2H28A

Crystal structure of yeeu from e. coli. northeast structural genomics target er304
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
DRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSGELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Phd-Doc, HigA, and YeeU Establish Multiple Evolutionary Links between Microbial Growth-Regulating Toxin-Antitoxin Systems.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yeeU
total genus 23
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06154 CbeA_antitoxin CbeA_antitoxin, type IV, cytoskeleton bundling-enhancing factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2h28A01
2GJ3A 4GHIB 4I5SA 3BWLA 1LL8A 4HJ3A 3UB9A 4K08A 4JGQA 3A0SA 3E4PA 2W27A 5J7EA 1VB6A 3FC7A 4M4XA 3F1OB 1LSXA 3H82B 3VOLA 2OWHA 2KX6A 3OLOA 4HIAA 1NWZA 2OWJA 1S66L 3UMEA 2L1MA 3LYXA 2PR6A 2PHYA 4R70A 4I3AA 1MZUA 1XJ4A 2Z6DA 3BY8A 4JGOA 3IS2B 1D06A 3MQQA 3F1PB 4NXGA 5DJUA 3VE3A 1XFNA 2JHEA 4MN5A 2PDRA 4XT2A 1T1BA 5AVFA 1UWPX 2KDKA 2A24A 2WKRA 5HSQA 3GECA 1T18A 3LIEA 4LRZE 5HD3A 3VE4A 1XJ3A 1S67L 1GSWA 1OJ5A 1XJ6A 2VV6A 1N9LA 5A8BA 1DP9A 4I3JA 4LRXC 3UB8A 2QHKA 2QWSA 4H6JB 4EW7A 1XJ2A 3LIFA 2QJ5A 5AVEA 1GSVA 3IBRA 4NXBA 1ODVA 3NHQA 1KOUA 1OTBA 3H7WB 4L9EA 3ULFA 5KIZA 2K7SA 3C8CA 1TS7A 2INWA 2P7JA 2VLGA 1JNUA 1TS0A 3KX0X 4HQAA 5I5LA 3UMDA 1F9IA 4F3LA 4LRYC 1DP6A 3ZQ5A 3PYPA 4R3AA 3UE6A 4HJ4A 4GW9A 2L0WA 3P7NA 1TS6A 4RQ9A 4YWZA 3RH8B 2PD8A 2L4RA 1OTEA 2V1AA 2YKHA 4I38A 5F6AA 5J3WA 3HJIA 1OTDA 4EQ1A 2VV7A 1T19A 3A0RA 2PYPA 2WKQA 3D72A 4GCZA 4L9GA 5IS1A 2OOLA 1OT9A 1S1YA 4HHDA 4KUOA 1TS8A 4PKYG 4GHIA 5HDSA 5F68A 3BY9A 4B9OA 5F5YA 3LIAA 2M1CA 1G28A 2W0NA 3LI9A 3UB7A 1UWNX 3UB6A 4JGRA 3PHYA 1T1AA 4EEPA 3F1OA 4GS9B 5TBMB 3B33A 1LSVA 1S4SA 2I9VA 3EEHA 3G6OA 2CMNA 5HWVA 4KUKA 4EESA 3HJKA 2PD7A 1F98A 1XFQA 4HH2A 3MR0A 4DJ2A 4BBUA 3ICYA 4WF0A 3NOPC 2VEAA 4XT2B 2Z6CA 4HJ6A 2ZOIA 4I3IA 2A24B 4JGPA 4WN5A 1S4RA 1S1ZA 5HWWA 4R38A 4HP9A 2PR5A 2YKFA 3NJAA 3NOUC 3LI8A 4HI4A 1LT0A 2D02A 2D01A 1OTIA 1OT6A 2ZBBA 3F1NA 1N9OA 4H6JA 4WUJA 3MQOA 4WLAA 5IU1A 5J4EA 3A0VA 5HWTA 5HD5A 1Y28A 3F1NB 1N9NA 3CLOA 3EWKA 4HP4A 1UGUA 3H82A 4L9FA 4LLOB 3MXQA 5G4ZA 4E04A 4EETB 2V1BA 2V0UA 4KQDA 4F3LB 4DJ3A 1T1CA 1V9YA 2J80A 5EFWA 3LICA 3CAXA 3K3CA 4EEUA 3IS2A 2ZOHA 4MN6A 3F1PA 2JN7A 4LPZA 2V9AA 4BBVA 1OJGA 1X0OA 4WL9A 4HY8A 5G4YA 2WKPA 3MFXA 1D7EA 1P0ZA 5HZHA 1OTAA 4HNBA 3GDIA 1BYWA 3LIDA 3LUQA 1LSWA 4R6LA 1P97A 2B02A 4EXOA 2H28A 3E4OA 1EW0A 2VV8A 2EA9A 2QKPA 2V0WA 4GS9A 2HV1A 4HOIA 5DKLA 5TBMA 3T50A 2R78A 3SW1A 1DRMA 3H9WA 3C2WA 3H7WA 3K3DA 5DKKA 3NOTC 4BBTA 3FG8A 2BASA 3CWFA 4HH3A 1V9ZA 4I39A 3LIBA 5DJTA 1GSXA 5HDDA 4NXEA 3E4QA 4EERA 5HDCA 3RTYA 3MJQA 1WA9A 1DP8A 5F69A 2PYRA 4NXFA 4PKYA 2QJ7A
chains in the Genus database with same CATH superfamily
4GHIB 1I2SA 4GKUA 4JGQA 4KENB 3VP1A 3NC8A 1S66L 2L1MA 3LYXA 1TDGA 4JGOA 1YLTA 3BY8A 3F1PB 3MS6A 4N92A 2O9AA 2KDKA 2WK0A 2VV6A 4CLCB 4H6JB 1Y54A 4L9EA 3O87A 4ID4A 1DJCA 3ZGAB 3M2JA 3ZQ5A 3IF6A 1H0MA 2RCXA 3WS2A 1OTEA 5IHVA 1MWRA 2OOLA 4S2NC 4EEPA 3KSHA 3S7OA 3MMHA 5CGXA 3ZG8B 5L10A 1W79A 3C4PA 2VEAA 3IXHA 4C75A 2WUQA 5CXWA 2PR5A 2D01A 5F83A 2MJ6A 1ALQA 3EWKA 4HP4A 4OQHA 4LLOB 4MEZA 5EM1A 1NLZA 4E04A 4MN6A 3F1PA 2HPBA 4OPRA 3MZEA 3GTCA 5G4YA 2Y2HA 4DRTA 2JKRM 1K25A 2G2WA 2Y2MA 4CLCA 4EUZA 4KZ8A 4MBFA 1BLHA 5HW3A 2J9PA 3R4KA 4OQIA 3SH9A 2PBYA 2ZM8A 1L3LA 5HDDA 2FZ0A 5F69A 4GN2A 4OPQA 4CLCE 1NZUA 2HDRA 1G68A 1G5UA 4B4ZA 3CG5A 4ZJ1A 3WS0A 2JHEA 4WEJA 2M7UA 3V67A 1XJ6A 4I3JA 1L2SA 3U2AA 4NXBA 3FV7A 1KE3A 2GZAA 3MZDA 2V8FA 2Q9NA 3PYPA 5A91A 4RQ9A 2Y91A 2ZM2A 4UAAA 5AQBA 1XP4A 5IS1A 3D72A 3LEZA 4KUOA 4X55A 3BY9A 4S2LA 3PHYA 3LCEA 3EEHA 3EEAA 2WAEA 3MR0A 1DJBA 3SOIA 3A3EA 2H10A 5F1FA 3FYZA 1STZA 1VETB 3A0VA 4P6BA 1K54A 2C5WB 3S7QA 4KQDA 1BUEA 5FI6A 2JKRI 3N7WA 1CF0A 1MKMA 4LPZA 2V9AA 4ZRRA 4HY8A 4LV3A 2O0YA 5HFOA 3DW0A 3WRZA 3G2ZA 2V0WA 2R78A 4Y0UA 2XQZA 3BFDA 5CHJA 3CWFA 5HL6A 2WGWB 5EOEA 3PAEA 5KMWA 3L7HA 5CEDA 2JKGA 3UPNA 4ARZB 5AQ9A 1VB6A 3PXPA 3H82B 1K56A 2OWJA 1VM1A 3TJZC 2NUTC 3Q7VB 3DAVA 1YLWA 2PDRA 5HSQA 2A24A 4L0LA 1GSWA 2O99A 3M6HA 4RX2A 1ZHHB 3HLFA 4Y2FA 1O07A 4ZJ3A 4LFUA 2QJ5A 5DTKA 4RVAA 3H7WB 3AGFA 4KG6A 4BJPA 4R3BA 1DP6A 3DBAA 3JVUA 3P7NA 4IEDA 2YKHA 2W1RA 4EQ1A 4RA7A 3OPLA 2WGIA 2JE5A 4KQRA 1VEUA 1FQGA 3IXDA 4DJ2A 3RXWA 3VSKA 4U0TA 4PM6A 4ZBEA 2LB5A 1NRFA 4WF0A 4UHUA 3IH9A 4AFIA 1OT6A 3CUEA 4Y3IA 3BFEA 4DXCA 1HVBA 2Y2KA 3A3JA 4OOLA 3NECA 5FEFA 2EX6A 3N8SA 3UY6A 2IWDA 1BTLA 4Y5FA 3IWIA 2Y2LA 3VP3A 1P97A 4R3JA 3OCLA 4MMNA 3IT9A 3C2WA 4K0WA 1PW1A 2JC7A 3EQVA 5HPIA 4BENA 4P6ZM 4U3TA 4I39A 1YLZA 5FQJA 1CQAA 4K91A 2ZOIA 4C3QA 2QMIA 4QWOA 2ZQDA 4R1GA 4I3AA 1MZUA 5GL9A 2ZL1B 1XFNA 2HGVA 1UWPX 3JYIA 1K56D 4E3NA 4B88A 1DP9A 3IH8A 3QP4A 5M1AA 3O5YA 3D9YA 1J3WA 4MDZA 4G3KA 4LRYC 4R3AA 4PM8A 4L9GA 2WKQA 2A49A 3DTMA 3HLEA 3IWQA 4EQIA 3DTEA 4D60A 3B33A 1RGYA 3HUNA 1ES2A 3HJKA 1ZKJA 3GVBA 4XT2B 5CTNA 3LO7A 2WADA 4R38A 3JVVA 5FQKA 4LV0A 5GHYA 3CLOA 2HJ9C 3KSIA 2J80A 2ZC4B 2ZJ9A 1NZOA 3CAXA 5I94A 4KZ5A 2ZL1A 