4UA9A

Ctx-m-14 class a beta-lactamase in complex with a boronic acid acylation transition state analog at sub-angstrom resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
ETSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase CTX-M-14
publication title Ligand-Induced Proton Transfer and Low-Barrier Hydrogen Bond Revealed by X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ua9A00
3GMWA 4R1GA 2JE5A 4UAAA 5F1FA 1MWUA 4X55A 1ES4A 1NXYA 3Q81A 5A93A 2XFTA 2IWBA 1K56A 4OONA 1BSGA 3VP0A 3VP4A 3TOIA 4EUZA 1MWTA 1KVLA 4KENB 4O7DA 2JCHA 3MZEA 1NZUA 3SH8A 3ZCZA 1LI9A 5FAOA 1SDEA 4ZJ3A 5DVAA 4E3NA 5CERA 4ID4A 5FATA 2XR0A 4E6WA 4Q8IA 2IWDA 3O87A 3G4PA 3N7WA 1E25A 3PAGA 4IEDA 1E3UD 5KSCA 2WYXA 4FD8A 1E4DA 1IYOA 3OCLA 5EVID 3HLBA 1NY0A 4HEFA 2WGWB 2ZC5B 3FZCA 1FQGA 4Y0TA 4KZ4A 1VM1A 3D4FA 2EX2A 1E3UA 2H5SA 1PWDA 1K4EA 3M6HA 3P98A 1N9BA 2XD5A 1SDNA 2Y2LA 3AGFA 5EPHA 5EOEA 4P0MA 3V50A 1NYYA 3UPNA 2ZM8A 4FSFA 2A3UA 3JYIA 3N8SA 1S6RA 1BZAA 1RP5A 5FA7A 4EWFA 3IT9A 3G2YA 1JWVA 3MXRA 1O07A 2V1ZA 4GD6A 5DF8A 5A90A 2RL3A 2V2FF 5KZHA 1GHPA 2PU4A 1JVJA 1L2SA 1M40A 4P85A 5FAQA 4ZJ2A 2BG1A 3LO7A 3W4PA 4KG6A 1PW8A 1O7EA 1XA7A 4FH4A 4QJGA 2Q9MA 5GLBA 2WGIA 1PYYA 4LCLA 5GHYA 3GR2A 5CHUA 1YLYA 5HW3A 3PBQA 2Y2JA 1N4OA 2B5RA 2ZC3B 4U3TA 3ZGAB 3C5AA 1YLJA 4ZAMA 2P9VA 4N9LA 3ZNYA 3IWOA 3BEBA 3B3XA 3UY6A 3LEZA 4UA6A 1HZOA 4LV1A 2Y59A 3SS4A 1HD8A 1XPBA 3MXSA 4RA7A 4MEZA 4PM5A 5KMWA 1FCNA 5M18A 3GSGA 3V39A 3RXWA 3SH9A 2J9PA 1BTLA 3ZNTA 5FASA 4NETA 1G6AA 3NI9A 4JF6A 3W4OA 3IHAA 3IXHA 1L0EA 3GRJA 1Y54A 3UE0A 4IBRA 3HLGA 4K0XA 3NDGA 3FKVA 4OPQA 1U60A 4DKIA 3ZG8B 5FI2A 2ZC6B 4DE3A 3QNBA 1GHMA 1IYQA 2QPNA 1HTZA 2VGJA 4FH2A 3BFGA 4QU3A 1KDWA 