 2B02A 2VV6A 5F83A 2ZMAA 3LEQA 5IHVA 4EUVA 3NDGA 4R3AA 2IWCA 4OPQA 1NY0A 2M1CA 5FEFA 3FYZA 1O07A 1JTDA 3VP0A 3C7UA 4O8GA 5CHJA 3Q81A 3IH9A 3FWLA 5IT5A 1NYMA 4EBLA 2PR5A 2VK3A 4R4SA 2ZOHA 4WF0A 4UA6A 4KZ6A 4NEED 2P7JA 1JWZA 5EPHA 1G68A 4JXGA 2P08A 1PWDA 4H6JB 5EOEA 2P04A 3WWXA 3LCEA 3Q7ZA 1L0EA 3WS4A 1DJCA 3AGEA 3G34A 2J3WA 3ZG5A 2Y2PA 1SKOA 2MJ6A 4RX2A 3UDXA 4Y5FA 4X1LA 4GS9B 3QNCA 4Z1WA 1TS0A 3WRZA 3CITA 2Y59A 2LB9A 3MFXA 5FAQA 1XFQA 3V5MA 5IS1A 1MZUA 3LR4A 5CERA 3M2KA 3NIAA 1MKIA 3ZQ5A 2D01A 3UB7A 3BY9A 4KQOA 3JPUA 3ZNYA 1L0FA 2XEPA 4E6XA 1CI8A 4PMAA 2WUQA 3IWOA 1W5DA 3ZNTA 3KSGA 4XT2B 3ICYA 1VETA 3FC7A 3RH8B 3PAEA 4BMWA 5HW3A 2FFYA 4OOLA 3VP3A 2QJ5A 2XQZA 4NG2A 3W8KA 2PBDP 4Y3IA 4L9EA 2ZQDA 4B9OA 3BEBA 2VGKA 4S2NA 3LIDA 2EX8A 1ODVA 3ITBA 4GKUA 1XJ4A 1ONHA 3GMWA 3OLOA 4LV1A 4OQHA 4GJ4A 4NKPA 2HP5A 1MWTA 3SH7A 4O7DA 1PW1A 4F94A 4OONA 1CQAA 2HJEA 1TDGA 1MBLA 4C75A 5JYPA 3OPRA 3BWLA 1SCWA 2JKRM 3ISGA 4HP9A 3OBFA 1PI4A 4ESPA 2HDSA 5FL3A 4E3NA 4FCFA 1ES3A 3P98A 2Y2JA 1XGJA 4M4XA 2KDKA 4OOYA 1LT0A 5HDSA 1P9WA 2VV8A 3P7NA 4NXFA 4GDBA 1CK3A 4N1HA 4PKYG 4CLCB 3SW1A 2H28A 1PI5A 1VHMA 1XP4A 3E2LA 5I5LA 2VGLS 5TFQA 3OC2A 4P6BA 4CLCD 3FV7A 4OP8A 2XD5A 1F98A 3CLOA 1P9RA 3P09A 5DTKA 3UPOA 1EI5A 3O5YA 3VFHA 2WGIA 1F2KA 3EGXC 4DDYA 4R38A 3VOLA 4K08A 4Y0OA 5A8BA 3JYIA 1K56D 2H10A 2OAQ1 4L0LA 5AQ7A 4DMZA 4IBRA 4FTXA 1OJGA 1QMEA 3IXHA 5F5YA 2Q9NA 4WEKA 2QJ7A 4X1MA 3N8RA 5L2FA 2OOLA 5AVFA 3BFGA 1ACFA 2Y55A 2V0UA 4ARZB 1OT6A 5GLDA 3LICA 1IKIA 4FH2A 2VJWA 1PFLA 1H3QA 5FSRA 1KE0A 3EOIA 1ESUA 2C5WB 3DTEA 4R1GA 4CQHA 5F1GA 3HLCA 5FQIA 5AQBA 4RYEA 3V67A 5HD3A 1OTDA 3G2YA 2XD1A 3IXGA 3NC8A 5GLCA 3G6OA 5HL6A 3QP2A 4R4RA 3ZGAB 1GSVA 1BULA 4Q0IA 1S6RA 3O86A 4Y7PA 2D02A 4H6JA 5CTNA 1H8MA 3FPWA 3LFVA 2XDMA 3BM6A 1MXOA 4ZRRA 5FASA 1JWVA 3IBJA 4Q8IA 5EE8A 5FDSA 1W63M 4HESA 3E4PA 4HH2A 2XF3A 4GS9A 4NXEA 1TS8A 2EXBA 2XH9A 1MC0A 3LY4A 3C4PA 4GD8A 3BQ8A 5HAQA 1PNEA 3IF6C 1TF1A 2EXAA 2HDRA 5E43A 3RXWA 4EBPA 2A2LA 3UMDA 2Y2LA 4DE2A 5HWTA 2HGVA 3GR2A 2Y79A 3HLEA 2Y2HA 5DFXA 2JKTI 1YLPA 4LLOB 4WBGA 2V0WA 4UQIS 5D3OA 4BBTA 1IYSA 2Z6CA 3G4PA 3Q1FA 5CGXA 1T1CA 4ZBEA 1I2WA 4K91A 1V9ZA 3FKVA 4ETZA 4OLGA 2KOIA 3C5AA 3IHAA 2GNXA 3T1SA 1VEUB 5EVLA 1CI9A 1LL5A 3TSGA 5DF7A 5FQJA 1DP8A 4WYYA 5GHZA 4HI4A 3M2JA 2ZD8A 1KDWA 1N9BA 3BFEA 4E3OA 1LL9A 2EA9A 2PYRA 1E4DA 2LB5A 3P01A 1OPXA 3LI8A 3KSHA 4X68A 4WN5A 2VV7A 1LL8A 1KGGA 4X69A 2W1RA 1C3BA 3AGFA 3MSHA 3WS0A 1VETB 5EM1A 3OOVA 3W2ZA 2HV1A 4HHDA 5EECA 2B18A 3KYQA 4PKYA 1IOUA 4PM7A 2HDUA 3CMZA 5F6AA 2GDNA 1IFQA 2WKPA 1A0KA 5F82A 1JVJA 4BL3A 3IF5A 4DRTA 2WKIA 5CXWA 3LIFA 1PYYA 1NZOA 1V9YA 1OT9A 3A3JA 4E04A 4YFMA 4S2KA 1W8YA 1KE4A 3AGDA 3HLFA 4BQMA 4LV2A 4DXBA 3HJIA 3ZG8B 2O99A 1MKMA 3D9YA 2GZAA 3N4IA 1OTIA 3MJQA 4I3IA 4U3TA 5TGFA 3IH8A 3TG9A 2XR0A 2X01A 3MMHA 1ZTUA 4I5SA 4DE3A 5EUAA 1IYQA 4DE0A 5DKLA 3QP8A 3QP6A 4KZ9A 1W8QA 5EVIB 1MWUA 2J8YA 4LENA 3MZDA 5EVIC 4P6ZM 3H9WA 4X53A 3IXDA 4NK3A 3L7HA 3QP5A 4NETA 5DTSA 3A0RA 3NULA 3BECA 2EX9A 2UWXA 4OPYA 4P0MA 5IU1A 1YLJA 3BYDA 4WZ5A 2K2NA 1YLZA 5HWVA 2R9WA 2OAP1 2W3DA 3OPLA 1W63Q 4K0XA 5F69A 2WGWA 4BD0A 2Y2GA 3O87A 3UY6A 3MQOA 4XUZA 1S0WA 3QNBA 2PBYA 4QWOA 3U2AA 3PBOA 5HAIA 4FSFA 2XA7S 3O88A 2AVXA 2DNSA 3G31A 4G3WA 4FH4A 4KZ7A 1HD8A 2HJ9C 3LO7A 3CWFA 3DAVA 4CJNA 1K57C 3TOIA 3IQAA 4XUXA 5HDCA 5CTMA 3IT9A 1I2SA 2ZM2A 3ULFA 3HBRA 4BLMA 3KSFA 3HVFA 4DF6A 2V1ZA 3UDFA 5DVAA 1OTEA 1DRMA 3IF6A 4JBFA 5FI7A 3T1QB 2I72A 4BJPA 5TR7A 3W4OA 1N9OA 1VM1A 3LIBA 1NYYA 4R70A 3MXRA 1E3UD 4NXGA 2WKQA 1XFNA 3Q07A 1GSXA 4EERA 1S4SA 1S1YA 3OZHA 1DJAA 2EX2A 4JXVA 5HAPA 1RCJA 3MFDA 3H7WA 4K0WA 5J8XA 2QKPA 1BTLA 1N9LA 3RJUA 3UO9A 5CEBA 1YAXA 4E3MA 3S22A 3UPNA 1VEUA 3WS1A 4R3BA 4DJ2A 1GHIA 4HQAA 3G2ZA 4WL9A 3MXQA 3L9KA 4PAUA 3PAGA 5E2FA 2GJ3A 4F3LA 2XK1A 4PM9A 1J9MA 2OWHA 5TJJA 3GECA 3CUEC 2JBFA 2ZMFA 3C7VA 5U47A 2Y2MA 4LFUA 3GVBA 1FSWA 4LRXC 3E98A 4KZAA 1K6SA 5DTTA 4ZJ3A 3HL9A 3A3FA 5TBMA 3UB8A 3KYEA 4GNUA 5EV0A 1N9NA 4Q0HA 4KZ4A 5FQMA 2WAEA 2DRWA 3N6IA 1YM1A 3FKWA 4S2MA 3T4OA 1L0GA 2JCHA 1XKZA 1WYCA 4KG6A 1LI0A 4OKPA 2H5SA 4ZAMA 4ZJ2A 3T12B 1FR1A 1XGIA 1XA1A 2G2WA 2VA0A 5J4EA 5KSHA 5HPFA 1ERMA 4RX3A 1M6KA 4PPRA 4HP4A 1HZOA 3C30A 2FH5A 5M19A 3UPPA 2KLIA 4DXCA 3LEZA 4KG5A 1YKDA 5HX9A 1YSPA 1OMEA 4A5RA 3BRMA 5HZHA 3TRCA 1LSWA 3UN7A 3RXXA 3C38A 1TS6A 1CEFA 4GDNA 5GLAA 2JHEA 1K38A 4JF5A 1NRFA 2GX5A 5EFWA 4LCLA 2WZZA 1BUEA 