4UA9A

Ctx-m-14 class a beta-lactamase in complex with a boronic acid acylation transition state analog at sub-angstrom resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
ETSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-Induced Proton Transfer and Low-Barrier Hydrogen Bond Revealed by X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase CTX-M-14
total genus 96
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ua9A00
3VFFA 1E3UD 3LO7A 2QPNA 1JTDA 2H0TA 3GVBA 5EVID 1MWTA 3G2YA 3BFFA 4S2LA 3ZGAB 3VP1A 3HLWA 3NCKA 5A92A 2ZQ9A 1O07A 2EX8A 1M40A 3UDFA 4KZBA 1VM1A 4JXSA 1PI5A 2VGJA 1LI0A 4ZJ2A 4OQIA 4JPMA 4QHCA 4GZBA 5HARA 4PM8A 4Y7PA 2XDMA 4H8RA 4UAAA 5D3OA 1BLCA 3MKFA 3G31A 4WMCD 1KGFA 4R4RA 3WWXA 5TR7A 4MBHA 1NRFA 1GA9A 1FQGA 4KENB 4FCFA 5CHJA 3VMAA 4CPKA 3HREA 3OCLA 3SH8A 4S2IA 1KDSA 5IHVA 1FR1A 2WK0A 3GQZA 4OP5A 2X71A 4LENA 5EUAA 4LCLA 1FCOA 3IHAA 3HLEA 3N6IA 4LV1A 4JBFA 2P9VB 4EWFA 5KSHA 3MXRA 3M6BA 4IBXA 4KG2A 5GHXA 1PW8A 4WMCA 1ESIA 2Y2LA 4KG5A 1XPBA 1BSGA 4HESA 1YT4A 2EXAA 2FFYA 3SS5A 3BEBA 3UPOA 4Y0TA 2QMIA 3FKWA 5CHUA 4PM5A 5JYOA 3HLBA 3SH7A 4EBNA 3NBLA 4OOYA 4O7DA 3W4PA 5DF7A 2XH9A 1K25A 1XGJA 4MLLA 2BG1A 4JF6A 1CK3A 2WGWB 4S2NC 3AGEA 3FV7A 3UE0A 3QNCA 4KZ6A 5FAPA 2A49A 3IT9A 4WYYA 4C6YA 3GSGA 3V39A 1JWZA 4P6BA 3HVFA 5EVLA 1YLYA 4KQOA 5F82A 1OMEA 2OLVA 5EPHA 1IYSA 3PBNA 1PI4A 3OPPA 4S2NA 2IWDA 2ZQDA 4KG6A 4GNUA 1BUEA 2WGIA 3NY4A 5GLAA 1ALQA 2XF3A 3ZG5A 4ZJ3A 5CGWA 3GV9A 2CC1A 3O88A 1K57C 2EXBA 4IEDA 1C3BA 1GCEA 2Q9MA 4R4SA 1BZAA 1WYBA 3C7UA 4LV0A 5F83A 1NY0A 2Y2GA 4S2KA 3IWQA 1IKIA 1KVLA 3BYDA 3O86A 2X01A 2JCHA 1SCWA 5CEDA 5CXWA 5TFQA 4NK3A 4JXWA 4P85A 3ZDJA 4ZBEA 3SH9A 3TSGA 3G34A 1K6SA 1XA1A 4K0WA 4WEKA 1MXOA 4BL3A 4OPZA 4OOLA 1W8QA 5GLBA 4BENA 4RVAA 2UWXA 4KZ5A 4N9LA 3IHBA 4HBTA 4QY6A 3HLFA 3RJUA 1N9BA 2WKIA 1I2SA 3WS5A 3P98A 3FWLA 2EFUA 3GRJA 5FQKA 4MNRA 1K4EA 3MBZA 4KZ9A 5KZHA 5DTTA 1FCMA 3HLGA 2VGKA 5FSRA 5EVIC 4WEJA 1HD8A 1ES2A 3ZHHA 1YLJA 5E2HA 1NYMA 4R23A 1GHIA 3EQVA 3ITAA 3SS4A 3RXXA 3UPNA 3VP4A 4IVKA 1KE4A 3RXWA 4KZAA 1PWGA 4XUZA 2EFXA 3DW0A 2H5SA 3N8SA 3G35A 3Q7VA 5HAIA 2WGVA 3IWIA 1L0FA 3DWZA 1KDWA 4ZDXA 2WGWA 1H8ZA 4GDBA 3LY3A 1S6RA 2Y2IA 2ZC5B 3OZHA 2Y2HA 2Y2QA 3IH8A 3WS2A 4QJGA 2IWBA 1QMEA 4UHUA 5CTNA 1YQSA 1RGZA 3A3EA 4ID4A 1W7FA 1TDGA 2H0YA 5I94A 2Y2JA 1BULA 4LV3A 1CEGA 5FI2A 1ES4A 4LV2A 3UE1A 5TGFA 4X6TA 3C5AA 1FCNA 5FDHA 2QZ6A 4PM6A 3ZG9B 3HUMA 2WAEA 1K55C 3CMZA 4FH2A 5FI6A 3E2LA 3ZG0A 4E3OA 3OPRA 1DJCA 4N1HA 2HDUA 3NC8A 5AQ9A 3UPPA 3BECA 1KGGA 5KSCA 4RX3A 1XA7A 4ZTKA 1IYPA 2J9PA 2Y4AA 3WRTA 4B88A 5M19A 2EX9A 2PBYA 5DTKA 5J8XA 5F1GA 2OLUA 1W8YA 1XGIA 2J7VA 3BFEA 1E4DA 1NJ4A 3WS1A 1KE3A 4OPRA 4KZ3A 1JWVA 3TOIA 5FQMA 3BLMA 1I5QA 4OOMA 5G18A 5CERA 2Z2LB 2Y55A 1XX2A 1GA0A 3IF6C 3IF5A 3M6HA 1MWSA 3UN7A 2HPBA 3FKVA 3NDGA 4LCMA 2I72A 3OCNA 4QD4A 1WYCA 5JYPA 5L2FA 3PBOA 3JYIA 5FA7A 1K4FA 2RCXA 2J9OA 3CG5A 4EQIA 2H10A 4EBLA 1W79A 3HL9A 3VP3A 2DNSA 1FSWA 1YLZA 4N1XA 3UDIA 4E6XA 3M2KA 3VOYA 2Y2PA 4DDYA 5DF9A 1L0GA 2C6WB 3NI9A 3G2ZA 4GOGA 2XLNA 5CGXA 4EUZA 5A90A 3PBSA 2ZC3B 3ZNYA 2V20A 5CECA 2ZQ8A 2Y2OA 4Z9QA 1JTGA 4B4XA 3D4FA 3PAGA 3AGFA 4RA7A 1Q2PA 1W5DA 4S2MA 3VOZA 1K54A 2WYXA 3Q7ZA 4WZ5A 3HBRA 3OPHA 1PZPA 4E3NA 4XUXA 3UO9A 2R9WA 1YMSA 1PIOA 3W4OA 4BD1A 1SDEA 4OQGA 5HAPA 2C5WB 2WADA 3GTCA 3O87A 2IWCA 4OPYA 2JBFA 1BLSA 3TG9A 3V5MA 3ZVTA 4OONA 5CEBA 4OLDA 5GL9A 3B3XA 2JE5A 4MBKA 3BFCA 3NIAA 4QY5A 2ZMAA 4A5RA 1L0DA 2GDNA 1GHPA 4X56A 5F1FA 4R1GA 1RGYA 4WZ5C 1PWDA 4E3IA 1O7EA 1Y54A 3GR2A 3HUNA 5FI7A 1ZG6A 4DXCA 4E3LA 4R3BA 5AQAA 4B4ZA 4BQMA 2HDRA 3HUOA 1ERQA 1M6KA 2Z2MB 3BM6A 1DY6A 4MBFA 1N4OA 2WZXA 1IYQA 4OP8A 5CGSA 4ZAMA 1HZOA 1K56A 3P09A 4JF4A 1ONGA 1JWPA 3C4OA 3W4QA 1ERMA 1PZOA 1MWRA 4DF6A 2JC7A 4Y0UA 1WE4A 3BFGA 3ZFZA 3OPLA 1FSYA 1PW1A 4DE1A 5FASA 3Q1FA 2XFSA 3A3JA 2ZQAA 5FQQA 1EI5A 1ZC2A 2ZC4B 5GLCA 4GD6A 3V50A 1H5XA 2DCFA 2ZM8A 4S2OA 4N9KA 4WZ4A 1AXBA 2PU4A 2HP9A 4UA9A 5HW3A 2ZQ7A 4PM9A 3CJMA 2HDSA 4L0LA 4C3QA 3C4PA 5HX9A 3HLDA 2ZC6B 2OSUA 2XD5A 1MWUA 2XEPA 3IXBA 3MKEA 4FH4A 5FQIA 3UE3A 3V3SA 2ZM0A 1LI9A 3Q7VB 3G4PA 2Y2NA 2WAFA 3MZDA 1XKZA 3LEZA 1IYOA 4X53A 3IWOA 2ZLYA 1KVMA 3VFHA 4D2OA 1MPLA 2HP6A 1L0EA 2XR0A 1LHYA 4BJPA 2G2UA 3PBRA 1BTLA 2R9XA 1JVJA 5EVIB 1DJBA 3IF6B 5FQJA 3VSKA 1KGEA 2A3UA 1HTZA 3A3FA 5AQBA 5FAQA 3S1YA 3QHYA 3PBTA 4R3JA 4DE0A 4Y0OA 4OLGA 3IXDA 4E3MA 2XGNA 5E2EA 3MZEA 4HEFA 5CHMA 5M1AA 4R0QA 3ISGA 1MKIA 3SS3A 4BLMA 4YFMA 1IEMA 3FYZA 4OPQA 5FQ9A 3PAEA 1TDLA 4OKPA 3EQUA 1YLWA 1FR6A 2OV5A 5BOHA 3BLSA 3IQAA 4RYEA 4UA6A 2V2FF 1EROA 1MY8A 5DF8A 1ZKJA 3BRMA 3LCEA 4JXVA 1G6AA 3SOIA 4CJNA 3G32A 2HDQA 2WZZA 1K38A 4DRTA 4WELA 4PPRA 3WS4A 3ZG7B 1ES5A 1HVBA 3IH9A 1IELA 2ZC7A 1NYYA 3OC2A 1YMXA 5GLDA 4C75A 3HLCA 4OVDA 4X69A 5U47A 4KQQA 1K55A 1SHVA 2BLSA 3DTMA 4DDSA 1LLBA 3PTEA 1ONHA 3IXHA 4OQHA 3WRZA 1EWZA 1U60A 4KZ8A 4FD8A 3GMWA 1YLTA 1CI8A 4UA7A 5EOOA 3A3DA 2FFFB 2ZD8A 1XP4A 4F94A 3ZCZA 3MZFA 4PMAA 1L2SA 3Q82A 2WKHA 4GB7A 5DVAA 1Z6FA 3UDXA 1SDNA 3N4IA 3VP2A 1BT5A 4N92A 1LL5A 4E3KA 3C7VA 4E3JA 3AGDA 2ZM2A 1BLPA 3E2KA 2V1ZA 5HFOA 4PM7A 2DRWA 4IBRA 5FAOA 5A93A 5E2GA 1ESUA 1I2WA 3S4XA 1ES3A 3UY6A 1BLHA 2P74A 2XQZA 4FSFA 5CTMA 1NZUA 5KMWA 5HL1A 1K54C 1S0WA 1YM1A 2ZJ9A 5EVIA 1G68A 3VP0A 1CI9A 5CRFA 1ZG4A 2WKEA 4HBUA 2WUQA 4WBGA 2Y2MA 1LL9A 4X55A 4DE3A 5HAQA 4NETA 4U3TA 2XFTA 3CZDA 4GD8A 4Q8IA 3Q07A 3M2JA 4JKTA 2RL3A 3W8KA 2B5RA 2XK1A 3IXGA 1PWCA 3WS0A 5EECA 4MEZA 4S2JA 3S22A 5M18A 1K6RA 3BFDA 4QB8A 3QNBA 1H8YA 1Q2QA 1TEMA 3N8RA 4JXGA 4GDNA 4OQ0A 4IVIA 1TVFA 1MBLA 4E6WA 2EX6A 1QMFA 2HP5A 3A3IA 4KZ7A 5EE8A 3PBQA 3UNWA 2Y91A 1K56D 1DJAA 2G2WA 1NXYA 4OH0A 1GHMA 1NZOA 3O3VA 4M3KA 4EBPA 3NDEA 4U0XA 4WM9A 1KE0A 2Y59A 2ZQCA 4P0MA 1YLPA 2P9VA 1PYYA 2Y2KA 1K57A 3N7WA 2X02A 3N8LA 4X68A 4BL2A 3FZCA 1J9MA 3Q81A 4KQRA 1RCJA 5EOEA 3I7JA 4EV4A 2J8YA 4JF5A 2PU2A 3V3RA 4U0TA 5GHZA 3MFDA 1VQQA 5FATA 4GN2A 5E2FA 4ZJ1A 4DKIA 4QU3A 1CEFA 4K91A 4XXRA 3VSLA 2Q9NA 4RX2A 4S2PA 5GHYA 4JLFA 2E8IA 1FOFA 5DTSA 5AQ7A 3ZG8B 4DXBA 2EX2A 4KZ4A 3DWKA 4P87A 3G30A 5A91A 4BD0A 1SKFA 1IKGA 4DE2A 3ZVWA 1E3UA 2XD1A 4GKUA 4YINA 3ZNTA 1RP5A 1XXMA 3MXSA 3ITBA 5E43A 3LY4A 3IF6A 4K0XA 1E25A
chains in the Genus database with same CATH superfamily
