2H28A

Crystal structure of yeeu from e. coli. northeast structural genomics target er304
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
DRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSGELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Phd-Doc, HigA, and YeeU Establish Multiple Evolutionary Links between Microbial Growth-Regulating Toxin-Antitoxin Systems.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yeeU
total genus 23
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06154 CbeA_antitoxin CbeA_antitoxin, type IV, cytoskeleton bundling-enhancing factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2h28A01
2M1CA 1KOUA 2QHKA 4HIAA 1DP9A 1P0ZA 1T1CA 2V0UA 4F3LB 4L9GA 4EETB 3BWLA 1V9ZA 1OTIA 1XJ6A 1N9NA 4EEPA 4F3LA 4XT2B 5HDSA 3UMEA 2YKHA 2PD8A 5F68A 2CMNA 3RTYA 4I3AA 3UB9A 4DJ2A 5HZHA 2OOLA 3A0SA 4KUOA 1P97A 4H6JB 2WKRA 4HOIA 1ODVA 4JGQA 5F69A 1F9IA 2PYRA 2ZOIA 4H6JA 5J7EA 5EFWA 2A24A 3IS2B 3MJQA 3UB7A 3KX0X 4EESA 2W27A 3H9WA 1DRMA 2QJ7A 4HHDA 5AVEA 4HI4A 1TS6A 4LPZA 2YKFA 3F1PB 5I5LA 1LSVA 1G28A 1UWPX 2Z6CA 3F1OB 5J3WA 4HQAA 3H82A 3VE4A 1LSWA 3F1PA 5HWTA 4PKYG 2ZBBA 1OJ5A 2Z6DA 3LI9A 4HP9A 3ULFA 4GW9A 2JHEA 4WL9A 5DJUA 1DP6A 2PHYA 2D01A 1OTAA 4EW7A 1LL8A 2V1AA 2VLGA 2R78A 2L1MA 3CAXA 2V1BA 3ICYA 2P7JA 5HSQA 1X0OA 2KDKA 2L0WA 2WKQA 4BBTA 3LUQA 2OWHA 1N9OA 3PHYA 4JGOA 1OTDA 1OT6A 1OTEA 1XJ2A 3GDIA 4HH3A 4KQDA 4KUKA 4R70A 3RH8B 3VOLA 1EW0A 1N9LA 2OWJA 2V0WA 3LIBA 4HJ3A 2VV8A 3F1NB 3UB6A 4DJ3A 3MR0A 5A8BA 5DKKA 5J4EA 3C2WA 4NXEA 4PKYA 2EA9A 3P7NA 1BYWA 1LSXA 1MZUA 2B02A 4R3AA 2BASA 1S1YA 2PR5A 3CWFA 3NJAA 4HJ6A 5HDCA 3T50A 4GS9A 3HJIA 5IS1A 1TS7A 1VB6A 5F6AA 1TS0A 1D7EA 3A0RA 3E4PA 1S1ZA 2J80A 3MQOA 1XFQA 4E04A 3LIDA 1XJ4A 4EERA 4HJ4A 5HD3A 3LICA 4EXOA 4NXBA 3A0VA 2PR6A 2PYPA 1S4SA 4LRXC 5AVFA 1NWZA 2D02A 4LRYC 1UGUA 4L9FA 3HJKA 2V9AA 5HWVA 1GSWA 3LYXA 3SW1A 1T1AA 4EEUA 4HY8A 1S66L 4EQ1A 3F1OA 5HWWA 1OT9A 4BBUA 3PYPA 3GECA 3MFXA 4HNBA 3K3CA 4LRZE 4NXGA 2I9VA 4XT2A 4LLOB 1S4RA 2A24B 1LT0A 2HV1A 3IS2A 4I5SA 2ZOHA 4I38A 2KX6A 5F5YA 2K7SA 1T19A 4HH2A 3UE6A 2H28A 2L4RA 3NOTC 3FC7A 3G6OA 2VV7A 4L9EA 4HP4A 1S67L 3H82B 4M4XA 2GJ3A 3LIAA 1JNUA 3MQQA 3LI8A 1V9YA 1T1BA 1Y28A 1GSVA 3D72A 3EWKA 1OTBA 4WLAA 5HDDA 3UB8A 5KIZA 3LIEA 1D06A 4JGRA 1OJGA 3K3DA 4MN6A 5TBMB 2PDRA 4JGPA 4YWZA 3F1NA 4K08A 4RQ9A 4WN5A 5HD5A 2QKPA 3B33A 2WKPA 2W0NA 5DJTA 4I39A 4I3IA 1XJ3A 3H7WB 3H7WA 3NHQA 1DP8A 3LIFA 4BBVA 3IBRA 4GHIA 4B9OA 3E4QA 3NOPC 3VE3A 2JN7A 4WUJA 5G4ZA 3UMDA 3ZQ5A 4NXFA 4GHIB 3NOUC 3EEHA 4R6LA 1GSXA 2QJ5A 4R38A 3C8CA 5IU1A 1UWNX 4I3JA 5TBMA 2INWA 1F98A 1TS8A 1XFNA 1WA9A 2PD7A 1T18A 3FG8A 4GCZA 4MN5A 3BY8A 5G4YA 3OLOA 2QWSA 3E4OA 5DKLA 2VV6A 4GS9B 4WF0A 2VEAA 3MXQA 3CLOA 3BY9A
chains in the Genus database with same CATH superfamily
2A49A 2VA0A 1GHMA 2HJEA 5DTTA 4OPZA 3IXDA 2XA7M 3C7UA 3WS4A 2Y2KA 3ZG8B 4LGWA 2J3WA 4OOMA 4DE0A 3HLCA 3IBJA 3ZFZA 2ZQAA 1ES5A 2ZC7A 2ZM8A 3L7HA 4RX3A 2G2UA 1XKZA 3HLEA 5C5KA 4JGOA 4R70A 4EBPA 4KQDA 1EW0A 2Y2QA 4R23A 3RJUA 3MBZA 3MMHA 3P7NA 5E43A 1ACFA 1MZUA 5HDCA 2GDNA 3IF6B 3WS1A 1MKMA 4EV4A 5FATA 1M40A 3FV7A 4IJGA 4JPMA 4FD8A 3A3JA 3QP5A 1ZC2A 3P98A 4Q0HA 1YLTA 4LLOB 4I38A 1MPLA 3QP6A 4NKPA 3HLDA 4WZ5A 2WGVA 2H28A 3NOTC 4X25A 1DJBA 5HW3A 3EWKA 1OTBA 3ZHHA 4OPRA 2PDRA 4JF5A 4RQ9A 3MXSA 3NOPC 2X02A 3PBNA 1NZUA 3ZQ5A 4QD4A 4KQRA 3C8CA 5IU1A 4KZ9A 2XH9A 4MN5A 4Y0OA 1RGZA 5GLBA 3VP3A 3SH7A 4OQGA 4S2JA 3HLFA 1P97A 4JGQA 5F69A 3A3FA 3O87A 4MLLA 2UWXA 1XGIA 1HTZA 4LCLA 1XP4A 4QHCA 1EI5A 1PWCA 4E3KA 1I2SA 5DVAA 1OTDA 4UQIM 4P6ZS 1HD8A 1W7FA 4OQIA 2PR5A 3T50A 1TF1A 5CEBA 3LO7A 1YQSA 1XFQA 3IF6C 1IFQA 5HD3A 4NXBA 4IUKA 5GLAA 3TSGA 4D60A 4GKUA 1S66L 1SHVA 4K91A 2HP9A 3ZYTA 2KX6A 4DXCA 1H0MA 3E2KA 4E6WA 1HZOA 4HH2A 4OQ0A 4R1GA 4K0WA 3MQQA 3HLBA 3UDFA 4CLCE 3UB8A 3PBQA 2JC7A 1K38A 2Y8HA 1STZA 4U0XA 2WADA 1ZKJA 2WKPA 4JXGA 4H8RA 1RCJA 1IOUA 3VE3A 5MC7A 3HLGA 4K0XA 1ZG6A 2VGKA 3Q7VB 4ZRRA 1JWPA 5CXWA 1WA9A 4ETZA 3KYZA 4GOGA 4WF0A 1YSPA 5HL6A 2ZMAA 1BLCA 4B93A 4FUWA 2QPNA 3B47A 5F68A 5HZHA 3T1QB 4WBGA 5FAPA 1ZG4A 1KVLA 2ZOIA 4H6JA 2DRWA 4KENB 3SZTA 3CG5A 2FZ0A 1LSWA 3S22A 3N8RA 3SH9A 2CC1A 3V5MA 2Y59A 1ESIA 1PWGA 1D1JA 4S2IA 1N9LA 4KZ5A 3LR5A 1W8YA 4QPRA 1MWUA 3UE1A 4E6XA 3SH8A 2XFTA 1JWZA 4LFUA 3S7NA 4EQIA 5KSCA 1D7EA 3E4PA 1MY8A 3LIDA 3OPLA 1JWVA 3VSKA 3A0VA 4LRXC 5EVIC 1GSWA 3R4KA 3PYPA 4HNBA 3BLMA 2XSSA 4XT2A 2EX6A 4Y5FA 2JKTM 5HAIA 2L4RA 3ITBA 3H82B 4EBNA 1V9YA 3Q82A 5KIZA 3G31A 1RP5A 3HLWA 3T4LA 3D9YA 5DJTA 3GR2A 1XJ3A 4S2MA 4UAAA 2JN7A 2NUTC 3NOUC 4PM9A 5J8XA 4XUZA 2B18A 5TJJA 5DKLA 4N9LA 4QY6A 5EVIA 1ERMA 2P9VA 4KZBA 3BWLA 4DJ2A 1OMEA 2PRFA 1K57C 5EOOA 1YLJA 2JKRI 3BFEA 3IS2B 3H9WA 1A0KA 1TS6A 2Z6CA 5J3WA 3H82A 4GDBA 2HGVA 4F94A 2ZC4B 3MKEA 3ZVWA 4EW7A 3K2NA 4CLCA 4X56A 4UQIS 2OWHA 1OT6A 1WYCA 2XF3A 3F1NB 2Y2OA 4RVAA 4NXEA 5LBRA 4Q0IA 5HX9A 1SKOB 1VB6A 2W1TB 3KSFA 4KZAA 3QNBA 4O8GA 2PU4A 2WAEA 4GN2A 1SKFA 3DTMA 4MMNA 4BBVA 1L0DA 4X53A 2A2LA 4RX2A 3GECA 4NXGA 5FASA 2K7SA 4XXRA 3VOYA 3ISGA 2VV7A 1T1BA 4P87A 