1SDNA 5HPIA 1M40A 1T1AA 2EFUA 1GHPA 3F1PA 3RFBA 2PD7A 4HJ3A 5EVIA 3EWKA 1MWSA 2XROA 2ZQ9A 1NJ4A 2PRFA 5DJTA 4GHIA 1STZA 1Z09A 1ES5A 3PBQA 1WE4A 2INWA 3E4QA 2W3HA 3Q7VA 3VMAA 2BTFP 2V1AA 3TJZC 1W7FA 1LLBA 4EBNA 3KYZA 4I3JA 4D2OA 1SHVA 2DCFA 4U0XA 5CHMA 2O0YA 2JKRI 2VEAA 1D06A 2EFXA 5A92A 3VSLA 2Y2QA 4QPRA 2ZC6B 1J3WA 3NOUC 2ZM0A 4H8RA 3VOZA 2PDRA 3K3DA 2EX6A 4R6LA 4MN5A 2ZC3B 1K57A 4EV4A 2R9XA 3V3RA 4YWZA 1OTBA 1HTZA 2ZM8A 5FA7A 1FILA 4N92A 4WZ5C 3F1NA 3NDEA 3MZFA 3D3OA 4N1XA 2E8IA 3HLGA 2WGWB 3GTCA 4R23A 4OLDA 2B5RA 2JC7A 5E2GA 5FQ9A 3FPVA 3R7WA 1CJFA 2C6WB 4KZ5A 1U60A 4JXWA 2W1TA 2O9AA 2YKFA 2PYPA 3NI9A 1G6AA 3HUMA 1OJ5A 1F9IA 2L4RA 1YQSA 3F1OB 2HF6A 4EU0A 2BLSA 2WAFA 3QHYA 3B47A 4DDSA 3SS3A 3HLWA 4HH3A 1FIKA 1Z6FA 5GLBA 1MPLA 3D72A 4UAAA 4OQIA 5CX7A 4ID4A 1PRQA 4E6WA 1FOFA 1UWPX 2Z2LB 2ZQ7A 4DN0A 3CUEA 3IF6B 4PHTA 2WK0A 5AQAA 5L09A 4HBUA 2V8FA 5J3WA 3CG5A 5LBRA 3NECA 5KMWA 1PWCA 3ZG7B 2VGLM 3H7WB 4Y0TA 1TS7A 2Y4AA 5J7EA 2Z6DA 4E3KA 3PYPA 3A3DA 5F68A 4DJ3A 4G3VA 3M6BA 4WLAA 3A0SA 4OP5A 4F3LB 4FUWA 5FAPA 3GSGA 1YMXA 4CLCE 2JE5A 3ZYTA 5HSQA 2V9AA 4MMNA 3LR5A 1GHMA 4RVAA 3IWIA 3OCLA 2V1BA 3B42A 2PHYA 3PR6A 3M6HA 3OPPA 3HCYA 5TBMB 4EQ1A 1L0DA 3MF0A 4AFIA 5CECA 3GRJA 2I9VA 3EQVA 1FSYA 1BLCA 4B4XA 2UV0E 3QP4A 2H0TA 2ZOIA 2ZLYA 3S7NA 4MCWA 2J3TD 3VE4A 1NRJA 4BENA 3DTIA 1HLUP 1K55C 2JKFA 1NWZA 1TDLA 4MEZA 4S2IA 3ZG9B 4KQQA 1YLWA 1K0KA 2K31A 1XJ2A 3KX0X 5FQKA 3EQUA 2V20A 1KVMA 2ZC7A 4PM8A 3W4PA 1T18A 4EWFA 3NOPC 2WKRA 4OH0A 4HBTA 4GZBA 1KE3A 4BWIA 3H82A 3UE3A 3KSIA 5AVEA 2CC1A 5HFOA 1YT4A 1XA7A 1KVLA 5HWWA 3VV4A 3DBAA 4JF4A 4HEFA 4UEYA 3KO6A 4S2OA 1W79A 4JKTA 5FATA 1K25A 4EEPA 4E3LA 5EM0A 1IEMA 3F1PB 1ESIA 3NJAA 4OOMA 3DTKA 4BD1A 5M18A 1H8ZA 3E2KA 1PWGA 1S4RA 2Q9MA 4BBUA 4L9GA 3N8SA 4C6YA 4JLFA 3SH8A 1MY8A 4P85A 1QMFA 4GHIB 1XJ3A 4JPMA 3S7QA 4GD6A 2XLNA 5EVID 3Q7VB 3C4OA 3MQQA 4JF6A 1YMSA 3U4LP 4UQIM 4Y15A 4ETXA 2KX6A 1BSGA 5L8MA 4O0PA 4EQIA 1MWRA 1NZUA 2WZXA 2HP9A 1LHYA 5GHYA 3BLSA 1PW8A 1Y54A 1BYWA 3CPTB 3N8LA 2L0WA 3NY4A 4ME4A 2L1MA 1GA9A 4M3KA 3MR0A 1DJBA 3C2WA 1FQGA 1IYOA 1Y28A 3DTMA 3T50A 3F1OA 3UE6A 4OQGA 3CHWP 4OQ0A 3NBLA 3B33A 2V8CA 3ZFZA 5C5KA 3BFFA 4EESA 3IHBA 4FOFA 3VSKA 4HNBA 2ZQCA 4S2PA 1PZPA 1D7EA 4S2LA 2O9BA 4I3AA 1WYBA 2W27A 5A90A 3F1NB 4XXRA 2HZ5A 1YSQA 4N9KA 2QYBA 4DKIA 3IXBA 3S7PA 1BT5A 2ZMVA 1G5UA 3IX4A 4LV3A 3R7WB 3SS4A 5EVEA 1HVBA 1AWIA 4R3JA 3UB6A 2W1TB 5FEGA 2PD8A 1G28A 4BBVA 2VGJA 1ERQA 1H8YA 2O9CA 2QHKA 2HDQA 1EWZA 2X71A 2M7UA 5KZHA 2XRNA 2XSSA 4X56A 1K4EA 3G32A 1NXYA 2QMIA 1LSXA 1X0OA 1BLPA 2JN7A 1WA9A 4WMCA 2PU2A 3BFDA 1ALQA 5G4ZA 2Y91A 2M7VA 3LR0A 4KUKA 1F5MA 3MKFA 1ZC2A 4IVKA 4EETB 3PTEA 2VLGA 3MS6A 3BJNA 1Y4OA 3ITAA 4E3JA 3E4OA 2ZJ9A 1ZKJA 1EW0A 3PBSA 4B93A 2A24A 2WYXA 2P74A 2R78A 2Y2IA 5CHUA 4LRYC 5CEDA 1EROA 2J9PA 3HJKA 3UDIA 3IWQA 2YKHA 1AXBA 1KOUA 2PAVP 4LRZE 4MBKA 3I7JA 1Q2PA 4JGPA 1I5QA 1K55A 1UWNX 1IYPA 4KQDA 2K7SA 1PIOA 2J9OA 4JGQA 3BW6A 5MC7A 3WS2A 2G2UA 3VE3A 4UA9A 3A0VA 4HJ4A 2J80A 2XA7M 3IX3A 4YNRA 3HLDA 2A3UA 4HJ6A 4MDZA 3T4SA 4Z9QA 3IS2B 1VQQA 1JWPA 3EGDC 3LY3A 2JKGA 5F1FA 5DFYA 1SKFA 4IBXA 1ZHHB 5CRFA 3V39A 1S66L 2BASA 4MNRA 4OVDA 4DE1A 3HREA 3ZVTA 1CF0A 1K54C 4GW9A 3HUOA 5E2EA 4MBFA 3UMEA 3CZDA 1KGFA 3S4XA 3SZTA 4N9LA 5FI6A 3DW0A 1BZAA 4LGWA 2W3GA 2IWDA 4ZTKA 3LUQA 5JYOA 1ES2A 4JGOA 4KZ3A 2HP6A 1ES4A 2G7UA 4NXBA 2P9VA 1T1BA 4R0QA 1NLYA 2ZL1A 2OLVA 3OPHA 3H82B 2QPNA 2EWVA 4IVIA 2B95A 3CPTA 5HARA 4CLCC 1RGYA 3VOYA 3R4KA 4EW7A 1G6OA 4YINA 3T4JA 4KG2A 3ZCZA 3O3VA 1TEMA 5G18A 3JVUA 2H0YA 4LPZA 1L2SA 3T4QA 3T4LA 5CGSA 5HDDA 5KSCA 1T19A 3G35A 2XFTA 2RCXA 3T1XA 4C3QA 2Y8HA 5I94A 3CAXA 1JTGA 4X25A 4S2JA 2ZQ8A 1L3LA 2QWSA 1KDSA 1TD5A 1K6RA 4LCMA 4GOGA 1BLSA 4KZ8A 1P0ZA 5HL1A 1SZVA 3EEAA 1YPRA 1IELA 2E8JA 1SDEA 3IBRA 3IX8A 4X55A 2X02A 5DF8A 5M1AA 3UE1A 1E3UA 2RL3A 1RGZA 3PHYA 3NCKA 4GLQA 3MBZA 3S7OA 3LIEA 4Y17A 5FAOA 1H0MA 1XX2A 4QB8A 3BQAA 1DY6A 3G30A 4PM5A 2Z2MB 3D4FA 2BG1A 3K2NA 3VP4A 2WADA 1S67L 4G3KA 4IEDA 4P87A 4YOFA 3ZHHA 5EOOA 2JKTM 4HIAA 4QY5A 4ZJ1A 4WUJA 3OCNA 1FCOA 4OPRA 3T1RA 5FI2A 4PM6A 1DP9A 1GSWA 3T4TA 4BL2A 2V2FF 2ZC4B 4JGRA 4MN7A 3V3SA 1NLZA 2W0NA 3FZCA 2WGVA 3PBNA 4RQ9A 4JXSA 1ZG4A 4I38A 4P6ZS 1FR6A 2ZQAA 4IJGA 1XXMA 3DWKA 1XPBA 3MQ0A 5AQ9A 3HUNA 3ZDJA 4FD8A 1ZG6A 4UA7A 4UHUA 1YLTA 4XT2A 1CEGA 1YLYA 2IWBA 4WZ4A 5CGWA 4WELA 4WM9A 1S1ZA 2VX8A 4KQRA 2VZWA 1IKGA 1ONGA 2W3EA 4WMCD 5DKKA 1FCNA 3A3EA 4U0TA 4LV0A 1SKOB 3CJMA 3Q82A 3K3CA 3ZVWA 3LR3A 5K5BA 3IS2A 4KUOA 5GL9A 4ZDXA 5HD5A 1GA0A 2A24B 3ZG0A 3CI6A 4Y13A 4QY6A 5GHXA 5AJGA 2NUPC 3BFCA 3GDIA 1K54A 4EEUA 1TVFA 2IA2A 2FZ0A 4HOIA 3BLMA 2A49A 4Y2FA 2HPBA 2WKEA 5E2HA 1N4OA 3UNWA 3E0YA 3MXSA 1E25A 2J3TC 3SOIA 1VB6A 4OPZA 4WEJA 2ACGA 4KZBA 4IHQA 2XFSA 5L07A 2ZBBA 1LI9A 1JNUA 5BOHA 1KGEA 3EEHA 2PR6A 2OLUA 1UGUA 3TW8A 1H5XA 2Y2KA 3UB5P 4IUKA 5KIZA 4S2NC 4Y0UA 4CLCA 3DWZA 5FDHA 3PBTA 3HLBA 2OV5A 3SH9A 1OTAA 4MN6A 3MZEA 1D1JA