5EPHA 4X1MA 2WZXA 4WMCA 1IKGA 1ESUA 5HZHA 1BYWA 3N8RA 2H28A 1EW0A 5CX7A 4FSFA 1PWDA 4ME4A 2J7VA 1VQQA 4S2KA 1CI9A 3TE8A 3HLBA 3MJQA 5GHXA 3MBZA 3WS4A 2GJ3A 5EVIC 4QPRA 4HJ3A 3VOYA 4BD0A 4GJ4A 1KGEA 4P6ZS 1LSXA 2KX6A 5TFQA 3OCNA 4JKTA 4GDBA 3MQQA 3PBRA 3N6IA 4PAUA 1LL5A 4KG2A 4XT2A 4NK3A 1ONHA 4LRZE 3VE4A 1OJ5A 1N9BA 4KZ7A 2W3EA 2OSUA 1S0WA 1W5DA 1JNUA 4X69A 2XRNA 3IBJA 4GZBA 3UE6A 1KVMA 3RXXA 5MC7A 5J3WA 3ZNYA 3HJIA 2VV7A 4PKYG 5CHMA 5HDSA 4B9OA 1CEFA 4JGRA 2HP6A 1YKDA 2DCFA 2J8YA 2RL3A 4E3LA 5JYOA 4XXRA 1U60A 1XKZA 1K55C 3LR5A 4I3IA 4JGPA 2V1ZA 5HWWA 1AWIA 3NBLA 3RJUA 4KZBA 4WUJA 1SZVA 1OTIA 2W3GA 4Q8IA 3IX8A 4S2PA 2H5SA 2V1BA 3Q1FA 2OLUA 5EVIA 5DTTA 4EWFA 3BRMA 1NJ4A 3CI6A 4UQIM 4Y0OA 1XA7A 4XUXA 2J3WA 4FOFA 4OOMA 1KDWA 3T50A 1JWPA 4IVKA 3ZYTA 3AGDA 2XSSA 1OPXA 4F94A 3HLWA 1K0KA 3LY4A 3NY4A 1YLPA 3IF6C 1O7EA 1MWSA 1PZOA 1F2KA 4WZ5A 3UB5P 4O7DA 5DVAA 4X56A 4WBGA 2Z6DA 4MCWA 3VV4A 4A5RA 3GRJA 1H8YA 2PAVP 4UQIS 1FCNA 3Q81A 1H5XA 3ZFZA 2ZQ8A 2ZMFA 1ZG6A 4LRXC 3SZTA 3UB8A 2ZQCA 1XJ2A 3IBRA 3C8CA 3UMDA 3KX0X 1GA0A 2Y8HA 1TS6A 1KDSA 5EVIB 2V1AA 2OV5A 4PM7A 3MKFA 1L0FA 1EWZA 5CECA 1E4DA 5HL1A 3BQ8A 1UWNX 5FI2A 1LSVA 1TVFA 4KUKA 1YLYA 3PTEA 2JKTI 4HP9A 3W4PA 2XR0A 1YPRA 3HCYA 1Y28A 2W1TA 1C3BA 5FEGA 4KZAA 1FSWA 3IX3A 5GLCA 3PR6A 5EVEA 4EEUA 1FOFA 1LI0A 5FAPA 1K38A 3MFXA 3EGXC 2Y2JA 3BW6A 3LUQA 3K2NA 3IWOA 3HLDA 2QKPA 1NXYA 2ZC3B 5CEBA 5FAOA 3K3DA 3TW8A 4DMZA 1K4FA 2W3FA 4IUKA 2XROA 1GSXA 2LB9A 5HDCA 1XXMA 2WKHA 3SS3A 1WA9A 4N1HA 5FQIA 3A0SA 1IKIA 3M6BA 2B5RA 1HZOA 3VP4A 2IA2A 2EWVA 5EECA 4NG2A 4S2JA 2VGLS 4Y15A 3UPPA 3G34A 4OP8A 4FUWA 3ZG5A 1PWGA 2FH5A 3OPHA 4YINA 1IYSA 4RX3A 1N9LA 1D1JA 1PNEA 2QHKA 2PU2A 4FH2A 2G2UA 1TS7A 1SKFA 1Z09A 4QY6A 4HJ4A 2O9BA 4YWZA 5G18A 2J3TC 3T1RA 4WEKA 1ERQA 2AVXA 3UN7A 3VMAA 3VSLA 2XFSA 4QD4A 4DN0A 3LIAA 3MQ0A 4FH4A 4Y0TA 5AJGA 3G35A 1EI5A 4YOFA 5A90A 2PD7A 5TGFA 2HP9A 1IYQA 4HBUA 4MBHA 4KZ4A 2W3DA 2ACGA 5BOHA 1YM1A 1N9OA 1W63Q 5KSCA 3ISGA 4PHTA 3ZG0A 3QP2A 4F3LB 5U47A 5EVID 4EBNA 1XGJA 2C6WB 4IUHA 1OJGA 1X0OA 4N9KA 1YSQA 1OTAA 2XD5A 4HNBA 2IWCA 4QHCA 4EXOA 4HOIA 3T4QA 3OZHA 3SS5A 1AXBA 5M19A 4KG5A 2HP5A 1ZG4A 4X1LA 3F1NB 2J9OA 3T4JA 4Y7PA 2P9VA 2QYBA 3PBTA 1W63M 2OWHA 1NRJA 4XUZA 4Y17A 2QZ6A 1D06A 4NXGA 1MPLA 3LIEA 5HD3A 1ES4A 2ZC7A 1PZPA 4CLCC 2QWSA 3N4IA 4EW7A 2EFUA 3EGDC 4F3LA 3S1YA 3IQAA 3PAGA 4KZ9A 5EUAA 4JPMA 4DE2A 3BYDA 4OLDA 3S4XA 3B42A 5E2HA 5DF8A 4ZJ2A 4R4SA 4X53A 3MKEA 4WN5A 1KE0A 3LR0A 5EM0A 5FAQA 3LFVA 1K57A 4PM9A 1CK3A 4PMAA 2FFYA 5E2GA 4L9FA 4M3KA 1YLJA 3ZG7B 4EBPA 3PBNA 3MZFA 2KLIA 2I72A 1JVJA 4OP5A 2ZM0A 2EA9A 5TBMA 2NUPC 4LGWA 3SH8A 3V39A 3PBOA 3T1XA 1IYPA 1K6SA 1ERMA 1W7FA 1E3UD 1YMXA 2A2LA 3T4KA 3OLOA 1NWZA 1MWUA 1HD8A 1T1BA 1CEGA 3A3FA 2VGLM 5L2FA 2OLVA 4X6TA 4BD1A 1GHPA 1ESIA 3CITA 4GLQA 1TS0A 3IHBA 4R23A 3P09A 3DWZA 1QMFA 2K31A 3LEQA 1FILA 1OT9A 4LENA 4UA7A 4Q0IA 5F5YA 3LI9A 3UDFA 3UO9A 3F1OA 5TBMB 3QNCA 5HAQA 4HH2A 3SH7A 3M2KA 3T4SA 4JBFA 5TJJA 3MSHA 4GDNA 1TDLA 3NOUC 2B95A 4OQ0A 3D4FA 2ZLYA 4OOYA 2X01A 3HUMA 3Q07A 1GHMA 2JBFA 1IFQA 2V0UA 1T1CA 1V9YA 2H0YA 2OAQ1 4E3KA 4GNUA 2HJEA 3VFFA 4BWIA 3G30A 3LIDA 1WYBA 4OQGA 2ZC5B 4GS9A 2HV1A 3SW1A 3KSGA 4BBTA 3CZDA 4Q0HA 2BTFP 3IF6B 4UA9A 3V3RA 3KSFA 5DJTA 2GDNA 3D3OA 4JXVA 1XX2A 3E4QA 2Z2LB 3BLSA 4NXFA 3E0YA 4I5SA 3UDXA 4NKPA 5CGWA 4JF6A 2W27A 3F1OB 3TOIA 2PR6A 4O8GA 5F1GA 5FL3A 3VP0A 2ZQAA 2FFFB 3NHQA 3QHYA 1I2WA 1JWVA 5A8BA 4R0QA 5E43A 3BJNA 1SDNA 1TEMA 1K54C 4HHDA 4ARZA 5F68A 3UB7A 4QY5A 2W0NA 3G2YA 3VP2A 4R4RA 3T4OA 4GS9B 2XA7S 4DF6A 1BT5A 3G6OA 5FI7A 2WYXA 3Q7VA 2B18A 3NOPC 3LY3A 2A24B 3UE0A 3GSGA 2Q9MA 1SCWA 3KYZA 4ETXA 3T4TA 3W4OA 2JKTM 3VFHA 3CHWP 4Z1WA 1DY6A 4UA6A 2HDSA 4S2IA 2ZMAA 1ZTUA 5FDHA 1LSWA 1ZC2A 2B02A 1NY0A 2VV8A 1VEUB 5JYPA 5DTSA 3HVFA 1H8MA 3TRCA 3FG8A 3NCKA 3O88A 4HH3A 3BFCA 2OAP1 3Q82A 4K0XA 4EERA 4JF5A 3QP1A 1DP8A 1PWCA 2QJ7A 4DDYA 4Y13A 2Y2NA 4N9LA 1WYCA 1IOUA 2VKSA 2Y59A 5FASA 1FCOA 2PBDP 1PI4A 2XDMA 4JLFA 2BLSA 4E3IA 1T18A 4IVIA 1XJ3A 1M6KA 3HBRA 4ZTKA 5KSHA 2PRFA 5FDSA 1VETA 2WAFA 5DFXA 1CJFA 1ODVA 4OPZA 1NYYA 1ES5A 3KO6A 2H0TA 2O9CA 1T19A 1KGGA 1S1YA 2HZ5A 4HBTA 1IYOA 4RYEA 4NEED 2K2NA 4X25A 3IXGA 1SDEA 2Z6CA 2WGWA 3T4LA 2WKEA 2XA7M 2ZBBA 1FSYA 5IU1A 1H3QA 4CLCD 1N9NA 3NDEA 5CGSA 1FIKA 1UGUA 2HF6A 3H82A 4EETB 4FTXA 1PRQA 5HPFA 3VOZA 4BBVA 1K57C 2ZC6B 2Q0OA 1TF1A 1XPBA 1BLCA 5K5BA 3ITAA 3IHAA 5AQ7A 3LR4A 4WELA 3QP6A 4ZAMA 1JTGA 1LL9A 3H7WA 1GCEA 4DKIA 3KYEA 1Q2PA 2EX2A 3E2LA 3CPTB 5M18A 4PKYA 3ZHHA 3W4QA 2GNXA 1MXOA 1MY8A 4HIAA 4Z9QA 4MLLA 2WKRA 3PBSA 4GOGA 4O01A 3ZCZA 4MNRA 3EQUA 2G7UA 1QMEA 5KZHA 2XFTA 4OPYA 1YT4A 4HQAA 4KQOA 2PD8A 4S2OA 5CRFA 1RCJA 1ONGA 4N1XA 1G28A 3QNBA 5GLDA 1T1AA 3AGEA 2Y4AA 5L8MA 2VGKA 3IX4A 5HWVA 2GX5A 1F98A 2DNSA 5EE8A 1YMSA 3UE1A 2E8JA 3S7NA 4P87A 4CQHA 1TD5A 3CPTA 2YKFA 2CC1A 3MQOA 5HD5A 3BQAA 3C7UA 4E3JA 2J3TD 2X02A 4LV1A 1YAXA 2Y55A 4DJ3A 3Q7ZA 2BG1A 1XA1A 5L09A 4E6WA 1BSGA 4O0PA 1IELA 2JN7A 2Y2PA 4R6LA 1VHMA 3E4OA 3O86A 3R7WA 3WS5A 3RFBA 4ETZA 3G4PA 5D3OA 5HAPA 2BASA 5F82A 4DXBA 5DF7A 