2H28A

Crystal structure of yeeu from e. coli. northeast structural genomics target er304
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
DRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSGELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yeeU
publication title Crystal Structures of Phd-Doc, HigA, and YeeU Establish Multiple Evolutionary Links between Microbial Growth-Regulating Toxin-Antitoxin Systems.
pubmed doi rcsb
source organism Escherichia coli
total genus 23
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06154 CbeA_antitoxin CbeA_antitoxin, type IV, cytoskeleton bundling-enhancing factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2h28A01
3H82B 3VE3A 5HZHA 4R38A 2A24B 4LPZA 3IBRA 3B33A 4GHIA 3CAXA 4H6JB 5TBMA 2GJ3A 3A0VA 2PDRA 1N9LA 4WF0A 2V0UA 4GS9A 1XJ6A 2D02A 5DKLA 1LT0A 5G4YA 3G6OA 1ODVA 1T19A 4GHIB 2PD8A 4HP9A 2OOLA 4JGRA 4GS9B 1GSXA 2QJ7A 1KOUA 1BYWA 1DP9A 3VE4A 3UB6A 2L4RA 2QHKA 5EFWA 5G4ZA 4HJ6A 2WKPA 2PR5A 3NOUC 1Y28A 4EW7A 2M1CA 1XFQA 5HWVA 1F9IA 4R70A 2B02A 3H7WB 1OTIA 4JGPA 2PHYA 5IU1A 4NXEA 3LIAA 3EWKA 2YKFA 2V1AA 3C8CA 3UE6A 1S67L 2VV8A 3VOLA 3HJKA 3LIBA 4BBVA 5J7EA 2QWSA 1WA9A 2L0WA 2K7SA 3PHYA 4K08A 1UWNX 5HDSA 5HWWA 5J4EA 2H28A 3IS2A 4MN6A 1LL8A 3K3CA 4LRZE 2V0WA 3UB7A 1P97A 2VEAA 5HDCA 4DJ2A 1OTEA 4F3LB 4LRXC 3D72A 4MN5A 4I38A 1S4RA 2D01A 2W0NA 3IS2B 4EQ1A 1S1YA 5F6AA 1UGUA 1X0OA 4I3IA 3PYPA 4KUKA 2OWJA 3F1NB 1F98A 3UMEA 3CWFA 1T1AA 1N9NA 3NHQA 3MFXA 2ZOHA 3A0SA 1D7EA 2PD7A 5TBMB 4WUJA 4LRYC 3UB9A 2R78A 3MXQA 2KX6A 4L9FA 1MZUA 3SW1A 3NOPC 4HOIA 1GSWA 2KDKA 1T18A 1EW0A 3MR0A 4HY8A 3NOTC 1V9YA 2QJ5A 4L9EA 1P0ZA 3UMDA 3LICA 1D06A 2L1MA 3F1OA 2OWHA 1N9OA 2WKQA 4EXOA 1XFNA 4KUOA 4NXFA 4WL9A 4XT2A 4HNBA 1T1CA 3MQQA 4HH2A 4HQAA 4BBTA 2JN7A 1LSVA 3MQOA 3LI9A 3F1OB 1OT9A 4HI4A 3UB8A 3LIFA 1GSVA 4EERA 3HJIA 5HDDA 5DKKA 4HJ4A 4EETB 5I5LA 2V1BA 5AVFA 1LSXA 1TS6A 3GDIA 4BBUA 1XJ3A 3LUQA 2W27A 4DJ3A 1XJ4A 3K3DA 3E4PA 2VV6A 1V9ZA 3P7NA 1JNUA 4I5SA 1DP6A 4H6JA 1DRMA 3MJQA 4I39A 2PR6A 4GW9A 5HSQA 2ZBBA 2PYPA 2VLGA 3ZQ5A 1NWZA 4L9GA 5A8BA 2VV7A 1OT6A 3GECA 3LIEA 3NJAA 4I3AA 3OLOA 1VB6A 3A0RA 1UWPX 5F69A 3EEHA 1S1ZA 4M4XA 2JHEA 5AVEA 2Z6CA 3BY8A 1OJGA 1TS7A 4RQ9A 5IS1A 5HD3A 4PKYA 1OTBA 3ICYA 3KX0X 1LSWA 3H7WA 4EESA 3E4OA 2INWA 2ZOIA 4GCZA 4B9OA 5HWTA 2HV1A 3FG8A 4NXBA 1OTAA 4HJ3A 3LI8A 3H9WA 3CLOA 3FC7A 2Z6DA 2EA9A 5DJUA 1TS0A 4JGQA 1S4SA 3C2WA 3E4QA 5F68A 4NXGA 3F1PA 4XT2B 5F5YA 1OTDA 2P7JA 1S66L 4JGOA 4KQDA 2V9AA 4WN5A 4F3LA 5J3WA 2I9VA 2QKPA 4HP4A 3LYXA 4R6LA 4R3AA 2YKHA 1G28A 3RTYA 1DP8A 2J80A 4E04A 5DJTA 3T50A 4WLAA 3ULFA 3H82A 3F1PB 5KIZA 4EEPA 2A24A 4LLOB 3LIDA 2WKRA 5HD5A 4I3JA 1T1BA 4HHDA 3RH8B 4HH3A 4PKYG 3BWLA 3F1NA 4EEUA 1XJ2A 2PYRA 3BY9A 2BASA 2CMNA 1OJ5A 4YWZA 4HIAA 1TS8A
chains in the Genus database with same CATH superfamily
3C5AA 1MBLA 4IHQA 5AQAA 2ZMFA 3T4TA 3IBRA 4GHIA 4PHTA 4D60A 2GJ3A 2JBFA 1ERMA 3VP1A 4CLCC 1FR1A 5DF9A 2XK1A 5KSCA 1QMEA 1OPXA 2G2UA 3S1YA 1XJ6A 3OPRA 3KYQA 3B3XA 4WELA 1LL5A 2J9OA 4S2KA 3KSHA 1ODVA 3AGDA 1ZTUA 3BW6A 2WAEA 2HJEA 5L8MA 2W1TB 1KOUA 3ZG5A 3PBOA 5BOHA 4X1LA 3IT9A 5A93A 5EFWA 2P74A 2ZC6B 4EUZA 5G4ZA 2WKPA 2PR5A 3B47A 1E4DA 1Y28A 1ES3A 3Q81A 2AVXA 3IX8A 3FKWA 3HUMA 1F9IA 1YM1A 3H7WB 3NECA 4KZBA 1Y54A 4HBUA 1W8QA 1G68A 4OVDA 1VEUA 2R9WA 2Y2LA 3DWZA 4JXWA 2V1AA 2Y2NA 2VV8A 2W3GA 3BFGA 1PI5A 3C4OA 4WEJA 5FAPA 1FCMA 2XD1A 2XD5A 4BWIA 4BLMA 2QWSA 3S22A 4BJPA 1W5DA 1WA9A 1BUEA 3M6HA 2OAP1 4WM9A 3G2ZA 4MNRA 3MZFA 5HARA 2VKSA 3UPPA 3JVVA 5F83A 1G6AA 3CUEA 3K3CA 5A92A 1GHPA 3BRMA 1WYCA 2V0WA 1P97A 2XSSA 3HLGA 1OTEA 4F3LB 3D72A 3GQZA 4P87A 1S4RA 2D01A 3IF6A 3ZG7B 1WE4A 2ZC7A 3MZEA 1X0OA 1ESUA 2JCHA 4KENB 3LEZA 2OWJA 4FTXA 4ID4A 5L07A 4U0XA 4UA9A 5EM1A 4YINA 2ZOHA 4WZ4A 3UN7A 1PNEA 2OLVA 3B42A 5EE8A 4B4XA 2Y2MA 3IXHA 4QPRA 4L9FA 3GTCA 3LR4A 1JWPA 1PWGA 3LO7A 3ZHHA 1ZKJA 2VZWA 4GNUA 5CERA 4GN2A 5KSHA 4PM9A 5FAQA 1PWCA 2VGLM 3TE8A 4OOMA 1IKIA 3NOTC 3C7UA 2O0YA 3S4XA 4ARZB 1P0ZA 5A90A 2CC1A 1K0KA 1TVFA 1N9OA 3T12B 5M19A 5FQKA 4E3IA 4Y17A 1FR6A 3MQQA 4FCFA 1N4OA 3ZCZA 4B4ZA 4HQAA 3TG9A 4BBTA 3ZG9B 1FOFA 4S2LA 1K54C 3R7WA 4Y0OA 3SH9A 1MWTA 3LI9A 3E2KA 3UB8A 3LIFA 4R23A 4EERA 2DMWA 3WS5A 1K6SA 4Z9QA 1TDLA 1JTGA 1DJAA 1KVMA 4N1XA 1F2KA 4X56A 1PIOA 4NETA 2X71A 4JLFA 1VETB 1LSXA 3GDIA 4BBUA 5TR7A 3OPHA 1NY0A 4DJ3A 2LB9A 3IH8A 5DF8A 3G32A 1JWVA 2XDMA 3BFFA 2WGWB 2WKEA 2PBYA 3MXRA 2VV6A 1V9ZA 1LLBA 4OQGA 1SDNA 4Y0TA 3T1QB 4OQHA 3HLBA 1G5UA 3IXBA 1Z09A 3MBZA 2HF6A 3DTEA 4O7DA 3IWIA 4WEKA 2ZBBA 1PI4A 1C3BA 3ZQ5A 4WZ5A 1H5XA 3LCEA 2VV7A 1L0GA 1OT6A 1EWZA 4Z1WA 3QP2A 4R3BA 3T4OA 5KMWA 4R1GA 2H5SA 1Y4OA 3EEHA 5FQQA 4DE0A 4X53A 4E3NA 2ZM8A 1GHIA 4OKPA 2Z2MB 3CITA 3WWXA 3W8KA 1OJGA 2XGNA 5HD3A 4DE3A 1A0KA 5CHJA 3ICYA 3CI6A 5JYPA 1IYPA 3BQAA 3CPTA 2XA7M 1K56D 4UQIM 4JXGA 2HV1A 2HDSA 1KDWA 1NJ4A 1FQGA 3UPNA 4NXBA 1YAXA 4KZ6A 5AQ9A 1RGYA 1W79A 3RXWA 4O0PA 3L7HA 3K2NA 4P6ZS 5DJUA 4ZTKA 3Q7VA 1ESIA 1J9MA 2PT7A 5DVAA 2WADA 5FQ9A 5F68A 4GD8A 1VQQA 3DTKA 4LCLA 4E6XA 5F5YA 4PM6A 3S7NA 5F1FA 3V39A 