3VSLA 4MN6A 3ZG0A 4MCWA 5IT5A 1DP8A 3OCNA 4B9OA 3E4QA 1YMSA 2WKEA 4GHIB 1GSXA 5TBMA 1UWNX 2QMIA 2OLUA 1EWZA 3TG9A 3E4OA 3T4JA 4IUHA 3PTEA 3WRTA 1IEMA 1P0ZA 1T1CA 3KYEA 3IF6A 4JLFA 3VFFA 2XROA 4H6JB 3IQAA 1LI9A 3BRMA 1PZOA 5CGXA 1VETB 2A24A 4BWIA 3KX0X 3C4OA 2ZC5B 2H10A 2C5WB 3ZDJA 4MBHA 1G28A 1CI9A 2Y4AA 1E3UD 1KDWA 3UNWA 1PFLA 5DJUA 2PHYA 1ESUA 5FAQA 2V1BA 2KDKA 1IYOA 1W79A 4ZDXA 1MWRA 5DTSA 3GDIA 4KUKA 3AGEA 4A5RA 4OPYA 3IWQA 4IHQA 3BFGA 3OCLA 1LI0A 3CUEC 4PKYA 3O5YA 5GLCA 3IXBA 4E04A 3WS5A 3E98A 1YMXA 4EXOA 3W8KA 1KGGA 3UY6A 1L0GA 2XA7S 5HWVA 4WMCA 3LYXA 5HWWA 2RCXA 2ZM2A 1ALQA 1K57A 2HV1A 3T4OA 4S2PA 4G3WA 5CTMA 3O86A 3BYDA 4DKIA 4ARZA 3N6IA 1KDSA 5HARA 1XPBA 3QP2A 4UA7A 2KOIA 5KSHA 1DY6A 4O0PA 1MXOA 2ZLYA 3RXWA 3G34A 4R38A 3OC2A 1F98A 1KE3A 1E25A 4O7DA 5EUAA 1P9RA 4PPRA 2XQZA 1SDEA 2J3TC 2MJ6A 4ESPA 4F3LB 5A92A 1OTIA 3LFVA 5FQMA 4LV1A 1LL9A 2Y2IA 3W4OA 4R3JA 3A0SA 1NJ4A 5DFYA 1VHMA 3UDIA 1DJCA 4BJPA 4CLCD 2W27A 2QJ7A 4HHDA 3MF0A 4ARZB 3U4LP 4YFMA 3S7QA 1OTAA 4S2LA 1FIKA 4YNRA 2EX2A 3VP0A 4IVIA 5FQKA 1KGFA 3KSIA 1NY0A 3LEZA 5HAQA 4HBTA 3LY4A 3WWXA 4IBXA 4R4SA 1J9MA 2E8JA 4KZ3A 2PR6A 3T4KA 3CZDA 4DDYA 1NWZA 4E3LA 1Q2QA 3IH9A 4OVDA 2Z2LB 3FZCA 5FQ9A 4KZ8A 1PI4A 2XRNA 1IYPA 4KZ4A 4PAUA 2Y55A 2ZQ8A 4DF6A 2J9OA 4MBKA 4GD6A 3PAEA 3N8LA 1D06A 4JGRA 4O01A 2HP5A 3GQZA 1TVFA 1H3QA 1C3BA 2W1RA 1M6KA 2LB9A 3M2JA 3C4PA 3JPUA 4GHIA 3G2ZA 4OLGA 4KQOA 3IWIA 3MXRA 2M1CA 3CPTA 2ZQ9A 2V0UA 4B4XA 5E2GA 1V9ZA 1BLPA 1S6RA 4F3LA 2PD8A 3RTYA 1BZAA 4ZJ1A 3HBRA 1DRMA 4Y15A 4LPZA 1NYYA 2Y2HA 1H8ZA 3LI9A 3WRZA 4WL9A 2ZQDA 3LR0A 5F1FA 5A91A 2BG1A 1K0KA 1XGJA 1NLYA 5TFQA 4Y7PA 3RXXA 4OKPA 3D3OA 4WM9A 5KMWA 2BASA 3CWFA 1YLYA 1NRFA 5CHUA 3OPRA 4JXVA 3BQAA 4OQHA 1W63Q 3CMZA 1RGYA 4FSFA 1O7EA 2VZWA 1IKIA 3BEBA 5EPHA 2BTFP 1FOFA 3NY4A 4Y0TA 2ACGA 1YM1A 3SW1A 4HY8A 3IWOA 5GHZA 3G2YA 3QNCA 3UN7A 1EROA 4GZBA 3ZNYA 4I3JA 1JNUA 1LHYA 1K56D 4MN7A 3D4FA 5GHYA 2HDQA 2M7UA 2EFXA 4NK3A 5E2FA 4QU3A 3B33A 4EUVA 3GSGA 4LV0A 3KYQA 5G4ZA 3VV4A 4YINA 5CGWA 2INWA 1L2SA 3FG8A 5L09A 2H5SA 3CI6A 2W1TA 2JKTI 2XEPA 3MXQA 4IEDA 1BTLA 2XR0A 1PZPA 1SKOA 1XA7A 3L9KA 2WAFA 3FPWA 4KUOA 5L07A 4HESA 2XD1A 4Q8IA 4MEZA 4X55A 4HOIA 3IX8A 4RYEA 3VMAA 4C75A 3MJQA 2EXAA 1QMFA 2WKIA 4CLCB 2C6WB 3DTEA 2H0TA 3BJNA 4NEED 2P04A 1LL8A 2P7JA 3B3XA 3QHYA 3BECA 4WYYA 2J8YA 3BM6A 3RFBA 2W3FA 2VGLS 4EUZA 2EA9A 4DXBA 2WGIA 2PAVP 2B02A 5IS1A 4KZ6A 1FCOA 1W8QA 4DN0A 2Y2JA 4BD1A 3ZCZA 3U2AA 4LRYC 3TOIA 4OP5A 3IX4A 1ES2A 1ZHHB 3JVUA 1T1AA 3N7WA 3K3CA 4B4ZA 3IXGA 2W3HA 3FC7A 3VP4A 1MKIA 1Y28A 4EBLA 3LIEA 4CLCC 1AWIA 3S1YA 4C3QA 3GRJA 5CECA 3PXPA 3B42A 2Q9NA 3E0YA 1FCNA 3T4QA 4WZ4A 4OOLA 2EFUA 3VFHA 4LV2A 4R0QA 5EECA 2ZD8A 4S2KA 2FFYA 2HJ9C 2W3DA 3OLOA 3M6BA 4NG2A 1YPRA 4X69A 3BY9A 2FH5A 1DP9A 2JKGA 1L3LA 4KG5A 4GNUA 4DE3A 1Y54A 3NECA 3AGDA 3IH8A 2Y2LA 4PMAA 2PYRA 5J7EA 5EFWA 1ES3A 3HUOA 3UE3A 5DFXA 2Y2GA 1I5QA 1IKGA 1VQQA 3ULFA 3MQ0A 2GX5A 3LEQA 5IHVA 1PWDA 1WE4A 3DTIA 3PBRA 1FSYA 2OWJA 5F1GA 2Y2NA 4LCMA 3G30A 4S2NA 2ZJ9A 5EE8A 3V3SA 3QP1A 5D3OA 5FQQA 3WS0A 3LICA 1K6RA 4N9KA 3TE8A 1U60A 3UPOA 2XD5A 5JYPA 4EQ1A 5FQJA 2JBFA 1IYSA 3OPHA 2A24B 1LT0A 5A93A 4FOFA 4X6TA 3W4QA 3WS2A 3G6OA 5FSRA 4M4XA 1HVBA 1CEFA 3Q7VA 1OJGA 1CI8A 4GD8A 5CERA 4BL3A 5HAPA 3TJZC 3MZFA 3A3DA 3UO9A 5AJGA 2HPBA 4YOFA 4ZTKA 1G6AA 4X1LA 3N4IA 3DTKA 3NULA 4BQMA 3T1XA 4OP8A 4L9GA 2EWWA 1OPXA 4R3BA 5FAOA 2YKHA 3VP2A 4PM6A 4P0MA 3ZG9B 3UB7A 5FI2A 3NCKA 5FQIA 2VGLM 5DF7A 4CJNA 4GW9A 3UB5P 1DP6A 2L1MA 5HFOA 2IWDA 2WKQA 3IT9A 4CPKA 3BFFA 3IHBA 1O07A 4G3VA 2V0WA 3MR0A 3LR4A 5FEGA 4BMWA 3KSHA 3Q1FA 2W3EA 1TS0A 4P6ZM 1YLWA 1MBLA 2B95A 2PT7A 3DWKA 1P9WA 4QY5A 4L9FA 3ITAA 4LENA 4Z1WA 1SCWA 2J7VA 4BD0A 3F1OA 4BBUA 2LB5A 4LRZE 2I9VA 1KE4A 2UV0E 4Q0JA 3S7PA 3ZNTA 2ZOHA 3UPNA 1E4DA 5L8MA 4E3MA 2WUQA 3A3EA 3W2ZA 3G4PA 3N8SA 4HJ4A 3BLSA 5CTNA 1BLHA 4FH4A 1K4EA 1JVJA 3FWLA 4K08A 4WN5A 2QKPA 1WYBA 2W0NA 3NHQA 1G6OA 3EEHA 3EOIA 3G35A 4UA9A 4BL2A 1KOUA 1SZVA 1VM1A 3UDXA 1TEMA 4EEPA 5U47A 2A3UA 2B5RA 2CMNA 3FYZA 1N9BA 2OOLA 3T1SA 2K31A 3GTCA 3OBFA 3CPTB 2XDMA 1IELA 2G7UA 2Y2PA 1F2KA 1LSVA 5K5BA 4HQAA 4E3IA 2ZBBA 3ZG7B 3FKWA 3G32A 5HSQA 5TR7A 4BBTA 5KZHA 1OTEA 5AQ9A 3SOIA 3DAVA 2V20A 3M2KA 1YLPA 2ZC6B 3ZG5A 1K55C 2E8IA 2HF6A 1VEUB 5GLDA 1TDLA 4EERA 1CK3A 2VK3A 3DWZA 4KQQA 2D02A 1QMEA 4MBFA 5FA7A 2WZZA 4EEUA 1BULA 3VOZA 2FFFB 3MFXA 1S4RA 4UHUA 2NUPC 1T19A 5CEDA 4P6BA 3UE6A 1IYQA 2DMWA 1CJFA 5AVFA 1G68A 4IBRA 2ZQ7A 3MZDA 3SS4A 5CHJA 4E3JA 3K3DA 5TBMB 1KE0A 2KLIA 1H5XA 1LLBA 3O88A 2Q0OA 3C30A 3CITA 2PBYA 2QJ5A 3CJMA 2J3TD 2PD7A 4WMCD 1T18A 1XX2A 1CQAA 5HDDA 2W3GA 2QHKA 2JKRM 5FI7A 1XJ6A 3NC8A 3UMEA 1PYYA 2K2NA 4DMZA 1K25A 1F5MA 1ONHA 2XFSA 1K4FA 4FTXA 3C5AA 1J3WA 2YKFA 1H8MA 3VE4A 1GHPA 3C7VA 3HCYA 2R78A 3VP1A 3LY3A 5M18A 4JBFA 5FDSA 3FKVA 5F83A 3RH8B 4WZ5C 3LIBA 4DJ3A 2BLSA 4PM5A 2OV5A 4U0TA 5JYOA 2WKHA 4R3AA 4WEJA 4N92A 2P9VB 3I7JA 3HJKA 3TRCA 4JF4A 3R7WA 3TW8A 1HLUP 5FI6A 2O9AA 1AXBA 4R4RA 2Y91A 5GHXA 4P85A 2OAP1 5A90A 4NETA 4PM7A 2XK1A 1GSVA 3D72A 2Y79A 3HVFA 5EVID 4I39A 