2J9OA

Structure of pbp-a, l158e mutant
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
264
structure length
264
Chain Sequence
LPPERPLTNLQQQIQQLVSRQPNLTAGLYFFNLDSGASLNVGGDQVFPAASTIKFPILVAFFKAVDEGRVTLQERLTMRPDLIAPEAGTLQYQKPNSQYAALEVAELMITISDNTATNMIIDRLGGAAELNQQFQEWGLENTVINNPEPDMKGTNTTSPRDLATLMLKIGQGEILSPRSRDRLLDIMRRTVTNTLLPAGLGKGATIAHKTGDIGIVVGDAGMVDMPNGQRYVAAMMVKRPYNDPRGSELIRQVSRMVYQAFEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TLL2115 PROTEIN
publication title Structure of Pbp-A from Thermosynechococcus Elongatus, a Penicillin-Binding Protein Closely Related to Class a Beta-Lactamases.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Hydrolase
total genus 98
structure length 264
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2j9oA01
2P9VB 2WZXA 4QD4A 3VP0A 5L2FA 3ZG8B 5HAPA 1XGIA 3SS5A 1E4DA 3I7JA 4PM9A 2IWBA 3VSLA 3ZFZA 3VP1A 1HD8A 4E3LA 3NDEA 2DRWA 3V3SA 4XUZA 3SS3A 1U60A 1XX2A 3IWIA 4DRTA 5E2EA 2ZC5B 1DJAA 4R3BA 1JWVA 4YFMA 4S2LA 3RJUA 4FCFA 2XEPA 3A3JA 2CC1A 2EX8A 3SH7A 1ERQA 3S22A 3A3DA 4Z9QA 2EFXA 3M2KA 3QHYA 2ZM8A 1YQSA 1KE3A 2Y2QA 1YLYA 4LV0A 3IF5A 4RVAA 4OLDA 5E2GA 5FAPA 1RCJA 3IH9A 2ZC4B 1Z6FA 1KGFA 3AGEA 1BLPA 5FQIA 3B3XA 5G18A 3WRZA 4CJNA 1XGJA 2P74A 1FCNA 3BRMA 3Q7VB 4WZ5C 1RGZA 1BUEA 4K0XA 3MFDA 4GZBA 5DTTA 4R4RA 3UDFA 1BZAA 3CJMA 2DCFA 1WE4A 2ZQ7A 5DTSA 1ESIA 5HAQA 1EWZA 4N1XA 2G2UA 1K57A 3V39A 2EXBA 3E2KA 3C5AA 4PM5A 3LO7A 3DTMA 3ZDJA 1YMSA 1ERMA 4U0XA 1GHPA 1BSGA 5D3OA 4QU3A 2WYXA 4BJPA 4KQQA 2JE5A 4QJGA 3IXDA 5DF9A 1QMEA 4IVKA 1Q2PA 1K56D 1LHYA 4E6XA 4BL3A 5FQJA 4P87A 1KVLA 5JYOA 2UWXA 3W4OA 5A93A 5GHYA 2HDQA 3GSGA 3LEZA 5FI6A 1N9BA 2WK0A 4N9KA 5FDHA 1CI9A 3ZNYA 3VSKA 3BFDA 1PZOA 4JXVA 1RGYA 1E25A 2QZ6A 3C4PA 4WMCA 3O87A 4GN2A 3GVBA 3QNBA 4E3OA 1JTDA 3G31A 4KZ5A 2WGWA 4LCLA 3N7WA 2XR0A 1MWRA 3BM6A 3N8SA 3VP2A 2QMIA 4ZBEA 4B88A 1WYBA 2H0YA 3GTCA 3IXHA 3M2JA 2V20A 4S2OA 5EVIA 5DF7A 1BLCA 3D4FA 5GHZA 3HLEA 5DVAA 1BLHA 4R1GA 4GD6A 4MBFA 2EX2A 1DJCA 3FWLA 3NIAA 4LV2A 1FOFA 1W5DA 1YT4A 5CECA 4Q8IA 5F82A 5GHXA 3V50A 2Z2MB 1VQQA 5FI7A 3WS5A 2ZMAA 1JTGA 3IF6A 3G2YA 3P09A 2OV5A 3IT9A 2Y2MA 5KZHA 4DE2A 3V3RA 4E3MA 1K54C 1PI4A 1VM1A 2FFYA 4CPKA 1NRFA 4ID4A 3VFHA 4S2NA 3FYZA 4LV3A 3FKVA 3EQVA 2Y2PA 2V1ZA 2H5SA 4OPYA 3WS2A 3HUMA 4JXGA 4OLGA 3UE0A 3FZCA 4DXBA 4Y0TA 3PAEA 1K4FA 1BT5A 2V2FF 2JCHA 3PBTA 1MXOA 1TDGA 3TOIA 2Y2OA 5CEBA 2HP6A 4BENA 3GV9A 4EUZA 5DTKA 2Q9NA 2WGWB 1L0FA 4S2IA 5FAOA 3VP3A 5CHUA 4P0MA 3MXSA 4X55A 2EFUA 1BLSA 2PU4A 5HW3A 1ESUA 3IWQA 4IBRA 3N8RA 2X71A 4OPZA 5EVIB 3A3FA 3MKFA 1XA7A 2HP5A 3NCKA 2OLUA 1OMEA 2Y2GA 5CTNA 4ZJ2A 5EOEA 2A49A 4MNRA 4QB8A 4GD8A 4OVDA 4C3QA 3TG9A 3C7VA 4EBPA 2R9XA 2WGVA 4S2JA 1MWUA 1NZOA 4B4XA 4S2MA 5FAQA 4DDYA 4KQOA 4F94A 1CK3A 1LI9A 1E3UD 3BLSA 2FFFB 4UA9A 3IF6B 4IBXA 3PAGA 5HX9A 2XH9A 4MBKA 5CTMA 1FCOA 1J9MA 4U3TA 2ZJ9A 2JC7A 4KQRA 1NYMA 1MWSA 2WKIA 2ZC7A 4U0TA 4E6WA 4LENA 4NK3A 3MZDA 1PI5A 3NDGA 2GDNA 3IQAA 1ONGA 3CG5A 2Y91A 3ISGA 3Q81A 1YLTA 1NYYA 4MEZA 3FKWA 1IYPA 2Y2LA 5FI2A 1GA0A 4GDNA 4JXWA 1BULA 4PM8A 1Y54A 3LY3A 3PTEA 4P85A 4OP5A 1M6KA 5JYPA 1FSWA 1SDNA 1YLJA 2OSUA 2XK1A 3O3VA 1FR6A 2HP9A 2ZC6B 3BFCA 5AQAA 1SDEA 2WKEA 4UA6A 5M18A 1K55C 2ZQ9A 4KZ9A 4HEFA 1I5QA 2BG1A 5HFOA 5CERA 4K91A 4JKTA 3W4PA 3BECA 4HESA 5IHVA 4D2OA 1MKIA 2Y2IA 1IYSA 2I72A 3A3EA 4GNUA 1ES4A 1PYYA 1KGEA 4N92A 5CGXA 1G6AA 3VOZA 1I2WA 1AXBA 1ONHA 1ES2A 5GLBA 4O7DA 1CI8A 1XPBA 2PU2A 1CEFA 3ITAA 3QNCA 5M1AA 1KGGA 4EV4A 1FR1A 3DWKA 2WUQA 2J9PA 1S0WA 1K6SA 2A3UA 3AGFA 4C75A 4OOLA 5TR7A 2XQZA 2EX9A 3EQUA 1MY8A 5GLCA 5AQ7A 4R23A 4KG2A 2JBFA 2RCXA 3UDIA 1IELA 1NJ4A 5EOOA 3M6HA 5FQMA 1L2SA 1GCEA 4HBTA 5TGFA 3SH9A 4OP8A 4DE1A 3GMWA 1FSYA 4PM7A 1XA1A 4P6BA 4R4SA 4OQ0A 3HUOA 5EE8A 4BL2A 1HVBA 5E43A 3HLBA 3HUNA 5CGSA 4LV1A 3A3IA 1NZUA 2G2WA 4YINA 1XKZA 3BFGA 3MXRA 1K38A 3GQZA 3UO9A 4JXSA 3ZG5A 3BLMA 1ALQA 4IEDA 4KG5A 4E3JA 4NETA 3G32A 5EUAA 1MPLA 3VMAA 5CHMA 4KENB 2ZM2A 3OCLA 4BQMA 1JWPA 3UY6A 3ZVTA 4Y0OA 1YLWA 3HLGA 4DXCA 3N8LA 3GR2A 4WZ5A 3OCNA 3RXWA 3W4QA 3UPOA 4OONA 5FQKA 2H10A 1JVJA 2J9OA 2EXAA 3MBZA 3M6BA 4L0LA 5KMWA 4N1HA 1W7FA 4MLLA 3UE1A 2C5WB 3ZG0A 4QY5A 4DE3A 1K55A 3LY4A 2H0TA 1ZG4A 3IXBA 5U47A 1C3BA 4WEJA 4OH0A 2XDMA 4X6TA 1W8QA 2E8IA 1KVMA 3HBRA 2ZD8A 5KSCA 1PWDA 5EPHA 1KDSA 4KZAA 2WZZA 4QY6A 5FQ9A 4EBLA 4S2PA 1XP4A 3BFFA 1Q2QA 3SOIA 1K6RA 1DY6A 1O7EA 4GB7A 4OOMA 3ZG7B 4OPRA 4R0QA 3HL9A 5A91A 4RX3A 3FV7A 1CEGA 4BLMA 3PBSA 1I2SA 3ZCZA 1L0EA 1GA9A 1FQGA 4KZ7A 1TVFA 4R3JA 5GLAA 4WMCD 1K57C 3VOYA 1PZPA 1PWCA 4RX2A 3Q07A 4JLFA 1TEMA 4WYYA 1K25A 1HZOA 3E2LA 4OKPA 1PW8A 2XD5A 3O88A 2BLSA 4FSFA 4HBUA 3BFEA 1K56A 3OPLA 5FSRA 3OC2A 3UPNA 4B4ZA 5A92A 1QMFA 1EI5A 1LL9A 5EVID 3ITBA 4X69A 4GDBA 5GLDA 4OOYA 5F83A 3MZEA 4RYEA 1L0DA 2PBYA 4FD8A 4E3NA 3IXGA 4BD0A 5J8XA 5HAIA 3OZHA 4OPQA 4RA7A 1N4OA 3IH8A 5FASA 1MWTA 5M19A 5GL9A 1MBLA 3VP4A 4ZAMA 4KZBA 1NY0A 5CHJA 1IKIA 1K54A 1YLZA 5EECA 2WGIA 4JPMA 4OQIA 2XD1A 1YMXA 1ZC2A 4XUXA 2IWCA 1GHIA 2Y55A 3N6IA 2WAEA 5EVIC 5HARA 1IYOA 4JBFA 1KE4A 1LLBA 1RP5A 1BTLA 4DKIA 5CRFA 4E3KA 1PWGA 4KZ8A 4E3IA 2ZC3B 1ES5A 1EROA 3NY4A 4Y0UA 2X02A 3UNWA 2ZM0A 3PBRA 2EX6A 4KG6A 2XLNA 3IF6C 2XF3A 2ZLYA 3G2ZA 2IWDA 2ZQCA 4FH2A 4GOGA 3G35A 1YLPA 4A5RA 4KZ6A 3N4IA 1M40A 1L0GA 5AQ9A 3WS0A 2OLVA 1JWZA 3C4OA 3DWZA 3G4PA 3MKEA 1ES3A 3ZG9B 3IHAA 5CEDA 5BOHA 4IVIA 4DDSA 4S2NC 5FATA 3P98A 2J8YA 3VFFA 1XXMA 1TDLA 2Y59A 1H5XA 3JYIA 2Y4AA 3HREA 5F1GA 3C7UA 3HLDA 1W79A 4UA7A 4DE0A 1ZG6A 3SH8A 3OPHA 1LL5A 2ZQDA 4OQHA 3RXXA 3NBLA 4EQIA 4ZDXA 3WS1A 3CMZA 2RL3A 1IYQA 4PMAA 4EWFA 4LCMA 4ZJ1A 2HDRA 4WM9A 3PBOA 2XFSA 3G30A 1ZKJA 2Z2LB 1K4EA 4JF4A 3HLCA 4PM6A 5E2FA 2XGNA 1PW1A 3Q82A 3W8KA 5KSHA 3LCEA 3DW0A 4QHCA 5EVLA 4BD1A 3IHBA 4S2KA 2VGJA 1IKGA 2B5RA 2Y2NA 2WADA 3MZFA 4M3KA 3G34A 2P9VA 2C6WB 2WAFA 3UPPA 2XFTA 4MBHA 5CXWA 5A90A 2Y2KA 2VGKA 5E2HA 2X01A 4C6YA 4WBGA 1YM1A 2J7VA 2HDSA 4K0WA 2R9WA 3GRJA 4JF5A 4OQGA 1S6RA 4PPRA 3PBQA 1E3UA 1HTZA 5HL1A 3HLFA 4FH4A 1H8ZA 3OPRA 1SKFA 3IWOA 3BEBA 1KE0A 1W8YA 4Y7PA 3CZDA 2ZQAA 5FQQA 4GKUA 5FA7A 2QPNA 3HLWA 4X53A 3ZNTA 3SS4A 2Y2JA 4WZ4A 4KZ4A 1LI0A 1DJBA 3AGDA 3Q1FA 4DF6A 3OPPA 4X68A 3S1YA 5TFQA 3ZVWA 2HDUA 3Q7ZA 2Y2HA 3WS4A 1FCMA 1WYCA 1PIOA 3TSGA 3ZGAB 3WWXA 1SCWA 3HVFA 4ZJ3A 4KZ3A 3UDXA 4UAAA 3O86A 1IEMA 4WELA 3Q7VA 4WEKA 4XXRA 3S4XA 3UN7A 5I94A 3UE3A 5CGWA 1GHMA 3ZHHA 5DF8A 4JF6A 3NI9A 2WKHA 3BYDA 3PBNA 4X56A 3V5MA 2HPBA 1SHVA 5F1FA 1O07A 4ZTKA 4EBNA 4N9LA 2Q9MA 3WRTA 1H8YA 5AQBA 2ZQ8A 4H8RA 1NXYA 3NC8A 4UHUA 1KDWA 1G68A 2DNSA
chains in the Genus database with same CATH superfamily