3IF5A 3SS5A 3MKFA 2Y2NA 3DWZA 5FDHA 3ZG5A 4DE0A 3Q7ZA 4X6TA 1W79A 5DF9A 4F94A 4MBHA 4JBFA 4P6BA 1K38A 4NK3A 4OOLA 1I2WA 1KVMA 4KZ9A 4PM9A 1I2SA 4LCMA 3PBSA 2I72A 5FQ9A 2OV5A 5KSHA 5HAQA 4OVDA 3QHYA 3N8LA 1ESUA 4BL3A 3EQVA 1FR6A 4LV0A 1RGYA 5AQ7A 3ZFZA 3UE3A 4OQGA 1PI4A 3GTCA 2Y2MA 2WZXA 1ES3A 1H8ZA 4EBLA 4ZJ1A 4S2KA 2Y2QA 3HBRA 4XXRA 3OPHA 3CMZA 4GDBA 4YINA 3I7JA 4MNRA 1FOFA 1M6KA 3BLMA 4KZ8A 4KQOA 3WS4A 1K4FA 2E8IA 3M2JA 3VMAA 5I94A 3GV9A 3HLFA 1WE4A 4JKTA 4ZTKA 4KZ5A 5JYOA 4E3MA 1YMSA 3Q7VB 3IF6A 3OC2A 1MY8A 2XGNA 4S2JA 1XXMA 5CGXA 3RJUA 2X02A 5E2GA 5G18A 4WMCD 3BECA 3VOZA 2ZC4B 2OLVA 4IVKA 2EXBA 3WS2A 1TEMA 3IF6C 1IKIA 2WADA 1TVFA 1K54A 3C7UA 3FWLA 4S2MA 4S2NA 3VP2A 4WMCA 3LCEA 5CTMA 4UA9A 1ONHA 2Q9NA 5EUAA 1JWPA 4OOYA 3UE1A 3CJMA 3NDEA 4OP5A 4C3QA 5EVLA 4BL2A 3OPLA 4DDSA 1BUEA 2ZC7A 4KQRA 2XEPA 1LL9A 5TGFA 1PIOA 1K25A 1K54C 4QHCA 4S2NC 5D3OA 3FV7A 4E3JA 3S22A 3O3VA 4HESA 2WKIA 1RCJA 2XLNA 5CGSA 1L0DA 5AQAA 5BOHA 4KZ7A 1L0GA 1QMEA 1TDLA 3ITAA 4FCFA 1CEFA 1DJAA 1ERMA 3GQZA 3BFCA 4BD1A 2WUQA 3S1YA 1AXBA 3QNCA 5FQIA 3IQAA 3E2KA 5CHJA 2DRWA 5EVIA 3IH9A 3PBRA 4OPRA 1WYBA 1CI8A 1XA1A 3BFDA 1BULA 5GHZA 4JF5A 3ZHHA 4EQIA 5EOOA 1ONGA 2BLSA 4GZBA 1Q2PA 1MWSA 4S2PA 4D2OA 1G68A 1XP4A 2Y55A 1IYPA 4GD8A 5EE8A 2EFXA 5EVIC 3IWIA 4CJNA 3TG9A 1FR1A 1DJCA 1PI5A 4WZ4A 3ZVWA 5U47A 4C6YA 5CEDA 2ZQAA 3C4PA 2UWXA 2Y2GA 3N6IA 5TFQA 2EX9A 2G2UA 3IH8A 5IHVA 1W8QA 3SH7A 5E43A 5GL9A 4WELA 3PAEA 3NC8A 4X68A 4DE1A 1CEGA 2XD1A 3G32A 4S2OA 1DJBA 1ZC2A 3NCKA 5CRFA 5TR7A 4GN2A 4OQIA 2VGKA 5F1GA 3UPPA 4B88A 2H0YA 1QMFA 2Y2PA 3UO9A 4RVAA 1H8YA 4U0TA 4OKPA 1XGIA 3NY4A 1BLCA 3DTMA 4OLGA 3Q82A 3MBZA 3NIAA 1CK3A 3OCNA 3FYZA 2DCFA 4R0QA 2ZQ8A 3N8RA 2V20A 