1PIOA 1V9ZA 2EX8A 2JCHA 1FR1A 1LLBA 3CMZA 3MXRA 3UB9A 1LL8A 4MN7A 5AQAA 2Y2IA 3V3SA 4DE0A 1P9WA 2PHYA 4R70A 1XJ4A 3FPVA 3IS2B 4JXSA 3WRTA 5AVFA 5CHUA 1GHIA 1ACFA 5HX9A 4QJGA 1BLSA 1BLPA 2XH9A 1S6RA 4MBKA 4B93A 1K55A 4KZ6A 3GQZA 2P7JA 4GB7A 1F9IA 4BL3A 2L0WA 4IBXA 2XLNA 1Z6FA 4CJNA 3HREA 1OTDA 2HDUA 2UWXA 3ZVTA 3S22A 3SS4A 3UB6A 4Q0JA 2VX8A 2EX9A 2QPNA 1S4SA 2I9VA 3R7WB 1PYYA 2CMNA 4P85A 2ZQ7A 5EVLA 1HLUP 1XFQA 3UDIA 4BBUA 2VA0A 2A3UA 3BECA 4EUVA 2VJWA 5GHZA 5L07A 3LI8A 1PW8A 2D02A 4ESPA 1F5MA 4WLAA 3T1QB 2V2FF 2ZMVA 3LGOA 1YQSA 5G4ZA 4OH0A 4S2MA 4LCMA 3UPOA 1J9MA 1E3UA 5FQ9A 5GLBA 3IS2A 4UEYA 5HARA 3BM6A 4WL9A 1HTZA 1KVLA 1XGIA 2ZQ9A 3GDIA 2IWBA 1K4EA 3C4OA 5IT5A 5A93A 4ZDXA 3H9WA 3MFDA 3NOTC 1K6RA 2Y2GA 2EXAA 4EBLA 1LHYA 1Y4OA 4WMCD 4NXEA 3RTYA 4JXGA 3BWLA 3KYQA 5DF9A 4IBRA 1YSPA 4M4XA 3VOLA 5CTMA 1W8QA 1RP5A 2V8CA 2P04A 4OONA 3NIAA 3E2KA 4MN5A 4YNRA 2PU4A 4D2OA 3GECA 5FA7A 4OVDA 3L9KA 4DE1A 5FSRA 3LIFA 3ULFA 3C30A 4HEFA 3QP8A 2VLGA 2XK1A 2Z2MB 3EOIA 1JTDA 3NULA 4OLGA 3OBFA 4GW9A 4EU0A 2WGVA 1PFLA 3CUEC 3IXBA 3A0RA 4PM5A 3P98A 5C5KA 3A3DA 3NDGA 2DRWA 2ZD8A 5J8XA 5A92A 1MWTA 2M7VA 3ZDJA 5EV0A 2VK3A 3E98A 3FWLA 2P08A 1FCMA 1GA9A 3FKWA 1DJAA 1S4RA 3LR3A 1OMEA 4BQMA 1MBLA 4HI4A 1LT0A 1KE4A 3B3XA 3C7VA 5KIZA 4GD6A 3LICA 3DTIA 2EWWA 2ZOHA 2UV0E 3CJMA 4BLMA 2WKPA 5E2FA 2XEPA 5TR7A 3BFGA 3OOVA 1NYMA 2XF3A 2JKFA 5DKLA 2KOIA 3I7JA 3HLCA 3HL9A 3T1SA 2V20A 5DFYA 5J7EA 3FC7A 4BMWA 4X68A 3UMEA 1ES3A 4E3MA 1CI8A 3HLGA 5LBRA 1SHVA 3WWXA 3JPUA 4HESA 5DJUA 3VE3A 3ITBA 4QU3A 2Y79A 3BEBA 1KOUA 1OTBA 2W1TB 3FZCA 3GMWA 3QP5A 1FR6A 2R9WA 5F6AA 3P01A 4I38A 1SKOA 5HAIA 2PYPA 1BZAA 4GCZA 1TS8A 3OC2A 1I5QA 2M1CA 4G3VA 4KZ3A 1G6OA 2P9VB 4G3WA 3V5MA 3GV9A 1Q2QA 3A3IA 3MXSA 3V50A 4HJ6A 1N4OA 3TG9A 4WYYA 3ZVWA 2X71A 4C6YA 2Y2OA 5EOOA 1M40A 3OPPA 4H8RA 4E6XA 1L0EA 4FCFA 3ZG9B 4EV4A 3IF5A 4B4XA 4WZ4A 4LCLA 4WZ5C 4JF4A 1WE4A 5FQMA 2P74A 1P9RA 3FPWA 3WS1A 1BULA 2Y2QA 3C38A 4JXWA 1A0KA 4DE3A 2WZZA 2XD1A 4YFMA 5DKKA 4OKPA 3TSGA 3LIBA 1SKOB 3O3VA 4U0XA 4K08A 1MKIA 3E4PA 1EROA 2HDQA 2EXBA 1RGZA 3ZNTA 3BLMA 4E3OA 3GR2A 4IHQA 2EFXA 2WKIA 1S67L 2VZWA 5AVEA 1GSVA 4NETA 5GLAA 2K7SA 2INWA 5I5LA 3HUOA 3NI9A 3N8LA 3W8KA 1NLYA 3RH8B 3OPRA 3PBQA 3MF0A 2L4RA 1E25A 4P0MA 3T12B 3DTKA 4GHIA 2W3HA 1G6AA 4FD8A 4EESA 5FQQA 4KQQA 1LI9A 3ICYA 3BFFA 2DMWA 1S1ZA 4PPRA 4CPKA 3NJAA 3S7PA 3UNWA 4DDSA 2XGNA 3F1NA 2PT7A 4LV2A 4H6JA 4S2NA 1KGFA 5J4EA 4IJGA 5HWTA 1W8YA 5CERA 1L0GA 3MXQA 3C5AA 3W2ZA 5FATA 5EFWA 2E8IA 3K3CA 3B47A 2VGJA 1D7EA 4WM9A 1P0ZA 3G32A 3U4LP 1H8ZA 4GD8A 1L0DA 4BL2A 1DRMA 3FKVA 1IEMA 3G31A 1JWZA 1PI5A 1MC0A 3UE3A 4II7A 3DWKA 5E2EA 2R9XA 2PYRA 4QB8A
chains in the Genus database with same CATH topology
2GJ3A 4GHIB 3UB9A 4QPRA 1LL8A 4HJ3A 4MN7A 4JGQA 4GJ4A 4P6ZS 1LSXA 3T4KA 3OLOA 2KX6A 1NWZA 1S66L 3OCNA 2L1MA 1P9WA 3LYXA 2PHYA 4R70A 1XJ4A 4JGOA 3BY8A 3FPVA 3IS2B 3MQQA 3F1PB 3PBRA 4PAUA 4XT2A 1T1BA 2O9AA 2KDKA 5AVFA 4LRZE 3VE4A 1OJ5A 2VGLM 2VV6A 4CLCB 2W3EA 4H6JB 3CITA 4B93A 4L9EA 4GLQA 2P7JA 1JNUA 1TS0A 2XRNA 1F9IA 3ZQ5A 3IBJA 3UE6A 2L0WA 1OTEA 2K31A 5MC7A 5J3WA 3HJIA 1OTDA 2VV7A 2OOLA 1OT9A 4PKYG 5HDSA 4B9OA 4Q0IA 5F5YA 4Q0JA 3LI9A 3UB6A 4EEPA 2VX8A 4JGRA 3F1OA 3KSHA 1YKDA 5TBMB 3S7OA 1S4SA 2I9VA 3MMHA 3R7WB 2CMNA 4HH2A 1XFQA 4BBUA 2VA0A 2VEAA 3LR5A 4I3IA 4JGPA 3T4SA 5TJJA 5HWWA 4EUVA 2VJWA 2PR5A 3NOUC 3LI8A 4WUJA 2D02A 2D01A 1OTIA 2W3GA 1F5MA 4WLAA 2MJ6A 2ZMVA 3EWKA 4HP4A 4E04A 4LLOB 5G4ZA 1NLZA 1IFQA 2V1BA 2V0UA 1T1CA 1V9YA 2OAQ1 3IS2A 4MN6A 2HJEA 3F1PA 4UEYA 4BWIA 4WL9A 5G4YA 2JKRM 3CI6A 4UQIM 3GDIA 3LIDA 4CLCA 2J3WA 4FOFA 4OOMA 5IT5A 4GS9A 2HV1A 3T50A 3SW1A 3H9WA 3KSGA 3ZYTA 3NOTC 3R4KA 4BBTA 4Q0HA 3KSFA 5DJTA 2XSSA 3D3OA 4NXEA 1OPXA 3E4QA 3RTYA 5HDDA 2FZ0A 5F69A 4NXFA 3E0YA 4I5SA 3BWLA 3KYQA 4NKPA 5DF9A 2W27A 1YSPA 4M4XA 3VOLA 3F1OB 4CLCE 2PR6A 2P04A 2Z6DA 4O8GA 4MCWA 3VV4A 2JHEA 4MN5A 4WEJA 4UQIS 4YNRA 2M7UA 3GECA 5FL3A 3V67A 1XJ6A 2ZMFA 4LRXC 4I3JA 3UB8A 3U2AA 1XJ2A 3LIFA 3IBRA 4NXBA 3NHQA 3ULFA 3C8CA 3C30A 3UMDA 2GZAA 2VLGA 3EOIA 3KX0X 5A8BA 3PYPA 2Y8HA 3OBFA 4GW9A 4EU0A 1TS6A 3BJNA 4RQ9A 2V1AA 3CUEC 3A0RA 5IS1A 3D72A 4HHDA 4ARZA 4KUOA 5C5KA 5F68A 3BY9A 3UB7A 2W0NA 3BQ8A 1UWNX 3PHYA 3T4OA 4GS9B 2XA7S 1LSVA 3EEHA 3G6OA 4KUKA 2M7VA 3EEAA 2B18A 3MR0A 3NOPC 3E98A 2P08A 2A24B 2JKTI 1S4RA 3LR3A 4HP9A 4HI4A 3KYZA 1LT0A 4ETXA 1STZA 3HCYA 3A0VA 1Y28A 3T4TA 2JKTM 2W1TA 5KIZA 3S7QA 4KQDA 2JKRI 3PR6A 3LICA 4EEUA 2EWWA 1MKMA 2ZOHA 4Z1WA 4LPZA 2V9AA 4ZRRA 4HY8A 2O0YA 3MFXA 2WKPA 3EGXC 1ZTUA 3BW6A 3LUQA 1LSWA 2B02A 3K2NA 3OOVA 2VV8A 2QKPA 2V0WA 5DKLA 2R78A 2KOIA 3K3DA 1H8MA 3TRCA 3TW8A 3FG8A 3CWFA 4DMZA 5HL6A 4HH3A 2W3FA 4IUKA 2XROA 2OAP1 1GSXA 2LB9A 4EERA 5HDCA 1WA9A 1DP8A 5DFYA 4ARZB 2QJ7A 3A0SA 5J7EA 1VB6A 3PXPA 3FC7A 4BMWA 1IOUA 3H82B 2OWJA 2VKSA 2IA2A 2EWVA 3UMEA 3TJZC 5LBRA 2VGLS 2NUTC 5DJUA 3VE3A 2PDRA 2FH5A 5HSQA 2A24A 1T18A 4L0LA 1XJ3A 1GSWA 2O99A 1N9LA 5KSHA 1ZHHB 2QHKA 4Y2FA 2Y79A 5DFXA 2QJ5A 1ODVA 1KOUA 1OTBA 2W1TB 3H7WB 1TS7A 4BJPA 1DP6A 3DBAA 4HJ4A 3JVUA 3P7NA 2O9BA 4YWZA 