2GX5A

N-terminal gaf domain of transcriptional pleiotropic repressor cody
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
161
structure length
157
Chain Sequence
HMALLQKTRIINSMLQAAAGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDRMKKMLEDRQFPEEYTKNLFNVPETSSNLDINSFPVENRDLFQAGLTTIVPIIGGGERLGTLILSRLQDQFNDDDLILAEYGATVVGMEILREKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of CodY, a GTP- and isoleucine-responsive regulator of stationary phase and virulence in gram-positive bacteria.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords GTP-sensing transcriptional pleiotropic repressor codY
total genus 55
structure length 157
sequence length 161
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2gx5A00
1F5MA 3C2WA 4ZRRA 5HPFA 5TJJA 3EEAA 4G3WA 3BJNA 2OOLA 4EU0A 3OOVA 4RQ9A 5DFXA 2O99A 3IBRA 2O9BA 5AJGA 4DMZA 4ETXA 2ZMFA 1ZTUA 3NOUC 4QPRA 4R6LA 3S7QA 3D3OA 5HSQA 2O0YA 3W2ZA 3MMHA 4FOFA 3ZQ5A 2XSSA 4Q0HA 4G3KA 5K5BA 2KLIA 4R70A 4E04A 1YSQA 2XRNA 4DN0A 1YKDA 3NOPC 3KO6A 4IUKA 4ETZA 2KOIA 4GW9A 4Q0JA 4EUVA 2IA2A 4BWIA 4MMNA 2O9AA 3E0YA 4CQHA 3KSIA 3KSFA 3TRCA 4Z1WA 3S7NA 3VV4A 2Y79A 4O8GA 2M7UA 2W3FA 3OBFA 2K31A 5DFYA 2W1RA 3MQ0A 2W3GA 1VHMA 4LRXC 4Y2FA 1TF1A 3S7PA 3K2NA 3NHQA 5HPIA 3G6OA 2W1TA 2LB5A 4MCWA 5HL6A 4LRYC 3KSGA 2LB9A 4O0PA 4ME4A 1TD5A 2K2NA 3CITA 2VJWA 2VZWA 3MF0A 2B18A 3R4KA 2W3EA 4O01A 3NOTC 3RFBA 2O9CA 2HGVA 5LBRA 4PAUA 4YNRA 4Y3IA 4GLQA 2VEAA 3KSHA 4IUHA 4YOFA 4IJGA 2XROA 2W1TB 3S7OA 2GX5A 3LFVA 2VKSA 5C5KA 4Y5FA 2QYBA 3HCYA 3CI6A 1STZA 1MKMA 3E98A 2M7VA 1MC0A 4MN7A 2G7UA 3DBAA 2W3HA 4G3VA 5L8MA 4MDZA 4LRZE 2W3DA 3IBJA 1YSPA 3O5YA 5I5LA 2Y8HA 4Q0IA
chains in the Genus database with same CATH superfamily
3C2WA 4N1XA 2PYPA 4KZ5A 3CLOA 4EQIA 4HBUA 4KZ4A 3ZCZA 5FQJA 1PZOA 2HDRA 4H8RA 1H3QA 4JGQA 2ZM8A 5GHYA 2ZC6B 2I9VA 1PI4A 3NOPC 4Q0JA 4L9EA 1S4SA 1PFLA 5DKKA 2L0WA 2Y79A 2EWWA 2AVXA 1MWTA 1PWCA 5G4ZA 1LHYA 5EOEA 4WLAA 2OAP1 4LRXC 4OH0A 1W63Q 3HLBA 1PI5A 4QD4A 3S7PA 3ZNYA 3M2JA 4GDBA 1LL5A 4PMAA 3C7UA 4HH2A 3CITA 4FD8A 2FFFB 4O01A 4ARZB 1PIOA 3NOTC 3RFBA 2VK3A 3D72A 1K54A 5FQQA 2XD1A 4YNRA 4EV4A 3VFHA 2VEAA 1KGEA 2P08A 2WYXA 1Z09A 4E3KA 4R4SA 1K57C 2XFSA 2WKHA 4I3JA 4XUZA 3CMZA 3K3DA 4G3VA 5GLBA 4KENB 4K91A 3GQZA 3M6BA 2ZMAA 1OT6A 3VP4A 1GA9A 4EWFA 4HP4A 5FATA 5AVEA 4G3WA 4KG6A 5CRFA 3BJNA 3SH7A 3UB5P 2C6WB 2Y2JA 2Y91A 4M4XA 4MN5A 2O99A 5TGFA 3CWFA 4QPRA 1K57A 3CAXA 4OONA 5HDCA 1RGZA 2P9VA 3MR0A 1IYOA 3QHYA 1CI9A 4P87A 1FCOA 3I7JA 2HP6A 4QB8A 1XJ4A 4HI4A 3EOIA 2A2LA 5EE8A 2JKGA 1MWRA 3IXBA 2WUQA 1T18A 5L09A 5M1AA 3A0SA 4OOLA 2B95A 3W4QA 4R3BA 1P9WA 2PDRA 4XT2A 4UA9A 4XT2B 2GDNA 3DW0A 3BM6A 4JBFA 1OPXA 4WZ5C 5HAIA 3LIFA 1K25A 1YQSA 1MKIA 1NZUA 3SS5A 1K56D 4PAUA 1H5XA 1BTLA 4RVAA 4YOFA 4DJ3A 2XROA 5F1FA 2INWA 3IH8A 1G68A 3S7OA 3MXRA 1OJ5A 1KE0A 3MFXA 2JE5A 3V3RA 4MN7A 2G7UA 2WZZA 2W3HA 1QMEA 4MDZA 2EX6A 5HAPA 4E3OA 1H0MA 5HW3A 5E2GA 1BLCA 3Q82A 4LV0A 2K7SA 3GDIA 2JHEA 2YKFA 5FI6A 2Y2NA 3WRZA 1G6OA 4R0QA 1GSVA 4H6JB 4DMZA 3WS0A 3MBZA 1OMEA 4Y13A 3D3OA 5EVEA 3T4LA 3ZGAB 2EWVA 4LV1A 4FOFA 4WMCD 3OCNA 5K5BA 1NYYA 1XP4A 4IBRA 4WMCA 2X01A 3CG5A 4PM7A 5CEBA 5JYPA 5E2FA 1YAXA 2WADA 2QHKA 2IA2A 4CLCE 3FWLA 2RL3A 2H0YA 3MFDA 1EWZA 1I5QA 4WZ5A 1W8QA 4JF6A 1A0KA 5L10A 4OPRA 2RCXA 1P9RA 1D06A 3LCEA 3UNWA 1NYMA 4NKPA 1PRQA 3UY6A 3NY4A 3ICYA 2IWDA 1OTDA 4EEPA 2PBYA 1D7EA 1CI8A 4Y0OA 5AQAA 1ESUA 2C5WB 4DDSA 2WZXA 1VETB 2XA7S 4MEZA 4PHTA 3B3XA 4GD6A 2XA7M 3N6IA 5CHJA 2DCFA 2ZJ9A 2Y2OA 4WL9A 5FI7A 4OVDA 4I5SA 4R23A 1S67L 4UAAA 4UHUA 3DWZA 2WKIA 4AFIA 4BBVA 4Q8IA 3UE6A 5FEFA 1KE4A 3ITAA 2XLNA 1S1YA 1M40A 4GDNA 1C3BA 2L4RA 4ZJ3A 2KOIA 1GSWA 5DF8A 5KSCA 2J8YA 5HWTA 4CQHA 3CJMA 5TBMB 1JWPA 5E43A 2Y2IA 3C4PA 3N4IA 3UE0A 3A0VA 5I94A 2JKTM 2R9WA 3G2ZA 4NXBA 3NJAA 1NLYA 5EVIA 1TD5A 2K2NA 1YMSA 3ZVWA 3U4LP 1ZC2A 3GRJA 5LBRA 2WAEA 1SKOA 4IJGA 5CHUA 2W1TB 1K0KA 1Y28A 2XDMA 4LENA 4KQOA 4CLCA 4UQIS 1GCEA 1ESIA 3F1PA 3HL9A 4GD8A 1ZKJA 4A5RA 5F1GA 4L9FA 3MXSA 1YLPA 1IYQA 1T1BA 3A3FA 1HD8A 4I3IA 1RCJA 5I5LA 2VGKA 4DE2A 4JF5A 1F5MA 4ZBEA 1S6RA 5HPFA 3PBOA 4WEKA 4B9OA 3B47A 3O88A 1ACFA 1IKIA 4OQIA 4S2OA 3LIAA 4NXGA 2HP9A 3W4OA 1PW8A 4OOMA 4Y7PA 1HTZA 3M6HA 5AVFA 3VP0A 4R6LA 5HSQA 2J3TD 2O0YA 1YLTA 3E2KA 1JTGA 3W2ZA 3ZQ5A 1JWZA 2WKRA 4QWOA 3RH8B 4E04A 4S2NC 3HLFA 4P6ZM 3MSHA 3VFFA 3NC8A 1L0DA 3IS2A 3IS2B 3MXQA 3SH9A 3IX8A 4GHIA 4HIAA 1YT4A 2BASA 2I72A 1BYWA 3RTYA 2HJ9C 5DFYA 1EW0A 1G28A 3BYDA 4UQIM 3QP5A 4Y2FA 5IU1A 2ZC7A 4S2NA 2KX6A 1LI0A 1GHPA 1OTIA 3LIDA 3ULFA 3VSLA 1H8YA 3T50A 5J4EA 4IVKA 1ODVA 3CUEA 3HUOA 3IF5A 2Q9MA 4K0WA 4FUWA 3A3EA 1EI5A 4BQMA 3FKVA 4FH2A 4R3AA 4X68A 1N9OA 1BT5A 3H82A 3LFVA 2XD5A 3SS3A 3GMWA 