1BLHA 3HREA 4KZ6A 4PPRA 4DRTA 4LV2A 1ZG6A 1FCOA 4R3JA 3M2KA 1SHVA 4LENA 4R4SA 4BD0A 4E3KA 4HBUA 1EWZA 5FQJA 4YFMA 3HL9A 5EVIB 1PZOA 3V3RA 4KG5A 4CPKA 2XDMA 1NRFA 1ZG4A 3G34A 4JLFA 4OPZA 5A91A 3S4XA 4JXSA 2PU2A 3UN7A 4QY6A 4JXVA 5FQQA 3HUOA 2ZM0A 4HBTA 4S2IA 4P87A 1MXOA 2HDQA 2WAEA 4OOMA 1EI5A 4ZBEA 4X53A 5AQBA 4X56A 4L0LA 2J7VA 2WGVA 1H5XA 3AGDA 1PW1A 2IWCA 4OH0A 1TDGA 2HP6A 3O88A 4OPYA 2P74A 4M3KA 3WRTA 3A3DA 4WZ5A 3UDFA 4E3IA 2Y2IA 4ZDXA 1LL5A 3VP1A 1ES5A 2XH9A 2ZLYA 4GOGA 2ZQCA 3ZG7B 5FI7A 3ISGA 3LY3A 2QMIA 2WGWA 2QZ6A 4DF6A 1NYMA 3G31A 1L0FA 1YLZA 3OPRA 2FFFB 3BM6A 2P9VB 5L2FA 5FI6A 1KDSA 1BLSA 2ZQDA 4KG2A 4KZBA 5M1AA 3V5MA 3M6BA 2C5WB 1JWZA 4PM8A 4WZ5C 5J8XA 1YMXA 1LLBA 5E2HA 2Y2HA 2XQZA 2XK1A 3VFFA 1PWCA 3A3FA 4WBGA 1KE0A 4OQ0A 4QY5A 3G35A 4RX2A 1MWRA 2XF3A 2OLUA 1LHYA 1JTDA 3HLCA 1K6SA 4GKUA 4WEJA 4UA7A 2FFYA 1MBLA 1GA0A 3IXDA 4WM9A 4RYEA 3DWKA 3V3SA 3HUNA 5HAPA 2Z2LB 3G30A 4MBFA 3RXXA 3VP3A 2JC7A 2EX6A 4WYYA 3WS1A 3OPPA 3BFFA 2Y4AA 4XUZA 4N1XA 3UNWA 1KE4A 3N4IA 4GB7A 4KZAA 2HDUA 3W4QA 1K6RA 4E3LA 5CEBA 3LY4A 4U0XA 2ZJ9A 3UDIA 3C4OA 3MZDA 3PBOA 5CTNA 2Z2MB 1SKFA 3C7VA 3MFDA 4PM6A 2HDSA 3FKWA 4MLLA 5CGWA 4QB8A 1FSYA 2ZD8A 4JXWA 5HAIA 1SCWA 1YLPA 3W8KA 1MPLA 4N9KA 3ZVTA 1BLPA 4EV4A 3Q07A 5GHXA 2JBFA 1NZOA 5GLDA 4N92A 1VQQA 2ZQ9A 1IKGA 3BFEA 2WKHA 4K0WA 1WYCA 1CI9A 1GCEA 4JF4A 3WS0A 3ZG9B 3E2LA 3HLDA 5DTKA 3TSGA 1EROA 2H10A 3A3IA 2X71A 1PWGA 5EECA 2EFUA 3NBLA 5AQ9A 2C6WB 1JTGA 5DTTA 3VSLA 5HARA 4IBXA 2R9WA 1GA9A 2WK0A 1W5DA 4XUXA 3GVBA 3HLEA 3G2ZA 3IF6B 5GLAA 3AGEA 1LI0A 2WZZA 2RCXA 3A3EA 1KGGA 1C3BA 2R9XA 4C75A 2HPBA 5HX9A 3ZDJA 3HLWA 1W8YA 2ZQ7A 4PM7A 4K91A 4A5RA 5FQMA 3SS3A 4IVIA 5DF7A 1IYSA 4UHUA 4JPMA 4X69A 