3VFFA 5EVID 4S2LA 3BFFA 3NCKA 3H9WA 5HWWA 3UDFA 4ETZA 4KUKA 4OQIA 4JPMA 4GZBA 5HARA 4Y7PA 2OWHA 3UMDA 5HDCA 1VB6A 1V9YA 4X1MA 4OP5A 4LENA 4LCLA 3IHAA 3HLEA 4JBFA 4LRZE 4YOFA 2FZ0A 4KG2A 3SW1A 4WF0A 1ESIA 3R7WB 4KG5A 4HESA 1VEUB 2EXAA 3A0VA 3SH7A 3NBLA 5DF7A 4B9OA 1K25A 3CI6A 4CQHA 1XGJA 2WGWB 3QNCA 4KZ6A 4MN7A 3A0SA 4C6YA 3V39A 1F98A 5F69A 5EVLA 4R3AA 4IJGA 1OMEA 2L1MA 2V0WA 3PBNA 4MN5A 4KG6A 2PBDP 4ZRRA 4I3AA 5GLAA 1ALQA 2XF3A 3GV9A 1VEUA 2CC1A 2OWJA 2UV0E 3O88A 4NG2A 1WYBA 3HJIA 1GSVA 4EUVA 4LV0A 5F83A 2Y2GA 4UQIS 3DAVA 1IKIA 1TS6A 1KVLA 2X01A 5CEDA 5CXWA 3U2AA 4ZBEA 2J3TD 3TSGA 1XA1A 3IS2B 2W1TA 3CAXA 3NJAA 4KUOA 4X1LA 2Z6DA 1PNEA 3HJKA 2EFUA 3GRJA 2LB5A 5FSRA 5EVIC 1EW0A 2D02A 2OAQ1 3MS6A 2B18A 4KZAA 5HAIA 3LUQA 3IWIA 3VE3A 1H8ZA 3T50A 1S6RA 2Y2IA 3LEQA 4YWZA 5I94A 4K08A 4LV3A 1CEGA 1S4RA 4X6TA 3ZG9B 4EXOA 3CMZA 3VOLA 4R38A 1DJCA 2HJEA 5HWVA 4UQIM 1XA7A 4ZTKA 4WL9A 5J8XA 5F1GA 4H6JA 1W8YA 3WS1A 2JHEA 2H28A 4Y15A 3TOIA 5FQMA 2W0NA 3LR0A 1I5QA 2YKHA 3QP2A 1G6OA 5F68A 1OT6A 3UN7A 2ZOHA 2I72A 4CLCD 3PBOA 4MN6A 1K4FA 4L9FA 4EQIA 1W79A 1FSWA 2JKFA 3VOYA 3EEHA 3MSHA 3G2ZA 2B02A 3QP8A 5A90A 3PBSA 3ZNYA 2V8FA 3ULFA 5CECA 2ZQ8A 3D4FA 2VA0A 2WYXA 4WZ5A 1CJFA 1OTAA 4EW7A 3UO9A 3KO6A 3S7NA 4OQGA 1Y4OA 2NUTC 3GTCA 2JBFA 1F5MA 3V5MA 5DJTA 5GL9A 4QY5A 4HHDA 2ZMAA 4I3IA 4LGWA 4WZ5C 3HCYA 1PWDA 4E3IA 3A0RA 4E3LA 5AQAA 2HDRA 1M6KA 2WZXA 3CLOA 4GS9A 4RQ9A 1T19A 1Y28A 2P04A 3P09A 3DTEA 1JWPA 1PZOA 2JC7A 3RTYA 1OPXA 4BMWA 1TF1A 5K5BA 3OPLA 5FASA 1PW1A 3A3JA 1EI5A 1ZC2A 3ICYA 3V50A 4Y5FA 2DCFA 4WZ4A 4I5SA 2PU4A 2HP9A 5HW3A 2ZQ7A 4PM9A 2HDSA 4C3QA 3LIDA 2OSUA 3UE3A 1LI9A 1T1CA 3CHWP 1IYOA 4X53A 2W3EA 3QP1A 2HP6A 1L0EA 1LHYA 2G2UA 1BTLA 2R9XA 4XT2A 1DP9A 1DJBA 4NEED 2HV1A 1KGEA 2A3UA 5FAQA 3OOVA 3C2WA 5DFYA 2Z6CA 3T4QA 4WUJA 3MFXA 1VETA 4OPQA 2HJ9C 4OKPA 5DF8A 3IQAA 4UA6A 1STZA 3G32A 3E4QA 4BBUA 4F3LB 1K38A 1ES5A 3UB6A 1NYYA 2VKSA 3KYEA 5GLDA 3HLCA 1K55A 3B33A 2BLSA 5LBRA 5HPIA 2W27A 2GNXA 4UA7A 2IA2A 4HY8A 2FFFB 2ZD8A 3T4TA 2O9BA 4PMAA 1L2SA 5DVAA 1Z6FA 3UDXA 2GX5A 1LL5A 2G7UA 1BLPA 3E2KA 4DJ3A 2V1ZA 1H0MA 4F3LA 2DRWA 4EEPA 5L07A 1I2WA 3S4XA 1S4SA 1YPRA 1YM1A 3NOUC 5EVIA 1G68A 3E0YA 1CI9A 1ZG4A 2WKEA 2WUQA 1N9OA 2Y2MA 4U3TA 3CZDA 3KSIA 4R70A 3L9KA 2ZOIA 2RL3A 2B5RA 3E4OA 1PWCA 4WLAA 4MEZA 1VHMA 1K6RA 3BFDA 1TD5A 1TEMA 4JXGA 3JVUA 1QMFA 4KZ7A 5EV0A 3KYZA 2A2LA 1K56D 1NZOA 3O3VA 4M3KA 4EBPA 2W1TB 1P9RA 1KE0A 4Z1WA 2Y59A 4L9EA 1YLPA 1K57A 3FZCA 1D06A 3Q81A 5EOEA 5I5LA 2PU2A 5G4YA 5GHZA 1T1BA 1VQQA 1NWZA 5IS1A 4RX2A 5A8BA 1T18A 4UEYA 2Y79A 3ZG8B 4P87A 4DE2A 3ZQ5A 2XD1A 3ZNTA 1RP5A 4AFIA 3IF6A 3DTKA 3PYPA 2KDKA 2WKPA 1D7EA 2H0TA 3MJQA 3HLWA 1XJ4A 2JKRI 2EX8A 1M40A 4KZBA 1VM1A 4H8RA 1UWPX 3P7NA 2P08A 3WWXA 2ZBBA 2PYRA 1NRFA 4MBHA 1FQGA 3VMAA 3IS2A 3SH8A 3R4KA 5IHVA 2WK0A 3GQZA 3F1NB 3C8CA 5HZHA 5KSHA 2P9VB 3LICA 4IBXA 5HL6A 5L8MA 4WMCA 2FFYA 3PXPA 3FKWA 5JYOA 4Y17A 3HLBA 4EBNA 1DRMA 1CK3A 3UE0A 5FAPA 2A49A 3IT9A 2Q0OA 4P6BA 3P01A 4KQOA 5F82A 3D9YA 4S2NA 5DFXA 4EU0A 1K57C 3C30A 2Q9MA 1BZAA 4PAUA 5J7EA 3BYDA 3LR5A 2LB9A 4NK3A 5KIZA 2PYPA 3ZDJA 3TW8A 1K6SA 4WEKA 1MXOA 4BL3A 4OOLA 4RVAA 2UWXA 3IHBA 2W3GA 3JVVA 3FWLA 2OAP1 5FQKA 3OBFA 3D3OA 3SZTA 1K4EA 2PAVP 4Q0HA 3CUEA 4GHIA 1HD8A 2PRFA 3ZHHA 5HPFA 4IVKA 3RXWA 4IUKA 4XUZA 2PR6A 4O8GA 1KDWA 3LR4A 4UHUA 1XJ2A 3A3EA 3QP6A 4ID4A 1W7FA 1TDGA 3UE1A 5FDHA 4I38A 3QP5A 1K55C 5FI6A 3CITA 3E2LA 3ZG0A 3BECA 5KSCA 3LYXA 2VV6A 2Y4AA 1T1AA 2B95A 2EX9A 2D01A 2PBYA 5DTKA 3BFEA 1E4DA 1KE3A 2JKGA 4G3VA 1OTEA 4OOMA 5G18A 2ZMVA 3KSHA 4HQAA 3IF5A 1GA0A 3T1RA 4NXGA 3OCNA 1WYCA 5FA7A 4ESPA 2RCXA 3HL9A 4N1XA 4E6XA 1YLZA 2W1RA 4DDYA 1L0GA 2C6WB 1XFQA 5CGXA 2ZC3B 2O99A 2Y2OA 4Z9QA 4RA7A 1W5DA 3MF0A 3OPHA 1PZPA 4XUXA 1PIOA 3W4OA 5J4EA 5HAPA 2C5WB 2WADA 5C5KA 3O87A 2IWCA 2QWSA 3TG9A 3FC7A 3ZVTA 1TS8A 3BFCA 1L0DA 1VETB 1GHPA 1O7EA 3GR2A 3HUNA 3NECA 5FI7A 4DXCA 5FEFA 1Z09A 1P0ZA 4JGPA 1IYQA 4ZAMA 3F1PA 4JF4A 3C4OA 3W4QA 2VJWA 4Y0UA 3ZFZA 1FSYA 3UB8A 3Q1FA 3T1XA 1D1JA 3E98A 2JKRM 1MZUA 2ZM8A 4S2OA 4UA9A 4PHTA 5HX9A 3IXBA 4FH4A 1MWUA 2XEPA 3MKEA 5FQIA 2ZM0A 1ACFA 3DBAA 1LSWA 3IWOA 1KVMA 3VFHA 4D2OA 2ACGA 4HJ4A 1JVJA 5EVIB 3IF6B 5FQJA 3T4JA 2A24A 3S7PA 4LRYC 1F9IA 3LGOA 2VEAA 2XRNA 4OLGA 3IXDA 4HI4A 3R7WA 2XGNA 5E2EA 4HEFA 5CHMA 1IEMA 1XJ3A 1TDLA 4RYEA 4I3JA 1ZKJA 3BQAA 3SOIA 4CJNA 2HDQA 5EM1A 5AJGA 1HVBA 2ZC7A 1PRQA 2A24B 3OC2A 4NXFA 4X69A 3BY8A 1ONHA 4OQHA 2K2NA 2VX8A 3WRZA 1EWZA 1KOUA 1U60A 1CI8A 3H7WA 3T4LA 3Q82A 1SDNA 3N4IA 1BT5A 4N92A 1NLYA 2YKFA 4IBRA 5A93A 5HDSA 3F1OB 4O01A 1ES3A 4FSFA 2XQZA 5KMWA 1S0WA 3CUEC 3VP0A 5CRFA 3IBRA 1LL9A 3OLOA 4NETA 2XFTA 2QHKA 4JGOA 3WS0A 5TBMB 1XJ6A 4HP9A 1LL8A 1JNUA 4QB8A 3QNBA 4II7A 1Q2QA 2JKTM 3N8RA 1GSXA 2V1AA 2O0YA 3UNWA 1S1YA 4MMNA 2Y91A 4OH0A 1DJAA 2G2WA 1GHMA 3F1NA 4P0MA 2P9VA 3N7WA 2X02A 4X68A 1J9MA 1RCJA 3I7JA 4U0TA 3MFDA 3GECA 4DKIA 1CEFA 4K91A 4MCWA 1SKOA 4JLFA 4Y3IA 5A91A 3G30A 2J3WA 1IKGA 3ZVWA 3ITBA 3LY4A 3S7OA 4Q0JA 4DN0A 2PR5A 4Y13A 1E3UD 3LO7A 1JTDA 3FPWA 3MQ0A 3VV4A 3G2YA 3ZGAB 5A92A 1IOUA 2ZMFA 1O07A 5FL3A 4JXSA 1PI5A 2VGJA 4Y2FA 1LI0A 4ZJ2A 4QHCA 4PM8A 5D3OA 1BLCA 1KGFA 4KENB 4FCFA 3HREA 4S2IA 1KDSA 3LIBA 1G28A 2X71A 1PFLA 1FCOA 3N6IA 4EWFA 1HLUP 3MXRA 5GHXA 1OT9A 3IBJA 2Y2LA 1P9WA 1YT4A 3SS5A 3BEBA 3UPOA 4NXBA 4Y0TA 3FPVA 5CHUA 1GSWA 1NLZA 3DTIA 4OOYA 4BBVA 4HP4A 3KSGA 2XH9A 4GLQA 4MLLA 4S2NC 4WYYA 3GSGA 4CLCB 2E8JA 2OLVA 1BYWA 4LRXC 2EWWA 1PI4A 2DMWA 1LSXA 1BUEA 3CWFA 5EVEA 3NY4A 3ZG5A 5G4ZA 1GCEA 4ME4A 3C7UA 4S2KA 3B47A 3IWQA 5HD5A 5MC7A 3O86A 1SCWA 3MXQA 2XA7S 5TFQA 4JXWA 3SH9A 4OPZA 1YSPA 4BENA 4KZ5A 1XFNA 1YAXA 3HLFA 3QP4A 3RJUA 3WS5A 2WKIA 2PDRA 3MBZA 1L3LA 2VGKA 4WEJA 1YLJA 4R23A 3EQVA 3ITAA 1UGUA 3RXXA 3VP4A 1KE4A 2W3DA 4ETXA 1PWGA 3DW0A 2H5SA 4FTXA 3N8SA 4ZDXA 1L0FA 3DWZA 4HJ3A 4GDBA 3LY3A 3OZHA 3IH8A 4QJGA 2IWBA 1QMEA 5CTNA 1RGZA 4ARZB 4EEUA 2H0YA 1V9ZA 5TGFA 3C5AA 2QZ6A 4PM6A 2L4RA 1H3QA 3OPRA 4N1HA 3UPPA 1MC0A 4RX3A 3W2ZA 2J9PA 4NKPA 2XSSA 4B88A 4EERA 2OLUA 1XGIA 5AVEA 2J7VA 1NJ4A 4KZ3A 3NULA 1JWVA 5F6AA 5CX7A 3BLMA 5CERA 2Z2LB 3EGXC 3IF6C 3T4KA 1MWSA 2HPBA 3FKVA 4QD4A 5JYPA 5L2FA 2J9OA 3CG5A 2H10A 2DNSA 2WKRA 4EETB 3H7WB 2VGLM 4EUZA 2VZWA 2V20A 3GDIA 4B4XA 2KLIA 2FH5A 3PAGA 1Q2PA 4S2MA 3LIEA 4B93A 4IUHA 3HBRA 2V1BA 2R9WA 4JGRA 3F1OA 1OTDA 1YMSA 2HZ5A 1LT0A 4KQDA 4OONA 4OLDA 2JE5A 4MBKA 3NIAA 4A5RA 2GDNA 3BQ8A 3K3DA 2BASA 3S7QA 1Y54A 4LPZA 4R3BA 4FUWA 4BQMA 4EQ1A 1ERQA 2M7UA 2W3FA 1DY6A 1N4OA 4OP8A 1HZOA 1K56A 2PD8A 1ONGA 1ERMA 1MWRA 1CQAA 1N9LA 2EWVA 1WE4A 3BFGA 4QWOA 2XFSA 4GD6A 1H5XA 3E4PA 4N9KA 3TJZC 1AXBA 3H82B 4I39A 3CJMA 5TJJA 4L0LA 2PHYA 4PKYA 3HLDA 4HOIA 3Q7VB 3T4OA 2WAFA 3MZDA 1XKZA 3LEZA 4CLCE 2PD7A 3MQOA 2J3TC 4LLOB 3K2NA 4BJPA 3C38A 3VSKA 3UMEA 1HTZA 1G5UA 3QHYA 4R3JA 3ZYTA 5HD3A 2Y8HA 4R0QA 3ISGA 1MKIA 3H82A 4BLMA 4YFMA 3PAEA 1NRJA 1YLWA 3BLSA 1ODVA 2V2FF 1EROA 4JXVA 4DRTA 4WELA 1S67L 4PPRA 3G6OA 1S66L 5EM0A 4OVDA 5U47A 1AWIA 4KQQA 5DJUA 3DTMA 3IX8A 4KZ8A 1YLTA 3MMHA 3A3DA 1OJ5A 1XP4A 4F94A 3ZCZA 1ZTUA 2WKHA 3VP2A 3IX3A 1P97A 4E3KA 3C7VA 5FEGA 3AGDA 3KYQA 4H6JB 4PM7A 1ESUA 2V0UA 4P6ZM 1NZUA 3LI9A 4PKYG 2ZJ9A 5L09A 2QYBA 4WBGA 1A0KA 1UWNX 4X55A 5HAQA 4DE3A 4CLCC 3CPTA 4GD8A 2R78A 4Q8IA 4O0PA 3KX0X 4JKTA 4DMZA 2XK1A 2INWA 5EECA 3S22A 1N9NA 1LSVA 3T1SA 4GDNA 5HDDA 1TVFA 2EX6A 5EE8A 3PBQA 2XROA 3NDEA 