3HJKA 1PYYA 4KZBA 4PKYA 3IT9A 2Z2LB 1XGJA 3EGDC 3E4QA 2HV1A 4QU3A 1IOUA 5F82A 5DKLA 5FQKA 3OPHA 3W8KA 1FOFA 2VV6A 4EU0A 5FI2A 3IF6B 4P6ZS 2J3TC 4EW7A 3FZCA 2V2FF 4YFMA 2A49A 4IHQA 3GECA 3WS5A 3UE1A 1Q2QA 3NULA 5HX9A 2Z6DA 4U0XA 2ZBBA 2ZQDA 2M7UA 1LL8A 1MWSA 1XKZA 2K31A 1K6SA 4GNUA 3CZDA 5HPIA 3HBRA 4KQDA 5HL6A 3KSGA 3IWQA 3C8CA 5DF7A 2WAFA 2PD8A 3LEZA 4UA7A 3PTEA 3FG8A 1JTDA 3Q7ZA 5CTNA 5CGWA 2O9CA 1S4RA 1LSXA 3UPNA 4N9LA 3VOZA 2P04A 3A0RA 2V8FA 3E98A 1V9YA 2PR6A 1OTAA 1BLSA 1XX2A 3NCKA 5EM0A 1CF0A 4KG5A 1K6RA 4Y0UA 3BLMA 4BD1A 4HNBA 3QP6A 1D1JA 1JVJA 2V0WA 4Y15A 5HWWA 3TG9A 5IHVA 5DJTA 1FQGA 1JNUA 3VOLA 3IBRA 2ZM2A 3SW1A 3H7WB 2XSSA 4DRTA 4Q0HA 4PM9A 3Q07A 4JLFA 3KYQA 1UGUA 1FSYA 4OQGA 4S2LA 2G2WA 3E2LA 5J3WA 2E8JA 3SOIA 3GTCA 3QP1A 4EETB 5JYOA 4Z1WA 1F98A 5FA7A 3LR5A 3PAEA 1CJFA 3UDXA 4L0LA 1E3UA 4C3QA 3OBFA 3N8RA 5TFQA 1IELA 1YM1A 2EXAA 3NHQA 4WUJA 2HZ5A 4O0PA 4LV3A 4NEED 2J80A 4HEFA 4JGRA 4EXOA 3RXXA 2B18A 2XR0A 3R4KA 1L0FA 3WS1A 3T1SA 3B33A 2ZQAA 2HGVA 2V20A 2DNSA 1KE3A 4Y3IA 3ITBA 3KYZA 3K3CA 4BL3A 2PU2A 3T12B 4HOIA 2VKSA 3DTEA 5EOOA 3HCYA 1ERQA 3JVUA 5FAOA 5A8BA 2ZC4B 3BQAA 4GB7A 4OP8A 3UB9A 1P97A 3E4OA 3LR3A 1YSPA 4RA7A 2BTFP 2Y2PA 2QKPA 4OPYA 1YLJA 4M3KA 5F83A 3PR6A 2FZ0A 4HHDA 3UB7A 4F3LA 3T1XA 3UB8A 4OLDA 3ISGA 5KSHA 4JKTA 4PM8A 5HFOA 4KG2A 1BSGA 3KYEA 2VGLM 2JN7A 2A24A 4BLMA 1XA1A 5HAQA 3SZTA 5CXWA 3WRTA 3MZFA 3PXPA 2ZLYA 4KZ7A 3N7WA 3T1QB 1VB6A 3TSGA 3ZG9B 4EERA 2XK1A 1CK3A 4ARZA 5CERA 1E3UD 3F1NB 1LSVA 3K2NA 3OLOA 4JXWA 3CHWP 3KX0X 2QWSA 3P09A 3OPRA 3T4TA 1FILA 4WBGA 2E8IA 2W3EA 2JKRM 4EEUA 2JC7A 3PBTA 3AGDA 4E3NA 4PM5A 3WS2A 1KGGA 1YPRA 4E3JA 3ZNTA 3OPPA 2XEPA 5GLAA 3O3VA 2QYBA 3RXWA 4YWZA 3BY8A 2Y55A 2ZM0A 4YINA 1KDSA 3O5YA 2WKEA 3LO7A 4C6YA 3DTKA 1J3WA 3M2KA 1H8ZA 4MNRA 1OTBA 2EFUA 4HQAA 3ZG8B 2VV7A 3SS4A 1MY8A 2Z2MB 3V50A 3BY9A 1IYPA 4WM9A 3T4QA 4ZJ2A 4C75A 4FSFA 2ZOIA 3TE8A 1TVFA 1N4OA 3IXDA 1JWVA 4LLOB 4DN0A 5CEDA 1DRMA 2QJ7A 4DXBA 4EUVA 1O7EA 1XXMA 4LFUA 3MKEA 3ZFZA 5AQBA 1SZVA 1DJCA 3V67A 2W3FA 4HBTA 1H8MA 4X1LA 4I3AA 3IX4A 3MQ0A 3Q7VA 2V1AA 5HDSA 4DE3A 2WGVA 1ALQA 3UMEA 1DP8A 5G18A 2WKPA 4WN5A 5F69A 3IXHA 5CGXA 2ZL1B 5KZHA 4IEDA 3ZVTA 2HDQA 3R7WA 3GSGA 1DY6A 4OQHA 3FPWA 4S2JA 2M7VA 1STZA 3EQUA 1MZUA 2J3WA 3DBAA 3DWKA 2YKHA 2ZQ9A 2WGIA 3V3SA 5CGSA 2Y4AA 4HY8A 4ZRRA 3C4OA 4LCLA 2EX9A 2H28A 3IQAA 1T1CA 2V1ZA 1BLHA 4K0XA 1G6AA 3OOVA 4NK3A 3QNCA 3MZDA 4GCZA 5BOHA 2WKQA 1TDLA 4P0MA 1ES4A 4R1GA 4UA6A 1TS8A 3TJZC 2A3UA 5E2HA 4I38A 3KSFA 3PBNA 4DJ2A 3P7NA 2JBFA 2OLVA 2ZC5B 5A92A 3O87A 5FDHA 4GOGA 2WK0A 1ES3A 4WEJA 3B42A 2W3GA 3H9WA 1TF1A 4GJ4A 1W63M 5HD3A 2LB9A 3IXGA 4CLCD 3ZG5A 2ACGA 4OPZA 2VJWA 5HD5A 1F9IA 3D9YA 1AXBA 1J9MA 1GA0A 3QP8A 4ESPA 4OP5A 3LEQA 5MC7A 2GJ3A 2ZQ8A 5EVIB 5KIZA 4B93A 4K08A 4B4XA 1DJBA 3PHYA 4CPKA 3UE3A 4JF4A 5M18A 4LRZE 4MBHA 2EX2A 2M1CA 1KVLA 4Q0IA 2KDKA 5TJJA 2ZQ7A 3HLGA 3DTMA 1ONHA 1W8YA 3UPOA 3LR0A 3C38A 4RX3A 5KMWA 4NG2A 5EVIC 3PAGA 2EA9A 3UDFA 5HWVA 2X02A 1DP9A 5FDSA 4WF0A 5CX7A 2D01A 5TBMA 3NDEA 4IBXA 1T19A 1YSQA 1OT9A 4BENA 1TS7A 3ZYTA 1SDEA 1TEMA 2A24B 1HVBA 1XGIA 1YKDA 1DP6A 3HVFA 1MXOA 4MMNA 2G2UA 4N92A 3WWXA 3TRCA 4OLGA 2PR5A 2PRFA 4NXEA 2P9VB 2ZC3B 3OCLA 5F6AA 2H5SA 4Y17A 4ZDXA 2J9OA 3GVBA 5GLDA 1FCNA 1WE4A 2PHYA 2W1RA 3A3JA 2XF3A 3FPVA 1NY0A 2VLGA 3G34A 4D60A 5CHMA 2W1TA 2LB5A 3BEBA 3TOIA 4CLCB 4JXVA 2DMWA 3IHBA 3EQVA 5HZHA 5FL3A 4HJ3A 3NECA 1I2SA 5EECA 4KUOA 1WA9A 4GLQA 3T4KA 4B88A 1W5DA 4RX2A 1O07A 3S1YA 2Y2HA 1CEFA 2UWXA 2Y2GA 1U60A 5L2FA 3V39A 2BLSA 3D4FA 1K4EA 1LT0A 2H0TA 4BBUA 2XQZA 2H10A 5FQIA 4X6TA 3BECA 4DE0A 4X55A 3P98A 4UEYA 2P7JA 3V5MA 3VMAA 1MBLA 2WGWA 4U3TA 1BLPA 4S2IA 2WGWB 3MQOA 3VP1A 5GLCA 4EQ1A 2EX8A 1HLUP 5AJGA 3OC2A 4GN2A 2ZQCA 3G32A 2KLIA 1ZG4A 4S2PA 5EPHA 4BJPA 3VE4A 3C5AA 3FKWA 3Q1FA 3LICA 1UWNX 2EFXA 1KGFA 4MBKA 4P6BA 3JPUA 3IF6A 2UV0E 2V9AA 3KSIA 3G31A 2QZ6A 2VA0A 2QPNA 1YLZA 4KZ8A 3NDGA 1RGYA 1OTEA 5A91A 5GHZA 3T4SA 2PD7A 5DTKA 2DRWA 1LL9A 2XFTA 2HDUA 3N8LA 1XJ3A 2B02A 3H82B 5AQ7A 1XPBA 3JYIA 3ZG0A 4L9GA 4GS9B 4E3IA 1SHVA 3ZHHA 4QJGA 1IYSA 3FV7A 1OJGA 2OSUA 1TS6A 1FSWA 3LYXA 4RYEA 5EV0A 3F1OB 2GX5A 2PBDP 3F1OA 1K56A 4R3JA 2R9XA 3LI9A 1Z6FA 4N1HA 1VQQA 5D3OA 1YLYA 3QP4A 3UB6A 3FC7A 3BFGA 4B4ZA 4LGWA 2PAVP 2VGLS 4HP9A 3IBJA 2Y8HA 3L9KA 1VETA 4MBFA 5TR7A 2ZOHA 3S22A 1PNEA 3OZHA 4KZ3A 4BL2A 5CTMA 3P01A 2ZMVA 3T4JA 3VE3A 3MJQA 4KZAA 3RJUA 2JKTI 2J7VA 5F5YA 4G3KA 3Q81A 4HESA 3LUQA 4FCFA 5L07A 2XRNA 2EXBA 1PWGA 1N9BA 3BFDA 1PWDA 1FIKA 1VEUB 4IUKA 4ETZA 1VEUA 3LGOA 4O7DA 1BUEA 4S2MA 3PBSA 4CJNA 4QY6A 5FASA 1K4FA 3W4PA 4LV2A 1LLBA 4S2KA 5AQ9A 1W7FA 3IX3A 1UWPX 1VHMA 4DKIA 3CPTB 1ONGA 1SKFA 3CPTA 3IH9A 3BW6A 5J7EA 2HF6A 4OOYA 1EROA 3IHAA 