2J9OA

Structure of pbp-a, l158e mutant
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
264
structure length
264
Chain Sequence
LPPERPLTNLQQQIQQLVSRQPNLTAGLYFFNLDSGASLNVGGDQVFPAASTIKFPILVAFFKAVDEGRVTLQERLTMRPDLIAPEAGTLQYQKPNSQYAALEVAELMITISDNTATNMIIDRLGGAAELNQQFQEWGLENTVINNPEPDMKGTNTTSPRDLATLMLKIGQGEILSPRSRDRLLDIMRRTVTNTLLPAGLGKGATIAHKTGDIGIVVGDAGMVDMPNGQRYVAAMMVKRPYNDPRGSELIRQVSRMVYQAFEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TLL2115 PROTEIN
publication title Structure of Pbp-A from Thermosynechococcus Elongatus, a Penicillin-Binding Protein Closely Related to Class a Beta-Lactamases.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 98
structure length 264
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2j9oA01
3OZHA 4P0MA 4Y0TA 1JWPA 1IYQA 1PZPA 4RX3A 3M2JA 1XA1A 1W7FA 1MWRA 1C3BA 3A3FA 5CTNA 5E2FA 4BJPA 1BT5A 3RXWA 2WAFA 4QY6A 4R0QA 4E3OA 2WK0A 3PBSA 3AGFA 4A5RA 4OOYA 5HARA 2FFYA 3O87A 4OLGA 3V3RA 4IBRA 3MXRA 3ZGAB 4OLDA 1WYCA 1K6RA 2OSUA 4BL3A 2Z2LB 3OCNA 5E2EA 3OPRA 3HLCA 2GDNA 4HEFA 3GQZA 4XUXA 1PZOA 2V1ZA 4JXVA 5GLAA 4BENA 2RL3A 4IBXA 4GDBA 2HDRA 3MKEA 4M3KA 1E4DA 1DJBA 1XXMA 5GHXA 1SCWA 4IVKA 1MXOA 2Y2OA 4PM9A 4S2JA 5EVIC 1K38A 4Y7PA 1K56D 2ZM2A 3G35A 4S2IA 4LV2A 4GKUA 5E2GA 3ZDJA 1XGIA 1EWZA 3IQAA 5CEDA 1LL5A 2ZM8A 1YLYA 3Q7ZA 2ZC6B 4OOLA 4UA7A 4ZJ1A 4EWFA 3G2ZA 4C75A 3OPLA 5HAIA 4ZJ2A 3G2YA 5DVAA 5FQKA 2WGIA 1IELA 4GOGA 3HLEA 4O7DA 3ZG8B 3HL9A 2QPNA 3DTMA 5GLCA 3BLSA 5EVIA 5FATA 4D2OA 3FYZA 3BLMA 4IVIA 4BD0A 3V5MA 1KGFA 1DJAA 4Y0OA 4LCLA 3M6BA 5FQIA 3VP0A 3C4OA 1KE3A 3HLDA 4LV0A 5EPHA 4JXWA 5CHJA 5CHMA 5HX9A 1AXBA 3C4PA 3WS2A 4X56A 5FQJA 3M2KA 3ZCZA 3S22A 2J7VA 2H10A 1RGYA 2WGVA 3G4PA 3GSGA 1ES5A 4OPQA 3MZDA 3E2KA 1MY8A 3MBZA 5M19A 4JXSA 3C5AA 4R4RA 3RJUA 4BD1A 5EVIB 1PIOA 1NYYA 3WS4A 4OPYA 1FOFA 3OPPA 1IKIA 3WRTA 4S2OA 1ZC2A 3DWZA 5F1GA 2XK1A 3IXDA 5FI2A 3UDXA 2DRWA 2J9OA 4DXBA 1E3UA 2XDMA 3LCEA 1IKGA 3UDIA 4X55A 5DTTA 5TGFA 5CEBA 2OV5A 1ZG4A 3G30A 3FKWA 3GV9A 4KZAA 4N9KA 1KE0A 3PBQA 2C5WB 3WS1A 4U3TA 5G18A 2UWXA 3BFDA 2Y2QA 5KSCA 2CC1A 2WZZA 1MWTA 3BFFA 1K25A 4CPKA 4ZTKA 3SH7A 1I2SA 4UHUA 4WBGA 3IF5A 1HZOA 4QHCA 4JKTA 3VFHA 4UAAA 3BRMA 1K57A 2Q9MA 3JYIA 3Q07A 3Q81A 5IHVA 5F83A 1ESIA 4LCMA 5HL1A 1XA7A 3G34A 4R1GA 1I2WA 2H0TA 4OP8A 4QY5A 1N4OA 4OKPA 1ES4A 4KZ6A 4NK3A 1FCNA 1L0DA 4GB7A 4R3BA 4E6XA 3ITAA 5AQAA 1XPBA 3O86A 5A90A 2IWBA 3WWXA 2ZQAA 4CJNA 4GZBA 4EBNA 2XEPA 2WKIA 3EQUA 3ZG9B 2WYXA 4IEDA 3FKVA 4WEJA 1L0GA 2J9PA 1XX2A 3A3DA 3WRZA 1U60A 4KENB 2XD5A 3Q82A 1ERMA 1ONGA 2XGNA 3SS3A 4DE2A 5I94A 4WEKA 3O88A 2Y4AA 2WGWB 3VOYA 1Z6FA 1JTGA 1BLHA 4MBKA 4DDYA 4X69A 1IYOA 1K6SA 2Y2KA 1W8YA 1RP5A 2ZQ8A 3SS4A 3GVBA 3QHYA 3VFFA 5FQMA 3TOIA 4KG5A 1GCEA 1CI8A 2EXBA 1PWDA 3IH9A 5HFOA 2ZQ7A 4GDNA 5CTMA 1CEFA 5FI7A 5FASA 4PMAA 2EX9A 5M1AA 5J8XA 1BLSA 1YLWA 4E3KA 2XH9A 4PM8A 3FV7A 3Q7VA 3G31A 2P74A 1XGJA 3HBRA 5CHUA 5KZHA 4OPZA 1CK3A 1S6RA 4QD4A 5F82A 3ZNTA 1LL9A 1KGEA 2Y55A 3HVFA 2Y2GA 3UE0A 3CG5A 2HDSA 2DCFA 3BFGA 3UNWA 5DF9A 2QMIA 5HW3A 1W8QA 4WMCA 3M6HA 2X02A 3ZG5A 1JVJA 2P9VA 4QJGA 1IEMA 3HLWA 1SKFA 3N8RA 1VQQA 4EV4A 2EFXA 1EROA 3MZEA 4RX2A 3VMAA 3Q7VB 1SDNA 1E25A 3SS5A 1BSGA 3UPNA 4HESA 3C7VA 3HLBA 3VSLA 5FA7A 1CI9A 1YMXA 3UDFA 4N9LA 4FD8A 4LENA 3ZG0A 1JWZA 2PU4A 1W79A 3EQVA 3A3IA 2V20A 3BFCA 5JYOA 4KZ8A 3MFDA 1BTLA 1MKIA 2G2UA 5AQ9A 1MPLA 5DTKA 4E3NA 1JWVA 4U0TA 4WM9A 2E8IA 4DDSA 2HPBA 4KG2A 5TR7A 2P9VB 1FCOA 1TVFA 3C7UA 4KZ7A 2XD1A 2ZMAA 1CEGA 3LY4A 2Y91A 4OQGA 4YINA 1LI9A 2Y2NA 3NBLA 3A3JA 5CGXA 4MLLA 1GHMA 1SDEA 5KMWA 4Z9QA 1ONHA 2XF3A 3LY3A 1GA0A 4UA6A 4DRTA 2ZD8A 3IF6C 1PW1A 3W8KA 4R3JA 4X6TA 4ZJ3A 3AGEA 4E3LA 4H8RA 3IXBA 3BYDA 4DE0A 2ZQCA 1J9MA 4ZBEA 4JF5A 4DE1A 4K91A 5HAQA 4RYEA 4EBLA 4EQIA 1G68A 3GTCA 3PBNA 4F94A 3NCKA 3UO9A 4ZAMA 1GHPA 1O07A 1XP4A 5U47A 1BUEA 3V39A 1BLCA 1M6KA 2XLNA 2ZQ9A 4PM6A 3VP4A 2WAEA 3LO7A 1HD8A 2V2FF 4S2PA 3IF6A 4KG6A 5FAQA 3VP1A 5HAPA 1YLZA 4ID4A 4JXGA 2G2WA 5FSRA 5CERA 3W4PA 4S2NC 1BLPA 3VP3A 4MBHA 2ZC4B 1YLPA 5E43A 5A93A 2Y2HA 4B88A 4E6WA 1EI5A 1ESUA 2Q9NA 1K56A 2QZ6A 4YFMA 3N8LA 1Q2PA 4E3IA 4KQQA 3MXSA 3ZG7B 3PBOA 4FSFA 1L0EA 1KVMA 2J8YA 4P6BA 4RA7A 3PBTA 2WZXA 3CZDA 3N7WA 3ISGA 3N8SA 2ZM0A 4S2NA 4WZ5C 4C6YA 1QMEA 3QNBA 3WS5A 3HLFA 5GHYA 1IYPA 1KE4A 5EVID 4MNRA 1KDWA 1KVLA 3MZFA 5CECA 2JC7A 1NYMA 1FCMA 1FSYA 4Q8IA 3DWKA 3DW0A 3OCLA 2Z2MB 3SOIA 1NJ4A 5FQQA 3UY6A 3SH9A 3UN7A 2ZC3B 1PI5A 1ZKJA 2A3UA 3HUMA 3E2LA 3W4QA 4B4ZA 3V50A 1BULA 1H5XA 4OQ0A 5EVLA 3UE3A 4WZ5A 2WKHA 2Y2JA 3N4IA 5M18A 1ES3A 4EBPA 3IWQA 1RGZA 4PPRA 3I7JA 4GD8A 4S2LA 3GMWA 5GHZA 3O3VA 1SHVA 4LV3A 2JE5A 1K55C 4HBUA 4KZBA 1NY0A 2ZLYA 2C6WB 1E3UD 4S2KA 3PAEA 5EOEA 5GLBA 4BQMA 1FR6A 2VGKA 2I72A 4R4SA 4QB8A 1XKZA 2XFSA 3FWLA 2PBYA 4WZ4A 4JPMA 2A49A 3UPPA 1NXYA 3AGDA 4KQOA 2H5SA 5FQ9A 3IWOA 5CGSA 3IWIA 4OONA 5D3OA 3V3SA 2EXAA 2EX6A 2HP5A 1MWUA 3D4FA 3SH8A 3NIAA 3ITBA 3BM6A 4MBFA 2BG1A 1TDGA 4OQIA 5CRFA 1K55A 1K54C 2RCXA 4PM5A 2JCHA 4OP5A 4QU3A 1TDLA 2WKEA 3NDEA 2WADA 4UA9A 2IWDA 1PI4A 3HLGA 3S1YA 5A92A 4KZ5A 4S2MA 2Y59A 5TFQA 4KZ4A 5KSHA 4GD6A 5E2HA 2EFUA 1S0WA 1DY6A 3ZVTA 3ZVWA 5A91A 4E3JA 5EOOA 4ZDXA 2H0YA 2ZC7A 4KZ3A 1MWSA 4JF6A 4KZ9A 3ZHHA 5FI6A 1OMEA 4WYYA 5GLDA 4OVDA 3W4OA 1K54A 4MEZA 3WS0A 4U0XA 2PU2A 1GHIA 1G6AA 4KQRA 4LV1A 2Y2PA 1L2SA 1LHYA 1Y54A 3BECA 1O7EA 1KDSA 2OLUA 1PYYA 2HP9A 1LI0A 1QMFA 1IYSA 1RCJA 1LLBA 1K4EA 3VSKA 4OOMA 4Y0UA 3NY4A 1PW8A 1H8YA 3N6IA 3PBRA 2DNSA 3IT9A 1ALQA 4B4XA 2WUQA 3S4XA 4GN2A 5DTSA 3GRJA 3IHBA 2HDUA 1BZAA 1K4FA 3B3XA 3PTEA 4OQHA 3IH8A 1L0FA 5EE8A 3NC8A 1YT4A 5EECA 3UE1A 5FDHA 2Y2IA 4K0WA 4EUZA 3UPOA 5CGWA 1Q2QA 2ZJ9A 3PAGA 3RXXA 4C3QA 4JLFA 1KGGA 4OPRA 1PWCA 3CMZA 4GNUA 5DF7A 1FSWA 3VOZA 2ZQDA 3QNCA 1W5DA 2HP6A 4N1HA 1YM1A 4FH4A 3P09A 3NI9A 4OH0A 2B5RA 2Y2LA 5AQBA 5DF8A 2OLVA 1FR1A 1JTDA 4X68A 3IXHA 4P85A 5EUAA 4E3MA 4XUZA 1YMSA 4K0XA 3LEZA 4DE3A 1YQSA 4R23A 2EX2A 1MBLA 4FCFA 1NZOA 4BLMA 1K57C 3HUOA 3P98A 1YLTA 1ERQA 4WMCD 3VP2A 3TSGA 2X71A 5L2FA 2EX8A 3IF6B 3BFEA 4JF4A 4P87A 1PWGA 3Q1FA 1TEMA 1FQGA 4HBTA 2XFTA 2Y2MA 2R9WA 2VGJA 1I5QA 1WE4A 5JYPA 5BOHA 1ZG6A 4JBFA 5FAPA 3A3EA 2XR0A 2R9XA 1VM1A 5F1FA 3MKFA 3HUNA 2BLSA 3NDGA 3ZNYA 3BEBA 4N1XA 5FAOA 5GL9A 1WYBA 3CJMA 1HVBA 4DKIA 1N9BA 4N92A 1YLJA 3G32A 1H8ZA 2XQZA 2WGWA 5AQ7A 3OC2A 3ZFZA 4XXRA 3HREA 3GR2A 3OPHA 4DXCA 4WELA 1M40A 1HTZA 1ES2A 4FH2A 3FZCA 2HDQA 4DF6A 1DJCA 2FFFB 2JBFA 4L0LA 2IWCA 1GA9A 1NRFA 4RVAA 3IHAA 4NETA 4PM7A 2X01A 2ZC5B 3TG9A 4X53A 1NZUA 4BL2A 5CXWA 3IXGA
chains in the Genus database with same CATH superfamily