4I3IA 1G5UA 2WK0A 4WUJA 4NXFA 4L0LA 5AQ7A 1YKDA 2HDSA 1MC0A 2EWVA 1PW8A 4C6YA 3JYIA 3CLOA 3NIAA 2IWBA 4HIAA 5GL9A 2O9CA 3MFDA 5BOHA 3IXHA 2DNSA 3EGXC 4XT2B 3MKFA 3IHAA 5EV0A 1Y4OA 1K56A 4PM8A 1ODVA 1F9IA 4HBUA 2XGNA 3SS5A 4OH0A 2V1ZA 2JHEA 1H8YA 4GB7A 3T4TA 3ICYA 1K54C 1N4OA 1N9OA 2WZXA 1SDNA 5AQAA 3VOLA 3GMWA 3KO6A 3NI9A 5CGSA 3C2WA 5M19A 4QWOA 4HJ6A 1KVMA 3HJIA 1TS7A 4E3NA 4X68A 5F6AA 4AFIA 3OOVA 3A0RA 4BLMA 2J80A 2HZ5A 2IA2A 1UGUA 1PRQA 3Q81A 1YLZA 2P74A 3A3IA 4GLQA 3W4PA 5E2HA 1CF0A 3PR6A 2ZM0A 1BT5A 1Q2PA 4WELA 2H0YA 2Q9MA 5DF9A 5DF8A 1NLZA 3R7WB 1L0EA 3LI8A 2OLVA 4N1HA 4U3TA 3T4SA 3S7OA 5HD5A 4KG6A 2EXBA 3H7WB 3LIFA 1GA0A 3IBRA 2ZQCA 5EOEA 1PW1A 4G3KA 3SS3A 3UPPA 4GCZA 3BQ8A 4GS9B 2ZMVA 2VGJA 3S4XA 3NBLA 3UMDA 4BENA 3C38A 2P08A 5FL3A 4ZJ3A 1Z6FA 2GZAA 4I3AA 3UB9A 4PHTA 1XXMA 3Q07A 3LGOA 5DTKA 3PBSA 5HPIA 3P01A 2V8FA 3T1RA 3P09A 4JKTA 3F1OB 1UWPX 1W63M 1I2WA 3F1PA 3MSHA 4M3KA 4PKYG 3V67A 3EQVA 3DBAA 3HL9A 3HUMA 2J9PA 1GCEA 1GA9A 3LUQA 3JVVA 1XJ2A 4HH3A 3BW6A 2X71A 3KSGA 3Q7ZA 4QB8A 1BYWA 1LSXA 3GV9A 4WEKA 4EESA 1JTGA 3NJAA 2JE5A 4GS9A 4II7A 4E3OA 1W5DA 2PBDP 2PYPA 2WYXA 5CRFA 2V9AA 2V2FF 5FDHA 5EVLA 1OT9A 2Z2MB 4RA7A 4S2OA 3ZVTA 5L2FA 4X1MA 1PIOA 1FR1A 4L9EA 4N1XA 4OOYA 2GJ3A 2O0YA 3PBOA 3OZHA 1NYMA 1YT4A 2HDRA 4JGPA 4ME4A 3CUEA 1LL5A 2I72A 2Y2MA 1ERQA 4Y3IA 4ETXA 3EGDC 5L10A 1XFNA 4XUXA 5G4YA 2X01A 3BY8A 2VV6A 2VEAA 3H7WA 4Z9QA 2V8CA 5CHMA 1MWTA 2AVXA 2JKFA 1N9NA 1VEUA 2ZC3B 3V39A 4B88A 3QP8A 4JXWA 4HI4A 2GNXA 4D2OA 3CHWP 5HWTA 1OJ5A 1PNEA 4KZ7A 3M6HA 2HP6A 2V1AA 2VLGA 3CAXA 3EEAA 4DE1A 5AQBA 1NXYA 4GJ4A 4HJ3A 1YAXA 2VV8A 4IVKA 4EWFA 5A8BA 5DKKA 1S1YA 4OONA 2WGWA 5EVEA 4ZBEA 2DCFA 2EX9A 4Y17A 1KGEA 1S1ZA 4ZAMA 2ZMFA 2IWCA 3GVBA 3IF5A 1Z09A 2QZ6A 4ID4A 3HUNA 3OPPA 2XLNA 2RL3A 3LR3A 3E2LA 3T12B 4I5SA 1BLSA 1PI5A 2VKSA 5F5YA 3PAGA 4QJGA 2QYBA 3MZEA 1GHIA 4KG2A 2EX8A 3LIAA 4MDZA 1XA1A 2R9XA 2O9BA 4Y0UA 5HL1A 5EM0A 4HEFA 1FILA 1K55A 1FSWA 5E2EA 4DRTA 5G18A 3UE0A 5CX7A 1TS8A 2WGWB 3V50A 1FQGA 2G2WA 1L0FA 1FCMA 2O99A 4EETB 4OLDA 3ZGAB 5HDSA 3LCEA 2ZL1A 3QP4A 2OSUA 2WKRA 5EVIB 4UEYA 3V3RA 3EQUA 5AVEA 4JF6A 3F1PB 3DW0A 4Y13A 1TDGA 4HP9A 2Z6DA 5TGFA 2D01A 1X0OA 2L0WA 1NRJA 3NDGA 2HDUA 5EM1A 4ZJ2A 3PHYA 1CEGA 3O3VA 4S2NC 3PBTA 1S0WA 3UB6A 1TD5A 4CQHA 1K54A 3FPVA 3HREA 5J4EA 2M7VA 5I5LA 1JTDA 1ZTUA 3MQOA 3BFCA 1ES4A 5M1AA 1BUEA 2VJWA 2VX8A 2PU2A 1XJ4A 5FEFA 4MNRA 1S4SA 4DE2A 1ONGA 2ZL1B 1E3UA 4GDNA 5HPFA 4OPQA 4FCFA 5I94A 3IS2A 1YSQA 4FH2A 1NZOA 1K6SA 1VETA 4HP4A 1S67L 1BSGA 3IX3A 3MS6A 1MWSA 4LV3A 4WLAA 3BFDA 3NDEA 4UA6A 4JXSA 4YWZA 3F1NA 1FR6A 4DDSA 3AGFA 4EU0A 2OAQ1 2JCHA 5F82A 4R6LA 4Y2FA 2QWSA 2R9WA 1DJAA
chains in the Genus database with same CATH topology
4HIAA 2FH5A 2O9CA 1DP9A 1P0ZA 1T1CA 2VA0A 2HJEA 3EGXC 4XT2B 2XROA 2XA7M 4H6JB 1ODVA 1F9IA 2PYRA 5J7EA 5EFWA 2A24A 2J3WA 4BWIA 3KX0X 4OOMA 3UE3A 5DFXA 1G28A 3ULFA 3IBJA 3MQ0A 2GX5A 2JHEA 5DJUA 2PHYA 3T4TA 3ICYA 2V1BA 3PBRA 2KDKA 5C5KA 1N9OA 4JGOA 3GDIA 3VOLA 4R70A 4KUKA 4KQDA 3KO6A 1EW0A 2OWJA 4IHQA 3OCLA 3CUEC 3MMHA 3C2WA 4PKYA 3P7NA 3O5YA 1MZUA 5HDCA 4HJ6A 3HJIA 1TS7A 5F6AA 1MKMA 4AFIA 3OOVA 3A0RA 4E04A 2J80A 3E98A 2IA2A 3LICA 4EXOA 3TE8A 1UGUA 4IJGA 2XA7S 5HWVA 3LYXA 4EQ1A 4Q0HA 4GLQA 5HWWA 3PR6A 4LLOB 2A24B 1LT0A 2HV1A 3T4OA 4I38A 4FOFA 4WELA 4NKPA 4G3WA 5DF9A 1NLZA 2H28A 3NOTC 3R7WB 3G6OA 4M4XA 4ARZA 3LI8A 3EWKA 1OTBA 1OJGA 3T4SA 2PDRA 2KOIA 3S7OA 3TJZC 5KSHA 4RQ9A 5HD5A 4O0PA 5AJGA 3H7WB 3LIFA 3IBRA 3NOPC 3PBNA 4YOFA 3ZQ5A 4R38A 3C8CA 5IU1A 3OC2A 4G3KA 1F98A 4GCZA 3BQ8A 4GS9B 4MN5A 1P9RA 2ZMVA 3UMDA 2J3TC 2MJ6A 4F3LB 3C38A 4L9GA 1OTIA 2P08A 2EWWA 1OPXA 3LFVA 5FL3A 2YKHA 2GZAA 4I3AA 3UB9A 4PHTA 3A0SA 1P97A 5DFYA 4JGQA 5F69A 1VHMA 4BJPA 3UB7A 3PBSA 4CLCD 5HPIA 2W27A 3P01A 2QJ7A 4HHDA 3F1OB 1UWPX 1W63M 3MF0A 4ARZB 3F1PA 2VGLM 4PKYG 3V67A 4GW9A 3EQVA 1DP6A 3DBAA 3S7QA 1OTAA 2L1MA 4YNRA 2WKQA 3LUQA 3JVVA 1OTDA 1XJ2A 4HH3A 3BW6A 4G3VA 4UQIM 2V0WA 3KSIA 4P6ZS 3MR0A 3KSGA 3LR4A 1BYWA 1LSXA 4WEKA 2PR5A 4BMWA 3T50A 3NJAA 3KSHA 4EESA 4GS9A 1TF1A 2W3EA 1TS0A 4P6ZM 4II7A 1XFQA 2PT7A 1IFQA 5HD3A 4NXBA 1P9WA 2PR6A 2PYPA 4IUKA 3T4KA 1NWZA 4L9FA 2V9AA 4Z1WA 1S66L 3F1OA 1OT9A 4BBUA 2LB5A 4LRZE 2I9VA 4Q0JA 2XRNA 3S7PA 2ZOHA 3ZYTA 2KX6A 4PAUA 5L8MA 4HH2A 4L9EA 3W2ZA 2GJ3A 4HJ4A 3MQQA 2O0YA 3PBOA 4CLCE 3UB8A 3PBQA 1D06A 2Y8HA 4JGRA 1STZA 4O01A 4JGPA 4ME4A 4K08A 3CUEA 4WN5A 1H3QA 2QKPA 2WKPA 2W1RA 2W0NA 2LB9A 3NHQA 4Y3IA 1G6OA 4GHIA 1IOUA 3VE3A 4ETXA 5MC7A 3EGDC 3EEHA 4ZRRA 1XFNA 5G4YA 1WA9A 4ETZA 3BY8A 3EOIA 3KYZA 2VV6A 4WF0A 3H7WA 2VEAA 4KQOA 1YSPA 5HL6A 2M1CA 1KOUA 2V0UA 4B93A 1V9ZA 1N9NA 4EEPA 4F3LA 3B47A 2PD8A 5F68A 2CMNA 3RTYA 5HZHA 2OOLA 2K31A 3OBFA 2ZOIA 4H6JA 1DRMA 2G7UA 4HI4A 4LPZA 1LSVA 5K5BA 2FZ0A 2GNXA 4HQAA 1LSWA 5HWTA 2ZBBA 1OJ5A 3LI9A 4WL9A 2V1AA 2VLGA 3LR0A 3CAXA 5HSQA 3EEAA 4BBTA 1OTEA 4GJ4A 1NLYA 1N9LA 4HJ3A 1YAXA 2VV8A 3D3OA 5A8BA 3LR5A 5DKKA 4QPRA 1S1YA 2BASA 2HF6A 3CWFA 3S7NA 1D7EA 3BQAA 1S1ZA 1W63Q 3E4PA 3LIDA 4EERA 4FSFA 2VZWA 2ZMFA 3A0VA 4LRXC 2D02A 1GSWA 3SW1A 3R4KA 4EEUA 