5FAPA 4EESA 1N9NA 4HJ6A 2PT7A 3WS4A 5DVAA 1T1AA 3JVVA 4IVIA 1LSWA 1YMXA 3KSHA 4CLCC 4X69A 3IWIA 3MS6A 3E4PA 4EBLA 1GHIA 3HREA 4Z9QA 3S4XA 3TW8A 2HDSA 1K55A 1MKMA 3CI6A 3BFCA 3OPLA 2FFYA 4KQQA 3GR2A 3DTIA 3HJIA 1XFQA 5L8MA 2R78A 3U2AA 2PU4A 4ID4A 1NRJA 4LPZA 2OV5A 4DE1A 2GNXA 2V1BA 4PKYG 3C7VA 2Y2KA 3EEAA 4R4RA 3NIAA 1NWZA 4MLLA 1SDNA 1ZG6A 1XA7A 3G2YA 1FR1A 5DFXA 2O9BA 2ZMFA 1ZTUA 5FQMA 2NUPC 3S7QA 4KZ9A 1E25A 1M6KA 1RP5A 3BFEA 4GZBA 4R38A 3A3IA 3UO9A 5DTTA 4F3LB 5DF9A 4P85A 2HPBA 5G4YA 4E6XA 4X53A 2Y2LA 4JGOA 2QMIA 2PYRA 3CUEC 4BWIA 1S66L 1NLZA 3NBLA 3LIEA 3VV4A 3HLCA 3EGXC 3HLEA 1FR6A 3BQ8A 1ZHHB 5DJUA 2QJ5A 1Y4OA 2FH5A 3FYZA 5GHXA 3LI8A 1P0ZA 4DDYA 4GKUA 1SKOB 4E6WA 4EUZA 2VX8A 2Y59A 3BFFA 4GHIB 3G6OA 1NZOA 4MCWA 3HLDA 4OQ0A 4NETA 5A90A 3DAVA 2J9PA 2VZWA 3GV9A 3F1PB 2X71A 1SCWA 4KQRA 1TS0A 4WELA 1PW1A 3PYPA 4MN6A 3F1NA 4D2OA 5HL1A 1ES5A 3VP3A 1WYBA 3NI9A 3G35A 4KZ6A 2L1MA 4JXSA 4XXRA 1I2WA 4X56A 1XFNA 5CECA 5HDDA 1KOUA 2JCHA 2Z6CA 2MJ6A 1NJ4A 3T4OA 4E3LA 5EM1A 4FTXA 4JGPA 2NUTC 2JKRI 1K38A 4ETXA 1AWIA 1HZOA 3HUMA 1BULA 4HH3A 1WYCA 3G30A 4OPQA 2VGJA 2OAQ1 2Y2MA 4DXCA 3ZDJA 1Y54A 2V0UA 2W27A 1L0EA 4GW9A 2D02A 2V8CA 2O9AA 1S1ZA 3E0YA 4LCMA 4NXFA 2ZD8A 1TDGA 1PZPA 3LY3A 5F68A 1KVMA 2JKFA 2W0NA 2VV8A 4WYYA 4X25A 3A3DA 4E3MA 1IFQA 1F2KA 3PBQA 5A93A 4X1MA 4LRYC 2IWCA 4ME4A 3G4PA 3HUNA 5FSRA 4XUXA 4PM6A 1E4DA 2P74A 3MF0A 1L2SA 3IF6C 2CMNA 2Q0OA 3HLWA 4GS9A 5M19A 3O86A 4EBPA 2IWBA 1IEMA 3QP2A 2CC1A 4FH4A 5FAQA 5C5KA 4EBNA 5EFWA 3VP2A 1MC0A 3UN7A 3UMDA 3BRMA 1KDWA 2OWHA 2BG1A 2OWJA 4WZ4A 2W3DA 4ZTKA 1QMFA 2Y2QA 4Y0TA 3MQQA 1LI9A 4OKPA 4DF6A 1XJ2A 1IKGA 2OOLA 3VOYA 5J8XA 4H6JA 3SH8A 2B5RA 3EEHA 4RQ9A 3PBRA 1G5UA 2OLUA 1YLWA 3NOUC 1N9LA 3BWLA 3AGEA 1MWUA 1ES2A 3MMHA 1FCMA 4U0TA 1NRFA 3UPPA 4II7A 3N8SA 4JPMA 4R70A 1VM1A 1MPLA 1XJ6A 3L7HA 4F94A 3KO6A 1L3LA 3Q7VB 1K55C 5FEGA 1W79A 5HARA 4ZJ1A 4QY5A 3AGFA 3S7NA 3C30A 3ZG7B 4KUKA 4O8GA 1L0GA 5U47A 2Q9NA 4BD0A 3UDIA 3LIBA 1ERMA 3EWKA 4QHCA 4BMWA 2ZL1A 1X0OA 1CQAA 3IWOA 5EUAA 2HJEA 3R7WB 1S0WA 4PPRA 1GHMA 4ZAMA 4JXGA 3LR4A 4I39A 1CEGA 5FQ9A 5DTSA 2XGNA 5E2EA 5IS1A 3LY4A 3T1RA 4IUHA 2HP5A 2GZAA 4BBTA 3QNBA 1DJAA 1K54C 4Y5FA 3MZEA 4HJ4A 4N9KA 1BZAA 5GL9A 3BLSA 5EVID 2XH9A 3MKFA 1V9ZA 1Q2PA 1GSXA 3VSKA 5IT5A 5EVLA 3H7WA 1NXYA
chains in the Genus database with same CATH topology
1F5MA 3C2WA 5HPFA 2PYPA 2ZOHA 3PBOA 4WEKA 4B9OA 3B47A 3CLOA 1OTBA 4HQAA 3P01A 3LIAA 2ZMVA 4NXGA 2VV7A 3T4JA 3VE3A 3MJQA 4OOMA 2JKTI 5AVFA 3BY9A 4R6LA 5HSQA 2J3TD 2O0YA 5F5YA 3T4QA 3W2ZA 3ZQ5A 1H3QA 4FSFA 2WKRA 4G3KA 3RH8B 4JGQA 2ZOIA 3TE8A 4E04A 4P6ZM 3LUQA 2XRNA 4LLOB 2I9VA 4DN0A 1DRMA 2QJ7A 3IS2A 3NOPC 3IS2B 3MXQA 4IUKA 4ETZA 4EUVA 4Q0JA 4L9EA 4GHIA 1S4SA 3PBSA 5DKKA 4HIAA 2L0WA 2BASA 2Y79A 1BYWA 2EWWA 3V67A 2W3FA 3RTYA 5G4ZA 1H8MA 2HJ9C 5DFYA 4I3AA 4WLAA 1EW0A 1G28A 3MQ0A 1UWPX 1VHMA 2OAP1 4LRXC 4UQIM 1W63Q 4Y2FA 2V1AA 5HDSA 5IU1A 3S7PA 2KX6A 3BW6A 3UMEA 5J7EA 1DP8A 2HF6A 1OTIA 3LIDA 3ULFA 4HH2A 3CITA 2WKPA 3T50A 5J4EA 4WN5A 4EESA 4O01A 4ARZB 1ODVA 3NOTC 3CUEA 3RFBA 1N9NA 4HJ6A 3D72A 5F69A 2PT7A 1T1AA 4YNRA 2VEAA 3JVVA 1LSWA 3KSHA 4CLCC 2P08A 4R3AA 3R7WA 1N9OA 3H82A 3E4PA 3LFVA 3FPWA 3HJKA 3TW8A 3CI6A 1STZA 1MKMA 3EQUA 2M7VA 1MZUA 4PKYA 4I3JA 2J3WA 3DBAA 2YKHA 3HJIA 3K3DA 4G3VA 1XFQA 5L8MA 2R78A 3U2AA 3EGDC 3E4QA 2HV1A 1IOUA 4HY8A 4ZRRA 1NRJA 4LPZA 5DKLA 1OT6A 2H28A 2GNXA 2V1BA 4PKYG 3EEAA 4HP4A 1T1CA 5AVEA 4G3WA 1NWZA 3BJNA 2VV6A 4EU0A 3OOVA 5DFXA 4M4XA 4MN5A 2O99A 2O9BA 3CWFA 4P6ZS 2J3TC 2ZMFA 1ZTUA 4QPRA 2NUPC 4GCZA 3CAXA 5HDCA 3S7QA 4EW7A 2WKQA 3MR0A 4IHQA 4R38A 3GECA 4F3LB 5DF9A 5G4YA 1TS8A 3TJZC 4JGOA 1XJ4A 4HI4A 3EOIA 2A2LA 2PYRA 3CUEC 4BWIA 1S66L 2Z6DA 1NLZA 4I38A 1T18A 3KSFA 3LIEA 3PBNA 3VV4A 4DJ2A 3P7NA 3EGXC 2ZBBA 3A0SA 3BQ8A 1ZHHB 4OOLA 2M7UA 1LL8A 5DJUA 2QJ5A 2FH5A 1P9WA 2PDRA 2K31A 4XT2A 3LI8A 4WEJA 3B42A 4XT2B 1P0ZA 2W3GA 3H9WA 1TF1A 4GJ4A 1W63M 2VX8A 5HPIA 4KQDA 4GHIB 3G6OA 4MCWA 5HD3A 5HL6A 3KSGA 2LB9A 1OPXA 4CLCD 3C8CA 3LIFA 2PD8A 2VJWA 2VZWA 3F1PB 5HD5A 3FG8A 1F9IA 2O9CA 1S4RA 1TS0A 4WELA 3PYPA 4MN6A 4PAUA 3F1NA 1LSXA 4YOFA 4DJ3A 2XROA 5MC7A 2INWA 2GJ3A 3S7OA 5KIZA 2L1MA 2P04A 4B93A 1OJ5A 3MFXA 3A0RA 4K08A 3E98A 1V9YA 2PR6A 1OTAA 4MN7A 2G7UA 1XFNA 3PHYA 2W3HA 5HDDA 3UE3A 1KOUA 4MDZA 4LRZE 2Z6CA 2MJ6A 2M1CA 3T4OA 4Q0IA 4HNBA 2KDKA 4JGPA 5TJJA 2K7SA 2NUTC 3GDIA 2JKRI 2V0WA 2JHEA 5HWWA 3LR0A 3C38A 2YKFA 1G6OA 5DJTA 1JNUA 1GSVA 4H6JB 2EA9A 3VOLA 3IBRA 4DMZA 4ETXA 5HWVA 1DP9A 3D3OA 3T4LA 4HH3A 4WF0A 2EWVA 5CX7A 2D01A 3SW1A 4FOFA 3H7WB 5TBMA 2XSSA 3OCNA 4Q0HA 5K5BA 1T19A 1YSQA 1OT9A 2OAQ1 1TS7A 3ZYTA 3KYQA 1UGUA 2A24B 1YKDA 2V0UA 2W27A 5J3WA 1DP6A 4GW9A 1YAXA 2QHKA 2IA2A 2D02A 4MMNA 