chains in the Genus database with same CATH topology
4IUHA 4Q0JA 1WA9A 2INWA 3E4QA 1TF1A 2W3HA 2A2LA 3UMDA 4O01A 5G4ZA 5DJUA 3LR0A 2M7VA 4KUKA 5HWTA 1F5MA 3JVVA 2HGVA 2V1AA 4EETB 2Y79A 4I39A 3TJZC 3PBRA 3PXPA 2VLGA 3KYZA 4I3JA 5DFXA 2JKTI 2O0YA 2JKRI 2VEAA 4LLOB 1D06A 2V0WA 3BJNA 4UQIS 2VKSA 3E4OA 4QPRA 4BBTA 3C8CA 3BY8A 3NOUC 1EW0A 2Z6CA 2PDRA 1T1CA 3PBSA 4B93A 2A24A 1V9ZA 3LIAA 4ETZA 2R78A 3K3DA 3T4KA 2KOIA 4LRYC 4R6LA 2GNXA 4MN5A 3HJKA 2CMNA 3FG8A 5DF9A 2YKHA 2W3FA 1KOUA 4ARZA 4EXOA 1DP8A 4LRZE 5G4YA 2OWJA 4YWZA 4HI4A 4JGPA 1P97A 1OTBA 3TE8A 3NHQA 3LI9A 1UWNX 4KQDA 2K7SA 4GCZA 4JGQA 2DMWA 2EA9A 2PYRA 2LB5A 3BW6A 3P01A 4L9FA 5MC7A 1LSVA 1OPXA 3LI8A 3KSHA 2PT7A 4WN5A 2VV7A 4HY8A 3VE3A 3F1NA 3A0VA 4HJ4A 1LL8A 2J80A 2XA7M 3D3OA 4YNRA 2W1RA 1XJ6A 4HJ6A 4MDZA 4II7A 3FPVA 3UB9A 2EWWA 3R7WA 1DP6A 3NOTC 3OOVA 3T4SA 3W2ZA 3IS2B 2HV1A 2W1TA 2O9AA 2YKFA 4HHDA 2B18A 3KYQA 2PYPA 2NUTC 4PKYA 3LYXA 1IOUA 3RTYA 3EGDC 5F6AA 1IFQA 1OJ5A 2B02A 2WKPA 2VV6A 1F9IA 5DFYA 2L4RA 3F1OB 2HF6A 4EU0A 4EUVA 1ZHHB 4R3AA 1S66L 2BASA 3LIFA 2M1CA 4GW9A 3B47A 3UMEA 1V9YA 4HH3A 3D72A 1OT9A 4O8GA 5CX7A 4E04A 1UWPX 4DN0A 3CUEA 2W3GA 3HJIA 5IT5A 2O99A 2PR5A 1MKMA 2GZAA 3LUQA 4JGOA 1OTIA 4PHTA 2ZOHA 3MJQA 4I3IA 4WF0A 4NEED 2P7JA 2G7UA 4NXBA 2P08A 3MMHA 4H6JB 1ZTUA 4I5SA 2P04A 1T1BA 5J3WA 5LBRA 1NLYA 5DKLA 3H82B 2J3WA 2MJ6A 2EWVA 4CLCC 3R4KA 4Y5FA 4EW7A 1G6OA 4GS9B 2VGLM 3H7WB 4P6ZM 3H9WA 4Z1WA 1TS0A 1TS7A 3T4JA 3CITA 5J7EA 3MFXA 2LB9A 3A0RA 2Z6DA 3PYPA 1XFQA 5IS1A 1MZUA 5F68A 4DJ3A 3LR4A 3JVUA 4G3VA 4LPZA 5IU1A 3T4QA 3ZQ5A 4WLAA 3A0SA 3T4LA 2D01A 2K2NA 3UB7A 3BY9A 4F3LB 5HWVA 4KQOA 4CLCE 2OAP1 3ZYTA 2W3DA 5HDDA 5HSQA 2V9AA 1T19A 4MMNA 3LR5A 1W63Q 3OCLA 2V1BA 2Y8HA 5F69A 3B42A 2PHYA 3CAXA 3KSGA 4XT2B 3ICYA 3FC7A 3RH8B 3MQOA 3PR6A 3HCYA 5TBMB 4EQ1A 2QWSA 3U2AA 1TD5A 3PBOA 4BMWA 4FSFA 4OOLA 3MF0A 4AFIA 1P0ZA 2XA7S 3EEAA 2QJ5A 2I9VA 3IBRA 3EQVA 4G3WA 2HJ9C 2ZOIA 3PHYA 3CWFA 4L9EA 4Y3IA 3S7NA 4B9OA 4GLQA 3LIDA 3S7OA 3LIEA 4MCWA 4GHIA 1ODVA 5HDCA 2J3TD 1XJ4A 3ULFA 3VE4A 3OLOA 1NRJA 3KSFA 4NKPA 4GJ4A 3BQAA 1NWZA 1OTEA 3K2NA 1DRMA 2K31A 2HJEA 1XJ2A 4BJPA 3KX0X 1S67L 1N9OA 3EQUA 3LIBA 4G3KA 4R70A 1T18A 4YOFA 3NOPC 4NXGA 2WKQA 1XFNA 3BWLA 2JKTM 1GSXA 2WKRA 4HIAA 2JKRM 4EERA 1S4SA 4HP9A 3OBFA 4WUJA 3OCNA 5FL3A 4BWIA 1S1YA 3H82A 3UE3A 3KSIA 5AVEA 1DP9A 1GSWA 3T4TA 5HWWA 4M4XA 2KDKA 3VV4A 1LT0A 5HDSA 3DBAA 1P9WA 3H7WA 4UEYA 3KO6A 4JGRA 4MN7A 2QKPA 1N9LA 1NLZA 2W0NA 4EEPA 2VV8A 3P7NA 4NXFA 1YAXA 3PBNA 4RQ9A 3F1PB 4PKYG 4CLCB 3SW1A 4DJ2A 4HQAA 2H28A 3NJAA 4OOMA 4WL9A 4I38A 3MXQA 1VHMA 4PAUA 2GJ3A 4F3LA 5I5LA 2VGLS 4P6ZS 1S4RA 4IJGA 2OWHA 4BBUA 4L9GA 5TJJA 3GECA 3OC2A 3MQ0A 3CUEC 4GHIB 2ZMFA 4CLCD 1XJ3A 3S7QA 1F98A 4XT2A 3MQQA 3CLOA 3E98A 4LRXC 4UQIM 1P9RA 4ETXA 2KX6A 5L8MA 5TBMA 3UB8A 4O0PA 4WELA 1S1ZA 2VX8A 1N9NA 4Q0HA 2VZWA 5DKKA 2W3EA 3O5YA 3EGXC 3T4OA 4R38A 3VOLA 4K08A 5A8BA 1BYWA 3K3CA 2OAQ1 3LR3A 4L0LA 4DMZA 5K5BA 3IS2A 4KUOA 2L0WA 4ME4A 1OJGA 2L1MA 5HD5A 5F5YA 2A24B 4WEKA 2QJ7A 3CI6A 3MR0A 5AJGA 3C2WA 2NUPC 2VA0A 1Y28A 2OOLA 3T50A 5J4EA 3F1OA 5AVFA 3UE6A 3GDIA 5KSHA 5HPFA 2V0UA 4ARZB 1OT6A 4HP4A 3C30A 2FH5A 3LICA 4EEUA 2IA2A 3B33A 2VJWA 2FZ0A 4HOIA 1H3QA 2KLIA 4Y2FA 5C5KA 4EESA 3EOIA 3E0YA 4CQHA 4FOFA 2J3TC 4HNBA 1VB6A 1YKDA 4WEJA 1YSPA 3V67A 5HD3A 1D7EA 5HZHA 1OTDA 4IHQA 2O9BA 4I3AA 1LSWA 3TRCA 2W27A 3C38A 3G6OA 2ZBBA 3F1NB 5HL6A 1TS6A 1YSQA 1JNUA 2JHEA 2QYBA 1GSVA 3S7PA 3EEHA 2PR6A 2ZMVA 2GX5A 5EFWA 1UGUA 4Q0IA 3TW8A 2D02A 4H6JA 1H8MA 3FPWA 3LFVA 3R7WB 5HPIA 3UB6A 4ZRRA 1T1AA 2W1TB 3IBJA 2PD8A 1G28A 4IUKA 4BBVA 5KIZA 3F1PA 3RFBA 4CLCA 2O9CA 2QHKA 1W63M 3PBTA 2PD7A 3E4PA 4HJ3A 3EWKA 2M7UA 4HH2A 4GS9A 2XROA 4NXEA 1TS8A 2XRNA 2XSSA 1OTAA 1MC0A 4MN6A 1LSXA 5DJTA 1X0OA 1STZA 3BQ8A 2JN7A 3PBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUH A;  5DFY A;  3MF0 A;  5L8M A;  4Q0J A;  3EEA