4HY8A 3PYPA 3MFXA 3LR3A 4HNBA 2XSSA 4XT2A 1S4RA 4I5SA 2VKSA 5F5YA 4Y5FA 2NUPC 1T19A 2QYBA 2JKTM 3UE6A 2L4RA 2DMWA 3H82B 4I3JA 3LIAA 1JNUA 4MDZA 5AVFA 1V9YA 4MN7A 2O9BA 5KIZA 3K3DA 2M7UA 5TBMB 3T4LA 2KLIA 3B33A 5DJTA 4EUVA 1XJ3A 3KYQA 2JN7A 5G4ZA 3C30A 3VV4A 2NUTC 3NOUC 3CITA 2QJ5A 5CX7A 2INWA 1TS8A 2J3TD 2PD7A 3FG8A 3CI6A 1T18A 2B18A 2W1TA 2JKTI 5DKLA 5TJJA 5HDDA 3MXQA 2W3GA 2O99A 2QHKA 2JKRM 4EETB 3BWLA 1XJ6A 3UMEA 5HDSA 2K2NA 4DJ2A 3FPWA 4KUOA 4DMZA 2WKRA 4HOIA 4UEYA 2JKRI 1F5MA 3IS2B 3EQUA 3MJQA 3H9WA 5AVEA 4CLCB 1TS6A 2YKFA 3F1PB 2Z6CA 1H8MA 5J3WA 3H82A 3VE4A 4HP9A 2Z6DA 3BJNA 2HGVA 3HCYA 4NEED 2D01A 2P04A 4EW7A 1LL8A 3K2NA 2R78A 2P7JA 4CLCA 1X0OA 2L0WA 1NRJA 4UQIS 2OWHA 3PHYA 1OT6A 3PBTA 3RH8B 3RFBA 3LIBA 2W3FA 3F1NB 1TD5A 2VGLS 3UB6A 4CQHA 4DJ3A 3FPVA 5J4EA 4NXEA 5LBRA 2EA9A 2M7VA 4Q0IA 5I5LA 2B02A 4R3AA 1ZTUA 5IS1A 1VB6A 2W1TB 3KSFA 4WEJA 4O8GA 3MQOA 2VJWA 2VX8A 1XJ4A 4MMNA 4DN0A 4BBVA 1S4SA 3U2AA 4LRYC 3HJKA 3TRCA 3R7WA 2A2LA 1ZHHB 3TW8A 3JVUA 1T1AA 5HPFA 2O9AA 3GECA 4NXGA 3K3CA 3IS2A 1YSQA 2K7SA 2OAP1 2W3HA 3FC7A 2VV7A 4HP4A 1S67L 1T1BA 1Y28A 1GSVA 3D72A 4WLAA 3LIEA 4CLCC 2Y79A 4MN6A 4YWZA 3F1NA 4MCWA 3PXPA 3B42A 5IT5A 4I39A 4I3IA 1DP8A 3OCNA 4EU0A 2OAQ1 4B9OA 3E0YA 3E4QA 4WUJA 4NXFA 4L0LA 1YKDA 4GHIB 3T4QA 4R6LA 1GSXA 5TBMA 1UWNX 4OOLA 1MC0A 2EWVA 4Y2FA 2HJ9C 3OLOA 2W3DA 2QWSA 3E4OA 3T4JA 4IUHA 3CLOA 3BY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M1C A;  1KOU A;  2QHK A;  4HIA A;  1DP9 A;  1P0Z A;  1T1C A;  2V0U A;  4F3L B;  4L9G A;  4EET B;  3BWL A;  1V9Z A;  1OTI A;  1XJ6 A;  1N9N A;  4EEP A;  4F3L A;  4XT2 B;  5HDS A;  3UME A;  2YKH A;  2PD8 A;  5F68 A;  2CMN A;  3RTY A;  4I3A A;  3UB9 A;  4DJ2 A;  5HZH A;  2OOL A;  3A0S A;  4KUO A;  1P97 A;  4H6J B;  2WKR A;  4HOI A;  1ODV A;  4JGQ A;  5F69 A;  1F9I A;  2PYR A;  2ZOI A;  4H6J A;  5J7E A;  5EFW A;  2A24 A;  3IS2 B;  3MJQ A;  3UB7 A;  3KX0 X;  4EES A;  2W27 A;  3H9W A;  1DRM A;  2QJ7 A;  4HHD A;  5AVE A;  4HI4 A;  1TS6 A;  4LPZ A;  2YKF A;  3F1P B;  5I5L A;  1LSV A;  1G28 A;  1UWP X;  2Z6C A;  3F1O B;  5J3W A;  4HQA A;  3H82 A;  3VE4 A;  1LSW A;  3F1P A;  5HWT A;  4PKY G;  2ZBB A;  1OJ5 A;  2Z6D A;  3LI9 A;  4HP9 A;  3ULF A;  4GW9 A;  2JHE A;  4WL9 A;  5DJU A;  1DP6 A;  2PHY A;  2D01 A;  1OTA A;  4EW7 A;  1LL8 A;  2V1A A;  2VLG A;  2R78 A;  2L1M A;  3CAX A;  2V1B A;  3ICY A;  2P7J A;  5HSQ A;  1X0O A;  2KDK A;  2L0W A;  2WKQ A;  4BBT A;  3LUQ A;  2OWH A;  1N9O A;  3PHY A;  4JGO A;  1OTD A;  1OT6 A;  1OTE A;  1XJ2 A;  3GDI A;  4HH3 A;  4KQD A;  4KUK A;  4R70 A;  3RH8 B;  3VOL A;  1EW0 A;  1N9L A;  2OWJ A;  2V0W A;  3LIB A;  4HJ3 A;  2VV8 A;  3F1N B;  3UB6 A;  4DJ3 A;  3MR0 A;  5A8B A;  5DKK A;  5J4E A;  3C2W A;  4NXE A;  4PKY A;  2EA9 A;  3P7N A;  1BYW A;  1LSX A;  1MZU A;  2B02 A;  4R3A A;  2BAS A;  1S1Y A;  2PR5 A;  3CWF A;  3NJA A;  4HJ6 A;  5HDC A;  3T50 A;  4GS9 A;  3HJI A;  5IS1 A;  1TS7 A;  1VB6 A;  5F6A A;  1TS0 A;  1D7E A;  3A0R A;  3E4P A;  1S1Z A;  2J80 A;  3MQO A;  1XFQ A;  4E04 A;  3LID A;  1XJ4 A;  4EER A;  4HJ4 A;  5HD3 A;  3LIC A;  4EXO A;  4NXB A;  3A0V A;  2PR6 A;  2PYP A;  1S4S A;  4LRX C;  5AVF A;  1NWZ A;  2D02 A;  4LRY C;  1UGU A;  4L9F A;  3HJK A;  2V9A A;  5HWV A;  1GSW A;  3LYX A;  3SW1 A;  1T1A A;  4EEU A;  4HY8 A;  1S66 L;  4EQ1 A;  3F1O A;  5HWW A;  1OT9 A;  4BBU A;  3PYP A;  3GEC A;  3MFX A;  4HNB A;  3K3C A;  4LRZ E;  4NXG A;  2I9V A;  4XT2 A;  4LLO B;  1S4R A;  2A24 B;  1LT0 A;  2HV1 A;  3IS2 A;  4I5S A;  2ZOH A;  4I38 A;  2KX6 A;  5F5Y A;  2K7S A;  1T19 A;  4HH2 A;  3UE6 A;  2H28 A;  2L4R A;  3NOT C;  3FC7 A;  3G6O A;  2VV7 A;  4L9E A;  4HP4 A;  1S67 L;  3H82 B;  4M4X A;  2GJ3 A;  3LIA A;  1JNU A;  3MQQ A;  3LI8 A;  1V9Y A;  1T1B A;  1Y28 A;  1GSV A;  3D72 A;  3EWK A;  1OTB A;  4WLA A;  5HDD A;  3UB8 A;  5KIZ A;  3LIE A;  1D06 A;  4JGR A;  1OJG A;  3K3D A;  4MN6 A;  5TBM B;  2PDR A;  4JGP A;  4YWZ A;  3F1N A;  4K08 A;  4RQ9 A;  4WN5 A;  5HD5 A;  2QKP A;  3B33 A;  2WKP A;  2W0N A;  5DJT A;  4I39 A;  4I3I A;  1XJ3 A;  3H7W B;  3H7W A;  3NHQ A;  1DP8 A;  3LIF A;  4BBV A;  3IBR A;  4GHI A;  4B9O A;  3E4Q A;  3NOP C;  3VE3 A;  2JN7 A;  4WUJ A;  5G4Z A;  3UMD A;  3ZQ5 A;  4NXF A;  4GHI B;  3NOU C;  3EEH A;  4R6L A;  1GSX A;  2QJ5 A;  4R38 A;  3C8C A;  5IU1 A;  1UWN X;  4I3J A;  5TBM A;  2INW A;  1F98 A;  1TS8 A;  1XFN A;  1WA9 A;  2PD7 A;  1T18 A;  3FG8 A;  4GCZ A;  4MN5 A;  3BY8 A;  5G4Y A;  3OLO A;  2QWS A;  3E4O A;  5DKL A;  2VV6 A;  4GS9 B;  4WF0 A;  2VEA A;  3MXQ A;  3CLO A;  3BY9 A; 
#chains in the Genus database with same CATH topology