2ZQCA 1PYYA 3N8LA 3LI8A 4EV4A 3V3RA 5FATA 5E2FA 1YSQA 4XXRA 2Q9NA 4S2PA 5GHYA 3IX4A 2E8IA 1MKMA 5AQ7A 4DXBA 2EX2A 5F5YA 4E04A 1E3UA 2PT7A 5HSQA 4YINA 3TRCA 4CLCA 5DKKA 1XXMA 2QJ5A 3MXSA 5E43A 1ZHHB 2QKPA 2QPNA 3GVBA 4LFUA 1MWTA 3VP1A 2ZQ9A 2W3HA 1FIKA 3LIFA 2VK3A 2P7JA 3T4SA 2XDMA 4UAAA 3MKFA 3G31A 4WMCD 4R4RA 5TR7A 1GA9A 5CHJA 4CPKA 3OCLA 4NXEA 1FR1A 5EUAA 1DP6A 3UB9A 4LV1A 2GJ3A 3M6BA 1PW8A 4HIAA 1XPBA 1BSGA 4BWIA 2QMIA 4PM5A 2EA9A 5J3WA 3W4PA 4O7DA 2BG1A 4JF6A 3RH8B 1WA9A 3AGEA 2GZAA 3FV7A 2I9VA 3MR0A 4HNBA 1JWZA 3F1PB 3HVFA 1YLYA 4P6ZS 2ZL1B 5EPHA 1IYSA 3OPPA 2IWDA 2ZQDA 4GNUA 2WGIA 3B42A 2MJ6A 5CGWA 4ZJ3A 2EXBA 4IEDA 1C3BA 4R4SA 3LIAA 2JKTI 1NY0A 3O5YA 2CMNA 4DJ2A 2JCHA 3PHYA 4BBTA 4P85A 3G34A 3JPUA 1DP8A 4K0WA 1J3WA 1W8QA 5GLBA 1TS7A 4N9LA 4HBTA 4QY6A 1N9BA 1I2SA 3P98A 3UE6A 4MNRA 4KZ9A 4EESA 5DTTA 5KZHA 1FCMA 2HF6A 5AVFA 3HLGA 1ES2A 2L0WA 5E2HA 1NYMA 5IU1A 1GHIA 3SS4A 3UPNA 2EFXA 3Q7VA 3G35A 1H8MA 2WGVA 1OTBA 2WGWA 4FOFA 3TE8A 2ZC5B 2Y2HA 2Y2QA 3WS2A 4R6LA 1YQSA 3LR3A 2Y2JA 1BULA 3EWKA 5FI2A 1ES4A 4LV2A 3L7HA 1TS0A 1FCNA 3HUMA 2WAEA 4FH2A 4E3OA 2HDUA 3NC8A 5AQ9A 5HWTA 3T1QB 1FILA 1KGGA 1IYPA 3WRTA 5M19A 2M7VA 3BW6A 4OPRA 3NHQA 4G3KA 2Y55A 1XX2A 3M6HA 4YNRA 3NDGA 4LCMA 3VE4A 3JYIA 2J80A 4EBLA 3VP3A 3UDIA 3M2KA 2Y2PA 5DF9A 3NI9A 4GOGA 2XLNA 5TBMA 1F2KA 3RFBA 2AVXA 4D60A 1JTGA 5FDSA 2KX6A 3AGFA 1W63M 3VOZA 1K54A 3Q7ZA 3D72A 4E3NA 2QJ7A 3U4LP 4BD1A 1SDEA 1SZVA 2WKQA 3BJNA 4OPYA 1BLSA 5CEBA 3B3XA 4X56A 5F1FA 4R1GA 1RGYA 1SKOB 4Q0IA 3T12B 1ZG6A 4B4ZA 3HUOA 2Z2MB 3PR6A 2V8CA 2M1CA 3BM6A 3MQQA 3FG8A 4MBFA 4X25A 5CGSA 2OOLA 4DF6A 4DE1A 5GLCA 1OJGA 5FQQA 2ZQAA 1OTIA 2ZC4B 4L9GA 2HGVA 3C4PA 3UB7A 2ZC6B 2XD5A 3V3SA 4JGQA 3G4PA 2Y2NA 4M4XA 3BWLA 2ZLYA 1MPLA 1YKDA 2XR0A 2VV8A 3PBRA 5IT5A 3A3FA 5AQBA 3S1YA 2NUPC 3PBTA 4DE0A 3CPTB 4Y0OA 1IFQA 4E3MA 3MZEA 3KSFA 5M1AA 3SS3A 3FYZA 5FQ9A 1S1ZA 5EFWA 2K31A 4GHIB 3EQUA 1FR6A 2OV5A 5BOHA 4GW9A 3EOIA 1MY8A 3BRMA 3LCEA 1G6AA 1K0KA 2WZZA 4IHQA 3WS4A 3ZG7B 3IH9A 4GS9B 1IELA 3NOTC 2XA7M 1YMXA 4HH3A 4C75A 1SHVA 4HJ6A 4DDSA 1LLBA 3PTEA 3IXHA 1X0OA 4FD8A 3GMWA 5EOOA 3MZFA 2JN7A 4GB7A 5DKLA 4E3JA 4QPRA 1W63Q 2VV7A 2ZM2A 3EEAA 5HFOA 5FAOA 3BY9A 2KOIA 5E2GA 3UB5P 5L10A 3K3CA 3UY6A 1BLHA 2P74A 4G3WA 5CTMA 5HL1A 1K54C 3NOPC 4XT2B 4HBUA 2K7SA 4HH2A 3Q07A 3V67A 3M2JA 3W8KA 3IXGA 4MDZA 4S2JA 5M18A 1H8YA 4OQ0A 2V9AA 4IVIA 1MBLA 4E6WA 2HP5A 3A3IA 1NXYA 4U0XA 4WM9A 4ARZA 2O9AA 2O9CA 2Y2KA 3EGDC 4BL2A 4KQRA 2BTFP 2J8YA 4JF5A 4GN2A 4ZJ1A 4QU3A 2VLGA 3VSLA 1FOFA 5DTSA 4GCZA 4KZ4A 3DWKA 4BD0A 1SKFA 4GKUA 4GJ4A 3LFVA 2VGLS 1CF0A 2ZL1A 4K0XA 4WN5A 1E25A
chains in the Genus database with same CATH topology
3VFFA 1E3UD 3LO7A 2QPNA 1JTDA 2H0TA 3GVBA 5EVID 1MWTA 3G2YA 3BFFA 4S2LA 3ZGAB 3VP1A 3HLWA 3NCKA 5A92A 2ZQ9A 1O07A 2EX8A 1M40A 3UDFA 4KZBA 1VM1A 4JXSA 1PI5A 2VGJA 1LI0A 4ZJ2A 4OQIA 4JPMA 4QHCA 4GZBA 5HARA 4PM8A 4Y7PA 2XDMA 4H8RA 4UAAA 5D3OA 1BLCA 3MKFA 3G31A 4WMCD 1KGFA 4R4RA 3WWXA 5TR7A 4MBHA 1NRFA 1GA9A 1FQGA 4KENB 4FCFA 5CHJA 3VMAA 4CPKA 3HREA 3OCLA 3SH8A 4S2IA 1KDSA 5IHVA 1FR1A 2WK0A 3GQZA 4OP5A 2X71A 4LENA 5EUAA 4LCLA 1FCOA 3IHAA 3HLEA 3N6IA 4LV1A 4JBFA 2P9VB 4EWFA 5KSHA 3MXRA 3M6BA 4IBXA 4KG2A 5GHXA 1PW8A 4WMCA 1ESIA 2Y2LA 4KG5A 1XPBA 1BSGA 4HESA 1YT4A 2EXAA 2FFYA 3SS5A 3BEBA 3UPOA 4Y0TA 2QMIA 3FKWA 5CHUA 4PM5A 5JYOA 3HLBA 3SH7A 4EBNA 3NBLA 4OOYA 4O7DA 3W4PA 5DF7A 2XH9A 1K25A 1XGJA 4MLLA 2BG1A 4JF6A 1CK3A 2WGWB 4S2NC 3AGEA 3FV7A 3UE0A 3QNCA 4KZ6A 5FAPA 2A49A 3IT9A 4WYYA 4C6YA 3GSGA 3V39A 1JWZA 4P6BA 3HVFA 5EVLA 1YLYA 4KQOA 5F82A 1OMEA 2OLVA 5EPHA 1IYSA 3PBNA 1PI4A 3OPPA 4S2NA 2IWDA 2ZQDA 4KG6A 4GNUA 1BUEA 2WGIA 3NY4A 5GLAA 1ALQA 2XF3A 3ZG5A 4ZJ3A 5CGWA 3GV9A 2CC1A 3O88A 1K57C 2EXBA 4IEDA 1C3BA 1GCEA 2Q9MA 4R4SA 1BZAA 1WYBA 3C7UA 4LV0A 5F83A 1NY0A 2Y2GA 4S2KA 3IWQA 1IKIA 1KVLA 3BYDA 3O86A 2X01A 2JCHA 1SCWA 5CEDA 5CXWA 5TFQA 4NK3A 4JXWA 4P85A 3ZDJA 4ZBEA 3SH9A 3TSGA 3G34A 1K6SA 1XA1A 4K0WA 4WEKA 1MXOA 4BL3A 4OPZA 4OOLA 1W8QA 5GLBA 4BENA 4RVAA 2UWXA 4KZ5A 4N9LA 3IHBA 4HBTA 4QY6A 3HLFA 3RJUA 1N9BA 2WKIA 1I2SA 3WS5A 3P98A 3FWLA 2EFUA 3GRJA 5FQKA 4MNRA 1K4EA 3MBZA 4KZ9A 5KZHA 5DTTA 1FCMA 3HLGA 2VGKA 5FSRA 5EVIC 4WEJA 1HD8A 1ES2A 3ZHHA 1YLJA 5E2HA 1NYMA 4R23A 1GHIA 3EQVA 3ITAA 3SS4A 3RXXA 3UPNA 3VP4A 4IVKA 1KE4A 3RXWA 4KZAA 1PWGA 4XUZA 2EFXA 3DW0A 2H5SA 3N8SA 3G35A 3Q7VA 5HAIA 2WGVA 3IWIA 1L0FA 3DWZA 1KDWA 4ZDXA 2WGWA 1H8ZA 4GDBA 3LY3A 1S6RA 2Y2IA 2ZC5B 3OZHA 2Y2HA 2Y2QA 3IH8A 3WS2A 4QJGA 2IWBA 1QMEA 4UHUA 5CTNA 1YQSA 1RGZA 3A3EA 4ID4A 1W7FA 1TDGA 2H0YA 5I94A 2Y2JA 1BULA 4LV3A 1CEGA 5FI2A 1ES4A 4LV2A 3UE1A 5TGFA 4X6TA 3C5AA 1FCNA 5FDHA 2QZ6A 4PM6A 3ZG9B 3HUMA 2WAEA 1K55C 3CMZA 4FH2A 5FI6A 3E2LA 3ZG0A 4E3OA 3OPRA 1DJCA 4N1HA 2HDUA 3NC8A 5AQ9A 3UPPA 3BECA 1KGGA 5KSCA 4RX3A 1XA7A 4ZTKA 1IYPA 2J9PA 2Y4AA 3WRTA 4B88A 5M19A 2EX9A 2PBYA 5DTKA 5J8XA 5F1GA 2OLUA 1W8YA 1XGIA 2J7VA 3BFEA 1E4DA 1NJ4A 3WS1A 1KE3A 4OPRA 4KZ3A 1JWVA 3TOIA 5FQMA 3BLMA 1I5QA 4OOMA 5G18A 5CERA 2Z2LB 2Y55A 1XX2A 1GA0A 3IF6C 3IF5A 3M6HA 1MWSA 3UN7A 2HPBA 3FKVA 3NDGA 4LCMA 2I72A 3OCNA 4QD4A 1WYCA 5JYPA 5L2FA 3PBOA 3JYIA 5FA7A 1K4FA 2RCXA 2J9OA 3CG5A 4EQIA 2H10A 4EBLA 1W79A 3HL9A 3VP3A 2DNSA 1FSWA 1YLZA 4N1XA 3UDIA 4E6XA 3M2KA 3VOYA 2Y2PA 4DDYA 5DF9A 1L0GA 2C6WB 3NI9A 3G2ZA 4GOGA 2XLNA 5CGXA 4EUZA 5A90A 3PBSA 2ZC3B 3ZNYA 2V20A 5CECA 2ZQ8A 2Y2OA 4Z9QA 1JTGA 4B4XA 3D4FA 3PAGA 3AGFA 4RA7A 1Q2PA 1W5DA 4S2MA 3VOZA 1K54A 2WYXA 3Q7ZA 4WZ5A 3HBRA 3OPHA 1PZPA 4E3NA 4XUXA 3UO9A 2R9WA 1YMSA 1PIOA 3W4OA 4BD1A 1SDEA 4OQGA 5HAPA 2C5WB 2WADA 3GTCA 3O87A 2IWCA 4OPYA 2JBFA 1BLSA 3TG9A 3V5MA 3ZVTA 4OONA 5CEBA 4OLDA 5GL9A 3B3XA 2JE5A 4MBKA 3BFCA 3NIAA 4QY5A 2ZMAA 4A5RA 1L0DA 2GDNA 1GHPA 4X56A 5F1FA 4R1GA 1RGYA 4WZ5C 1PWDA 4E3IA 1O7EA 1Y54A 3GR2A 3HUNA 5FI7A 1ZG6A 4DXCA 4E3LA 4R3BA 5AQAA 4B4ZA 4BQMA 2HDRA 3HUOA 1ERQA 1M6KA 2Z2MB 3BM6A 1DY6A 4MBFA 1N4OA 2WZXA 1IYQA 4OP8A 5CGSA 4ZAMA 1HZOA 1K56A 3P09A 4JF4A 1ONGA 1JWPA 3C4OA 3W4QA 1ERMA 1PZOA 1MWRA 4DF6A 2JC7A 4Y0UA 1WE4A 3BFGA 3ZFZA 3OPLA 1FSYA 1PW1A 4DE1A 5FASA 3Q1FA 2XFSA 3A3JA 2ZQAA 5FQQA 1EI5A 1ZC2A 2ZC4B 5GLCA 4GD6A 3V50A 1H5XA 2DCFA 2ZM8A 4S2OA 4N9KA 4WZ4A 1AXBA 2PU4A 2HP9A 4UA9A 5HW3A 2ZQ7A 4PM9A 3CJMA 2HDSA 4L0LA 4C3QA 3C4PA 5HX9A 3HLDA 2ZC6B 2OSUA 2XD5A 1MWUA 2XEPA 3IXBA 3MKEA 4FH4A 5FQIA 3UE3A 3V3SA 2ZM0A 1LI9A 3Q7VB 3G4PA 2Y2NA 2WAFA 3MZDA 1XKZA 3LEZA 1IYOA 4X53A 3IWOA 2ZLYA 1KVMA 3VFHA 4D2OA 1MPLA 2HP6A 1L0EA 2XR0A 1LHYA 4BJPA 2G2UA 3PBRA 1BTLA 2R9XA 1JVJA 5EVIB 1DJBA 3IF6B 5FQJA 3VSKA 1KGEA 2A3UA 1HTZA 3A3FA 5AQBA 5FAQA 3S1YA 3QHYA 3PBTA 4R3JA 4DE0A 4Y0OA 4OLGA 3IXDA 4E3MA 2XGNA 5E2EA 3MZEA 4HEFA 5CHMA 5M1AA 4R0QA 3ISGA 1MKIA 3SS3A 4BLMA 4YFMA 1IEMA 3FYZA 4OPQA 5FQ9A 3PAEA 1TDLA 4OKPA 3EQUA 1YLWA 1FR6A 2OV5A 5BOHA 3BLSA 3IQAA 4RYEA 4UA6A 