4QD4A 4GJ4A 5HAPA 3SS5A 3I7JA 4X1MA 3W2ZA 5HPIA 4JGQA 1IOUA 4DRTA 2PYPA 3UMEA 3S22A 3A3DA 3M2KA 2Y2QA 4FOFA 5FAPA 3QP4A 3IH9A 1Z6FA 1KGFA 3AGEA 1BLPA 3QP2A 4WZ5C 3EGXC 3MFDA 5DTTA 3A0VA 4EU0A 5HZHA 2DCFA 3DAVA 4B93A 2EA9A 5G4YA 4CLCA 2W1TA 1YMSA 4U0XA 1XJ3A 4QJGA 4KQQA 3A0SA 5DF9A 4NEED 1K56D 1LHYA 3FPVA 4E6XA 5FQJA 2ZL1A 2PYRA 1D1JA 5JYOA 2PT7A 2ZOIA 5A93A 2HJEA 3GSGA 3LEZA 1CI9A 5TBMA 3VSKA 3MMHA 1RGYA 2QZ6A 3C4PA 4GN2A 4LCLA 3N8SA 3VP2A 3GTCA 3IXHA 1F5MA 3D4FA 5GHZA 4Y13A 3HJKA 4Y3IA 3FWLA 1FOFA 1TD5A 1YT4A 4Q8IA 2OV5A 3MXQA 2Y2MA 2Y8HA 3IX4A 4DE2A 5AVFA 4CLCB 2W1TB 4E3MA 1PI4A 1VM1A 2KOIA 4ID4A 3FYZA 3FKVA 2H5SA 2ZL1B 3UB7A 3WS2A 2WKRA 2O9AA 5TBMB 2JCHA 3PBTA 3B33A 2Y2OA 2Q9NA 3MXSA 3NHQA 4X55A 2EFUA 1ESUA 4OPZA 3NOTC 3A3FA 3MKFA 2YKHA 2Y2GA 2A49A 4MNRA 4QB8A 4EBPA 2R9XA 2WGVA 2BTFP 5FAQA 4F94A 4KQOA 5A8BA 2O99A 4WUJA 5L8MA 1W63M 2XH9A 1MWSA 1TF1A 3A0RA 3Q81A 4KQDA 1J3WA 4RQ9A 3LY3A 1M6KA 1YLJA 1D7EA 1FR6A 3BFCA 4UA6A 2ZQ9A 5HFOA 1I5QA 4JKTA 2FZ0A 5IHVA 2I72A 3A3EA 5CGXA 5EM0A 3VOZA 1XPBA 2PU2A 2QHKA 4UQIS 3DWKA 5TR7A 2XQZA 2EX9A 4FUWA 5GLCA 5J4EA 3S7NA 5J3WA 4IHQA 5EOOA 4DE1A 1L2SA 1GCEA 1S4RA 3GMWA 4R4SA 3LR5A 3HUNA 4LV1A 3F1PA 1XKZA 1OT9A 1UWNX 4IEDA 5EUAA 1MPLA 4KENB 1JWPA 5DKLA 4Y0OA 3HLGA 1T1AA 3UPOA 1FILA 5KMWA 4N1HA 3JVVA 4MLLA 3UE1A 3TE8A 5U47A 1ZG4A 3IXBA 2LB9A 4WEJA 1YPRA 4L9GA 2ZD8A 4HNBA 4QY6A 1XP4A 2XA7M 1K6RA 4GB7A 3ZG7B 5A91A 4BLMA 3PBSA 3CLOA 4BBVA 2I9VA 1GA9A 2KLIA 5GLAA 4WMCD 1K57C 3F1PB 5DJUA 1TEMA 4WYYA 1X0OA 3E2LA 1PW8A 3O88A 4HBUA 3BFEA 3OPLA 5A92A 4B4ZA 1LL9A 2KX6A 5EVID 4GDBA 5GLDA 4OOYA 1LSXA 3MZEA 4RYEA 1L0DA 3UB5P 5HWVA 4RA7A 2ZBBA 4BMWA 5FASA 3KYQA 1OPXA 4KZBA 3SZTA 1T1BA 5CHJA 1NLYA 1XJ6A 2WGIA 2W3HA 1NWZA 1YMXA 1GHIA 1P9RA 5EVIC 1IYOA 1LLBA 3S7PA 4DKIA 4E3KA 1PWGA 1ES5A 1EROA 2UV0E 3BQAA 2EX6A 3C8CA 4LRYC 4KZ6A 3K2NA 3WS0A 3MKEA 3IHAA 5BOHA 4DJ3A 3P98A 2J8YA 3VFFA 1H5XA 3ZYTA 4BBUA 3C7UA 1W79A 4UA7A 3SH8A 2V1BA 2ZQDA 3EEHA 2A24A 3R7WA 4EQIA 4ZDXA 2JN7A 4MN5A 4EWFA 2HDRA 1K4EA 1PW1A 1UGUA 4QHCA 5CX7A 5EVLA 4I38A 5AVEA 4M3KA 3G34A 2P9VA 3UB8A 2XFTA 2J7VA 2HDSA 4K0WA 4HH2A 2R9WA 3NOUC 1E3UA 5HL1A 4FH4A 3OPRA 3P7NA 1KE0A 4PKYG 5FQQA 4GKUA 3KSFA 4UEYA 3AGDA 3Q1FA 3CITA 2Y2HA 3WS4A 1WYCA 3TSGA 3ZGAB 2A24B 4YNRA 4R38A 4UAAA 3R7WB 4XXRA 5I94A 2NUTC 3UE3A 5CGWA 5DF8A 3V5MA 4DN0A 3FG8A 1SHVA 3IBRA 5F1FA 4ZTKA 4P6ZS 4N9LA 2Q9MA 2R78A 3CHWP 1NXYA 3NC8A 4UHUA 3NDEA 2DNSA 2P9VB 3VP0A 3CPTA 3VSLA 4R70A 5EV0A 3L9KA 3IWIA 1JWVA 3C38A 1GSXA 4Q0HA 3MR0A 3SH7A 4D60A 2EFXA 1YQSA 1KE3A 3PYPA 1CJFA 1D06A 3B3XA 4Y2FA 5DKKA 2YKFA 3ZQ5A 4R4RA 3CJMA 3MSHA 1ESIA 5HAQA 4EQ1A 3V39A 3E2KA 3ZDJA 1GHPA 4BJPA 3CPTB 2JE5A 3E4PA 2CMNA 3LIBA 4BL3A 4P87A 2W3DA 2D01A 3LI9A 5GHYA 3RTYA 4GCZA 5FDHA 1H0MA 3DTIA 3ZNYA 4I3AA 3GVBA 3QNBA 4E3OA 2XR0A 4R3AA 1YSPA 4B88A 3CWFA 3M2JA 5DF7A 1PFLA 3EGDC 4Q0IA 3HLEA 1BLHA 2Q0OA 4GD6A 2XRNA 1MKMA 1VEUA 4I5SA 3NIAA 5CECA 5F82A 5GHXA 3F1NA 2Z2MB 3G2YA 5TJJA 1K54C 1G5UA 4IUKA 3RH8B 4CPKA 3LIAA 4S2NA 5HL6A 3EQVA 5EFWA 2V1ZA 4OPYA 4OLGA 3PAEA 3VE4A 4I39A 5CEBA 4BENA 4EUZA 5DTKA 3KSIA 4HIAA 4IUHA 4BWIA 4MN6A 4P0MA 3LGOA 4K08A 1BLSA 3IWQA 4IBRA 1F9IA 5DFXA 2O9CA 5CTNA 4GD8A 1VEUB 3U2AA 3F1NB 1LI9A 3BLSA 2FFFB 3K3DA 4IBXA 2GZAA 2PRFA 1V9YA 2Z6DA 1J9MA 1TS0A 1NYMA 2WKIA 3NDGA 1BYWA 2GDNA 4YOFA 4MEZA 5L10A 4JXWA 4PM8A 3PTEA 1T18A 1OTDA 4WN5A 1S4SA 5JYPA 5A90A 3O3VA 1S1ZA 5EM1A 4ETZA 1N9LA 4KZ9A 4HEFA 2BG1A 3E98A 4HESA 3LI8A 4GNUA 4N92A 1G6AA 1ES2A 4BBTA 4O7DA 1CI8A 3QNCA 5M1AA 1KGGA 3MF0A 4EERA 3AGFA 2Y79A 1MY8A 4R23A 4KG2A 2JBFA 1TS6A 1NJ4A 5LBRA 5TGFA 3SH9A 3E4OA 4BL2A 1HVBA 5CGSA 3A3IA 1NZUA 4O0PA 4YINA 3BFGA 3ZG5A 1ALQA 4KG5A 4E3JA 2L1MA 3VMAA 5CHMA 4BQMA 4XT2A 2B18A 3DTEA 1UWPX 1P0ZA 3GR2A 4HOIA 3W4QA 2V0UA 5FQKA 4L0LA 2J3WA 5HDSA 4OH0A 1WA9A 2XDMA 4CLCD 3BW6A 1W8QA 1KVMA 4PKYA 1OTAA 3T4QA 2HJ9C 5KSCA 1KDSA 4KZAA 3LR4A 5FQ9A 4EBLA 3BJNA 1Q2QA 1DY6A 3BY8A 1O7EA 4OOMA 3VOLA 2V8CA 3HL9A 4R0QA 4RX3A 3FV7A 3ULFA 1EW0A 1L0EA 4E04A 3JVUA 1CQAA 4HJ4A 3UB9A 4CLCC 4JLFA 4NKPA 1K25A 4OKPA 3O5YA 2BLSA 4FSFA 4GW9A 4XT2B 5FSRA 1QMFA 4X69A 4G3VA 4LLOB 3IXGA 4I3IA 3OZHA 4OPQA 1MBLA 3T4LA 1NY0A 1IKIA 5F6AA 4JPMA 2PHYA 2QJ7A 4LGWA 5DFYA 1ZC2A 3N6IA 4LFUA 1BTLA 3S7OA 3IBJA 2ZC3B 2OWHA 3NY4A 1H3QA 4KG6A 2XF3A 2ZLYA 3G2ZA 3G35A 5DJTA 3TRCA 4A5RA 2W0NA 3N4IA 1HLUP 1L0GA 2OLVA 3DWZA 3G4PA 5FATA 4UQIM 1TDLA 2Y59A 2LB5A 2IA2A 3DTKA 3L7HA 4DE0A 4FTXA 2XSSA 2VZWA 3C2WA 3D72A 3CMZA 2RL3A 4PMAA 1PRQA 2VEAA 5HPFA 4WM9A 3MS6A 3PBOA 2XFSA 5IU1A 2Z2LB 4JF4A 5E2FA 4NG2A 5KSHA 2O0YA 2VGJA 4HJ3A 3QP8A 3NOPC 3MZFA 2C6WB 3UPPA 3U4LP 2VV6A 4C6YA 2JKRI 1YM1A 5IT5A 4JF5A 4PPRA 3F1OA 1HTZA 3CAXA 3NECA 1SKFA 3BEBA 4Y7PA 2ZQAA 1FIKA 4X53A 3SS4A 4WZ4A 1Y4OA 1LI0A 1DJBA 4DF6A 2DMWA 3S1YA 1CF0A 4I3JA 3LR0A 3Q7ZA 1FCMA 1PIOA 1SCWA 1XJ4A 3O86A 1OTIA 4WELA 4WEKA 3Q7VA 3CUEA 4MMNA 1GHMA 3BYDA 4X56A 4ARZA 3T1SA 1W63Q 2HPBA 4EBNA 4H6JA 5AQBA 2ZQ8A 1G68A 5L2FA 2OOLA 4PM9A 2IWBA 3LIEA 3VP1A 1JNUA 1HD8A 4E3LA 3BQ8A 3SS3A 1U60A 1XX2A 3F1OB 3T4TA 4L9EA 3OBFA 4S2LA 3A3JA 2EX8A 4AFIA 1ERQA 1OJGA 4Z9QA 3QHYA 4NXFA 2ZM8A 4F3LA 2P08A 4L9FA 1YLYA 3IF5A 4OLDA 3DBAA 2ZC4B 1VB6A 3D9YA 4LRXC 5G18A 4HI4A 3WRZA 4CJNA 1XGJA 3BRMA 1FCNA 1ODVA 3Q7VB 1RGZA 2VJWA 1DRMA 1WE4A 4ARZB 4HQAA 2VA0A 4H6JB 2EXBA 3C5AA 4PM5A 2H28A 2PR5A 1ERMA 5D3OA 4QU3A 1SKOA 2VLGA 1QMEA 4IVKA 1F98A 1YKDA 2UWXA 3W4OA 2JKRM 5FI6A 3LICA 1N9BA 2WK0A 1PZOA 4F3LB 2HV1A 3G31A 2WGWA 3N7WA 3BM6A 2QMIA 3KYZA 4ZBEA 1WYBA 1OJ5A 4R1GA 2QWSA 2J3TD 1DJCA 3KSGA 1W5DA 1VQQA 2JKTI 3WS5A 3IF6A 3IT9A 1SKOB 3VFHA 3T1QB 3T1XA 1VETA 3MQOA 4WF0A 3EOIA 2J3TC 3UE0A 3K3CA 1AWIA 1K4FA 2V2FF 2W1RA 1MXOA 1TDGA 3TOIA 4II7A 2HP6A 4HHDA 2WGWB 1PNEA 1L0FA 4S2IA 2PR6A 4EXOA 3N8RA 2X71A 2HP5A 3NCKA 1OMEA 4ZJ2A 2EWWA 5IS1A 3TG9A 1MWUA 1G6OA 1CK3A 1E3UD 1ACFA 4UA9A 3IF6B 3IS2A 5L09A 2ZJ9A 4KQRA 4U0TA 4NK3A 3MZDA 1G28A 1PI5A 4JGRA 3CG5A 4ETXA 3ISGA 1VETB 2QJ5A 1GA0A 1Y54A 1STZA 2OAP1 3C30A 1SDNA 2ZC6B 3QP6A 5AQAA 2WKEA 5M18A 1K55C 4NXBA 1YSQA 4K91A 5CERA 3MFXA 3BECA 4D2OA 2PDRA 2E8JA 1ES4A 2BASA 1KGEA 1I2WA 1AXBA 1ONHA 5GLBA 4EV4A 2KDKA 1FR1A 2WUQA 3T1RA 2J9PA 4C75A 1H8MA 1K6SA 2A3UA 2HF6A 3UDIA 3M6HA 5FQMA 4HBTA 1XJ2A 1Z09A 1FSYA 4P6BA 5KIZA 4OQ0A 3IS2B 2JKTM 5E43A 3HLBA 1K38A 3BLMA 3VE3A 3LEQA 3G32A 2A2LA 3B47A 3OCLA 3ZVTA 1YLWA 4WZ5A 3OCNA 3RXWA 4OONA 2H10A 2J9OA 3MBZA 3ZG0A 4QY5A 4DE3A 3LY4A 1C3BA 1K0KA 3HBRA 1L3LA 2GX5A 5G4ZA 3TJZC 2WZZA 5I5LA 3BFFA 3SOIA 2VGLS 3BWLA 1I2SA 3ZCZA 2W3EA 4KUKA 4KZ7A 1TVFA 4R3JA 3MQ0A 3PXPA 1PZPA 4RX2A 3LYXA 3Q07A 3R4KA 5HDCA 1K56A 2PD7A 3UPNA 3ITBA 5FEFA 2M7VA 4E3NA 4BD0A 5J8XA 1N4OA 3IH8A 1MWTA 5GL9A 2VKSA 3RFBA 4OQIA 2PBDP 4XUXA 2IWCA 4PHTA 2Y55A 5HD3A 2WAEA 5HARA 5CRFA 4KZ8A 4E3IA 1TS7A 4X1LA 4Y0UA 2X02A 1MZUA 3UNWA 2ZM0A 3PBRA 2VX8A 2FH5A 2XLNA 5FL3A 2IWDA 1VHMA 5HWWA 1M40A 3H9WA 5AQ9A 4X25A 3ZG9B 1ES3A 2V8FA 3QP5A 4IVIA 4DDSA 4S2NC 1XXMA 3NULA 3JYIA 2Y4AA 3HREA 2GJ3A 5C5KA 1LL5A 4OQHA 3RXXA 3WS1A 1IYQA 3HJIA 4LCMA 4ZJ1A 1DP8A 4Q0JA 3G30A 1ZKJA 3EEAA 4QPRA 3FC7A 2XGNA 3W8KA 3H7WA 3DW0A 3IHBA 