4HH3A 1KOUA 1C3BA 5CTNA 2YKHA 2W1RA 1VEUA 3RXWA 3ZYTA 4X25A 3O5YA 2FFYA 2EA9A 3A0RA 2XA7S 5E2EA 3OPRA 1UGUA 2M1CA 2GDNA 4HEFA 3GQZA 4DMZA 1XFQA 2V1ZA 5FDSA 3FPWA 2HDRA 3MKEA 3LIBA 1XXMA 1SCWA 3ULFA 3LIAA 1MXOA 2Y2OA 4PM9A 1K56D 1XJ2A 4GKUA 5CEDA 3MQ0A 3UMEA 4ZJ1A 3G2YA 2WGIA 1IELA 1V9ZA 3HLEA 3ZG8B 3DTMA 3T4QA 3BLMA 4IVIA 4BD0A 4YOFA 3V5MA 1KGFA 5FQIA 4NXBA 5CHMA 1OT6A 3WS2A 1TS7A 2KX6A 2KLIA 3G4PA 1ES5A 3EOIA 3MBZA 2R78A 3UB8A 4R4RA 3RJUA 5EVIB 1PIOA 2K2NA 3OPPA 1IKIA 2MJ6A 2B02A 2PDRA 1ZC2A 2XK1A 2J9OA 1E3UA 3UDIA 4I39A 2OV5A 4N9KA 4JGQA 5HWVA 1MKMA 1VHMA 3BFDA 3IX4A 4CPKA 1MWTA 4UHUA 3IF5A 4JKTA 3VFHA 3H9WA 3MMHA 3BRMA 1K57A 2HJ9C 3G6OA 3F1OB 3T1XA 3G34A 4OP8A 4OKPA 4KZ6A 1N9LA 3KO6A 5AQAA 5A90A 4JGRA 4EBNA 2WKIA 2WYXA 2VZWA 1LSVA 3FKVA 3KSHA 1L0GA 1XX2A 2XD5A 3Q82A 4DE2A 3TW8A 2WGWB 4CLCC 1Z6FA 1JTGA 4MBKA 3T4KA 4X69A 1K6SA 2Y2KA 2ZQ8A 5FQMA 3TOIA 2HZ5A 5DJTA 1CI8A 4GDNA 1CEFA 1CJFA 5KZHA 1XGJA 4G3WA 3K3CA 1LL9A 1KGEA 4Y5FA 1OTBA 3BFGA 3UNWA 4JGOA 2P9VA 1SKFA 3CAXA 3N8RA 5AVEA 3Q7VB 3SS5A 3HLBA 1W79A 4KZ8A 5F6AA 3C2WA 1MPLA 1T18A 4WM9A 1VETB 4GHIB 2ZMAA 2Y91A 4KQDA 1H3QA 3NBLA 3A3JA 1GHMA 2L0WA 1ONHA 3LY3A 4DRTA 3R7WA 4HH2A 4R3JA 4X6TA 4ZJ3A 1SKOB 2ZQCA 1J9MA 4JF5A 4K91A 2AVXA 4EBLA 4EQIA 1G68A 3GTCA 5C5KA 5U47A 1BUEA 3VP4A 5TBMB 3IF6A 3KX0X 1YLZA 3E98A 3CWFA 5CERA 4S2NC 3VP3A 3LYXA 2V9AA 2ZOIA 3K2NA 2QZ6A 1K56A 2K7SA 4KQQA 3NULA 2J8YA 1D7EA 4RA7A 3CZDA 1QMEA 3QNBA 4R70A 2Y79A 3MZFA 3S7NA 4EXOA 1VB6A 1FCMA 4Q8IA 3F1PA 1XJ3A 3DW0A 2Z2MB 4D60A 1NJ4A 3UY6A 3BY9A 3H82B 3SH9A 2ZC3B 1PI5A 4I3AA 2PYRA 3T1RA 2PRFA 3VV4A 3T4LA 5M18A 3CITA 4HI4A 4GD8A 1F98A 3KSGA 4NG2A 1K55C 2GNXA 4DJ2A 4I5SA 2L1MA 4AFIA 1FR6A 3RTYA 1ACFA 3D3OA 1P0ZA 5FQ9A 3IWOA 4OONA 5D3OA 2HP5A 1MZUA 3SH8A 4ETXA 3MF0A 2WADA 3IX3A 4KZ5A 4S2MA 5KSHA 1DY6A 3MFXA 5EOOA 2ZC7A 5FI6A 1OMEA 4WYYA 4L9EA 2W3HA 1K54A 2Y8HA 1GHIA 2ZBBA 2Y2PA 1LHYA 3BECA 2B95A 1O7EA 1KDSA 5FL3A 3E4OA 1LLBA 1N9NA 4II7A 1K4EA 3VSKA 3N6IA 3IT9A 2WUQA 3IHBA 3B3XA 5HD3A 3IH8A 1L0FA 1FILA 4FOFA 3T1SA 5FDHA 3RXXA 4JLFA 1KGGA 4OPRA 1FSWA 2HP6A 4N1HA 2B5RA 2Y2LA 3B42A 2NUPC 4X68A 3IXHA 2D02A 1MBLA 1S1ZA 4FCFA 1STZA 4Y13A 1Z09A 4ARZB 3BW6A 3BFEA 3IBRA 4JF4A 2FZ0A 1S4RA 3Q1FA 4LPZA 3CPTB 2VV8A 3EGDC 1WE4A 4JBFA 2V1AA 1VM1A 2GX5A 3IBJA 2BLSA 3NDGA 3BEBA 4BMWA 4N1XA 2VLGA 5GL9A 1WYBA 3CJMA 1HVBA 4DKIA 2HJEA 1N9BA 2WGWA 3H7WA 1PRQA 3GR2A 1M40A 4FH2A 1A0KA 2HDQA 3MR0A 1TD5A 4RVAA 4NETA 5EV0A 3TG9A 3OZHA 2VGLM 4Y0TA 1JWPA 4RX3A 5EFWA 1BT5A 5EM1A 4QY6A 4R0QA 2OAQ1 3AGFA 1ZTUA 3V3RA 4IBRA 4OLDA 1WYCA 3K3DA 2Z2LB 4BBUA 3U2AA 4XUXA 2V1BA 4Q0HA 4IBXA 3S7OA 3BQAA 4M3KA 5GHXA 4HY8A 5DKKA 2ACGA 4LV2A 5E2GA 1XGIA 1LL5A 1OJ5A 3Q7ZA 4OOLA 4EWFA 1S4SA 1SZVA 4ZJ2A 5DVAA 4O7DA 1XJ4A 4QWOA 4Y0OA 4R3AA 4LV0A 5EPHA 3MS6A 5FQJA 3M2KA 2VX8A 2J7VA 2H10A 1H8MA 3GSGA 4OPQA 3E2KA 3NECA 4JXSA 2KDKA 1NYYA 3WS4A 3WRTA 5F1GA 3IXDA 3UDXA 4QPRA 1YAXA 4WN5A 5AVFA 5DTTA 3WS1A 2UWXA 4LLOB 2ZMFA 4ZTKA 2PD7A 1HZOA 4UAAA 1UWNX 3JYIA 3Q81A 4LCMA 5HL1A 2BTFP 4IUKA 2J80A 1I2WA 4DJ3A 2M7UA 1ES4A 1F9IA 1J3WA 1FCNA 1L0DA 4GB7A 4E6XA 2IWBA 3WWXA 4CJNA 2XEPA 5CX7A 4WEJA 3WRZA 1ERMA 5I94A 1L3LA 2Y4AA 3LFVA 3F1NA 1BLHA 1D1JA 1IYOA 1W8YA 2DMWA 1GCEA 4I38A 1PWDA 3FC7A 5J8XA 1TF1A 2JKTM 4PM8A 3G31A 4PKYG 3HBRA 4QD4A 3ZNTA 5HZHA 4ME4A 1X0OA 2Y55A 2DCFA 2J3TD 5HW3A 1W8QA 3M6HA 5MC7A 4O8GA 4O0PA 4CLCB 1VQQA 3VMAA 5L09A 3BY8A 1SDNA 1BSGA 3VE3A 2G7UA 2V20A 5JYOA 4P6ZM 4NKPA 4DDSA 1H0MA 2HPBA 1FCOA 3T4JA 5CGXA 3DTEA 4Z9QA 2XF3A 2GJ3A 3IF6C 2QJ5A 3DTKA 4LRYC 4ZBEA 4DE1A 5HAQA 1D06A 2W1TB 4RYEA 3TRCA 3PBNA 4F94A 2O9BA 3NCKA 2LB9A 3UO9A 1GHPA 2XLNA 4PM6A 2WAEA 3FG8A 4S2PA 3VP1A 3DAVA 2QYBA 2G2WA 3W4PA 1EW0A 4HQAA 3MQQA 4MBHA 5E43A 5A93A 2Y2HA 1Y28A 2I9VA 4YFMA 2M7VA 1PFLA 2PR6A 4E3IA 3MXSA 3ZG7B 3HJIA 2A2LA 4WUJA 3T12B 2WZXA 3N7WA 3ISGA 3WS5A 2ZL1B 5GHYA 1IYPA 1KE4A 3QP5A 5EVID 3JVUA 3OLOA 2A24A 2P08A 3OCLA 1ZKJA 2A3UA 3E2LA 1UWPX 1H5XA 3UE3A 5G4YA 4IHQA 4WZ5A 4G3KA 2ZOHA 3ICYA 4EBPA 4Z1WA 4PPRA 4S2LA 5HWTA 1P97A 4XT2A 1T19A 2ZLYA 3KSFA 3PAEA 5EOEA 5GLBA 4QB8A 1XKZA 4WZ4A 2PBYA 4KQOA 2LB5A 5CGSA 2PHYA 4GS9A 1NLZA 2PYPA 2JKRM 5A8BA 4BBVA 1G6OA 1K54C 3KYZA 2RCXA 2JCHA 4OP5A 2WKEA 4HNBA 3NDEA 3HLGA 2HGVA 2Y59A 2FH5A 1S0WA 3HJKA 2VJWA 1YPRA 1MWSA 4JF6A 5GLDA 4G3VA 4MEZA 1MC0A 2PU2A 1G6AA 1DRMA 4LV1A 1Y54A 3OBFA 4PKYA 1IYSA 2QJ7A 3D72A 1ODVA 3LI8A 2HDUA 5EE8A 2D01A 2L4RA 3C8CA 4LRXC 4X1LA 5EECA 3UE1A 2Y2IA 1LSWA 5CGWA 4X1MA 4C3QA 3IS2B 3BWLA 3CMZA 2ZQDA 1YM1A 3P09A 4H6JB 3RH8B 4F3LB 1JTDA 1TS0A 3LEZA 2PR5A 3PYPA 3LR4A 4R6LA 4HOIA 3SZTA 3D9YA 3CUEA 4WMCD 3VP2A 3TSGA 2O9CA 1PWGA 4CLCE 1TEMA 2R9WA 2VGJA 4HJ4A 5JYPA 5BOHA 1ZG6A 3A3EA 1T1AA 2R9XA 3MKFA 3HUNA 1OPXA 3R4KA 5FAOA 1H8ZA 3OC2A 1T1CA 3HREA 4XXRA 4DXCA 4WELA 1ES2A 3KSIA 3L9KA 4DF6A 2FFFB 4L0LA 2JBFA 1NRFA 4X53A 4MN6A 1OTIA 3IXGA 4P0MA 1IYQA 1PZPA 1XA1A 1W7FA 1MWRA 2W3EA 4BBTA 2WAFA 4E3OA 2WK0A 3PBSA 3TE8A 5HARA 3O87A 3MXRA 3ZGAB 1K6RA 2WKQA 2OSUA 5DJUA 1DP9A 4Y2FA 3HLCA 5GLAA 2RL3A 4FTXA 4GDBA 1VEUB 1DJBA 2PT7A 2NUTC 4NXGA 5HDDA 4Y7PA 3ZQ5A 2ZM2A 3ZDJA 2ZM8A 1YLYA 4WLAA 5FQKA 3HL9A 3BLSA 5EVIA 5FATA 3FYZA 3PR6A 3M6BA 4YNRA 3C4OA 1KE3A 3HLDA 1F2KA 4JXWA 5CHJA 5HX9A 1AXBA 3C4PA 4RQ9A 4MCWA 5KIZA 3MZDA 1MY8A 1ZHHB 3C5AA 5K5BA 1CQAA 4B93A 2INWA 2O99A 5FI2A 4DXBA 3LCEA 4GW9A 2GZAA 5G4ZA 3GV9A 4KZAA 4IJGA 3F1OA 3PBQA 4U3TA 5KSCA 2Y2QA 2WZZA 4Y17A 1K25A 5IU1A 2JHEA 3B33A 4QHCA 2BASA 4HIAA 2VV7A 2Q9MA 4Y3IA 3Q07A 5IHVA 5F83A 1ESIA 2H0TA 1N4OA 5FEGA 4GCZA 5HDSA 4R3BA 3ITAA 3LI9A 2ZQAA 3LIDA 4IUHA 4GZBA 3LR3A 3EQUA 3RFBA 3A3DA 2VK3A 2PD8A 4KENB 3MXQA 1ONGA 2XGNA 3SS3A 2VGLS 4WEKA 3O88A 5LBRA 4MN5A 3LR0A 5AJGA 4DDYA 5HPIA 2JN7A 1RP5A 3GVBA 3QHYA 4KG5A 2EXBA 3LUQA 1JNUA 5HFOA 2ZQ7A 5FI7A 5FASA 4UQIM 5M1AA 2EX9A 4UQIS 4E3KA 2XH9A 3NOPC 3EWKA 3FV7A 3Q7VA 3T4SA 2KOIA 1IFQA 3U4LP 3HVFA 5FEFA 3UE0A 4L9FA 2E8JA 3LGOA 2HDSA 2P04A 5DF9A 2QMIA 1IOUA 4WMCA 2X02A 3ZG5A 4NXEA 4QJGA 1IEMA 3HLWA 1VETA 4GHIA 1EROA 3MZEA 1E25A 3UPNA 3VSLA 2V8CA 5FA7A 1CI9A 3UDFA 4N9LA 4FD8A 3ZG0A 2JKFA 1JWZA 3E4QA 3EGXC 3A3IA 3BFCA 1SKOA 1MKIA 5DTKA 4E3NA 1V9YA 1JWVA 4U0TA 2Z6DA 3MJQA 5TR7A 4KG2A 2P9VB 4EQ1A 2XD1A 5L8MA 3LY4A 2Y2NA 4MLLA 1SDEA 1YSQA 5TBMA 5KMWA 4ZRRA 4UA6A 3W8KA 4K08A 4F3LA 1OTAA 3AGEA 4H8RA 3IXBA 1W63M 4DE0A 3NOUC 3PHYA 4ZAMA 1O07A 3V39A 1BLCA 2ZQ9A 2W3GA 3LO7A 2V2FF 2O9AA 4KG6A 1PNEA 1OTEA 3R7WB 4HP4A 3QP1A 4B88A 3N8LA 3H82A 1Q2PA 5HL6A 4FSFA 3KYEA 4P6BA 1KVMA 2WKRA 3N8SA 2ZM0A 4WZ5C 4C6YA 3HLFA 4WL9A 1KDWA 1KVLA 5CECA 3LIFA 5IT5A 1NYMA 1FSYA 3DWKA 3SOIA 3FPVA 3UN7A 3HUMA 3T4TA 3W4QA 3V50A 1BULA 4OQ0A 2Y2JA 3N4IA 4L9GA 3IWQA 1YKDA 1RGZA 3GMWA 5GHZA 3E0YA 4LV3A 3F1PB 4HBUA 2HV1A 4EERA 2EWVA 2I72A 3FWLA 2A49A 3UPPA 2XA7M 3AGDA 4EETB 3IWIA 2EXAA 1MWUA 3QP8A 3NIAA 4MBFA 1FIKA 5HWWA 4PM5A 1TDLA 4UA9A 1PI4A 3S1YA 3PXPA 4KZ4A 4GD6A 1NWZA 5E2HA 1G28A 4GLQA 2EFUA 3ZVWA 3ZVTA 5A91A 1GSXA 4ZDXA 3T1QB 4KZ9A 2JKTI 3ZHHA 5DFYA 4OVDA 4Y15A 1AWIA 3CLOA 3W4OA 3WS0A 4P6ZS 4KQRA 1F5MA 4PHTA 1L2SA 4R38A 2OLUA 3UB5P 1PYYA 1LI0A 1QMFA 4MN7A 1RCJA 4Y0UA 3NY4A 1H8YA 3PBRA 3W2ZA 