2O9AA 1S1ZA 3E0YA 4CLCE 4NXFA 4EETB 3TRCA 4Z1WA 1F98A 2PR5A 4NXEA 3LR5A 5F68A 3OCLA 5F6AA 4L0LA 3OBFA 2W0NA 2PHYA 2VV8A 2W1RA 3FPVA 2VLGA 1P9RA 1D06A 3NHQA 1IFQA 2W1TA 2LB5A 3PBQA 4WUJA 4LRYC 4CLCB 4O0PA 2DMWA 4ME4A 4NEED 4NKPA 2J80A 4JGRA 4EXOA 3EQVA 3MF0A 2B18A 3R4KA 5HZHA 5FL3A 3B33A 4HJ3A 2CMNA 4GS9A 2HGVA 3ICYA 1OTDA 4KUOA 1WA9A 4Y3IA 4GLQA 3T4KA 4EEPA 1D7EA 3KYZA 3K3CA 4HOIA 2VKSA 5C5KA 2XA7S 3HCYA 3JVUA 5EFWA 5A8BA 1MC0A 4PHTA 3BQAA 1LT0A 3UMDA 4BBUA 3UB9A 2OWHA 2OWJA 2XA7M 1P97A 3E4OA 2W3DA 3LR3A 1YSPA 2QKPA 4WL9A 4UEYA 2P7JA 3PR6A 2FZ0A 4HHDA 3MQQA 3UB7A 4F3LA 3MQOA 1XJ2A 2OOLA 4I5SA 3UB8A 4H6JA 4EQ1A 3EEHA 4RQ9A 3PBRA 1S67L 5AJGA 3OC2A 5KSHA 3NOUC 1N9LA 3BWLA 4AFIA 4BBVA 3MMHA 3UE6A 4II7A 2KLIA 4R70A 1XJ6A 2VGLM 4BJPA 1S1YA 3VE4A 2JN7A 2A24A 2L4RA 3LICA 1UWNX 3KO6A 2KOIA 1GSWA 3PXPA 2V9AA 5HWTA 4CQHA 1VB6A 3KSIA 3S7NA 3C30A 4KUKA 2VA0A 5TBMB 4O8GA 4EERA 1OTEA 4ARZA 3LIBA 3A0VA 3EWKA 3T4SA 4BMWA 3F1NB 2PD7A 2JKTM 1X0OA 1LSVA 4NXBA 3NJAA 1NLYA 3K2NA 3OLOA 1XJ3A 2HJEA 3KX0X 2QWSA 3R7WB 2B02A 3H82B 3T4TA 3LR4A 1TD5A 2K2NA 4I39A 2W3EA 2JKRM 4EEUA 3PBTA 4L9GA 4GS9B 5IS1A 5LBRA 4IUHA 1OJGA 4IJGA 2GZAA 2W1TB 1TS6A 1Y28A 3LYXA 4KQOA 4CLCA 3F1OB 2GX5A 4BBTA 4UQIS 3F1OA 4Y5FA 2QYBA 3F1PA 3LI9A 4HJ4A 4YWZA 4L9FA 3BY8A 1T1BA 3UB6A 1V9ZA 3FC7A 4I3IA 1GSXA 2VGLS 3O5YA 3IBJA 4HP9A 5I5LA 5IT5A 2Y8HA 3H7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F5M A;  3C2W A;  4ZRR A;  5HPF A;  5TJJ A;  3EEA A;  4G3W A;  3BJN A;  2OOL A;  4EU0 A;  3OOV A;  4RQ9 A;  5DFX A;  2O99 A;  3IBR A;  2O9B A;  5AJG A;  4DMZ A;  4ETX A;  2ZMF A;  1ZTU A;  3NOU C;  4QPR A;  4R6L A;  3S7Q A;  3D3O A;  5HSQ A;  2O0Y A;  3W2Z A;  3MMH A;  4FOF A;  3ZQ5 A;  2XSS A;  4Q0H A;  4G3K A;  5K5B A;  2KLI A;  4R70 A;  4E04 A;  1YSQ A;  2XRN A;  4DN0 A;  1YKD A;  3NOP C;  3KO6 A;  4IUK A;  4ETZ A;  2KOI A;  4GW9 A;  4Q0J A;  4EUV A;  2IA2 A;  4BWI A;  4MMN A;  2O9A A;  3E0Y A;  4CQH A;  3KSI A;  3KSF A;  3TRC A;  4Z1W A;  3S7N A;  3VV4 A;  2Y79 A;  4O8G A;  2M7U A;  2W3F A;  3OBF A;  2K31 A;  5DFY A;  2W1R A;  3MQ0 A;  2W3G A;  1VHM A;  4LRX C;  4Y2F A;  1TF1 A;  3S7P A;  3K2N A;  3NHQ A;  5HPI A;  3G6O A;  2W1T A;  2LB5 A;  4MCW A;  5HL6 A;  4LRY C;  3KSG A;  2LB9 A;  4O0P A;  4ME4 A;  1TD5 A;  2K2N A;  3CIT A;  2VJW A;  2VZW A;  3MF0 A;  2B18 A;  3R4K A;  2W3E A;  4O01 A;  3NOT C;  3RFB A;  2O9C A;  2HGV A;  5LBR A;  4PAU A;  4YNR A;  4Y3I A;  4GLQ A;  2VEA A;  3KSH A;  4IUH A;  4YOF A;  4IJG A;  2XRO A;  2W1T B;  3S7O A;  2GX5 A;  3LFV A;  2VKS A;  5C5K A;  4Y5F A;  2QYB A;  3HCY A;  3CI6 A;  1STZ A;  1MKM A;  3E98 A;  2M7V A;  1MC0 A;  4MN7 A;  2G7U A;  3DBA A;  2W3H A;  4G3V A;  5L8M A;  4MDZ A;  4LRZ E;  2W3D A;  3IBJ A;  1YSP A;  3O5Y A;  5I5L A;  2Y8H A;  4Q0I A; 
#chains in the Genus database with same CATH topology
 3C2W A;  4N1X A;  2PYP A;  4KZ5 A;  3CLO A;  4EQI A;  4HBU A;  4KZ4 A;  3ZCZ A;  5FQJ A;  1PZO A;  2HDR A;  4H8R A;  1H3Q A;  4JGQ A;  2ZM8 A;  5GHY A;  2ZC6 B;  2I9V A;  1PI4 A;  3NOP C;  4Q0J A;  4L9E A;  1S4S A;  1PFL A;  5DKK A;  2L0W A;  2Y79 A;  2EWW A;  2AVX A;  1MWT A;  1PWC A;  5G4Z A;  1LHY A;  5EOE A;  4WLA A;  2OAP 1;  4LRX C;  4OH0 A;  1W63 Q;  3HLB A;  1PI5 A;  4QD4 A;  3S7P A;  3ZNY A;  3M2J A;  4GDB A;  1LL5 A;  4PMA A;  3C7U A;  4HH2 A;  3CIT A;  4FD8 A;  2FFF B;  4O01 A;  4ARZ B;  1PIO A;  3NOT C;  3RFB A;  2VK3 A;  3D72 A;  1K54 A;  5FQQ A;  2XD1 A;  4YNR A;  4EV4 A;  3VFH A;  2VEA A;  1KGE A;  2P08 A;  2WYX A;  1Z09 A;  4E3K A;  4R4S A;  1K57 C;  2XFS A;  2WKH A;  4I3J A;  4XUZ A;  3CMZ A;  3K3D A;  4G3V A;  5GLB A;  4KEN B;  4K91 A;  3GQZ A;  3M6B A;  2ZMA A;  1OT6 A;  3VP4 A;  1GA9 A;  4EWF A;  4HP4 A;  5FAT A;  5AVE A;  4G3W A;  4KG6 A;  5CRF A;  3BJN A;  3SH7 A;  3UB5 P;  2C6W B;  2Y2J A;  2Y91 A;  4M4X A;  4MN5 A;  2O99 A;  5TGF A;  3CWF A;  4QPR A;  1K57 A;  3CAX A;  4OON A;  5HDC A;  1RGZ A;  2P9V A;  3MR0 A;  1IYO A;  3QHY A;  1CI9 A;  4P87 A;  1FCO A;  3I7J A;  2HP6 A;  4QB8 A;  1XJ4 A;  4HI4 A;  3EOI A;  2A2L A;  5EE8 A;  2JKG A;  1MWR A;  3IXB A;  2WUQ A;  1T18 A;  5L09 A;  5M1A A;  3A0S A;  4OOL A;  2B95 A;  3W4Q A;  4R3B A;  1P9W A;  2PDR A;  4XT2 A;  4UA9 A;  4XT2 B;  2GDN A;  3DW0 A;  3BM6 A;  4JBF A;  1OPX A;  4WZ5 C;  5HAI A;  3LIF A;  1K25 A;  1YQS A;  1MKI A;  1NZU A;  3SS5 A;  1K56 D;  4PAU A;  1H5X A;  1BTL A;  4RVA A;  4YOF A;  4DJ3 A;  2XRO A;  5F1F A;  2INW A;  3IH8 A;  1G68 A;  3S7O A;  3MXR A;  1OJ5 A;  1KE0 A;  3MFX A;  2JE5 A;  3V3R A;  4MN7 A;  2G7U A;  2WZZ A;  2W3H A;  1QME A;  4MDZ A;  2EX6 A;  5HAP A;  4E3O A;  1H0M A;  5HW3 A;  5E2G A;  1BLC A;  3Q82 A;  4LV0 A;  2K7S