4S2KA 4G3KA 4HH3A 1YAXA 2B95A 2WADA 2MJ6A 5CXWA 2K31A 5E2HA 2QKPA 2VGKA 2X01A 4WBGA 2W27A 3MQQA 5F68A 4ESPA 3HLFA 1H8ZA 2WKPA 3IWOA 1W8YA 5FEGA 2QPNA 4HP4A 1ZTUA 2Y2JA 1P97A 3LIDA 4MDZA 4X68A 5TFQA 3ZVWA 2HDUA 3T4KA 1MC0A 4ZJ3A 3UDXA 1IEMA 3ZHHA 4JF6A 4R6LA 3HCYA 3PBNA 4WL9A 5HWTA 3PR6A 3H7WB 1O07A 2V1AA 4ME4A 4O01A 3EWKA 4H8RA 2WZXA 3B42A 3ZG8B 1XGIA 3ZFZA 1E4DA 2B02A 2DRWA 3V3SA 4XUZA 4EEPA 2ACGA 4HP9A 4KUOA 5E2EA 2ZC5B 1DJAA 4R3BA 4M4XA 4YFMA 3RJUA 4FCFA 2XEPA 2CC1A 4HJ6A 1T19A 1OTEA 3SW1A 4PAUA 4LV0A 2WKQA 4RVAA 5E2GA 1RCJA 2D02A 1DP9A 2V0WA 4GS9A 5J7EA 1IFQA 5FQIA 1S1YA 2PD8A 2P74A 1ZHHB 3T4SA 1BUEA 4K0XA 4GZBA 3UDFA 1BZAA 4GLQA 3E0YA 2ZQ7A 2XROA 5DTSA 1EWZA 4N1XA 2G2UA 1K57A 3LO7A 3DTMA 1BSGA 2WYXA 2INWA 3IXDA 1TS8A 1GSVA 1Q2PA 2ZOHA 5AJGA 4EUVA 1KVLA 2G7UA 1XFNA 2HDQA 2M7UA 4N9KA 3BFDA 1S67L 4JXVA 4Z1WA 1E25A 4WMCA 3O87A 1JTDA 4KZ5A 1MWRA 4Y17A 4Y15A 3UMDA 4GS9B 2H0YA 2V20A 4S2OA 5EVIA 1BLCA 1SZVA 2Z6CA 5DVAA 3UE6A 2VV8A 4MBFA 2EX2A 2K2NA 4EEUA 4LV2A 4LPZA 2L0WA 3V50A 3KYEA 5FI7A 2VK3A 2ZMAA 1JTGA 3P09A 3OOVA 5KZHA 3V3RA 2FFYA 1NRFA 3IX8A 3MJQA 3H82A 4LV3A 2Y2PA 5HD5A 2XA7S 3HUMA 4JXGA 3FZCA 4DXBA 4Y0TA 1BT5A 3V67A 4EESA 3GV9A 3VP3A 5FAOA 5CHUA 3T4JA 2PU4A 5HW3A 3LIFA 5EVIB 1XA7A 2AVXA 2OLUA 5EOEA 4OVDA 4C3QA 3C7VA 4S2JA 1NZOA 1V9ZA 4B4XA 4S2MA 4DDYA 1GSWA 3IX3A 3KO6A 3PAGA 5HX9A 5CTMA 1FCOA 4G3WA 4U3TA 2JC7A 2ZC7A 3UB6A 4E6WA 4LENA 2V9AA 3LR3A 3IQAA 1ONGA 5K5BA 2Y91A 3H82B 1YLTA 1NYYA 5FI2A 3FKWA 1IYPA 2Y2LA 2OAQ1 4GDNA 1BULA 3T50A 4P85A 4OP5A 5F5YA 3CI6A 1FSWA 1NRJA 2XK1A 2OSUA 2HP9A 1OT6A 1SDEA 1LL8A 1NLZA 3W4PA 1MKIA 2Y2IA 1IYSA 1OTBA 1PYYA 4Y5FA 4EETB 1CEFA 3ITAA 4LRZE 3JPUA 1S0WA 2K7SA 4OOLA 3EQUA 5AQ7A 4O8GA 2RCXA 3CUEC 1IELA 2W3GA 3VV4A 4OP8A 2QYBA 4PM7A 1XA1A 3HUOA 5EE8A 2G2WA 4DJ2A 3MXRA 3ICYA 3UO9A 3GQZA 4JXSA 3TW8A 2HGVA 4NETA 3NJAA 2VV7A 2ZM2A 2P7JA 3D3OA 3UY6A 4DXCA 3N8LA 1JVJA 2EXAA 3M6BA 4B9OA 1W7FA 2C5WB 1S66L 1K55A 3P01A 2H0TA 3OLOA 4X6TA 2E8IA 5F69A 1PWDA 1XFQA 2P04A 5EPHA 4CQHA 4S2PA 4YWZA 4OPRA 4QWOA 1CEGA 4P6ZM 2ZMVA 1FQGA 1N9NA 2O9BA 3VOYA 1PWCA 4MN7A 5L07A 4ZRRA 4MCWA 1HZOA 2GNXA 3LUQA 2XD5A 4GHIA 3OC2A 1EI5A 4EW7A 2JHEA 5F83A 4CLCE 4FD8A 2PBYA 3FPWA 5HAIA 4DMZA 5M19A 2OWJA 4ZAMA 3VP4A 2J80A 4NXGA 1K54A 1YLZA 5EECA 2XD1A 3GECA 3T12B 2PAVP 2L4RA 5MC7A 4JBFA 1KE4A 1RP5A 4HY8A 1LT0A 2M1CA 1A0KA 3IF6C 4FH2A 2ZQCA 4GOGA 2JKGA 1YLPA 1JWZA 3C4OA 5CEDA 4NXEA 1KOUA 4GHIB 2W3FA 3T4OA 5F1GA 3G6OA 1LSVA 3HLDA 1ZG6A 3OPHA 3NBLA 2HZ5A 1DP6A 2EWVA 1T1CA 4JGPA 3HLCA 4PM6A 3Q82A 3LCEA 4BD1A 1IKGA 2B5RA 2Y2NA 3KSHA 2NUPC 4IJGA 2WAFA 4MBHA 1N9OA 2Y2KA 3GRJA 3GDIA 4OQGA 1S6RA 3PBQA 3KX0X 2JKFA 3CZDA 3S7QA 5FA7A 5FDSA 3HLWA 3ZNTA 2ZMFA 4KZ4A 5EVEA 3OPPA 1F2KA 3PHYA 5HDDA 4WLAA 5HSQA 1Y28A 3WWXA 3LFVA 3HVFA 4KZ3A 3S4XA 3UN7A 2VGLM 1P9WA 3NI9A 2WKHA 3BY9A 3E4QA 1H8YA 1LSWA 3WRTA 4JGOA 3QP1A 1KDWA 4MBKA
chains in the Genus database with same CATH topology
2P9VB 2WZXA 4QD4A 3VP0A 5L2FA 3ZG8B 5HAPA 1XGIA 3SS5A 1E4DA 3I7JA 4PM9A 2IWBA 3VSLA 3ZFZA 3VP1A 1HD8A 4E3LA 3NDEA 2DRWA 3V3SA 4XUZA 3SS3A 1U60A 1XX2A 3IWIA 4DRTA 5E2EA 2ZC5B 1DJAA 4R3BA 1JWVA 4YFMA 4S2LA 3RJUA 4FCFA 2XEPA 3A3JA 2CC1A 2EX8A 3SH7A 1ERQA 3S22A 3A3DA 4Z9QA 2EFXA 3M2KA 3QHYA 2ZM8A 1YQSA 1KE3A 2Y2QA 1YLYA 4LV0A 3IF5A 4RVAA 4OLDA 5E2GA 5FAPA 1RCJA 3IH9A 2ZC4B 1Z6FA 1KGFA 3AGEA 1BLPA 5FQIA 3B3XA 5G18A 3WRZA 4CJNA 1XGJA 2P74A 1FCNA 3BRMA 3Q7VB 4WZ5C 1RGZA 1BUEA 4K0XA 3MFDA 4GZBA 5DTTA 4R4RA 3UDFA 1BZAA 3CJMA 2DCFA 1WE4A 2ZQ7A 5DTSA 1ESIA 5HAQA 1EWZA 4N1XA 2G2UA 1K57A 3V39A 2EXBA 3E2KA 3C5AA 4PM5A 3LO7A 3DTMA 3ZDJA 1YMSA 1ERMA 4U0XA 1GHPA 1BSGA 5D3OA 4QU3A 2WYXA 4BJPA 4KQQA 2JE5A 4QJGA 3IXDA 5DF9A 1QMEA 4IVKA 1Q2PA 1K56D 1LHYA 4E6XA 4BL3A 5FQJA 4P87A 1KVLA 5JYOA 2UWXA 3W4OA 5A93A 5GHYA 2HDQA 3GSGA 3LEZA 5FI6A 1N9BA 2WK0A 4N9KA 5FDHA 1CI9A 3ZNYA 3VSKA 3BFDA 1PZOA 4JXVA 1RGYA 1E25A 2QZ6A 3C4PA 4WMCA 3O87A 4GN2A 3GVBA 3QNBA 4E3OA 1JTDA 3G31A 4KZ5A 2WGWA 4LCLA 3N7WA 2XR0A 1MWRA 3BM6A 3N8SA 3VP2A 2QMIA 4ZBEA 4B88A 1WYBA 2H0YA 3GTCA 3IXHA 3M2JA 2V20A 4S2OA 5EVIA 5DF7A 1BLCA 3D4FA 5GHZA 3HLEA 5DVAA 1BLHA 4R1GA 4GD6A 4MBFA 2EX2A 1DJCA 3FWLA 3NIAA 4LV2A 1FOFA 1W5DA 1YT4A 5CECA 4Q8IA 5F82A 5GHXA 3V50A 2Z2MB 1VQQA 5FI7A 3WS5A 2ZMAA 1JTGA 3IF6A 3G2YA 3P09A 2OV5A 3IT9A 2Y2MA 5KZHA 4DE2A 3V3RA 4E3MA 1K54C 1PI4A 1VM1A 2FFYA 4CPKA 1NRFA 4ID4A 3VFHA 4S2NA 3FYZA 4LV3A 3FKVA 3EQVA 2Y2PA 2V1ZA 2H5SA 4OPYA 3WS2A 3HUMA 4JXGA 4OLGA 3UE0A 3FZCA 4DXBA 4Y0TA 3PAEA 1K4FA 1BT5A 2V2FF 2JCHA 3PBTA 1MXOA 1TDGA 3TOIA 2Y2OA 5CEBA 2HP6A 4BENA 3GV9A 4EUZA 5DTKA 2Q9NA 2WGWB 1L0FA 4S2IA 5FAOA 3VP3A 5CHUA 4P0MA 3MXSA 4X55A 2EFUA 1BLSA 2PU4A 5HW3A 1ESUA 3IWQA 4IBRA 3N8RA 2X71A 4OPZA 5EVIB 3A3FA 3MKFA 1XA7A 2HP5A 3NCKA 2OLUA 1OMEA 2Y2GA 5CTNA 4ZJ2A 5EOEA 2A49A 4MNRA 4QB8A 4GD8A 4OVDA 4C3QA 3TG9A 3C7VA 4EBPA 2R9XA 2WGVA 4S2JA 1MWUA 1NZOA 4B4XA 4S2MA 5FAQA 4DDYA 4KQOA 4F94A 1CK3A 1LI9A 1E3UD 3BLSA 2FFFB 4UA9A 3IF6B 4IBXA 3PAGA 5HX9A 2XH9A 4MBKA 5CTMA 1FCOA 1J9MA 4U3TA 2ZJ9A 2JC7A 4KQRA 1NYMA 1MWSA 2WKIA 2ZC7A 4U0TA 4E6WA 4LENA 4NK3A 3MZDA 1PI5A 3NDGA 2GDNA 3IQAA 1ONGA 3CG5A 2Y91A 3ISGA 3Q81A 1YLTA 1NYYA 4MEZA 3FKWA 1IYPA 2Y2LA 5FI2A 1GA0A 4GDNA 4JXWA 1BULA 4PM8A 1Y54A 3LY3A 3PTEA 4P85A 4OP5A 1M6KA 5JYPA 1FSWA 1SDNA 1YLJA 2OSUA 2XK1A 3O3VA 1FR6A 2HP9A 2ZC6B 3BFCA 5AQAA 1SDEA 2WKEA 4UA6A 5M18A 1K55C 2ZQ9A 4KZ9A 4HEFA 1I5QA 2BG1A 5HFOA 5CERA 4K91A 4JKTA 3W4PA 3BECA 4HESA 5IHVA 4D2OA 1MKIA 2Y2IA 1IYSA 2I72A 3A3EA 4GNUA 1ES4A 1PYYA 1KGEA 4N92A 5CGXA 1G6AA 3VOZA 1I2WA 1AXBA 1ONHA 1ES2A 5GLBA 4O7DA 1CI8A 1XPBA 2PU2A 1CEFA 3ITAA 3QNCA 5M1AA 1KGGA 4EV4A 1FR1A 3DWKA 2WUQA 2J9PA 1S0WA 1K6SA 2A3UA 3AGFA 4C75A 4OOLA 5TR7A 2XQZA 2EX9A 3EQUA 1MY8A 5GLCA 5AQ7A 4R23A 4KG2A 2JBFA 2RCXA 3UDIA 1IELA 1NJ4A 5EOOA 3M6HA 5FQMA 1L2SA 1GCEA 4HBTA 5TGFA 3SH9A 4OP8A 4DE1A 3GMWA 1FSYA 4PM7A 1XA1A 4P6BA 4R4SA 4OQ0A 3HUOA 5EE8A 4BL2A 1HVBA 5E43A 3HLBA 3HUNA 5CGSA 4LV1A 3A3IA 1NZUA 2G2WA 4YINA 1XKZA 3BFGA 3MXRA 1K38A 3GQZA 3UO9A 4JXSA 3ZG5A 3BLMA 1ALQA 4IEDA 4KG5A 4E3JA 4NETA 3G32A 5EUAA 1MPLA 3VMAA 5CHMA 4KENB 2ZM2A 3OCLA 4BQMA 1JWPA 3UY6A 3ZVTA 4Y0OA 1YLWA 3HLGA 4DXCA 3N8LA 3GR2A 4WZ5A 3OCNA 3RXWA 3W4QA 3UPOA 4OONA 5FQKA 2H10A 1JVJA 2J9OA 2EXAA 3MBZA 3M6BA 4L0LA 5KMWA 4N1HA 1W7FA 4MLLA 3UE1A 2C5WB 3ZG0A 4QY5A 4DE3A 1K55A 3LY4A 2H0TA 1ZG4A 3IXBA 5U47A 1C3BA 4WEJA 4OH0A 2XDMA 4X6TA 1W8QA 2E8IA 1KVMA 3HBRA 2ZD8A 5KSCA 1PWDA 5EPHA 1KDSA 4KZAA 2WZZA 4QY6A 5FQ9A 4EBLA 4S2PA 1XP4A 3BFFA 1Q2QA 3SOIA 1K6RA 1DY6A 1O7EA 4GB7A 4OOMA 3ZG7B 4OPRA 4R0QA 3HL9A 5A91A 4RX3A 3FV7A 1CEGA 4BLMA 3PBSA 1I2SA 3ZCZA 1L0EA 1GA9A 1FQGA 4KZ7A 1TVFA 4R3JA 5GLAA 4WMCD 1K57C 3VOYA 1PZPA 1PWCA 4RX2A 3Q07A 4JLFA 1TEMA 4WYYA 1K25A 1HZOA 3E2LA 4OKPA 1PW8A 2XD5A 3O88A 2BLSA 4FSFA 4HBUA 3BFEA 1K56A 3OPLA 5FSRA 3OC2A 3UPNA 4B4ZA 5A92A 1QMFA 