2V2FF 1EROA 1MY8A 5DF8A 1ZKJA 3BRMA 3LCEA 4JXVA 1G6AA 3SOIA 4CJNA 3G32A 2HDQA 2WZZA 1K38A 4DRTA 4WELA 4PPRA 3WS4A 3ZG7B 1ES5A 1HVBA 3IH9A 1IELA 2ZC7A 1NYYA 3OC2A 1YMXA 5GLDA 4C75A 3HLCA 4OVDA 4X69A 5U47A 4KQQA 1K55A 1SHVA 2BLSA 3DTMA 4DDSA 1LLBA 3PTEA 1ONHA 3IXHA 4OQHA 3WRZA 1EWZA 1U60A 4KZ8A 4FD8A 3GMWA 1YLTA 1CI8A 4UA7A 5EOOA 3A3DA 2FFFB 2ZD8A 1XP4A 4F94A 3ZCZA 3MZFA 4PMAA 1L2SA 3Q82A 2WKHA 4GB7A 5DVAA 1Z6FA 3UDXA 1SDNA 3N4IA 3VP2A 1BT5A 4N92A 1LL5A 4E3KA 3C7VA 4E3JA 3AGDA 2ZM2A 1BLPA 3E2KA 2V1ZA 5HFOA 4PM7A 2DRWA 4IBRA 5FAOA 5A93A 5E2GA 1ESUA 1I2WA 3S4XA 1ES3A 3UY6A 1BLHA 2P74A 2XQZA 4FSFA 5CTMA 1NZUA 5KMWA 5HL1A 1K54C 1S0WA 1YM1A 2ZJ9A 5EVIA 1G68A 3VP0A 1CI9A 5CRFA 1ZG4A 2WKEA 4HBUA 2WUQA 4WBGA 2Y2MA 1LL9A 4X55A 4DE3A 5HAQA 4NETA 4U3TA 2XFTA 3CZDA 4GD8A 4Q8IA 3Q07A 3M2JA 4JKTA 2RL3A 3W8KA 2B5RA 2XK1A 3IXGA 1PWCA 3WS0A 5EECA 4MEZA 4S2JA 3S22A 5M18A 1K6RA 3BFDA 4QB8A 3QNBA 1H8YA 1Q2QA 1TEMA 3N8RA 4JXGA 4GDNA 4OQ0A 4IVIA 1TVFA 1MBLA 4E6WA 2EX6A 1QMFA 2HP5A 3A3IA 4KZ7A 5EE8A 3PBQA 3UNWA 2Y91A 1K56D 1DJAA 2G2WA 1NXYA 4OH0A 1GHMA 1NZOA 3O3VA 4M3KA 4EBPA 3NDEA 4U0XA 4WM9A 1KE0A 2Y59A 2ZQCA 4P0MA 1YLPA 2P9VA 1PYYA 2Y2KA 1K57A 3N7WA 2X02A 3N8LA 4X68A 4BL2A 3FZCA 1J9MA 3Q81A 4KQRA 1RCJA 5EOEA 3I7JA 4EV4A 2J8YA 4JF5A 2PU2A 3V3RA 4U0TA 5GHZA 3MFDA 1VQQA 5FATA 4GN2A 5E2FA 4ZJ1A 4DKIA 4QU3A 1CEFA 4K91A 4XXRA 3VSLA 2Q9NA 4RX2A 4S2PA 5GHYA 4JLFA 2E8IA 1FOFA 5DTSA 5AQ7A 3ZG8B 4DXBA 2EX2A 4KZ4A 3DWKA 4P87A 3G30A 5A91A 4BD0A 1SKFA 1IKGA 4DE2A 3ZVWA 1E3UA 2XD1A 4GKUA 4YINA 3ZNTA 1RP5A 1XXMA 3MXSA 3ITBA 5E43A 3LY4A 3IF6A 4K0XA 1E25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VFF A;  1E3U D;  3LO7 A;  2QPN A;  1JTD A;  2H0T A;  3GVB A;  5EVI D;  1MWT A;  3G2Y A;  3BFF A;  4S2L A;  3ZGA B;  3VP1 A;  3HLW A;  3NCK A;  5A92 A;  2ZQ9 A;  1O07 A;  2EX8 A;  1M40 A;  3UDF A;  4KZB A;  1VM1 A;  4JXS A;  1PI5 A;  2VGJ A;  1LI0 A;  4ZJ2 A;  4OQI A;  4JPM A;  4QHC A;  4GZB A;  5HAR A;  4PM8 A;  4Y7P A;  2XDM A;  4H8R A;  4UAA A;  5D3O A;  1BLC A;  3MKF A;  3G31 A;  4WMC D;  1KGF A;  4R4R A;  3WWX A;  5TR7 A;  4MBH A;  1NRF A;  1GA9 A;  1FQG A;  4KEN B;  4FCF A;  5CHJ A;  3VMA A;  4CPK A;  3HRE A;  3OCL A;  3SH8 A;  4S2I A;  1KDS A;  5IHV A;  1FR1 A;  2WK0 A;  3GQZ A;  4OP5 A;  2X71 A;  4LEN A;  5EUA A;  4LCL A;  1FCO A;  3IHA A;  3HLE A;  3N6I A;  4LV1 A;  4JBF A;  2P9V B;  4EWF A;  5KSH A;  3MXR A;  3M6B A;  4IBX A;  4KG2 A;  5GHX A;  1PW8 A;  4WMC A;  1ESI A;  2Y2L A;  4KG5 A;  1XPB A;  1BSG A;  4HES A;  1YT4 A;  2EXA A;  2FFY A;  3SS5 A;  3BEB A;  3UPO A;  4Y0T A;  2QMI A;  3FKW A;  5CHU A;  4PM5 A;  5JYO A;  3HLB A;  3SH7 A;  4EBN A;  3NBL A;  4OOY A;  4O7D A;  3W4P A;  5DF7 A;  2XH9 A;  1K25 A;  1XGJ A;  4MLL A;  2BG1 A;  4JF6 A;  1CK3 A;  2WGW B;  4S2N C;  3AGE A;  3FV7 A;  3UE0 A;  3QNC A;  4KZ6 A;  5FAP A;  2A49 A;  3IT9 A;  4WYY A;  4C6Y A;  3GSG A;  3V39 A;  1JWZ A;  4P6B A;  3HVF A;  5EVL A;  1YLY A;  4KQO A;  5F82 A;  1OME A;  2OLV A;  5EPH A;  1IYS A;  3PBN A;  1PI4 A;  3OPP A;  4S2N A;  2IWD A;  2ZQD A;  4KG6 A;  4GNU A;  1BUE A;  2WGI A;  3NY4 A;  5GLA A;  1ALQ A;  2XF3 A;  3ZG5 A;  4ZJ3 A;  5CGW A;  3GV9 A;  2CC1 A;  3O88 A;  1K57 C;  2EXB A;  4IED A;  1C3B A;  1GCE A;  2Q9M A;  4R4S A;  1BZA A;  1WYB A;  3C7U A;  4LV0 A;  5F83 A;  1NY0 A;  2Y2G A;  4S2K A;  3IWQ A;  1IKI A;  1KVL A;  3BYD A;  3O86 A;  2X01 A;  2JCH A;  1SCW A;  5CED A;  5CXW A;  5TFQ A;  4NK3 A;  4JXW A;  4P85 A;  3ZDJ A;  4ZBE A;  3SH9 A;  3TSG A;  3G34 A;  1K6S A;  1XA1 A;  4K0W A;  4WEK A;  1MXO A;  4BL3 A;  4OPZ A;  4OOL A;  1W8Q A;  5GLB A;  4BEN A;  4RVA A;  2UWX A;  4KZ5 A;  4N9L A;  3IHB A;  4HBT A;  4QY6 A;  3HLF A;  3RJU A;  1N9B A;  2WKI A;  1I2S A;  3WS5 A;  3P98 A;  3FWL A;  2EFU A;  3GRJ A;  5FQK A;  4MNR A;  1K4E A;  3MBZ A;  4KZ9 A;  5KZH A;  5DTT A;  1FCM A;  3HLG A;  2VGK A;  5FSR A;  5EVI C;  4WEJ A;  1HD8 A;  1ES2 A;  3ZHH A;  1YLJ A;  5E2H A;  1NYM A;  4R23 A;  1GHI A;  3EQV A;  3ITA A;  3SS4 A;  3RXX A;  3UPN A;  3VP4 A;  4IVK A;  1KE4 A;  3RXW A;  4KZA A;  1PWG A;  4XUZ A;  2EFX A;  3DW0 A;  2H5S A;  3N8S A;  3G35 A;  3Q7V A;  5HAI A;  2WGV A;  3IWI A;  1L0F A;  3DWZ A;  1KDW A;  4ZDX A;  2WGW A;  1H8Z A;  4GDB A;  3LY3 A;  1S6R A;  2Y2I A;  2ZC5 B;  3OZH A;  2Y2H A;  2Y2Q A;  3IH8 A;  3WS2 A;  4QJG A;  2IWB A;  1QME A;  4UHU A;  5CTN A;  1YQS A;  1RGZ A;  3A3E A;  4ID4 A;  1W7F A;  1TDG A;  2H0Y A;  5I94 A;  2Y2J A;  1BUL A;  4LV3 A;  1CEG A;  5FI2 A;  1ES4 A;  4LV2 A;  3UE1 A;  5TGF A;  4X6T A;  3C5A A;  1FCN A;  5FDH A;  2QZ6 A;  4PM6 A;  3ZG9 B;  3HUM A;  2WAE A;  1K55 C;  3CMZ A;  4FH2 A;  5FI6 A;  3E2L A;  3ZG0 A;  4E3O A;  3OPR A;  1DJC A;  4N1H A;  2HDU A;  3NC8 A;  5AQ9 A;  3UPP A;  3BEC A;  1KGG A;  5KSC A;  4RX3 A;  1XA7 A;  4ZTK A;  1IYP A;  2J9P A;  2Y4A A;  3WRT A;  4B88 A;  5M19 A;  2EX9 A;  2PBY A;  5DTK A;  5J8X A;  5F1G A;  2OLU A;  1W8Y A;  1XGI A;  2J7V A;  3BFE A;  1E4D A;  1NJ4 A;  3WS1 A;  1KE3 A;  4OPR A;  4KZ3 A;  1JWV A;  3TOI A;  5FQM A;  3BLM A;  1I5Q A;  4OOM A;  5G18 A;  5CER A;  2Z2L B;  2Y55 A;  1XX2 A;  1GA0 A;  3IF6 C;  3IF5 A;  3M6H A;  1MWS A;  3UN7 A;  2HPB A;  3FKV A;  3NDG A;  4LCM A;  2I72 A;  3OCN A;  4QD4 A;  1WYC A;  5JYP A;  5L2F A;  3PBO A;  3JYI A;  5FA7 A;  1K4F A;  2RCX A;  2J9O A;  3CG5 A;  4EQI A;  2H10 A;  4EBL A;  1W79 A;  3HL9 A;  3VP3 A;  2DNS A;  1FSW A;  1YLZ A;  4N1X A;  3UDI A;  4E6X A;  3M2K A;  3VOY A;  2Y2P A;  4DDY A;  5DF9 A;  1L0G A;  2C6W B;  3NI9 A;  3G2Z A;  4GOG A;  2XLN A;  5CGX A;  4EUZ A;  5A90 A;  3PBS A;  2ZC3 B;  3ZNY A;  2V20 A;  5CEC A;  2ZQ8 A;  2Y2O A;  4Z9Q A;  1JTG A;  4B4X A;  3D4F A;  3PAG A;  3AGF A;  4RA7 A;  1Q2P A;  1W5D A;  4S2M A;  3VOZ A;  1K54 A;  2WYX A;  3Q7Z A;  4WZ5 A;  3HBR A;  3OPH A;  1PZP A;  4E3N A;  4XUX A;  3UO9 A;  2R9W A;  1YMS A;  1PIO A;  3W4O A;  4BD1 A;  1SDE A;  4OQG A;  5HAP A;  2C5W B;  2WAD A;  3GTC A;  3O87 A;  2IWC A;  4OPY A;  2JBF A;  1BLS A;  3TG9 A;  3V5M A;  3ZVT A;  4OON A;  5CEB A;  4OLD A;  5GL9 A;  3B3X A;  2JE5 A;  4MBK A;  3BFC A;  3NIA A;  4QY5 A;  2ZMA A;  4A5R A;  1L0D A;  2GDN A;  1GHP A;  4X56 A;  5F1F A;  4R1G A;  1RGY A;  4WZ5 C;  1PWD A;  4E3I A;  1O7E A;  1Y54 A;  3GR2 A;  3HUN A;  5FI7 A;  1ZG6 A;  4DXC A;  4E3L A;  4R3B A;  5AQA A;  4B4Z A;  4BQM A;  2HDR A;  3HUO A;  1ERQ A;  1M6K A;  2Z2M B;  3BM6 A;  1DY6 A;  4MBF A;  1N4O A;  2WZX A;  1IYQ A;  4OP8 A;  5CGS A;  4ZAM A;  1HZO A;  1K56 A;  3P09 A;  4JF4 A;  1ONG A;  1JWP A;  3C4O A;  3W4Q A;  1ERM A;  1PZO A;  1MWR A;  4DF6 A;  2JC7 A;  4Y0U A;  1WE4 A;  3BFG A;  3ZFZ A;  3OPL A;  1FSY A;  1PW1 A;  4DE1 A;  5FAS A;  3Q1F A;  2XFS A;  3A3J A;  2ZQA A;  5FQQ A;  1EI5 A;  1ZC2 A;  2ZC4 