2J3TC 3KO6A 2YKHA 2O9CA 3P01A 4I38A 4WEKA 2W1RA 5F6AA 4EQ1A 1T19A 2PYPA 4GCZA 1S1YA 1TS8A 3OC2A 4DN0A 3LIAA 2M1CA 4G3VA 3MQ0A 1G6OA 4G3WA 5AJGA 4NEED 2K2NA 4YOFA 2PD7A 4DJ2A 2W3DA 2Z6CA 4HJ6A 2LB5A 3T4LA 4WF0A 4AFIA 1OT6A 2XA7M 2ZBBA 1N9OA 1W63Q 1H3QA 5IU1A 4CLCD 3CUEA 4Y3IA 4PHTA 1N9NA 1UGUA 2HF6A 3H82A 4EETB 4F3LB 4OOLA 5HPFA 4BBVA 4IUHA 1OJGA 1X0OA 1P9RA 3FPWA 1TF1A 4Y5FA 1YSQA 1OTAA 4HNBA 1P97A 4EXOA 5K5BA 3LR4A 3OCLA 3C38A 4HOIA 4MMNA 4WELA 3C2WA 3EQVA 3H7WA 3T4QA 5DKKA 5HPIA 4P6ZM 4I39A 3LIBA 3F1NB 2ZOIA 4PKYA 4K08A 2GNXA 3T4JA 3E4PA 2QYBA 3PBTA 1W63M 2OWHA 4HIAA 1NRJA 4I3AA 1MZUA 1D06A 4NXGA 4IHQA 1XFNA 2HGVA 1UWPX 2WKRA 3PBSA 3LIEA 4O01A 5HD3A 1S67L 3EQUA 4CLCC 2G7UA 1DP9A 2QWSA 2VZWA 4EW7A 5AVEA 1GSVA 3O5YA 2K7SA 2INWA 4HQAA 4MDZA 3EGDC 5I5LA 4F3LA 4G3KA 4LRYC 4R3AA 1NLYA 3RH8B 4KQOA 3PBQA 2PD8A 2L4RA 3MF0A 4L9GA 2WKQA 4GHIA 2W3HA 1G28A 1T1AA 3B33A 3B42A 5L8MA 5HWVA 2GX5A 4EESA 3HJKA 1F98A 3ICYA 3S7NA 4XT2B 4WN5A 4CQHA 3LR0A 2DMWA 1TD5A 1S1ZA 4R38A 3LFVA 3JVVA 3NJAA 2YKFA 3S7PA 3F1NA 2PT7A 4H6JA 3MQOA 5J4EA 4IJGA 5HWTA 5HD5A 3BQAA 2J3TD 3CLOA 1YAXA 2HJ9C 4L9FA 3MXQA 4DJ3A 3W2ZA 3KSIA 2J80A 5EFWA 3CAXA 3K3CA 4O0PA 3PBNA 2JN7A 2KLIA 3B47A 1D7EA 1P0ZA 5HZHA 4R6LA 1BYWA 1VHMA 2H28A 3E4OA 1EW0A 2EA9A 5CX7A 5TBMA 2NUPC 4FSFA 3R7WA 1DRMA 3RFBA 3PBOA 4ETZA 4ME4A 2BASA 1V9ZA 1MC0A 3UE3A 4II7A 3TE8A 3MJQA 2A2LA 2PYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GJ3 A;  4GHI B;  4I5S A;  3BWL A;  1LL8 A;  4HJ3 A;  3UB9 A;  4K08 A;  4JGQ A;  3A0S A;  3E4P A;  2W27 A;  5J7E A;  1VB6 A;  3FC7 A;  4M4X A;  3F1O B;  1LSX A;  3H82 B;  3VOL A;  2OWH A;  2KX6 A;  3OLO A;  4HIA A;  1NWZ A;  2OWJ A;  1S66 L;  3UME A;  2L1M A;  3LYX A;  2PR6 A;  2PHY A;  4R70 A;  4I3A A;  1MZU A;  1XJ4 A;  2Z6D A;  3BY8 A;  4JGO A;  3IS2 B;  1D06 A;  3MQQ A;  3F1P B;  4NXG A;  5DJU A;  3VE3 A;  1XFN A;  2JHE A;  4MN5 A;  2PDR A;  4XT2 A;  1T1B A;  5AVF A;  1UWP X;  2KDK A;  2A24 A;  2WKR A;  5HSQ A;  3GEC A;  1T18 A;  3LIE A;  4LRZ E;  5HD3 A;  3VE4 A;  1XJ3 A;  1S67 L;  1GSW A;  1OJ5 A;  1XJ6 A;  2VV6 A;  1N9L A;  5A8B A;  1DP9 A;  4I3J A;  4LRX C;  3UB8 A;  2QHK A;  2QWS A;  4H6J B;  4EW7 A;  1XJ2 A;  3LIF A;  2QJ5 A;  5AVE A;  1GSV A;  3IBR A;  4NXB A;  1ODV A;  3NHQ A;  1KOU A;  1OTB A;  3H7W B;  4L9E A;  3ULF A;  5KIZ A;  2K7S A;  3C8C A;  1TS7 A;  2INW A;  2P7J A;  2VLG A;  1JNU A;  1TS0 A;  3KX0 X;  4HQA A;  5I5L A;  3UMD A;  1F9I A;  4F3L A;  4LRY C;  1DP6 A;  3ZQ5 A;  3PYP A;  4R3A A;  3UE6 A;  4HJ4 A;  4GW9 A;  2L0W A;  3P7N A;  1TS6 A;  4RQ9 A;  4YWZ A;  3RH8 B;  2PD8 A;  2L4R A;  1OTE A;  2V1A A;  2YKH A;  4I38 A;  5F6A A;  5J3W A;  3HJI A;  1OTD A;  4EQ1 A;  2VV7 A;  1T19 A;  3A0R A;  2PYP A;  2WKQ A;  3D72 A;  4GCZ A;  4L9G A;  5IS1 A;  2OOL A;  1OT9 A;  1S1Y A;  4HHD A;  4KUO A;  1TS8 A;  4PKY G;  4GHI A;  5HDS A;  5F68 A;  3BY9 A;  4B9O A;  5F5Y A;  3LIA A;  2M1C A;  1G28 A;  2W0N A;  3LI9 A;  3UB7 A;  1UWN X;  3UB6 A;  4JGR A;  3PHY A;  1T1A A;  4EEP A;  3F1O A;  4GS9 B;  5TBM B;  3B33 A;  1LSV A;  1S4S A;  2I9V A;  3EEH A;  3G6O A;  2CMN A;  5HWV A;  4KUK A;  4EES A;  3HJK A;  2PD7 A;  1F98 A;  1XFQ A;  4HH2 A;  3MR0 A;  4DJ2 A;  4BBU A;  3ICY A;  4WF0 A;  3NOP C;  2VEA A;  4XT2 B;  2Z6C A;  4HJ6 A;  2ZOI A;  4I3I A;  2A24 B;  4JGP A;  4WN5 A;  1S4R A;  1S1Z A;  5HWW A;  4R38 A;  4HP9 A;  2PR5 A;  2YKF A;  3NJA A;  3NOU C;  3LI8 A;  4HI4 A;  1LT0 A;  2D02 A;  2D01 A;  1OTI A;  1OT6 A;  2ZBB A;  3F1N A;  1N9O A;  4H6J A;  4WUJ A;  3MQO A;  4WLA A;  5IU1 A;  5J4E A;  3A0V A;  5HWT A;  5HD5 A;  1Y28 A;  3F1N B;  1N9N A;  3CLO A;  3EWK A;  4HP4 A;  1UGU A;  3H82 A;  4L9F A;  4LLO B;  3MXQ A;  5G4Z A;  4E04 A;  4EET B;  2V1B A;  2V0U A;  4KQD A;  4F3L B;  4DJ3 A;  1T1C A;  1V9Y A;  2J80 A;  5EFW A;  3LIC A;  3CAX A;  3K3C A;  4EEU A;  3IS2 A;  2ZOH A;  4MN6 A;  3F1P A;  2JN7 A;  4LPZ A;  2V9A A;  4BBV A;  1OJG A;  1X0O A;  4WL9 A;  4HY8 A;  5G4Y A;  2WKP A;  3MFX A;  1D7E A;  1P0Z A;  5HZH A;  1OTA A;  4HNB A;  3GDI A;  1BYW A;  3LID A;  3LUQ A;  1LSW A;  4R6L A;  1P97 A;  2B02 A;  4EXO A;  2H28 A;  3E4O A;  1EW0 A;  2VV8 A;  2EA9 A;  2QKP A;  2V0W A;  4GS9 A;  2HV1 A;  4HOI A;  5DKL A;  5TBM A;  3T50 A;  2R78 A;  3SW1 A;  1DRM A;  3H9W A;  3C2W A;  3H7W A;  3K3D A;  5DKK A;  3NOT C;  4BBT A;  3FG8 A;  2BAS A;  3CWF A;  4HH3 A;  1V9Z A;  4I39 A;  3LIB A;  5DJT A;  1GSX A;  5HDD A;  4NXE A;  3E4Q A;  4EER A;  5HDC A;  3RTY A;  3MJQ A;  1WA9 A;  1DP8 A;  5F69 A;  2PYR A;  4NXF A;  4PKY A;  2QJ7 A; 
#chains in the Genus database with same CATH topology