1EI5A 1LL9A 5EVID 3ITBA 4X69A 4GDBA 5GLDA 4OOYA 5F83A 3MZEA 4RYEA 1L0DA 2PBYA 4FD8A 4E3NA 3IXGA 4BD0A 5J8XA 5HAIA 3OZHA 4OPQA 4RA7A 1N4OA 3IH8A 5FASA 1MWTA 5M19A 5GL9A 1MBLA 3VP4A 4ZAMA 4KZBA 1NY0A 5CHJA 1IKIA 1K54A 1YLZA 5EECA 2WGIA 4JPMA 4OQIA 2XD1A 1YMXA 1ZC2A 4XUXA 2IWCA 1GHIA 2Y55A 3N6IA 2WAEA 5EVIC 5HARA 1IYOA 4JBFA 1KE4A 1LLBA 1RP5A 1BTLA 4DKIA 5CRFA 4E3KA 1PWGA 4KZ8A 4E3IA 2ZC3B 1ES5A 1EROA 3NY4A 4Y0UA 2X02A 3UNWA 2ZM0A 3PBRA 2EX6A 4KG6A 2XLNA 3IF6C 2XF3A 2ZLYA 3G2ZA 2IWDA 2ZQCA 4FH2A 4GOGA 3G35A 1YLPA 4A5RA 4KZ6A 3N4IA 1M40A 1L0GA 5AQ9A 3WS0A 2OLVA 1JWZA 3C4OA 3DWZA 3G4PA 3MKEA 1ES3A 3ZG9B 3IHAA 5CEDA 5BOHA 4IVIA 4DDSA 4S2NC 5FATA 3P98A 2J8YA 3VFFA 1XXMA 1TDLA 2Y59A 1H5XA 3JYIA 2Y4AA 3HREA 5F1GA 3C7UA 3HLDA 1W79A 4UA7A 4DE0A 1ZG6A 3SH8A 3OPHA 1LL5A 2ZQDA 4OQHA 3RXXA 3NBLA 4EQIA 4ZDXA 3WS1A 3CMZA 2RL3A 1IYQA 4PMAA 4EWFA 4LCMA 4ZJ1A 2HDRA 4WM9A 3PBOA 2XFSA 3G30A 1ZKJA 2Z2LB 1K4EA 4JF4A 3HLCA 4PM6A 5E2FA 2XGNA 1PW1A 3Q82A 3W8KA 5KSHA 3LCEA 3DW0A 4QHCA 5EVLA 4BD1A 3IHBA 4S2KA 2VGJA 1IKGA 2B5RA 2Y2NA 2WADA 3MZFA 4M3KA 3G34A 2P9VA 2C6WB 2WAFA 3UPPA 2XFTA 4MBHA 5CXWA 5A90A 2Y2KA 2VGKA 5E2HA 2X01A 4C6YA 4WBGA 1YM1A 2J7VA 2HDSA 4K0WA 2R9WA 3GRJA 4JF5A 4OQGA 1S6RA 4PPRA 3PBQA 1E3UA 1HTZA 5HL1A 3HLFA 4FH4A 1H8ZA 3OPRA 1SKFA 3IWOA 3BEBA 1KE0A 1W8YA 4Y7PA 3CZDA 2ZQAA 5FQQA 4GKUA 5FA7A 2QPNA 3HLWA 4X53A 3ZNTA 3SS4A 2Y2JA 4WZ4A 4KZ4A 1LI0A 1DJBA 3AGDA 3Q1FA 4DF6A 3OPPA 4X68A 3S1YA 5TFQA 3ZVWA 2HDUA 3Q7ZA 2Y2HA 3WS4A 1FCMA 1WYCA 1PIOA 3TSGA 3ZGAB 3WWXA 1SCWA 3HVFA 4ZJ3A 4KZ3A 3UDXA 4UAAA 3O86A 1IEMA 4WELA 3Q7VA 4WEKA 4XXRA 3S4XA 3UN7A 5I94A 3UE3A 5CGWA 1GHMA 3ZHHA 5DF8A 4JF6A 3NI9A 2WKHA 3BYDA 3PBNA 4X56A 3V5MA 2HPBA 1SHVA 5F1FA 1O07A 4ZTKA 4EBNA 4N9LA 2Q9MA 3WRTA 1H8YA 5AQBA 2ZQ8A 4H8RA 1NXYA 3NC8A 4UHUA 1KDWA 1G68A 2DNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9V B;  2WZX A;  4QD4 A;  3VP0 A;  5L2F A;  3ZG8 B;  5HAP A;  1XGI A;  3SS5 A;  1E4D A;  3I7J A;  4PM9 A;  2IWB A;  3VSL A;  3ZFZ A;  3VP1 A;  1HD8 A;  4E3L A;  3NDE A;  2DRW A;  3V3S A;  4XUZ A;  3SS3 A;  1U60 A;  1XX2 A;  3IWI A;  4DRT A;  5E2E A;  2ZC5 B;  1DJA A;  4R3B A;  1JWV A;  4YFM A;  4S2L A;  3RJU A;  4FCF A;  2XEP A;  3A3J A;  2CC1 A;  2EX8 A;  3SH7 A;  1ERQ A;  3S22 A;  3A3D A;  4Z9Q A;  2EFX A;  3M2K A;  3QHY A;  2ZM8 A;  1YQS A;  1KE3 A;  2Y2Q A;  1YLY A;  4LV0 A;  3IF5 A;  4RVA A;  4OLD A;  5E2G A;  5FAP A;  1RCJ A;  3IH9 A;  2ZC4 B;  1Z6F A;  1KGF A;  3AGE A;  1BLP A;  5FQI A;  3B3X A;  5G18 A;  3WRZ A;  4CJN A;  1XGJ A;  2P74 A;  1FCN A;  3BRM A;  3Q7V B;  4WZ5 C;  1RGZ A;  1BUE A;  4K0X A;  3MFD A;  4GZB A;  5DTT A;  4R4R A;  3UDF A;  1BZA A;  3CJM A;  2DCF A;  1WE4 A;  2ZQ7 A;  5DTS A;  1ESI A;  5HAQ A;  1EWZ A;  4N1X A;  2G2U A;  1K57 A;  3V39 A;  2EXB A;  3E2K A;  3C5A A;  4PM5 A;  3LO7 A;  3DTM A;  3ZDJ A;  1YMS A;  1ERM A;  4U0X A;  1GHP A;  1BSG A;  5D3O A;  4QU3 A;  2WYX A;  4BJP A;  4KQQ A;  2JE5 A;  4QJG A;  3IXD A;  5DF9 A;  1QME A;  4IVK A;  1Q2P A;  1K56 D;  1LHY A;  4E6X A;  4BL3 A;  5FQJ A;  4P87 A;  1KVL A;  5JYO A;  2UWX A;  3W4O A;  5A93 A;  5GHY A;  2HDQ A;  3GSG A;  3LEZ A;  5FI6 A;  1N9B A;  2WK0 A;  4N9K A;  5FDH A;  1CI9 A;  3ZNY A;  3VSK A;  3BFD A;  1PZO A;  4JXV A;  1RGY A;  1E25 A;  2QZ6 A;  3C4P A;  4WMC A;  3O87 A;  4GN2 A;  3GVB A;  3QNB A;  4E3O A;  1JTD A;  3G31 A;  4KZ5 A;  2WGW A;  4LCL A;  3N7W A;  2XR0 A;  1MWR A;  3BM6 A;  3N8S A;  3VP2 A;  2QMI A;  4ZBE A;  4B88 A;  1WYB A;  2H0Y A;  3GTC A;  3IXH A;  3M2J A;  2V20 A;  4S2O A;  5EVI A;  5DF7 A;  1BLC A;  3D4F A;  5GHZ A;  3HLE A;  5DVA A;  1BLH A;  4R1G A;  4GD6 A;  4MBF A;  2EX2 A;  1DJC A;  3FWL A;  3NIA A;  4LV2 A;  1FOF A;  1W5D A;  1YT4 A;  5CEC A;  4Q8I A;  5F82 A;  5GHX A;  3V50 A;  2Z2M B;  1VQQ A;  5FI7 A;  3WS5 A;  2ZMA A;  1JTG A;  3IF6 A;  3G2Y A;  3P09 A;  2OV5 A;  3IT9 A;  2Y2M A;  5KZH A;  4DE2 A;  3V3R A;  4E3M A;  1K54 C;  1PI4 A;  1VM1 A;  2FFY A;  4CPK A;  1NRF A;  4ID4 A;  3VFH A;  4S2N A;  3FYZ A;  4LV3 A;  3FKV A;  3EQV A;  2Y2P A;  2V1Z A;  2H5S A;  4OPY A;  3WS2 A;  3HUM A;  4JXG A;  4OLG A;  3UE0 A;  3FZC A;  4DXB A;  4Y0T A;  3PAE A;  1K4F A;  1BT5 A;  2V2F F;  2JCH A;  3PBT A;  1MXO A;  1TDG A;  3TOI A;  2Y2O A;  5CEB A;  2HP6 A;  4BEN A;  3GV9 A;  4EUZ A;  5DTK A;  2Q9N A;  2WGW B;  1L0F A;  4S2I A;  5FAO A;  3VP3 A;  5CHU A;  4P0M A;  3MXS A;  4X55 A;  2EFU A;  1BLS A;  2PU4 A;  5HW3 A;  1ESU A;  3IWQ A;  4IBR A;  3N8R A;  2X71 A;  4OPZ A;  5EVI B;  3A3F A;  3MKF A;  1XA7 A;  2HP5 A;  3NCK A;  2OLU A;  1OME A;  2Y2G A;  5CTN A;  4ZJ2 A;  5EOE A;  2A49 A;  4MNR A;  4QB8 A;  4GD8 A;  4OVD A;  4C3Q A;  3TG9 A;  3C7V A;  4EBP A;  2R9X A;  2WGV A;  4S2J A;  1MWU A;  1NZO A;  4B4X A;  4S2M A;  5FAQ A;  4DDY A;  4KQO A;  4F94 A;  1CK3 A;  1LI9 A;  1E3U D;  3BLS A;  2FFF B;  4UA9 A;  3IF6 B;  4IBX A;  3PAG A;  5HX9 A;  2XH9 A;  4MBK A;  5CTM A;  1FCO A;  1J9M A;  4U3T A;  2ZJ9 A;  2JC7 A;  4KQR A;  1NYM A;  1MWS A;  2WKI A;  2ZC7 A;  4U0T A;  4E6W A;  4LEN A;  4NK3 A;  3MZD A;  1PI5 A;  3NDG A;  2GDN A;  3IQA A;  1ONG A;  3CG5 A;  2Y91 A;  3ISG A;  3Q81 A;  1YLT A;  1NYY A;  4MEZ A;  3FKW A;  1IYP A;  2Y2L A;  5FI2 A;  1GA0 A;  4GDN A;  4JXW A;  1BUL A;  4PM8 A;  1Y54 A;  3LY3 A;  3PTE A;  4P85 A;  4OP5 A;  1M6K A;  5JYP A;  1FSW A;  1SDN A;  1YLJ A;  2OSU A;  2XK1 A;  3O3V A;  1FR6 A;  2HP9 A;  2ZC6 B;  3BFC A;  5AQA A;  1SDE A;  2WKE A;  4UA6 A;  5M18 A;  1K55 C;  2ZQ9 A;  4KZ9 A;  4HEF A;  1I5Q A;  2BG1 A;  5HFO A;  5CER A;  4K91 A;  4JKT A;  3W4P A;  3BEC A;  4HES A;  5IHV A;  4D2O A;  1MKI A;  2Y2I A;  1IYS A;  2I72 A;  3A3E A;  4GNU A;  1ES4 A;  1PYY A;  1KGE A;  4N92 A;  5CGX A;  1G6A A;  3VOZ A;  1I2W A;  1AXB A;  1ONH A;  1ES2 A;  5GLB A;  4O7D A;  1CI8 A;  1XPB A;  2PU2 A;  1CEF A;  3ITA A;  3QNC A;  5M1A A;  1KGG A;  4EV4 A;  1FR1 A;  3DWK A;  2WUQ A;  2J9P A;  1S0W A;  1K6S A;  2A3U A;  3AGF A;  4C75 A;  4OOL A;  5TR7 A;  2XQZ A;  2EX9 A;  3EQU A;  1MY8 A;  5GLC A;  5AQ7 A;  4R23 A;  4KG2 A;  2JBF A;  2RCX A;  3UDI A;  1IEL A;  1NJ4 A;  5EOO A;  3M6H A;  5FQM A;  1L2S A;  1GCE A;  4HBT A;  5TGF A;  3SH9 A;  4OP8 A;  4DE1 A;  3GMW A;  1FSY A;  4PM7 A;  1XA1 A;  4P6B A;  4R4S A;  4OQ0 A;  3HUO A;  5EE8 A;  4BL2 A;  1HVB A;  5E43 A;  3HLB A;  3HUN A;  5CGS A;  4LV1 A;  3A3I A;  1NZU A;  2G2W A;  4YIN A;  1XKZ A;  3BFG A;  3MXR A;  1K38 A;  3GQZ A;  3UO9 A;  4JXS A;  3ZG5 A;  3BLM A;  1ALQ A;  4IED A;  4KG5 A;  4E3J A;  4NET A;  3G32 A;  5EUA A;  1MPL A;  3VMA A;  5CHM A;  4KEN B;  2ZM2 A;  3OCL A;  4BQM A;  1JWP A;  3UY6 A;  3ZVT A;  4Y0O A;  1YLW A;  3HLG A;  4DXC A;  3N8L A;  3GR2 A;  4WZ5 A;  3OCN A;  3RXW A;  3W4Q A;  3UPO A;  4OON A;  5FQK A;  2H10 A;  1JVJ A;  2J9O A;  2EXA A;  3MBZ A;  3M6B