1K56A 4OPRA 2P08A 4HP4A 4R3AA 2YKHA 2ZL1B 4L0LA 1YT4A 4XUXA 1IYSA 3NIAA 5DJTA 2OLUA 1ONHA 3ULFA 3DW0A 3UY6A 2B5RA 2XFTA 4GLQA 3F1PB 4DDYA 2ZQ7A 4Q0IA 4LFUA 3O86A 3PAEA 1T1BA 3KSFA 4HH3A 2PYRA 2BASA 2O99A 4JKTA 3HLDA 4WMCD 1TS8A 3G35A 3H82B 1ZG4A 4R38A 2A24B 1K57A 4KZAA 3N4IA 4OPYA 3T1XA 3V3RA 4KQOA 5A91A 1SCWA 3A0VA 1N9LA 2V0UA 2ZQDA 5HFOA 4GS9A 2WGIA 2EX9A 2VK3A 3DTMA 1I2WA 3UDIA 1Q2QA 1TF1A 3G30A 3ZVTA 4QWOA 5AQBA 4HP9A 4GHIB 4GD6A 2X01A 2OOLA 4WMCA 3MKEA 5EVIC 2XLNA 4MEZA 4RX3A 1IYQA 3IWQA 1GSXA 2J3TD 2E8IA 4EQIA 3FPVA 2L4RA 1RCJA 3BQ8A 2FH5A 3TRCA 5CGSA 4EW7A 1G6OA 2EX2A 4FD8A 2OAQ1 4DXBA 2W3DA 3JPUA 1W8YA 5EM0A 1YMSA 3WRZA 3QHYA 3OBFA 4MMNA 2Y2IA 1YLPA 1SDEA 4EUVA 1XGIA 3LIAA 3EWKA 4DF6A 3C8CA 5DFXA 1JTDA 3HJKA 4FH2A 4JXVA 4QY5A 3U4LP 5HW3A 3MFDA 4Y3IA 5CHMA 4EBNA 4P6BA 1GCEA 2K7SA 3N7WA 1VEUB 3PHYA 2P9VB 4GOGA 5HWWA 2H28A 4X1MA 4KZ9A 3PBNA 4MN6A 4IBRA 4JF5A 4EWFA 4LRZE 3T4KA 2Y2HA 5HAIA 2HDRA 5HDCA 4DJ2A 4M3KA 4U0TA 4N9KA 2K2NA 3QNCA 3SS3A 5FL3A 3O5YA 3CG5A 4C75A 4EQ1A 3T4JA 1S1YA 5F6AA 4Y15A 4I3IA 2Q0OA 1YLJA 3PYPA 4KG5A 2Y2PA 2A3UA 4KUKA 1JWZA 3OPLA 1S0WA 1ONGA 4PMAA 3IF6B 5HL6A 4KZ7A 4X55A 3UMEA 5CGWA 1XX2A 2PU2A 3PTEA 3A0SA 4YNRA 1K4FA 3EEAA 2H0YA 2PD7A 3WS2A 5TBMB 3HREA 2MJ6A 4LRYC 3VP4A 3W4QA 4JXSA 2R78A 3UB9A 2ZM0A 3DAVA 2QMIA 3BFDA 3UO9A 5E2HA 3MZDA 3NDGA 4IUHA 3HUNA 2GDNA 3SW1A 4OPZA 4FUWA 4X25A 2WGVA 4HOIA 3ZGAB 1S6RA 4II7A 4CLCE 2KDKA 1T18A 3R4KA 4ZAMA 2HDQA 2EX6A 4ZDXA 5CHUA 1I5QA 1D06A 4JBFA 2L1MA 3F1OA 3GRJA 2OWHA 2WKQA 4FSFA 1XFNA 4NXFA 4MDZA 4R3JA 4HH2A 3MKFA 3QP8A 2JE5A 5K5BA 2JN7A 3MQOA 4BL2A 2LB5A 4QJGA 3A3DA 4KQQA 4OLGA 5FI7A 4R4RA 1TDGA 5HDDA 1BLSA 3EGDC 3T4SA 3IBJA 4QY6A 2HDUA 5E2GA 2IWBA 1TS6A 1XKZA 1TD5A 4KQRA 1XA7A 5J8XA 2PU4A 4ZBEA 1BSGA 3K3DA 3T4LA 4QD4A 3LR3A 5EV0A 2NUTC 3P01A 1NYMA 3CUEC 3C4PA 3FKVA 3A3JA 4EU0A 5HSQA 1NWZA 4L9GA 4LENA 5A8BA 2Y55A 4IBXA 4OP8A 4I3AA 1XPBA 3FZCA 1VB6A 4EV4A 1UWPX 4IJGA 5F69A 4OONA 5EVEA 1IYOA 1H8ZA 4M4XA 5AVEA 5CGXA 3KO6A 3UE1A 2V20A 2VA0A 1O7EA 2Z6CA 1AXBA 3HLFA 1KGFA 5F1GA 1L0FA 3BY8A 4ME4A 5IS1A 3D4FA 2WZZA 1E3UD 1OTBA 4LV2A 1LSWA 2GNXA 3H7WA 3OCNA 4EESA 2ZQAA 3ZVWA 4Y2FA 2INWA 4GJ4A 4GCZA 3M6BA 3BFEA 3DBAA 4KZ8A 1K54A 4OPQA 3RJUA 4E3MA 3KSIA 2XEPA 2W1RA 2C6WB 3CPTB 3MS6A 5GLBA 2EA9A 4E3LA 1NLYA 5CX7A 1TS0A 1ZC2A 4MCWA 3VP3A 1E3UA 3HVFA 1L0DA 1S4SA 3C2WA 3E4QA 4OOYA 4PPRA 3LEQA 4NXGA 4E6WA 1VM1A 3PBSA 4ETXA 4XT2B 1BLCA 3VP0A 4JGOA 2V9AA 4WN5A 1KE4A 1SKOB 1K6RA 1FILA 4F3LA 2I9VA 2O9CA 1BTLA 4UAAA 4NK3A 3LYXA 1ES4A 3LR0A 3FYZA 3Q7VB 2JC7A 1D1JA 3T50A 4WLAA 2VJWA 3E98A 5JYOA 4OP5A 1YKDA 3VFHA 1XXMA 1NXYA 3RH8B 2QZ6A 1BULA 3Q1FA 3VE3A 1DJBA 2PBDP 1SHVA 1SZVA 3GSGA 4Q0JA 3D3OA 4H6JB 3WS1A 1PWDA 4WF0A 1PZOA 2P04A 1MPLA 5DKLA 5FDHA 5G4YA 3BEBA 3UB5P 3G6OA 1HLUP 2VX8A 4XUZA 2J8YA 5TJJA 3OZHA 3CMZA 3SZTA 4G3KA 4GS9B 5DTSA 1CJFA 4HESA 1PYYA 2XH9A 1DP9A 5C5KA 1YLTA 3UB6A 1XGJA 2QHKA 2C5WB 4P85A 1PZPA 4NG2A 2M1CA 1XFQA 5HPIA 5HWVA 4R70A 2R9XA 2B02A 5M1AA 3IF5A 1YSQA 1OTIA 1MC0A 4PAUA 3ISGA 4UHUA 4JGPA 3V3SA 2PHYA 3C7VA 5IU1A 2J3WA 4NXEA 2YKFA 1NLZA 5DFYA 3UE6A 2M7UA 1VHMA 5GLCA 3LIBA 2RCXA 2Q9NA 3O87A 3V5MA 2ZQCA 4O01A 4GKUA 2L0WA 2HZ5A 1TEMA 4K08A 2FFFB 5HDSA 5F82A 2IA2A 4AFIA 5J4EA 2XRNA 3IS2A 4ZRRA 3FV7A 4GDBA 3IH9A 2WGWA 3S7OA 1LI0A 4LCMA 2Y8HA 3OCLA 5EVID 2VEAA 3UB7A 1EROA 3JYIA 3LGOA 4LRXC 1QMFA 4I38A 5EOOA 5FAOA 5TGFA 2ZC5B 3MXSA 2Y79A 3VSLA 2G2WA 5CEBA 5E2EA 4KZ5A 5MC7A 4OH0A 3F1NB 3UDFA 2UV0E 1F98A 3CWFA 5EVIA 5IT5A 1N9NA 4BENA 5CEDA 4Y13A 3MFXA 4S2NC 4S2PA 2V8CA 4LV1A 2FZ0A 3OC2A 4E3JA 1LHYA 1K55C 4DXCA 2VGLS 4BMWA 1K57C 4QB8A 3TOIA 2KX6A 1ERQA 3KYZA 2GZAA 4U3TA 5GLDA 3DTIA 2BTFP 2X02A 3T4QA 1GSWA 1NZUA 5FA7A 3VOYA 5L09A 3ZFZA 1L2SA 4EBPA 4EBLA 3A3FA 2WK0A 2BG1A 3CHWP 1EW0A 3BECA 3MR0A 2Y2QA 2XROA 4S2JA 1L3LA 3UNWA 3N6IA 4F94A 2QJ5A 2EFUA 4ZJ3A 4CPKA 3TJZC 3UMDA 4R4SA 3DWKA 4G3WA 3IHBA 3QP6A 3S7QA 2K31A 5HX9A 2ZJ9A 4OLDA 3P98A 4NEED 2O9AA 4CLCD 2A2LA 4HNBA 3W4OA 4N1HA 4DRTA 4FH4A 1JVJA 2H10A 4ESPA 5EPHA 1KGEA 5I94A 4KZ4A 5FEGA 4RA7A 2B18A 1YMXA 3F1OB 4HI4A 4C6YA 3QNBA 3BYDA 1GSVA 4GDNA 3BM6A 3HJIA 1GHMA 3AGFA 2ZC4B 3IX3A 5DKKA 4HJ4A 2V8FA 2E8JA 3OOVA 4P0MA 4EETB 2JKTM 3HLEA 5I5LA 2V1BA 2J3TC 4Y5FA 5AVFA 4LV0A 2JKRM 1H3QA 1XJ3A 3ZNTA 1W63Q 3LUQA 5L10A 2W27A 4CLCA 4ETZA 3BFCA 2Y4AA 3E4PA 5EOEA 1JNUA 2BLSA 1PW8A 1DP6A 3JVUA 4RX2A 1FSWA 3M2KA 1H0MA 4QU3A 4LGWA 3PBTA 2ZC3B 1DRMA 1HZOA 3MJQA 4I39A 3VP2A 1YSPA 3E2LA 3A3EA 5CTMA 1PFLA 2VGKA 2VLGA 2DRWA 3ZNYA 4DE2A 3C30A 1MWSA 3GECA 3NJAA 3V50A 3LFVA 3V67A 3A0RA 2V1ZA 2EFXA 1KE3A 2DCFA 1S1ZA 5EVLA 3NBLA 2JHEA 4DE1A 2EX8A 2XA7S 4UQIS 2JKFA 1CEFA 4GB7A 4G3VA 4GZBA 5HPFA 4Q0HA 4PKYA 2ZD8A 4IEDA 3ZDJA 2ZM2A 2NUPC 3E4OA 4Y7PA 1MXOA 4IVIA 3SOIA 2Y2GA 2ZOIA 4ZJ1A 4X6TA 2B95A 5FATA 4Q8IA 5DF7A 3FG8A 3ITAA 2XFSA 2ZQ9A 4HJ3A 2RL3A 5HAPA 4RYEA 1FCNA 2WUQA 1LL9A 2Z6DA 3NDEA 3IHAA 3MQ0A 5CTNA 4JGQA 2P9VA 1ALQA 2V2FF 3MF0A 4BD1A 5D3OA 1YPRA 2HJ9C 1RP5A 4E3KA 3RXXA 4KG6A 1OTDA 4K0XA 5GHYA 4DN0A 2QKPA 3MSHA 4YFMA 3SH7A 2UWXA 1HTZA 2GX5A 3UE0A 3R7WB 