 2A49 A;  2VA0 A;  1GHM A;  2HJE A;  5DTT A;  4OPZ A;  3IXD A;  2XA7 M;  3C7U A;  3WS4 A;  2Y2K A;  3ZG8 B;  4LGW A;  2J3W A;  4OOM A;  4DE0 A;  3HLC A;  3IBJ A;  3ZFZ A;  2ZQA A;  1ES5 A;  2ZC7 A;  2ZM8 A;  3L7H A;  4RX3 A;  2G2U A;  1XKZ A;  3HLE A;  5C5K A;  4JGO A;  4R70 A;  4EBP A;  4KQD A;  1EW0 A;  2Y2Q A;  4R23 A;  3RJU A;  3MBZ A;  3MMH A;  3P7N A;  5E43 A;  1ACF A;  1MZU A;  5HDC A;  2GDN A;  3IF6 B;  3WS1 A;  1MKM A;  4EV4 A;  5FAT A;  1M40 A;  3FV7 A;  4IJG A;  4JPM A;  4FD8 A;  3A3J A;  3QP5 A;  1ZC2 A;  3P98 A;  4Q0H A;  1YLT A;  4LLO B;  4I38 A;  1MPL A;  3QP6 A;  4NKP A;  3HLD A;  4WZ5 A;  2WGV A;  2H28 A;  3NOT C;  4X25 A;  1DJB A;  5HW3 A;  3EWK A;  1OTB A;  3ZHH A;  4OPR A;  2PDR A;  4JF5 A;  4RQ9 A;  3MXS A;  3NOP C;  2X02 A;  3PBN A;  1NZU A;  3ZQ5 A;  4QD4 A;  4KQR A;  3C8C A;  5IU1 A;  4KZ9 A;  2XH9 A;  4MN5 A;  4Y0O A;  1RGZ A;  5GLB A;  3VP3 A;  3SH7 A;  4OQG A;  4S2J A;  3HLF A;  1P97 A;  4JGQ A;  5F69 A;  3A3F A;  3O87 A;  4MLL A;  2UWX A;  1XGI A;  1HTZ A;  4LCL A;  1XP4 A;  4QHC A;  1EI5 A;  1PWC A;  4E3K A;  1I2S A;  5DVA A;  1OTD A;  4UQI M;  4P6Z S;  1HD8 A;  1W7F A;  4OQI A;  2PR5 A;  3T50 A;  1TF1 A;  5CEB A;  3LO7 A;  1YQS A;  1XFQ A;  3IF6 C;  1IFQ A;  5HD3 A;  4NXB A;  4IUK A;  5GLA A;  3TSG A;  4D60 A;  4GKU A;  1S66 L;  1SHV A;  4K91 A;  2HP9 A;  3ZYT A;  2KX6 A;  4DXC A;  1H0M A;  3E2K A;  4E6W A;  1HZO A;  4HH2 A;  4OQ0 A;  4R1G A;  4K0W A;  3MQQ A;  3HLB A;  3UDF A;  4CLC E;  3UB8 A;  3PBQ A;  2JC7 A;  1K38 A;  2Y8H A;  1STZ A;  4U0X A;  2WAD A;  1ZKJ A;  2WKP A;  4JXG A;  4H8R A;  1RCJ A;  1IOU A;  3VE3 A;  5MC7 A;  3HLG A;  4K0X A;  1ZG6 A;  2VGK A;  3Q7V B;  4ZRR A;  1JWP A;  5CXW A;  1WA9 A;  4ETZ A;  3KYZ A;  4GOG A;  4WF0 A;  1YSP A;  5HL6 A;  2ZMA A;  1BLC A;  4B93 A;  4FUW A;  2QPN A;  3B47 A;  5F68 A;  5HZH A;  3T1Q B;  4WBG A;  5FAP A;  1ZG4 A;  1KVL A;  2ZOI A;  4H6J A;  2DRW A;  4KEN B;  3SZT A;  3CG5 A;  2FZ0 A;  1LSW A;  3S22 A;  3N8R A;  3SH9 A;  2CC1 A;  3V5M A;  2Y59 A;  1ESI A;  1PWG A;  1D1J A;  4S2I A;  1N9L A;  4KZ5 A;  3LR5 A;  1W8Y A;  4QPR A;  1MWU A;  3UE1 A;  4E6X A;  3SH8 A;  2XFT A;  1JWZ A;  4LFU A;  3S7N A;  4EQI A;  5KSC A;  1D7E A;  3E4P A;  1MY8 A;  3LID A;  3OPL A;  1JWV A;  3VSK A;  3A0V A;  4LRX C;  5EVI C;  1GSW A;  3R4K A;  3PYP A;  4HNB A;  3BLM A;  2XSS A;  4XT2 A;  2EX6 A;  4Y5F A;  2JKT M;  5HAI A;  2L4R A;  3ITB A;  3H82 B;  4EBN A;  1V9Y A;  3Q82 A;  5KIZ A;  3G31 A;  1RP5 A;  3HLW A;  3T4L A;  3D9Y A;  5DJT A;  3GR2 A;  1XJ3 A;  4S2M A;  4UAA A;  2JN7 A;  2NUT C;  3NOU C;  4PM9 A;  5J8X A;  4XUZ A;  2B18 A;  5TJJ A;  5DKL A;  4N9L A;  4QY6 A;  5EVI A;  1ERM A;  2P9V A;  4KZB A;  3BWL A;  4DJ2 A;  1OME A;  2PRF A;  1K57 C;  5EOO A;  1YLJ A;  2JKR I;  3BFE A;  3IS2 B;  3H9W A;  1A0K A;  1TS6 A;  2Z6C A;  5J3W A;  3H82 A;  4GDB A;  2HGV A;  4F94 A;  2ZC4 B;  3MKE A;  3ZVW A;  4EW7 A;  3K2N A;  4CLC A;  4X56 A;  4UQI S;  2OWH A;  1OT6 A;  1WYC A;  2XF3 A;  3F1N B;  2Y2O A;  4RVA A;  4NXE A;  5LBR A;  4Q0I A;  5HX9 A;  1SKO B;  1VB6 A;  2W1T B;  3KSF A;  4KZA A;  3QNB A;  4O8G A;  2PU4 A;  2WAE A;  4GN2 A;  1SKF A;  3DTM A;  4MMN A;  4BBV A;  1L0D A;  4X53 A;  2A2L A;  4RX2 A;  3GEC A;  4NXG A;  5FAS A;  2K7S A;  4XXR A;  3VOY A;  3ISG A;  2VV7 A;  1T1B A;  4P87 A;  3VSL A;  4MN6 A;  3ZG0 A;  4MCW A;  5IT5 A;  1DP8 A;  3OCN A;  4B9O A;  3E4Q A;  1YMS A;  2WKE A;  4GHI B;  1GSX A;  5TBM A;  1UWN X;  2QMI A;  2OLU A;  1EWZ A;  3TG9 A;  3E4O A;  3T4J A;  4IUH A;  3PTE A;  3WRT A;  1IEM A;  1P0Z A;  1T1C A;  3KYE A;  3IF6 A;  4JLF A;  3VFF A;  2XRO A;  4H6J B;  3IQA A;  1LI9 A;  3BRM A;  1PZO A;  5CGX A;  1VET B;  2A24 A;  4BWI A;  3KX0 X;  3C4O A;  2ZC5 B;  2H10 A;  2C5W B;  3ZDJ A;  4MBH A;  1G28 A;  1CI9 A;  2Y4A A;  1E3U D;  1KDW A;  3UNW A;  1PFL A;  5DJU A;  2PHY A;  1ESU A;  5FAQ A;  2V1B A;  2KDK A;  1IYO A;  1W79 A;  4ZDX A;  1MWR A;  5DTS A;  3GDI A;  4KUK A;  3AGE A;  4A5R A;  4OPY A;  3IWQ A;  4IHQ A;  3BFG A;  3OCL A;  1LI0 A;  3CUE C;  4PKY A;  3O5Y A;  5GLC A;  3IXB A;  4E04 A;  3WS5 A;  3E98 A;  1YMX A;  4EXO A;  3W8K A;  1KGG A;  3UY6 A;  1L0G A;  2XA7 S;  5HWV A;  4WMC A;  3LYX A;  5HWW A;  2RCX A;  2ZM2 A;  1ALQ A;  1K57 A;  2HV1 A;  3T4O A;  4S2P A;  4G3W A;  5CTM A;  3O86 A;  3BYD A;  4DKI A;  4ARZ A;  3N6I A;  1KDS A;  5HAR A;  1XPB A;  3QP2 A;  4UA7 A;  2KOI A;  5KSH A;  1DY6 A;  4O0P A;  1MXO A;  2ZLY A;  3RXW A;  3G34 A;  4R38 A;  3OC2 A;  1F98 A;  1KE3 A;  1E25 A;  4O7D A;  5EUA A;  1P9R A;  4PPR A;  2XQZ A;  1SDE A;  2J3T C;  2MJ6 A;  4ESP A;  4F3L B;  5A92 A;  1OTI A;  3LFV A;  5FQM A;  4LV1 A;  1LL9 A;  2Y2I A;  3W4O A;  4R3J A;  3A0S A;  1NJ4 A;  5DFY A;  1VHM A;  3UDI A;  1DJC A;  4BJP A;  4CLC D;  2W27 A;  2QJ7 A;  4HHD A;  3MF0 A;  4ARZ B;  3U4L P;  4YFM A;  3S7Q A;  1OTA A;  4S2L A;  1FIK A;  4YNR A;  2EX2 A;  3VP0 A;  4IVI A;  5FQK A;  1KGF A;  3KSI A;  1NY0 A;  3LEZ A;  5HAQ A;  4HBT A;  3LY4 A;  3WWX A;  4IBX A;  4R4S A;  1J9M A;  2E8J A;  4KZ3 A;  2PR6 A;  3T4K A;  3CZD A;  4DDY A;  1NWZ A;  4E3L A;  1Q2Q A;  3IH9 A;  4OVD A;  2Z2L B;  3FZC A;  5FQ9 A;  4KZ8 A;  1PI4 A;  2XRN A;  1IYP A;  4KZ4 A;  4PAU A;  2Y55 A;  2ZQ8 A;  4DF6 A;  2J9O A;  4MBK A;  4GD6 A;  3PAE A;  3N8L A;  1D06 A;  4JGR A;  4O01 A;  2HP5 A;  3GQZ A;  1TVF A;  1H3Q A;  1C3B A;  2W1R A;  1M6K A;  2LB9 A;  3M2J A;  3C4P A;  3JPU A;  4GHI A;  3G2Z A;  4OLG