B;  5GLC A;  4GD6 A;  3V50 A;  1H5X A;  2DCF A;  2ZM8 A;  4S2O A;  4N9K A;  4WZ4 A;  1AXB A;  2PU4 A;  2HP9 A;  4UA9 A;  5HW3 A;  2ZQ7 A;  4PM9 A;  3CJM A;  2HDS A;  4L0L A;  4C3Q A;  3C4P A;  5HX9 A;  3HLD A;  2ZC6 B;  2OSU A;  2XD5 A;  1MWU A;  2XEP A;  3IXB A;  3MKE A;  4FH4 A;  5FQI A;  3UE3 A;  3V3S A;  2ZM0 A;  1LI9 A;  3Q7V B;  3G4P A;  2Y2N A;  2WAF A;  3MZD A;  1XKZ A;  3LEZ A;  1IYO A;  4X53 A;  3IWO A;  2ZLY A;  1KVM A;  3VFH A;  4D2O A;  1MPL A;  2HP6 A;  1L0E A;  2XR0 A;  1LHY A;  4BJP A;  2G2U A;  3PBR A;  1BTL A;  2R9X A;  1JVJ A;  5EVI B;  1DJB A;  3IF6 B;  5FQJ A;  3VSK A;  1KGE A;  2A3U A;  1HTZ A;  3A3F A;  5AQB A;  5FAQ A;  3S1Y A;  3QHY A;  3PBT A;  4R3J A;  4DE0 A;  4Y0O A;  4OLG A;  3IXD A;  4E3M A;  2XGN A;  5E2E A;  3MZE A;  4HEF A;  5CHM A;  5M1A A;  4R0Q A;  3ISG A;  1MKI A;  3SS3 A;  4BLM A;  4YFM A;  1IEM A;  3FYZ A;  4OPQ A;  5FQ9 A;  3PAE A;  1TDL A;  4OKP A;  3EQU A;  1YLW A;  1FR6 A;  2OV5 A;  5BOH A;  3BLS A;  3IQA A;  4RYE A;  4UA6 A;  2V2F F;  1ERO A;  1MY8 A;  5DF8 A;  1ZKJ A;  3BRM A;  3LCE A;  4JXV A;  1G6A A;  3SOI A;  4CJN A;  3G32 A;  2HDQ A;  2WZZ A;  1K38 A;  4DRT A;  4WEL A;  4PPR A;  3WS4 A;  3ZG7 B;  1ES5 A;  1HVB A;  3IH9 A;  1IEL A;  2ZC7 A;  1NYY A;  3OC2 A;  1YMX A;  5GLD A;  4C75 A;  3HLC A;  4OVD A;  4X69 A;  5U47 A;  4KQQ A;  1K55 A;  1SHV A;  2BLS A;  3DTM A;  4DDS A;  1LLB A;  3PTE A;  1ONH A;  3IXH A;  4OQH A;  3WRZ A;  1EWZ A;  1U60 A;  4KZ8 A;  4FD8 A;  3GMW A;  1YLT A;  1CI8 A;  4UA7 A;  5EOO A;  3A3D A;  2FFF B;  2ZD8 A;  1XP4 A;  4F94 A;  3ZCZ A;  3MZF A;  4PMA A;  1L2S A;  3Q82 A;  2WKH A;  4GB7 A;  5DVA A;  1Z6F A;  3UDX A;  1SDN A;  3N4I A;  3VP2 A;  1BT5 A;  4N92 A;  1LL5 A;  4E3K A;  3C7V A;  4E3J A;  3AGD A;  2ZM2 A;  1BLP A;  3E2K A;  2V1Z A;  5HFO A;  4PM7 A;  2DRW A;  4IBR A;  5FAO A;  5A93 A;  5E2G A;  1ESU A;  1I2W A;  3S4X A;  1ES3 A;  3UY6 A;  1BLH A;  2P74 A;  2XQZ A;  4FSF A;  5CTM A;  1NZU A;  5KMW A;  5HL1 A;  1K54 C;  1S0W A;  1YM1 A;  2ZJ9 A;  5EVI A;  1G68 A;  3VP0 A;  1CI9 A;  5CRF A;  1ZG4 A;  2WKE A;  4HBU A;  2WUQ A;  4WBG A;  2Y2M A;  1LL9 A;  4X55 A;  4DE3 A;  5HAQ A;  4NET A;  4U3T A;  2XFT A;  3CZD A;  4GD8 A;  4Q8I A;  3Q07 A;  3M2J A;  4JKT A;  2RL3 A;  3W8K A;  2B5R A;  2XK1 A;  3IXG A;  1PWC A;  3WS0 A;  5EEC A;  4MEZ A;  4S2J A;  3S22 A;  5M18 A;  1K6R A;  3BFD A;  4QB8 A;  3QNB A;  1H8Y A;  1Q2Q A;  1TEM A;  3N8R A;  4JXG A;  4GDN A;  4OQ0 A;  4IVI A;  1TVF A;  1MBL A;  4E6W A;  2EX6 A;  1QMF A;  2HP5 A;  3A3I A;  4KZ7 A;  5EE8 A;  3PBQ A;  3UNW A;  2Y91 A;  1K56 D;  1DJA A;  2G2W A;  1NXY A;  4OH0 A;  1GHM A;  1NZO A;  3O3V A;  4M3K A;  4EBP A;  3NDE A;  4U0X A;  4WM9 A;  1KE0 A;  2Y59 A;  2ZQC A;  4P0M A;  1YLP A;  2P9V A;  1PYY A;  2Y2K A;  1K57 A;  3N7W A;  2X02 A;  3N8L A;  4X68 A;  4BL2 A;  3FZC A;  1J9M A;  3Q81 A;  4KQR A;  1RCJ A;  5EOE A;  3I7J A;  4EV4 A;  2J8Y A;  4JF5 A;  2PU2 A;  3V3R A;  4U0T A;  5GHZ A;  3MFD A;  1VQQ A;  5FAT A;  4GN2 A;  5E2F A;  4ZJ1 A;  4DKI A;  4QU3 A;  1CEF A;  4K91 A;  4XXR A;  3VSL A;  2Q9N A;  4RX2 A;  4S2P A;  5GHY A;  4JLF A;  2E8I A;  1FOF A;  5DTS A;  5AQ7 A;  3ZG8 B;  4DXB A;  2EX2 A;  4KZ4 A;  3DWK A;  4P87 A;  3G30 A;  5A91 A;  4BD0 A;  1SKF A;  1IKG A;  4DE2 A;  3ZVW A;  1E3U A;  2XD1 A;  4GKU A;  4YIN A;  3ZNT A;  1RP5 A;  1XXM A;  3MXS A;  3ITB A;  5E43 A;  3LY4 A;  3IF6 A;  4K0X A;  1E25 A; 
#chains in the Genus database with same CATH topology
 3VFF A;  5EVI D;  4S2L A;  3BFF A;  3NCK A;  3H9W A;  5HWW A;  3UDF A;  4ETZ A;  4KUK A;  4OQI A;  4JPM A;  4GZB A;  5HAR A;  4Y7P A;  2OWH A;  3UMD A;  5HDC A;  1VB6 A;  1V9Y A;  4X1M A;  4OP5 A;  4LEN A;  4LCL A;  3IHA A;  3HLE A;  4JBF A;  4LRZ E;  4YOF A;  2FZ0 A;  4KG2 A;  3SW1 A;  4WF0 A;  1ESI A;  3R7W B;  4KG5 A;  4HES A;  1VEU B;  2EXA A;  3A0V A;  3SH7 A;  3NBL A;  5DF7 A;  4B9O A;  1K25 A;  3CI6 A;  4CQH A;  1XGJ A;  2WGW B;  3QNC A;  4KZ6 A;  4MN7 A;  3A0S A;  4C6Y A;  3V39 A;  1F98 A;  5F69 A;  5EVL A;  4R3A A;  4IJG A;  1OME A;  2L1M A;  2V0W A;  3PBN A;  4MN5 A;  4KG6 A;  2PBD P;  4ZRR A;  4I3A A;  5GLA A;  1ALQ A;  2XF3 A;  3GV9 A;  1VEU A;  2CC1 A;  2OWJ A;  2UV0 E;  3O88 A;  4NG2 A;  1WYB A;  3HJI A;  1GSV A;  4EUV A;  4LV0 A;  5F83 A;  2Y2G A;  4UQI S;  3DAV A;  1IKI A;  1TS6 A;  1KVL A;  2X01 A;  5CED A;  5CXW A;  3U2A A;  4ZBE A;  2J3T D;  3TSG A;  1XA1 A;  3IS2 B;  2W1T A;  3CAX A;  3NJA A;  4KUO A;  4X1L A;  2Z6D A;  1PNE A;  3HJK A;  2EFU A;  3GRJ A;  2LB5 A;  5FSR A;  5EVI C;  1EW0 A;  2D02 A;  2OAQ 1;  3MS6 A;  2B18 A;  4KZA A;  5HAI A;  3LUQ A;  3IWI A;  3VE3 A;  1H8Z A;  3T50 A;  1S6R A;  2Y2I A;  3LEQ A;  4YWZ A;  5I94 A;  4K08 A;  4LV3 A;  1CEG A;  1S4R A;  4X6T A;  3ZG9 B;  4EXO A;  3CMZ A;  3VOL A;  4R38 A;  1DJC A;  2HJE A;  5HWV A;  4UQI M;  1XA7 A;  4ZTK A;  4WL9 A;  5J8X A;  5F1G A;  4H6J A;  1W8Y A;  3WS1 A;  2JHE A;  2H28 A;  4Y15 A;  3TOI A;  5FQM A;  2W0N A;  3LR0 A;  1I5Q A;  2YKH A;  3QP2 A;  1G6O A;  5F68 A;  1OT6 A;  3UN7 A;  2ZOH A;  2I72 A;  4CLC D;  3PBO A;  4MN6 A;  1K4F A;  4L9F A;  4EQI A;  1W79 A;  1FSW A;  2JKF A;  3VOY A;  3EEH A;  3MSH A;  3G2Z A;  2B02 A;  3QP8 A;  5A90 A;  3PBS A;  3ZNY A;  2V8F A;  3ULF A;  5CEC A;  2ZQ8 A;  3D4F A;  2VA0 A;  2WYX A;  4WZ5 A;  1CJF A;  1OTA A;  4EW7 A;  3UO9 A;  3KO6 A;  3S7N A;  4OQG A;  1Y4O A;  2NUT C;  3GTC A;  2JBF A;  1F5M A;  3V5M A;  5DJT A;  5GL9 A;  4QY5 A;  4HHD A;  2ZMA A;  4I3I A;  4LGW A;  4WZ5 C;  3HCY A;  1PWD A;  4E3I A;  3A0R A;  4E3L A;  5AQA A;  2HDR A;  1M6K A;  2WZX A;  3CLO A;  4GS9 A;  4RQ9 A;  1T19 A;  1Y28 A;  2P04 A;  3P09 A;  3DTE A;  1JWP A;  1PZO A;  2JC7 A;  3RTY A;  1OPX A;  4BMW A;  1TF1 A;  5K5B A;  3OPL A;  5FAS A;  1PW1 A;  3A3J A;  1EI5 A;  1ZC2 A;  3ICY A;  3V50 A;  4Y5F A;  2DCF A;  4WZ4 A;  4I5S A;  2PU4 A;  2HP9 A;  5HW3 A;  2ZQ7 A;  4PM9 A;  2HDS A;  4C3Q A;  3LID A;  2OSU A;  3UE3 A;  1LI9 A;  1T1C A;  3CHW P;  1IYO A;  4X53 A;  2W3E A;  3QP1 A;  2HP6 A;  1L0E A;  1LHY A;  2G2U A;  1BTL A;  2R9X A;  4XT2 A;  1DP9 A;  1DJB A;  4NEE D;  2HV1 A;  1KGE A;  2A3U A;  5FAQ A;  3OOV A;  3C2W A;  5DFY A;  2Z6C A;  3T4Q A;  4WUJ A;  3MFX A;  1VET A;  4OPQ A;  2HJ9 C;  4OKP A;  5DF8 A;  3IQA A;  4UA6 A;  1STZ A;  3G32 A;  3E4Q A;  4BBU A;  4F3L B;  1K38 A;  1ES5 A;  3UB6 A;  1NYY A;  2VKS A;  3KYE A;  5GLD A;  3HLC A;  1K55 A;  3B33 A;  2BLS A;  5LBR A;  5HPI A;  2W27 A;  2GNX A;  4UA7 A;  2IA2 A;  4HY8 A;  2FFF B;  2ZD8 A;  3T4T A;  2O9B A;  4PMA A;  1L2S A;  5DVA A;  1Z6F A;  3UDX A;  2GX5 A;  1LL5 A;  2G7U A;  1BLP A;  3E2K A;  4DJ3 A;  2V1Z A;  1H0M A;  4F3L A;  2DRW A;  4EEP A;  5L07 A;  1I2W A;  3S4X A;  1S4S A;  1YPR A;  1YM1 A;  3NOU C;  