2DNSA 3MSHA 3T50A 4GN2A 5DTSA 3GRJA 4OQHA 1K4FA 4HP9A 4EW7A 3TJZC 3QP4A 1N9OA 3DBAA 4EUZA 3PAGA 1PWCA 4GNUA 3SW1A 5DF7A 4EEUA 3QNCA 4FUWA 3CUEC 4ARZA 3NI9A 5J7EA 4CLCD 2J3TC 3CPTA 4P85A 4E3MA 4XUZA 1YMSA 4K0XA 4DE3A 1YQSA 4R23A 3CHWP 2EX2A 1NZOA 4BLMA 3BQ8A 3HUOA 1YLTA 3VOLA 2VA0A 5L2FA 2EX8A 2H28A 3HCYA 4HBTA 1I5QA 5F1FA 1YLJA 3NOTC 5AQ7A 4HHDA 3ZFZA 3OPHA 1HTZA 4LFUA 1LL8A 4BWIA 1GA9A 4PM7A 2P7JA 2ZC5B 2X01A 1NZUA 2XROA 2WKPA 4LRZE 5HSQA 5CXWA 3QP2A 4UEYA 3M2JA 2VV6A 3A3FA 5E2FA 4BJPA 1NLYA 2W3FA 3H7WB 4A5RA 4OOYA 2V8FA 4EEPA 4OLGA 1BYWA 4BL3A 3B47A 3OCNA 4EU0A 1GSWA 1PZOA 4BENA 4JXVA 3UB9A 3DTIA 1E4DA 4IVKA 4S2JA 5EVIC 1K38A 3G35A 4S2IA 4GJ4A 1EWZA 3IQAA 1DP8A 2ZC6B 5TJJA 2OAP1 4UA7A 3G2ZA 4C75A 3OPLA 4E04A 1YSPA 5HAIA 3MQOA 4GOGA 2XSSA 2JKRI 2QPNA 5GLCA 4D2OA 1DJAA 4LCLA 3VP0A 2PAVP 2W0NA 4X56A 3ZCZA 3S22A 4MDZA 1RGYA 2WGVA 4KUKA 5J4EA 5M19A 1OJGA 1NRJA 4BD1A 4OPYA 1FOFA 4CQHA 4S2OA 3DWZA 2Q0OA 2EWWA 2DRWA 2XDMA 2VKSA 1IKGA 4O01A 4X55A 5TGFA 5CEBA 4I3JA 1ZG4A 3G30A 3FKWA 1KE0A 3A0SA 2C5WB 5G18A 4ESPA 2OOLA 2CC1A 3BFFA 3SH7A 1I2SA 4WBGA 1XA7A 3NJAA 4R1GA 4QY5A 4NK3A 3A0VA 1LSXA 1XPBA 3O86A 2Z6CA 2J3WA 3ZG9B 4IEDA 4ETZA 2J9PA 1U60A 4KUOA 2IA2A 3VOYA 5F69A 3E4PA 4Q0IA 3SS4A 3VFFA 1WA9A 3IH9A 5CTMA 4PMAA 1BLSA 1YLWA 4CLCA 5IS1A 5L07A 2OWJA 3GDIA 3LR5A 4HJ3A 5CHUA 2P74A 3C38A 3F1NB 4OPZA 1CK3A 1S6RA 5F82A 3IX8A 2Y2GA 3T4OA 3CG5A 1JVJA 3JVVA 3UMDA 4PAUA 4EV4A 2EFXA 4RX2A 3V67A 4Q0JA 4HESA 3C7VA 4I3IA 1YMXA 1OT9A 5J3WA 4LENA 2PU4A 1TS8A 3EQVA 2W27A 3MFDA 1BTLA 2G2UA 5AQ9A 1LT0A 5HD5A 2E8IA 2W1TA 1S66L 1TVFA 3C7UA 4KZ7A 4LGWA 1TS6A 1CEGA 3P7NA 4OQGA 4YINA 4DN0A 1LI9A 4EESA 2XRNA 5F68A 1GA0A 2ZD8A 1PW1A 3GECA 4E3LA 4NEED 3BYDA 3UE6A 3BJNA 5F5YA 3S7QA 1T1BA 1XP4A 1M6KA 3NHQA 1HD8A 5HAPA 5FAQA 4B9OA 4ID4A 4JXGA 5FSRA 2ZL1A 1BLPA 4YWZA 2V0UA 1CF0A 1YLPA 2VEAA 2ZC4B 1P9RA 4E6WA 1EI5A 1ESUA 2Q9NA 1S1YA 3EEHA 5EVEA 4EUVA 1W63Q 3PBOA 1L0EA 2CMNA 1P9WA 3PBTA 4S2NA 4MNRA 4NXFA 2HF6A 3C30A 2JC7A 5FQQA 3S7PA 4B4ZA 5EVLA 3LIEA 1XJ6A 2WKHA 1ES3A 3I7JA 3LEQA 3L7HA 1K0KA 3O3VA 2A24B 1SHVA 2JE5A 4MMNA 4KZBA 1DP6A 1NY0A 2JKGA 2C6WB 1E3UD 4S2KA 4BQMA 2VGKA 5HDCA 4R4SA 2XFSA 4JPMA 1NXYA 2H5SA 3V3SA 2EX6A 3VE4A 3OOVA 1GSVA 3D4FA 4WF0A 3ITBA 3BM6A 2BG1A 1HLUP 1TDGA 4OQIA 5CRFA 1OTDA 1K55A 2QHKA 4QU3A 4XT2B 2IWDA 5I5LA 5A92A 2QKPA 5TFQA 2YKFA 4E3JA 2B18A 2H0YA 4KZ3A 1Y4OA 4GS9B 4U0XA 2HP9A 4M4XA 1G5UA 3LICA 3IS2A 2O0YA 2OWHA 4OOMA 1PW8A 3EEAA 1ALQA 4B4XA 1S67L 4H6JA 3S4XA 3QP6A 3PTEA 3KYQA 1BZAA 5DKLA 3NC8A 1YT4A 2QWSA 4K0WA 2W3DA 3UPOA 1Q2QA 2V0WA 2ZJ9A 3VOZA 1W5DA 3CI6A 3UB7A 4FH4A 4OH0A 5L10A 2PBDP 5AQBA 3P01A 5DF8A 2OLVA 1FR1A 5EUAA 2UV0E 5HPFA 1K57C 3P98A 2K31A 1ERQA 2X71A 3IF6B 4P87A 1FQGA 2XFTA 2Y2MA 3UB6A 4HJ6A 5FAPA 2XR0A 3ZNYA 5DFXA 3JPUA 4N92A 2ZMVA 3G32A 2XQZA 1XFNA 3FZCA 1DJCA 2IWCA 3IHAA 4JGPA 4BL2A 5EM0A
chains in the Genus database with same CATH topology
3OZHA 4P0MA 4Y0TA 1JWPA 1IYQA 1PZPA 4RX3A 3M2JA 1XA1A 1W7FA 1MWRA 1C3BA 3A3FA 5CTNA 5E2FA 4BJPA 1BT5A 3RXWA 2WAFA 4QY6A 4R0QA 4E3OA 2WK0A 3PBSA 3AGFA 4A5RA 4OOYA 5HARA 2FFYA 3O87A 4OLGA 3V3RA 4IBRA 3MXRA 3ZGAB 4OLDA 1WYCA 1K6RA 2OSUA 4BL3A 2Z2LB 3OCNA 5E2EA 3OPRA 3HLCA 2GDNA 4HEFA 3GQZA 4XUXA 1PZOA 2V1ZA 4JXVA 5GLAA 4BENA 2RL3A 4IBXA 4GDBA 2HDRA 3MKEA 4M3KA 1E4DA 1DJBA 1XXMA 5GHXA 1SCWA 4IVKA 1MXOA 2Y2OA 4PM9A 4S2JA 5EVIC 1K38A 4Y7PA 1K56D 2ZM2A 3G35A 4S2IA 4LV2A 4GKUA 5E2GA 3ZDJA 1XGIA 1EWZA 3IQAA 5CEDA 1LL5A 2ZM8A 1YLYA 3Q7ZA 2ZC6B 4OOLA 4UA7A 4ZJ1A 4EWFA 3G2ZA 4C75A 3OPLA 5HAIA 4ZJ2A 3G2YA 5DVAA 5FQKA 2WGIA 1IELA 4GOGA 3HLEA 4O7DA 3ZG8B 3HL9A 2QPNA 3DTMA 5GLCA 3BLSA 5EVIA 5FATA 4D2OA 3FYZA 3BLMA 4IVIA 4BD0A 3V5MA 1KGFA 1DJAA 4Y0OA 4LCLA 3M6BA 5FQIA 3VP0A 3C4OA 1KE3A 3HLDA 4LV0A 5EPHA 4JXWA 5CHJA 5CHMA 5HX9A 1AXBA 3C4PA 3WS2A 4X56A 5FQJA 3M2KA 3ZCZA 3S22A 2J7VA 2H10A 1RGYA 2WGVA 3G4PA 3GSGA 1ES5A 4OPQA 3MZDA 3E2KA 1MY8A 3MBZA 5M19A 4JXSA 3C5AA 4R4RA 3RJUA 4BD1A 5EVIB 1PIOA 1NYYA 3WS4A 4OPYA 1FOFA 3OPPA 1IKIA 3WRTA 4S2OA 1ZC2A 3DWZA 5F1GA 2XK1A 3IXDA 5FI2A 3UDXA 2DRWA 2J9OA 4DXBA 1E3UA 2XDMA 3LCEA 1IKGA 3UDIA 4X55A 5DTTA 5TGFA 5CEBA 2OV5A 1ZG4A 3G30A 3FKWA 3GV9A 4KZAA 4N9KA 1KE0A 3PBQA 2C5WB 3WS1A 4U3TA 5G18A 2UWXA 3BFDA 2Y2QA 5KSCA 2CC1A 2WZZA 1MWTA 3BFFA 1K25A 4CPKA 4ZTKA 3SH7A 1I2SA 4UHUA 4WBGA 3IF5A 1HZOA 4QHCA 4JKTA 3VFHA 4UAAA 3BRMA 1K57A 2Q9MA 3JYIA 3Q07A 3Q81A 5IHVA 5F83A 1ESIA 4LCMA 5HL1A 1XA7A 3G34A 4R1GA 1I2WA 2H0TA 4OP8A 4QY5A 1N4OA 4OKPA 1ES4A 4KZ6A 4NK3A 1FCNA 1L0DA 4GB7A 4R3BA 4E6XA 3ITAA 5AQAA 1XPBA 3O86A 5A90A 2IWBA 3WWXA 2ZQAA 4CJNA 4GZBA 4EBNA 2XEPA 2WKIA 3EQUA 3ZG9B 2WYXA 4IEDA 3FKVA 4WEJA 1L0GA 2J9PA 1XX2A 3A3DA 3WRZA 1U60A 4KENB 2XD5A 3Q82A 1ERMA 1ONGA 2XGNA 3SS3A 4DE2A 5I94A 4WEKA 3O88A 2Y4AA 2WGWB 3VOYA 1Z6FA 1JTGA 1BLHA 4MBKA 4DDYA 4X69A 1IYOA 1K6SA 2Y2KA 1W8YA 1RP5A 2ZQ8A 3SS4A 3GVBA 3QHYA 3VFFA 5FQMA 3TOIA 4KG5A 1GCEA 1CI8A 2EXBA 1PWDA 3IH9A 5HFOA 2ZQ7A 4GDNA 5CTMA 1CEFA 5FI7A 5FASA 4PMAA 2EX9A 5M1AA 5J8XA 1BLSA 1YLWA 4E3KA 2XH9A 4PM8A 3FV7A 3Q7VA 3G31A 2P74A 1XGJA 3HBRA 5CHUA 5KZHA 4OPZA 1CK3A 1S6RA 4QD4A 5F82A 3ZNTA 1LL9A 1KGEA 2Y55A 3HVFA 2Y2GA 3UE0A 3CG5A 2HDSA 2DCFA 3BFGA 3UNWA 5DF9A 2QMIA 5HW3A 1W8QA 4WMCA 3M6HA 2X02A 3ZG5A 1JVJA 2P9VA 4QJGA 1IEMA 3HLWA 1SKFA 3N8RA 1VQQA 4EV4A 2EFXA 1EROA 3MZEA 4RX2A 3VMAA 3Q7VB 1SDNA 1E25A 3SS5A 1BSGA 3UPNA 4HESA 3C7VA 3HLBA 3VSLA 5FA7A 1CI9A 1YMXA 3UDFA 4N9LA 4FD8A 4LENA 3ZG0A 1JWZA 2PU4A 1W79A 3EQVA 3A3IA 2V20A 3BFCA 5JYOA 4KZ8A 3MFDA 1BTLA 1MKIA 2G2UA 5AQ9A 1MPLA 5DTKA 4E3NA 1JWVA 4U0TA 4WM9A 2E8IA 4DDSA 2HPBA 4KG2A 5TR7A 2P9VB 1FCOA 1TVFA 3C7UA 4KZ7A 2XD1A 2ZMAA 1CEGA 3LY4A 2Y91A 4OQGA 4YINA 1LI9A 2Y2NA 3NBLA 3A3JA 5CGXA 4MLLA 1GHMA 1SDEA 5KMWA 4Z9QA 1ONHA 2XF3A 3LY3A 1GA0A 4UA6A 4DRTA 2ZD8A 3IF6C 1PW1A 3W8KA 4R3JA 4X6TA 4ZJ3A 3AGEA 4E3LA 4H8RA 3IXBA 3BYDA 4DE0A 2ZQCA 1J9MA 4ZBEA 4JF5A 4DE1A 4K91A 5HAQA 4RYEA 4EBLA 4EQIA 1G68A 3GTCA 3PBNA 4F94A 3NCKA 3UO9A 4ZAMA 1GHPA 1O07A 1XP4A 5U47A 1BUEA 3V39A 1BLCA 1M6KA 2XLNA 2ZQ9A 4PM6A 3VP4A 2WAEA 3LO7A 1HD8A 2V2FF 4S2PA 3IF6A 4KG6A 5FAQA 3VP1A 5HAPA 1YLZA 4ID4A 4JXGA 2G2WA 5FSRA 5CERA 3W4PA 4S2NC 1BLPA 3VP3A 4MBHA 2ZC4B 1YLPA 5E43A 5A93A 2Y2HA 4B88A 4E6WA 1EI5A 1ESUA 2Q9NA 1K56A 2QZ6A 4YFMA 3N8LA 1Q2PA 4E3IA 4KQQA 3MXSA 3ZG7B 3PBOA 4FSFA 1L0EA 1KVMA 2J8YA 4P6BA 4RA7A 3PBTA 2WZXA 3CZDA 3N7WA 3ISGA 3N8SA 2ZM0A 4S2NA 4WZ5C 4C6YA 1QMEA 3QNBA 3WS5A 3HLFA 5GHYA 1IYPA 1KE4A 5EVID 4MNRA 1KDWA 1KVLA 3MZFA 5CECA 2JC7A 1NYMA 1FCMA 1FSYA 4Q8IA 3DWKA 3DW0A 3OCLA 2Z2MB 3SOIA 1NJ4A 5FQQA 3UY6A 3SH9A 3UN7A 2ZC3B 1PI5A 1ZKJA 2A3UA 3HUMA 3E2LA 3W4QA 4B4ZA 3V50A 1BULA 1H5XA 4OQ0A 5EVLA 3UE3A 4WZ5A 2WKHA 2Y2JA 3N4IA 5M18A 1ES3A 4EBPA 3IWQA 1RGZA 4PPRA 3I7JA 4GD8A 4S2LA 3GMWA 5GHZA 3O3VA 1SHVA 4LV3A 2JE5A 1K55C 4HBUA 4KZBA 1NY0A 2ZLYA 2C6WB 1E3UD 4S2KA 3PAEA 