A;  4KQO A;  3IWI A;  3MXR A;  2M1C A;  3CPT A;  2ZQ9 A;  2V0U A;  4B4X A;  5E2G A;  1V9Z A;  1BLP A;  1S6R A;  4F3L A;  2PD8 A;  3RTY A;  1BZA A;  4ZJ1 A;  3HBR A;  1DRM A;  4Y15 A;  4LPZ A;  1NYY A;  2Y2H A;  1H8Z A;  3LI9 A;  3WRZ A;  4WL9 A;  2ZQD A;  3LR0 A;  5F1F A;  5A91 A;  2BG1 A;  1K0K A;  1XGJ A;  1NLY A;  5TFQ A;  4Y7P A;  3RXX A;  4OKP A;  3D3O A;  4WM9 A;  5KMW A;  2BAS A;  3CWF A;  1YLY A;  1NRF A;  5CHU A;  3OPR A;  4JXV A;  3BQA A;  4OQH A;  1W63 Q;  3CMZ A;  1RGY A;  4FSF A;  1O7E A;  2VZW A;  1IKI A;  3BEB A;  5EPH A;  2BTF P;  1FOF A;  3NY4 A;  4Y0T A;  2ACG A;  1YM1 A;  3SW1 A;  4HY8 A;  3IWO A;  5GHZ A;  3G2Y A;  3QNC A;  3UN7 A;  1ERO A;  4GZB A;  3ZNY A;  4I3J A;  1JNU A;  1LHY A;  1K56 D;  4MN7 A;  3D4F A;  5GHY A;  2HDQ A;  2M7U A;  2EFX A;  4NK3 A;  5E2F A;  4QU3 A;  3B33 A;  4EUV A;  3GSG A;  4LV0 A;  3KYQ A;  5G4Z A;  3VV4 A;  4YIN A;  5CGW A;  2INW A;  1L2S A;  3FG8 A;  5L09 A;  2H5S A;  3CI6 A;  2W1T A;  2JKT I;  2XEP A;  3MXQ A;  4IED A;  1BTL A;  2XR0 A;  1PZP A;  1SKO A;  1XA7 A;  3L9K A;  2WAF A;  3FPW A;  4KUO A;  5L07 A;  4HES A;  2XD1 A;  4Q8I A;  4MEZ A;  4X55 A;  4HOI A;  3IX8 A;  4RYE A;  3VMA A;  4C75 A;  3MJQ A;  2EXA A;  1QMF A;  2WKI A;  4CLC B;  2C6W B;  3DTE A;  2H0T A;  3BJN A;  4NEE D;  2P04 A;  1LL8 A;  2P7J A;  3B3X A;  3QHY A;  3BEC A;  4WYY A;  2J8Y A;  3BM6 A;  3RFB A;  2W3F A;  2VGL S;  4EUZ A;  2EA9 A;  4DXB A;  2WGI A;  2PAV P;  2B02 A;  5IS1 A;  4KZ6 A;  1FCO A;  1W8Q A;  4DN0 A;  2Y2J A;  4BD1 A;  3ZCZ A;  3U2A A;  4LRY C;  3TOI A;  4OP5 A;  3IX4 A;  1ES2 A;  1ZHH B;  3JVU A;  1T1A A;  3N7W A;  3K3C A;  4B4Z A;  3IXG A;  2W3H A;  3FC7 A;  3VP4 A;  1MKI A;  1Y28 A;  4EBL A;  3LIE A;  4CLC C;  1AWI A;  3S1Y A;  4C3Q A;  3GRJ A;  5CEC A;  3PXP A;  3B42 A;  2Q9N A;  3E0Y A;  1FCN A;  3T4Q A;  4WZ4 A;  4OOL A;  2EFU A;  3VFH A;  4LV2 A;  4R0Q A;  5EEC A;  2ZD8 A;  4S2K A;  2FFY A;  2HJ9 C;  2W3D A;  3OLO A;  3M6B A;  4NG2 A;  1YPR A;  4X69 A;  3BY9 A;  2FH5 A;  1DP9 A;  2JKG A;  1L3L A;  4KG5 A;  4GNU A;  4DE3 A;  1Y54 A;  3NEC A;  3AGD A;  3IH8 A;  2Y2L A;  4PMA A;  2PYR A;  5J7E A;  5EFW A;  1ES3 A;  3HUO A;  3UE3 A;  5DFX A;  2Y2G A;  1I5Q A;  1IKG A;  1VQQ A;  3ULF A;  3MQ0 A;  2GX5 A;  3LEQ A;  5IHV A;  1PWD A;  1WE4 A;  3DTI A;  3PBR A;  1FSY A;  2OWJ A;  5F1G A;  2Y2N A;  4LCM A;  3G30 A;  4S2N A;  2ZJ9 A;  5EE8 A;  3V3S A;  3QP1 A;  5D3O A;  5FQQ A;  3WS0 A;  3LIC A;  1K6R A;  4N9K A;  3TE8 A;  1U60 A;  3UPO A;  2XD5 A;  5JYP A;  4EQ1 A;  5FQJ A;  2JBF A;  1IYS A;  3OPH A;  2A24 B;  1LT0 A;  5A93 A;  4FOF A;  4X6T A;  3W4Q A;  3WS2 A;  3G6O A;  5FSR A;  4M4X A;  1HVB A;  1CEF A;  3Q7V A;  1OJG A;  1CI8 A;  4GD8 A;  5CER A;  4BL3 A;  5HAP A;  3TJZ C;  3MZF A;  3A3D A;  3UO9 A;  5AJG A;  2HPB A;  4YOF A;  4ZTK A;  1G6A A;  4X1L A;  3N4I A;  3DTK A;  3NUL A;  4BQM A;  3T1X A;  4OP8 A;  4L9G A;  2EWW A;  1OPX A;  4R3B A;  5FAO A;  2YKH A;  3VP2 A;  4PM6 A;  4P0M A;  3ZG9 B;  3UB7 A;  5FI2 A;  3NCK A;  5FQI A;  2VGL M;  5DF7 A;  4CJN A;  4GW9 A;  3UB5 P;  1DP6 A;  2L1M A;  5HFO A;  2IWD A;  2WKQ A;  3IT9 A;  4CPK A;  3BFF A;  3IHB A;  1O07 A;  4G3V A;  2V0W A;  3MR0 A;  3LR4 A;  5FEG A;  4BMW A;  3KSH A;  3Q1F A;  2W3E A;  1TS0 A;  4P6Z M;  1YLW A;  1MBL A;  2B95 A;  2PT7 A;  3DWK A;  1P9W A;  4QY5 A;  4L9F A;  3ITA A;  4LEN A;  4Z1W A;  1SCW A;  2J7V A;  4BD0 A;  3F1O A;  4BBU A;  2LB5 A;  4LRZ E;  2I9V A;  1KE4 A;  2UV0 E;  4Q0J A;  3S7P A;  3ZNT A;  2ZOH A;  3UPN A;  1E4D A;  5L8M A;  4E3M A;  2WUQ A;  3A3E A;  3W2Z A;  3G4P A;  3N8S A;  4HJ4 A;  3BLS A;  5CTN A;  1BLH A;  4FH4 A;  1K4E A;  1JVJ A;  3FWL A;  4K08 A;  4WN5 A;  2QKP A;  1WYB A;  2W0N A;  3NHQ A;  1G6O A;  3EEH A;  3EOI A;  3G35 A;  4UA9 A;  4BL2 A;  1KOU A;  1SZV A;  1VM1 A;  3UDX A;  1TEM A;  4EEP A;  5U47 A;  2A3U A;  2B5R A;  2CMN A;  3FYZ A;  1N9B A;  2OOL A;  3T1S A;  2K31 A;  3GTC A;  3OBF A;  3CPT B;  2XDM A;  1IEL A;  2G7U A;  2Y2P A;  1F2K A;  1LSV A;  5K5B A;  4HQA A;  4E3I A;  2ZBB A;  3ZG7 B;  3FKW A;  3G32 A;  5HSQ A;  5TR7 A;  4BBT A;  5KZH A;  1OTE A;  5AQ9 A;  3SOI A;  3DAV A;  2V20 A;  3M2K A;  1YLP A;  2ZC6 B;  3ZG5 A;  1K55 C;  2E8I A;  2HF6 A;  1VEU B;  5GLD A;  1TDL A;  4EER A;  1CK3 A;  2VK3 A;  3DWZ A;  4KQQ A;  2D02 A;  1QME A;  4MBF A;  5FA7 A;  2WZZ A;  4EEU A;  1BUL A;  3VOZ A;  2FFF B;  3MFX A;  1S4R A;  4UHU A;  2NUP C;  1T19 A;  5CED A;  4P6B A;  3UE6 A;  1IYQ A;  2DMW A;  1CJF A;  5AVF A;  1G68 A;  4IBR A;  2ZQ7 A;  3MZD A;  3SS4 A;  5CHJ A;  4E3J A;  3K3D A;  5TBM B;  1KE0 A;  2KLI A;  1H5X A;  1LLB A;  3O88 A;  2Q0O A;  3C30 A;  3CIT A;  2PBY A;  2QJ5 A;  3CJM A;  2J3T D;  2PD7 A;  4WMC D;  1T18 A;  1XX2 A;  1CQA A;  5HDD A;  2W3G A;  2QHK A;  2JKR M;  5FI7 A;  1XJ6 A;  3NC8 A;  3UME A;  1PYY A;  2K2N A;  4DMZ A;  1K25 A;  1F5M A;  1ONH A;  2XFS A;  1K4F A;  4FTX A;  3C5A A;  1J3W A;  2YKF A;  1H8M A;  3VE4 A;  1GHP A;  3C7V A;  3HCY A;  2R78 A;  3VP1 A;  3LY3 A;  5M18 A;  4JBF