A;  3GDI A;  2JHE A;  2YKF A;  5FI6 A;  2Y2N A;  3WRZ A;  1G6O A;  4R0Q A;  1GSV A;  4H6J B;  4DMZ A;  3WS0 A;  3MBZ A;  1OME A;  4Y13 A;  3D3O A;  5EVE A;  3T4L A;  3ZGA B;  2EWV A;  4LV1 A;  4FOF A;  4WMC D;  3OCN A;  5K5B A;  1NYY A;  1XP4 A;  4IBR A;  4WMC A;  2X01 A;  3CG5 A;  4PM7 A;  5CEB A;  5JYP A;  5E2F A;  1YAX A;  2WAD A;  2QHK A;  2IA2 A;  4CLC E;  3FWL A;  2RL3 A;  2H0Y A;  3MFD A;  1EWZ A;  1I5Q A;  4WZ5 A;  1W8Q A;  4JF6 A;  1A0K A;  5L10 A;  4OPR A;  2RCX A;  1P9R A;  1D06 A;  3LCE A;  3UNW A;  1NYM A;  4NKP A;  1PRQ A;  3UY6 A;  3NY4 A;  3ICY A;  2IWD A;  1OTD A;  4EEP A;  2PBY A;  1D7E A;  1CI8 A;  4Y0O A;  5AQA A;  1ESU A;  2C5W B;  4DDS A;  2WZX A;  1VET B;  2XA7 S;  4MEZ A;  4PHT A;  3B3X A;  4GD6 A;  2XA7 M;  3N6I A;  5CHJ A;  2DCF A;  2ZJ9 A;  2Y2O A;  4WL9 A;  5FI7 A;  4OVD A;  4I5S A;  4R23 A;  1S67 L;  4UAA A;  4UHU A;  3DWZ A;  2WKI A;  4AFI A;  4BBV A;  4Q8I A;  3UE6 A;  5FEF A;  1KE4 A;  3ITA A;  2XLN A;  1S1Y A;  1M40 A;  4GDN A;  1C3B A;  2L4R A;  4ZJ3 A;  2KOI A;  1GSW A;  5DF8 A;  5KSC A;  2J8Y A;  5HWT A;  4CQH A;  3CJM A;  5TBM B;  1JWP A;  5E43 A;  2Y2I A;  3C4P A;  3N4I A;  3UE0 A;  3A0V A;  5I94 A;  2JKT M;  2R9W A;  3G2Z A;  4NXB A;  3NJA A;  1NLY A;  5EVI A;  1TD5 A;  2K2N A;  1YMS A;  3ZVW A;  3U4L P;  1ZC2 A;  3GRJ A;  5LBR A;  2WAE A;  1SKO A;  4IJG A;  5CHU A;  2W1T B;  1K0K A;  1Y28 A;  2XDM A;  4LEN A;  4KQO A;  4CLC A;  4UQI S;  1GCE A;  1ESI A;  3F1P A;  3HL9 A;  4GD8 A;  1ZKJ A;  4A5R A;  5F1G A;  4L9F A;  3MXS A;  1YLP A;  1IYQ A;  1T1B A;  3A3F A;  1HD8 A;  4I3I A;  1RCJ A;  5I5L A;  2VGK A;  4DE2 A;  4JF5 A;  1F5M A;  4ZBE A;  1S6R A;  5HPF A;  3PBO A;  4WEK A;  4B9O A;  3B47 A;  3O88 A;  1ACF A;  1IKI A;  4OQI A;  4S2O A;  3LIA A;  4NXG A;  2HP9 A;  3W4O A;  1PW8 A;  4OOM A;  4Y7P A;  1HTZ A;  3M6H A;  5AVF A;  3VP0 A;  4R6L A;  5HSQ A;  2J3T D;  2O0Y A;  1YLT A;  3E2K A;  1JTG A;  3W2Z A;  3ZQ5 A;  1JWZ A;  2WKR A;  4QWO A;  3RH8 B;  4E04 A;  4S2N C;  3HLF A;  4P6Z M;  3MSH A;  3VFF A;  3NC8 A;  1L0D A;  3IS2 A;  3IS2 B;  3MXQ A;  3SH9 A;  3IX8 A;  4GHI A;  4HIA A;  1YT4 A;  2BAS A;  2I72 A;  1BYW A;  3RTY A;  2HJ9 C;  5DFY A;  1EW0 A;  1G28 A;  3BYD A;  4UQI M;  3QP5 A;  4Y2F A;  5IU1 A;  2ZC7 A;  4S2N A;  2KX6 A;  1LI0 A;  1GHP A;  1OTI A;  3LID A;  3ULF A;  3VSL A;  1H8Y A;  3T50 A;  5J4E A;  4IVK A;  1ODV A;  3CUE A;  3HUO A;  3IF5 A;  2Q9M A;  4K0W A;  4FUW A;  3A3E A;  1EI5 A;  4BQM A;  3FKV A;  4FH2 A;  4R3A A;  4X68 A;  1N9O A;  1BT5 A;  3H82 A;  3LFV A;  2XD5 A;  3SS3 A;  3GMW A;  3HJK A;  1PYY A;  4KZB A;  4PKY A;  3IT9 A;  2Z2L B;  1XGJ A;  3EGD C;  3E4Q A;  2HV1 A;  4QU3 A;  1IOU A;  5F82 A;  5DKL A;  5FQK A;  3OPH A;  3W8K A;  1FOF A;  2VV6 A;  4EU0 A;  5FI2 A;  3IF6 B;  4P6Z S;  2J3T C;  4EW7 A;  3FZC A;  2V2F F;  4YFM A;  2A49 A;  4IHQ A;  3GEC A;  3WS5 A;  3UE1 A;  1Q2Q A;  3NUL A;  5HX9 A;  2Z6D A;  4U0X A;  2ZBB A;  2ZQD A;  2M7U A;  1LL8 A;  1MWS A;  1XKZ A;  2K31 A;  1K6S A;  4GNU A;  3CZD A;  5HPI A;  3HBR A;  4KQD A;  5HL6 A;  3KSG A;  3IWQ A;  3C8C A;  5DF7 A;  2WAF A;  2PD8 A;  3LEZ A;  4UA7 A;  3PTE A;  3FG8 A;  1JTD A;  3Q7Z A;  5CTN A;  5CGW A;  2O9C A;  1S4R A;  1LSX A;  3UPN A;  4N9L A;  3VOZ A;  2P04 A;  3A0R A;  2V8F A;  3E98 A;  1V9Y A;  2PR6 A;  1OTA A;  1BLS A;  1XX2 A;  3NCK A;  5EM0 A;  1CF0 A;  4KG5 A;  1K6R A;  4Y0U A;  3BLM A;  4BD1 A;  4HNB A;  3QP6 A;  1D1J A;  1JVJ A;  2V0W A;  4Y15 A;  5HWW A;  3TG9 A;  5IHV A;  5DJT A;  1FQG A;  1JNU A;  3VOL A;  3IBR A;  2ZM2 A;  3SW1 A;  3H7W B;  2XSS A;  4DRT A;  4Q0H A;  4PM9 A;  3Q07 A;  4JLF A;  3KYQ A;  1UGU A;  1FSY A;  4OQG A;  4S2L A;  2G2W A;  3E2L A;  5J3W A;  2E8J A;  3SOI A;  3GTC A;  3QP1 A;  4EET B;  5JYO A;  4Z1W A;  1F98 A;  5FA7 A;  3LR5 A;  3PAE A;  1CJF A;  3UDX A;  4L0L A;  1E3U A;  4C3Q A;  3OBF A;  3N8R A;  5TFQ A;  1IEL A;  1YM1 A;  2EXA A;  3NHQ A;  4WUJ A;  2HZ5 A;  4O0P A;  4LV3 A;  4NEE D;  2J80 A;  4HEF A;  4JGR A;  4EXO A;  3RXX A;  2B18 A;  2XR0 A;  3R4K A;  1L0F A;  3WS1 A;  3T1S A;  3B33 A;  2ZQA A;  2HGV A;  2V20 A;  2DNS A;  1KE3 A;  4Y3I A;  3ITB A;  3KYZ A;  3K3C A;  4BL3 A;  2PU2 A;  3T12 B;  4HOI A;  2VKS A;  3DTE A;  5EOO A;  3HCY A;  1ERQ A;  3JVU A;  5FAO A;  5A8B A;  2ZC4 B;  3BQA A;  4GB7 A;  4OP8 A;  3UB9 A;  1P97 A;  3E4O A;  3LR3 A;  1YSP A;  4RA7 A;  2BTF P;  2Y2P A;  2QKP A;  4OPY A;  1YLJ A;  4M3K A;  5F83 A;  3PR6 A;  2FZ0 A;  4HHD A;  3UB7 A;  4F3L A;  3T1X A;  3UB8 A;  4OLD A;  3ISG A;  5KSH A;  4JKT A;  4PM8 A;  5HFO A;  4KG2 A;  1BSG A;  3KYE A;  2VGL M;  2JN7 A;  2A24 A;  4BLM A;  1XA1 A;  5HAQ A;  3SZT A;  5CXW A;  3WRT