5EOEA 5GLBA 4BQMA 1FR6A 2VGKA 2I72A 4R4SA 4QB8A 1XKZA 2XFSA 3FWLA 2PBYA 4WZ4A 4JPMA 2A49A 3UPPA 1NXYA 3AGDA 4KQOA 2H5SA 5FQ9A 3IWOA 5CGSA 3IWIA 4OONA 5D3OA 3V3SA 2EXAA 2EX6A 2HP5A 1MWUA 3D4FA 3SH8A 3NIAA 3ITBA 3BM6A 4MBFA 2BG1A 1TDGA 4OQIA 5CRFA 1K55A 1K54C 2RCXA 4PM5A 2JCHA 4OP5A 4QU3A 1TDLA 2WKEA 3NDEA 2WADA 4UA9A 2IWDA 1PI4A 3HLGA 3S1YA 5A92A 4KZ5A 4S2MA 2Y59A 5TFQA 4KZ4A 5KSHA 4GD6A 5E2HA 2EFUA 1S0WA 1DY6A 3ZVTA 3ZVWA 5A91A 4E3JA 5EOOA 4ZDXA 2H0YA 2ZC7A 4KZ3A 1MWSA 4JF6A 4KZ9A 3ZHHA 5FI6A 1OMEA 4WYYA 5GLDA 4OVDA 3W4OA 1K54A 4MEZA 3WS0A 4U0XA 2PU2A 1GHIA 1G6AA 4KQRA 4LV1A 2Y2PA 1L2SA 1LHYA 1Y54A 3BECA 1O7EA 1KDSA 2OLUA 1PYYA 2HP9A 1LI0A 1QMFA 1IYSA 1RCJA 1LLBA 1K4EA 3VSKA 4OOMA 4Y0UA 3NY4A 1PW8A 1H8YA 3N6IA 3PBRA 2DNSA 3IT9A 1ALQA 4B4XA 2WUQA 3S4XA 4GN2A 5DTSA 3GRJA 3IHBA 2HDUA 1BZAA 1K4FA 3B3XA 3PTEA 4OQHA 3IH8A 1L0FA 5EE8A 3NC8A 1YT4A 5EECA 3UE1A 5FDHA 2Y2IA 4K0WA 4EUZA 3UPOA 5CGWA 1Q2QA 2ZJ9A 3PAGA 3RXXA 4C3QA 4JLFA 1KGGA 4OPRA 1PWCA 3CMZA 4GNUA 5DF7A 1FSWA 3VOZA 2ZQDA 3QNCA 1W5DA 2HP6A 4N1HA 1YM1A 4FH4A 3P09A 3NI9A 4OH0A 2B5RA 2Y2LA 5AQBA 5DF8A 2OLVA 1FR1A 1JTDA 4X68A 3IXHA 4P85A 5EUAA 4E3MA 4XUZA 1YMSA 4K0XA 3LEZA 4DE3A 1YQSA 4R23A 2EX2A 1MBLA 4FCFA 1NZOA 4BLMA 1K57C 3HUOA 3P98A 1YLTA 1ERQA 4WMCD 3VP2A 3TSGA 2X71A 5L2FA 2EX8A 3IF6B 3BFEA 4JF4A 4P87A 1PWGA 3Q1FA 1TEMA 1FQGA 4HBTA 2XFTA 2Y2MA 2R9WA 2VGJA 1I5QA 1WE4A 5JYPA 5BOHA 1ZG6A 4JBFA 5FAPA 3A3EA 2XR0A 2R9XA 1VM1A 5F1FA 3MKFA 3HUNA 2BLSA 3NDGA 3ZNYA 3BEBA 4N1XA 5FAOA 5GL9A 1WYBA 3CJMA 1HVBA 4DKIA 1N9BA 4N92A 1YLJA 3G32A 1H8ZA 2XQZA 2WGWA 5AQ7A 3OC2A 3ZFZA 4XXRA 3HREA 3GR2A 3OPHA 4DXCA 4WELA 1M40A 1HTZA 1ES2A 4FH2A 3FZCA 2HDQA 4DF6A 1DJCA 2FFFB 2JBFA 4L0LA 2IWCA 1GA9A 1NRFA 4RVAA 3IHAA 4NETA 4PM7A 2X01A 2ZC5B 3TG9A 4X53A 1NZUA 4BL2A 5CXWA 3IXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OZH A;  4P0M A;  4Y0T A;  1JWP A;  1IYQ A;  1PZP A;  4RX3 A;  3M2J A;  1XA1 A;  1W7F A;  1MWR A;  1C3B A;  3A3F A;  5CTN A;  5E2F A;  4BJP A;  1BT5 A;  3RXW A;  2WAF A;  4QY6 A;  4R0Q A;  4E3O A;  2WK0 A;  3PBS A;  3AGF A;  4A5R A;  4OOY A;  5HAR A;  2FFY A;  3O87 A;  4OLG A;  3V3R A;  4IBR A;  3MXR A;  3ZGA B;  4OLD A;  1WYC A;  1K6R A;  2OSU A;  4BL3 A;  2Z2L B;  3OCN A;  5E2E A;  3OPR A;  3HLC A;  2GDN A;  4HEF A;  3GQZ A;  4XUX A;  1PZO A;  2V1Z A;  4JXV A;  5GLA A;  4BEN A;  2RL3 A;  4IBX A;  4GDB A;  2HDR A;  3MKE A;  4M3K A;  1E4D A;  1DJB A;  1XXM A;  5GHX A;  1SCW A;  4IVK A;  1MXO A;  2Y2O A;  4PM9 A;  4S2J A;  5EVI C;  1K38 A;  4Y7P A;  1K56 D;  2ZM2 A;  3G35 A;  4S2I A;  4LV2 A;  4GKU A;  5E2G A;  3ZDJ A;  1XGI A;  1EWZ A;  3IQA A;  5CED A;  1LL5 A;  2ZM8 A;  1YLY A;  3Q7Z A;  2ZC6 B;  4OOL A;  4UA7 A;  4ZJ1 A;  4EWF A;  3G2Z A;  4C75 A;  3OPL A;  5HAI A;  4ZJ2 A;  3G2Y A;  5DVA A;  5FQK A;  2WGI A;  1IEL A;  4GOG A;  3HLE A;  4O7D A;  3ZG8 B;  3HL9 A;  2QPN A;  3DTM A;  5GLC A;  3BLS A;  5EVI A;  5FAT A;  4D2O A;  3FYZ A;  3BLM A;  4IVI A;  4BD0 A;  3V5M A;  1KGF A;  1DJA A;  4Y0O A;  4LCL A;  3M6B A;  5FQI A;  3VP0 A;  3C4O A;  1KE3 A;  3HLD A;  4LV0 A;  5EPH A;  4JXW A;  5CHJ A;  5CHM A;  5HX9 A;  1AXB A;  3C4P A;  3WS2 A;  4X56 A;  5FQJ A;  3M2K A;  3ZCZ A;  3S22 A;  2J7V A;  2H10 A;  1RGY A;  2WGV A;  3G4P A;  3GSG A;  1ES5 A;  4OPQ A;  3MZD A;  3E2K A;  1MY8 A;  3MBZ A;  5M19 A;  4JXS A;  3C5A A;  4R4R A;  3RJU A;  4BD1 A;  5EVI B;  1PIO A;  1NYY A;  3WS4 A;  4OPY A;  1FOF A;  3OPP A;  1IKI A;  3WRT A;  4S2O A;  1ZC2 A;  3DWZ A;  5F1G A;  2XK1 A;  3IXD A;  5FI2 A;  3UDX A;  2DRW A;  2J9O A;  4DXB A;  1E3U A;  2XDM A;  3LCE A;  1IKG A;  3UDI A;  4X55 A;  5DTT A;  5TGF A;  5CEB A;  2OV5 A;  1ZG4 A;  3G30 A;  3FKW A;  3GV9 A;  4KZA A;  4N9K A;  1KE0 A;  3PBQ A;  2C5W B;  3WS1 A;  4U3T A;  5G18 A;  2UWX A;  3BFD A;  2Y2Q A;  5KSC A;  2CC1 A;  2WZZ A;  1MWT A;  3BFF A;  1K25 A;  4CPK A;  4ZTK A;  3SH7 A;  1I2S A;  4UHU A;  4WBG A;  3IF5 A;  1HZO A;  4QHC A;  4JKT A;  3VFH A;  4UAA A;  3BRM A;  1K57 A;  2Q9M A;  3JYI A;  3Q07 A;  3Q81 A;  5IHV A;  5F83 A;  1ESI A;  4LCM A;  5HL1 A;  1XA7 A;  3G34 A;  4R1G A;  1I2W A;  2H0T A;  4OP8 A;  4QY5 A;  1N4O A;  4OKP A;  1ES4 A;  4KZ6 A;  4NK3 A;  1FCN A;  1L0D A;  4GB7 A;  4R3B A;  4E6X A;  3ITA A;  5AQA A;  1XPB A;  3O86 A;  5A90 A;  2IWB A;  3WWX A;  2ZQA A;  4CJN A;  4GZB A;  4EBN A;  2XEP A;  2WKI A;  3EQU A;  3ZG9 B;  2WYX A;  4IED A;  3FKV A;  4WEJ A;  1L0G A;  2J9P A;  1XX2 A;  3A3D A;  3WRZ A;  1U60 A;  4KEN B;  2XD5 A;  3Q82 A;  1ERM A;  1ONG A;  2XGN A;  3SS3 A;  4DE2 A;  5I94 A;  4WEK A;  3O88 A;  2Y4A A;  2WGW B;  3VOY A;  1Z6F A;  1JTG A;  1BLH A;  4MBK A;  4DDY A;  4X69 A;  1IYO A;  1K6S A;  2Y2K A;  1W8Y A;  1RP5 A;  2ZQ8 A;  3SS4 A;  3GVB A;  3QHY A;  3VFF A;  5FQM A;  3TOI A;  4KG5 A;  1GCE A;  1CI8 A;  2EXB A;  1PWD A;  3IH9 A;  5HFO A;  2ZQ7 A;  4GDN A;  5CTM A;  1CEF A;  5FI7 A;  5FAS A;  4PMA A;  2EX9 A;  5M1A A;  5J8X A;  1BLS A;  1YLW A;  4E3K A;  2XH9 A;  4PM8 A;  3FV7 A;  3Q7V A;  3G31 A;  2P74 A;  1XGJ A;  3HBR A;  5CHU A;  5KZH A;  4OPZ A;  1CK3 A;  1S6R A;  4QD4 A;  5F82 A;  3ZNT A;  1LL9 A;  1KGE A;  2Y55 A;  3HVF A;  2Y2G A;  3UE0 A;  3CG5 A;  2HDS A;  2DCF A;  3BFG A;  3UNW A;  5DF9 A;  2QMI A;  5HW3 A;  1W8Q A;  4WMC A;  3M6H A;  2X02 A;  3ZG5 A;  1JVJ A;  2P9V A;  4QJG A;  1IEM A;  3HLW A;  1SKF A;  3N8R A;  1VQQ A;  4EV4 A;  2EFX A;  1ERO A;  3MZE A;  4RX2 A;  3VMA A;  3Q7V B;  1SDN A;  1E25 A;  3SS5 A;  1BSG A;  3UPN A;  4HES A;  3C7V A;  3HLB A;  3VSL A;  5FA7 A;  1CI9 A;  1YMX A;  3UDF A;  4N9L A;  4FD8 A;  4LEN A;  3ZG0 A;  1JWZ A;  2PU4 A;  1W79 A;  3EQV A;  3A3I A;  2V20 A;  3BFC A;  5JYO A;  4KZ8 A;  3MFD A;  1BTL A;  1MKI A;  2G2U A;  5AQ9 A;  1MPL A;  5DTK A;  4E3N A;  1JWV A;  4U0T A;  4WM9 A;  2E8I A;  4DDS A;  2HPB A;  4KG2 A;  5TR7 A;  2P9V B;  1FCO A;  1TVF A;  3C7U A;  4KZ7 A;  2XD1 A;  2ZMA A;  1CEG A;  3LY4 A;  2Y91 A;  4OQG A;  4YIN A;  1LI9 A;  2Y2N A;  3NBL A;  3A3J A;  5CGX A;  4MLL A;  1GHM A;  1SDE A;  5KMW A;  4Z9Q A;  1ONH A;  2XF3 A;  3LY3 A;  1GA0 A;  4UA6 A;  4DRT A;  2ZD8 A;  3IF6 C;  1PW1 A;  3W8K A;  4R3J A;  4X6T A;  4ZJ3 A;  3AGE A;  4E3L A;  4H8R A;  3IXB A;  3BYD A;  4DE0 A;  2ZQC A;  1J9M A;  4ZBE A;  4JF5 A;  4DE1 A;  4K91 A;  5HAQ A;  4RYE A;  4EBL A;  4EQI A;  1G68 A;  3GTC A;  3PBN A;  4F94 A;  3NCK A;  3UO9 A;  4ZAM A;  1GHP A;  1O07 A;  1XP4 A;  5U47 A;  1BUE A;  3V39 A;  1BLC A;  1M6K A;  2XLN A;  2ZQ9 A;  4PM6 A;  3VP4 A;  2WAE A;  3LO7 A;  1HD8 A;  2V2F F;  4S2P A;  3IF6 A;  4KG6 A;  5FAQ A;  3VP1 A;  5HAP A;  1YLZ A;  4ID4 A;  4JXG A;  2G2W A;  5FSR A;  5CER A;  3W4P A;  4S2N C;  1BLP A;  3VP3 A;  4MBH A;  2ZC4 B;  1YLP A;  5E43 A;  5A93 A;  2Y2H A;  4B88 A;  4E6W A;  1EI5 A;  1ESU A;  2Q9N A;  1K56 A;  2QZ6 