A;  5FDS A;  3FKV A;  5F83 A;  3RH8 B;  4WZ5 C;  3LIB A;  4DJ3 A;  2BLS A;  4PM5 A;  2OV5 A;  4U0T A;  5JYO A;  2WKH A;  4R3A A;  4WEJ A;  4N92 A;  2P9V B;  3I7J A;  3HJK A;  3TRC A;  4JF4 A;  3R7W A;  3TW8 A;  1HLU P;  5FI6 A;  2O9A A;  1AXB A;  4R4R A;  2Y91 A;  5GHX A;  4P85 A;  2OAP 1;  5A90 A;  4NET A;  4PM7 A;  2XK1 A;  1GSV A;  3D72 A;  2Y79 A;  3HVF A;  5EVI D;  4I39 A;  4I3I A;  1G5U A;  2WK0 A;  4WUJ A;  4NXF A;  4L0L A;  5AQ7 A;  1YKD A;  2HDS A;  1MC0 A;  2EWV A;  1PW8 A;  4C6Y A;  3JYI A;  3CLO A;  3NIA A;  2IWB A;  4HIA A;  5GL9 A;  2O9C A;  3MFD A;  5BOH A;  3IXH A;  2DNS A;  3EGX C;  4XT2 B;  3MKF A;  3IHA A;  5EV0 A;  1Y4O A;  1K56 A;  4PM8 A;  1ODV A;  1F9I A;  4HBU A;  2XGN A;  3SS5 A;  4OH0 A;  2V1Z A;  2JHE A;  1H8Y A;  4GB7 A;  3T4T A;  3ICY A;  1K54 C;  1N4O A;  1N9O A;  2WZX A;  1SDN A;  5AQA A;  3VOL A;  3GMW A;  3KO6 A;  3NI9 A;  5CGS A;  3C2W A;  5M19 A;  4QWO A;  4HJ6 A;  1KVM A;  3HJI A;  1TS7 A;  4E3N A;  4X68 A;  5F6A A;  4AFI A;  3OOV A;  3A0R A;  4BLM A;  2J80 A;  2HZ5 A;  2IA2 A;  1UGU A;  1PRQ A;  3Q81 A;  1YLZ A;  2P74 A;  3A3I A;  4GLQ A;  3W4P A;  5E2H A;  1CF0 A;  3PR6 A;  2ZM0 A;  1BT5 A;  1Q2P A;  4WEL A;  2H0Y A;  2Q9M A;  5DF9 A;  5DF8 A;  1NLZ A;  3R7W B;  1L0E A;  3LI8 A;  2OLV A;  4N1H A;  4U3T A;  3T4S A;  3S7O A;  5HD5 A;  4KG6 A;  2EXB A;  3H7W B;  3LIF A;  1GA0 A;  3IBR A;  2ZQC A;  5EOE A;  1PW1 A;  4G3K A;  3SS3 A;  3UPP A;  4GCZ A;  3BQ8 A;  4GS9 B;  2ZMV A;  2VGJ A;  3S4X A;  3NBL A;  3UMD A;  4BEN A;  3C38 A;  2P08 A;  5FL3 A;  4ZJ3 A;  1Z6F A;  2GZA A;  4I3A A;  3UB9 A;  4PHT A;  1XXM A;  3Q07 A;  3LGO A;  5DTK A;  3PBS A;  5HPI A;  3P01 A;  2V8F A;  3T1R A;  3P09 A;  4JKT A;  3F1O B;  1UWP X;  1W63 M;  1I2W A;  3F1P A;  3MSH A;  4M3K A;  4PKY G;  3V67 A;  3EQV A;  3DBA A;  3HL9 A;  3HUM A;  2J9P A;  1GCE A;  1GA9 A;  3LUQ A;  3JVV A;  1XJ2 A;  4HH3 A;  3BW6 A;  2X71 A;  3KSG A;  3Q7Z A;  4QB8 A;  1BYW A;  1LSX A;  3GV9 A;  4WEK A;  4EES A;  1JTG A;  3NJA A;  2JE5 A;  4GS9 A;  4II7 A;  4E3O A;  1W5D A;  2PBD P;  2PYP A;  2WYX A;  5CRF A;  2V9A A;  2V2F F;  5FDH A;  5EVL A;  1OT9 A;  2Z2M B;  4RA7 A;  4S2O A;  3ZVT A;  5L2F A;  4X1M A;  1PIO A;  1FR1 A;  4L9E A;  4N1X A;  4OOY A;  2GJ3 A;  2O0Y A;  3PBO A;  3OZH A;  1NYM A;  1YT4 A;  2HDR A;  4JGP A;  4ME4 A;  3CUE A;  1LL5 A;  2I72 A;  2Y2M A;  1ERQ A;  4Y3I A;  4ETX A;  3EGD C;  5L10 A;  1XFN A;  4XUX A;  5G4Y A;  2X01 A;  3BY8 A;  2VV6 A;  2VEA A;  3H7W A;  4Z9Q A;  2V8C A;  5CHM A;  1MWT A;  2AVX A;  2JKF A;  1N9N A;  1VEU A;  2ZC3 B;  3V39 A;  4B88 A;  3QP8 A;  4JXW A;  4HI4 A;  2GNX A;  4D2O A;  3CHW P;  5HWT A;  1OJ5 A;  1PNE A;  4KZ7 A;  3M6H A;  2HP6 A;  2V1A A;  2VLG A;  3CAX A;  3EEA A;  4DE1 A;  5AQB A;  1NXY A;  4GJ4 A;  4HJ3 A;  1YAX A;  2VV8 A;  4IVK A;  4EWF A;  5A8B A;  5DKK A;  1S1Y A;  4OON A;  2WGW A;  5EVE A;  4ZBE A;  2DCF A;  2EX9 A;  4Y17 A;  1KGE A;  1S1Z A;  4ZAM A;  2ZMF A;  2IWC A;  3GVB A;  3IF5 A;  1Z09 A;  2QZ6 A;  4ID4 A;  3HUN A;  3OPP A;  2XLN A;  2RL3 A;  3LR3 A;  3E2L A;  3T12 B;  4I5S A;  1BLS A;  1PI5 A;  2VKS A;  5F5Y A;  3PAG A;  4QJG A;  2QYB A;  3MZE A;  1GHI A;  4KG2 A;  2EX8 A;  3LIA A;  4MDZ A;  1XA1 A;  2R9X A;  2O9B A;  4Y0U A;  5HL1 A;  5EM0 A;  4HEF A;  1FIL A;  1K55 A;  1FSW A;  5E2E A;  4DRT A;  5G18 A;  3UE0 A;  5CX7 A;  1TS8 A;  2WGW B;  3V50 A;  1FQG A;  2G2W A;  1L0F A;  1FCM A;  2O99 A;  4EET B;  4OLD A;  3ZGA B;  5HDS A;  3LCE A;  2ZL1 A;  3QP4 A;  2OSU A;  2WKR A;  5EVI B;  4UEY A;  3V3R A;  3EQU A;  5AVE A;  4JF6 A;  3F1P B;  3DW0 A;  4Y13 A;  1TDG A;  4HP9 A;  2Z6D A;  5TGF A;  2D01 A;  1X0O A;  2L0W A;  1NRJ A;  3NDG A;  2HDU A;  5EM1 A;  4ZJ2 A;  3PHY A;  1CEG A;  3O3V A;  4S2N C;  3PBT A;  1S0W A;  3UB6 A;  1TD5 A;  4CQH A;  1K54 A;  3FPV A;  3HRE A;  5J4E A;  2M7V A;  5I5L A;  1JTD A;  1ZTU A;  3MQO A;  3BFC A;  1ES4 A;  5M1A A;  1BUE A;  2VJW A;  2VX8 A;  2PU2 A;  1XJ4 A;  5FEF A;  4MNR A;  1S4S A;  4DE2 A;  1ONG A;  2ZL1 B;  1E3U A;  4GDN A;  5HPF A;  4OPQ A;  4FCF A;  5I94 A;  3IS2 A;  1YSQ A;  4FH2 A;  1NZO A;  1K6S A;  1VET A;  4HP4 A;  1S67 L;  1BSG A;  3IX3 A;  3MS6 A;  1MWS A;  4LV3 A;  4WLA A;  3BFD A;  3NDE A;  4UA6 A;  4JXS A;  4YWZ A;  3F1N A;  1FR6 A;  4DDS A;  3AGF A;  4EU0 A;  2OAQ 1;  2JCH A;  5F82 A;  4R6L A;  4Y2F A;  2QWS A;  2R9W A;  1DJA A; 
#chains in the Genus database with same CATH homology