A;  4EU0 A;  4O0P A;  1TF1 A;  4EUV A;  2W3H A;  3IBR A;  4G3W A;  4O01 A;  4Q0H A;  2M7V A;  2VZW A;  2W3E A;  1F5M A;  4GW9 A;  3O5Y A;  4Y3I A;  2HGV A;  3S7N A;  2Y79 A;  4GLQ A;  3S7O A;  4MCW A;  1STZ A;  4O8G A;  5DFX A;  2O0Y A;  4E04 A;  4DMZ A;  2VEA A;  5K5B A;  3BJN A;  4DN0 A;  2W3G A;  3KSF A;  2VKS A;  2O99 A;  4ME4 A;  1MKM A;  4QPR A;  3CI6 A;  3NOU C;  3K2N A;  5AJG A;  2K31 A;  3C2W A;  2OOL A;  4ETZ A;  2G7U A;  5HPF A;  2KOI A;  4G3K A;  4LRY C;  4R6L A;  4R70 A;  3MMH A;  1ZTU A;  2IA2 A;  2VJW A;  4YOF A;  3NOP C;  5LBR A;  4Y2F A;  2KLI A;  5C5K A;  2W3F A;  4LRZ E;  3OBF A;  3E0Y A;  4CQH A;  4FOF A;  3R4K A;  4Y5F A;  4BWI A;  1YKD A;  3NHQ A;  1YSP A;  3KSI A;  4Z1W A;  2O9B A;  3TRC A;  3CIT A;  2LB9 A;  3VV4 A;  3G6O A;  3DBA A;  5HL6 A;  1YSQ A;  3KO6 A;  4MN7 A;  2LB5 A;  2QYB A;  3KSH A;  3S7P A;  4G3V A;  3ZQ5 A;  2GX5 A;  4Q0I A;  2K2N A;  4RQ9 A;  3D3O A;  3LFV A;  5HPI A;  4YNR A;  2W1R A;  2W3D A;  4ZRR A;  5HSQ A;  2W1T B;  1VHM A;  3IBJ A;  4PAU A;  4MMN A;  4IUK A;  4MDZ A;  5I5L A;  3RFB A;  2O9C A;  3NOT C;  4IJG A;  2Y8H A;  5TJJ A;  3OOV A;  3W2Z A;  3MQ0 A;  2W1T A;  3KSG A;  2M7U A;  2O9A A;  2B18 A;  2ZMF A;  2XRO A;  2XRN A;  2XSS A;  3S7Q A;  3HCY A;  1MC0 A;  1TD5 A;  4LRX C;  3E98 A;  4ETX A; 
#chains in the Genus database with same CATH topology
 4IUH A;  5L10 A;  2FFF B;  4Q0J A;  1RP5 A;  3V50 A;  3VP1 A;  4GB7 A;  5A91 A;  4O01 A;  2Y2O A;  5FQQ A;  3S1Y A;  5DJU A;  1K56 A;  4QHC A;  3JVV A;  4QD4 A;  3SS5 A;  4B4Z A;  4I39 A;  3PBR A;  1O7E A;  3PXP A;  3VP2 A;  3QP1 A;  2VKS A;  2Q0O A;  3C8C A;  3BY8 A;  2QZ6 A;  1FCM A;  2P9V B;  3GQZ A;  1GCE A;  3LIA A;  4MBH A;  4KEN B;  1PZO A;  2ZL1 B;  3T4K A;  3WS5 A;  2CMN A;  3FG8 A;  5DF9 A;  2W3F A;  4ARZ A;  4EXO A;  4QJG A;  4B88 A;  4RA7 A;  5G4Y A;  2OWJ A;  3N7W A;  1Q2Q A;  2OSU A;  1P97 A;  3TE8 A;  3NHQ A;  2Y2N A;  3LI9 A;  2XGN A;  4QU3 A;  4GCZ A;  2PU4 A;  2ZC5 B;  1BLH A;  5A93 A;  2J7V A;  2DMW A;  4L9F A;  3UE0 A;  1LSV A;  2PT7 A;  3B3X A;  4HY8 A;  3LGO A;  4GN2 A;  3W4Q A;  4E3I A;  4MLL A;  4X6T A;  3VFF A;  1XJ6 A;  4II7 A;  3UB9 A;  2EWW A;  4CPK A;  1DP6 A;  3GV9 A;  3NOT C;  2WKH A;  2NUT C;  4D60 A;  3A3I A;  3LYX A;  3MKE A;  3RTY A;  3WRT A;  4EUZ A;  1K4F A;  2B02 A;  2VV6 A;  5F83 A;  2ZMA A;  3LEQ A;  5IHV A;  4EUV A;  3NDG A;  4R3A A;  2IWC A;  4OPQ A;  1NY0 A;  2M1C A;  5FEF A;  3FYZ A;  1O07 A;  1JTD A;  3VP0 A;  3C7U A;  4O8G A;  5CHJ A;  3Q81 A;  3IH9 A;  3FWL A;  5IT5 A;  1NYM A;  4EBL A;  2PR5 A;  2VK3 A;  4R4S A;  2ZOH A;  4WF0 A;  4UA6 A;  4KZ6 A;  4NEE D;  2P7J A;  1JWZ A;  5EPH A;  1G68 A;  4JXG A;  2P08 A;  1PWD A;  4H6J B;  5EOE A;  2P04 A;  3WWX A;  3LCE A;  3Q7Z A;  1L0E A;  3WS4 A;  1DJC A;  3AGE A;  3G34 A;  2J3W A;  3ZG5 A;  2Y2P A;  1SKO A;  2MJ6 A;  4RX2 A;  3UDX A;  4Y5F A;  4X1L A;  4GS9 B;  3QNC A;  4Z1W A;  1TS0 A;  3WRZ A;  3CIT A;  2Y59 A;  2LB9 A;  3MFX A;  5FAQ A;  1XFQ A;  3V5M A;  5IS1 A;  1MZU A;  3LR4 A;  5CER A;  3M2K A;  3NIA A;  1MKI A;  3ZQ5 A;  2D01 A;  3UB7 A;  3BY9 A;  4KQO A;  3JPU A;  3ZNY A;  1L0F A;  2XEP A;  4E6X A;  1CI8 A;  4PMA A;  2WUQ A;  3IWO A;  1W5D A;  3ZNT A;  3KSG A;  4XT2 B;  3ICY A;  1VET A;  3FC7 A;  3RH8 B;  3PAE A;  4BMW A;  5HW3 A;  2FFY A;  4OOL A;  3VP3 A;  2QJ5 A;  2XQZ A;  4NG2 A;  3W8K A;  2PBD P;  4Y3I A;  4L9E A;  2ZQD A;  4B9O A;  3BEB A;  2VGK A;  4S2N A;  3LID A;  2EX8 A;  1ODV A;  3ITB A;  4GKU A;  1XJ4 A;  1ONH A;  3GMW A;  3OLO A;  4LV1 A;  4OQH A;  4GJ4 A;  4NKP A;  2HP5 A;  1MWT A;  3SH7 A;  4O7D A;  1PW1 A;  4F94 A;  4OON A;  1CQA A;  2HJE A;  1TDG A;  1MBL A;  4C75 A;  5JYP A;  3OPR A;  3BWL A;  1SCW A;  2JKR M;  3ISG A;  4HP9 A;  3OBF A;  1PI4 A;  4ESP A;  2HDS A;  5FL3 A;  4E3N A;  4FCF A;  1ES3 A;  3P98 A;  2Y2J A;  1XGJ A;  4M4X A;  2KDK A;  4OOY A;  1LT0 A;  5HDS A;  1P9W A;  2VV8 A;  3P7N A;  4NXF A;  4GDB A;  1CK3 A;  4N1H A;  4PKY G;  4CLC B;  3SW1 A;  2H28 A;  1PI5 A;  1VHM A;  1XP4 A;  3E2L A;  5I5L A;  2VGL S;  5TFQ A;  3OC2 A;  4P6B A;  4CLC D;  3FV7 A;  4OP8 A;  2XD5 A;  1F98 A;  3CLO A;  1P9R A;  3P09 A;  5DTK A;  3UPO A;  1EI5 A;  3O5Y A;  3VFH A;  2WGI A;  1F2K A;  3EGX C;  4DDY A;  4R38 A;  3VOL A;  4K08 A;  4Y0O A;  5A8B A;  3JYI A;  1K56 D;  2H10 A;  2OAQ 1;  4L0L A;  5AQ7 A;  4DMZ A;  4IBR A;  4FTX