 4GHI B;  1I2S A;  4GKU A;  4JGQ A;  4KEN B;  3VP1 A;  3NC8 A;  1S66 L;  2L1M A;  3LYX A;  1TDG A;  4JGO A;  1YLT A;  3BY8 A;  3F1P B;  3MS6 A;  4N92 A;  2O9A A;  2KDK A;  2WK0 A;  2VV6 A;  4CLC B;  4H6J B;  1Y54 A;  4L9E A;  3O87 A;  4ID4 A;  1DJC A;  3ZGA B;  3M2J A;  3ZQ5 A;  3IF6 A;  1H0M A;  2RCX A;  3WS2 A;  1OTE A;  5IHV A;  1MWR A;  2OOL A;  4S2N C;  4EEP A;  3KSH A;  3S7O A;  3MMH A;  5CGX A;  3ZG8 B;  5L10 A;  1W79 A;  3C4P A;  2VEA A;  3IXH A;  4C75 A;  2WUQ A;  5CXW A;  2PR5 A;  2D01 A;  5F83 A;  2MJ6 A;  1ALQ A;  3EWK A;  4HP4 A;  4OQH A;  4LLO B;  4MEZ A;  5EM1 A;  1NLZ A;  4E04 A;  4MN6 A;  3F1P A;  2HPB A;  4OPR A;  3MZE A;  3GTC A;  5G4Y A;  2Y2H A;  4DRT A;  2JKR M;  1K25 A;  2G2W A;  2Y2M A;  4CLC A;  4EUZ A;  4KZ8 A;  4MBF A;  1BLH A;  5HW3 A;  2J9P A;  3R4K A;  4OQI A;  3SH9 A;  2PBY A;  2ZM8 A;  1L3L A;  5HDD A;  2FZ0 A;  5F69 A;  4GN2 A;  4OPQ A;  4CLC E;  1NZU A;  2HDR A;  1G68 A;  1G5U A;  4B4Z A;  3CG5 A;  4ZJ1 A;  3WS0 A;  2JHE A;  4WEJ A;  2M7U A;  3V67 A;  1XJ6 A;  4I3J A;  1L2S A;  3U2A A;  4NXB A;  3FV7 A;  1KE3 A;  2GZA A;  3MZD A;  2V8F A;  2Q9N A;  3PYP A;  5A91 A;  4RQ9 A;  2Y91 A;  2ZM2 A;  4UAA A;  5AQB A;  1XP4 A;  5IS1 A;  3D72 A;  3LEZ A;  4KUO A;  4X55 A;  3BY9 A;  4S2L A;  3PHY A;  3LCE A;  3EEH A;  3EEA A;  2WAE A;  3MR0 A;  1DJB A;  3SOI A;  3A3E A;  2H10 A;  5F1F A;  3FYZ A;  1STZ A;  1VET B;  3A0V A;  4P6B A;  1K54 A;  2C5W B;  3S7Q A;  4KQD A;  1BUE A;  5FI6 A;  2JKR I;  3N7W A;  1CF0 A;  1MKM A;  4LPZ A;  2V9A A;  4ZRR A;  4HY8 A;  4LV3 A;  2O0Y A;  5HFO A;  3DW0 A;  3WRZ A;  3G2Z A;  2V0W A;  2R78 A;  4Y0U A;  2XQZ A;  3BFD A;  5CHJ A;  3CWF A;  5HL6 A;  2WGW B;  5EOE A;  3PAE A;  5KMW A;  3L7H A;  5CED A;  2JKG A;  3UPN A;  4ARZ B;  5AQ9 A;  1VB6 A;  3PXP A;  3H82 B;  1K56 A;  2OWJ A;  1VM1 A;  3TJZ C;  2NUT C;  3Q7V B;  3DAV A;  1YLW A;  2PDR A;  5HSQ A;  2A24 A;  4L0L A;  1GSW A;  2O99 A;  3M6H A;  4RX2 A;  1ZHH B;  3HLF A;  4Y2F A;  1O07 A;  4ZJ3 A;  4LFU A;  2QJ5 A;  5DTK A;  4RVA A;  3H7W B;  3AGF A;  4KG6 A;  4BJP A;  4R3B A;  1DP6 A;  3DBA A;  3JVU A;  3P7N A;  4IED A;  2YKH A;  2W1R A;  4EQ1 A;  4RA7 A;  3OPL A;  2WGI A;  2JE5 A;  4KQR A;  1VEU A;  1FQG A;  3IXD A;  4DJ2 A;  3RXW A;  3VSK A;  4U0T A;  4PM6 A;  4ZBE A;  2LB5 A;  1NRF A;  4WF0 A;  4UHU A;  3IH9 A;  4AFI A;  1OT6 A;  3CUE A;  4Y3I A;  3BFE A;  4DXC A;  1HVB A;  2Y2K A;  3A3J A;  4OOL A;  3NEC A;  5FEF A;  2EX6 A;  3N8S A;  3UY6 A;  2IWD A;  1BTL A;  4Y5F A;  3IWI A;  2Y2L A;  3VP3 A;  1P97 A;  4R3J A;  3OCL A;  4MMN A;  3IT9 A;  3C2W A;  4K0W A;  1PW1 A;  2JC7 A;  3EQV A;  5HPI A;  4BEN A;  4P6Z M;  4U3T A;  4I39 A;  1YLZ A;  5FQJ A;  1CQA A;  4K91 A;  2ZOI A;  4C3Q A;  2QMI A;  4QWO A;  2ZQD A;  4R1G A;  4I3A A;  1MZU A;  5GL9 A;  2ZL1 B;  1XFN A;  2HGV A;  1UWP X;  3JYI A;  1K56 D;  4E3N A;  4B88 A;  1DP9 A;  3IH8 A;  3QP4 A;  5M1A A;  3O5Y A;  3D9Y A;  1J3W A;  4MDZ A;  4G3K A;  4LRY C;  4R3A A;  4PM8 A;  4L9G A;  2WKQ A;  2A49 A;  3DTM A;  3HLE A;  3IWQ A;  4EQI A;  3DTE A;  4D60 A;  3B33 A;  1RGY A;  3HUN A;  1ES2 A;  3HJK A;  1ZKJ A;  3GVB A;  4XT2 B;  5CTN A;  3LO7 A;  2WAD A;  4R38 A;  3JVV A;  5FQK A;  4LV0 A;  5GHY A;  3CLO A;  2HJ9 C;  3KSI A;  2J80 A;  2ZC4 B;  2ZJ9 A;  1NZO A;  3CAX A;  5I94 A;  4KZ5 A;  2ZL1 A;  5EPH A;  4X1M A;  2WZX A;  4WMC A;  1IKG A;  1ESU A;  5HZH A;  1BYW A;  3N8R A;  2H28 A;  1EW0 A;  5CX7 A;  4FSF A;  1PWD A;  4ME4 A;  2J7V A;  1VQQ A;  4S2K A;  1CI9 A;  3TE8 A;  3HLB A;  3MJQ A;  5GHX A;  3MBZ A;  3WS4 A;  2GJ3 A;  5EVI C;  4QPR A;  4HJ3 A;  3VOY A;  4BD0 A;  4GJ4 A;  1KGE A;  4P6Z S;  1LSX A;  2KX6 A;  5TFQ A;  3OCN A;  4JKT A;  4GDB A;  3MQQ A;  3PBR A;  3N6I A;  4PAU A;  1LL5 A;  4KG2 A;  4XT2 A;  4NK3 A;  1ONH A;  4LRZ E;  3VE4 A;  1OJ5 A;  1N9B A;  4KZ7 A;  2W3E A;  2OSU A;  1S0W A;  1W5D A;  1JNU A;  4X69 A;  2XRN A;  3IBJ A;  4GZB A;  3UE6 A;  1KVM A;  3RXX A;  5MC7 A;  5J3W A;  3ZNY A;  3HJI A;  2VV7 A;  4PKY G;  5CHM A;  5HDS A;  4B9O A;  1CEF A;  4JGR A;  2HP6 A;  1YKD A;  2DCF A;  2J8Y A;  2RL3 A;  4E3L A;  5JYO A;  4XXR A;  1U60 A;  1XKZ A;  1K55 C;  3LR5 A;  4I3I A;  4JGP A;  2V1Z A;  5HWW A;  1AWI A;  3NBL A;  3RJU A;  4KZB A;  4WUJ A;  1SZV A;  1OTI A;  2W3G A;  4Q8I A;  3IX8 A;  4S2P A;  2H5S A;  2V1B A;  3Q1F A;  2OLU A;  5EVI A;  5DTT A;  4EWF A;  3BRM A;  1NJ4 A;  3CI6 A;  4UQI M;  4Y0O A;  1XA7 A;  4XUX A;  2J3W A;  4FOF A;  4OOM A;  1KDW A;  3T50 A;  1JWP A;  4IVK A;  3ZYT A;  3AGD A;  2XSS A;  1OPX A;  4F94 A;  3HLW A;  1K0K A;  3LY4 A;  3NY4 A;  1YLP A;  3IF6 C;  1O7E A;  1MWS A;  1PZO A;  1F2K A;  4WZ5 A;  3UB5 P;  4O7D A;  5DVA A;  4X56 A;  4WBG A;  2Z6D A;  4MCW A;  3VV4 A;  4A5R A;  3GRJ A;  1H8Y A;  2PAV P;  4UQI S;  1FCN A;  3Q81 A;  1H5X A;  3ZFZ A;  2ZQ8 A;  2ZMF A;  1ZG6 A;  4LRX C;  3SZT A;  3UB8 A;  2ZQC A;  1XJ2 A;  3IBR A;  3C8C A;  3UMD A;  3KX0 X;  1GA0 A;  2Y8H A;  1TS6 A;  1KDS A;  5EVI B;  2V1A A;  2OV5 A;  4PM7 A;  3MKF A;  1L0F A;  1EWZ A;  5CEC A;  1E4D A;  5HL1 A;  3BQ8 A;  1UWN X;  5FI2 A;  1LSV A;  1TVF A;  4KUK A;  1YLY A;  3PTE A;  2JKT I;  4HP9 A;  3W4P A;  2XR0 A;  1YPR A;  3HCY A;  1Y28 A;  2W1T A;  1C3B A;  5FEG A;  4KZA A;  1FSW A;  3IX3 A;  5GLC A;  3PR6 A;  5EVE A;  4EEU A;  1FOF A;  1LI0 A;  5FAP A;  1K38 A;  3MFX A;  3EGX C;  2Y2J A;  3BW6 A;  3LUQ A;  3K2N A;  3IWO A;  3HLD A;  2QKP A;  1NXY A;  2ZC3 B;  5CEB A;  5FAO