5EVI A;  1G68 A;  3E0Y A;  1CI9 A;  1ZG4 A;  2WKE A;  2WUQ A;  1N9O A;  2Y2M A;  4U3T A;  3CZD A;  3KSI A;  4R70 A;  3L9K A;  2ZOI A;  2RL3 A;  2B5R A;  3E4O A;  1PWC A;  4WLA A;  4MEZ A;  1VHM A;  1K6R A;  3BFD A;  1TD5 A;  1TEM A;  4JXG A;  3JVU A;  1QMF A;  4KZ7 A;  5EV0 A;  3KYZ A;  2A2L A;  1K56 D;  1NZO A;  3O3V A;  4M3K A;  4EBP A;  2W1T B;  1P9R A;  1KE0 A;  4Z1W A;  2Y59 A;  4L9E A;  1YLP A;  1K57 A;  3FZC A;  1D06 A;  3Q81 A;  5EOE A;  5I5L A;  2PU2 A;  5G4Y A;  5GHZ A;  1T1B A;  1VQQ A;  1NWZ A;  5IS1 A;  4RX2 A;  5A8B A;  1T18 A;  4UEY A;  2Y79 A;  3ZG8 B;  4P87 A;  4DE2 A;  3ZQ5 A;  2XD1 A;  3ZNT A;  1RP5 A;  4AFI A;  3IF6 A;  3DTK A;  3PYP A;  2KDK A;  2WKP A;  1D7E A;  2H0T A;  3MJQ A;  3HLW A;  1XJ4 A;  2JKR I;  2EX8 A;  1M40 A;  4KZB A;  1VM1 A;  4H8R A;  1UWP X;  3P7N A;  2P08 A;  3WWX A;  2ZBB A;  2PYR A;  1NRF A;  4MBH A;  1FQG A;  3VMA A;  3IS2 A;  3SH8 A;  3R4K A;  5IHV A;  2WK0 A;  3GQZ A;  3F1N B;  3C8C A;  5HZH A;  5KSH A;  2P9V B;  3LIC A;  4IBX A;  5HL6 A;  5L8M A;  4WMC A;  2FFY A;  3PXP A;  3FKW A;  5JYO A;  4Y17 A;  3HLB A;  4EBN A;  1DRM A;  1CK3 A;  3UE0 A;  5FAP A;  2A49 A;  3IT9 A;  2Q0O A;  4P6B A;  3P01 A;  4KQO A;  5F82 A;  3D9Y A;  4S2N A;  5DFX A;  4EU0 A;  1K57 C;  3C30 A;  2Q9M A;  1BZA A;  4PAU A;  5J7E A;  3BYD A;  3LR5 A;  2LB9 A;  4NK3 A;  5KIZ A;  2PYP A;  3ZDJ A;  3TW8 A;  1K6S A;  4WEK A;  1MXO A;  4BL3 A;  4OOL A;  4RVA A;  2UWX A;  3IHB A;  2W3G A;  3JVV A;  3FWL A;  2OAP 1;  5FQK A;  3OBF A;  3D3O A;  3SZT A;  1K4E A;  2PAV P;  4Q0H A;  3CUE A;  4GHI A;  1HD8 A;  2PRF A;  3ZHH A;  5HPF A;  4IVK A;  3RXW A;  4IUK A;  4XUZ A;  2PR6 A;  4O8G A;  1KDW A;  3LR4 A;  4UHU A;  1XJ2 A;  3A3E A;  3QP6 A;  4ID4 A;  1W7F A;  1TDG A;  3UE1 A;  5FDH A;  4I38 A;  3QP5 A;  1K55 C;  5FI6 A;  3CIT A;  3E2L A;  3ZG0 A;  3BEC A;  5KSC A;  3LYX A;  2VV6 A;  2Y4A A;  1T1A A;  2B95 A;  2EX9 A;  2D01 A;  2PBY A;  5DTK A;  3BFE A;  1E4D A;  1KE3 A;  2JKG A;  4G3V A;  1OTE A;  4OOM A;  5G18 A;  2ZMV A;  3KSH A;  4HQA A;  3IF5 A;  1GA0 A;  3T1R A;  4NXG A;  3OCN A;  1WYC A;  5FA7 A;  4ESP A;  2RCX A;  3HL9 A;  4N1X A;  4E6X A;  1YLZ A;  2W1R A;  4DDY A;  1L0G A;  2C6W B;  1XFQ A;  5CGX A;  2ZC3 B;  2O99 A;  2Y2O A;  4Z9Q A;  4RA7 A;  1W5D A;  3MF0 A;  3OPH A;  1PZP A;  4XUX A;  1PIO A;  3W4O A;  5J4E A;  5HAP A;  2C5W B;  2WAD A;  5C5K A;  3O87 A;  2IWC A;  2QWS A;  3TG9 A;  3FC7 A;  3ZVT A;  1TS8 A;  3BFC A;  1L0D A;  1VET B;  1GHP A;  1O7E A;  3GR2 A;  3HUN A;  3NEC A;  5FI7 A;  4DXC A;  5FEF A;  1Z09 A;  1P0Z A;  4JGP A;  1IYQ A;  4ZAM A;  3F1P A;  4JF4 A;  3C4O A;  3W4Q A;  2VJW A;  4Y0U A;  3ZFZ A;  1FSY A;  3UB8 A;  3Q1F A;  3T1X A;  1D1J A;  3E98 A;  2JKR M;  1MZU A;  2ZM8 A;  4S2O A;  4UA9 A;  4PHT A;  5HX9 A;  3IXB A;  4FH4 A;  1MWU A;  2XEP A;  3MKE A;  5FQI A;  2ZM0 A;  1ACF A;  3DBA A;  1LSW A;  3IWO A;  1KVM A;  3VFH A;  4D2O A;  2ACG A;  4HJ4 A;  1JVJ A;  5EVI B;  3IF6 B;  5FQJ A;  3T4J A;  2A24 A;  3S7P A;  4LRY C;  1F9I A;  3LGO A;  2VEA A;  2XRN A;  4OLG A;  3IXD A;  4HI4 A;  3R7W A;  2XGN A;  5E2E A;  4HEF A;  5CHM A;  1IEM A;  1XJ3 A;  1TDL A;  4RYE A;  4I3J A;  1ZKJ A;  3BQA A;  3SOI A;  4CJN A;  2HDQ A;  5EM1 A;  5AJG A;  1HVB A;  2ZC7 A;  1PRQ A;  2A24 B;  3OC2 A;  4NXF A;  4X69 A;  3BY8 A;  1ONH A;  4OQH A;  2K2N A;  2VX8 A;  3WRZ A;  1EWZ A;  1KOU A;  1U60 A;  1CI8 A;  3H7W A;  3T4L A;  3Q82 A;  1SDN A;  3N4I A;  1BT5 A;  4N92 A;  1NLY A;  2YKF A;  4IBR A;  5A93 A;  5HDS A;  3F1O B;  4O01 A;  1ES3 A;  4FSF A;  2XQZ A;  5KMW A;  1S0W A;  3CUE C;  3VP0 A;  5CRF A;  3IBR A;  1LL9 A;  3OLO A;  4NET A;  2XFT A;  2QHK A;  4JGO A;  3WS0 A;  5TBM B;  1XJ6 A;  4HP9 A;  1LL8 A;  1JNU A;  4QB8 A;  3QNB A;  4II7 A;  1Q2Q A;  2JKT M;  3N8R A;  1GSX A;  2V1A A;  2O0Y A;  3UNW A;  1S1Y A;  4MMN A;  2Y91 A;  4OH0 A;  1DJA A;  2G2W A;  1GHM A;  3F1N A;  4P0M A;  2P9V A;  3N7W A;  2X02 A;  4X68 A;  1J9M A;  1RCJ A;  3I7J A;  4U0T A;  3MFD A;  3GEC A;  4DKI A;  1CEF A;  4K91 A;  4MCW A;  1SKO A;  4JLF A;  4Y3I A;  5A91 A;  3G30 A;  2J3W A;  1IKG A;  3ZVW A;  3ITB A;  3LY4 A;  3S7O A;  4Q0J A;  4DN0 A;  2PR5 A;  4Y13 A;  1E3U D;  3LO7 A;  1JTD A;  3FPW A;  3MQ0 A;  3VV4 A;  3G2Y A;  3ZGA B;  5A92 A;  1IOU A;  2ZMF A;  1O07 A;  5FL3 A;  4JXS A;  1PI5 A;  2VGJ A;  4Y2F A;  1LI0 A;  4ZJ2 A;  4QHC A;  4PM8 A;  5D3O A;  1BLC A;  1KGF A;  4KEN B;  4FCF A;  3HRE A;  4S2I A;  1KDS A;  3LIB A;  1G28 A;  2X71 A;  1PFL A;  1FCO A;  3N6I A;  4EWF A;  1HLU P;  3MXR A;  5GHX A;  1OT9 A;  3IBJ A;  2Y2L A;  1P9W A;  1YT4 A;  3SS5 A;  3BEB A;  3UPO A;  4NXB A;  4Y0T A;  3FPV A;  5CHU A;  1GSW A;  1NLZ A;  3DTI A;  4OOY A;  4BBV A;  4HP4 A;  3KSG A;  2XH9 A;  4GLQ A;  4MLL A;  4S2N C;  4WYY A;  3GSG A;  4CLC B;  2E8J A;  2OLV A;  1BYW A;  4LRX C;  2EWW A;  1PI4 A;  2DMW A;  1LSX A;  1BUE A;  3CWF A;  5EVE A;  3NY4 A;  3ZG5 A;  5G4Z A;  1GCE A;  4ME4 A;  3C7U A;  4S2K A;  3B47 A;  3IWQ A;  5HD5 A;  5MC7 A;  3O86 A;  1SCW A;  3MXQ A;  2XA7 S;  5TFQ A;  4JXW A;  3SH9 A;  4OPZ A;  1YSP A;  4BEN A;  4KZ5 A;  1XFN A;  1YAX A;  3HLF A;  3QP4 A;  3RJU A;  3WS5 A;  2WKI A;  2PDR A;  3MBZ A;  1L3L A;  2VGK A;  4WEJ A;  1YLJ A;  4R23 A;  3EQV A;  3ITA A;  1UGU A;  3RXX A;  3VP4 A;  1KE4 A;  2W3D A;  4ETX A;  1PWG A;  3DW0 A;  2H5S A;  4FTX A;  3N8S A;  4ZDX A;  1L0F A;  3DWZ A;  4HJ3 A;  4GDB A;  3LY3 A;  3OZH A;  3IH8 A;  4QJG A;  2IWB A;  1QME A;  5CTN A;  1RGZ A;  4ARZ B;  4EEU A;  2H0Y A;  1V9Z A;  5TGF A;  3C5A A;  2QZ6 A;  4PM6 A;  2L4R A;  1H3Q A;  3OPR A;  4N1H A;  3UPP A;  1MC0 A;  4RX3 A;  3W2Z A;  2J9P A;  4NKP A;  2XSS A;  4B88 A;  4EER A;  2OLU A;  1XGI A;  5AVE A;  2J7V A;  1NJ4 A;  4KZ3 A;  3NUL A;  1JWV A;  5F6A A;  5CX7 A;  3BLM A;  5CER A;  2Z2L B;  3EGX C;  3IF6 C;  3T4K A;  1MWS A;  2HPB A;  3FKV A;  4QD4 A;  5JYP A;  5L2F A;  2J9O A;  3CG5 A;  2H10 A;  2DNS A;  2WKR A;  4EET B;  3H7W B;  2VGL M;  4EUZ A;  2VZW A;  2V20 A;  3GDI A;  4B4X A;  2KLI A;  2FH5 A;  3PAG A;  1Q2P A;  4S2M A;  3LIE A;  4B93 A;  4IUH A;  3HBR A;  2V1B A;  2R9W A;  4JGR A;  3F1O A;  1OTD A;  1YMS A;  2HZ5 A;  1LT0 A;  4KQD A;  4OON A;  4OLD A;  2JE5 A;  4MBK A;  3NIA A;  4A5R A;  2GDN A;  3BQ8 A;  3K3D A;  2BAS A;  3S7Q A;  1Y54 A;  4LPZ A;  4R3B A;  4FUW A;  4BQM A;  4EQ1 A;  1ERQ A;  2M7U A;  2W3F A;  1DY6 A;  1N4O A;  4OP8 A;  1HZO A;  1K56 A;  2PD8 A;  1ONG A;  1ERM A;  1MWR A;  1CQA A;  1N9L A;  2EWV A;  1WE4 A;  3BFG A;  4QWO A;  2XFS A;  4GD6 A;  1H5X A;  3E4P A;  4N9K A;  3TJZ C;  1AXB A;  3H82 B;  4I39 A;  3CJM A;  5TJJ A;  4L0L A;  2PHY A;  4PKY A;  3HLD A;  4HOI A;  3Q7V B;  3T4O A;  2WAF A;  3MZD A;  1XKZ A;  3LEZ A;  4CLC E;  2PD7 A;  3MQO A;  2J3T