A;  4YFM A;  3N8L A;  1Q2P A;  4E3I A;  4KQQ A;  3MXS A;  3ZG7 B;  3PBO A;  4FSF A;  1L0E A;  1KVM A;  2J8Y A;  4P6B A;  4RA7 A;  3PBT A;  2WZX A;  3CZD A;  3N7W A;  3ISG A;  3N8S A;  2ZM0 A;  4S2N A;  4WZ5 C;  4C6Y A;  1QME A;  3QNB A;  3WS5 A;  3HLF A;  5GHY A;  1IYP A;  1KE4 A;  5EVI D;  4MNR A;  1KDW A;  1KVL A;  3MZF A;  5CEC A;  2JC7 A;  1NYM A;  1FCM A;  1FSY A;  4Q8I A;  3DWK A;  3DW0 A;  3OCL A;  2Z2M B;  3SOI A;  1NJ4 A;  5FQQ A;  3UY6 A;  3SH9 A;  3UN7 A;  2ZC3 B;  1PI5 A;  1ZKJ A;  2A3U A;  3HUM A;  3E2L A;  3W4Q A;  4B4Z A;  3V50 A;  1BUL A;  1H5X A;  4OQ0 A;  5EVL A;  3UE3 A;  4WZ5 A;  2WKH A;  2Y2J A;  3N4I A;  5M18 A;  1ES3 A;  4EBP A;  3IWQ A;  1RGZ A;  4PPR A;  3I7J A;  4GD8 A;  4S2L A;  3GMW A;  5GHZ A;  3O3V A;  1SHV A;  4LV3 A;  2JE5 A;  1K55 C;  4HBU A;  4KZB A;  1NY0 A;  2ZLY A;  2C6W B;  1E3U D;  4S2K A;  3PAE A;  5EOE A;  5GLB A;  4BQM A;  1FR6 A;  2VGK A;  2I72 A;  4R4S A;  4QB8 A;  1XKZ A;  2XFS A;  3FWL A;  2PBY A;  4WZ4 A;  4JPM A;  2A49 A;  3UPP A;  1NXY A;  3AGD A;  4KQO A;  2H5S A;  5FQ9 A;  3IWO A;  5CGS A;  3IWI A;  4OON A;  5D3O A;  3V3S A;  2EXA A;  2EX6 A;  2HP5 A;  1MWU A;  3D4F A;  3SH8 A;  3NIA A;  3ITB A;  3BM6 A;  4MBF A;  2BG1 A;  1TDG A;  4OQI A;  5CRF A;  1K55 A;  1K54 C;  2RCX A;  4PM5 A;  2JCH A;  4OP5 A;  4QU3 A;  1TDL A;  2WKE A;  3NDE A;  2WAD A;  4UA9 A;  2IWD A;  1PI4 A;  3HLG A;  3S1Y A;  5A92 A;  4KZ5 A;  4S2M A;  2Y59 A;  5TFQ A;  4KZ4 A;  5KSH A;  4GD6 A;  5E2H A;  2EFU A;  1S0W A;  1DY6 A;  3ZVT A;  3ZVW A;  5A91 A;  4E3J A;  5EOO A;  4ZDX A;  2H0Y A;  2ZC7 A;  4KZ3 A;  1MWS A;  4JF6 A;  4KZ9 A;  3ZHH A;  5FI6 A;  1OME A;  4WYY A;  5GLD A;  4OVD A;  3W4O A;  1K54 A;  4MEZ A;  3WS0 A;  4U0X A;  2PU2 A;  1GHI A;  1G6A A;  4KQR A;  4LV1 A;  2Y2P A;  1L2S A;  1LHY A;  1Y54 A;  3BEC A;  1O7E A;  1KDS A;  2OLU A;  1PYY A;  2HP9 A;  1LI0 A;  1QMF A;  1IYS A;  1RCJ A;  1LLB A;  1K4E A;  3VSK A;  4OOM A;  4Y0U A;  3NY4 A;  1PW8 A;  1H8Y A;  3N6I A;  3PBR A;  2DNS A;  3IT9 A;  1ALQ A;  4B4X A;  2WUQ A;  3S4X A;  4GN2 A;  5DTS A;  3GRJ A;  3IHB A;  2HDU A;  1BZA A;  1K4F A;  3B3X A;  3PTE A;  4OQH A;  3IH8 A;  1L0F A;  5EE8 A;  3NC8 A;  1YT4 A;  5EEC A;  3UE1 A;  5FDH A;  2Y2I A;  4K0W A;  4EUZ A;  3UPO A;  5CGW A;  1Q2Q A;  2ZJ9 A;  3PAG A;  3RXX A;  4C3Q A;  4JLF A;  1KGG A;  4OPR A;  1PWC A;  3CMZ A;  4GNU A;  5DF7 A;  1FSW A;  3VOZ A;  2ZQD A;  3QNC A;  1W5D A;  2HP6 A;  4N1H A;  1YM1 A;  4FH4 A;  3P09 A;  3NI9 A;  4OH0 A;  2B5R A;  2Y2L A;  5AQB A;  5DF8 A;  2OLV A;  1FR1 A;  1JTD A;  4X68 A;  3IXH A;  4P85 A;  5EUA A;  4E3M A;  4XUZ A;  1YMS A;  4K0X A;  3LEZ A;  4DE3 A;  1YQS A;  4R23 A;  2EX2 A;  1MBL A;  4FCF A;  1NZO A;  4BLM A;  1K57 C;  3HUO A;  3P98 A;  1YLT A;  1ERQ A;  4WMC D;  3VP2 A;  3TSG A;  2X71 A;  5L2F A;  2EX8 A;  3IF6 B;  3BFE A;  4JF4 A;  4P87 A;  1PWG A;  3Q1F A;  1TEM A;  1FQG A;  4HBT A;  2XFT A;  2Y2M A;  2R9W A;  2VGJ A;  1I5Q A;  1WE4 A;  5JYP A;  5BOH A;  1ZG6 A;  4JBF A;  5FAP A;  3A3E A;  2XR0 A;  2R9X A;  1VM1 A;  5F1F A;  3MKF A;  3HUN A;  2BLS A;  3NDG A;  3ZNY A;  3BEB A;  4N1X A;  5FAO A;  5GL9 A;  1WYB A;  3CJM A;  1HVB A;  4DKI A;  1N9B A;  4N92 A;  1YLJ A;  3G32 A;  1H8Z A;  2XQZ A;  2WGW A;  5AQ7 A;  3OC2 A;  3ZFZ A;  4XXR A;  3HRE A;  3GR2 A;  3OPH A;  4DXC A;  4WEL A;  1M40 A;  1HTZ A;  1ES2 A;  4FH2 A;  3FZC A;  2HDQ A;  4DF6 A;  1DJC A;  2FFF B;  2JBF A;  4L0L A;  2IWC A;  1GA9 A;  1NRF A;  4RVA A;  3IHA A;  4NET A;  4PM7 A;  2X01 A;  2ZC5 B;  3TG9 A;  4X53 A;  1NZU A;  4BL2 A;  5CXW A;  3IXG A; 
#chains in the Genus database with same CATH topology
 4HH3 A;  1KOU A;  1C3B A;  5CTN A;  2YKH A;  2W1R A;  1VEU A;  3RXW A;  3ZYT A;  4X25 A;  3O5Y A;  2FFY A;  2EA9 A;  3A0R A;  2XA7 S;  5E2E A;  3OPR A;  1UGU A;  2M1C A;  2GDN A;  4HEF A;  3GQZ A;  4DMZ A;  1XFQ A;  2V1Z A;  5FDS A;  3FPW A;  2HDR A;  3MKE A;  3LIB A;  1XXM A;  1SCW A;  3ULF A;  3LIA A;  1MXO A;  2Y2O A;  4PM9 A;  1K56 D;  1XJ2 A;  4GKU A;  5CED A;  3MQ0 A;  3UME A;  4ZJ1 A;  3G2Y A;  2WGI A;  1IEL A;  1V9Z A;  3HLE A;  3ZG8 B;  3DTM A;  3T4Q A;  3BLM A;  4IVI A;  4BD0 A;  4YOF A;  3V5M A;  1KGF A;  5FQI A;  4NXB A;  5CHM A;  1OT6 A;  3WS2 A;  1TS7 A;  2KX6 A;  2KLI A;  3G4P A;  1ES5 A;  3EOI A;  3MBZ A;  2R78 A;  3UB8 A;  4R4R A;  3RJU A;  5EVI B;  1PIO A;  2K2N A;  3OPP A;  1IKI A;  2MJ6 A;  2B02 A;  2PDR A;  1ZC2 A;  2XK1 A;  2J9O A;  1E3U A;  3UDI A;  4I39 A;  2OV5 A;  4N9K A;  4JGQ A;  5HWV A;  1MKM A;  1VHM A;  3BFD A;  3IX4 A;  4CPK A;  1MWT A;  4UHU A;  3IF5 A;  4JKT A;  3VFH A;  3H9W A;  3MMH A;  3BRM A;  1K57 A;  2HJ9 C;  3G6O A;  3F1O B;  3T1X A;  3G34 A;  4OP8 A;  4OKP A;  4KZ6 A;  1N9L A;  3KO6 A;  5AQA A;  5A90 A;  4JGR A;  4EBN A;  2WKI A;  2WYX A;  2VZW A;  1LSV A;  3FKV A;  3KSH A;  1L0G A;  1XX2 A;  2XD5 A;  3Q82 A;  4DE2 A;  3TW8 A;  2WGW B;  4CLC C;  1Z6F A;  1JTG A;  4MBK A;  3T4K A;  4X69 A;  1K6S A;  2Y2K A;  2ZQ8 A;  5FQM A;  3TOI A;  2HZ5 A;  5DJT A;  1CI8 A;  4GDN A;  1CEF A;  1CJF A;  5KZH A;  1XGJ A;  4G3W A;  3K3C A;  1LL9 A;  1KGE A;  4Y5F A;  1OTB A;  3BFG A;  3UNW A;  4JGO A;  2P9V A;  1SKF A;  3CAX A;  3N8R A;  5AVE A;  3Q7V B;  3SS5 A;  3HLB A;  1W79 A;  4KZ8 A;  5F6A A;  3C2W A;  1MPL A;  1T18 A;  4WM9 A;  1VET B;  4GHI B;  2ZMA A;  2Y91 A;  4KQD A;  1H3Q A;  3NBL A;  3A3J A;  1GHM A;  2L0W A;  1ONH A;  3LY3 A;  4DRT A;  3R7W A;  4HH2 A;  4R3J A;  4X6T A;  4ZJ3 A;  1SKO B;  2ZQC A;  1J9M A;  4JF5 A;  4K91 A;  2AVX A;  4EBL A;  4EQI A;  1G68 A;  3GTC A;  5C5K A;  5U47 A;  1BUE A;  3VP4 A;  5TBM B;  3IF6 A;  3KX0 X;  1YLZ A;  3E98 A;  3CWF A;  5CER A;  4S2N C;  3VP3 A;  3LYX A;  2V9A A;  2ZOI A;  3K2N A;  2QZ6 A;  1K56 A;  2K7S A;  4KQQ A;  3NUL A;  2J8Y A;  1D7E A;  4RA7 A;  3CZD A;  1QME A;  3QNB A;  4R70 A;  2Y79 A;  3MZF A;  3S7N A;  4EXO A;  1VB6 A;  1FCM A;  4Q8I A;  3F1P A;  1XJ3 A;  3DW0 A;  2Z2M B;  4D60 A;  1NJ4 A;  3UY6 A;  3BY9 A;  3H82 B;  3SH9 A;  2ZC3 B;  1PI5 A;  4I3A A;  2PYR A;  3T1R A;  2PRF A;  3VV4 A;  3T4L A;  5M18 A;  3CIT A;  4HI4 A;  4GD8 A;  1F98 A;  3KSG A;  4NG2 A;  1K55 C;  2GNX A;  4DJ2 A;  4I5S A;  2L1M A;  4AFI A;  1FR6 A;  3RTY A;  1ACF A;  3D3O A;  1P0Z A;  5FQ9 A;  3IWO A;  4OON A;  5D3O A;  2HP5 A;  1MZU A;  3SH8 A;  4ETX A;  3MF0 A;  2WAD A;  3IX3 A;  4KZ5 A;  4S2M A;  5KSH A;  1DY6 A;  3MFX A;  5EOO A;  2ZC7 A;  5FI6 A;  1OME A;  4WYY A;  4L9E A;  2W3H A;  1K54 A;  2Y8H A;  1GHI A;  2ZBB A;  2Y2P A;  1LHY A;  3BEC A;  2B95 A;  1O7E A;  1KDS A;  5FL3 A;  3E4O A;  1LLB A;  1N9N A;  4II7 A;  1K4E A;  3VSK A;  3N6I A;  3IT9 A;  2WUQ A;  3IHB A;  3B3X A;  5HD3 A;  3IH8 A;  1L0F A;  1FIL A;  4FOF A;  3T1S A;  5FDH A;  3RXX A;  4JLF A;  1KGG A;  4OPR A;  1FSW A;  2HP6 A;  4N1H