2J8YA 3BYDA 2WAFA 3ITBA 4MBKA 4KQQA 1K57A 5M19A 1YLTA 3Q1FA 3MKEA 2ZMAA 4BLMA 4DE2A 3DW0A 3HVFA 1BT5A 1K56D 4DDYA 1IEMA 1MKIA 1ERQA 3IWQA 5FQKA 1Z6FA 1YQSA 2G2WA 2WKEA 3VOYA 3CZDA 3PBTA 4RX3A 1K57C 1XKZA 3Q7VA 4Y0OA 2Y91A 3SOIA 5JYPA 3IHBA 4B4XA 3WWXA 3UPOA 4KZ3A 4R3BA 2GDNA 1KGFA 2HDRA 5GLCA 1YM1A 1K55A 4EBPA 2DNSA 1ES2A 5HL1A 2H0TA 3UDXA 3A3JA 2HP5A 5DTSA 4JXGA 4S2LA 2HP9A 4OQHA 1Q2QA 3BLSA 5CECA 2J9OA 5E2EA 4PMAA 1ESIA 1K55C 2XFSA 5FAPA 1KE3A 1FCMA 3BRMA 4OLDA 1ZKJA 2OSUA 4DXBA 2A49A 4BQMA 5F82A 3OZHA 1GHIA 4B4ZA 5FSRA 1RGZA 1FSWA 1ALQA 2CC1A 3MZFA 3PBNA 5F83A 4R4RA 3IXBA 4GNUA 3P09A 1J9MA 1IELA 1YLWA 4QD4A 1YT4A 1S0WA 1NJ4A 2Y2KA 1I5QA 2ZM2A 3WS5A 4LV3A 4Y7PA 4Z9QA 2EXAA 3VFHA 3WRZA 4E6XA 4DXCA 1KGEA 1OMEA 2PBYA 1DY6A 4EBNA 4R23A 1XGJA 1HVBA 4BJPA 3EQUA 4H8RA 5HFOA 4N1HA 2Y2OA 2X01A 4OP8A 3VSKA 4E3OA 3PTEA 4Y0UA 3O86A 1PZPA 4WEKA 3ZG0A 3CG5A 4BENA 4GDNA 1W7FA 2EX8A 5CXWA 5A92A 3IXGA 3HUMA 1XX2A 5CHMA 5E2FA
chains in the Genus database with same CATH superfamily
2JE5A 3EEAA 3NOTC 2OWHA 1K56A 4OONA 3VP4A 4EUZA 5HZHA 4NXBA 4ZJ3A 5FATA 3O87A 3P01A 4PAUA 1E25A 4WL9A 2D02A 1E4DA 1IYOA 4CLCD 2WGWB 1N9OA 1VM1A 1TS6A 1E3UA 1K4EA 3P98A 4O01A 2XD5A 1MC0A 5EOEA 1NYYA 2ZM8A 3JYIA 4EWFA 3IT9A 5KZHA 2L1MA 4CLCC 1L2SA 2M7UA 3VE3A 4R38A 4KG6A 4FH4A 5L8MA 2Q9MA 5GLBA 2WGIA 4LCLA 5GHYA 5HW3A 1VETA 1N4OA 4U3TA 2GNXA 3IS2B 4I3JA 5I5LA 2M7VA 3IWOA 4I3IA 2HZ5A 3LGOA 1FCNA 3S7PA 3ICYA 3SZTA 4DJ2A 3GSGA 2J9PA 3NI9A 3HLGA 4DKIA 5FI2A 2W3FA 5IS1A 3D9YA 1KDWA 4FTXA 3MKFA 3DWZA 3BY9A 5FDHA 1W79A 4F94A 4P6BA 1K38A 1I2WA 2HGVA 4KZ9A 3T12B 2OV5A 5DJUA 4OVDA 3DTIA 1FILA 3N8LA 3EQVA 3ZFZA 3CMZA 4KZ8A 4KQOA 1K4FA 2E8IA 3M2JA 2PD8A 4DMZA 4ZTKA 