A;  1OJG A;  1QME A;  3IXH A;  5F5Y A;  2Q9N A;  4WEK A;  2QJ7 A;  4X1M A;  3N8R A;  5L2F A;  2OOL A;  5AVF A;  3BFG A;  1ACF A;  2Y55 A;  2V0U A;  4ARZ B;  1OT6 A;  5GLD A;  3LIC A;  1IKI A;  4FH2 A;  2VJW A;  1PFL A;  1H3Q A;  5FSR A;  1KE0 A;  3EOI A;  1ESU A;  2C5W B;  3DTE A;  4R1G A;  4CQH A;  5F1G A;  3HLC A;  5FQI A;  5AQB A;  4RYE A;  3V67 A;  5HD3 A;  1OTD A;  3G2Y A;  2XD1 A;  3IXG A;  3NC8 A;  5GLC A;  3G6O A;  5HL6 A;  3QP2 A;  4R4R A;  3ZGA B;  1GSV A;  1BUL A;  4Q0I A;  1S6R A;  3O86 A;  4Y7P A;  2D02 A;  4H6J A;  5CTN A;  1H8M A;  3FPW A;  3LFV A;  2XDM A;  3BM6 A;  1MXO A;  4ZRR A;  5FAS A;  1JWV A;  3IBJ A;  4Q8I A;  5EE8 A;  5FDS A;  1W63 M;  4HES A;  3E4P A;  4HH2 A;  2XF3 A;  4GS9 A;  4NXE A;  1TS8 A;  2EXB A;  2XH9 A;  1MC0 A;  3LY4 A;  3C4P A;  4GD8 A;  3BQ8 A;  5HAQ A;  1PNE A;  3IF6 C;  1TF1 A;  2EXA A;  2HDR A;  5E43 A;  3RXW A;  4EBP A;  2A2L A;  3UMD A;  2Y2L A;  4DE2 A;  5HWT A;  2HGV A;  3GR2 A;  2Y79 A;  3HLE A;  2Y2H A;  5DFX A;  2JKT I;  1YLP A;  4LLO B;  4WBG A;  2V0W A;  4UQI S;  5D3O A;  4BBT A;  1IYS A;  2Z6C A;  3G4P A;  3Q1F A;  5CGX A;  1T1C A;  4ZBE A;  1I2W A;  4K91 A;  1V9Z A;  3FKV A;  4ETZ A;  4OLG A;  2KOI A;  3C5A A;  3IHA A;  2GNX A;  3T1S A;  1VEU B;  5EVL A;  1CI9 A;  1LL5 A;  3TSG A;  5DF7 A;  5FQJ A;  1DP8 A;  4WYY A;  5GHZ A;  4HI4 A;  3M2J A;  2ZD8 A;  1KDW A;  1N9B A;  3BFE A;  4E3O A;  1LL9 A;  2EA9 A;  2PYR A;  1E4D A;  2LB5 A;  3P01 A;  1OPX A;  3LI8 A;  3KSH A;  4X68 A;  4WN5 A;  2VV7 A;  1LL8 A;  1KGG A;  4X69 A;  2W1R A;  1C3B A;  3AGF A;  3MSH A;  3WS0 A;  1VET B;  5EM1 A;  3OOV A;  3W2Z A;  2HV1 A;  4HHD A;  5EEC A;  2B18 A;  3KYQ A;  4PKY A;  1IOU A;  4PM7 A;  2HDU A;  3CMZ A;  5F6A A;  2GDN A;  1IFQ A;  2WKP A;  1A0K A;  5F82 A;  1JVJ A;  4BL3 A;  3IF5 A;  4DRT A;  2WKI A;  5CXW A;  3LIF A;  1PYY A;  1NZO A;  1V9Y A;  1OT9 A;  3A3J A;  4E04 A;  4YFM A;  4S2K A;  1W8Y A;  1KE4 A;  3AGD A;  3HLF A;  4BQM A;  4LV2 A;  4DXB A;  3HJI A;  3ZG8 B;  2O99 A;  1MKM A;  3D9Y A;  2GZA A;  3N4I A;  1OTI A;  3MJQ A;  4I3I A;  4U3T A;  5TGF A;  3IH8 A;  3TG9 A;  2XR0 A;  2X01 A;  3MMH A;  1ZTU A;  4I5S A;  4DE3 A;  5EUA A;  1IYQ A;  4DE0 A;  5DKL A;  3QP8 A;  3QP6 A;  4KZ9 A;  1W8Q A;  5EVI B;  1MWU A;  2J8Y A;  4LEN A;  3MZD A;  5EVI C;  4P6Z M;  3H9W A;  4X53 A;  3IXD A;  4NK3 A;  3L7H A;  3QP5 A;  4NET A;  5DTS A;  3A0R A;  3NUL A;  3BEC A;  2EX9 A;  2UWX A;  4OPY A;  4P0M A;  5IU1 A;  1YLJ A;  3BYD A;  4WZ5 A;  2K2N A;  1YLZ A;  5HWV A;  2R9W A;  2OAP 1;  2W3D A;  3OPL A;  1W63 Q;  4K0X A;  5F69 A;  2WGW A;  4BD0 A;  2Y2G A;  3O87 A;  3UY6 A;  3MQO A;  4XUZ A;  1S0W A;  3QNB A;  2PBY A;  4QWO A;  3U2A A;  3PBO A;  5HAI A;  4FSF A;  2XA7 S;  3O88 A;  2AVX A;  2DNS A;  3G31 A;  4G3W A;  4FH4 A;  4KZ7 A;  1HD8 A;  2HJ9 C;  3LO7 A;  3CWF A;  3DAV A;  4CJN A;  1K57 C;  3TOI A;  3IQA A;  4XUX A;  5HDC A;  5CTM A;  3IT9 A;  1I2S A;  2ZM2 A;  3ULF A;  3HBR A;  4BLM A;  3KSF A;  3HVF A;  4DF6 A;  2V1Z A;  3UDF A;  5DVA A;  1OTE A;  1DRM A;  3IF6 A;  4JBF A;  5FI7 A;  3T1Q B;  2I72 A;  4BJP A;  5TR7 A;  3W4O A;  1N9O A;  1VM1 A;  3LIB A;  1NYY A;  4R70 A;  3MXR A;  1E3U D;  4NXG A;  2WKQ A;  1XFN A;  3Q07 A;  1GSX A;  4EER A;  1S4S A;  1S1Y A;  3OZH A;  1DJA A;  2EX2 A;  4JXV A;  5HAP A;  1RCJ A;  3MFD A;  3H7W A;  4K0W A;  5J8X A;  2QKP A;  1BTL A;  1N9L A;  3RJU A;  3UO9 A;  5CEB A;  1YAX A;  4E3M A;  3S22 A;  3UPN A;  1VEU A;  3WS1 A;  4R3B A;  4DJ2 A;  1GHI A;  4HQA A;  3G2Z A;  4WL9 A;  3MXQ A;  3L9K A;  4PAU A;  3PAG A;  5E2F A;  2GJ3 A;  4F3L A;  2XK1 A;  4PM9 A;  1J9M A;  2OWH A;  5TJJ A;  3GEC A;  3CUE C;  2JBF A;  2ZMF A;  3C7V A;  5U47 A;  2Y2M A;  4LFU A;  3GVB A;  1FSW A;  4LRX C;  3E98 A;  4KZA A;  1K6S A;  5DTT A;  4ZJ3 A;  3HL9 A;  3A3F A;  5TBM A;  3UB8 A;  3KYE A;  4GNU A;  5EV0 A;  1N9N A;  4Q0H A;  4KZ4 A;  5FQM A;  2WAE A;  2DRW A;  3N6I A;  1YM1 A;  3FKW A;  4S2M A;  3T4O A;  1L0G A;  2JCH A;  1XKZ A;  1WYC A;  4KG6 A;  1LI0 A;  4OKP A;  2H5S A;  4ZAM A;  4ZJ2 A;  3T12 B;  1FR1 A;  1XGI A;  1XA1 A;  2G2W A;  2VA0 A;  5J4E A;  5KSH A;  5HPF A;  1ERM A;  4RX3 A;  1M6K A;  4PPR A;  4HP4 A;  1HZO A;  3C30 A;  2FH5 A;  5M19 A;  3UPP A;  2KLI A;  4DXC A;  3LEZ A;  4KG5 A;  1YKD A;  5HX9 A;  1YSP A;  1OME A;  4A5R A;  3BRM A;  5HZH A;  3TRC A;  1LSW A;  3UN7 A;  3RXX A;  