A;  4L0L A;  5KMW A;  4N1H A;  1W7F A;  4MLL A;  3UE1 A;  2C5W B;  3ZG0 A;  4QY5 A;  4DE3 A;  1K55 A;  3LY4 A;  2H0T A;  1ZG4 A;  3IXB A;  5U47 A;  1C3B A;  4WEJ A;  4OH0 A;  2XDM A;  4X6T A;  1W8Q A;  2E8I A;  1KVM A;  3HBR A;  2ZD8 A;  5KSC A;  1PWD A;  5EPH A;  1KDS A;  4KZA A;  2WZZ A;  4QY6 A;  5FQ9 A;  4EBL A;  4S2P A;  1XP4 A;  3BFF A;  1Q2Q A;  3SOI A;  1K6R A;  1DY6 A;  1O7E A;  4GB7 A;  4OOM A;  3ZG7 B;  4OPR A;  4R0Q A;  3HL9 A;  5A91 A;  4RX3 A;  3FV7 A;  1CEG A;  4BLM A;  3PBS A;  1I2S A;  3ZCZ A;  1L0E A;  1GA9 A;  1FQG A;  4KZ7 A;  1TVF A;  4R3J A;  5GLA A;  4WMC D;  1K57 C;  3VOY A;  1PZP A;  1PWC A;  4RX2 A;  3Q07 A;  4JLF A;  1TEM A;  4WYY A;  1K25 A;  1HZO A;  3E2L A;  4OKP A;  1PW8 A;  2XD5 A;  3O88 A;  2BLS A;  4FSF A;  4HBU A;  3BFE A;  1K56 A;  3OPL A;  5FSR A;  3OC2 A;  3UPN A;  4B4Z A;  5A92 A;  1QMF A;  1EI5 A;  1LL9 A;  5EVI D;  3ITB A;  4X69 A;  4GDB A;  5GLD A;  4OOY A;  5F83 A;  3MZE A;  4RYE A;  1L0D A;  2PBY A;  4FD8 A;  4E3N A;  3IXG A;  4BD0 A;  5J8X A;  5HAI A;  3OZH A;  4OPQ A;  4RA7 A;  1N4O A;  3IH8 A;  5FAS A;  1MWT A;  5M19 A;  5GL9 A;  1MBL A;  3VP4 A;  4ZAM A;  4KZB A;  1NY0 A;  5CHJ A;  1IKI A;  1K54 A;  1YLZ A;  5EEC A;  2WGI A;  4JPM A;  4OQI A;  2XD1 A;  1YMX A;  1ZC2 A;  4XUX A;  2IWC A;  1GHI A;  2Y55 A;  3N6I A;  2WAE A;  5EVI C;  5HAR A;  1IYO A;  4JBF A;  1KE4 A;  1LLB A;  1RP5 A;  1BTL A;  4DKI A;  5CRF A;  4E3K A;  1PWG A;  4KZ8 A;  4E3I A;  2ZC3 B;  1ES5 A;  1ERO A;  3NY4 A;  4Y0U A;  2X02 A;  3UNW A;  2ZM0 A;  3PBR A;  2EX6 A;  4KG6 A;  2XLN A;  3IF6 C;  2XF3 A;  2ZLY A;  3G2Z A;  2IWD A;  2ZQC A;  4FH2 A;  4GOG A;  3G35 A;  1YLP A;  4A5R A;  4KZ6 A;  3N4I A;  1M40 A;  1L0G A;  5AQ9 A;  3WS0 A;  2OLV A;  1JWZ A;  3C4O A;  3DWZ A;  3G4P A;  3MKE A;  1ES3 A;  3ZG9 B;  3IHA A;  5CED A;  5BOH A;  4IVI A;  4DDS A;  4S2N C;  5FAT A;  3P98 A;  2J8Y A;  3VFF A;  1XXM A;  1TDL A;  2Y59 A;  1H5X A;  3JYI A;  2Y4A A;  3HRE A;  5F1G A;  3C7U A;  3HLD A;  1W79 A;  4UA7 A;  4DE0 A;  1ZG6 A;  3SH8 A;  3OPH A;  1LL5 A;  2ZQD A;  4OQH A;  3RXX A;  3NBL A;  4EQI A;  4ZDX A;  3WS1 A;  3CMZ A;  2RL3 A;  1IYQ A;  4PMA A;  4EWF A;  4LCM A;  4ZJ1 A;  2HDR A;  4WM9 A;  3PBO A;  2XFS A;  3G30 A;  1ZKJ A;  2Z2L B;  1K4E A;  4JF4 A;  3HLC A;  4PM6 A;  5E2F A;  2XGN A;  1PW1 A;  3Q82 A;  3W8K A;  5KSH A;  3LCE A;  3DW0 A;  4QHC A;  5EVL A;  4BD1 A;  3IHB A;  4S2K A;  2VGJ A;  1IKG A;  2B5R A;  2Y2N A;  2WAD A;  3MZF A;  4M3K A;  3G34 A;  2P9V A;  2C6W B;  2WAF A;  3UPP A;  2XFT A;  4MBH A;  5CXW A;  5A90 A;  2Y2K A;  2VGK A;  5E2H A;  2X01 A;  4C6Y A;  4WBG A;  1YM1 A;  2J7V A;  2HDS A;  4K0W A;  2R9W A;  3GRJ A;  4JF5 A;  4OQG A;  1S6R A;  4PPR A;  3PBQ A;  1E3U A;  1HTZ A;  5HL1 A;  3HLF A;  4FH4 A;  1H8Z A;  3OPR A;  1SKF A;  3IWO A;  3BEB A;  1KE0 A;  1W8Y A;  4Y7P A;  3CZD A;  2ZQA A;  5FQQ A;  4GKU A;  5FA7 A;  2QPN A;  3HLW A;  4X53 A;  3ZNT A;  3SS4 A;  2Y2J A;  4WZ4 A;  4KZ4 A;  1LI0 A;  1DJB A;  3AGD A;  3Q1F A;  4DF6 A;  3OPP A;  4X68 A;  3S1Y A;  5TFQ A;  3ZVW A;  2HDU A;  3Q7Z A;  2Y2H A;  3WS4 A;  1FCM A;  1WYC A;  1PIO A;  3TSG A;  3ZGA B;  3WWX A;  1SCW A;  3HVF A;  4ZJ3 A;  4KZ3 A;  3UDX A;  4UAA A;  3O86 A;  1IEM A;  4WEL A;  3Q7V A;  4WEK A;  4XXR A;  3S4X A;  3UN7 A;  5I94 A;  3UE3 A;  5CGW A;  1GHM A;  3ZHH A;  5DF8 A;  4JF6 A;  3NI9 A;  2WKH A;  3BYD A;  3PBN A;  4X56 A;  3V5M A;  2HPB A;  1SHV A;  5F1F A;  1O07 A;  4ZTK A;  4EBN A;  4N9L A;  2Q9M A;  3WRT A;  1H8Y A;  5AQB A;  2ZQ8 A;  4H8R A;  1NXY A;  3NC8 A;  4UHU A;  1KDW A;  1G68 A;  2DNS A; 
#chains in the Genus database with same CATH topology
 4QD4 A;  4GJ4 A;  5HAP A;  3SS5 A;  3I7J A;  4X1M A;  3W2Z A;  5HPI A;  4JGQ A;  1IOU A;  4DRT A;  2PYP A;  3UME A;  3S22 A;  3A3D A;  3M2K A;  2Y2Q A;  4FOF A;  5FAP A;  3QP4 A;  3IH9 A;  1Z6F A;  1KGF A;  3AGE A;  1BLP A;  3QP2 A;  4WZ5 C;  3EGX C;  3MFD A;  5DTT A;  3A0V A;  4EU0 A;  5HZH A;  2DCF A;  3DAV A;  4B93 A;  2EA9 A;  5G4Y A;  4CLC A;  2W1T A;  1YMS A;  4U0X A;  1XJ3 A;  4QJG A;  4KQQ A;  3A0S A;  5DF9 A;  4NEE D;  1K56 D;  1LHY A;  3FPV A;  4E6X A;  5FQJ A;  2ZL1 A;  2PYR A;  1D1J A;  5JYO A;  2PT7 A;  2ZOI A;  5A93 A;  2HJE A;  3GSG A;  3LEZ A;  1CI9 A;  5TBM A;  3VSK A;  3MMH A;  1RGY A;  2QZ6 A;  3C4P A;  4GN2 A;  4LCL A;  3N8S A;  3VP2 A;  3GTC A;  3IXH A;  1F5M A;  3D4F A;  5GHZ A;  4Y13 A;  3HJK A;  4Y3I A;  3FWL A;  1FOF A;  1TD5 A;  1YT4 A;  4Q8I A;  2OV5 A;  3MXQ A;  2Y2M A;  2Y8H A;  3IX4 A;  4DE2 A;  5AVF A;  4CLC B;  2W1T B;  4E3M A;  1PI4 A;  1VM1 A;  2KOI A;  4ID4 A;  3FYZ A;  3FKV A;  2H5S A;  2ZL1 B;  3UB7 A;  3WS2 A;  2WKR A;  2O9A A;  5TBM B;  2JCH A;  3PBT A;  3B33 A;  2Y2O A;  2Q9N A;  3MXS A;  3NHQ A;  4X55 A;  2EFU A;  1ESU A;  4OPZ A;  3NOT C;  3A3F A;  3MKF A;  2YKH A;  2Y2G A;  2A49 A;  4MNR A;  4QB8 A;  4EBP A;  2R9X A;  2WGV A;  2BTF P;  5FAQ A;  4F94 A;  4KQO A;  5A8B A;  2O99 A;  4WUJ A;  5L8M A;  1W63 M;  2XH9 A;  1MWS A;  1TF1 A;  3A0R A;  3Q81 A;  4KQD A;  1J3W A;  4RQ9 A;  3LY3 A;  1M6K A;  1YLJ A;  1D7E A;  1FR6 A;  3BFC A;  4UA6 A;  2ZQ9 A;  5HFO A;  1I5Q A;  4JKT A;  2FZ0 A;  5IHV A;  2I72 A;  3A3E A;  5CGX A;  5EM0 A;  3VOZ A;  1XPB A;  2PU2 A;  2QHK A;  4UQI S;  3DWK A;  5TR7 A;  2XQZ A;  2EX9 A;  4FUW A;  5GLC A;  5J4E A;  3S7N A;  5J3W A;  4IHQ A;  5EOO A;  4DE1 A;  1L2S A;  1GCE A;  1S4R A;  3GMW A;  4R4S A;  3LR5 A;  3HUN A;  4LV1 A;  3F1P A;  1XKZ A;  1OT9 A;  1UWN X;  4IED A;  5EUA A;  1MPL A;  4KEN B;  1JWP A;  5DKL A;  4Y0O A;  3HLG A;  1T1A A;  3UPO A;  1FIL A;  5KMW A;  4N1H A;  3JVV A;  4MLL A;  3UE1 A;  3TE8 A;  5U47 A;  1ZG4 A;  3IXB A;  2LB9 A;  4WEJ A;  1YPR A;  4L9G A;  2ZD8 A;  4HNB A;  4QY6 A;  1XP4 A;  2XA7 M;  1K6R A;  4GB7 A;  3ZG7 B;  5A91 A;  4BLM A;  3PBS A;  3CLO A;  4BBV A;  2I9V A;  1GA9 A;  2KLI A;  5GLA A;  4WMC D;  1K57 C;  3F1P B;  5DJU A;  1TEM A;  4WYY A;  1X0O A;  3E2L A;  1PW8 A;  3O88 A;  4HBU A;  3BFE A;  3OPL A;  5A92 A;  4B4Z A;  1LL9 A;  2KX6 A;  5EVI D;  4GDB A;  5GLD A;  4OOY A;  1LSX A;  3MZE A;  4RYE A;  1L0D A;  3UB5 P;  5HWV A;  4RA7 A;  2ZBB A;  4BMW A;  5FAS A;  3KYQ A;  1OPX A;  4KZB A;  3SZT A;  1T1B A;  5CHJ A;  1NLY A;  1XJ6 A;  2WGI A;  2W3H A;  1NWZ A;  1YMX A;  1GHI A;  1P9R A;  5EVI C;  1IYO A;  1LLB A;  3S7P A;  4DKI A;  4E3K A;  1PWG A;  1ES5 A;  1ERO A;  2UV0 E;  3BQA A;  2EX6 A;  3C8C A;  4LRY C;  4KZ6 A;  3K2N A;  3WS0 A;  3MKE A;  3IHA A;  5BOH A;  4DJ3 A;  3P98 A;  2J8Y A;  3VFF A;  1H5X A;  3ZYT A;  4BBU A;  3C7U A;  1W79 A;  4UA7 A;  3SH8 A;  2V1B A;  2ZQD A;  3EEH A;  2A24 A;  3R7W A;  4EQI A;  4ZDX A;  2JN7 A;  4MN5 A;  4EWF A;  2HDR A;  1K4E A;  1PW1 A;  1UGU A;  4QHC A;  5CX7 A;  5EVL A;  4I38 A;  5AVE A;  4M3K A;  3G34 A;  2P9V