C;  4LLO B;  3K2N A;  4BJP A;  3C38 A;  3VSK A;  3UME A;  1HTZ A;  1G5U A;  3QHY A;  4R3J A;  3ZYT A;  5HD3 A;  2Y8H A;  4R0Q A;  3ISG A;  1MKI A;  3H82 A;  4BLM A;  4YFM A;  3PAE A;  1NRJ A;  1YLW A;  3BLS A;  1ODV A;  2V2F F;  1ERO A;  4JXV A;  4DRT A;  4WEL A;  1S67 L;  4PPR A;  3G6O A;  1S66 L;  5EM0 A;  4OVD A;  5U47 A;  1AWI A;  4KQQ A;  5DJU A;  3DTM A;  3IX8 A;  4KZ8 A;  1YLT A;  3MMH A;  3A3D A;  1OJ5 A;  1XP4 A;  4F94 A;  3ZCZ A;  1ZTU A;  2WKH A;  3VP2 A;  3IX3 A;  1P97 A;  4E3K A;  3C7V A;  5FEG A;  3AGD A;  3KYQ A;  4H6J B;  4PM7 A;  1ESU A;  2V0U A;  4P6Z M;  1NZU A;  3LI9 A;  4PKY G;  2ZJ9 A;  5L09 A;  2QYB A;  4WBG A;  1A0K A;  1UWN X;  4X55 A;  5HAQ A;  4DE3 A;  4CLC C;  3CPT A;  4GD8 A;  2R78 A;  4Q8I A;  4O0P A;  3KX0 X;  4JKT A;  4DMZ A;  2XK1 A;  2INW A;  5EEC A;  3S22 A;  1N9N A;  1LSV A;  3T1S A;  4GDN A;  5HDD A;  1TVF A;  2EX6 A;  5EE8 A;  3PBQ A;  2XRO A;  3NDE A;  2ZQC A;  1PYY A;  3N8L A;  3LI8 A;  4EV4 A;  3V3R A;  5FAT A;  5E2F A;  1YSQ A;  4XXR A;  2Q9N A;  4S2P A;  5GHY A;  3IX4 A;  2E8I A;  1MKM A;  5AQ7 A;  4DXB A;  2EX2 A;  5F5Y A;  4E04 A;  1E3U A;  2PT7 A;  5HSQ A;  4YIN A;  3TRC A;  4CLC A;  5DKK A;  1XXM A;  2QJ5 A;  3MXS A;  5E43 A;  1ZHH B;  2QKP A;  2QPN A;  3GVB A;  4LFU A;  1MWT A;  3VP1 A;  2ZQ9 A;  2W3H A;  1FIK A;  3LIF A;  2VK3 A;  2P7J A;  3T4S A;  2XDM A;  4UAA A;  3MKF A;  3G31 A;  4WMC D;  4R4R A;  5TR7 A;  1GA9 A;  5CHJ A;  4CPK A;  3OCL A;  4NXE A;  1FR1 A;  5EUA A;  1DP6 A;  3UB9 A;  4LV1 A;  2GJ3 A;  3M6B A;  1PW8 A;  4HIA A;  1XPB A;  1BSG A;  4BWI A;  2QMI A;  4PM5 A;  2EA9 A;  5J3W A;  3W4P A;  4O7D A;  2BG1 A;  4JF6 A;  3RH8 B;  1WA9 A;  3AGE A;  2GZA A;  3FV7 A;  2I9V A;  3MR0 A;  4HNB A;  1JWZ A;  3F1P B;  3HVF A;  1YLY A;  4P6Z S;  2ZL1 B;  5EPH A;  1IYS A;  3OPP A;  2IWD A;  2ZQD A;  4GNU A;  2WGI A;  3B42 A;  2MJ6 A;  5CGW A;  4ZJ3 A;  2EXB A;  4IED A;  1C3B A;  4R4S A;  3LIA A;  2JKT I;  1NY0 A;  3O5Y A;  2CMN A;  4DJ2 A;  2JCH A;  3PHY A;  4BBT A;  4P85 A;  3G34 A;  3JPU A;  1DP8 A;  4K0W A;  1J3W A;  1W8Q A;  5GLB A;  1TS7 A;  4N9L A;  4HBT A;  4QY6 A;  1N9B A;  1I2S A;  3P98 A;  3UE6 A;  4MNR A;  4KZ9 A;  4EES A;  5DTT A;  5KZH A;  1FCM A;  2HF6 A;  5AVF A;  3HLG A;  1ES2 A;  2L0W A;  5E2H A;  1NYM A;  5IU1 A;  1GHI A;  3SS4 A;  3UPN A;  2EFX A;  3Q7V A;  3G35 A;  1H8M A;  2WGV A;  1OTB A;  2WGW A;  4FOF A;  3TE8 A;  2ZC5 B;  2Y2H A;  2Y2Q A;  3WS2 A;  4R6L A;  1YQS A;  3LR3 A;  2Y2J A;  1BUL A;  3EWK A;  5FI2 A;  1ES4 A;  4LV2 A;  3L7H A;  1TS0 A;  1FCN A;  3HUM A;  2WAE A;  4FH2 A;  4E3O A;  2HDU A;  3NC8 A;  5AQ9 A;  5HWT A;  3T1Q B;  1FIL A;  1KGG A;  1IYP A;  3WRT A;  5M19 A;  2M7V A;  3BW6 A;  4OPR A;  3NHQ A;  4G3K A;  2Y55 A;  1XX2 A;  3M6H A;  4YNR A;  3NDG A;  4LCM A;  3VE4 A;  3JYI A;  2J80 A;  4EBL A;  3VP3 A;  3UDI A;  3M2K A;  2Y2P A;  5DF9 A;  3NI9 A;  4GOG A;  2XLN A;  5TBM A;  1F2K A;  3RFB A;  2AVX A;  4D60 A;  1JTG A;  5FDS A;  2KX6 A;  3AGF A;  1W63 M;  3VOZ A;  1K54 A;  3Q7Z A;  3D72 A;  4E3N A;  2QJ7 A;  3U4L P;  4BD1 A;  1SDE A;  1SZV A;  2WKQ A;  3BJN A;  4OPY A;  1BLS A;  5CEB A;  3B3X A;  4X56 A;  5F1F A;  4R1G A;  1RGY A;  1SKO B;  4Q0I A;  3T12 B;  1ZG6 A;  4B4Z A;  3HUO A;  2Z2M B;  3PR6 A;  2V8C A;  2M1C A;  3BM6 A;  3MQQ A;  3FG8 A;  4MBF A;  4X25 A;  5CGS A;  2OOL A;  4DF6 A;  4DE1 A;  5GLC A;  1OJG A;  5FQQ A;  2ZQA A;  1OTI A;  2ZC4 B;  4L9G A;  2HGV A;  3C4P A;  3UB7 A;  2ZC6 B;  2XD5 A;  3V3S A;  4JGQ A;  3G4P A;  2Y2N A;  4M4X A;  3BWL A;  2ZLY A;  1MPL A;  1YKD A;  2XR0 A;  2VV8 A;  3PBR A;  5IT5 A;  3A3F A;  5AQB A;  3S1Y A;  2NUP C;  3PBT A;  4DE0 A;  3CPT B;  4Y0O A;  1IFQ A;  4E3M A;  3MZE A;  3KSF A;  5M1A A;  3SS3 A;  3FYZ A;  5FQ9 A;  1S1Z A;  5EFW A;  2K31 A;  4GHI B;  3EQU A;  1FR6 A;  2OV5 A;  5BOH A;  4GW9 A;  3EOI A;  1MY8 A;  3BRM A;  3LCE A;  1G6A A;  1K0K A;  2WZZ A;  4IHQ A;  3WS4 A;  3ZG7 B;  3IH9 A;  4GS9 B;  1IEL A;  3NOT C;  2XA7 M;  1YMX A;  4HH3 A;  4C75 A;  1SHV A;  4HJ6 A;  4DDS A;  1LLB A;  3PTE A;  3IXH A;  1X0O A;  4FD8 A;  3GMW A;  5EOO A;  3MZF A;  2JN7 A;  4GB7 A;  5DKL A;  4E3J A;  4QPR A;  1W63 Q;  2VV7 A;  2ZM2 A;  3EEA A;  5HFO A;  5FAO A;  3BY9 A;  2KOI A;  5E2G A;  3UB5 P;  5L10 A;  3K3C A;  3UY6 A;  1BLH A;  2P74 A;  4G3W A;  5CTM A;  5HL1 A;  1K54 C;  3NOP C;  4XT2 B;  4HBU A;  2K7S A;  4HH2 A;  3Q07 A;  3V67 A;  3M2J A;  3W8K A;  3IXG A;  4MDZ A;  4S2J A;  5M18 A;  1H8Y A;  4OQ0 A;  2V9A A;  4IVI A;  1MBL A;  4E6W A;  2HP5 A;  3A3I A;  1NXY A;  4U0X A;  4WM9 A;  4ARZ A;  2O9A A;  2O9C A;  2Y2K A;  3EGD C;  4BL2 A;  4KQR A;  2BTF P;  2J8Y A;  4JF5 A;  4GN2 A;  4ZJ1 A;  4QU3 A;  2VLG A;  3VSL A;  1FOF A;  5DTS A;  4GCZ A;  4KZ4 A;  3DWK A;  4BD0 A;  1SKF A;  4GKU A;  4GJ4 A;  3LFV A;  2VGL S;  1CF0 A;  2ZL1 A;  4K0X A;  4WN5 A;  1E25 A; 
#chains in the Genus database with same CATH homology
 3VFF A;  1E3U D;  3LO7 A;  2QPN A;  1JTD A;  2H0T A;  3GVB A;  5EVI D;  1MWT A;  3G2Y A;  3BFF A;  4S2L A;  3ZGA B;  3VP1 A;  3HLW A;  3NCK A;  5A92 A;  2ZQ9 A;  1O07 A;  2EX8 A;  1M40 A;  3UDF A;  4KZB A;  1VM1 A;  4JXS A;  1PI5 A;  2VGJ A;  1LI0 A;  4ZJ2 A;  4OQI A;  4JPM A;  4QHC A;  4GZB A;  5HAR A;  4PM8 A;  4Y7P A;  2XDM A;  4H8R A;  4UAA A;  5D3O A;  1BLC A;  3MKF A;  3G31 A;  4WMC D;  1KGF A;  4R4R A;  3WWX A;  5TR7 A;  4MBH A;  1NRF A;  1GA9 A;  1FQG A;  4KEN B;  4FCF A;  5CHJ A;  3VMA A;  4CPK A;  3HRE A;  3OCL A;  3SH8 A;  4S2I A;  1KDS A;  5IHV A;  1FR1 A;  2WK0 A;  3GQZ A;  4OP5 A;  2X71 A;  4LEN A;  5EUA A;  4LCL A;  1FCO A;  3IHA A;  3HLE A;  3N6I A;  4LV1 A;  4JBF A;  2P9V B;  4EWF A;  5KSH A;  3MXR A;  3M6B A;  4IBX A;  4KG2 A;  5GHX A;  1PW8 A;  4WMC A;  1ESI A;  2Y2L A;  4KG5 A;  1XPB A;  1BSG A;  4HES A;  1YT4 A;  2EXA A;  2FFY A;  3SS5 A;  3BEB A;  3UPO A;  4Y0T A;  2QMI A;  3FKW A;  5CHU A;  4PM5 A;  5JYO A;  3HLB A;  3SH7 A;  4EBN A;  3NBL A;  4OOY A;  4O7D A;  3W4P A;  5DF7 A;  2XH9 A;  1K25 A;  1XGJ A;  4MLL A;  2BG1 A;  4JF6 A;  1CK3 A;  2WGW B;  4S2N C;  3AGE A;  3FV7 A;  3UE0 A;  3QNC A;  4KZ6 A;  5FAP A;  2A49 A;  3IT9 A;  4WYY A;  4C6Y A;  3GSG A;  3V39 A;  1JWZ A;  4P6B A;  3HVF A;  5EVL A;  1YLY A;  4KQO A;  5F82 A;  1OME A;  2OLV A;  5EPH A;  1IYS A;  3PBN A;  1PI4 A;  3OPP A;  4S2N A;  2IWD A;  2ZQD A;  4KG6 A;  4GNU A;  1BUE A;  2WGI A;  3NY4 A;  5GLA A;  1ALQ A;  2XF3 A;  3ZG5 A;  4ZJ3 A;  5CGW A;  3GV9 A;  2CC1 A;  3O88 A;  1K57 C;  2EXB A;  4IED A;  1C3B A;  1GCE A;  2Q9M A;  4R4S A;  1BZA A;  1WYB A;  3C7U A;  4LV0 A;  5F83 A;  1NY0 A;  2Y2G A;  4S2K A;  3IWQ A;  1IKI A;  1KVL A;  3BYD A;  3O86 A;  2X01 A;  2JCH A;  1SCW A;  5CED A;  5CXW A;  5TFQ A;  4NK3 A;  4JXW A;  4P85 A;  3ZDJ A;  