4Y5FA 5JYOA 4E3MA 3IF6A 4X1MA 3B33A 3OBFA 1MY8A 5CGXA 3RJUA 5E2GA 1XJ3A 3VOZA 3FC7A 3E98A 2EXBA 4ESPA 1K54A 3E4OA 3FWLA 3IX4A 3LCEA 3S7QA 2P7JA 1JWPA 4OP5A 4ZRRA 3ZYTA 5EVLA 4C3QA 3OPLA 2ZC7A 1PIOA 4S2NC 3K2NA 4NXFA 1RCJA 5BOHA 5AQAA 2AVXA 1QMEA 3DAVA 3ITAA 1ERMA 2PYRA 3GDIA 4HHDA 1AXBA 3QNCA 5FQIA 5CHJA 2DRWA 4NXEA 1XA1A 1BULA 3CUEC 3ZHHA 4EQIA 5EOOA 1ONGA 5F5YA 2XRNA 2Y79A 1G68A 5EE8A 3PYPA 4ARZA 4WZ4A 3IH8A 1LL8A 1W8QA 1S4SA 1XFQA 3PAEA 2IA2A 3BW6A 1YPRA 3G32A 4HH3A 2JKRI 1DJBA 4GN2A 5F1GA 4U0TA 3NY4A 3DTMA 1CK3A 3FYZA 2DCFA 4R0QA 4PPRA 1ZG6A 3H7WA 1OTDA 4R3JA 1T1AA 4LENA 3T4KA 4EUVA 5L09A 5FQJA 4YFMA 3HL9A 2GZAA 4CLCB 4OPZA 3S4XA 3T4JA 3UN7A 4JXSA 2PU2A 4QY6A 5FQQA 3HUOA 2WKQA 4S2IA 1MXOA 2JKFA 2W3EA 2CMNA 4OOMA 3KSGA 5AQBA 4X56A 1H5XA 2V9AA 2IWCA 4OH0A 4M3KA 3A3DA 4ME4A 2Y2IA 1FIKA 3F1OB 4BBTA 5HPFA 2WGWA 4Y3IA 3F1PB 4DF6A 3G31A 1V9ZA 4R3AA 3BM6A 1HLUP 5FI6A 5M1AA 4KZBA 4WZ5C 5KIZA 5J8XA 4R6LA 2W27A 1LLBA 2J3TC 2XQZA 3A0VA 2XF3A 3V3SA 2O9BA 4N1XA 2HDUA 3W4QA 4E3LA 5CEBA 3EOIA 2ZJ9A 3IS2A 3C4OA 3MZDA 3C7VA 2BASA 2HDSA 2V1AA 4MLLA 5HAIA 3BQ8A 5GHXA 5GLDA 1IKGA 2XSSA 2WKHA 1GCEA 3HLDA 3TSGA 2H10A 3A3IA 4HP9A 5DTTA 3S7OA 4IBXA 2WK0A 2B95A 3LEQA 5GLAA 3RTYA 2WZZA 3A3EA 1C3BA 5F69A 1T1BA 5HX9A 2ZQ7A 4HJ4A 4X69A 3Q1FA 1DP8A 2OAQ1 4DE2A 3HVFA 1IEMA 3R7WB 2WKEA 3VOYA 3CZDA 1XKZA 1OPXA 1GSXA 3SOIA 4KZ3A 4NG2A 2HDRA 5GLCA 5MC7A 1YM1A 4HQAA 4Y15A 2DNSA 4EXOA 3JPUA 4JGRA 2HP9A 2Z6CA 2J9OA 4PMAA 1ESIA 2QHKA 3QP4A 3T1SA 3BRMA 2OSUA 3H82A 3BY8A 5F82A 4Q0JA 5FSRA 1RGZA 1FSWA 2V0UA 3IXBA 5CX7A 4QD4A 4QPRA 1NJ4A 2Y2KA 2OWJA 1F98A 3MS6A 3VFHA 3WRZA 4E6XA 2L4RA 1OMEA 5HD5A 1DY6A 4R23A 1XGJA 4DE3A 2EA9A 5HFOA 3CI6A 3KYZA 4WEKA 2PR5A 