A;  3UB8 A;  2XFT A;  2J7V A;  2HDS A;  4K0W A;  4HH2 A;  2R9W A;  3NOU C;  1E3U A;  5HL1 A;  4FH4 A;  3OPR A;  3P7N A;  1KE0 A;  4PKY G;  5FQQ A;  4GKU A;  3KSF A;  4UEY A;  3AGD A;  3Q1F A;  3CIT A;  2Y2H A;  3WS4 A;  1WYC A;  3TSG A;  3ZGA B;  2A24 B;  4YNR A;  4R38 A;  4UAA A;  3R7W B;  4XXR A;  5I94 A;  2NUT C;  3UE3 A;  5CGW A;  5DF8 A;  3V5M A;  4DN0 A;  3FG8 A;  1SHV A;  3IBR A;  5F1F A;  4ZTK A;  4P6Z S;  4N9L A;  2Q9M A;  2R78 A;  3CHW P;  1NXY A;  3NC8 A;  4UHU A;  3NDE A;  2DNS A;  2P9V B;  3VP0 A;  3CPT A;  3VSL A;  4R70 A;  5EV0 A;  3L9K A;  3IWI A;  1JWV A;  3C38 A;  1GSX A;  4Q0H A;  3MR0 A;  3SH7 A;  4D60 A;  2EFX A;  1YQS A;  1KE3 A;  3PYP A;  1CJF A;  1D06 A;  3B3X A;  4Y2F A;  5DKK A;  2YKF A;  3ZQ5 A;  4R4R A;  3CJM A;  3MSH A;  1ESI A;  5HAQ A;  4EQ1 A;  3V39 A;  3E2K A;  3ZDJ A;  1GHP A;  4BJP A;  3CPT B;  2JE5 A;  3E4P A;  2CMN A;  3LIB A;  4BL3 A;  4P87 A;  2W3D A;  2D01 A;  3LI9 A;  5GHY A;  3RTY A;  4GCZ A;  5FDH A;  1H0M A;  3DTI A;  3ZNY A;  4I3A A;  3GVB A;  3QNB A;  4E3O A;  2XR0 A;  4R3A A;  1YSP A;  4B88 A;  3CWF A;  3M2J A;  5DF7 A;  1PFL A;  3EGD C;  4Q0I A;  3HLE A;  1BLH A;  2Q0O A;  4GD6 A;  2XRN A;  1MKM A;  1VEU A;  4I5S A;  3NIA A;  5CEC A;  5F82 A;  5GHX A;  3F1N A;  2Z2M B;  3G2Y A;  5TJJ A;  1K54 C;  1G5U A;  4IUK A;  3RH8 B;  4CPK A;  3LIA A;  4S2N A;  5HL6 A;  3EQV A;  5EFW A;  2V1Z A;  4OPY A;  4OLG A;  3PAE A;  3VE4 A;  4I39 A;  5CEB A;  4BEN A;  4EUZ A;  5DTK A;  3KSI A;  4HIA A;  4IUH A;  4BWI A;  4MN6 A;  4P0M A;  3LGO A;  4K08 A;  1BLS A;  3IWQ A;  4IBR A;  1F9I A;  5DFX A;  2O9C A;  5CTN A;  4GD8 A;  1VEU B;  3U2A A;  3F1N B;  1LI9 A;  3BLS A;  2FFF B;  3K3D A;  4IBX A;  2GZA A;  2PRF A;  1V9Y A;  2Z6D A;  1J9M A;  1TS0 A;  1NYM A;  2WKI A;  3NDG A;  1BYW A;  2GDN A;  4YOF A;  4MEZ A;  5L10 A;  4JXW A;  4PM8 A;  3PTE A;  1T18 A;  1OTD A;  4WN5 A;  1S4S A;  5JYP A;  5A90 A;  3O3V A;  1S1Z A;  5EM1 A;  4ETZ A;  1N9L A;  4KZ9 A;  4HEF A;  2BG1 A;  3E98 A;  4HES A;  3LI8 A;  4GNU A;  4N92 A;  1G6A A;  1ES2 A;  4BBT A;  4O7D A;  1CI8 A;  3QNC A;  5M1A A;  1KGG A;  3MF0 A;  4EER A;  3AGF A;  2Y79 A;  1MY8 A;  4R23 A;  4KG2 A;  2JBF A;  1TS6 A;  1NJ4 A;  5LBR A;  5TGF A;  3SH9 A;  3E4O A;  4BL2 A;  1HVB A;  5CGS A;  3A3I A;  1NZU A;  4O0P A;  4YIN A;  3BFG A;  3ZG5 A;  1ALQ A;  4KG5 A;  4E3J A;  2L1M A;  3VMA A;  5CHM A;  4BQM A;  4XT2 A;  2B18 A;  3DTE A;  1UWP X;  1P0Z A;  3GR2 A;  4HOI A;  3W4Q A;  2V0U A;  5FQK A;  4L0L A;  2J3W A;  5HDS A;  4OH0 A;  1WA9 A;  2XDM A;  4CLC D;  3BW6 A;  1W8Q A;  1KVM A;  4PKY A;  1OTA A;  3T4Q A;  2HJ9 C;  5KSC A;  1KDS A;  4KZA A;  3LR4 A;  5FQ9 A;  4EBL A;  3BJN A;  1Q2Q A;  1DY6 A;  3BY8 A;  1O7E A;  4OOM A;  3VOL A;  2V8C A;  3HL9 A;  4R0Q A;  4RX3 A;  3FV7 A;  3ULF A;  1EW0 A;  1L0E A;  4E04 A;  3JVU A;  1CQA A;  4HJ4 A;  3UB9 A;  4CLC C;  4JLF A;  4NKP A;  1K25 A;  4OKP A;  3O5Y A;  2BLS A;  4FSF A;  4GW9 A;  4XT2 B;  5FSR A;  1QMF A;  4X69 A;  4G3V A;  4LLO B;  3IXG A;  4I3I A;  3OZH A;  4OPQ A;  1MBL A;  3T4L A;  1NY0 A;  1IKI A;  5F6A A;  4JPM A;  2PHY A;  2QJ7 A;  4LGW A;  5DFY A;  1ZC2 A;  3N6I A;  4LFU A;  1BTL A;  3S7O A;  3IBJ A;  2ZC3 B;  2OWH A;  3NY4 A;  1H3Q A;  4KG6 A;  2XF3 A;  2ZLY A;  3G2Z A;  3G35 A;  5DJT A;  3TRC A;  4A5R A;  2W0N A;  3N4I A;  1HLU P;  1L0G A;  2OLV A;  3DWZ A;  3G4P A;  5FAT A;  4UQI M;  1TDL A;  2Y59 A;  2LB5 A;  2IA2 A;  3DTK A;  3L7H A;  4DE0 A;  4FTX A;  2XSS A;  2VZW A;  3C2W A;  3D72 A;  3CMZ A;  2RL3 A;  4PMA A;  1PRQ A;  2VEA A;  5HPF A;  4WM9 A;  3MS6 A;  3PBO A;  2XFS A;  5IU1 A;  2Z2L B;  4JF4 A;  5E2F A;  4NG2 A;  5KSH A;  2O0Y A;  2VGJ A;  4HJ3 A;  3QP8 A;  3NOP C;  3MZF A;  2C6W B;  3UPP A;  3U4L P;  2VV6 A;  4C6Y A;  2JKR I;  1YM1 A;  5IT5 A;  4JF5 A;  4PPR A;  3F1O A;  1HTZ A;  3CAX A;  3NEC A;  1SKF A;  3BEB A;  4Y7P A;  2ZQA A;  1FIK A;  4X53 A;  3SS4 A;  4WZ4 A;  1Y4O A;  1LI0 A;  1DJB A;  4DF6 A;  2DMW A;  3S1Y A;  1CF0 A;  4I3J A;  3LR0 A;  3Q7Z A;  1FCM A;  1PIO A;  1SCW A;  1XJ4 A;  3O86 A;  1OTI A;  4WEL A;  4WEK A;  3Q7V A;  3CUE A;  4MMN A;  1GHM A;  3BYD A;  4X56 A;  4ARZ A;  3T1S A;  1W63 Q;  2HPB A;  4EBN A;  4H6J A;  5AQB A;  2ZQ8 A;  1G68 A;  5L2F A;  2OOL A;  4PM9 A;  2IWB A;  3LIE A;  3VP1 A;  1JNU A;  1HD8 A;  4E3L A;  3BQ8 A;  3SS3 A;  1U60 A;  1XX2 A;  3F1O B;  3T4T A;  4L9E A;  3OBF A;  4S2L A;  3A3J A;  2EX8 A;  4AFI A;  1ERQ A;  1OJG A;  4Z9Q A;  3QHY A;  4NXF A;  2ZM8 A;  4F3L A;  2P08 A;  4L9F A;  1YLY A;  3IF5 A;  4OLD A;  3DBA A;  2ZC4 B;  1VB6 A;  3D9Y A;  4LRX C;  5G18 A;  4HI4 A;  3WRZ A;  4CJN A;  1XGJ A;  3BRM A;  1FCN A;  1ODV A;  3Q7V B;  1RGZ A;  2VJW A;  1DRM A;  1WE4 A;  4ARZ B;  4HQA A;  2VA0 A;  4H6J B;  2EXB A;  3C5A A;  4PM5 A;  2H28 A;  2PR5 A;  1ERM A;  5D3O A;  4QU3 A;  1SKO A;  2VLG A;  1QME A;  4IVK A;  1F98 A;  1YKD A;  2UWX A;  3W4O A;  2JKR M;  5FI6 A;  3LIC A;  1N9B A;  2WK0 A;  1PZO A;  4F3L B;  2HV1 A;  3G31 A;  2WGW A;  3N7W A;  3BM6 A;  2QMI A;  3KYZ A;  4ZBE A;  1WYB A;  1OJ5 A;  4R1G A;  2QWS A;  2J3T D;  1DJC A;  3KSG A;  1W5D A;  1VQQ A;  2JKT I;  3WS5 A;  3IF6 A;  3IT9 A;  1SKO B;  3VFH A;  3T1Q B;  3T1X A;  1VET A;  3MQO A;  4WF0 A;  3EOI A;  2J3T C;  3UE0 A;  3K3C A;  1AWI A;  1K4F A;  2V2F F;  2W1R A;  1MXO A;  1TDG A;  3TOI A;  4II7 A;  2HP6 A;  4HHD A;  2WGW B;  1PNE A;  1L0F A;  4S2I A;  2PR6 A;  4EXO A;  3N8R A;  2X71 A;  2HP5 A;  3NCK A;  1OME A;  4ZJ2 A;  2EWW A;  5IS1 A;  3TG9 A;  1MWU A;  1G6O A;  1CK3 A;  1E3U D;  1ACF A;  4UA9 A;  3IF6 B;  3IS2 A;  5L09 A;  2ZJ9 A;  4KQR A;  4U0T A;  4NK3 A;  3MZD A;  1G28 A;  1PI5 A;  4JGR A;  3CG5 A;  4ETX A;  3ISG A;  1VET B;  2QJ5 A;  1GA0 A;  1Y54 A;  1STZ A;  2OAP 1;  3C30 A;  1SDN A;  2ZC6 B;  3QP6 A;  5AQA A;  2WKE A;  5M18 A;  1K55 C;  4NXB A;  1YSQ A;  4K91 A;  5CER A;  3MFX A;  3BEC A;  4D2O A;  2PDR A;  2E8J A;  1ES4 A;  2BAS A;  1KGE A;  1I2W A;  1AXB A;  1ONH A;  5GLB A;  4EV4 A;  2KDK A;  1FR1 A;  2WUQ A;  3T1R A;  2J9P A;  4C75 A;  1H8M A;  1K6S A;  2A3U A;  2HF6 A;  3UDI A;  3M6H A;  5FQM A;  4HBT A;  1XJ2 A;  1Z09 A;  1FSY A;  4P6B A;  5KIZ A;  4OQ0 A;  3IS2 B;  2JKT M;  5E43 A;  3HLB A;  1K38 A;  3BLM A;  3VE3 A;  3LEQ A;  3G32 A;  2A2L A;  3B47 A;  3OCL A;  3ZVT A;  1YLW A;  4WZ5 A;  3OCN A;  3RXW A;  4OON A;  2H10 A;  2J9O A;  3MBZ A;  3ZG0 A;  4QY5 A;  4DE3 A;  3LY4 A;  1C3B A;  1K0K A;  3HBR A;  1L3L A;  2GX5 A;  5G4Z A;  3TJZ C;  2WZZ A;  5I5L A;  3BFF A;  3SOI A;  2VGL S;  3BWL A;  1I2S A;  3ZCZ A;  2W3E A;  4KUK A;  4KZ7 A;  1TVF A;  4R3J A;  3MQ0 A;  3PXP A;  1PZP A;  4RX2 A;  3LYX A;  3Q07 A;  3R4K A;  5HDC A;  1K56 A;  2PD7 A;  3UPN A;  3ITB A;  5FEF A;  2M7V A;  4E3N A;  4BD0 A;  5J8X A;  1N4O A;  3IH8 A;  1MWT A;  5GL9 