A;  3MZF A;  3PXP A;  2ZLY A;  4KZ7 A;  3N7W A;  3T1Q B;  1VB6 A;  3TSG A;  3ZG9 B;  4EER A;  2XK1 A;  1CK3 A;  4ARZ A;  5CER A;  1E3U D;  3F1N B;  1LSV A;  3K2N A;  3OLO A;  4JXW A;  3CHW P;  3KX0 X;  2QWS A;  3P09 A;  3OPR A;  3T4T A;  1FIL A;  4WBG A;  2E8I A;  2W3E A;  2JKR M;  4EEU A;  2JC7 A;  3PBT A;  3AGD A;  4E3N A;  4PM5 A;  3WS2 A;  1KGG A;  1YPR A;  4E3J A;  3ZNT A;  3OPP A;  2XEP A;  5GLA A;  3O3V A;  2QYB A;  3RXW A;  4YWZ A;  3BY8 A;  2Y55 A;  2ZM0 A;  4YIN A;  1KDS A;  3O5Y A;  2WKE A;  3LO7 A;  4C6Y A;  3DTK A;  1J3W A;  3M2K A;  1H8Z A;  4MNR A;  1OTB A;  2EFU A;  4HQA A;  3ZG8 B;  2VV7 A;  3SS4 A;  1MY8 A;  2Z2M B;  3V50 A;  3BY9 A;  1IYP A;  4WM9 A;  3T4Q A;  4ZJ2 A;  4C75 A;  4FSF A;  2ZOI A;  3TE8 A;  1TVF A;  1N4O A;  3IXD A;  1JWV A;  4LLO B;  4DN0 A;  5CED A;  1DRM A;  2QJ7 A;  4DXB A;  4EUV A;  1O7E A;  1XXM A;  4LFU A;  3MKE A;  3ZFZ A;  5AQB A;  1SZV A;  1DJC A;  3V67 A;  2W3F A;  4HBT A;  1H8M A;  4X1L A;  4I3A A;  3IX4 A;  3MQ0 A;  3Q7V A;  2V1A A;  5HDS A;  4DE3 A;  2WGV A;  1ALQ A;  3UME A;  1DP8 A;  5G18 A;  2WKP A;  4WN5 A;  5F69 A;  3IXH A;  5CGX A;  2ZL1 B;  5KZH A;  4IED A;  3ZVT A;  2HDQ A;  3R7W A;  3GSG A;  1DY6 A;  4OQH A;  3FPW A;  4S2J A;  2M7V A;  1STZ A;  3EQU A;  1MZU A;  2J3W A;  3DBA A;  3DWK A;  2YKH A;  2ZQ9 A;  2WGI A;  3V3S A;  5CGS A;  2Y4A A;  4HY8 A;  4ZRR A;  3C4O A;  4LCL A;  2EX9 A;  2H28 A;  3IQA A;  1T1C A;  2V1Z A;  1BLH A;  4K0X A;  1G6A A;  3OOV A;  4NK3 A;  3QNC A;  3MZD A;  4GCZ A;  5BOH A;  2WKQ A;  1TDL A;  4P0M A;  1ES4 A;  4R1G A;  4UA6 A;  1TS8 A;  3TJZ C;  2A3U A;  5E2H A;  4I38 A;  3KSF A;  3PBN A;  4DJ2 A;  3P7N A;  2JBF A;  2OLV A;  2ZC5 B;  5A92 A;  3O87 A;  5FDH A;  4GOG A;  2WK0 A;  1ES3 A;  4WEJ A;  3B42 A;  2W3G A;  3H9W A;  1TF1 A;  4GJ4 A;  1W63 M;  5HD3 A;  2LB9 A;  3IXG A;  4CLC D;  3ZG5 A;  2ACG A;  4OPZ A;  2VJW A;  5HD5 A;  1F9I A;  3D9Y A;  1AXB A;  1J9M A;  1GA0 A;  3QP8 A;  4ESP A;  4OP5 A;  3LEQ A;  5MC7 A;  2GJ3 A;  2ZQ8 A;  5EVI B;  5KIZ A;  4B93 A;  4K08 A;  4B4X A;  1DJB A;  3PHY A;  4CPK A;  3UE3 A;  4JF4 A;  5M18 A;  4LRZ E;  4MBH A;  2EX2 A;  2M1C A;  1KVL A;  4Q0I A;  2KDK A;  5TJJ A;  2ZQ7 A;  3HLG A;  3DTM A;  1ONH A;  1W8Y A;  3UPO A;  3LR0 A;  3C38 A;  4RX3 A;  5KMW A;  4NG2 A;  5EVI C;  3PAG A;  2EA9 A;  3UDF A;  5HWV A;  2X02 A;  1DP9 A;  5FDS A;  4WF0 A;  5CX7 A;  2D01 A;  5TBM A;  3NDE A;  4IBX A;  1T19 A;  1YSQ A;  1OT9 A;  4BEN A;  1TS7 A;  3ZYT A;  1SDE A;  1TEM A;  2A24 B;  1HVB A;  1XGI A;  1YKD A;  1DP6 A;  3HVF A;  1MXO A;  4MMN A;  2G2U A;  4N92 A;  3WWX A;  3TRC A;  4OLG A;  2PR5 A;  2PRF A;  4NXE A;  2P9V B;  2ZC3 B;  3OCL A;  5F6A A;  2H5S A;  4Y17 A;  4ZDX A;  2J9O A;  3GVB A;  5GLD A;  1FCN A;  1WE4 A;  2PHY A;  2W1R A;  3A3J A;  2XF3 A;  3FPV A;  1NY0 A;  2VLG A;  3G34 A;  4D60 A;  5CHM A;  2W1T A;  2LB5 A;  3BEB A;  3TOI A;  4CLC B;  4JXV A;  2DMW A;  3IHB A;  3EQV A;  5HZH A;  5FL3 A;  4HJ3 A;  3NEC A;  1I2S A;  5EEC A;  4KUO A;  1WA9 A;  4GLQ A;  3T4K A;  4B88 A;  1W5D A;  4RX2 A;  1O07 A;  3S1Y A;  2Y2H A;  1CEF A;  2UWX A;  2Y2G A;  1U60 A;  5L2F A;  3V39 A;  2BLS A;  3D4F A;  1K4E A;  1LT0 A;  2H0T A;  4BBU A;  2XQZ A;  2H10 A;  5FQI A;  4X6T A;  3BEC A;  4DE0 A;  4X55 A;  3P98 A;  4UEY A;  2P7J A;  3V5M A;  3VMA A;  1MBL A;  2WGW A;  4U3T A;  1BLP A;  4S2I A;  2WGW B;  3MQO A;  3VP1 A;  5GLC A;  4EQ1 A;  2EX8 A;  1HLU P;  5AJG A;  3OC2 A;  4GN2 A;  2ZQC A;  3G32 A;  2KLI A;  1ZG4 A;  4S2P A;  5EPH A;  4BJP A;  3VE4 A;  3C5A A;  3FKW A;  3Q1F A;  3LIC A;  1UWN X;  2EFX A;  1KGF A;  4MBK A;  4P6B A;  3JPU A;  3IF6 A;  2UV0 E;  2V9A A;  3KSI A;  3G31 A;  2QZ6 A;  2VA0 A;  2QPN A;  1YLZ A;  4KZ8 A;  3NDG A;  1RGY A;  1OTE A;  5A91 A;  5GHZ A;  3T4S A;  2PD7 A;  5DTK A;  2DRW A;  1LL9 A;  2XFT A;  2HDU A;  3N8L A;  1XJ3 A;  2B02 A;  3H82 B;  5AQ7 A;  1XPB A;  3JYI A;  3ZG0 A;  4L9G A;  4GS9 B;  4E3I A;  1SHV A;  3ZHH A;  4QJG A;  1IYS A;  3FV7 A;  1OJG A;  2OSU A;  1TS6 A;  1FSW A;  3LYX A;  4RYE A;  5EV0 A;  3F1O B;  2GX5 A;  2PBD P;  3F1O A;  1K56 A;  4R3J A;  2R9X A;  3LI9 A;  1Z6F A;  4N1H A;  1VQQ A;  5D3O A;  1YLY A;  3QP4 A;  3UB6 A;  3FC7 A;  3BFG A;  4B4Z A;  4LGW A;  2PAV P;  2VGL S;  4HP9 A;  3IBJ A;  2Y8H A;  3L9K A;  1VET A;  4MBF A;  5TR7 A;  2ZOH A;  3S22 A;  1PNE A;  3OZH A;  4KZ3 A;  4BL2 A;  5CTM A;  3P01 A;  2ZMV A;  3T4J A;  3VE3 A;  3MJQ A;  4KZA A;  3RJU A;  2JKT I;  2J7V A;  5F5Y A;  4G3K A;  3Q81 A;  4HES A;  3LUQ A;  4FCF A;  5L07 A;  2XRN A;  2EXB A;  1PWG A;  1N9B A;  3BFD A;  1PWD A;  1FIK A;  1VEU B;  4IUK A;  4ETZ A;  1VEU A;  3LGO A;  4O7D A;  1BUE A;  