4ZBE A;  3SH9 A;  3TSG A;  3G34 A;  1K6S A;  1XA1 A;  4K0W A;  4WEK A;  1MXO A;  4BL3 A;  4OPZ A;  4OOL A;  1W8Q A;  5GLB A;  4BEN A;  4RVA A;  2UWX A;  4KZ5 A;  4N9L A;  3IHB A;  4HBT A;  4QY6 A;  3HLF A;  3RJU A;  1N9B A;  2WKI A;  1I2S A;  3WS5 A;  3P98 A;  3FWL A;  2EFU A;  3GRJ A;  5FQK A;  4MNR A;  1K4E A;  3MBZ A;  4KZ9 A;  5KZH A;  5DTT A;  1FCM A;  3HLG A;  2VGK A;  5FSR A;  5EVI C;  4WEJ A;  1HD8 A;  1ES2 A;  3ZHH A;  1YLJ A;  5E2H A;  1NYM A;  4R23 A;  1GHI A;  3EQV A;  3ITA A;  3SS4 A;  3RXX A;  3UPN A;  3VP4 A;  4IVK A;  1KE4 A;  3RXW A;  4KZA A;  1PWG A;  4XUZ A;  2EFX A;  3DW0 A;  2H5S A;  3N8S A;  3G35 A;  3Q7V A;  5HAI A;  2WGV A;  3IWI A;  1L0F A;  3DWZ A;  1KDW A;  4ZDX A;  2WGW A;  1H8Z A;  4GDB A;  3LY3 A;  1S6R A;  2Y2I A;  2ZC5 B;  3OZH A;  2Y2H A;  2Y2Q A;  3IH8 A;  3WS2 A;  4QJG A;  2IWB A;  1QME A;  4UHU A;  5CTN A;  1YQS A;  1RGZ A;  3A3E A;  4ID4 A;  1W7F A;  1TDG A;  2H0Y A;  5I94 A;  2Y2J A;  1BUL A;  4LV3 A;  1CEG A;  5FI2 A;  1ES4 A;  4LV2 A;  3UE1 A;  5TGF A;  4X6T A;  3C5A A;  1FCN A;  5FDH A;  2QZ6 A;  4PM6 A;  3ZG9 B;  3HUM A;  2WAE A;  1K55 C;  3CMZ A;  4FH2 A;  5FI6 A;  3E2L A;  3ZG0 A;  4E3O A;  3OPR A;  1DJC A;  4N1H A;  2HDU A;  3NC8 A;  5AQ9 A;  3UPP A;  3BEC A;  1KGG A;  5KSC A;  4RX3 A;  1XA7 A;  4ZTK A;  1IYP A;  2J9P A;  2Y4A A;  3WRT A;  4B88 A;  5M19 A;  2EX9 A;  2PBY A;  5DTK A;  5J8X A;  5F1G A;  2OLU A;  1W8Y A;  1XGI A;  2J7V A;  3BFE A;  1E4D A;  1NJ4 A;  3WS1 A;  1KE3 A;  4OPR A;  4KZ3 A;  1JWV A;  3TOI A;  5FQM A;  3BLM A;  1I5Q A;  4OOM A;  5G18 A;  5CER A;  2Z2L B;  2Y55 A;  1XX2 A;  1GA0 A;  3IF6 C;  3IF5 A;  3M6H A;  1MWS A;  3UN7 A;  2HPB A;  3FKV A;  3NDG A;  4LCM A;  2I72 A;  3OCN A;  4QD4 A;  1WYC A;  5JYP A;  5L2F A;  3PBO A;  3JYI A;  5FA7 A;  1K4F A;  2RCX A;  2J9O A;  3CG5 A;  4EQI A;  2H10 A;  4EBL A;  1W79 A;  3HL9 A;  3VP3 A;  2DNS A;  1FSW A;  1YLZ A;  4N1X A;  3UDI A;  4E6X A;  3M2K A;  3VOY A;  2Y2P A;  4DDY A;  5DF9 A;  1L0G A;  2C6W B;  3NI9 A;  3G2Z A;  4GOG A;  2XLN A;  5CGX A;  4EUZ A;  5A90 A;  3PBS A;  2ZC3 B;  3ZNY A;  2V20 A;  5CEC A;  2ZQ8 A;  2Y2O A;  4Z9Q A;  1JTG A;  4B4X A;  3D4F A;  3PAG A;  3AGF A;  4RA7 A;  1Q2P A;  1W5D A;  4S2M A;  3VOZ A;  1K54 A;  2WYX A;  3Q7Z A;  4WZ5 A;  3HBR A;  3OPH A;  1PZP A;  4E3N A;  4XUX A;  3UO9 A;  2R9W A;  1YMS A;  1PIO A;  3W4O A;  4BD1 A;  1SDE A;  4OQG A;  5HAP A;  2C5W B;  2WAD A;  3GTC A;  3O87 A;  2IWC A;  4OPY A;  2JBF A;  1BLS A;  3TG9 A;  3V5M A;  3ZVT A;  4OON A;  5CEB A;  4OLD A;  5GL9 A;  3B3X A;  2JE5 A;  4MBK A;  3BFC A;  3NIA A;  4QY5 A;  2ZMA A;  4A5R A;  1L0D A;  2GDN A;  1GHP A;  4X56 A;  5F1F A;  4R1G A;  1RGY A;  4WZ5 C;  1PWD A;  4E3I A;  1O7E A;  1Y54 A;  3GR2 A;  3HUN A;  5FI7 A;  1ZG6 A;  4DXC A;  4E3L A;  4R3B A;  5AQA A;  4B4Z A;  4BQM A;  2HDR A;  3HUO A;  1ERQ A;  1M6K A;  2Z2M B;  3BM6 A;  1DY6 A;  4MBF A;  1N4O A;  2WZX A;  1IYQ A;  4OP8 A;  5CGS A;  4ZAM A;  1HZO A;  1K56 A;  3P09 A;  4JF4 A;  1ONG A;  1JWP A;  3C4O A;  3W4Q A;  1ERM A;  1PZO A;  1MWR A;  4DF6 A;  2JC7 A;  4Y0U A;  1WE4 A;  3BFG A;  3ZFZ A;  3OPL A;  1FSY A;  1PW1 A;  4DE1 A;  5FAS A;  3Q1F A;  2XFS A;  3A3J A;  2ZQA A;  5FQQ A;  1EI5 A;  1ZC2 A;  2ZC4 B;  5GLC A;  4GD6 A;  3V50 A;  1H5X A;  2DCF A;  2ZM8 A;  4S2O A;  4N9K A;  4WZ4 A;  1AXB A;  2PU4 A;  2HP9 A;  4UA9 A;  5HW3 A;  2ZQ7 A;  4PM9 A;  3CJM A;  2HDS A;  4L0L A;  4C3Q A;  3C4P A;  5HX9 A;  3HLD A;  2ZC6 B;  2OSU A;  2XD5 A;  1MWU A;  2XEP A;  3IXB A;  3MKE A;  4FH4 A;  5FQI A;  3UE3 A;  3V3S A;  2ZM0 A;  1LI9 A;  3Q7V B;  3G4P A;  2Y2N A;  2WAF A;  3MZD A;  1XKZ A;  3LEZ A;  1IYO A;  4X53 A;  3IWO A;  2ZLY A;  1KVM A;  3VFH A;  4D2O A;  1MPL A;  2HP6 A;  1L0E A;  2XR0 A;  1LHY A;  4BJP A;  2G2U A;  3PBR A;  1BTL A;  2R9X A;  1JVJ A;  5EVI B;  1DJB A;  3IF6 B;  5FQJ A;  3VSK A;  1KGE A;  2A3U A;  1HTZ A;  3A3F A;  5AQB A;  5FAQ A;  3S1Y A;  3QHY A;  3PBT A;  4R3J A;  4DE0 A;  4Y0O A;  4OLG A;  3IXD A;  4E3M A;  2XGN A;  5E2E A;  3MZE A;  4HEF A;  5CHM A;  5M1A A;  4R0Q A;  3ISG A;  1MKI A;  3SS3 A;  4BLM A;  4YFM A;  1IEM A;  3FYZ A;  4OPQ A;  5FQ9 A;  3PAE A;  1TDL A;  4OKP A;  3EQU A;  1YLW A;  1FR6 A;  2OV5 A;  5BOH A;  3BLS A;  3IQA A;  4RYE A;  4UA6 A;  2V2F F;  1ERO A;  1MY8 A;  5DF8 A;  1ZKJ A;  3BRM A;  3LCE A;  4JXV A;  1G6A A;  3SOI A;  4CJN A;  3G32 A;  2HDQ A;  2WZZ A;  1K38 A;  4DRT A;  4WEL A;  4PPR A;  3WS4 A;  3ZG7 B;  1ES5 A;  1HVB A;  3IH9 A;  1IEL A;  2ZC7 A;  1NYY A;  3OC2 A;  1YMX A;  5GLD A;  4C75 A;  3HLC A;  4OVD A;  4X69 A;  5U47 A;  4KQQ A;  1K55 A;  1SHV A;  2BLS A;  3DTM A;  4DDS A;  1LLB A;  3PTE A;  1ONH A;  3IXH A;  4OQH A;  3WRZ A;  1EWZ A;  1U60 A;  4KZ8 A;  4FD8 A;  3GMW A;  1YLT A;  1CI8 A;  4UA7 A;  5EOO A;  3A3D A;  2FFF B;  2ZD8 A;  1XP4 A;  4F94 A;  3ZCZ A;  3MZF A;  4PMA A;  1L2S A;  3Q82 A;  2WKH A;  4GB7 A;  5DVA A;  1Z6F A;  3UDX A;  1SDN A;  3N4I A;  3VP2 A;  1BT5 A;  4N92 A;  1LL5 A;  4E3K A;  3C7V A;  4E3J A;  3AGD A;  2ZM2 A;  1BLP A;  3E2K A;  2V1Z A;  5HFO A;  4PM7 A;  2DRW A;  4IBR A;  5FAO A;  5A93 A;  5E2G A;  1ESU A;  1I2W A;  3S4X A;  1ES3 A;  3UY6 A;  1BLH A;  2P74 A;  2XQZ A;  4FSF A;  5CTM A;  1NZU A;  5KMW A;  5HL1 A;  1K54 C;  1S0W A;  1YM1 A;  2ZJ9 A;  5EVI A;  1G68 A;  3VP0 A;  1CI9 A;  5CRF A;  1ZG4 A;  2WKE A;  4HBU A;  2WUQ A;  4WBG A;  2Y2M A;  1LL9 A;  4X55 A;  4DE3 A;  5HAQ A;  4NET A;  4U3T A;  2XFT A;  3CZD A;  4GD8 A;  4Q8I A;  3Q07 A;  3M2J A;  4JKT A;  2RL3 A;  3W8K A;  2B5R A;  2XK1 A;  3IXG A;  1PWC A;  3WS0 A;  5EEC A;  4MEZ A;  4S2J A;  3S22 A;  5M18 A;  1K6R A;  3BFD A;  4QB8 A;  3QNB A;  1H8Y A;  1Q2Q A;  1TEM A;  3N8R A;  4JXG A;  4GDN A;  4OQ0 A;  4IVI A;  1TVF A;  1MBL A;  4E6W A;  2EX6 A;  1QMF A;  2HP5 A;  3A3I A;  4KZ7 A;  5EE8 A;  3PBQ A;  3UNW A;  2Y91 A;  1K56 D;  1DJA A;  2G2W A;  1NXY A;  4OH0 A;  1GHM A;  1NZO A;  3O3V A;  4M3K A;  4EBP A;  3NDE A;  4U0X A;  4WM9 A;  1KE0 A;  2Y59 A;  2ZQC A;  4P0M A;  1YLP A;  2P9V A;  1PYY A;  2Y2K A;  1K57 A;  3N7W A;  2X02 A;  3N8L A;  4X68 A;  4BL2 A;  3FZC A;  1J9M A;  3Q81 A;  4KQR A;  1RCJ A;  5EOE A;  3I7J A;  4EV4 A;  2J8Y A;  4JF5 A;  2PU2 A;  3V3R A;  4U0T A;  5GHZ A;  3MFD A;  1VQQ A;  5FAT A;  4GN2 A;  5E2F A;  4ZJ1 A;  4DKI A;  4QU3 A;  1CEF A;  4K91 A;  4XXR A;  3VSL A;  2Q9N A;  4RX2 A;  4S2P A;  5GHY A;  4JLF A;  2E8I A;  1FOF A;  5DTS A;  5AQ7 A;  3ZG8 B;  4DXB A;  2EX2 A;  4KZ4 A;  3DWK A;  4P87 A;  3G30 A;  5A91 A;  4BD0 A;  1SKF A;  1IKG A;  4DE2 A;  3ZVW A;  1E3U A;  2XD1 A;  4GKU A;  4YIN A;  3ZNT A;  1RP5 A;  1XXM A;  3MXS A;  3ITB A;  5E43 A;  3LY4 A;  3IF6 A;  4K0X A;  1E25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...