A;  2VKS A;  3RFB A;  4OQI A;  2PBD P;  4XUX A;  2IWC A;  4PHT A;  2Y55 A;  5HD3 A;  2WAE A;  5HAR A;  5CRF A;  4KZ8 A;  4E3I A;  1TS7 A;  4X1L A;  4Y0U A;  2X02 A;  1MZU A;  3UNW A;  2ZM0 A;  3PBR A;  2VX8 A;  2FH5 A;  2XLN A;  5FL3 A;  2IWD A;  1VHM A;  5HWW A;  1M40 A;  3H9W A;  5AQ9 A;  4X25 A;  3ZG9 B;  1ES3 A;  2V8F A;  3QP5 A;  4IVI A;  4DDS A;  4S2N C;  1XXM A;  3NUL A;  3JYI A;  2Y4A A;  3HRE A;  2GJ3 A;  5C5K A;  1LL5 A;  4OQH A;  3RXX A;  3WS1 A;  1IYQ A;  3HJI A;  4LCM A;  4ZJ1 A;  1DP8 A;  4Q0J A;  3G30 A;  1ZKJ A;  3EEA A;  4QPR A;  3FC7 A;  2XGN A;  3W8K A;  3H7W A;  3DW0 A;  3IHB A;  4S2K A;  4G3K A;  4HH3 A;  1YAX A;  2B95 A;  2WAD A;  2MJ6 A;  5CXW A;  2K31 A;  5E2H A;  2QKP A;  2VGK A;  2X01 A;  4WBG A;  2W27 A;  3MQQ A;  5F68 A;  4ESP A;  3HLF A;  1H8Z A;  2WKP A;  3IWO A;  1W8Y A;  5FEG A;  2QPN A;  4HP4 A;  1ZTU A;  2Y2J A;  1P97 A;  3LID A;  4MDZ A;  4X68 A;  5TFQ A;  3ZVW A;  2HDU A;  3T4K A;  1MC0 A;  4ZJ3 A;  3UDX A;  1IEM A;  3ZHH A;  4JF6 A;  4R6L A;  3HCY A;  3PBN A;  4WL9 A;  5HWT A;  3PR6 A;  3H7W B;  1O07 A;  2V1A A;  4ME4 A;  4O01 A;  3EWK A;  4H8R A;  2WZX A;  3B42 A;  3ZG8 B;  1XGI A;  3ZFZ A;  1E4D A;  2B02 A;  2DRW A;  3V3S A;  4XUZ A;  4EEP A;  2ACG A;  4HP9 A;  4KUO A;  5E2E A;  2ZC5 B;  1DJA A;  4R3B A;  4M4X A;  4YFM A;  3RJU A;  4FCF A;  2XEP A;  2CC1 A;  4HJ6 A;  1T19 A;  1OTE A;  3SW1 A;  4PAU A;  4LV0 A;  2WKQ A;  4RVA A;  5E2G A;  1RCJ A;  2D02 A;  1DP9 A;  2V0W A;  4GS9 A;  5J7E A;  1IFQ A;  5FQI A;  1S1Y A;  2PD8 A;  2P74 A;  1ZHH B;  3T4S A;  1BUE A;  4K0X A;  4GZB A;  3UDF A;  1BZA A;  4GLQ A;  3E0Y A;  2ZQ7 A;  2XRO A;  5DTS A;  1EWZ A;  4N1X A;  2G2U A;  1K57 A;  3LO7 A;  3DTM A;  1BSG A;  2WYX A;  2INW A;  3IXD A;  1TS8 A;  1GSV A;  1Q2P A;  2ZOH A;  5AJG A;  4EUV A;  1KVL A;  2G7U A;  1XFN A;  2HDQ A;  2M7U A;  4N9K A;  3BFD A;  1S67 L;  4JXV A;  4Z1W A;  1E25 A;  4WMC A;  3O87 A;  1JTD A;  4KZ5 A;  1MWR A;  4Y17 A;  4Y15 A;  3UMD A;  4GS9 B;  2H0Y A;  2V20 A;  4S2O A;  5EVI A;  1BLC A;  1SZV A;  2Z6C A;  5DVA A;  3UE6 A;  2VV8 A;  4MBF A;  2EX2 A;  2K2N A;  4EEU A;  4LV2 A;  4LPZ A;  2L0W A;  3V50 A;  3KYE A;  5FI7 A;  2VK3 A;  2ZMA A;  1JTG A;  3P09 A;  3OOV A;  5KZH A;  3V3R A;  2FFY A;  1NRF A;  3IX8 A;  3MJQ A;  3H82 A;  4LV3 A;  2Y2P A;  5HD5 A;  2XA7 S;  3HUM A;  4JXG A;  3FZC A;  4DXB A;  4Y0T A;  1BT5 A;  3V67 A;  4EES A;  3GV9 A;  3VP3 A;  5FAO A;  5CHU A;  3T4J A;  2PU4 A;  5HW3 A;  3LIF A;  5EVI B;  1XA7 A;  2AVX A;  2OLU A;  5EOE A;  4OVD A;  4C3Q A;  3C7V A;  4S2J A;  1NZO A;  1V9Z A;  4B4X A;  4S2M A;  4DDY A;  1GSW A;  3IX3 A;  3KO6 A;  3PAG A;  5HX9 A;  5CTM A;  1FCO A;  4G3W A;  4U3T A;  2JC7 A;  2ZC7 A;  3UB6 A;  4E6W A;  4LEN A;  2V9A A;  3LR3 A;  3IQA A;  1ONG A;  5K5B A;  2Y91 A;  3H82 B;  1YLT A;  1NYY A;  5FI2 A;  3FKW A;  1IYP A;  2Y2L A;  2OAQ 1;  4GDN A;  1BUL A;  3T50 A;  4P85 A;  4OP5 A;  5F5Y A;  3CI6 A;  1FSW A;  1NRJ A;  2XK1 A;  2OSU A;  2HP9 A;  1OT6 A;  1SDE A;  1LL8 A;  1NLZ A;  3W4P A;  1MKI A;  2Y2I A;  1IYS A;  1OTB A;  1PYY A;  4Y5F A;  4EET B;  1CEF A;  3ITA A;  4LRZ E;  3JPU A;  1S0W A;  2K7S A;  4OOL A;  3EQU A;  5AQ7 A;  4O8G A;  2RCX A;  3CUE C;  1IEL A;  2W3G A;  3VV4 A;  4OP8 A;  2QYB A;  4PM7 A;  1XA1 A;  3HUO A;  5EE8 A;  2G2W A;  4DJ2 A;  3MXR A;  3ICY A;  3UO9 A;  3GQZ A;  4JXS A;  3TW8 A;  2HGV A;  4NET A;  3NJA A;  2VV7 A;  2ZM2 A;  2P7J A;  3D3O A;  3UY6 A;  4DXC A;  3N8L A;  1JVJ A;  2EXA A;  3M6B A;  4B9O A;  1W7F A;  2C5W B;  1S66 L;  1K55 A;  3P01 A;  2H0T A;  3OLO A;  4X6T A;  2E8I A;  5F69 A;  1PWD A;  1XFQ A;  2P04 A;  5EPH A;  4CQH A;  4S2P A;  4YWZ A;  4OPR A;  4QWO A;  1CEG A;  4P6Z M;  2ZMV A;  1FQG A;  1N9N A;  2O9B A;  3VOY A;  1PWC A;  4MN7 A;  5L07 A;  4ZRR A;  4MCW A;  1HZO A;  2GNX A;  3LUQ A;  2XD5 A;  4GHI A;  3OC2 A;  1EI5 A;  4EW7 A;  2JHE A;  5F83 A;  4CLC E;  4FD8 A;  2PBY A;  3FPW A;  5HAI A;  4DMZ A;  5M19 A;  2OWJ A;  4ZAM A;  3VP4 A;  2J80 A;  4NXG A;  1K54 A;  1YLZ A;  5EEC A;  2XD1 A;  3GEC A;  3T12 B;  2PAV P;  2L4R A;  5MC7 A;  4JBF A;  1KE4 A;  1RP5 A;  4HY8 A;  1LT0 A;  2M1C A;  1A0K A;  3IF6 C;  4FH2 A;  2ZQC A;  4GOG A;  2JKG A;  1YLP A;  1JWZ A;  3C4O A;  5CED A;  4NXE A;  1KOU A;  4GHI B;  2W3F A;  3T4O A;  5F1G A;  3G6O A;  1LSV A;  3HLD A;  1ZG6 A;  3OPH A;  3NBL A;  2HZ5 A;  1DP6 A;  2EWV A;  1T1C A;  4JGP A;  3HLC A;  4PM6 A;  3Q82 A;  3LCE A;  4BD1 A;  1IKG A;  2B5R A;  2Y2N A;  3KSH A;  2NUP C;  4IJG A;  2WAF A;  4MBH A;  1N9O A;  2Y2K A;  3GRJ A;  3GDI A;  4OQG A;  1S6R A;  3PBQ A;  3KX0 X;  2JKF A;  3CZD A;  3S7Q A;  5FA7 A;  5FDS A;  3HLW A;  3ZNT A;  2ZMF A;  4KZ4 A;  5EVE A;  3OPP A;  1F2K A;  3PHY A;  5HDD A;  4WLA A;  5HSQ A;  1Y28 A;  3WWX A;  3LFV A;  3HVF A;  4KZ3 A;  3S4X A;  3UN7 A;  2VGL M;  1P9W A;  3NI9 A;  2WKH A;  3BY9 A;  3E4Q A;  1H8Y A;  1LSW A;  3WRT A;  4JGO A;  3QP1 A;  1KDW A;  4MBK A; 
#chains in the Genus database with same CATH homology
 2P9V B;  2WZX A;  4QD4 A;  3VP0 A;  5L2F A;  3ZG8 B;  5HAP A;  1XGI A;  3SS5 A;  1E4D A;  3I7J A;  4PM9 A;  2IWB A;  3VSL A;  3ZFZ A;  3VP1 A;  1HD8 A;  4E3L A;  3NDE A;  2DRW A;  3V3S A;  4XUZ A;  3SS3 A;  1U60 A;  1XX2 A;  3IWI A;  4DRT A;  5E2E A;  2ZC5 B;  1DJA A;  4R3B A;  1JWV A;  4YFM A;  4S2L A;  3RJU A;  4FCF A;  2XEP A;  3A3J A;  2CC1 A;  2EX8 A;  3SH7 A;  1ERQ A;  3S22 A;  3A3D A;  4Z9Q A;  2EFX A;  3M2K A;  3QHY A;  2ZM8 A;  1YQS A;  1KE3 A;  2Y2Q A;  1YLY A;  4LV0 A;  3IF5 A;  4RVA A;  4OLD A;  5E2G A;  5FAP A;  1RCJ A;  3IH9 A;  2ZC4 B;  1Z6F A;  1KGF A;  3AGE A;  1BLP A;  5FQI A;  3B3X A;  5G18 A;  3WRZ A;  4CJN A;  1XGJ A;  2P74 A;  1FCN A;  3BRM A;  3Q7V B;  4WZ5 C;  1RGZ A;  1BUE A;  4K0X A;  3MFD A;  4GZB A;  5DTT A;  4R4R A;  3UDF A;  1BZA A;  3CJM A;  2DCF A;  1WE4 A;  2ZQ7 A;  5DTS A;  1ESI A;  5HAQ A;  1EWZ A;  4N1X A;  2G2U A;  1K57 A;  3V39 A;  2EXB A;  3E2K A;  3C5A A;  4PM5 A;  3LO7 A;  3DTM A;  3ZDJ A;  1YMS A;  1ERM A;  4U0X A;  1GHP A;  1BSG A;  5D3O A;  4QU3 A;  2WYX A;  4BJP A;  4KQQ A;  2JE5 A;  4QJG A;  3IXD A;  5DF9 A;  1QME A;  4IVK A;  1Q2P A;  1K56 D;  1LHY A;  4E6X A;  4BL3 A;  5FQJ A;  4P87 A;  1KVL A;  5JYO A;  2UWX A;  3W4O A;  5A93 A;  5GHY A;  2HDQ A;  3GSG A;  3LEZ A;  5FI6 A;  1N9B A;  2WK0 A;  4N9K A;  5FDH A;  1CI9 A;  3ZNY A;  3VSK A;  3BFD A;  1PZO A;  4JXV A;  1RGY A;  1E25 A;  2QZ6 A;  3C4P A;  4WMC A;  3O87 A;  4GN2 A;  3GVB A;  3QNB A;  4E3O A;  1JTD A;  3G31 A;  4KZ5 A;  2WGW A;  4LCL A;  3N7W A;  2XR0 A;  1MWR A;  3BM6 A;  3N8S A;  3VP2 A;  2QMI A;  4ZBE A;  4B88 A;  1WYB A;  2H0Y A;  3GTC A;  3IXH A;  3M2J A;  2V20 A;  4S2O A;  5EVI A;  5DF7 A;  1BLC A;  3D4F A;  5GHZ A;  3HLE A;  5DVA A;  1BLH A;  4R1G A;  4GD6 A;  4MBF A;  2EX2 