4MBKA 1G28A 2PAVP 4P6ZM 1P9WA 1K4EA 1CK3A 1MWUA 3ZYTA 2FFYA 3HCYA 1N9BA 5EUAA 5KIZA 4EEPA 4LLOB 3TW8A 1NRJA 5DTTA 1CI8A 1AWIA 2ZLYA 3LIDA 3T1SA 2WKIA 3C38A 4DKIA 1J3WA 1IOUA 3EGXC 3PBQA 4EEUA 1XJ2A 3BY9A 5LBRA 2XQZA 1OJ5A 4ZJ2A 2M7VA 4YWZA 1M40A 4HIAA 1HD8A 2G7UA 5HZHA 2ACGA 4LPZA 2HPBA 3B33A 3CAXA 5TBMA 3IF6C 2EWWA 5CXWA 3SS5A 3ZG8B 2PDRA 2XF3A 1BZAA 5CECA 5IHVA 2D02A 1BLPA 2W1TA 3BLMA 1LT0A 3E0YA 3MMHA 1T19A 2PD8A 1H8YA 4C3QA 2WAFA 4JGRA 1FCOA 2QJ7A 5GLAA 2WKHA 2HP6A 1BYWA 4WYYA 5FDSA 3VE4A 1CQAA 1E25A 4HJ6A 3HUOA 3UE3A 3NOUC 3IXGA 2HP9A 5EECA 1CI9A 3S7PA 3PXPA 5M18A 3O88A 3FWLA 5GHXA 1GA9A 4OQIA 2WYXA 1NZOA 2QYBA 3KYEA 1W7FA 1S67L 3VOLA 3NULA 3U2AA 4BBVA 5J7EA 2VGJA 3UDXA 2Y2OA 4JF6A 1NYYA 4N9LA 1HVBA 1ZHHB 1K25A 1K38A 3KSGA 1UWNX 4LV3A 1W63M 1PW1A 3EQVA 3HL9A 1LL8A 2XR0A 1YLWA 2J7VA 3G2YA 2Z2LB 1IEMA 3EOIA 4MN5A 4DMZA 2HP5A 1MY8A 4BD0A 2ZQ8A 3CJMA 1ZG6A 2W0NA 2Y91A 3IS2B 3PAGA 5DTKA 4PM5A 1UGUA 5TFQA 5AJGA 2PRFA 3M2JA 4R0QA 5FI6A 3IQAA 1YLZA 3P09A 1L0EA 2IWDA 3NCKA 4FOFA 4O8GA 3IWOA 3IXDA 4YOFA 3Q7ZA 3VOZA 1T1AA 1FSYA 3L9KA 1MWRA 3NHQA 3SH8A 1U60A 4JF4A 4S2OA 3D9YA 1D7EA 4A5RA 1GA0A 1DJCA 1NRFA 4NKPA 4S2IA 5GHZA 4WUJA 4MN7A 4MBFA 4WZ5C 5U47A 3GV9A 3SS4A 1F5MA 5EVIB 3MXQA 4OOLA 2Y2JA 4X69A 3GR2A 4ARZA 1MZUA 5KZHA 3BLSA 3HLCA 1XP4A 3VV4A 4KG2A 3NOPC 3CZDA 2A49A 4CJNA 1M6KA 1MKIA 3Q07A 1YQSA 3VFFA 4HY8A 1V9YA 4L9EA 5FEFA 3W2ZA 2OV5A 4QHCA 4JPMA 2J9PA 3LICA 2IWCA 4CQHA 1KGGA 3WS4A 2Y2KA 4EXOA 3N8RA 3GMWA 4KUOA 4PM8A 4WL9A 1KE0A 1XA1A 1RGZA 4XT2A 1T1CA 4N92A 2W3HA 4BQMA 1SKOA 2O9BA 1LSVA 1Z6FA 1VETA 2Q9MA 2W3EA 4B88A 3N8SA 3NI9A 1OT9A 3VSKA 4RVAA 5GL9A 3O3VA 5FASA 1FIKA 3QP4A 1ACFA 4MLLA 3ZG0A 3BJNA 1KDSA 1XJ4A 3FPWA 1MKMA 1YLYA 1KVLA 5FQMA 3W4PA 5CRFA 3P7NA 4XXRA 4I5SA 1IFQA 5E43A 1I2SA 4H6JA 4S2NA 4BL3A 3WS0A 1O07A 4CLCB 1K55A 2PR6A 4KZ3A 5E2FA 4GW9A 3PBRA 1IELA 2PYPA 2WZXA 2KOIA 4HBTA 4IVKA 1PRQA 4H8RA 3T1RA 1CF0A 5HL1A 3OPPA 3LIEA 3OLOA 2EWVA 3G4PA 2ZMVA 4K0WA 4D2OA 3NY4A 2I72A 4PM7A 3RFBA 5FQJA 1H8MA 1BLHA 1TS7A 4RQ9A 3VMAA 4B93A 4DDSA 4Y0UA 3KX0X 4UEYA 2W3FA 1STZA 3LR5A 1IKGA 2QPNA 2KLIA 3AGEA 3Q82A 4UA7A 4MBHA 4B9OA 3GVBA 5HWTA 5AQ7A 1ES2A 3LY3A 3EQUA 1EI5A 1OTAA 3G34A 1OMEA 3LI8A 3H9WA 2DNSA 3CLOA 2Y59A 3FC7A 5FQIA 3HBRA 2HGVA 1P9RA 3N8LA 4IUKA 4UA6A 4K91A 2ZL1A 5FSRA 3TSGA 1Q2PA 3I7JA 3G31A 2OSUA 2EXBA 1CEGA 4X68A 2H0TA 3F1PA 5FI2A 3HLWA 2JKGA 3A3IA 3IX4A 2JKTI 2P7JA 1S66L 4KQDA 3LY4A 5J3WA 2JKRI 1LI9A 4S2MA 5G18A 2ZMAA 4OQ0A 1SKFA 3PR6A 3NC8A 4R6LA 3UPOA 3RTYA 1DP8A 2J80A 4E04A 3QP1A 5L2FA 3H82A 2A24A 2EXAA 4HEFA 1WYBA 1DY6A 2WKRA 5HD5A 4I3JA 3WRTA 4HHDA 3ITBA 4PKYG 3BWLA 5HAQA 4E3OA 3F1NA 1ES5A 1BT5A 2CMNA 3QP5A 4WBGA
chains in the Genus database with same CATH topology
3H82B 2G7UA 3VE3A 5HZHA 4R38A 4IHQA 2A24B 4LPZA 2ZMFA 3T4TA 3IBRA 3B33A 4GHIA 4KQOA 4Q0JA 3D3OA 3CAXA 4PHTA 4H6JB 5TBMA 2GJ3A 3A0VA 4CLCC 2EWWA 2PDRA 5DF9A 1N9LA 4WF0A 2V0UA 4GS9A 1OPXA 1XJ6A 2D02A 2P04A 2W1TA 3KYQA 5DKLA 1LT0A 5G4YA 3E0YA 4WELA 1TF1A 3MMHA 3KSHA 3G6OA 1ODVA 1T19A 4GHIB 2PD8A 4HP9A 2VX8A 2OOLA 1ZTUA 5TJJA 3BW6A 4JGRA 4G3KA 4GS9B 1GSXA 2QJ7A 2HJEA 2J3TD 5L8MA 2W1TB 1KOUA 1BYWA 1DP9A 5C5KA 3FPVA 3PBOA 3VE4A 3UB6A 2L4RA 2QHKA 5EFWA 3BQ8A 2FH5A 5G4ZA 4HJ6A 2WKPA 2PR5A 3TRCA 3UE3A 3NOUC 3B47A 1Y28A 4EW7A 3S7PA 1G6OA 3PXPA 2M1CA 1XFQA 5HPIA 5HWVA 1F9IA 4R70A 2OAQ1 2W3DA 2B02A 3H7WB 1YSQA 1OTIA 1MC0A 4PAUA 3OBFA 4JGPA 4MMNA 2PHYA 5IU1A 2J3WA 4EUVA 4NXEA 3LIAA 3EWKA 2YKFA 2QYBA 1NLZA 2V1AA 5DFYA 3C8CA 3UE6A 1S67L 2VV8A 2W3GA 5DFXA 3VOLA 3HJKA 2M7UA 3U2AA 1VHMA 4WEJA 3LIBA 4BBVA 5J7EA 4BWIA 4O01A 4Y3IA 4BJPA 2QWSA 1WA9A 1ZHHB 2L0WA 2OAP1 2K7SA 3KSGA 4EESA 3PHYA 4K08A 1UWNX 5HDSA 5HWWA 2IA2A 4AFIA 5J4EA 1W63M 2H28A 2VKSA 2XRNA 3IS2A 4ZRRA 3PBNA 3JVVA 4MN6A 3EQVA 1LL8A 3CUEA 3S7OA 3K3CA 4LRZE 2Y8HA 3T4KA 2V0WA 3OCLA 1P97A 2VEAA 3UB7A 2XSSA 5HDCA 4DJ2A 1OTEA 4F3LB 3EOIA 4LRXC 3D72A 4MN5A 4DMZA 2K2NA 4I38A 1S4RA 2D01A 5FL3A 3O5YA 2W0NA 3IS2B 4EQ1A 3T4JA 1S1YA 5F6AA 1UGUA 5AJGA 1X0OA 4I3IA 3PYPA 2Y79A 4KUKA 5MC7A 2OWJA 3F1NB 4FOFA 4O8GA 1F98A 4YOFA 5HL6A 3UMEA 3CWFA 5IT5A 1T1AA 1N9NA 3NHQA 3MFXA 2ZOHA 3A0SA 4YNRA 2FZ0A 3EEAA 3OC2A 3B42A 1D7EA 2PD7A 5TBMB 2MJ6A 4NKPA 4WUJA 2VGLS 4MN7A 4LRYC 4BMWA 3UB9A 2R78A 1F5MA 4QPRA 3MXQA 2KX6A 4OOLA 4L9FA 3KYZA 2GZAA 3LR4A 4ARZA 1MZUA 4IUHA 3SW1A 3VV4A 2VZWA 3T4QA 3NOPC 4HOIA 1GSWA 4II7A 4CLCE 2KDKA 5KSHA 1T18A 2VGLM 1EW0A 3MR0A 3R4KA 4OOMA 3TE8A 2XROA 4HY8A 3NOTC 1V9YA 2O0YA 2QJ5A 4L9EA 4ARZB 1P0ZA 3W2ZA 3TJZC 3UMDA 3LICA 4G3WA 1D06A 2L1MA 3F1OA 4CQHA 2OWHA 3S7QA 1N9OA 2K31A 2WKQA 4EXOA 4FSFA 1XFNA 4KUOA 4NEED 2O9AA 4NXFA 4WL9A 4XT2A 4CLCD 2A2LA 4HNBA 4MDZA 1T1CA 3MQQA 4HH2A 2W3HA 5K5BA 4HQAA 4BBTA 2O9BA 2JN7A 1LSVA 3MQOA 2LB5A 3R7WA 2W3EA 2B18A 3LI9A 3F1OB 1OT9A 4HI4A 3UB8A 3LIFA 1GSVA 4EERA 3HJIA 2DMWA 5HDDA 3EGDC 5DKKA 4HJ4A 3OOVA 3T4SA 3IBJA 4EETB 2JKTM 5I5LA 2V1BA 2J3TC 4Y5FA 5AVFA 1LSXA 1TS6A 2JKRM 3GDIA 4BBUA 1H3QA 1TD5A 1XJ3A 1W63Q 3BJNA 3LUQA 2W27A 4CLCA 4DJ3A 1XJ4A 2LB9A 3FPWA 1MKMA 3K3DA 3T4LA 4ETZA 3E4PA 3LR3A 