4S2M A;  3PBS A;  4CJN A;  4QY6 A;  5FAS A;  1K4F A;  3W4P A;  4LV2 A;  1LLB A;  4S2K A;  5AQ9 A;  1W7F A;  3IX3 A;  1UWP X;  1VHM A;  4DKI A;  3CPT B;  1ONG A;  1SKF A;  3CPT A;  3IH9 A;  3BW6 A;  5J7E A;  2HF6 A;  4OOY A;  1ERO A;  3IHA A;  5FAP A;  4EES A;  1N9N A;  4HJ6 A;  2PT7 A;  3WS4 A;  5DVA A;  1T1A A;  3JVV A;  4IVI A;  1LSW A;  1YMX A;  3KSH A;  4CLC C;  4X69 A;  3IWI A;  3MS6 A;  3E4P A;  4EBL A;  1GHI A;  3HRE A;  4Z9Q A;  3S4X A;  3TW8 A;  2HDS A;  1K55 A;  1MKM A;  3CI6 A;  3BFC A;  3OPL A;  2FFY A;  4KQQ A;  3GR2 A;  3DTI A;  3HJI A;  1XFQ A;  5L8M A;  2R78 A;  3U2A A;  2PU4 A;  4ID4 A;  1NRJ A;  4LPZ A;  2OV5 A;  4DE1 A;  2GNX A;  2V1B A;  4PKY G;  3C7V A;  2Y2K A;  3EEA A;  4R4R A;  3NIA A;  1NWZ A;  4MLL A;  1SDN A;  1ZG6 A;  1XA7 A;  3G2Y A;  1FR1 A;  5DFX A;  2O9B A;  2ZMF A;  1ZTU A;  5FQM A;  2NUP C;  3S7Q A;  4KZ9 A;  1E25 A;  1M6K A;  1RP5 A;  3BFE A;  4GZB A;  4R38 A;  3A3I A;  3UO9 A;  5DTT A;  4F3L B;  5DF9 A;  4P85 A;  2HPB A;  5G4Y A;  4E6X A;  4X53 A;  2Y2L A;  4JGO A;  2QMI A;  2PYR A;  3CUE C;  4BWI A;  1S66 L;  1NLZ A;  3NBL A;  3LIE A;  3VV4 A;  3HLC A;  3EGX C;  3HLE A;  1FR6 A;  3BQ8 A;  1ZHH B;  5DJU A;  2QJ5 A;  1Y4O A;  2FH5 A;  3FYZ A;  5GHX A;  3LI8 A;  1P0Z A;  4DDY A;  4GKU A;  1SKO B;  4E6W A;  4EUZ A;  2VX8 A;  2Y59 A;  3BFF A;  4GHI B;  3G6O A;  1NZO A;  4MCW A;  3HLD A;  4OQ0 A;  4NET A;  5A90 A;  3DAV A;  2J9P A;  2VZW A;  3GV9 A;  3F1P B;  2X71 A;  1SCW A;  4KQR A;  1TS0 A;  4WEL A;  1PW1 A;  3PYP A;  4MN6 A;  3F1N A;  4D2O A;  5HL1 A;  1ES5 A;  3VP3 A;  1WYB A;  3NI9 A;  3G35 A;  4KZ6 A;  2L1M A;  4JXS A;  4XXR A;  1I2W A;  4X56 A;  1XFN A;  5CEC A;  5HDD A;  1KOU A;  2JCH A;  2Z6C A;  2MJ6 A;  1NJ4 A;  3T4O A;  4E3L A;  5EM1 A;  4FTX A;  4JGP A;  2NUT C;  2JKR I;  1K38 A;  4ETX A;  1AWI A;  1HZO A;  3HUM A;  1BUL A;  4HH3 A;  1WYC A;  3G30 A;  4OPQ A;  2VGJ A;  2OAQ 1;  2Y2M A;  4DXC A;  3ZDJ A;  1Y54 A;  2V0U A;  2W27 A;  1L0E A;  4GW9 A;  2D02 A;  2V8C A;  2O9A A;  1S1Z A;  3E0Y A;  4LCM A;  4NXF A;  2ZD8 A;  1TDG A;  1PZP A;  3LY3 A;  5F68 A;  1KVM A;  2JKF A;  2W0N A;  2VV8 A;  4WYY A;  4X25 A;  3A3D A;  4E3M A;  1IFQ A;  1F2K A;  3PBQ A;  5A93 A;  4X1M A;  4LRY C;  2IWC A;  4ME4 A;  3G4P A;  3HUN A;  5FSR A;  4XUX A;  4PM6 A;  1E4D A;  2P74 A;  3MF0 A;  1L2S A;  3IF6 C;  2CMN A;  2Q0O A;  3HLW A;  4GS9 A;  5M19 A;  3O86 A;  4EBP A;  2IWB A;  1IEM A;  3QP2 A;  2CC1 A;  4FH4 A;  5FAQ A;  5C5K A;  4EBN A;  5EFW A;  3VP2 A;  1MC0 A;  3UN7 A;  3UMD A;  3BRM A;  1KDW A;  2OWH A;  2BG1 A;  2OWJ A;  4WZ4 A;  2W3D A;  4ZTK A;  1QMF A;  2Y2Q A;  4Y0T A;  3MQQ A;  1LI9 A;  4OKP A;  4DF6 A;  1XJ2 A;  1IKG A;  2OOL A;  3VOY A;  5J8X A;  4H6J A;  3SH8 A;  2B5R A;  3EEH A;  4RQ9 A;  3PBR A;  1G5U A;  2OLU A;  1YLW A;  3NOU C;  1N9L A;  3BWL A;  3AGE A;  1MWU A;  1ES2 A;  3MMH A;  1FCM A;  4U0T A;  1NRF A;  3UPP A;  4II7 A;  3N8S A;  4JPM A;  4R70 A;  1VM1 A;  1MPL A;  1XJ6 A;  3L7H A;  4F94 A;  3KO6 A;  1L3L A;  3Q7V B;  1K55 C;  5FEG A;  1W79 A;  5HAR A;  4ZJ1 A;  4QY5 A;  3AGF A;  3S7N A;  3C30 A;  3ZG7 B;  4KUK A;  4O8G A;  1L0G A;  5U47 A;  2Q9N A;  4BD0 A;  3UDI A;  3LIB A;  1ERM A;  3EWK A;  4QHC A;  4BMW A;  2ZL1 A;  1X0O A;  1CQA A;  3IWO A;  5EUA A;  2HJE A;  3R7W B;  1S0W A;  4PPR A;  1GHM A;  4ZAM A;  4JXG A;  3LR4 A;  4I39 A;  1CEG A;  5FQ9 A;  5DTS A;  2XGN A;  5E2E A;  5IS1 A;  3LY4 A;  3T1R A;  4IUH A;  2HP5 A;  2GZA A;  4BBT A;  3QNB A;  1DJA A;  1K54 C;  4Y5F A;  3MZE A;  4HJ4 A;  4N9K A;  1BZA A;  5GL9 A;  3BLS A;  5EVI D;  2XH9 A;  3MKF A;  1V9Z A;  1Q2P A;  1GSX A;  3VSK A;  5IT5 A;  5EVL A;  3H7W A;  1NXY A; 
#chains in the Genus database with same CATH homology
 1F5M A;  3C2W A;  5HPF A;  2PYP A;  2ZOH A;  3PBO A;  4WEK A;  4B9O A;  3B47 A;  3CLO A;  1OTB A;  4HQA A;  3P01 A;  3LIA A;  2ZMV A;  4NXG A;  2VV7 A;  3T4J A;  3VE3 A;  3MJQ A;  4OOM A;  2JKT I;  5AVF A;  3BY9 A;  4R6L A;  5HSQ A;  2J3T D;  2O0Y A;  5F5Y A;  3T4Q A;  3W2Z A;  3ZQ5 A;  1H3Q A;  4FSF A;  2WKR A;  4G3K A;  3RH8 B;  4JGQ A;  2ZOI A;  3TE8 A;  4E04 A;  4P6Z M;  3LUQ A;  2XRN A;  4LLO B;  2I9V A;  4DN0 A;  1DRM A;  2QJ7 A;  3IS2 A;  3NOP C;  3IS2 B;  3MXQ A;  4IUK A;  4ETZ A;  4EUV A;  4Q0J A;  4L9E A;  4GHI A;  1S4S A;  3PBS A;  5DKK A;  4HIA A;  2L0W A;  2BAS A;  2Y79 A;  1BYW A;  2EWW A;  3V67 A;  2W3F A;  3RTY A;  5G4Z A;  1H8M A;  2HJ9 C;  5DFY A;  4I3A A;  4WLA A;  1EW0 A;  1G28 A;  3MQ0 A;  1UWP X;  1VHM A;  2OAP 1;  4LRX C;  4UQI M;  1W63 Q;  4Y2F A;  2V1A A;  5HDS A;  5IU1 A;  3S7P A;  2KX6 A;  3BW6 A;  3UME A;  5J7E A;  1DP8 A;  2HF6 A;  1OTI A;  3LID A;  3ULF A;  