A;  2B5R A;  2Y2L A;  3B42 A;  2NUP C;  4X68 A;  3IXH A;  2D02 A;  1MBL A;  1S1Z A;  4FCF A;  1STZ A;  4Y13 A;  1Z09 A;  4ARZ B;  3BW6 A;  3BFE A;  3IBR A;  4JF4 A;  2FZ0 A;  1S4R A;  3Q1F A;  4LPZ A;  3CPT B;  2VV8 A;  3EGD C;  1WE4 A;  4JBF A;  2V1A A;  1VM1 A;  2GX5 A;  3IBJ A;  2BLS A;  3NDG A;  3BEB A;  4BMW A;  4N1X A;  2VLG A;  5GL9 A;  1WYB A;  3CJM A;  1HVB A;  4DKI A;  2HJE A;  1N9B A;  2WGW A;  3H7W A;  1PRQ A;  3GR2 A;  1M40 A;  4FH2 A;  1A0K A;  2HDQ A;  3MR0 A;  1TD5 A;  4RVA A;  4NET A;  5EV0 A;  3TG9 A;  3OZH A;  2VGL M;  4Y0T A;  1JWP A;  4RX3 A;  5EFW A;  1BT5 A;  5EM1 A;  4QY6 A;  4R0Q A;  2OAQ 1;  3AGF A;  1ZTU A;  3V3R A;  4IBR A;  4OLD A;  1WYC A;  3K3D A;  2Z2L B;  4BBU A;  3U2A A;  4XUX A;  2V1B A;  4Q0H A;  4IBX A;  3S7O A;  3BQA A;  4M3K A;  5GHX A;  4HY8 A;  5DKK A;  2ACG A;  4LV2 A;  5E2G A;  1XGI A;  1LL5 A;  1OJ5 A;  3Q7Z A;  4OOL A;  4EWF A;  1S4S A;  1SZV A;  4ZJ2 A;  5DVA A;  4O7D A;  1XJ4 A;  4QWO A;  4Y0O A;  4R3A A;  4LV0 A;  5EPH A;  3MS6 A;  5FQJ A;  3M2K A;  2VX8 A;  2J7V A;  2H10 A;  1H8M A;  3GSG A;  4OPQ A;  3E2K A;  3NEC A;  4JXS A;  2KDK A;  1NYY A;  3WS4 A;  3WRT A;  5F1G A;  3IXD A;  3UDX A;  4QPR A;  1YAX A;  4WN5 A;  5AVF A;  5DTT A;  3WS1 A;  2UWX A;  4LLO B;  2ZMF A;  4ZTK A;  2PD7 A;  1HZO A;  4UAA A;  1UWN X;  3JYI A;  3Q81 A;  4LCM A;  5HL1 A;  2BTF P;  4IUK A;  2J80 A;  1I2W A;  4DJ3 A;  2M7U A;  1ES4 A;  1F9I A;  1J3W A;  1FCN A;  1L0D A;  4GB7 A;  4E6X A;  2IWB A;  3WWX A;  4CJN A;  2XEP A;  5CX7 A;  4WEJ A;  3WRZ A;  1ERM A;  5I94 A;  1L3L A;  2Y4A A;  3LFV A;  3F1N A;  1BLH A;  1D1J A;  1IYO A;  1W8Y A;  2DMW A;  1GCE A;  4I38 A;  1PWD A;  3FC7 A;  5J8X A;  1TF1 A;  2JKT M;  4PM8 A;  3G31 A;  4PKY G;  3HBR A;  4QD4 A;  3ZNT A;  5HZH A;  4ME4 A;  1X0O A;  2Y55 A;  2DCF A;  2J3T D;  5HW3 A;  1W8Q A;  3M6H A;  5MC7 A;  4O8G A;  4O0P A;  4CLC B;  1VQQ A;  3VMA A;  5L09 A;  3BY8 A;  1SDN A;  1BSG A;  3VE3 A;  2G7U A;  2V20 A;  5JYO A;  4P6Z M;  4NKP A;  4DDS A;  1H0M A;  2HPB A;  1FCO A;  3T4J A;  5CGX A;  3DTE A;  4Z9Q A;  2XF3 A;  2GJ3 A;  3IF6 C;  2QJ5 A;  3DTK A;  4LRY C;  4ZBE A;  4DE1 A;  5HAQ A;  1D06 A;  2W1T B;  4RYE A;  3TRC A;  3PBN A;  4F94 A;  2O9B A;  3NCK A;  2LB9 A;  3UO9 A;  1GHP A;  2XLN A;  4PM6 A;  2WAE A;  3FG8 A;  4S2P A;  3VP1 A;  3DAV A;  2QYB A;  2G2W A;  3W4P A;  1EW0 A;  4HQA A;  3MQQ A;  4MBH A;  5E43 A;  5A93 A;  2Y2H A;  1Y28 A;  2I9V A;  4YFM A;  2M7V A;  1PFL A;  2PR6 A;  4E3I A;  3MXS A;  3ZG7 B;  3HJI A;  2A2L A;  4WUJ A;  3T12 B;  2WZX A;  3N7W A;  3ISG A;  3WS5 A;  2ZL1 B;  5GHY A;  1IYP A;  1KE4 A;  3QP5 A;  5EVI D;  3JVU A;  3OLO A;  2A24 A;  2P08 A;  3OCL A;  1ZKJ A;  2A3U A;  3E2L A;  1UWP X;  1H5X A;  3UE3 A;  5G4Y A;  4IHQ A;  4WZ5 A;  4G3K A;  2ZOH A;  3ICY A;  4EBP A;  4Z1W A;  4PPR A;  4S2L A;  5HWT A;  1P97 A;  4XT2 A;  1T19 A;  2ZLY A;  3KSF A;  3PAE A;  5EOE A;  5GLB A;  4QB8 A;  1XKZ A;  4WZ4 A;  2PBY A;  4KQO A;  2LB5 A;  5CGS A;  2PHY A;  4GS9 A;  1NLZ A;  2PYP A;  2JKR M;  5A8B A;  4BBV A;  1G6O A;  1K54 C;  3KYZ A;  2RCX A;  2JCH A;  4OP5 A;  2WKE A;  4HNB A;  3NDE A;  3HLG A;  2HGV A;  2Y59 A;  2FH5 A;  1S0W A;  3HJK A;  2VJW A;  1YPR A;  1MWS A;  4JF6 A;  5GLD A;  4G3V A;  4MEZ A;  1MC0 A;  2PU2 A;  1G6A A;  1DRM A;  4LV1 A;  1Y54 A;  3OBF A;  4PKY A;  1IYS A;  2QJ7 A;  3D72 A;  1ODV A;  3LI8 A;  2HDU A;  5EE8 A;  2D01 A;  2L4R A;  3C8C A;  4LRX C;  4X1L A;  5EEC A;  3UE1 A;  2Y2I A;  1LSW A;  5CGW A;  4X1M A;  4C3Q A;  3IS2 B;  3BWL A;  3CMZ A;  2ZQD A;  1YM1 A;  3P09 A;  4H6J B;  3RH8 B;  4F3L B;  1JTD A;  1TS0 A;  3LEZ A;  2PR5 A;  3PYP A;  3LR4 A;  4R6L A;  4HOI A;  3SZT A;  3D9Y A;  3CUE A;  4WMC D;  3VP2 A;  3TSG A;  2O9C A;  1PWG A;  4CLC E;  1TEM A;  2R9W A;  2VGJ A;  4HJ4 A;  5JYP A;  5BOH A;  1ZG6 A;  3A3E A;  1T1A A;  2R9X A;  3MKF A;  3HUN A;  1OPX A;  3R4K A;  5FAO A;  1H8Z A;  3OC2 A;  1T1C A;  3HRE A;  4XXR A;  4DXC A;  4WEL A;  1ES2 A;  3KSI A;  3L9K A;  4DF6 A;  2FFF B;  4L0L A;  2JBF A;  1NRF A;  4X53 A;  4MN6 A;  1OTI A;  3IXG A;  4P0M A;  1IYQ A;  1PZP A;  1XA1 A;  1W7F A;  1MWR A;  2W3E A;  4BBT A;  2WAF A;  4E3O A;  2WK0 A;  3PBS A;  3TE8 A;  5HAR A;  3O87 A;  3MXR A;  3ZGA B;  1K6R A;  2WKQ A;  2OSU A;  5DJU A;  1DP9 A;  4Y2F A;  3HLC A;  5GLA A;  2RL3 A;  4FTX A;  4GDB A;  1VEU B;  1DJB A;  2PT7 A;  2NUT C;  4NXG A;  5HDD A;  4Y7P A;  3ZQ5 A;  2ZM2 A;  3ZDJ A;  2ZM8 A;  1YLY A;  4WLA A;  5FQK A;  3HL9 A;  3BLS A;  5EVI A;  5FAT A;  3FYZ A;  3PR6 A;  3M6B A;  4YNR A;  3C4O A;  1KE3 A;  3HLD A;  1F2K A;  4JXW A;  5CHJ A;  5HX9 A;  1AXB A;  3C4P A;  4RQ9 A;  4MCW A;  5KIZ A;  3MZD A;  1MY8 A;  1ZHH B;  3C5A A;  5K5B A;  1CQA A;  4B93 A;  2INW A;  2O99 A;  5FI2 A;  4DXB A;  3LCE A;  4GW9 A;  2GZA A;  5G4Z A;  3GV9 A;  4KZA A;  4IJG A;  3F1O A;  3PBQ A;  4U3T A;  5KSC A;  2Y2Q A;  2WZZ A;  4Y17 A;  1K25 A;  5IU1 A;  2JHE A;  3B33 A;  4QHC A;  2BAS A;  4HIA A;  2VV7 A;  2Q9M A;  4Y3I A;  3Q07 A;  5IHV A;  5F83 A;  1ESI A;  2H0T A;  1N4O A;  5FEG A;  4GCZ A;  5HDS A;  4R3B A;  3ITA A;  3LI9 A;  2ZQA A;  3LID A;  4IUH A;  4GZB A;  3LR3 A;  3EQU A;  3RFB A;  3A3D A;  2VK3 A;  2PD8 A;  4KEN B;  3MXQ A;  1ONG A;  2XGN A;  3SS3 A;  2VGL S;  4WEK A;  3O88 A;  5LBR A;  4MN5 A;  3LR0 A;  5AJG A;  4DDY A;  5HPI A;  2JN7 A;  1RP5 A;  3GVB A;  3QHY A;  4KG5 A;  2EXB A;  3LUQ A;  1JNU A;  5HFO A;  2ZQ7 A;  5FI7 A;  5FAS A;  4UQI M;  5M1A A;  2EX9 A;  4UQI S;  4E3K A;  2XH9 A;  3NOP C;  3EWK A;  3FV7 A;  3Q7V A;  3T4S A;  2KOI A;  1IFQ A;  3U4L P;  3HVF A;  5FEF A;  3UE0 A;  4L9F A;  2E8J A;  3LGO A;  2HDS A;  2P04 A;  5DF9 A;  2QMI A;  1IOU A;  4WMC A;  2X02 A;  3ZG5 A;  4NXE A;  4QJG A;  1IEM A;  3HLW A;  1VET A;  4GHI A;  1ERO A;  3MZE A;  1E25 A;  3UPN A;  3VSL A;  2V8C A;  5FA7 A;  1CI9 A;  3UDF A;  4N9L A;  4FD8 A;  3ZG0 A;  2JKF A;  1JWZ A;  3E4Q A;  3EGX C;  3A3I A;  3BFC A;  1SKO A;  1MKI A;  5DTK A;  4E3N A;  1V9Y A;  1JWV A;  4U0T A;  2Z6D A;  3MJQ A;  5TR7 A;  4KG2 A;  2P9V B;  4EQ1 A;  2XD1 A;  5L8M A;  3LY4 A;  2Y2N A;  4MLL A;  1SDE A;  1YSQ A;  5TBM A;  5KMW A;  4ZRR A;  4UA6 A;  3W8K A;  4K08 A;  4F3L A;  1OTA A;  3AGE A;  4H8R A;  3IXB A;  1W63 M;  4DE0 A;  3NOU C;  3PHY A;  4ZAM A;  1O07 A;  3V39 A;  1BLC A;  2ZQ9 A;  2W3G A;  3LO7 A;  2V2F F;  2O9A A;  4KG6 A;  1PNE A;  1OTE A;  3R7W B;  4HP4 A;  3QP1 A;  4B88 A;  3N8L A;  3H82 A;  1Q2P A;  5HL6 A;  4FSF A;  3KYE A;  4P6B A;  1KVM A;  2WKR A;  3N8S A;  2ZM0 A;  4WZ5 C;  4C6Y A;  3HLF A;  4WL9 A;  1KDW A;  1KVL A;  5CEC A;  3LIF A;  5IT5 A;  1NYM A;  1FSY A;  3DWK A;  3SOI A;  3FPV A;  3UN7 A;  3HUM A;  3T4T A;  3W4Q A;  3V50 A;  1BUL A;  4OQ0 A;  2Y2J A;  3N4I A;  4L9G A;  3IWQ A;  1YKD A;  1RGZ A;  3GMW A;  