A;  1DJC A;  3FWL A;  3NIA A;  4LV2 A;  1FOF A;  1W5D A;  1YT4 A;  5CEC A;  4Q8I A;  5F82 A;  5GHX A;  3V50 A;  2Z2M B;  1VQQ A;  5FI7 A;  3WS5 A;  2ZMA A;  1JTG A;  3IF6 A;  3G2Y A;  3P09 A;  2OV5 A;  3IT9 A;  2Y2M A;  5KZH A;  4DE2 A;  3V3R A;  4E3M A;  1K54 C;  1PI4 A;  1VM1 A;  2FFY A;  4CPK A;  1NRF A;  4ID4 A;  3VFH A;  4S2N A;  3FYZ A;  4LV3 A;  3FKV A;  3EQV A;  2Y2P A;  2V1Z A;  2H5S A;  4OPY A;  3WS2 A;  3HUM A;  4JXG A;  4OLG A;  3UE0 A;  3FZC A;  4DXB A;  4Y0T A;  3PAE A;  1K4F A;  1BT5 A;  2V2F F;  2JCH A;  3PBT A;  1MXO A;  1TDG A;  3TOI A;  2Y2O A;  5CEB A;  2HP6 A;  4BEN A;  3GV9 A;  4EUZ A;  5DTK A;  2Q9N A;  2WGW B;  1L0F A;  4S2I A;  5FAO A;  3VP3 A;  5CHU A;  4P0M A;  3MXS A;  4X55 A;  2EFU A;  1BLS A;  2PU4 A;  5HW3 A;  1ESU A;  3IWQ A;  4IBR A;  3N8R A;  2X71 A;  4OPZ A;  5EVI B;  3A3F A;  3MKF A;  1XA7 A;  2HP5 A;  3NCK A;  2OLU A;  1OME A;  2Y2G A;  5CTN A;  4ZJ2 A;  5EOE A;  2A49 A;  4MNR A;  4QB8 A;  4GD8 A;  4OVD A;  4C3Q A;  3TG9 A;  3C7V A;  4EBP A;  2R9X A;  2WGV A;  4S2J A;  1MWU A;  1NZO A;  4B4X A;  4S2M A;  5FAQ A;  4DDY A;  4KQO A;  4F94 A;  1CK3 A;  1LI9 A;  1E3U D;  3BLS A;  2FFF B;  4UA9 A;  3IF6 B;  4IBX A;  3PAG A;  5HX9 A;  2XH9 A;  4MBK A;  5CTM A;  1FCO A;  1J9M A;  4U3T A;  2ZJ9 A;  2JC7 A;  4KQR A;  1NYM A;  1MWS A;  2WKI A;  2ZC7 A;  4U0T A;  4E6W A;  4LEN A;  4NK3 A;  3MZD A;  1PI5 A;  3NDG A;  2GDN A;  3IQA A;  1ONG A;  3CG5 A;  2Y91 A;  3ISG A;  3Q81 A;  1YLT A;  1NYY A;  4MEZ A;  3FKW A;  1IYP A;  2Y2L A;  5FI2 A;  1GA0 A;  4GDN A;  4JXW A;  1BUL A;  4PM8 A;  1Y54 A;  3LY3 A;  3PTE A;  4P85 A;  4OP5 A;  1M6K A;  5JYP A;  1FSW A;  1SDN A;  1YLJ A;  2OSU A;  2XK1 A;  3O3V A;  1FR6 A;  2HP9 A;  2ZC6 B;  3BFC A;  5AQA A;  1SDE A;  2WKE A;  4UA6 A;  5M18 A;  1K55 C;  2ZQ9 A;  4KZ9 A;  4HEF A;  1I5Q A;  2BG1 A;  5HFO A;  5CER A;  4K91 A;  4JKT A;  3W4P A;  3BEC A;  4HES A;  5IHV A;  4D2O A;  1MKI A;  2Y2I A;  1IYS A;  2I72 A;  3A3E A;  4GNU A;  1ES4 A;  1PYY A;  1KGE A;  4N92 A;  5CGX A;  1G6A A;  3VOZ A;  1I2W A;  1AXB A;  1ONH A;  1ES2 A;  5GLB A;  4O7D A;  1CI8 A;  1XPB A;  2PU2 A;  1CEF A;  3ITA A;  3QNC A;  5M1A A;  1KGG A;  4EV4 A;  1FR1 A;  3DWK A;  2WUQ A;  2J9P A;  1S0W A;  1K6S A;  2A3U A;  3AGF A;  4C75 A;  4OOL A;  5TR7 A;  2XQZ A;  2EX9 A;  3EQU A;  1MY8 A;  5GLC A;  5AQ7 A;  4R23 A;  4KG2 A;  2JBF A;  2RCX A;  3UDI A;  1IEL A;  1NJ4 A;  5EOO A;  3M6H A;  5FQM A;  1L2S A;  1GCE A;  4HBT A;  5TGF A;  3SH9 A;  4OP8 A;  4DE1 A;  3GMW A;  1FSY A;  4PM7 A;  1XA1 A;  4P6B A;  4R4S A;  4OQ0 A;  3HUO A;  5EE8 A;  4BL2 A;  1HVB A;  5E43 A;  3HLB A;  3HUN A;  5CGS A;  4LV1 A;  3A3I A;  1NZU A;  2G2W A;  4YIN A;  1XKZ A;  3BFG A;  3MXR A;  1K38 A;  3GQZ A;  3UO9 A;  4JXS A;  3ZG5 A;  3BLM A;  1ALQ A;  4IED A;  4KG5 A;  4E3J A;  4NET A;  3G32 A;  5EUA A;  1MPL A;  3VMA A;  5CHM A;  4KEN B;  2ZM2 A;  3OCL A;  4BQM A;  1JWP A;  3UY6 A;  3ZVT A;  4Y0O A;  1YLW A;  3HLG A;  4DXC A;  3N8L A;  3GR2 A;  4WZ5 A;  3OCN A;  3RXW A;  3W4Q A;  3UPO A;  4OON A;  5FQK A;  2H10 A;  1JVJ A;  2J9O A;  2EXA A;  3MBZ A;  3M6B A;  4L0L A;  5KMW A;  4N1H A;  1W7F A;  4MLL A;  3UE1 A;  2C5W B;  3ZG0 A;  4QY5 A;  4DE3 A;  1K55 A;  3LY4 A;  2H0T A;  1ZG4 A;  3IXB A;  5U47 A;  1C3B A;  4WEJ A;  4OH0 A;  2XDM A;  4X6T A;  1W8Q A;  2E8I A;  1KVM A;  3HBR A;  2ZD8 A;  5KSC A;  1PWD A;  5EPH A;  1KDS A;  4KZA A;  2WZZ A;  4QY6 A;  5FQ9 A;  4EBL A;  4S2P A;  1XP4 A;  3BFF A;  1Q2Q A;  3SOI A;  1K6R A;  1DY6 A;  1O7E A;  4GB7 A;  4OOM A;  3ZG7 B;  4OPR A;  4R0Q A;  3HL9 A;  5A91 A;  4RX3 A;  3FV7 A;  1CEG A;  4BLM A;  3PBS A;  1I2S A;  3ZCZ A;  1L0E A;  1GA9 A;  1FQG A;  4KZ7 A;  1TVF A;  4R3J A;  5GLA A;  4WMC D;  1K57 C;  3VOY A;  1PZP A;  1PWC A;  4RX2 A;  3Q07 A;  4JLF A;  1TEM A;  4WYY A;  1K25 A;  1HZO A;  3E2L A;  4OKP A;  1PW8 A;  2XD5 A;  3O88 A;  2BLS A;  4FSF A;  4HBU A;  3BFE A;  1K56 A;  3OPL A;  5FSR A;  3OC2 A;  3UPN A;  4B4Z A;  5A92 A;  1QMF A;  1EI5 A;  1LL9 A;  5EVI D;  3ITB A;  4X69 A;  4GDB A;  5GLD A;  4OOY A;  5F83 A;  3MZE A;  4RYE A;  1L0D A;  2PBY A;  4FD8 A;  4E3N A;  3IXG A;  4BD0 A;  5J8X A;  5HAI A;  3OZH A;  4OPQ A;  4RA7 A;  1N4O A;  3IH8 A;  5FAS A;  1MWT A;  5M19 A;  5GL9 A;  1MBL A;  3VP4 A;  4ZAM A;  4KZB A;  1NY0 A;  5CHJ A;  1IKI A;  1K54 A;  1YLZ A;  5EEC A;  2WGI A;  4JPM A;  4OQI A;  2XD1 A;  1YMX A;  1ZC2 A;  4XUX A;  2IWC A;  1GHI A;  2Y55 A;  3N6I A;  2WAE A;  5EVI C;  5HAR A;  1IYO A;  4JBF A;  1KE4 A;  1LLB A;  1RP5 A;  1BTL A;  4DKI A;  5CRF A;  4E3K A;  1PWG A;  4KZ8 A;  4E3I A;  2ZC3 B;  1ES5 A;  1ERO A;  3NY4 A;  4Y0U A;  2X02 A;  3UNW A;  2ZM0 A;  3PBR A;  2EX6 A;  4KG6 A;  2XLN A;  3IF6 C;  2XF3 A;  2ZLY A;  3G2Z A;  2IWD A;  2ZQC A;  4FH2 A;  4GOG A;  3G35 A;  1YLP A;  4A5R A;  4KZ6 A;  3N4I A;  1M40 A;  1L0G A;  5AQ9 A;  3WS0 A;  2OLV A;  1JWZ A;  3C4O A;  3DWZ A;  3G4P A;  3MKE A;  1ES3 A;  3ZG9 B;  3IHA A;  5CED A;  5BOH A;  4IVI A;  4DDS A;  4S2N C;  5FAT A;  3P98 A;  2J8Y A;  3VFF A;  1XXM A;  1TDL A;  2Y59 A;  1H5X A;  3JYI A;  2Y4A A;  3HRE A;  5F1G A;  3C7U A;  3HLD A;  1W79 A;  4UA7 A;  4DE0 A;  1ZG6 A;  3SH8 A;  3OPH A;  1LL5 A;  2ZQD A;  4OQH A;  3RXX A;  3NBL A;  4EQI A;  4ZDX A;  3WS1 A;  3CMZ A;  2RL3 A;  1IYQ A;  4PMA A;  4EWF A;  4LCM A;  4ZJ1 A;  2HDR A;  4WM9 A;  3PBO A;  2XFS A;  3G30 A;  1ZKJ A;  2Z2L B;  1K4E A;  4JF4 A;  3HLC A;  4PM6 A;  5E2F A;  2XGN A;  1PW1 A;  3Q82 A;  3W8K A;  5KSH A;  3LCE A;  3DW0 A;  4QHC A;  5EVL A;  4BD1 A;  3IHB A;  4S2K A;  2VGJ A;  1IKG A;  2B5R A;  2Y2N A;  2WAD A;  3MZF A;  4M3K A;  3G34 A;  2P9V A;  2C6W B;  2WAF A;  3UPP A;  2XFT A;  4MBH A;  5CXW A;  5A90 A;  2Y2K A;  2VGK A;  5E2H A;  2X01 A;  4C6Y A;  4WBG A;  1YM1 A;  2J7V A;  2HDS A;  4K0W A;  2R9W A;  3GRJ A;  4JF5 A;  4OQG A;  1S6R A;  4PPR A;  3PBQ A;  1E3U A;  1HTZ A;  5HL1 A;  3HLF A;  4FH4 A;  1H8Z A;  3OPR A;  1SKF A;  3IWO A;  3BEB A;  1KE0 A;  1W8Y A;  4Y7P A;  3CZD A;  2ZQA A;  5FQQ A;  4GKU A;  5FA7 A;  2QPN A;  3HLW A;  4X53 A;  3ZNT A;  3SS4 A;  2Y2J A;  4WZ4 A;  4KZ4 A;  1LI0 A;  1DJB A;  3AGD A;  3Q1F A;  4DF6 A;  3OPP A;  4X68 A;  3S1Y A;  5TFQ A;  3ZVW A;  2HDU A;  3Q7Z A;  2Y2H A;  3WS4 A;  1FCM A;  1WYC A;  1PIO A;  3TSG A;  3ZGA B;  3WWX A;  1SCW A;  3HVF A;  4ZJ3 A;  4KZ3 A;  3UDX A;  4UAA A;  3O86 A;  1IEM A;  4WEL A;  3Q7V A;  4WEK A;  4XXR A;  3S4X A;  3UN7 A;  5I94 A;  3UE3 A;  5CGW A;  1GHM A;  3ZHH A;  5DF8 A;  4JF6 A;  3NI9 A;  2WKH A;  3BYD A;  3PBN A;  4X56 A;  3V5M A;  2HPB A;  1SHV A;  5F1F A;  1O07 A;  4ZTK A;  4EBN A;  4N9L A;  2Q9M A;  3WRT A;  1H8Y A;  5AQB A;  2ZQ8 A;  4H8R A;  1NXY A;  3NC8 A;  4UHU A;  1KDW A;  1G68 A;  2DNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...