4HH2 A;  3CIT A;  2WKP A;  3T50 A;  5J4E A;  4WN5 A;  4EES A;  4O01 A;  4ARZ B;  1ODV A;  3NOT C;  3CUE A;  3RFB A;  1N9N A;  4HJ6 A;  3D72 A;  5F69 A;  2PT7 A;  1T1A A;  4YNR A;  2VEA A;  3JVV A;  1LSW A;  3KSH A;  4CLC C;  2P08 A;  4R3A A;  3R7W A;  1N9O A;  3H82 A;  3E4P A;  3LFV A;  3FPW A;  3HJK A;  3TW8 A;  3CI6 A;  1STZ A;  1MKM A;  3EQU A;  2M7V A;  1MZU A;  4PKY A;  4I3J A;  2J3W A;  3DBA A;  2YKH A;  3HJI A;  3K3D A;  4G3V A;  1XFQ A;  5L8M A;  2R78 A;  3U2A A;  3EGD C;  3E4Q A;  2HV1 A;  1IOU A;  4HY8 A;  4ZRR A;  1NRJ A;  4LPZ A;  5DKL A;  1OT6 A;  2H28 A;  2GNX A;  2V1B A;  4PKY G;  3EEA A;  4HP4 A;  1T1C A;  5AVE A;  4G3W A;  1NWZ A;  3BJN A;  2VV6 A;  4EU0 A;  3OOV A;  5DFX A;  4M4X A;  4MN5 A;  2O99 A;  2O9B A;  3CWF A;  4P6Z S;  2J3T C;  2ZMF A;  1ZTU A;  4QPR A;  2NUP C;  4GCZ A;  3CAX A;  5HDC A;  3S7Q A;  4EW7 A;  2WKQ A;  3MR0 A;  4IHQ A;  4R38 A;  3GEC A;  4F3L B;  5DF9 A;  5G4Y A;  1TS8 A;  3TJZ C;  4JGO A;  1XJ4 A;  4HI4 A;  3EOI A;  2A2L A;  2PYR A;  3CUE C;  4BWI A;  1S66 L;  2Z6D A;  1NLZ A;  4I38 A;  1T18 A;  3KSF A;  3LIE A;  3PBN A;  3VV4 A;  4DJ2 A;  3P7N A;  3EGX C;  2ZBB A;  3A0S A;  3BQ8 A;  1ZHH B;  4OOL A;  2M7U A;  1LL8 A;  5DJU A;  2QJ5 A;  2FH5 A;  1P9W A;  2PDR A;  2K31 A;  4XT2 A;  3LI8 A;  4WEJ A;  3B42 A;  4XT2 B;  1P0Z A;  2W3G A;  3H9W A;  1TF1 A;  4GJ4 A;  1W63 M;  2VX8 A;  5HPI A;  4KQD A;  4GHI B;  3G6O A;  4MCW A;  5HD3 A;  5HL6 A;  3KSG A;  2LB9 A;  1OPX A;  4CLC D;  3C8C A;  3LIF A;  2PD8 A;  2VJW A;  2VZW A;  3F1P B;  5HD5 A;  3FG8 A;  1F9I A;  2O9C A;  1S4R A;  1TS0 A;  4WEL A;  3PYP A;  4MN6 A;  4PAU A;  3F1N A;  1LSX A;  4YOF A;  4DJ3 A;  2XRO A;  5MC7 A;  2INW A;  2GJ3 A;  3S7O A;  5KIZ A;  2L1M A;  2P04 A;  4B93 A;  1OJ5 A;  3MFX A;  3A0R A;  4K08 A;  3E98 A;  1V9Y A;  2PR6 A;  1OTA A;  4MN7 A;  2G7U A;  1XFN A;  3PHY A;  2W3H A;  5HDD A;  3UE3 A;  1KOU A;  4MDZ A;  4LRZ E;  2Z6C A;  2MJ6 A;  2M1C A;  3T4O A;  4Q0I A;  4HNB A;  2KDK A;  4JGP A;  5TJJ A;  2K7S A;  2NUT C;  3GDI A;  2JKR I;  2V0W A;  2JHE A;  5HWW A;  3LR0 A;  3C38 A;  2YKF A;  1G6O A;  5DJT A;  1JNU A;  1GSV A;  4H6J B;  2EA9 A;  3VOL A;  3IBR A;  4DMZ A;  4ETX A;  5HWV A;  1DP9 A;  3D3O A;  3T4L A;  4HH3 A;  4WF0 A;  2EWV A;  5CX7 A;  2D01 A;  3SW1 A;  4FOF A;  3H7W B;  5TBM A;  2XSS A;  3OCN A;  4Q0H A;  5K5B A;  1T19 A;  1YSQ A;  1OT9 A;  2OAQ 1;  1TS7 A;  3ZYT A;  3KYQ A;  1UGU A;  2A24 B;  1YKD A;  2V0U A;  2W27 A;  5J3W A;  1DP6 A;  4GW9 A;  1YAX A;  2QHK A;  2IA2 A;  2D02 A;  4MMN A;  2O9A A;  1S1Z A;  3E0Y A;  4CLC E;  4NXF A;  4EET B;  3TRC A;  4Z1W A;  1F98 A;  2PR5 A;  4NXE A;  3LR5 A;  5F68 A;  3OCL A;  5F6A A;  4L0L A;  3OBF A;  2W0N A;  2PHY A;  2VV8 A;  2W1R A;  3FPV A;  2VLG A;  1P9R A;  1D06 A;  3NHQ A;  1IFQ A;  2W1T A;  2LB5 A;  3PBQ A;  4WUJ A;  4LRY C;  4CLC B;  4O0P A;  2DMW A;  4ME4 A;  4NEE D;  4NKP A;  2J80 A;  4JGR A;  4EXO A;  3EQV A;  3MF0 A;  2B18 A;  3R4K A;  5HZH A;  5FL3 A;  3B33 A;  4HJ3 A;  2CMN A;  4GS9 A;  2HGV A;  3ICY A;  1OTD A;  4KUO A;  1WA9 A;  4Y3I A;  4GLQ A;  3T4K A;  4EEP A;  1D7E A;  3KYZ A;  3K3C A;  4HOI A;  2VKS A;  5C5K A;  2XA7 S;  3HCY A;  3JVU A;  5EFW A;  5A8B A;  1MC0 A;  4PHT A;  3BQA A;  1LT0 A;  3UMD A;  4BBU A;  3UB9 A;  2OWH A;  2OWJ A;  2XA7 M;  1P97 A;  3E4O A;  2W3D A;  3LR3 A;  1YSP A;  2QKP A;  4WL9 A;  4UEY A;  2P7J A;  3PR6 A;  2FZ0 A;  4HHD A;  3MQQ A;  3UB7 A;  4F3L A;  3MQO A;  1XJ2 A;  2OOL A;  4I5S A;  3UB8 A;  4H6J A;  4EQ1 A;  3EEH A;  4RQ9 A;  3PBR A;  1S67 L;  5AJG A;  3OC2 A;  5KSH A;  3NOU C;  1N9L A;  3BWL A;  4AFI A;  4BBV A;  3MMH A;  3UE6 A;  4II7 A;  2KLI A;  4R70 A;  1XJ6 A;  2VGL M;  4BJP A;  1S1Y A;  3VE4 A;  2JN7 A;  2A24 A;  2L4R A;  3LIC A;  1UWN X;  3KO6 A;  2KOI A;  1GSW A;  3PXP A;  2V9A A;  5HWT A;  4CQH A;  1VB6 A;  3KSI A;  3S7N A;  3C30 A;  4KUK A;  2VA0 A;  5TBM B;  4O8G A;  4EER A;  1OTE A;  4ARZ A;  3LIB A;  3A0V A;  3EWK A;  3T4S A;  4BMW A;  3F1N B;  2PD7 A;  2JKT M;  1X0O A;  1LSV A;  4NXB A;  3NJA A;  1NLY A;  3K2N A;  3OLO A;  1XJ3 A;  2HJE A;  3KX0 X;  2QWS A;  3R7W B;  2B02 A;  3H82 B;  3T4T A;  3LR4 A;  1TD5 A;  2K2N A;  4I39 A;  2W3E A;  2JKR M;  4EEU A;  3PBT A;  4L9G A;  4GS9 B;  5IS1 A;  5LBR A;  4IUH A;  1OJG A;  4IJG A;  2GZA A;  2W1T B;  1TS6 A;  1Y28 A;  3LYX A;  4KQO A;  4CLC A;  3F1O B;  2GX5 A;  4BBT A;  4UQI S;  3F1O A;  4Y5F A;  2QYB A;  3F1P A;  3LI9 A;  4HJ4 A;  4YWZ A;  4L9F A;  3BY8 A;  1T1B A;  3UB6 A;  1V9Z A;  3FC7 A;  4I3I A;  1GSX A;  2VGL S;  3O5Y A;  3IBJ A;  4HP9 A;  5I5L A;  5IT5 A;  2Y8H A;  3H7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...