5GHZ A;  3E0Y A;  4LV3 A;  3F1P B;  4HBU A;  2HV1 A;  4EER A;  2EWV A;  2I72 A;  3FWL A;  2A49 A;  3UPP A;  2XA7 M;  3AGD A;  4EET B;  3IWI A;  2EXA A;  1MWU A;  3QP8 A;  3NIA A;  4MBF A;  1FIK A;  5HWW A;  4PM5 A;  1TDL A;  4UA9 A;  1PI4 A;  3S1Y A;  3PXP A;  4KZ4 A;  4GD6 A;  1NWZ A;  5E2H A;  1G28 A;  4GLQ A;  2EFU A;  3ZVW A;  3ZVT A;  5A91 A;  1GSX A;  4ZDX A;  3T1Q B;  4KZ9 A;  2JKT I;  3ZHH A;  5DFY A;  4OVD A;  4Y15 A;  1AWI A;  3CLO A;  3W4O A;  3WS0 A;  4P6Z S;  4KQR A;  1F5M A;  4PHT A;  1L2S A;  4R38 A;  2OLU A;  3UB5 P;  1PYY A;  1LI0 A;  1QMF A;  4MN7 A;  1RCJ A;  4Y0U A;  3NY4 A;  1H8Y A;  3PBR A;  3W2Z A;  2DNS A;  3MSH A;  3T50 A;  4GN2 A;  5DTS A;  3GRJ A;  4OQH A;  1K4F A;  4HP9 A;  4EW7 A;  3TJZ C;  3QP4 A;  1N9O A;  3DBA A;  4EUZ A;  3PAG A;  1PWC A;  4GNU A;  3SW1 A;  5DF7 A;  4EEU A;  3QNC A;  4FUW A;  3CUE C;  4ARZ A;  3NI9 A;  5J7E A;  4CLC D;  2J3T C;  3CPT A;  4P85 A;  4E3M A;  4XUZ A;  1YMS A;  4K0X A;  4DE3 A;  1YQS A;  4R23 A;  3CHW P;  2EX2 A;  1NZO A;  4BLM A;  3BQ8 A;  3HUO A;  1YLT A;  3VOL A;  2VA0 A;  5L2F A;  2EX8 A;  2H28 A;  3HCY A;  4HBT A;  1I5Q A;  5F1F A;  1YLJ A;  3NOT C;  5AQ7 A;  4HHD A;  3ZFZ A;  3OPH A;  1HTZ A;  4LFU A;  1LL8 A;  4BWI A;  1GA9 A;  4PM7 A;  2P7J A;  2ZC5 B;  2X01 A;  1NZU A;  2XRO A;  2WKP A;  4LRZ E;  5HSQ A;  5CXW A;  3QP2 A;  4UEY A;  3M2J A;  2VV6 A;  3A3F A;  5E2F A;  4BJP A;  1NLY A;  2W3F A;  3H7W B;  4A5R A;  4OOY A;  2V8F A;  4EEP A;  4OLG A;  1BYW A;  4BL3 A;  3B47 A;  3OCN A;  4EU0 A;  1GSW A;  1PZO A;  4BEN A;  4JXV A;  3UB9 A;  3DTI A;  1E4D A;  4IVK A;  4S2J A;  5EVI C;  1K38 A;  3G35 A;  4S2I A;  4GJ4 A;  1EWZ A;  3IQA A;  1DP8 A;  2ZC6 B;  5TJJ A;  2OAP 1;  4UA7 A;  3G2Z A;  4C75 A;  3OPL A;  4E04 A;  1YSP A;  5HAI A;  3MQO A;  4GOG A;  2XSS A;  2JKR I;  2QPN A;  5GLC A;  4D2O A;  1DJA A;  4LCL A;  3VP0 A;  2PAV P;  2W0N A;  4X56 A;  3ZCZ A;  3S22 A;  4MDZ A;  1RGY A;  2WGV A;  4KUK A;  5J4E A;  5M19 A;  1OJG A;  1NRJ A;  4BD1 A;  4OPY A;  1FOF A;  4CQH A;  4S2O A;  3DWZ A;  2Q0O A;  2EWW A;  2DRW A;  2XDM A;  2VKS A;  1IKG A;  4O01 A;  4X55 A;  5TGF A;  5CEB A;  4I3J A;  1ZG4 A;  3G30 A;  3FKW A;  1KE0 A;  3A0S A;  2C5W B;  5G18 A;  4ESP A;  2OOL A;  2CC1 A;  3BFF A;  3SH7 A;  1I2S A;  4WBG A;  1XA7 A;  3NJA A;  4R1G A;  4QY5 A;  4NK3 A;  3A0V A;  1LSX A;  1XPB A;  3O86 A;  2Z6C A;  2J3W A;  3ZG9 B;  4IED A;  4ETZ A;  2J9P A;  1U60 A;  4KUO A;  2IA2 A;  3VOY A;  5F69 A;  3E4P A;  4Q0I A;  3SS4 A;  3VFF A;  1WA9 A;  3IH9 A;  5CTM A;  4PMA A;  1BLS A;  1YLW A;  4CLC A;  5IS1 A;  5L07 A;  2OWJ A;  3GDI A;  3LR5 A;  4HJ3 A;  5CHU A;  2P74 A;  3C38 A;  3F1N B;  4OPZ A;  1CK3 A;  1S6R A;  5F82 A;  3IX8 A;  2Y2G A;  3T4O A;  3CG5 A;  1JVJ A;  3JVV A;  3UMD A;  4PAU A;  4EV4 A;  2EFX A;  4RX2 A;  3V67 A;  4Q0J A;  4HES A;  3C7V A;  4I3I A;  1YMX A;  1OT9 A;  5J3W A;  4LEN A;  2PU4 A;  1TS8 A;  3EQV A;  2W27 A;  3MFD A;  1BTL A;  2G2U A;  5AQ9 A;  1LT0 A;  5HD5 A;  2E8I A;  2W1T A;  1S66 L;  1TVF A;  3C7U A;  4KZ7 A;  4LGW A;  1TS6 A;  1CEG A;  3P7N A;  4OQG A;  4YIN A;  4DN0 A;  1LI9 A;  4EES A;  2XRN A;  5F68 A;  1GA0 A;  2ZD8 A;  1PW1 A;  3GEC A;  4E3L A;  4NEE D;  3BYD A;  3UE6 A;  3BJN A;  5F5Y A;  3S7Q A;  1T1B A;  1XP4 A;  1M6K A;  3NHQ A;  1HD8 A;  5HAP A;  5FAQ A;  4B9O A;  4ID4 A;  4JXG A;  5FSR A;  2ZL1 A;  1BLP A;  4YWZ A;  2V0U A;  1CF0 A;  1YLP A;  2VEA A;  2ZC4 B;  1P9R A;  4E6W A;  1EI5 A;  1ESU A;  2Q9N A;  1S1Y A;  3EEH A;  5EVE A;  4EUV A;  1W63 Q;  3PBO A;  1L0E A;  2CMN A;  1P9W A;  3PBT A;  4S2N A;  4MNR A;  4NXF A;  2HF6 A;  3C30 A;  2JC7 A;  5FQQ A;  3S7P A;  4B4Z A;  5EVL A;  3LIE A;  1XJ6 A;  2WKH A;  1ES3 A;  3I7J A;  3LEQ A;  3L7H A;  1K0K A;  3O3V A;  2A24 B;  1SHV A;  2JE5 A;  4MMN A;  4KZB A;  1DP6 A;  1NY0 A;  2JKG A;  2C6W B;  1E3U D;  4S2K A;  4BQM A;  2VGK A;  5HDC A;  4R4S A;  2XFS A;  4JPM A;  1NXY A;  2H5S A;  3V3S A;  2EX6 A;  3VE4 A;  3OOV A;  1GSV A;  3D4F A;  4WF0 A;  3ITB A;  3BM6 A;  2BG1 A;  1HLU P;  1TDG A;  4OQI A;  5CRF A;  1OTD A;  1K55 A;  2QHK A;  4QU3 A;  4XT2 B;  2IWD A;  5I5L A;  5A92 A;  2QKP A;  5TFQ A;  2YKF A;  4E3J A;  2B18 A;  2H0Y A;  4KZ3 A;  1Y4O A;  4GS9 B;  4U0X A;  2HP9 A;  4M4X A;  1G5U A;  3LIC A;  3IS2 A;  2O0Y A;  2OWH A;  4OOM A;  1PW8 A;  3EEA A;  1ALQ A;  4B4X A;  1S67 L;  4H6J A;  3S4X A;  3QP6 A;  3PTE A;  3KYQ A;  1BZA A;  5DKL A;  3NC8 A;  1YT4 A;  2QWS A;  4K0W A;  2W3D A;  3UPO A;  1Q2Q A;  2V0W A;  2ZJ9 A;  3VOZ A;  1W5D A;  3CI6 A;  3UB7 A;  4FH4 A;  4OH0 A;  5L10 A;  2PBD P;  5AQB A;  3P01 A;  5DF8 A;  2OLV A;  1FR1 A;  5EUA A;  2UV0 E;  5HPF A;  1K57 C;  3P98 A;  2K31 A;  1ERQ A;  2X71 A;  3IF6 B;  4P87 A;  1FQG A;  2XFT A;  2Y2M A;  3UB6 A;  4HJ6 A;  5FAP A;  2XR0 A;  3ZNY A;  5DFX A;  3JPU A;  4N92 A;  2ZMV A;  3G32 A;  2XQZ A;  1XFN A;  3FZC A;  1DJC A;  2IWC A;  3IHA A;  4JGP A;  4BL2 A;  5EM0 A; 
#chains in the Genus database with same CATH homology
 3OZH A;  4P0M A;  4Y0T A;  1JWP A;  1IYQ A;  1PZP A;  4RX3 A;  3M2J A;  1XA1 A;  1W7F A;  1MWR A;  1C3B A;  3A3F A;  5CTN A;  5E2F A;  4BJP A;  1BT5 A;  3RXW A;  2WAF A;  4QY6 A;  4R0Q A;  4E3O A;  2WK0 A;  3PBS A;  3AGF A;  4A5R A;  4OOY A;  5HAR A;  2FFY A;  3O87 A;  4OLG A;  3V3R A;  4IBR A;  3MXR A;  3ZGA B;  4OLD A;  1WYC A;  1K6R A;  2OSU A;  4BL3 A;  2Z2L B;  3OCN A;  5E2E A;  3OPR A;  3HLC A;  2GDN A;  4HEF A;  3GQZ A;  4XUX A;  1PZO A;  2V1Z A;  4JXV A;  5GLA A;  4BEN A;  2RL3 A;  4IBX A;  4GDB A;  2HDR A;  3MKE A;  4M3K A;  1E4D A;  1DJB A;  1XXM A;  5GHX A;  1SCW A;  4IVK A;  1MXO A;  2Y2O A;  4PM9 A;  4S2J A;  5EVI C;  1K38 A;  4Y7P A;  1K56 D;  2ZM2 A;  3G35 A;  4S2I A;  4LV2 A;  4GKU A;  5E2G A;  3ZDJ A;  1XGI A;  1EWZ A;  3IQA A;  5CED A;  1LL5 A;  2ZM8 A;  1YLY A;  3Q7Z A;  2ZC6 B;  4OOL A;  4UA7 A;  4ZJ1 A;  4EWF A;  3G2Z A;  4C75 A;  3OPL A;  5HAI A;  4ZJ2 A;  3G2Y A;  5DVA A;  5FQK A;  2WGI A;  1IEL A;  4GOG A;  3HLE A;  4O7D A;  3ZG8 B;  3HL9 A;  2QPN A;  3DTM A;  5GLC A;  3BLS A;  5EVI A;  5FAT A;  4D2O A;  3FYZ A;  3BLM A;  4IVI A;  4BD0 A;  3V5M A;  1KGF A;  1DJA A;  4Y0O A;  4LCL A;  3M6B A;  5FQI A;  3VP0 A;  3C4O A;  1KE3 A;  3HLD A;  4LV0 A;  5EPH A;  4JXW A;  5CHJ A;  5CHM A;  5HX9 A;  1AXB A;  3C4P A;  3WS2 A;  4X56 A;  5FQJ A;  3M2K A;  3ZCZ A;  3S22 A;  2J7V A;  2H10 A;  1RGY A;  2WGV A;  3G4P A;  3GSG A;  1ES5 A;  4OPQ A;  3MZD A;  3E2K A;  1MY8 A;  3MBZ A;  5M19 A;  4JXS A;  3C5A A;  4R4R A;  3RJU A;  4BD1 A;  5EVI B;  1PIO A;  1NYY A;  3WS4 A;  4OPY A;  1FOF A;  3OPP A;  1IKI A;  3WRT A;  4S2O A;  1ZC2 A;  3DWZ A;  5F1G A;  2XK1 A;  3IXD A;  5FI2 A;  3UDX A;  2DRW A;  2J9O A;  4DXB A;  1E3U A;  2XDM A;  3LCE A;  1IKG A;  3UDI A;  4X55 A;  5DTT A;  5TGF