3C38 A;  1TS6 A;  1CEF A;  4GDN A;  5GLA A;  2JHE A;  1K38 A;  4JF5 A;  1NRF A;  2GX5 A;  5EFW A;  4LCL A;  2WZZ A;  1BUE A;  1SDN A;  5HPI A;  1M40 A;  1T1A A;  2EFU A;  1GHP A;  3F1P A;  3RFB A;  2PD7 A;  4HJ3 A;  5EVI A;  3EWK A;  1MWS A;  2XRO A;  2ZQ9 A;  1NJ4 A;  2PRF A;  5DJT A;  4GHI A;  1STZ A;  1Z09 A;  1ES5 A;  3PBQ A;  1WE4 A;  2INW A;  3E4Q A;  2W3H A;  3Q7V A;  3VMA A;  2BTF P;  2V1A A;  3TJZ C;  1W7F A;  1LLB A;  4EBN A;  3KYZ A;  4I3J A;  4D2O A;  1SHV A;  2DCF A;  4U0X A;  5CHM A;  2O0Y A;  2JKR I;  2VEA A;  1D06 A;  2EFX A;  5A92 A;  3VSL A;  2Y2Q A;  4QPR A;  2ZC6 B;  1J3W A;  3NOU C;  2ZM0 A;  4H8R A;  3VOZ A;  2PDR A;  3K3D A;  2EX6 A;  4R6L A;  4MN5 A;  2ZC3 B;  1K57 A;  4EV4 A;  2R9X A;  3V3R A;  4YWZ A;  1OTB A;  1HTZ A;  2ZM8 A;  5FA7 A;  1FIL A;  4N92 A;  4WZ5 C;  3F1N A;  3NDE A;  3MZF A;  3D3O A;  4N1X A;  2E8I A;  3HLG A;  2WGW B;  3GTC A;  4R23 A;  4OLD A;  2B5R A;  2JC7 A;  5E2G A;  5FQ9 A;  3FPV A;  3R7W A;  1CJF A;  2C6W B;  4KZ5 A;  1U60 A;  4JXW A;  2W1T A;  2O9A A;  2YKF A;  2PYP A;  3NI9 A;  1G6A A;  3HUM A;  1OJ5 A;  1F9I A;  2L4R A;  1YQS A;  3F1O B;  2HF6 A;  4EU0 A;  2BLS A;  2WAF A;  3QHY A;  3B47 A;  4DDS A;  3SS3 A;  3HLW A;  4HH3 A;  1FIK A;  1Z6F A;  5GLB A;  1MPL A;  3D72 A;  4UAA A;  4OQI A;  5CX7 A;  4ID4 A;  1PRQ A;  4E6W A;  1FOF A;  1UWP X;  2Z2L B;  2ZQ7 A;  4DN0 A;  3CUE A;  3IF6 B;  4PHT A;  2WK0 A;  5AQA A;  5L09 A;  4HBU A;  2V8F A;  5J3W A;  3CG5 A;  5LBR A;  3NEC A;  5KMW A;  1PWC A;  3ZG7 B;  2VGL M;  3H7W B;  4Y0T A;  1TS7 A;  2Y4A A;  5J7E A;  2Z6D A;  4E3K A;  3PYP A;  3A3D A;  5F68 A;  4DJ3 A;  4G3V A;  3M6B A;  4WLA A;  3A0S A;  4OP5 A;  4F3L B;  4FUW A;  5FAP A;  3GSG A;  1YMX A;  4CLC E;  2JE5 A;  3ZYT A;  5HSQ A;  2V9A A;  4MMN A;  3LR5 A;  1GHM A;  4RVA A;  3IWI A;  3OCL A;  2V1B A;  3B42 A;  2PHY A;  3PR6 A;  3M6H A;  3OPP A;  3HCY A;  5TBM B;  4EQ1 A;  1L0D A;  3MF0 A;  4AFI A;  5CEC A;  3GRJ A;  2I9V A;  3EQV A;  1FSY A;  1BLC A;  4B4X A;  2UV0 E;  3QP4 A;  2H0T A;  2ZOI A;  2ZLY A;  3S7N A;  4MCW A;  2J3T D;  3VE4 A;  1NRJ A;  4BEN A;  3DTI A;  1HLU P;  1K55 C;  2JKF A;  1NWZ A;  1TDL A;  4MEZ A;  4S2I A;  3ZG9 B;  4KQQ A;  1YLW A;  1K0K A;  2K31 A;  1XJ2 A;  3KX0 X;  5FQK A;  3EQU A;  2V20 A;  1KVM A;  2ZC7 A;  4PM8 A;  3W4P A;  1T18 A;  4EWF A;  3NOP C;  2WKR A;  4OH0 A;  4HBT A;  4GZB A;  1KE3 A;  4BWI A;  3H82 A;  3UE3 A;  3KSI A;  5AVE A;  2CC1 A;  5HFO A;  1YT4 A;  1XA7 A;  1KVL A;  5HWW A;  3VV4 A;  3DBA A;  4JF4 A;  4HEF A;  4UEY A;  3KO6 A;  4S2O A;  1W79 A;  4JKT A;  5FAT A;  1K25 A;  4EEP A;  4E3L A;  5EM0 A;  1IEM A;  3F1P B;  1ESI A;  3NJA A;  4OOM A;  3DTK A;  4BD1 A;  5M18 A;  1H8Z A;  3E2K A;  1PWG A;  1S4R A;  2Q9M A;  4BBU A;  4L9G A;  3N8S A;  4C6Y A;  4JLF A;  3SH8 A;  1MY8 A;  4P85 A;  1QMF A;  4GHI B;  1XJ3 A;  4JPM A;  3S7Q A;  4GD6 A;  2XLN A;  5EVI D;  3Q7V B;  3C4O A;  3MQQ A;  4JF6 A;  1YMS A;  3U4L P;  4UQI M;  4Y15 A;  4ETX A;  2KX6 A;  1BSG A;  5L8M A;  4O0P A;  4EQI A;  1MWR A;  1NZU A;  2WZX A;  2HP9 A;  1LHY A;  5GHY A;  3BLS A;  1PW8 A;  1Y54 A;  1BYW A;  3CPT B;  3N8L A;  2L0W A;  3NY4 A;  4ME4 A;  2L1M A;  1GA9 A;  4M3K A;  3MR0 A;  1DJB A;  3C2W A;  1FQG A;  1IYO A;  1Y28 A;  3DTM A;  3T50 A;  3F1O A;  3UE6 A;  4OQG A;  3CHW P;  4OQ0 A;  3NBL A;  3B33 A;  2V8C A;  3ZFZ A;  5C5K A;  3BFF A;  4EES A;  3IHB A;  4FOF A;  3VSK A;  4HNB A;  2ZQC A;  4S2P A;  1PZP A;  1D7E A;  4S2L A;  2O9B A;  4I3A A;  1WYB A;  2W27 A;  5A90 A;  3F1N B;  4XXR A;  2HZ5 A;  1YSQ A;  4N9K A;  2QYB A;  4DKI A;  3IXB A;  3S7P A;  1BT5 A;  2ZMV A;  1G5U A;  3IX4 A;  4LV3 A;  3R7W B;  3SS4 A;  5EVE A;  1HVB A;  1AWI A;  4R3J A;  3UB6 A;  2W1T B;  5FEG A;  2PD8 A;  1G28 A;  4BBV A;  2VGJ A;  1ERQ A;  1H8Y A;  2O9C A;  2QHK A;  2HDQ A;  1EWZ A;  2X71 A;  2M7U A;  5KZH A;  2XRN A;  2XSS A;  4X56 A;  1K4E A;  3G32 A;  1NXY A;  2QMI A;  1LSX A;  1X0O A;  1BLP A;  2JN7 A;  1WA9 A;  4WMC A;  2PU2 A;  3BFD A;  1ALQ A;  5G4Z A;  2Y91 A;  2M7V A;  3LR0 A;  4KUK A;  1F5M A;  3MKF A;  1ZC2 A;  4IVK A;  4EET B;  3PTE A;  2VLG A;  3MS6 A;  3BJN A;  1Y4O A;  3ITA A;  4E3J A;  3E4O A;  2ZJ9 A;  1ZKJ A;  1EW0 A;  3PBS A;  4B93 A;  2A24 A;  2WYX A;  2P74 A;  2R78 A;  2Y2I A;  5CHU A;  4LRY C;  5CED A;  1ERO A;  2J9P A;  3HJK A;  3UDI A;  3IWQ A;  2YKH A;  1AXB A;  