2VV6A 1V9ZA 3P7NA 1JNUA 4I5SA 1DP6A 3JVUA 1IFQA 2NUTC 4H6JA 3PBTA 3P01A 1DRMA 3MJQA 4I39A 3CUEC 2HF6A 4CLCB 2PR6A 1YSPA 4EU0A 4GW9A 4WEKA 2ZBBA 3PBRA 5HSQA 2PYPA 2VLGA 2KOIA 3ZQ5A 1NWZA 4L9GA 5A8BA 3C30A 2VV7A 1OT6A 3GECA 4Z1WA 3LIEA 3NJAA 3T4OA 4I3AA 3OLOA 3LFVA 3V67A 1VB6A 3A0RA 2EWVA 1UWPX 4IJGA 5F69A 3EEHA 1S1ZA 2ZMVA 4M4XA 2JHEA 5AVEA 3KO6A 2XA7S 2VA0A 4UQIS 2Z6CA 4G3VA 3CITA 5HPFA 3RFBA 1H8MA 3BY8A 1OJGA 1TS7A 4ME4A 4RQ9A 5IS1A 4Q0HA 5HD3A 4B93A 4PKYA 1OTBA 3ICYA 3KX0X 1LSWA 2GNXA 2W3FA 3CI6A 1STZA 3E4OA 3H7WA 3LR5A 3OCNA 4UEYA 2NUPC 3BQAA 4Y2FA 2KLIA 2INWA 2ZOIA 4GJ4A 2XA7M 4GCZA 4B9OA 4UQIM 5HWTA 2HV1A 3DBAA 3FG8A 3EQUA 4NXBA 1OTAA 4HJ3A 1YAXA 3LI8A 3H9WA 3KSIA 3CLOA 2W1RA 3FC7A 2Z6DA 2HGVA 4O0PA 1P9RA 2EA9A 3K2NA 4IUKA 3MQ0A 1NLYA 4P6ZS 5CX7A 1TS0A 4JGQA 4MCWA 5DJUA 2PT7A 1S4SA 3C2WA 3E4QA 5F68A 3MF0A 4NXGA 2HJ9C 3PBSA 3F1PA 4ETXA 4XT2B 5F5YA 1OTDA 3S7NA 2JKTI 2P7JA 1S66L 4JGOA 4KQDA 2V9AA 4WN5A 4F3LA 5J3WA 2JKRI 2I9VA 4DN0A 2O9CA 2P08A 2QKPA 4HP4A 2GX5A 3PR6A 3LYXA 3R7WB 3LR0A 4R6LA 4R3AA 2YKHA 1G28A 4L0LA 3RTYA 4P6ZM 1DP8A 2J80A 4E04A 1P9WA 5DJTA 3ZYTA 3HCYA 3T50A 4WLAA 3ULFA 2VJWA 3E98A 3H82A 4GLQA 3F1PB 5KIZA 4EEPA 2A24A 4LLOB 4Q0IA 3TW8A 1NRJA 3LIDA 1YKDA 2WKRA 5HD5A 4I3JA 1T1BA 4HHDA 3C38A 3RH8B 3KSFA 4HH3A 4PKYG 3BWLA 1IOUA 3EGXC 3F1NA 3PBQA 4EEUA 1XJ2A 2PYRA 3BY9A 2BASA 2CMNA 5LBRA 2O99A 1OJ5A 2M7VA 4YWZA 4HIAA 1TS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H82 B;  3VE3 A;  5HZH A;  4R38 A;  2A24 B;  4LPZ A;  3IBR A;  3B33 A;  4GHI A;  3CAX A;  4H6J B;  5TBM A;  2GJ3 A;  3A0V A;  2PDR A;  1N9L A;  4WF0 A;  2V0U A;  4GS9 A;  1XJ6 A;  2D02 A;  5DKL A;  1LT0 A;  5G4Y A;  3G6O A;  1ODV A;  1T19 A;  4GHI B;  2PD8 A;  4HP9 A;  2OOL A;  4JGR A;  4GS9 B;  1GSX A;  2QJ7 A;  1KOU A;  1BYW A;  1DP9 A;  3VE4 A;  3UB6 A;  2L4R A;  2QHK A;  5EFW A;  5G4Z A;  4HJ6 A;  2WKP A;  2PR5 A;  3NOU C;  1Y28 A;  4EW7 A;  2M1C A;  1XFQ A;  5HWV A;  1F9I A;  4R70 A;  2B02 A;  3H7W B;  1OTI A;  4JGP A;  2PHY A;  5IU1 A;  4NXE A;  3LIA A;  3EWK A;  2YKF A;  2V1A A;  3C8C A;  3UE6 A;  1S67 L;  2VV8 A;  3VOL A;  3HJK A;  3LIB A;  4BBV A;  5J7E A;  2QWS A;  1WA9 A;  2L0W A;  2K7S A;  3PHY A;  4K08 A;  1UWN X;  5HDS A;  5HWW A;  5J4E A;  2H28 A;  3IS2 A;  4MN6 A;  1LL8 A;  3K3C A;  4LRZ E;  2V0W A;  3UB7 A;  1P97 A;  2VEA A;  5HDC A;  4DJ2 A;  1OTE A;  4F3L B;  4LRX C;  3D72 A;  4MN5 A;  4I38 A;  1S4R A;  2D01 A;  2W0N A;  3IS2 B;  4EQ1 A;  1S1Y A;  5F6A A;  1UGU A;  1X0O A;  4I3I A;  3PYP A;  4KUK A;  2OWJ A;  3F1N B;  1F98 A;  3UME A;  3CWF A;  1T1A A;  1N9N A;  3NHQ A;  3MFX A;  2ZOH A;  3A0S A;  1D7E A;  2PD7 A;  5TBM B;  4WUJ A;  4LRY C;  3UB9 A;  2R78 A;  3MXQ A;  2KX6 A;  4L9F A;  1MZU A;  3SW1 A;  3NOP C;  4HOI A;  1GSW A;  2KDK A;  1T18 A;  1EW0 A;  3MR0 A;  4HY8 A;  3NOT C;  1V9Y A;  2QJ5 A;  4L9E A;  1P0Z A;  3UMD A;  3LIC A;  1D06 A;  2L1M A;  3F1O A;  2OWH A;  1N9O A;  2WKQ A;  4EXO A;  1XFN A;  4KUO A;  4NXF A;  4WL9 A;  4XT2 A;  4HNB A;  1T1C A;  3MQQ A;  4HH2 A;  4HQA A;  4BBT A;  2JN7 A;  1LSV A;  3MQO A;  3LI9 A;  3F1O B;  1OT9 A;  4HI4 A;  3UB8 A;  3LIF A;  1GSV A;  4EER A;  3HJI A;  5HDD A;  5DKK A;  4HJ4 A;  4EET B;  5I5L A;  2V1B A;  5AVF A;  1LSX A;  1TS6 A;  3GDI A;  4BBU A;  1XJ3 A;  3LUQ A;  2W27 A;  4DJ3 A;  1XJ4 A;  3K3D A;  3E4P A;  2VV6 A;  1V9Z A;  3P7N A;  1JNU A;  4I5S A;  1DP6 A;  4H6J A;  1DRM A;  3MJQ A;  4I39 A;  2PR6 A;  4GW9 A;  5HSQ A;  2ZBB A;  2PYP A;  2VLG A;  3ZQ5 A;  1NWZ A;  4L9G A;  5A8B A;  2VV7 A;  1OT6 A;  3GEC A;  3LIE A;  3NJA A;  4I3A A;  3OLO A;  1VB6 A;  3A0R A;  1UWP X;  5F69 A;  3EEH A;  1S1Z A;  4M4X A;  2JHE A;  5AVE A;  2Z6C A;  3BY8 A;  1OJG A;  1TS7 A;  4RQ9 A;  5IS1 A;  5HD3 A;  4PKY A;  1OTB A;  3ICY A;  3KX0 X;  1LSW A;  3H7W A;  4EES A;  3E4O A;  2INW A;  2ZOI A;  4GCZ A;  4B9O A;  5HWT A;  2HV1 A;  3FG8 A;  4NXB A;  1OTA A;  4HJ3 A;  3LI8 A;  3H9W A;  3CLO A;  3FC7 A;  2Z6D A;  2EA9 A;  5DJU A;  1TS0 A;  4JGQ A;  1S4S A;  3C2W A;  3E4Q A;  5F68 A;  4NXG A;  3F1P A;  4XT2 B;  5F5Y A;  1OTD A;  2P7J A;  1S66 L;  4JGO A;  4KQD A;  2V9A A;  4WN5 A;  4F3L A;  5J3W A;  2I9V A;  2QKP A;  4HP4 A;  3LYX A;  4R6L A;  4R3A A;  2YKH A;  1G28 A;  3RTY A;  1DP8 A;  2J80 A;  4E04 A;  5DJT A;  3T50 A;  4WLA A;  3ULF A;  3H82 A;  3F1P B;  5KIZ A;  4EEP A;  2A24 A;  4LLO B;  3LID A;  2WKR A;  5HD5 A;  4I3J A;  1T1B A;  4HHD A;  3RH8 B;  4HH3 A;  4PKY G;  3BWL A;  3F1N A;  4EEU A;  1XJ2 A;  2PYR A;  3BY9 A;  2BAS A;  2CMN A;  1OJ5 A;  4YWZ A;  4HIA A;  1TS8 A; 
#chains in the Genus database with same CATH topology