A;  3K3D A;  3TW8 A;  4DMZ A;  1K4F A;  2W3F A;  4IUK A;  2XRO A;  1GSX A;  2LB9 A;  5HDC A;  1XXM A;  2WKH A;  3SS3 A;  1WA9 A;  4N1H A;  5FQI A;  3A0S A;  1IKI A;  3M6B A;  2B5R A;  1HZO A;  3VP4 A;  2IA2 A;  2EWV A;  5EEC A;  4NG2 A;  4S2J A;  2VGL S;  4Y15 A;  3UPP A;  3G34 A;  4OP8 A;  4FUW A;  3ZG5 A;  1PWG A;  2FH5 A;  3OPH A;  4YIN A;  1IYS A;  4RX3 A;  1N9L A;  1D1J A;  1PNE A;  2QHK A;  2PU2 A;  4FH2 A;  2G2U A;  1TS7 A;  1SKF A;  1Z09 A;  4QY6 A;  4HJ4 A;  2O9B A;  4YWZ A;  5G18 A;  2J3T C;  3T1R A;  4WEK A;  1ERQ A;  2AVX A;  3UN7 A;  3VMA A;  3VSL A;  2XFS A;  4QD4 A;  4DN0 A;  3LIA A;  3MQ0 A;  4FH4 A;  4Y0T A;  5AJG A;  3G35 A;  1EI5 A;  4YOF A;  5A90 A;  2PD7 A;  5TGF A;  2HP9 A;  1IYQ A;  4HBU A;  4MBH A;  4KZ4 A;  2W3D A;  2ACG A;  5BOH A;  1YM1 A;  1N9O A;  1W63 Q;  5KSC A;  3ISG A;  4PHT A;  3ZG0 A;  3QP2 A;  4F3L B;  5U47 A;  5EVI D;  4EBN A;  1XGJ A;  2C6W B;  4IUH A;  1OJG A;  1X0O A;  4N9K A;  1YSQ A;  1OTA A;  2XD5 A;  4HNB A;  2IWC A;  4QHC A;  4EXO A;  4HOI A;  3T4Q A;  3OZH A;  3SS5 A;  1AXB A;  5M19 A;  4KG5 A;  2HP5 A;  1ZG4 A;  4X1L A;  3F1N B;  2J9O A;  3T4J A;  4Y7P A;  2P9V A;  2QYB A;  3PBT A;  1W63 M;  2OWH A;  1NRJ A;  4XUZ A;  4Y17 A;  2QZ6 A;  1D06 A;  4NXG A;  1MPL A;  3LIE A;  5HD3 A;  1ES4 A;  2ZC7 A;  1PZP A;  4CLC C;  2QWS A;  3N4I A;  4EW7 A;  2EFU A;  3EGD C;  4F3L A;  3S1Y A;  3IQA A;  3PAG A;  4KZ9 A;  5EUA A;  4JPM A;  4DE2 A;  3BYD A;  4OLD A;  3S4X A;  3B42 A;  5E2H A;  5DF8 A;  4ZJ2 A;  4R4S A;  4X53 A;  3MKE A;  4WN5 A;  1KE0 A;  3LR0 A;  5EM0 A;  5FAQ A;  3LFV A;  1K57 A;  4PM9 A;  1CK3 A;  4PMA A;  2FFY A;  5E2G A;  4L9F A;  4M3K A;  1YLJ A;  3ZG7 B;  4EBP A;  3PBN A;  3MZF A;  2KLI A;  2I72 A;  1JVJ A;  4OP5 A;  2ZM0 A;  2EA9 A;  5TBM A;  2NUP C;  4LGW A;  3SH8 A;  3V39 A;  3PBO A;  3T1X A;  1IYP A;  1K6S A;  1ERM A;  1W7F A;  1E3U D;  1YMX A;  2A2L A;  3T4K A;  3OLO A;  1NWZ A;  1MWU A;  1HD8 A;  1T1B A;  1CEG A;  3A3F A;  2VGL M;  5L2F A;  2OLV A;  4X6T A;  4BD1 A;  1GHP A;  1ESI A;  3CIT A;  4GLQ A;  1TS0 A;  3IHB A;  4R23 A;  3P09 A;  3DWZ A;  1QMF A;  2K31 A;  3LEQ A;  1FIL A;  1OT9 A;  4LEN A;  4UA7 A;  4Q0I A;  5F5Y A;  3LI9 A;  3UDF A;  3UO9 A;  3F1O A;  5TBM B;  3QNC A;  5HAQ A;  4HH2 A;  3SH7 A;  3M2K A;  3T4S A;  4JBF A;  5TJJ A;  3MSH A;  4GDN A;  1TDL A;  3NOU C;  2B95 A;  4OQ0 A;  3D4F A;  2ZLY A;  4OOY A;  2X01 A;  3HUM A;  3Q07 A;  1GHM A;  2JBF A;  1IFQ A;  2V0U A;  1T1C A;  1V9Y A;  2H0Y A;  2OAQ 1;  4E3K A;  4GNU A;  2HJE A;  3VFF A;  4BWI A;  3G30 A;  3LID A;  1WYB A;  4OQG A;  2ZC5 B;  4GS9 A;  2HV1 A;  3SW1 A;  3KSG A;  4BBT A;  3CZD A;  4Q0H A;  2BTF P;  3IF6 B;  4UA9 A;  3V3R A;  3KSF A;  5DJT A;  2GDN A;  3D3O A;  4JXV A;  1XX2 A;  3E4Q A;  2Z2L B;  3BLS A;  4NXF A;  3E0Y A;  4I5S A;  3UDX A;  4NKP A;  5CGW A;  4JF6 A;  2W27 A;  3F1O B;  3TOI A;  2PR6 A;  4O8G A;  5F1G A;  5FL3 A;  3VP0 A;  2ZQA A;  2FFF B;  3NHQ A;  3QHY A;  1I2W A;  1JWV A;  5A8B A;  4R0Q A;  5E43 A;  3BJN A;  1SDN A;  1TEM A;  1K54 C;  4HHD A;  4ARZ A;  5F68 A;  3UB7 A;  4QY5 A;  2W0N A;  3G2Y A;  3VP2 A;  4R4R A;  3T4O A;  4GS9 B;  2XA7 S;  4DF6 A;  1BT5 A;  3G6O A;  5FI7 A;  2WYX A;  3Q7V A;  2B18 A;  3NOP C;  3LY3 A;  2A24 B;  3UE0 A;  3GSG A;  2Q9M A;  1SCW A;  3KYZ A;  4ETX A;  3T4T A;  3W4O A;  2JKT M;  3VFH A;  3CHW P;  4Z1W A;  1DY6 A;  4UA6 A;  2HDS A;  4S2I A;  2ZMA A;  1ZTU A;  5FDH A;  1LSW A;  1ZC2 A;  2B02 A;  1NY0 A;  2VV8 A;  1VEU B;  5JYP A;  5DTS A;  3HVF A;  1H8M A;  3TRC A;  3FG8 A;  3NCK A;  3O88 A;  4HH3 A;  3BFC A;  2OAP 1;  3Q82 A;  4K0X A;  4EER A;  4JF5 A;  3QP1 A;  1DP8 A;  1PWC A;  2QJ7 A;  4DDY A;  4Y13 A;  2Y2N A;  4N9L A;  1WYC A;  1IOU A;  2VKS A;  2Y59 A;  5FAS A;  1FCO A;  2PBD P;  1PI4 A;  2XDM A;  4JLF A;  2BLS A;  4E3I A;  1T18 A;  4IVI A;  1XJ3 A;  1M6K A;  3HBR A;  4ZTK A;  5KSH A;  2PRF A;  5FDS A;  1VET A;  2WAF A;  5DFX A;  1CJF A;  1ODV A;  4OPZ A;  1NYY A;  1ES5 A;  3KO6 A;  2H0T A;  2O9C A;  1T19 A;  1KGG A;  1S1Y A;  2HZ5 A;  4HBT A;  1IYO A;  4RYE A;  4NEE D;  2K2N A;  4X25 A;  3IXG A;  1SDE A;  2Z6C A;  2WGW A;  3T4L A;  2WKE A;  2XA7 M;  2ZBB A;  1FSY A;  5IU1 A;  1H3Q A;  4CLC D;  1N9N A;  3NDE A;  5CGS A;  1FIK A;  1UGU A;  2HF6 A;  3H82 A;  4EET B;  4FTX A;  1PRQ A;  5HPF A;  3VOZ A;  4BBV A;  1K57 C;  2ZC6 B;  2Q0O A;  1TF1 A;  1XPB A;  1BLC A;  5K5B A;  3ITA A;  3IHA A;  5AQ7 A;  3LR4 A;  4WEL A;  3QP6 A;  4ZAM A;  1JTG A;  1LL9 A;  3H7W A;  1GCE A;  4DKI A;  3KYE A;  1Q2P A;  2EX2 A;  3E2L A;  3CPT B;  5M18 A;  4PKY A;  3ZHH A;  3W4Q A;  2GNX A;  1MXO A;  1MY8 A;  4HIA A;  4Z9Q A;  4MLL A;  2WKR A;  3PBS A;  4GOG A;  4O01 A;  3ZCZ A;  4MNR A;  3EQU A;  2G7U A;  1QME A;  5KZH A;  2XFT A;  4OPY A;  1YT4 A;  4HQA A;  4KQO A;  2PD8 A;  4S2O A;  5CRF A;  1RCJ A;  1ONG A;  4N1X A;  1G28 A;  3QNB A;  5GLD A;  1T1A A;  3AGE A;  2Y4A A;  5L8M A;  2VGK A;  3IX4 A;  5HWV A;  2GX5 A;  1F98 A;  2DNS A;  5EE8 A;  1YMS A;  3UE1 A;  2E8J A;  3S7N