1KOU A;  2PAV P;  4LRZ E;  4MBK A;  3I7J A;  1Q2P A;  4JGP A;  1I5Q A;  1K55 A;  1UWN X;  1IYP A;  4KQD A;  2K7S A;  1PIO A;  2J9O A;  4JGQ A;  3BW6 A;  5MC7 A;  3WS2 A;  2G2U A;  3VE3 A;  4UA9 A;  3A0V A;  4HJ4 A;  2J80 A;  2XA7 M;  3IX3 A;  4YNR A;  3HLD A;  2A3U A;  4HJ6 A;  4MDZ A;  3T4S A;  4Z9Q A;  3IS2 B;  1VQQ A;  1JWP A;  3EGD C;  3LY3 A;  2JKG A;  5F1F A;  5DFY A;  1SKF A;  4IBX A;  1ZHH B;  5CRF A;  3V39 A;  1S66 L;  2BAS A;  4MNR A;  4OVD A;  4DE1 A;  3HRE A;  3ZVT A;  1CF0 A;  1K54 C;  4GW9 A;  3HUO A;  5E2E A;  4MBF A;  3UME A;  3CZD A;  1KGF A;  3S4X A;  3SZT A;  4N9L A;  5FI6 A;  3DW0 A;  1BZA A;  4LGW A;  2W3G A;  2IWD A;  4ZTK A;  3LUQ A;  5JYO A;  1ES2 A;  4JGO A;  4KZ3 A;  2HP6 A;  1ES4 A;  2G7U A;  4NXB A;  2P9V A;  1T1B A;  4R0Q A;  1NLY A;  2ZL1 A;  2OLV A;  3OPH A;  3H82 B;  2QPN A;  2EWV A;  4IVI A;  2B95 A;  3CPT A;  5HAR A;  4CLC C;  1RGY A;  3VOY A;  3R4K A;  4EW7 A;  1G6O A;  4YIN A;  3T4J A;  4KG2 A;  3ZCZ A;  3O3V A;  1TEM A;  5G18 A;  3JVU A;  2H0Y A;  4LPZ A;  1L2S A;  3T4Q A;  3T4L A;  5CGS A;  5HDD A;  5KSC A;  1T19 A;  3G35 A;  2XFT A;  2RCX A;  3T1X A;  4C3Q A;  2Y8H A;  5I94 A;  3CAX A;  1JTG A;  4X25 A;  4S2J A;  2ZQ8 A;  1L3L A;  2QWS A;  1KDS A;  1TD5 A;  1K6R A;  4LCM A;  4GOG A;  1BLS A;  4KZ8 A;  1P0Z A;  5HL1 A;  1SZV A;  3EEA A;  1YPR A;  1IEL A;  2E8J A;  1SDE A;  3IBR A;  3IX8 A;  4X55 A;  2X02 A;  5DF8 A;  5M1A A;  3UE1 A;  1E3U A;  2RL3 A;  1RGZ A;  3PHY A;  3NCK A;  4GLQ A;  3MBZ A;  3S7O A;  3LIE A;  4Y17 A;  5FAO A;  1H0M A;  1XX2 A;  4QB8 A;  3BQA A;  1DY6 A;  3G30 A;  4PM5 A;  2Z2M B;  3D4F A;  2BG1 A;  3K2N A;  3VP4 A;  2WAD A;  1S67 L;  4G3K A;  4IED A;  4P87 A;  4YOF A;  3ZHH A;  5EOO A;  2JKT M;  4HIA A;  4QY5 A;  4ZJ1 A;  4WUJ A;  3OCN A;  1FCO A;  4OPR A;  3T1R A;  5FI2 A;  4PM6 A;  1DP9 A;  1GSW A;  3T4T A;  4BL2 A;  2V2F F;  2ZC4 B;  4JGR A;  4MN7 A;  3V3S A;  1NLZ A;  2W0N A;  3FZC A;  2WGV A;  3PBN A;  4RQ9 A;  4JXS A;  1ZG4 A;  4I38 A;  4P6Z S;  1FR6 A;  2ZQA A;  4IJG A;  1XXM A;  3DWK A;  1XPB A;  3MQ0 A;  5AQ9 A;  3HUN A;  3ZDJ A;  4FD8 A;  1ZG6 A;  4UA7 A;  4UHU A;  1YLT A;  4XT2 A;  1CEG A;  1YLY A;  2IWB A;  4WZ4 A;  5CGW A;  4WEL A;  4WM9 A;  1S1Z A;  2VX8 A;  4KQR A;  2VZW A;  1IKG A;  1ONG A;  2W3E A;  4WMC D;  5DKK A;  1FCN A;  3A3E A;  4U0T A;  4LV0 A;  1SKO B;  3CJM A;  3Q82 A;  3K3C A;  3ZVW A;  3LR3 A;  5K5B A;  3IS2 A;  4KUO A;  5GL9 A;  4ZDX A;  5HD5 A;  1GA0 A;  2A24 B;  3ZG0 A;  3CI6 A;  4Y13 A;  4QY6 A;  5GHX A;  5AJG A;  2NUP C;  3BFC A;  3GDI A;  1K54 A;  4EEU A;  1TVF A;  2IA2 A;  2FZ0 A;  4HOI A;  3BLM A;  2A49 A;  4Y2F A;  2HPB A;  2WKE A;  5E2H A;  1N4O A;  3UNW A;  3E0Y A;  3MXS A;  1E25 A;  2J3T C;  3SOI A;  1VB6 A;  4OPZ A;  4WEJ A;  2ACG A;  4KZB A;  4IHQ A;  2XFS A;  5L07 A;  2ZBB A;  1LI9 A;  1JNU A;  5BOH A;  1KGE A;  3EEH A;  2PR6 A;  2OLU A;  1UGU A;  3TW8 A;  1H5X A;  2Y2K A;  3UB5 P;  4IUK A;  5KIZ A;  4S2N C;  4Y0U A;  4CLC A;  3DWZ A;  5FDH A;  3PBT A;  3HLB A;  2OV5 A;  3SH9 A;  1OTA A;  4MN6 A;  3MZE A;  1D1J A; 
#chains in the Genus database with same CATH homology
 4IUH A;  4Q0J A;  1WA9 A;  2INW A;  3E4Q A;  1TF1 A;  2W3H A;  2A2L A;  3UMD A;  4O01 A;  5G4Z A;  5DJU A;  3LR0 A;  2M7V A;  4KUK A;  5HWT A;  1F5M A;  3JVV A;  2HGV A;  2V1A A;  4EET B;  2Y79 A;  4I39 A;  3TJZ C;  3PBR A;  3PXP A;  2VLG A;  3KYZ A;  4I3J A;  5DFX A;  2JKT I;  2O0Y A;  2JKR I;  2VEA A;  4LLO B;  1D06 A;  2V0W A;  3BJN A;  4UQI S;  2VKS A;  3E4O A;  4QPR A;  4BBT A;  3C8C A;  3BY8 A;  3NOU C;  1EW0 A;  2Z6C A;  2PDR A;  1T1C A;  3PBS A;  4B93 A;  2A24 A;  1V9Z A;  3LIA A;  4ETZ A;  2R78 A;  3K3D A;  3T4K A;  2KOI A;  4LRY C;  4R6L A;  2GNX A;  4MN5 A;  3HJK A;  2CMN A;  3FG8 A;  5DF9 A;  2YKH A;  2W3F A;  1KOU A;  4ARZ A;  4EXO A;  1DP8 A;  4LRZ E;  5G4Y A;  2OWJ A;  4YWZ A;  4HI4 A;  4JGP A;  1P97 A;  1OTB A;  3TE8 A;  3NHQ A;  3LI9 A;  1UWN X;  4KQD A;  2K7S A;  4GCZ A;  4JGQ A;  2DMW A;  2EA9 A;  2PYR A;  2LB5 A;  3BW6 A;  3P01 A;  4L9F A;  5MC7 A;  1LSV A;  1OPX A;  3LI8 A;  3KSH A;  2PT7 A;  4WN5 A;  2VV7 A;  4HY8 A;  3VE3 A;  3F1N A;  3A0V A;  4HJ4 A;  1LL8 A;  2J80 A;  2XA7 M;  3D3O A;  4YNR A;  2W1R A;  1XJ6 A;  4HJ6 A;  4MDZ A;  4II7 A;  3FPV A;  3UB9 A;  2EWW A;  3R7W A;  1DP6 A;  3NOT C;  3OOV A;  3T4S A;  3W2Z A;  3IS2 B;  2HV1 A;  2W1T