 3C5A A;  1MBL A;  4IHQ A;  5AQA A;  2ZMF A;  3T4T A;  3IBR A;  4GHI A;  4PHT A;  4D60 A;  2GJ3 A;  2JBF A;  1ERM A;  3VP1 A;  4CLC C;  1FR1 A;  5DF9 A;  2XK1 A;  5KSC A;  1QME A;  1OPX A;  2G2U A;  3S1Y A;  1XJ6 A;  3OPR A;  3KYQ A;  3B3X A;  4WEL A;  1LL5 A;  2J9O A;  4S2K A;  3KSH A;  1ODV A;  3AGD A;  1ZTU A;  3BW6 A;  2WAE A;  2HJE A;  5L8M A;  2W1T B;  1KOU A;  3ZG5 A;  3PBO A;  5BOH A;  4X1L A;  3IT9 A;  5A93 A;  5EFW A;  2P74 A;  2ZC6 B;  4EUZ A;  5G4Z A;  2WKP A;  2PR5 A;  3B47 A;  1E4D A;  1Y28 A;  1ES3 A;  3Q81 A;  2AVX A;  3IX8 A;  3FKW A;  3HUM A;  1F9I A;  1YM1 A;  3H7W B;  3NEC A;  4KZB A;  1Y54 A;  4HBU A;  1W8Q A;  1G68 A;  4OVD A;  1VEU A;  2R9W A;  2Y2L A;  3DWZ A;  4JXW A;  2V1A A;  2Y2N A;  2VV8 A;  2W3G A;  3BFG A;  1PI5 A;  3C4O A;  4WEJ A;  5FAP A;  1FCM A;  2XD1 A;  2XD5 A;  4BWI A;  4BLM A;  2QWS A;  3S22 A;  4BJP A;  1W5D A;  1WA9 A;  1BUE A;  3M6H A;  2OAP 1;  4WM9 A;  3G2Z A;  4MNR A;  3MZF A;  5HAR A;  2VKS A;  3UPP A;  3JVV A;  5F83 A;  1G6A A;  3CUE A;  3K3C A;  5A92 A;  1GHP A;  3BRM A;  1WYC A;  2V0W A;  1P97 A;  2XSS A;  3HLG A;  1OTE A;  4F3L B;  3D72 A;  3GQZ A;  4P87 A;  1S4R A;  2D01 A;  3IF6 A;  3ZG7 B;  1WE4 A;  2ZC7 A;  3MZE A;  1X0O A;  1ESU A;  2JCH A;  4KEN B;  3LEZ A;  2OWJ A;  4FTX A;  4ID4 A;  5L07 A;  4U0X A;  4UA9 A;  5EM1 A;  4YIN A;  2ZOH A;  4WZ4 A;  3UN7 A;  1PNE A;  2OLV A;  3B42 A;  5EE8 A;  4B4X A;  2Y2M A;  3IXH A;  4QPR A;  4L9F A;  3GTC A;  3LR4 A;  1JWP A;  1PWG A;  3LO7 A;  3ZHH A;  1ZKJ A;  2VZW A;  4GNU A;  5CER A;  4GN2 A;  5KSH A;  4PM9 A;  5FAQ A;  1PWC A;  2VGL M;  3TE8 A;  4OOM A;  1IKI A;  3NOT C;  3C7U A;  2O0Y A;  3S4X A;  4ARZ B;  1P0Z A;  5A90 A;  2CC1 A;  1K0K A;  1TVF A;  1N9O A;  3T12 B;  5M19 A;  5FQK A;  4E3I A;  4Y17 A;  1FR6 A;  3MQQ A;  4FCF A;  1N4O A;  3ZCZ A;  4B4Z A;  4HQA A;  3TG9 A;  4BBT A;  3ZG9 B;  1FOF A;  4S2L A;  1K54 C;  3R7W A;  4Y0O A;  3SH9 A;  1MWT A;  3LI9 A;  3E2K A;  3UB8 A;  3LIF A;  4R23 A;  4EER A;  2DMW A;  3WS5 A;  1K6S A;  4Z9Q A;  1TDL A;  1JTG A;  1DJA A;  1KVM A;  4N1X A;  1F2K A;  4X56 A;  1PIO A;  4NET A;  2X71 A;  4JLF A;  1VET B;  1LSX A;  3GDI A;  4BBU A;  5TR7 A;  3OPH A;  1NY0 A;  4DJ3 A;  2LB9 A;  3IH8 A;  5DF8 A;  3G32 A;  1JWV A;  2XDM A;  3BFF A;  2WGW B;  2WKE A;  2PBY A;  3MXR A;  2VV6 A;  1V9Z A;  1LLB A;  4OQG A;  1SDN A;  4Y0T A;  3T1Q B;  4OQH A;  3HLB A;  1G5U A;  3IXB A;  1Z09 A;  3MBZ A;  2HF6 A;  3DTE A;  4O7D A;  3IWI A;  4WEK A;  2ZBB A;  1PI4 A;  1C3B A;  3ZQ5 A;  4WZ5 A;  1H5X A;  3LCE A;  2VV7 A;  1L0G A;  1OT6 A;  1EWZ A;  4Z1W A;  3QP2 A;  4R3B A;  3T4O A;  5KMW A;  4R1G A;  2H5S A;  1Y4O A;  3EEH A;  5FQQ A;  4DE0 A;  4X53 A;  4E3N A;  2ZM8 A;  1GHI A;  4OKP A;  2Z2M B;  3CIT A;  3WWX A;  3W8K A;  1OJG A;  2XGN A;  5HD3 A;  4DE3 A;  1A0K A;  5CHJ A;  3ICY A;  3CI6 A;  5JYP A;  1IYP A;  3BQA A;  3CPT A;  2XA7 M;  1K56 D;  4UQI M;  4JXG A;  2HV1 A;  2HDS A;  1KDW A;  1NJ4 A;  1FQG A;  3UPN A;  4NXB A;  1YAX A;  4KZ6 A;  5AQ9 A;  1RGY A;  1W79 A;  3RXW A;  4O0P A;  3L7H A;  3K2N A;  4P6Z S;  5DJU A;  4ZTK A;  3Q7V A;  1ESI A;  1J9M A;  2PT7 A;  5DVA A;  2WAD A;  5FQ9 A;  5F68 A;  4GD8 A;  1VQQ A;  3DTK A;  4LCL A;  4E6X A;  5F5Y A;  4PM6 A;  3S7N A;  5F1F A;  3V39 A;  1K56 A;  4OPR A;  2P08 A;  4HP4 A;  4R3A A;  2YKH A;  2ZL1 B;  4L0L A;  1YT4 A;  4XUX A;  1IYS A;  3NIA A;  5DJT A;  2OLU A;  1ONH A;  3ULF A;  3DW0 A;  3UY6 A;  2B5R A;  2XFT A;  4GLQ A;  3F1P B;  4DDY A;  2ZQ7 A;  4Q0I A;  4LFU A;  3O86 A;  3PAE A;  1T1B A;  3KSF A;  4HH3 A;  2PYR A;  2BAS A;  2O99 A;  4JKT A;  3HLD A;  4WMC D;  1TS8 A;  3G35 A;  3H82 B;  1ZG4 A;  4R38 A;  2A24 B;  1K57 A;  4KZA A;  3N4I A;  4OPY A;  3T1X A;  3V3R A;  4KQO A;  5A91 A;  1SCW A;  3A0V A;  1N9L A;  2V0U A;  2ZQD A;  5HFO A;  4GS9 A;  2WGI A;  2EX9 A;  2VK3 A;  3DTM A;  1I2W A;  3UDI A;  1Q2Q A;  1TF1 A;  3G30 A;  3ZVT A;  4QWO A;  5AQB A;  4HP9 A;  4GHI B;  4GD6 A;  2X01 A;  2OOL A;  4WMC A;  3MKE A;  5EVI C;  2XLN A;  4MEZ A;  4RX3 A;  1IYQ A;  3IWQ A;  1GSX A;  2J3T D;  2E8I A;  4EQI A;  3FPV A;  2L4R A;  1RCJ A;  3BQ8 A;  2FH5 A;  3TRC A;  5CGS A;  4EW7 A;  1G6O A;  2EX2 A;  4FD8 A;  2OAQ 1;  4DXB A;  2W3D A;  3JPU A;  1W8Y A;  5EM0 A;  1YMS A;  3WRZ A;  3QHY A;  3OBF A;  4MMN A;  2Y2I A;  1YLP A;  1SDE A;  4EUV A;  1XGI A;  3LIA A;  3EWK A;  4DF6 A;  3C8C A;  5DFX A;  1JTD A;  3HJK A;  4FH2 A;  4JXV A;  4QY5 A;  3U4L P;  5HW3 A;  3MFD A;  4Y3I A;  5CHM A;  4EBN A;  4P6B A;  1GCE A;  2K7S A;  3N7W A;  1VEU B;  3PHY A;  2P9V B;  4GOG A;  5HWW A;  2H28 A;  4X1M A;  4KZ9 A;  3PBN A;  4MN6 A;  4IBR A;  4JF5 A;  4EWF A;  4LRZ E;  3T4K A;  2Y2H A;  5HAI A;  2HDR A;  5HDC A;  4DJ2 A;  4M3K A;  4U0T A;  4N9K A;  2K2N A;  3QNC A;  3SS3 A;  5FL3 A;  3O5Y A;  3CG5 A;  4C75 A;  4EQ1 A;  3T4J A;  1S1Y A;  5F6A A;  4Y15 A;  4I3I A;  2Q0O A;  1YLJ A;  3PYP A;  4KG5 A;  2Y2P A;  2A3U A;  4KUK A;  1JWZ A;  3OPL A;  1S0W A;  1ONG A;  4PMA A;  3IF6 B;  5HL6 A;  4KZ7 A;  4X55 A;  3UME A;  5CGW A;  1XX2 A;  2PU2 A;  3PTE A;  3A0S A;  4YNR A;  1K4F A;  3EEA A;  2H0Y A;  2PD7 A;  3WS2 A;  5TBM B;  3HRE A;  2MJ6 A;  4LRY C;  3VP4 A;  3W4Q A;  4JXS A;  2R78 A;  3UB9 A;  2ZM0 A;  3DAV A;  2QMI A;  3BFD A;  3UO9 A;  5E2H A;  3MZD A;  3NDG A;  4IUH A;  3HUN A;  2GDN A;  3SW1 A;  4OPZ A;  4FUW A;  4X25 A;  2WGV A;  4HOI A;  3ZGA B;  1S6R A;  4II7 A;  4CLC E;  2KDK A;  