A;  5CEB A;  2OV5 A;  1ZG4 A;  3G30 A;  3FKW A;  3GV9 A;  4KZA A;  4N9K A;  1KE0 A;  3PBQ A;  2C5W B;  3WS1 A;  4U3T A;  5G18 A;  2UWX A;  3BFD A;  2Y2Q A;  5KSC A;  2CC1 A;  2WZZ A;  1MWT A;  3BFF A;  1K25 A;  4CPK A;  4ZTK A;  3SH7 A;  1I2S A;  4UHU A;  4WBG A;  3IF5 A;  1HZO A;  4QHC A;  4JKT A;  3VFH A;  4UAA A;  3BRM A;  1K57 A;  2Q9M A;  3JYI A;  3Q07 A;  3Q81 A;  5IHV A;  5F83 A;  1ESI A;  4LCM A;  5HL1 A;  1XA7 A;  3G34 A;  4R1G A;  1I2W A;  2H0T A;  4OP8 A;  4QY5 A;  1N4O A;  4OKP A;  1ES4 A;  4KZ6 A;  4NK3 A;  1FCN A;  1L0D A;  4GB7 A;  4R3B A;  4E6X A;  3ITA A;  5AQA A;  1XPB A;  3O86 A;  5A90 A;  2IWB A;  3WWX A;  2ZQA A;  4CJN A;  4GZB A;  4EBN A;  2XEP A;  2WKI A;  3EQU A;  3ZG9 B;  2WYX A;  4IED A;  3FKV A;  4WEJ A;  1L0G A;  2J9P A;  1XX2 A;  3A3D A;  3WRZ A;  1U60 A;  4KEN B;  2XD5 A;  3Q82 A;  1ERM A;  1ONG A;  2XGN A;  3SS3 A;  4DE2 A;  5I94 A;  4WEK A;  3O88 A;  2Y4A A;  2WGW B;  3VOY A;  1Z6F A;  1JTG A;  1BLH A;  4MBK A;  4DDY A;  4X69 A;  1IYO A;  1K6S A;  2Y2K A;  1W8Y A;  1RP5 A;  2ZQ8 A;  3SS4 A;  3GVB A;  3QHY A;  3VFF A;  5FQM A;  3TOI A;  4KG5 A;  1GCE A;  1CI8 A;  2EXB A;  1PWD A;  3IH9 A;  5HFO A;  2ZQ7 A;  4GDN A;  5CTM A;  1CEF A;  5FI7 A;  5FAS A;  4PMA A;  2EX9 A;  5M1A A;  5J8X A;  1BLS A;  1YLW A;  4E3K A;  2XH9 A;  4PM8 A;  3FV7 A;  3Q7V A;  3G31 A;  2P74 A;  1XGJ A;  3HBR A;  5CHU A;  5KZH A;  4OPZ A;  1CK3 A;  1S6R A;  4QD4 A;  5F82 A;  3ZNT A;  1LL9 A;  1KGE A;  2Y55 A;  3HVF A;  2Y2G A;  3UE0 A;  3CG5 A;  2HDS A;  2DCF A;  3BFG A;  3UNW A;  5DF9 A;  2QMI A;  5HW3 A;  1W8Q A;  4WMC A;  3M6H A;  2X02 A;  3ZG5 A;  1JVJ A;  2P9V A;  4QJG A;  1IEM A;  3HLW A;  1SKF A;  3N8R A;  1VQQ A;  4EV4 A;  2EFX A;  1ERO A;  3MZE A;  4RX2 A;  3VMA A;  3Q7V B;  1SDN A;  1E25 A;  3SS5 A;  1BSG A;  3UPN A;  4HES A;  3C7V A;  3HLB A;  3VSL A;  5FA7 A;  1CI9 A;  1YMX A;  3UDF A;  4N9L A;  4FD8 A;  4LEN A;  3ZG0 A;  1JWZ A;  2PU4 A;  1W79 A;  3EQV A;  3A3I A;  2V20 A;  3BFC A;  5JYO A;  4KZ8 A;  3MFD A;  1BTL A;  1MKI A;  2G2U A;  5AQ9 A;  1MPL A;  5DTK A;  4E3N A;  1JWV A;  4U0T A;  4WM9 A;  2E8I A;  4DDS A;  2HPB A;  4KG2 A;  5TR7 A;  2P9V B;  1FCO A;  1TVF A;  3C7U A;  4KZ7 A;  2XD1 A;  2ZMA A;  1CEG A;  3LY4 A;  2Y91 A;  4OQG A;  4YIN A;  1LI9 A;  2Y2N A;  3NBL A;  3A3J A;  5CGX A;  4MLL A;  1GHM A;  1SDE A;  5KMW A;  4Z9Q A;  1ONH A;  2XF3 A;  3LY3 A;  1GA0 A;  4UA6 A;  4DRT A;  2ZD8 A;  3IF6 C;  1PW1 A;  3W8K A;  4R3J A;  4X6T A;  4ZJ3 A;  3AGE A;  4E3L A;  4H8R A;  3IXB A;  3BYD A;  4DE0 A;  2ZQC A;  1J9M A;  4ZBE A;  4JF5 A;  4DE1 A;  4K91 A;  5HAQ A;  4RYE A;  4EBL A;  4EQI A;  1G68 A;  3GTC A;  3PBN A;  4F94 A;  3NCK A;  3UO9 A;  4ZAM A;  1GHP A;  1O07 A;  1XP4 A;  5U47 A;  1BUE A;  3V39 A;  1BLC A;  1M6K A;  2XLN A;  2ZQ9 A;  4PM6 A;  3VP4 A;  2WAE A;  3LO7 A;  1HD8 A;  2V2F F;  4S2P A;  3IF6 A;  4KG6 A;  5FAQ A;  3VP1 A;  5HAP A;  1YLZ A;  4ID4 A;  4JXG A;  2G2W A;  5FSR A;  5CER A;  3W4P A;  4S2N C;  1BLP A;  3VP3 A;  4MBH A;  2ZC4 B;  1YLP A;  5E43 A;  5A93 A;  2Y2H A;  4B88 A;  4E6W A;  1EI5 A;  1ESU A;  2Q9N A;  1K56 A;  2QZ6 A;  4YFM A;  3N8L A;  1Q2P A;  4E3I A;  4KQQ A;  3MXS A;  3ZG7 B;  3PBO A;  4FSF A;  1L0E A;  1KVM A;  2J8Y A;  4P6B A;  4RA7 A;  3PBT A;  2WZX A;  3CZD A;  3N7W A;  3ISG A;  3N8S A;  2ZM0 A;  4S2N A;  4WZ5 C;  4C6Y A;  1QME A;  3QNB A;  3WS5 A;  3HLF A;  5GHY A;  1IYP A;  1KE4 A;  5EVI D;  4MNR A;  1KDW A;  1KVL A;  3MZF A;  5CEC A;  2JC7 A;  1NYM A;  1FCM A;  1FSY A;  4Q8I A;  3DWK A;  3DW0 A;  3OCL A;  2Z2M B;  3SOI A;  1NJ4 A;  5FQQ A;  3UY6 A;  3SH9 A;  3UN7 A;  2ZC3 B;  1PI5 A;  1ZKJ A;  2A3U A;  3HUM A;  3E2L A;  3W4Q A;  4B4Z A;  3V50 A;  1BUL A;  1H5X A;  4OQ0 A;  5EVL A;  3UE3 A;  4WZ5 A;  2WKH A;  2Y2J A;  3N4I A;  5M18 A;  1ES3 A;  4EBP A;  3IWQ A;  1RGZ A;  4PPR A;  3I7J A;  4GD8 A;  4S2L A;  3GMW A;  5GHZ A;  3O3V A;  1SHV A;  4LV3 A;  2JE5 A;  1K55 C;  4HBU A;  4KZB A;  1NY0 A;  2ZLY A;  2C6W B;  1E3U D;  4S2K A;  3PAE A;  5EOE A;  5GLB A;  4BQM A;  1FR6 A;  2VGK A;  2I72 A;  4R4S A;  4QB8 A;  1XKZ A;  2XFS A;  3FWL A;  2PBY A;  4WZ4 A;  4JPM A;  2A49 A;  3UPP A;  1NXY A;  3AGD A;  4KQO A;  2H5S A;  5FQ9 A;  3IWO A;  5CGS A;  3IWI A;  4OON A;  5D3O A;  3V3S A;  2EXA A;  2EX6 A;  2HP5 A;  1MWU A;  3D4F A;  3SH8 A;  3NIA A;  3ITB A;  3BM6 A;  4MBF A;  2BG1 A;  1TDG A;  4OQI A;  5CRF A;  1K55 A;  1K54 C;  2RCX A;  4PM5 A;  2JCH A;  4OP5 A;  4QU3 A;  1TDL A;  2WKE A;  3NDE A;  2WAD A;  4UA9 A;  2IWD A;  1PI4 A;  3HLG A;  3S1Y A;  5A92 A;  4KZ5 A;  4S2M A;  2Y59 A;  5TFQ A;  4KZ4 A;  5KSH A;  4GD6 A;  5E2H A;  2EFU A;  1S0W A;  1DY6 A;  3ZVT A;  3ZVW A;  5A91 A;  4E3J A;  5EOO A;  4ZDX A;  2H0Y A;  2ZC7 A;  4KZ3 A;  1MWS A;  4JF6 A;  4KZ9 A;  3ZHH A;  5FI6 A;  1OME A;  4WYY A;  5GLD A;  4OVD A;  3W4O A;  1K54 A;  4MEZ A;  3WS0 A;  4U0X A;  2PU2 A;  1GHI A;  1G6A A;  4KQR A;  4LV1 A;  2Y2P A;  1L2S A;  1LHY A;  1Y54 A;  3BEC A;  1O7E A;  1KDS A;  2OLU A;  1PYY A;  2HP9 A;  1LI0 A;  1QMF A;  1IYS A;  1RCJ A;  1LLB A;  1K4E A;  3VSK A;  4OOM A;  4Y0U A;  3NY4 A;  1PW8 A;  1H8Y A;  3N6I A;  3PBR A;  2DNS A;  3IT9 A;  1ALQ A;  4B4X A;  2WUQ A;  3S4X A;  4GN2 A;  5DTS A;  3GRJ A;  3IHB A;  2HDU A;  1BZA A;  1K4F A;  3B3X A;  3PTE A;  4OQH A;  3IH8 A;  1L0F A;  5EE8 A;  3NC8 A;  1YT4 A;  5EEC A;  3UE1 A;  5FDH A;  2Y2I A;  4K0W A;  4EUZ A;  3UPO A;  5CGW A;  1Q2Q A;  2ZJ9 A;  3PAG A;  3RXX A;  4C3Q A;  4JLF A;  1KGG A;  4OPR A;  1PWC A;  3CMZ A;  4GNU A;  5DF7 A;  1FSW A;  3VOZ A;  2ZQD A;  3QNC A;  1W5D A;  2HP6 A;  4N1H A;  1YM1 A;  4FH4 A;  3P09 A;  3NI9 A;  4OH0 A;  2B5R A;  2Y2L A;  5AQB A;  5DF8 A;  2OLV A;  1FR1 A;  1JTD A;  4X68 A;  3IXH A;  4P85 A;  5EUA A;  4E3M A;  4XUZ A;  1YMS A;  4K0X A;  3LEZ A;  4DE3 A;  1YQS A;  4R23 A;  2EX2 A;  1MBL A;  4FCF A;  1NZO A;  4BLM A;  1K57 C;  3HUO A;  3P98 A;  1YLT A;  1ERQ A;  4WMC D;  3VP2 A;  3TSG A;  2X71 A;  5L2F A;  2EX8 A;  3IF6 B;  3BFE A;  4JF4 A;  4P87 A;  1PWG A;  3Q1F A;  1TEM A;  1FQG A;  4HBT A;  2XFT A;  2Y2M A;  2R9W A;  2VGJ A;  1I5Q A;  1WE4 A;  5JYP A;  5BOH A;  1ZG6 A;  4JBF A;  5FAP A;  3A3E A;  2XR0 A;  2R9X A;  1VM1 A;  5F1F A;  3MKF A;  3HUN A;  2BLS A;  3NDG A;  3ZNY A;  3BEB A;  4N1X A;  5FAO A;  5GL9 A;  1WYB A;  3CJM A;  1HVB A;  4DKI A;  1N9B A;  4N92 A;  1YLJ A;  3G32 A;  1H8Z A;  2XQZ A;  2WGW A;  5AQ7 A;  3OC2 A;  3ZFZ A;  4XXR A;  3HRE A;  3GR2 A;  3OPH A;  4DXC A;  4WEL A;  1M40 A;  1HTZ A;  1ES2 A;  4FH2 A;  3FZC A;  2HDQ A;  4DF6 A;  1DJC A;  2FFF B;  2JBF A;  4L0L A;  2IWC A;  1GA9 A;  1NRF A;  4RVA A;  3IHA A;  4NET A;  4PM7 A;  2X01 A;  2ZC5 B;  3TG9 A;  4X53 A;  1NZU A;  4BL2 A;  5CXW A;  3IXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...