A;  2O9A A;  2YKF A;  4HHD A;  2B18 A;  3KYQ A;  2PYP A;  2NUT C;  4PKY A;  3LYX A;  1IOU A;  3RTY A;  3EGD C;  5F6A A;  1IFQ A;  1OJ5 A;  2B02 A;  2WKP A;  2VV6 A;  1F9I A;  5DFY A;  2L4R A;  3F1O B;  2HF6 A;  4EU0 A;  4EUV A;  1ZHH B;  4R3A A;  1S66 L;  2BAS A;  3LIF A;  2M1C A;  4GW9 A;  3B47 A;  3UME A;  1V9Y A;  4HH3 A;  3D72 A;  1OT9 A;  4O8G A;  5CX7 A;  4E04 A;  1UWP X;  4DN0 A;  3CUE A;  2W3G A;  3HJI A;  5IT5 A;  2O99 A;  2PR5 A;  1MKM A;  2GZA A;  3LUQ A;  4JGO A;  1OTI A;  4PHT A;  2ZOH A;  3MJQ A;  4I3I A;  4WF0 A;  4NEE D;  2P7J A;  2G7U A;  4NXB A;  2P08 A;  3MMH A;  4H6J B;  1ZTU A;  4I5S A;  2P04 A;  1T1B A;  5J3W A;  5LBR A;  1NLY A;  5DKL A;  3H82 B;  2J3W A;  2MJ6 A;  2EWV A;  4CLC C;  3R4K A;  4Y5F A;  4EW7 A;  1G6O A;  4GS9 B;  2VGL M;  3H7W B;  4P6Z M;  3H9W A;  4Z1W A;  1TS0 A;  1TS7 A;  3T4J A;  3CIT A;  5J7E A;  3MFX A;  2LB9 A;  3A0R A;  2Z6D A;  3PYP A;  1XFQ A;  5IS1 A;  1MZU A;  5F68 A;  4DJ3 A;  3LR4 A;  3JVU A;  4G3V A;  4LPZ A;  5IU1 A;  3T4Q A;  3ZQ5 A;  4WLA A;  3A0S A;  3T4L A;  2D01 A;  2K2N A;  3UB7 A;  3BY9 A;  4F3L B;  5HWV A;  4KQO A;  4CLC E;  2OAP 1;  3ZYT A;  2W3D A;  5HDD A;  5HSQ A;  2V9A A;  1T19 A;  4MMN A;  3LR5 A;  1W63 Q;  3OCL A;  2V1B A;  2Y8H A;  5F69 A;  3B42 A;  2PHY A;  3CAX A;  3KSG A;  4XT2 B;  3ICY A;  3FC7 A;  3RH8 B;  3MQO A;  3PR6 A;  3HCY A;  5TBM B;  4EQ1 A;  2QWS A;  3U2A A;  1TD5 A;  3PBO A;  4BMW A;  4FSF A;  4OOL A;  3MF0 A;  4AFI A;  1P0Z A;  2XA7 S;  3EEA A;  2QJ5 A;  2I9V A;  3IBR A;  3EQV A;  4G3W A;  2HJ9 C;  2ZOI A;  3PHY A;  3CWF A;  4L9E A;  4Y3I A;  3S7N A;  4B9O A;  4GLQ A;  3LID A;  3S7O A;  3LIE A;  4MCW A;  4GHI A;  1ODV A;  5HDC A;  2J3T D;  1XJ4 A;  3ULF A;  3VE4 A;  3OLO A;  1NRJ A;  3KSF A;  4NKP A;  4GJ4 A;  3BQA A;  1NWZ A;  1OTE A;  3K2N A;  1DRM A;  2K31 A;  2HJE A;  1XJ2 A;  4BJP A;  3KX0 X;  1S67 L;  1N9O A;  3EQU A;  3LIB A;  4G3K A;  4R70 A;  1T18 A;  4YOF A;  3NOP C;  4NXG A;  2WKQ A;  1XFN A;  3BWL A;  2JKT M;  1GSX A;  2WKR A;  4HIA A;  2JKR M;  4EER A;  1S4S A;  4HP9 A;  3OBF A;  4WUJ A;  3OCN A;  5FL3 A;  4BWI A;  1S1Y A;  3H82 A;  3UE3 A;  3KSI A;  5AVE A;  1DP9 A;  1GSW A;  3T4T A;  5HWW A;  4M4X A;  2KDK A;  3VV4 A;  1LT0 A;  5HDS A;  3DBA A;  1P9W A;  3H7W A;  4UEY A;  3KO6 A;  4JGR A;  4MN7 A;  2QKP A;  1N9L A;  1NLZ A;  2W0N A;  4EEP A;  2VV8 A;  3P7N A;  4NXF A;  1YAX A;  3PBN A;  4RQ9 A;  3F1P B;  4PKY G;  4CLC B;  3SW1 A;  4DJ2 A;  4HQA A;  2H28 A;  3NJA A;  4OOM A;  4WL9 A;  4I38 A;  3MXQ A;  1VHM A;  4PAU A;  2GJ3 A;  4F3L A;  5I5L A;  2VGL S;  4P6Z S;  1S4R A;  4IJG A;  2OWH A;  4BBU A;  4L9G A;  5TJJ A;  3GEC A;  3OC2 A;  3MQ0 A;  3CUE C;  4GHI B;  2ZMF A;  4CLC D;  1XJ3 A;  3S7Q A;  1F98 A;  4XT2 A;  3MQQ A;  3CLO A;  3E98 A;  4LRX C;  4UQI M;  1P9R A;  4ETX A;  2KX6 A;  5L8M A;  5TBM A;  3UB8 A;  4O0P A;  4WEL A;  1S1Z A;  2VX8 A;  1N9N A;  4Q0H A;  2VZW A;  5DKK A;  2W3E A;  3O5Y A;  3EGX C;  3T4O A;  4R38 A;  3VOL A;  4K08 A;  5A8B A;  1BYW A;  3K3C A;  2OAQ 1;  3LR3 A;  4L0L A;  4DMZ A;  5K5B A;  3IS2 A;  4KUO A;  2L0W A;  4ME4 A;  1OJG A;  2L1M A;  5HD5 A;  5F5Y A;  2A24 B;  4WEK A;  2QJ7 A;  3CI6 A;  3MR0 A;  5AJG A;  3C2W A;  2NUP C;  2VA0 A;  1Y28 A;  2OOL A;  3T50 A;  5J4E A;  3F1O A;  5AVF A;  3UE6 A;  3GDI A;  5KSH A;  5HPF A;  2V0U A;  4ARZ B;  1OT6 A;  4HP4 A;  3C30 A;  2FH5 A;  3LIC A;  4EEU A;  2IA2 A;  3B33 A;  2VJW A;  2FZ0 A;  4HOI A;  1H3Q A;  2KLI A;  4Y2F A;  5C5K A;  4EES A;  3EOI A;  3E0Y A;  4CQH A;  4FOF A;  2J3T C;  4HNB A;  1VB6 A;  1YKD A;  4WEJ A;  1YSP A;  3V67 A;  5HD3 A;  1D7E A;  5HZH A;  1OTD A;  4IHQ A;  2O9B A;  4I3A A;  1LSW A;  3TRC A;  2W27 A;  3C38 A;  3G6O A;  2ZBB A;  3F1N B;  5HL6 A;  1TS6 A;  1YSQ A;  1JNU A;  2JHE A;  2QYB A;  1GSV A;  3S7P A;  3EEH A;  2PR6 A;  2ZMV A;  2GX5 A;  5EFW A;  1UGU A;  4Q0I A;  3TW8 A;  2D02 A;  4H6J A;  1H8M A;  3FPW A;  3LFV A;  3R7W B;  5HPI A;  3UB6 A;  4ZRR A;  1T1A A;  2W1T B;  3IBJ A;  2PD8 A;  1G28 A;  4IUK A;  4BBV A;  5KIZ A;  3F1P A;  3RFB A;  4CLC A;  2O9C A;  2QHK A;  1W63 M;  3PBT A;  2PD7 A;  3E4P A;  4HJ3 A;  3EWK A;  2M7U A;  4HH2 A;  4GS9 A;  2XRO A;  4NXE A;  1TS8 A;  2XRN A;  2XSS A;  1OTA A;  1MC0 A;  4MN6 A;  1LSX A;  5DJT A;  1X0O A;  1STZ A;  3BQ8 A;  2JN7 A;  3PBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...