A;  4P87 A;  4CQH A;  1TD5 A;  3CPT A;  2YKF A;  2CC1 A;  3MQO A;  5HD5 A;  3BQA A;  3C7U A;  4E3J A;  2J3T D;  2X02 A;  4LV1 A;  1YAX A;  2Y55 A;  4DJ3 A;  3Q7Z A;  2BG1 A;  1XA1 A;  5L09 A;  4E6W A;  1BSG A;  4O0P A;  1IEL A;  2JN7 A;  2Y2P A;  4R6L A;  1VHM A;  3E4O A;  3O86 A;  3R7W A;  3WS5 A;  3RFB A;  4ETZ A;  3G4P A;  5D3O A;  5HAP A;  2BAS A;  5F82 A;  4DXB A;  5DF7 A;  1PIO A;  1V9Z A;  2EX8 A;  2JCH A;  1FR1 A;  1LLB A;  3CMZ A;  3MXR A;  3UB9 A;  1LL8 A;  4MN7 A;  5AQA A;  2Y2I A;  3V3S A;  4DE0 A;  1P9W A;  2PHY A;  4R70 A;  1XJ4 A;  3FPV A;  3IS2 B;  4JXS A;  3WRT A;  5AVF A;  5CHU A;  1GHI A;  1ACF A;  5HX9 A;  4QJG A;  1BLS A;  1BLP A;  2XH9 A;  1S6R A;  4MBK A;  4B93 A;  1K55 A;  4KZ6 A;  3GQZ A;  2P7J A;  4GB7 A;  1F9I A;  4BL3 A;  2L0W A;  4IBX A;  2XLN A;  1Z6F A;  4CJN A;  3HRE A;  1OTD A;  2HDU A;  2UWX A;  3ZVT A;  3S22 A;  3SS4 A;  3UB6 A;  4Q0J A;  2VX8 A;  2EX9 A;  2QPN A;  1S4S A;  2I9V A;  3R7W B;  1PYY A;  2CMN A;  4P85 A;  2ZQ7 A;  5EVL A;  1HLU P;  1XFQ A;  3UDI A;  4BBU A;  2VA0 A;  2A3U A;  3BEC A;  4EUV A;  2VJW A;  5GHZ A;  5L07 A;  3LI8 A;  1PW8 A;  2D02 A;  4ESP A;  1F5M A;  4WLA A;  3T1Q B;  2V2F F;  2ZMV A;  3LGO A;  1YQS A;  5G4Z A;  4OH0 A;  4S2M A;  4LCM A;  3UPO A;  1J9M A;  1E3U A;  5FQ9 A;  5GLB A;  3IS2 A;  4UEY A;  5HAR A;  3BM6 A;  4WL9 A;  1HTZ A;  1KVL A;  1XGI A;  2ZQ9 A;  3GDI A;  2IWB A;  1K4E A;  3C4O A;  5IT5 A;  5A93 A;  4ZDX A;  3H9W A;  3MFD A;  3NOT C;  1K6R A;  2Y2G A;  2EXA A;  4EBL A;  1LHY A;  1Y4O A;  4WMC D;  4NXE A;  3RTY A;  4JXG A;  3BWL A;  3KYQ A;  5DF9 A;  4IBR A;  1YSP A;  4M4X A;  3VOL A;  5CTM A;  1W8Q A;  1RP5 A;  2V8C A;  2P04 A;  4OON A;  3NIA A;  3E2K A;  4MN5 A;  4YNR A;  2PU4 A;  4D2O A;  3GEC A;  5FA7 A;  4OVD A;  3L9K A;  4DE1 A;  5FSR A;  3LIF A;  3ULF A;  3C30 A;  4HEF A;  3QP8 A;  2VLG A;  2XK1 A;  2Z2M B;  3EOI A;  1JTD A;  3NUL A;  4OLG A;  3OBF A;  4GW9 A;  4EU0 A;  2WGV A;  1PFL A;  3CUE C;  3IXB A;  3A0R A;  4PM5 A;  3P98 A;  5C5K A;  3A3D A;  3NDG A;  2DRW A;  2ZD8 A;  5J8X A;  5A92 A;  1MWT A;  2M7V A;  3ZDJ A;  5EV0 A;  2VK3 A;  3E98 A;  3FWL A;  2P08 A;  1FCM A;  1GA9 A;  3FKW A;  1DJA A;  1S4R A;  3LR3 A;  1OME A;  4BQM A;  1MBL A;  4HI4 A;  1LT0 A;  1KE4 A;  3B3X A;  3C7V A;  5KIZ A;  4GD6 A;  3LIC A;  3DTI A;  2EWW A;  2ZOH A;  2UV0 E;  3CJM A;  4BLM A;  2WKP A;  5E2F A;  2XEP A;  5TR7 A;  3BFG A;  3OOV A;  1NYM A;  2XF3 A;  2JKF A;  5DKL A;  2KOI A;  3I7J A;  3HLC A;  3HL9 A;  3T1S A;  2V20 A;  5DFY A;  5J7E A;  3FC7 A;  4BMW A;  4X68 A;  3UME A;  1ES3 A;  4E3M A;  1CI8 A;  3HLG A;  5LBR A;  1SHV A;  3WWX A;  3JPU A;  4HES A;  5DJU A;  3VE3 A;  3ITB A;  4QU3 A;  2Y79 A;  3BEB A;  1KOU A;  1OTB A;  2W1T B;  3FZC A;  3GMW A;  3QP5 A;  1FR6 A;  2R9W A;  5F6A A;  3P01 A;  4I38 A;  1SKO A;  5HAI A;  2PYP A;  1BZA A;  4GCZ A;  1TS8 A;  3OC2 A;  1I5Q A;  2M1C A;  4G3V A;  4KZ3 A;  1G6O A;  2P9V B;  4G3W A;  3V5M A;  3GV9 A;  1Q2Q A;  3A3I A;  3MXS A;  3V50 A;  4HJ6 A;  1N4O A;  3TG9 A;  4WYY A;  3ZVW A;  2X71 A;  4C6Y A;  2Y2O A;  5EOO A;  1M40 A;  3OPP A;  4H8R A;  4E6X A;  1L0E A;  4FCF A;  3ZG9 B;  4EV4 A;  3IF5 A;  4B4X A;  4WZ4 A;  4LCL A;  4WZ5 C;  4JF4 A;  1WE4 A;  5FQM A;  2P74 A;  1P9R A;  3FPW A;  3WS1 A;  1BUL A;  2Y2Q A;  3C38 A;  4JXW A;  1A0K A;  4DE3 A;  2WZZ A;  2XD1 A;  4YFM A;  5DKK A;  4OKP A;  3TSG A;  3LIB A;  1SKO B;  3O3V A;  4U0X A;  4K08 A;  1MKI A;  3E4P A;  1ERO A;  2HDQ A;  2EXB A;  1RGZ A;  3ZNT A;  3BLM A;  4E3O A;  3GR2 A;  4IHQ A;  2EFX A;  2WKI A;  1S67 L;  2VZW A;  5AVE A;  1GSV A;  4NET A;  5GLA A;  2K7S A;  2INW A;  5I5L A;  3HUO A;  3NI9 A;  3N8L A;  3W8K A;  1NLY A;  3RH8 B;  3OPR A;  3PBQ A;  3MF0 A;  2L4R A;  1E25 A;  4P0M A;  3T12 B;  3DTK A;  4GHI A;  2W3H A;  1G6A A;  4FD8 A;  4EES A;  5FQQ A;  4KQQ A;  1LI9 A;  3ICY A;  3BFF A;  2DMW A;  1S1Z A;  4PPR A;  4CPK A;  3NJA A;  3S7P A;  3UNW A;  4DDS A;  2XGN A;  3F1N A;  2PT7 A;  4LV2 A;  4H6J A;  4S2N A;  1KGF A;  5J4E A;  4IJG A;  5HWT A;  1W8Y A;  5CER A;  1L0G A;  3MXQ A;  3C5A A;  3W2Z A;  5FAT A;  5EFW A;  2E8I A;  3K3C A;  3B47 A;  2VGJ A;  1D7E A;  4WM9 A;  1P0Z A;  3G32 A;  3U4L P;  1H8Z A;  4GD8 A;  1L0D A;  4BL2 A;  1DRM A;  3FKV A;  1IEM A;  3G31 A;  1JWZ A;  1PI5 A;  1MC0 A;  3UE3 A;  4II7 A;  3DWK A;  5E2E A;  2R9X A;  2PYR A;  4QB8 A; 
#chains in the Genus database with same CATH homology