 4HIA A;  2FH5 A;  2O9C A;  1DP9 A;  1P0Z A;  1T1C A;  2VA0 A;  2HJE A;  3EGX C;  4XT2 B;  2XRO A;  2XA7 M;  4H6J B;  1ODV A;  1F9I A;  2PYR A;  5J7E A;  5EFW A;  2A24 A;  2J3W A;  4BWI A;  3KX0 X;  4OOM A;  3UE3 A;  5DFX A;  1G28 A;  3ULF A;  3IBJ A;  3MQ0 A;  2GX5 A;  2JHE A;  5DJU A;  2PHY A;  3T4T A;  3ICY A;  2V1B A;  3PBR A;  2KDK A;  5C5K A;  1N9O A;  4JGO A;  3GDI A;  3VOL A;  4R70 A;  4KUK A;  4KQD A;  3KO6 A;  1EW0 A;  2OWJ A;  4IHQ A;  3OCL A;  3CUE C;  3MMH A;  3C2W A;  4PKY A;  3P7N A;  3O5Y A;  1MZU A;  5HDC A;  4HJ6 A;  3HJI A;  1TS7 A;  5F6A A;  1MKM A;  4AFI A;  3OOV A;  3A0R A;  4E04 A;  2J80 A;  3E98 A;  2IA2 A;  3LIC A;  4EXO A;  3TE8 A;  1UGU A;  4IJG A;  2XA7 S;  5HWV A;  3LYX A;  4EQ1 A;  4Q0H A;  4GLQ A;  5HWW A;  3PR6 A;  4LLO B;  2A24 B;  1LT0 A;  2HV1 A;  3T4O A;  4I38 A;  4FOF A;  4WEL A;  4NKP A;  4G3W A;  5DF9 A;  1NLZ A;  2H28 A;  3NOT C;  3R7W B;  3G6O A;  4M4X A;  4ARZ A;  3LI8 A;  3EWK A;  1OTB A;  1OJG A;  3T4S A;  2PDR A;  2KOI A;  3S7O A;  3TJZ C;  5KSH A;  4RQ9 A;  5HD5 A;  4O0P A;  5AJG A;  3H7W B;  3LIF A;  3IBR A;  3NOP C;  3PBN A;  4YOF A;  3ZQ5 A;  4R38 A;  3C8C A;  5IU1 A;  3OC2 A;  4G3K A;  1F98 A;  4GCZ A;  3BQ8 A;  4GS9 B;  4MN5 A;  1P9R A;  2ZMV A;  3UMD A;  2J3T C;  2MJ6 A;  4F3L B;  3C38 A;  4L9G A;  1OTI A;  2P08 A;  2EWW A;  1OPX A;  3LFV A;  5FL3 A;  2YKH A;  2GZA A;  4I3A A;  3UB9 A;  4PHT A;  3A0S A;  1P97 A;  5DFY A;  4JGQ A;  5F69 A;  1VHM A;  4BJP A;  3UB7 A;  3PBS A;  4CLC D;  5HPI A;  2W27 A;  3P01 A;  2QJ7 A;  4HHD A;  3F1O B;  1UWP X;  1W63 M;  3MF0 A;  4ARZ B;  3F1P A;  2VGL M;  4PKY G;  3V67 A;  4GW9 A;  3EQV A;  1DP6 A;  3DBA A;  3S7Q A;  1OTA A;  2L1M A;  4YNR A;  2WKQ A;  3LUQ A;  3JVV A;  1OTD A;  1XJ2 A;  4HH3 A;  3BW6 A;  4G3V A;  4UQI M;  2V0W A;  3KSI A;  4P6Z S;  3MR0 A;  3KSG A;  3LR4 A;  1BYW A;  1LSX A;  4WEK A;  2PR5 A;  4BMW A;  3T50 A;  3NJA A;  3KSH A;  4EES A;  4GS9 A;  1TF1 A;  2W3E A;  1TS0 A;  4P6Z M;  4II7 A;  1XFQ A;  2PT7 A;  1IFQ A;  5HD3 A;  4NXB A;  1P9W A;  2PR6 A;  2PYP A;  4IUK A;  3T4K A;  1NWZ A;  4L9F A;  2V9A A;  4Z1W A;  1S66 L;  3F1O A;  1OT9 A;  4BBU A;  2LB5 A;  4LRZ E;  2I9V A;  4Q0J A;  2XRN A;  3S7P A;  2ZOH A;  3ZYT A;  2KX6 A;  4PAU A;  5L8M A;  4HH2 A;  4L9E A;  3W2Z A;  2GJ3 A;  4HJ4 A;  3MQQ A;  2O0Y A;  3PBO A;  4CLC E;  3UB8 A;  3PBQ A;  1D06 A;  2Y8H A;  4JGR A;  1STZ A;  4O01 A;  4JGP A;  4ME4 A;  4K08 A;  3CUE A;  4WN5 A;  1H3Q A;  2QKP A;  2WKP A;  2W1R A;  2W0N A;  2LB9 A;  3NHQ A;  4Y3I A;  1G6O A;  4GHI A;  1IOU A;  3VE3 A;  4ETX A;  5MC7 A;  3EGD C;  3EEH A;  4ZRR A;  1XFN A;  5G4Y A;  1WA9 A;  4ETZ A;  3BY8 A;  3EOI A;  3KYZ A;  2VV6 A;  4WF0 A;  3H7W A;  2VEA A;  4KQO A;  1YSP A;  5HL6 A;  2M1C A;  1KOU A;  2V0U A;  4B93 A;  1V9Z A;  1N9N A;  4EEP A;  4F3L A;  3B47 A;  2PD8 A;  5F68 A;  2CMN A;  3RTY A;  5HZH A;  2OOL A;  2K31 A;  3OBF A;  2ZOI A;  4H6J A;  1DRM A;  2G7U A;  4HI4 A;  4LPZ A;  1LSV A;  5K5B A;  2FZ0 A;  2GNX A;  4HQA A;  1LSW A;  5HWT A;  2ZBB A;  1OJ5 A;  3LI9 A;  4WL9 A;  2V1A A;  2VLG A;  3LR0 A;  3CAX A;  5HSQ A;  3EEA A;  4BBT A;  1OTE A;  4GJ4 A;  1NLY A;  1N9L A;  4HJ3 A;  1YAX A;  2VV8 A;  3D3O A;  5A8B A;  3LR5 A;  5DKK A;  4QPR A;  1S1Y A;  2BAS A;  2HF6 A;  3CWF A;  3S7N A;  1D7E A;  3BQA A;  1S1Z A;  1W63 Q;  3E4P A;  3LID A;  4EER A;  4FSF A;  2VZW A;  2ZMF A;  3A0V A;  4LRX C;  2D02 A;  1GSW A;  3SW1 A;  3R4K A;  4EEU A;  4HY8 A;  3PYP A;  3MFX A;  3LR3 A;  4HNB A;  2XSS A;  4XT2 A;  1S4R A;  4I5S A;  2VKS A;  5F5Y A;  4Y5F A;  2NUP C;  1T19 A;  2QYB A;  2JKT M;  3UE6 A;  2L4R A;  2DMW A;  3H82 B;  4I3J A;  3LIA A;  1JNU A;  4MDZ A;  5AVF A;  1V9Y A;  4MN7 A;  2O9B A;  5KIZ A;  3K3D A;  2M7U A;  5TBM B;  3T4L A;  2KLI A;  3B33 A;  5DJT A;  4EUV A;  1XJ3 A;  3KYQ A;  2JN7 A;  5G4Z A;  3C30 A;  3VV4 A;  2NUT C;  3NOU C;  3CIT A;  2QJ5 A;  5CX7 A;  2INW A;  1TS8 A;  2J3T D;  2PD7 A;  3FG8 A;  3CI6 A;  1T18 A;  2B18 A;  2W1T A;  2JKT I;  5DKL A;  5TJJ A;  5HDD A;  3MXQ A;  2W3G A;  2O99 A;  2QHK A;  2JKR M;  4EET B;  3BWL A;  1XJ6 A;  3UME A;  5HDS A;  2K2N A;  4DJ2 A;  3FPW A;  4KUO A;  4DMZ A;  2WKR A;  4HOI A;  4UEY A;  2JKR I;  1F5M A;  3IS2 B;  3EQU A;  3MJQ A;  3H9W A;  5AVE A;  4CLC B;  1TS6 A;  2YKF A;  3F1P B;  2Z6C A;  1H8M A;  5J3W A;  3H82 A;  3VE4 A;  4HP9 A;  2Z6D A;  3BJN A;  2HGV A;  3HCY A;  4NEE D;  2D01 A;  2P04 A;  4EW7 A;  1LL8 A;  3K2N A;  2R78 A;  2P7J A;  4CLC A;  1X0O A;  2L0W A;  1NRJ A;  4UQI S;  2OWH A;  3PHY A;  1OT6 A;  3PBT A;  3RH8 B;  3RFB A;  3LIB A;  2W3F A;  3F1N B;  1TD5 A;  2VGL S;  3UB6 A;  4CQH A;  4DJ3 A;  3FPV A;  5J4E A;  4NXE A;  5LBR A;  2EA9 A;  2M7V A;  4Q0I A;  5I5L A;  2B02 A;  4R3A A;  1ZTU A;  5IS1 A;  1VB6 A;  2W1T B;  3KSF A;  4WEJ A;  4O8G A;  3MQO A;  2VJW A;  2VX8 A;  1XJ4 A;  4MMN A;  4DN0 A;  4BBV A;  1S4S A;  3U2A A;  4LRY C;  3HJK A;  3TRC A;  3R7W A;  2A2L A;  1ZHH B;  3TW8 A;  3JVU A;  1T1A A;  5HPF A;  2O9A A;  3GEC A;  4NXG A;  3K3C A;  3IS2 A;  1YSQ A;  2K7S A;  2OAP 1;  2W3H A;  3FC7 A;  2VV7 A;  4HP4 A;  1S67 L;  1T1B A;  1Y28 A;  1GSV A;  3D72 A;  4WLA A;  3LIE A;  4CLC C;  2Y79 A;  4MN6 A;  4YWZ A;  3F1N A;  4MCW A;  3PXP A;  3B42 A;  5IT5 A;  4I39 A;  4I3I A;  1DP8 A;  3OCN A;  4EU0 A;  2OAQ 1;  4B9O A;  3E0Y A;  3E4Q A;  4WUJ A;  4NXF A;  4L0L A;  1YKD A;  4GHI B;  3T4Q A;  4R6L A;  1GSX A;  5TBM A;  1UWN X;  4OOL A;  1MC0 A;  2EWV A;  4Y2F A;  2HJ9 C;  3OLO A;  2W3D A;  2QWS A;  3E4O A;  3T4J A;  4IUH A;  3CLO A;  3BY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...