1T18 A;  3R4K A;  4ZAM A;  2HDQ A;  2EX6 A;  4ZDX A;  5CHU A;  1I5Q A;  1D06 A;  4JBF A;  2L1M A;  3F1O A;  3GRJ A;  2OWH A;  2WKQ A;  4FSF A;  1XFN A;  4NXF A;  4MDZ A;  4R3J A;  4HH2 A;  3MKF A;  3QP8 A;  2JE5 A;  5K5B A;  2JN7 A;  3MQO A;  4BL2 A;  2LB5 A;  4QJG A;  3A3D A;  4KQQ A;  4OLG A;  5FI7 A;  4R4R A;  1TDG A;  5HDD A;  1BLS A;  3EGD C;  3T4S A;  3IBJ A;  4QY6 A;  2HDU A;  5E2G A;  2IWB A;  1TS6 A;  1XKZ A;  1TD5 A;  4KQR A;  1XA7 A;  5J8X A;  2PU4 A;  4ZBE A;  1BSG A;  3K3D A;  3T4L A;  4QD4 A;  3LR3 A;  5EV0 A;  2NUT C;  3P01 A;  1NYM A;  3CUE C;  3C4P A;  3FKV A;  3A3J A;  4EU0 A;  5HSQ A;  1NWZ A;  4L9G A;  4LEN A;  5A8B A;  2Y55 A;  4IBX A;  4OP8 A;  4I3A A;  1XPB A;  3FZC A;  1VB6 A;  4EV4 A;  1UWP X;  4IJG A;  5F69 A;  4OON A;  5EVE A;  1IYO A;  1H8Z A;  4M4X A;  5AVE A;  5CGX A;  3KO6 A;  3UE1 A;  2V20 A;  2VA0 A;  1O7E A;  2Z6C A;  1AXB A;  3HLF A;  1KGF A;  5F1G A;  1L0F A;  3BY8 A;  4ME4 A;  5IS1 A;  3D4F A;  2WZZ A;  1E3U D;  1OTB A;  4LV2 A;  1LSW A;  2GNX A;  3H7W A;  3OCN A;  4EES A;  2ZQA A;  3ZVW A;  4Y2F A;  2INW A;  4GJ4 A;  4GCZ A;  3M6B A;  3BFE A;  3DBA A;  4KZ8 A;  1K54 A;  4OPQ A;  3RJU A;  4E3M A;  3KSI A;  2XEP A;  2W1R A;  2C6W B;  3CPT B;  3MS6 A;  5GLB A;  2EA9 A;  4E3L A;  1NLY A;  5CX7 A;  1TS0 A;  1ZC2 A;  4MCW A;  3VP3 A;  1E3U A;  3HVF A;  1L0D A;  1S4S A;  3C2W A;  3E4Q A;  4OOY A;  4PPR A;  3LEQ A;  4NXG A;  4E6W A;  1VM1 A;  3PBS A;  4ETX A;  4XT2 B;  1BLC A;  3VP0 A;  4JGO A;  2V9A A;  4WN5 A;  1KE4 A;  1SKO B;  1K6R A;  1FIL A;  4F3L A;  2I9V A;  2O9C A;  1BTL A;  4UAA A;  4NK3 A;  3LYX A;  1ES4 A;  3LR0 A;  3FYZ A;  3Q7V B;  2JC7 A;  1D1J A;  3T50 A;  4WLA A;  2VJW A;  3E98 A;  5JYO A;  4OP5 A;  1YKD A;  3VFH A;  1XXM A;  1NXY A;  3RH8 B;  2QZ6 A;  1BUL A;  3Q1F A;  3VE3 A;  1DJB A;  2PBD P;  1SHV A;  1SZV A;  3GSG A;  4Q0J A;  3D3O A;  4H6J B;  3WS1 A;  1PWD A;  4WF0 A;  1PZO A;  2P04 A;  1MPL A;  5DKL A;  5FDH A;  5G4Y A;  3BEB A;  3UB5 P;  3G6O A;  1HLU P;  2VX8 A;  4XUZ A;  2J8Y A;  5TJJ A;  3OZH A;  3CMZ A;  3SZT A;  4G3K A;  4GS9 B;  5DTS A;  1CJF A;  4HES A;  1PYY A;  2XH9 A;  1DP9 A;  5C5K A;  1YLT A;  3UB6 A;  1XGJ A;  2QHK A;  2C5W B;  4P85 A;  1PZP A;  4NG2 A;  2M1C A;  1XFQ A;  5HPI A;  5HWV A;  4R70 A;  2R9X A;  2B02 A;  5M1A A;  3IF5 A;  1YSQ A;  1OTI A;  1MC0 A;  4PAU A;  3ISG A;  4UHU A;  4JGP A;  3V3S A;  2PHY A;  3C7V A;  5IU1 A;  2J3W A;  4NXE A;  2YKF A;  1NLZ A;  5DFY A;  3UE6 A;  2M7U A;  1VHM A;  5GLC A;  3LIB A;  2RCX A;  2Q9N A;  3O87 A;  3V5M A;  2ZQC A;  4O01 A;  4GKU A;  2L0W A;  2HZ5 A;  1TEM A;  4K08 A;  2FFF B;  5HDS A;  5F82 A;  2IA2 A;  4AFI A;  5J4E A;  2XRN A;  3IS2 A;  4ZRR A;  3FV7 A;  4GDB A;  3IH9 A;  2WGW A;  3S7O A;  1LI0 A;  4LCM A;  2Y8H A;  3OCL A;  5EVI D;  2VEA A;  3UB7 A;  1ERO A;  3JYI A;  3LGO A;  4LRX C;  1QMF A;  4I38 A;  5EOO A;  5FAO A;  5TGF A;  2ZC5 B;  3MXS A;  2Y79 A;  3VSL A;  2G2W A;  5CEB A;  5E2E A;  4KZ5 A;  5MC7 A;  4OH0 A;  3F1N B;  3UDF A;  2UV0 E;  1F98 A;  3CWF A;  5EVI A;  5IT5 A;  1N9N A;  4BEN A;  5CED A;  4Y13 A;  3MFX A;  4S2N C;  4S2P A;  2V8C A;  4LV1 A;  2FZ0 A;  3OC2 A;  4E3J A;  1LHY A;  1K55 C;  4DXC A;  2VGL S;  4BMW A;  1K57 C;  4QB8 A;  3TOI A;  2KX6 A;  1ERQ A;  3KYZ A;  2GZA A;  4U3T A;  5GLD A;  3DTI A;  2BTF P;  2X02 A;  3T4Q A;  1GSW A;  1NZU A;  5FA7 A;  3VOY A;  5L09 A;  3ZFZ A;  1L2S A;  4EBP A;  4EBL A;  3A3F A;  2WK0 A;  2BG1 A;  3CHW P;  1EW0 A;  3BEC A;  3MR0 A;  2Y2Q A;  2XRO A;  4S2J A;  1L3L A;  3UNW A;  3N6I A;  4F94 A;  2QJ5 A;  2EFU A;  4ZJ3 A;  4CPK A;  3TJZ C;  3UMD A;  4R4S A;  3DWK A;  4G3W A;  3IHB A;  3QP6 A;  3S7Q A;  2K31 A;  5HX9 A;  2ZJ9 A;  4OLD A;  3P98 A;  4NEE D;  2O9A A;  4CLC D;  2A2L A;  4HNB A;  3W4O A;  4N1H A;  4DRT A;  4FH4 A;  1JVJ A;  2H10 A;  4ESP A;  5EPH A;  1KGE A;  5I94 A;  4KZ4 A;  5FEG A;  4RA7 A;  2B18 A;  1YMX A;  3F1O B;  4HI4 A;  4C6Y A;  3QNB A;  3BYD A;  1GSV A;  4GDN A;  3BM6 A;  3HJI A;  1GHM A;  3AGF A;  2ZC4 B;  3IX3 A;  5DKK A;  4HJ4 A;  2V8F A;  2E8J A;  3OOV A;  4P0M A;  4EET B;  2JKT M;  3HLE A;  5I5L A;  2V1B A;  2J3T C;  4Y5F A;  5AVF A;  4LV0 A;  2JKR M;  1H3Q A;  1XJ3 A;  3ZNT A;  1W63 Q;  3LUQ A;  5L10 A;  2W27 A;  4CLC A;  4ETZ A;  3BFC A;  2Y4A A;  3E4P A;  5EOE A;  1JNU A;  2BLS A;  1PW8 A;  1DP6 A;  3JVU A;  4RX2 A;  1FSW A;  3M2K A;  1H0M A;  4QU3 A;  4LGW A;  3PBT A;  2ZC3 B;  1DRM A;  1HZO A;  3MJQ A;  4I39 A;  3VP2 A;  1YSP A;  3E2L A;  3A3E A;  5CTM A;  1PFL A;  2VGK A;  2VLG A;  2DRW A;  3ZNY A;  4DE2 A;  3C30 A;  1MWS A;  3GEC A;  3NJA A;  3V50 A;  3LFV A;  3V67 A;  3A0R A;  2V1Z A;  2EFX A;  1KE3 A;  2DCF A;  1S1Z A;  5EVL A;  3NBL A;  2JHE A;  4DE1 A;  2EX8 A;  2XA7 S;  4UQI S;  2JKF A;  1CEF A;  4GB7 A;  4G3V A;  4GZB A;  5HPF A;  4Q0H A;  4PKY A;  2ZD8 A;  4IED A;  3ZDJ A;  2ZM2 A;  2NUP C;  3E4O A;  4Y7P A;  1MXO A;  4IVI A;  3SOI A;  2Y2G A;  2ZOI A;  4ZJ1 A;  4X6T A;  2B95 A;  5FAT A;  4Q8I A;  5DF7 A;  3FG8 A;  3ITA A;  2XFS