 2GJ3 A;  4GHI B;  3UB9 A;  4QPR A;  1LL8 A;  4HJ3 A;  4MN7 A;  4JGQ A;  4GJ4 A;  4P6Z S;  1LSX A;  3T4K A;  3OLO A;  2KX6 A;  1NWZ A;  1S66 L;  3OCN A;  2L1M A;  1P9W A;  3LYX A;  2PHY A;  4R70 A;  1XJ4 A;  4JGO A;  3BY8 A;  3FPV A;  3IS2 B;  3MQQ A;  3F1P B;  3PBR A;  4PAU A;  4XT2 A;  1T1B A;  2O9A A;  2KDK A;  5AVF A;  4LRZ E;  3VE4 A;  1OJ5 A;  2VGL M;  2VV6 A;  4CLC B;  2W3E A;  4H6J B;  3CIT A;  4B93 A;  4L9E A;  4GLQ A;  2P7J A;  1JNU A;  1TS0 A;  2XRN A;  1F9I A;  3ZQ5 A;  3IBJ A;  3UE6 A;  2L0W A;  1OTE A;  2K31 A;  5MC7 A;  5J3W A;  3HJI A;  1OTD A;  2VV7 A;  2OOL A;  1OT9 A;  4PKY G;  5HDS A;  4B9O A;  4Q0I A;  5F5Y A;  4Q0J A;  3LI9 A;  3UB6 A;  4EEP A;  2VX8 A;  4JGR A;  3F1O A;  3KSH A;  1YKD A;  5TBM B;  3S7O A;  1S4S A;  2I9V A;  3MMH A;  3R7W B;  2CMN A;  4HH2 A;  1XFQ A;  4BBU A;  2VA0 A;  2VEA A;  3LR5 A;  4I3I A;  4JGP A;  3T4S A;  5TJJ A;  5HWW A;  4EUV A;  2VJW A;  2PR5 A;  3NOU C;  3LI8 A;  4WUJ A;  2D02 A;  2D01 A;  1OTI A;  2W3G A;  1F5M A;  4WLA A;  2MJ6 A;  2ZMV A;  3EWK A;  4HP4 A;  4E04 A;  4LLO B;  5G4Z A;  1NLZ A;  1IFQ A;  2V1B A;  2V0U A;  1T1C A;  1V9Y A;  2OAQ 1;  3IS2 A;  4MN6 A;  2HJE A;  3F1P A;  4UEY A;  4BWI A;  4WL9 A;  5G4Y A;  2JKR M;  3CI6 A;  4UQI M;  3GDI A;  3LID A;  4CLC A;  2J3W A;  4FOF A;  4OOM A;  5IT5 A;  4GS9 A;  2HV1 A;  3T50 A;  3SW1 A;  3H9W A;  3KSG A;  3ZYT A;  3NOT C;  3R4K A;  4BBT A;  4Q0H A;  3KSF A;  5DJT A;  2XSS A;  3D3O A;  4NXE A;  1OPX A;  3E4Q A;  3RTY A;  5HDD A;  2FZ0 A;  5F69 A;  4NXF A;  3E0Y A;  4I5S A;  3BWL A;  3KYQ A;  4NKP A;  5DF9 A;  2W27 A;  1YSP A;  4M4X A;  3VOL A;  3F1O B;  4CLC E;  2PR6 A;  2P04 A;  2Z6D A;  4O8G A;  4MCW A;  3VV4 A;  2JHE A;  4MN5 A;  4WEJ A;  4UQI S;  4YNR A;  2M7U A;  3GEC A;  5FL3 A;  3V67 A;  1XJ6 A;  2ZMF A;  4LRX C;  4I3J A;  3UB8 A;  3U2A A;  1XJ2 A;  3LIF A;  3IBR A;  4NXB A;  3NHQ A;  3ULF A;  3C8C A;  3C30 A;  3UMD A;  2GZA A;  2VLG A;  3EOI A;  3KX0 X;  5A8B A;  3PYP A;  2Y8H A;  3OBF A;  4GW9 A;  4EU0 A;  1TS6 A;  3BJN A;  4RQ9 A;  2V1A A;  3CUE C;  3A0R A;  5IS1 A;  3D72 A;  4HHD A;  4ARZ A;  4KUO A;  5C5K A;  5F68 A;  3BY9 A;  3UB7 A;  2W0N A;  3BQ8 A;  1UWN X;  3PHY A;  3T4O A;  4GS9 B;  2XA7 S;  1LSV A;  3EEH A;  3G6O A;  4KUK A;  2M7V A;  3EEA A;  2B18 A;  3MR0 A;  3NOP C;  3E98 A;  2P08 A;  2A24 B;  2JKT I;  1S4R A;  3LR3 A;  4HP9 A;  4HI4 A;  3KYZ A;  1LT0 A;  4ETX A;  1STZ A;  3HCY A;  3A0V A;  1Y28 A;  3T4T A;  2JKT M;  2W1T A;  5KIZ A;  3S7Q A;  4KQD A;  2JKR I;  3PR6 A;  3LIC A;  4EEU A;  2EWW A;  1MKM A;  2ZOH A;  4Z1W A;  4LPZ A;  2V9A A;  4ZRR A;  4HY8 A;  2O0Y A;  3MFX A;  2WKP A;  3EGX C;  1ZTU A;  3BW6 A;  3LUQ A;  1LSW A;  2B02 A;  3K2N A;  3OOV A;  2VV8 A;  2QKP A;  2V0W A;  5DKL A;  2R78 A;  2KOI A;  3K3D A;  1H8M A;  3TRC A;  3TW8 A;  3FG8 A;  3CWF A;  4DMZ A;  5HL6 A;  4HH3 A;  2W3F A;  4IUK A;  2XRO A;  2OAP 1;  1GSX A;  2LB9 A;  4EER A;  5HDC A;  1WA9 A;  1DP8 A;  5DFY A;  4ARZ B;  2QJ7 A;  3A0S A;  5J7E A;  1VB6 A;  3PXP A;  3FC7 A;  4BMW A;  1IOU A;  3H82 B;  2OWJ A;  2VKS A;  2IA2 A;  2EWV A;  3UME A;  3TJZ C;  5LBR A;  2VGL S;  2NUT C;  5DJU A;  3VE3 A;  2PDR A;  2FH5 A;  5HSQ A;  2A24 A;  1T18 A;  4L0L A;  1XJ3 A;  1GSW A;  2O99 A;  1N9L A;  5KSH A;  1ZHH B;  2QHK A;  4Y2F A;  2Y79 A;  5DFX A;  2QJ5 A;  1ODV A;  1KOU A;  1OTB A;  2W1T B;  3H7W B;  1TS7 A;  4BJP A;  1DP6 A;  3DBA A;  4HJ4 A;  3JVU A;  3P7N A;  2O9B A;  4YWZ A;  2J3T C;  3KO6 A;  2YKH A;  2O9C A;  3P01 A;  4I38 A;  4WEK A;  2W1R A;  5F6A A;  4EQ1 A;  1T19 A;  2PYP A;  4GCZ A;  1S1Y A;  1TS8 A;  3OC2 A;  4DN0 A;  3LIA A;  2M1C A;  4G3V A;  3MQ0 A;  1G6O A;  4G3W A;  5AJG A;  4NEE D;  2K2N A;  4YOF A;  2PD7 A;  4DJ2 A;  2W3D A;  2Z6C A;  4HJ6 A;  2LB5 A;  3T4L A;  4WF0 A;  4AFI A;  1OT6 A;  2XA7 M;  2ZBB A;  1N9O A;  1W63 Q;  1H3Q A;  5IU1 A;  4CLC D;  3CUE A;  4Y3I A;  4PHT A;  1N9N A;  1UGU A;  2HF6 A;  3H82 A;  4EET B;  4F3L B;  4OOL A;  5HPF A;  4BBV A;  4IUH A;  1OJG A;  1X0O A;  1P9R A;  3FPW A;  1TF1 A;  4Y5F A;  1YSQ A;  1OTA A;  4HNB A;  1P97 A;  4EXO A;  5K5B A;  3LR4 A;  3OCL A;  3C38 A;  4HOI A;  4MMN A;  4WEL A;  3C2W A;  3EQV A;  3H7W A;  3T4Q A;  5DKK A;  5HPI A;  4P6Z M;  4I39 A;  3LIB A;  3F1N B;  2ZOI A;  4PKY A;  4K08 A;  2GNX A;  3T4J A;  3E4P A;  2QYB A;  3PBT A;  1W63 M;  2OWH A;  4HIA A;  1NRJ A;  4I3A A;  1MZU A;  1D06 A;  4NXG A;  4IHQ A;  1XFN A;  2HGV A;  1UWP X;  2WKR A;  3PBS A;  3LIE A;  4O01 A;  5HD3 A;  1S67 L;  3EQU A;  4CLC C;  2G7U A;  1DP9 A;  2QWS A;  2VZW A;  4EW7 A;  5AVE A;  1GSV A;  3O5Y A;  2K7S A;  2INW A;  4HQA A;  4MDZ A;  3EGD C;  5I5L A;  4F3L A;  4G3K A;  4LRY C;  4R3A A;  1NLY A;  3RH8 B;  4KQO A;  3PBQ A;  2PD8 A;  2L4R A;  3MF0 A;  4L9G A;  2WKQ A;  4GHI A;  2W3H A;  1G28 A;  1T1A A;  3B33 A;  3B42 A;  5L8M A;  5HWV A;  2GX5 A;  4EES A;  3HJK A;  1F98 A;  3ICY A;  3S7N A;  4XT2 B;  4WN5 A;  4CQH A;  3LR0 A;  2DMW A;  1TD5 A;  1S1Z A;  4R38 A;  3LFV A;  3JVV A;  3NJA A;  2YKF A;  3S7P A;  3F1N A;  2PT7 A;  4H6J A;  3MQO A;  5J4E A;  4IJG A;  5HWT A;  5HD5 A;  3BQA A;  2J3T D;  3CLO A;  1YAX A;  2HJ9 C;  4L9F A;  3MXQ A;  4DJ3 A;  3W2Z A;  3KSI A;  2J80 A;  5EFW A;  3CAX A;  3K3C A;  4O0P A;  3PBN A;  2JN7 A;  2KLI A;  3B47 A;  1D7E A;  1P0Z A;  5HZH A;  4R6L A;  1BYW A;  1VHM A;  2H28 A;  3E4O A;  1EW0 A;  2EA9 A;  5CX7 A;  5TBM A;  2NUP C;  4FSF A;  3R7W A;  1DRM A;  3RFB A;  3PBO A;  4ETZ A;  4ME4 A;  2BAS A;  1V9Z A;  1MC0 A;  3UE3 A;  4II7 A;  3TE8 A;  3MJQ A;  2A2L A;  2PYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...