A;  2ZQ9 A;  4HJ3 A;  2RL3 A;  5HAP A;  4RYE A;  1FCN A;  2WUQ A;  1LL9 A;  2Z6D A;  3NDE A;  3IHA A;  3MQ0 A;  5CTN A;  4JGQ A;  2P9V A;  1ALQ A;  2V2F F;  3MF0 A;  4BD1 A;  5D3O A;  1YPR A;  2HJ9 C;  1RP5 A;  4E3K A;  3RXX A;  4KG6 A;  1OTD A;  4K0X A;  5GHY A;  4DN0 A;  2QKP A;  3MSH A;  4YFM A;  3SH7 A;  2UWX A;  1HTZ A;  2GX5 A;  3UE0 A;  3R7W B;  4MBK A;  1G28 A;  2PAV P;  4P6Z M;  1P9W A;  1K4E A;  1CK3 A;  1MWU A;  3ZYT A;  2FFY A;  3HCY A;  1N9B A;  5EUA A;  5KIZ A;  4EEP A;  4LLO B;  3TW8 A;  1NRJ A;  5DTT A;  1CI8 A;  1AWI A;  2ZLY A;  3LID A;  3T1S A;  2WKI A;  3C38 A;  4DKI A;  1J3W A;  1IOU A;  3EGX C;  3PBQ A;  4EEU A;  1XJ2 A;  3BY9 A;  5LBR A;  2XQZ A;  1OJ5 A;  4ZJ2 A;  2M7V A;  4YWZ A;  1M40 A;  4HIA A;  1HD8 A;  2G7U A;  5HZH A;  2ACG A;  4LPZ A;  2HPB A;  3B33 A;  3CAX A;  5TBM A;  3IF6 C;  2EWW A;  5CXW A;  3SS5 A;  3ZG8 B;  2PDR A;  2XF3 A;  1BZA A;  5CEC A;  5IHV A;  2D02 A;  1BLP A;  2W1T A;  3BLM A;  1LT0 A;  3E0Y A;  3MMH A;  1T19 A;  2PD8 A;  1H8Y A;  4C3Q A;  2WAF A;  4JGR A;  1FCO A;  2QJ7 A;  5GLA A;  2WKH A;  2HP6 A;  1BYW A;  4WYY A;  5FDS A;  3VE4 A;  1CQA A;  1E25 A;  4HJ6 A;  3HUO A;  3UE3 A;  3NOU C;  3IXG A;  2HP9 A;  5EEC A;  1CI9 A;  3S7P A;  3PXP A;  5M18 A;  3O88 A;  3FWL A;  5GHX A;  1GA9 A;  4OQI A;  2WYX A;  1NZO A;  2QYB A;  3KYE A;  1W7F A;  1S67 L;  3VOL A;  3NUL A;  3U2A A;  4BBV A;  5J7E A;  2VGJ A;  3UDX A;  2Y2O A;  4JF6 A;  1NYY A;  4N9L A;  1HVB A;  1ZHH B;  1K25 A;  1K38 A;  3KSG A;  1UWN X;  4LV3 A;  1W63 M;  1PW1 A;  3EQV A;  3HL9 A;  1LL8 A;  2XR0 A;  1YLW A;  2J7V A;  3G2Y A;  2Z2L B;  1IEM A;  3EOI A;  4MN5 A;  4DMZ A;  2HP5 A;  1MY8 A;  4BD0 A;  2ZQ8 A;  3CJM A;  1ZG6 A;  2W0N A;  2Y91 A;  3IS2 B;  3PAG A;  5DTK A;  4PM5 A;  1UGU A;  5TFQ A;  5AJG A;  2PRF A;  3M2J A;  4R0Q A;  5FI6 A;  3IQA A;  1YLZ A;  3P09 A;  1L0E A;  2IWD A;  3NCK A;  4FOF A;  4O8G A;  3IWO A;  3IXD A;  4YOF A;  3Q7Z A;  3VOZ A;  1T1A A;  1FSY A;  3L9K A;  1MWR A;  3NHQ A;  3SH8 A;  1U60 A;  4JF4 A;  4S2O A;  3D9Y A;  1D7E A;  4A5R A;  1GA0 A;  1DJC A;  1NRF A;  4NKP A;  4S2I A;  5GHZ A;  4WUJ A;  4MN7 A;  4MBF A;  4WZ5 C;  5U47 A;  3GV9 A;  3SS4 A;  1F5M A;  5EVI B;  3MXQ A;  4OOL A;  2Y2J A;  4X69 A;  3GR2 A;  4ARZ A;  1MZU A;  5KZH A;  3BLS A;  3HLC A;  1XP4 A;  3VV4 A;  4KG2 A;  3NOP C;  3CZD A;  2A49 A;  4CJN A;  1M6K A;  1MKI A;  3Q07 A;  1YQS A;  3VFF A;  4HY8 A;  1V9Y A;  4L9E A;  5FEF A;  3W2Z A;  2OV5 A;  4QHC A;  4JPM A;  2J9P A;  3LIC A;  2IWC A;  4CQH A;  1KGG A;  3WS4 A;  2Y2K A;  4EXO A;  3N8R A;  3GMW A;  4KUO A;  4PM8 A;  4WL9 A;  1KE0 A;  1XA1 A;  1RGZ A;  4XT2 A;  1T1C A;  4N92 A;  2W3H A;  4BQM A;  1SKO A;  2O9B A;  1LSV A;  1Z6F A;  1VET A;  2Q9M A;  2W3E A;  4B88 A;  3N8S A;  3NI9 A;  1OT9 A;  3VSK A;  4RVA A;  5GL9 A;  3O3V A;  5FAS A;  1FIK A;  3QP4 A;  1ACF A;  4MLL A;  3ZG0 A;  3BJN A;  1KDS A;  1XJ4 A;  3FPW A;  1MKM A;  1YLY A;  1KVL A;  5FQM A;  3W4P A;  5CRF A;  3P7N A;  4XXR A;  4I5S A;  1IFQ A;  5E43 A;  1I2S A;  4H6J A;  4S2N A;  4BL3 A;  3WS0 A;  1O07 A;  4CLC B;  1K55 A;  2PR6 A;  4KZ3 A;  5E2F A;  4GW9 A;  3PBR A;  1IEL A;  2PYP A;  2WZX A;  2KOI A;  4HBT A;  4IVK A;  1PRQ A;  4H8R A;  3T1R A;  1CF0 A;  5HL1 A;  3OPP A;  3LIE A;  3OLO A;  2EWV A;  3G4P A;  2ZMV A;  4K0W A;  4D2O A;  3NY4 A;  2I72 A;  4PM7 A;  3RFB A;  5FQJ A;  1H8M A;  1BLH A;  1TS7 A;  4RQ9 A;  3VMA A;  4B93 A;  4DDS A;  4Y0U A;  3KX0 X;  4UEY A;  2W3F A;  1STZ A;  3LR5 A;  1IKG A;  2QPN A;  2KLI A;  3AGE A;  3Q82 A;  4UA7 A;  4MBH A;  4B9O A;  3GVB A;  5HWT A;  5AQ7 A;  1ES2 A;  3LY3 A;  3EQU A;  1EI5 A;  1OTA A;  3G34 A;  1OME A;  3LI8 A;  3H9W A;  2DNS A;  3CLO A;  2Y59 A;  3FC7 A;  5FQI A;  3HBR A;  2HGV A;  1P9R A;  3N8L A;  4IUK A;  4UA6 A;  4K91 A;  2ZL1 A;  5FSR A;  3TSG A;  1Q2P A;  3I7J A;  3G31 A;  2OSU A;  2EXB A;  1CEG A;  4X68 A;  2H0T A;  3F1P A;  5FI2 A;  3HLW A;  2JKG A;  3A3I A;  3IX4 A;  2JKT I;  2P7J A;  1S66 L;  4KQD A;  3LY4 A;  5J3W A;  2JKR I;  1LI9 A;  4S2M A;  5G18 A;  2ZMA A;  4OQ0 A;  1SKF A;  3PR6 A;  3NC8 A;  4R6L A;  3UPO A;  3RTY A;  1DP8 A;  2J80 A;  4E04 A;  3QP1 A;  5L2F A;  3H82 A;  2A24 A;  2EXA A;  4HEF A;  1WYB A;  1DY6 A;  2WKR A;  5HD5 A;  4I3J A;  3WRT A;  4HHD A;  3ITB A;  4PKY G;  3BWL A;  5HAQ A;  4E3O A;  3F1N A;  1ES5 A;  1BT5 A;  2CMN A;  3QP5 A;  4WBG A; 
#chains in the Genus database with same CATH homology
 3H82 B;  2G7U A;  3VE3 A;  5HZH A;  4R38 A;  4IHQ A;  2A24 B;  4LPZ A;  2ZMF A;  3T4T A;  3IBR A;  3B33 A;  4GHI A;  4KQO A;  4Q0J A;  3D3O A;  3CAX A;  4PHT A;  4H6J B;  5TBM A;  2GJ3 A;  3A0V A;  4CLC C;  2EWW A;  2PDR A;  5DF9 A;  1N9L A;  4WF0 A;  2V0U A;  4GS9 A;  1OPX A;  1XJ6 A;  2D02 A;  2P04 A;  2W1T A;  3KYQ A;  5DKL A;  1LT0 A;  5G4Y A;  3E0Y A;  4WEL A;  1TF1 A;  3MMH A;  3KSH A;  3G6O A;  1ODV A;  1T19 A;  4GHI B;  2PD8 A;  4HP9 A;  2VX8 A;  2OOL A;  1ZTU A;  5TJJ A;  3BW6 A;  4JGR A;  4G3K A;  4GS9 B;  1GSX A;  2QJ7 A;  2HJE A;  2J3T D;  5L8M A;  2W1T B;  1KOU A;  1BYW A;  1DP9 A;  5C5K A;  3FPV A;  3PBO A;  3VE4 A;  3UB6 A;  2L4R A;  2QHK A;  5EFW A;  3BQ8 A;  2FH5 A;  5G4Z A;  4HJ6 A;  2WKP A;  2PR5 A;  3TRC A;  3UE3 A;  3NOU C;  3B47 A;  1Y28 A;  4EW7 A;  3S7P A;  1G6O A;  3PXP A;  2M1C A;  1XFQ A;  5HPI A;  5HWV A;  1F9I A;  4R70 A;  2OAQ 1;  2W3D A;  2B02 A;  3H7W B;  1YSQ A;  1OTI A;  1MC0 A;  4PAU A;  3OBF A;  4JGP A;  4MMN A;  2PHY A;  5IU1 A;  2J3W A;  4EUV A;  4NXE A;  3LIA A;  3EWK A;  2YKF A;  2QYB A;  1NLZ A;  2V1A A;  5DFY A;  3C8C A;  3UE6 A;  1S67 L;  2VV8 A;  2W3G A;  5DFX A;  3VOL A;  3HJK A;  2M7U A;  3U2A A;  1VHM A;  4WEJ A;  3LIB A;  4BBV A;  5J7E A;  4BWI A;  4O01 A;  4Y3I A;  4BJP A;  2QWS A;  1WA9 A;  1ZHH B;  2L0W A;  2OAP 1;  2K7S A;  3KSG A;  4EES A;  3PHY A;  4K08 A;  1UWN X;  5HDS A;  5HWW A;  2IA2 A;  4AFI A;  5J4E A;  1W63 M;  2H28 A;  2VKS A;  2XRN A;  3IS2 A;  4ZRR A;  3PBN A;  3JVV A;  4MN6 A;  3EQV A;  1LL8 A;  3CUE A;  3S7O A;  3K3C A;  4LRZ E;  2Y8H A;  3T4K A;  2V0W A;  3OCL A;  1P97 A;  2VEA A;  3UB7 A;  2XSS A;  5HDC A;  4DJ2 A;  1OTE A;  4F3L B;  3EOI A;  4LRX C;  3D72 A;  4MN5 A;  4DMZ A;  2K2N A;  4I38 A;  1S4R A;  2D01 A;  5FL3 A;  3O5Y A;  2W0N A;  3IS2 B;  4EQ1 A;  3T4J A;  1S1Y A;  5F6A A;  1UGU A;  5AJG A;  1X0O A;  4I3I A;  3PYP A;  2Y79 A;  4KUK A;  5MC7 A;  2OWJ A;  3F1N B;  4FOF A;  4O8G A;  1F98 A;  4YOF A;  5HL6 A;  3UME A;  3CWF A;  5IT5 A;  1T1A A;  1N9N A;  3NHQ A;  3MFX A;  2ZOH A;  3A0S A;  4YNR A;  2FZ0 A;  3EEA A;  3OC2 A;  3B42 A;  1D7E A;  2PD7 A;  5TBM B;  2MJ6 A;  4NKP A;  4WUJ A;  2VGL S;  4MN7 A;  4LRY C;  4BMW A;  3UB9 A;  2R78 A;  1F5M A;  4QPR A;  3MXQ A;  2KX6 A;  4OOL A;  4L9F A;  3KYZ A;  2GZA A;  3LR4 A;  4ARZ A;  1MZU A;  4IUH A;  3SW1 A;  3VV4 A;  2VZW A;  3T4Q A;  3NOP C;  4HOI A;  1GSW A;  4II7 A;  4CLC E;  2KDK A;  5KSH A;  1T18 A;  2VGL M;  1EW0 A;  3MR0 A;  3R4K A;  4OOM A;  3TE8 A;  2XRO A;  4HY8 A;  3NOT C;  1V9Y A;  2O0Y A;  2QJ5 A;  4L9E A;  4ARZ B;  1P0Z A;  3W2Z A;  3TJZ C;  3UMD A;  3LIC A;  4G3W A;  1D06 A;  2L1M A;  3F1O A;  4CQH A;  2OWH A;  3S7Q A;  1N9O A;  2K31 A;  2WKQ A;  4EXO A;  4FSF A;  1XFN A;  4KUO A;  4NEE D;  2O9A A;  4NXF A;  4WL9 A;  4XT2 A;  4CLC D;  2A2L A;  4HNB A;  4MDZ A;  1T1C A;  3MQQ A;  4HH2 A;  2W3H A;  5K5B A;  4HQA A;  4BBT A;  2O9B A;  2JN7 A;  1LSV A;  3MQO A;  2LB5 A;  3R7W A;  2W3E A;  2B18 A;  3LI9 A;  3F1O B;  1OT9 A;  4HI4 A;  3UB8 A;  3LIF A;  1GSV A;  4EER A;  3HJI A;  2DMW A;  5HDD A;  3EGD C;  5DKK A;  4HJ4 A;  3OOV A;  3T4S A;  3IBJ A;  4EET B;  2JKT M;  5I5L A;  2V1B A;  2J3T C;  4Y5F A;  5AVF A;  1LSX A;  1TS6 A;  2JKR M;  3GDI A;  4BBU A;  1H3Q A;  1TD5 A;  1XJ3 A;  1W63 Q;  3BJN A;  3LUQ A;  2W27 A;  4CLC A;  4DJ3 A;  1XJ4 A;  2LB9 A;  3FPW A;  1MKM A;  3K3D A;  3T4L A;  4ETZ A;  3E4P A;  3LR3 A;  2VV6 A;  1V9Z A;  3P7N A;  1JNU A;  4I5S A;  1DP6 A;  3JVU A;  1IFQ A;  2NUT C;  4H6J A;  3PBT A;  3P01 A;  1DRM A;  3MJQ A;  4I39 A;  3CUE C;  2HF6 A;  4CLC B;  2PR6 A;  1YSP A;  4EU0 A;  4GW9 A;  4WEK A;  2ZBB A;  3PBR A;  5HSQ A;  2PYP A;  2VLG A;  2KOI A;  3ZQ5 A;  1NWZ A;  4L9G A;  5A8B A;  3C30 A;  2VV7 A;  1OT6 A;  3GEC A;  4Z1W A;  3LIE A;  3NJA A;  3T4O A;  4I3A A;  3OLO A;  3LFV A;  3V67 A;  1VB6 A;  3A0R A;  2EWV A;  1UWP X;  4IJG A;  5F69 A;  3EEH A;  1S1Z A;  2ZMV A;  4M4X A;  2JHE A;  5AVE A;  3KO6 A;  2XA7 S;  2VA0 A;  4UQI S;  2Z6C A;  4G3V A;  3CIT A;  5HPF A;  3RFB A;  1H8M A;  3BY8 A;  1OJG A;  1TS7 A;  4ME4 A;  4RQ9 A;  5IS1 A;  4Q0H A;  5HD3 A;  4B93 A;  4PKY A;  1OTB A;  3ICY A;  3KX0 X;  1LSW A;  2GNX A;  2W3F A;  3CI6 A;  1STZ A;  3E4O A;  3H7W A;  3LR5 A;  3OCN A;  4UEY A;  2NUP C;  3BQA A;  4Y2F A;  2KLI A;  2INW A;  2ZOI A;  4GJ4 A;  2XA7 M;  4GCZ A;  4B9O A;  4UQI M;  5HWT A;  2HV1 A;  3DBA A;  3FG8 A;  3EQU A;  4NXB A;  1OTA A;  4HJ3 A;  1YAX A;  3LI8 A;  3H9W A;  3KSI A;  3CLO A;  2W1R A;  3FC7 A;  2Z6D A;  2HGV A;  4O0P A;  1P9R A;  2EA9 A;  3K2N A;  4IUK A;  3MQ0 A;  1NLY A;  4P6Z S;  5CX7 A;  1TS0 A;  4JGQ A;  4MCW A;  5DJU A;  2PT7 A;  1S4S A;  3C2W A;  3E4Q A;  5F68 A;  3MF0 A;  4NXG A;  2HJ9 C;  3PBS A;  3F1P A;  4ETX A;  4XT2 B;  5F5Y A;  1OTD A;  3S7N A;  2JKT I;  2P7J A;  1S66 L;  4JGO A;  4KQD A;  2V9A A;  4WN5 A;  4F3L A;  5J3W A;  2JKR I;  2I9V A;  4DN0 A;  2O9C A;  2P08 A;  2QKP A;  4HP4 A;  2GX5 A;  3PR6 A;  3LYX A;  3R7W B;  3LR0 A;  4R6L A;  4R3A A;  2YKH A;  1G28 A;  4L0L A;  3RTY A;  4P6Z M;  1DP8 A;  2J80 A;  4E04 A;  1P9W A;  5DJT A;  3ZYT A;  3HCY A;  3T50 A;  4WLA A;  3ULF A;  2VJW A;  3E98 A;  3H82 A;  4GLQ A;  3F1P B;  5KIZ A;  4EEP A;  2A24 A;  4LLO B;  4Q0I A;  3TW8 A;  1NRJ A;  3LID A;  1YKD A;  2WKR A;  5HD5 A;  4I3J A;  1T1B A;  4HHD A;  3C38 A;  3RH8 B;  3KSF A;  4HH3 A;  4PKY G;  3BWL A;  1IOU A;  3EGX C;  3F1N A;  3PBQ A;  4EEU A;  1XJ2 A;  2PYR A;  3BY9 A;  2BAS A;  2CMN A;  5LBR A;  2O99 A;  1OJ5 A;  2M7V A;  4YWZ A;  4HIA A;  1TS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...