3O5YA 4EETB 1TS7A 4R1GA 1ES4A 3Q81A 1BSGA 4UEYA 1MWTA 1KVLA 1LSVA 3SH8A 4IHQA 1LI9A 5FAOA 1PFLA 4Q8IA 3LIDA 4E6WA 3N7WA 4I38A 4IEDA 4FD8A 3OCLA 5EVID 4HEFA 4Y0TA 2PD7A 1PWDA 3M6HA 4CLCA 3LUQA 3AGFA 3UB9A 3GECA 1JWVA 3KYQA 3MXRA 5HDSA 3LO7A 5J4EA 2NUPC 1O7EA 4QJGA 2VZWA 2YKFA 4JGOA 5FDSA 1VB6A 4FUWA 2J80A 5EM1A 3F1PA 1YKDA 1P0ZA 1YLJA 4HJ3A 4UA6A 4LV1A 3SS4A 1XPBA 1HD8A 5M18A 1MZUA 1UWPX 1BTLA 1G6AA 4JF6A 3IXHA 1L0EA 2VJWA 1Y54A 3NDGA 3LR5A 4OPQA 1GSWA 3QNBA 1IYQA 1HTZA 2VGJA 4QU3A 2ZMFA 2Y2NA 5DF9A 4MBHA 4OOLA 3K3CA 3RFBA 3BQAA 4EU0A 4LCMA 3PBSA 1JNUA 3QHYA 1ESUA 5HWTA 4BBVA 2PBDP 4Y13A 2BTFP 1FR6A 4RQ9A 3GTCA 2WZXA 1ES3A 1H8ZA 4EBLA 4S2KA 4XXRA 4YINA 4GDBA 3I7JA 1FOFA 1M6KA 3BLMA 3WS4A 3VMAA 3R4KA 3HLFA 1WE4A 4NXGA 3OC2A 4S2JA 2D01A 3UB7A 3VP2A 4S2NA 2KOIA 5CTMA 4UA9A 1YSQA 4OOYA 3NDEA 3LR0A 4BL2A 2W1TA 3EGDC 2XEPA 2JKGA 3S7NA 5D3OA 3FV7A 4E3JA 3R7WA 5HWWA 2XLNA 3CUEA 5CGSA 4KZ7A 1L0GA 1TDLA 4UQIM 5HPIA 3T50A 2WUQA 3E2KA 3IH9A 4OPRA 5C5KA 5GHZA 3A0RA 4JF5A 2Q0OA 2O0YA 1MWSA 4S2PA 1XP4A 1IYPA 2EFXA 4CJNA 1FR1A 1PI5A 5U47A 4C6YA 2ZQAA 4JGPA 4L9FA 3F1NB 3SH7A 2HF6A 1CEGA 4PKYA 3DTKA 5CRFA 4PHTA 3CPTB 1QMFA 2Y2PA 3UO9A 4YNRA 2GX5A 1ZHHB 4L9EA 3N8RA 2V20A 1BLHA 4MN7A 3KYEA 3M2KA 1OTBA 1UWNX 3MSHA 4E3KA 1EWZA 2W3DA 3HJIA 5EVIB 1CF0A 3V3RA 4H6JB 3DTEA 1X0OA 4CPKA 2XDMA 4F3LA 3KX0X 5A91A 1VEUB 2O9CA 3QP1A 3LIAA 2WAEA 1EI5A 3D72A 3QP6A 2EWWA 3O88A 4OPYA 5FL3A 3WRTA 4DJ3A 2XROA 4WZ5A 3UDFA 4ZDXA 4NEED 4YWZA 3VP1A 2XH9A 4GOGA 1T19A 2A24A 2ZQCA 3ISGA 4MCWA 4GLQA 1NYMA 1N9NA 1L0FA 3OPRA 2FFFB 2P9VB 1KDSA 1BLSA 4KG2A 1JWZA 4O8GA 1SKOB 2XK1A 3VFFA 1PWCA 3A3FA 3MJQA 1D1JA 4MN6A 2VKSA 3G35A 1JTDA 2VK3A 1EW0A 4UA7A 4WM9A 3VE4A 4MBFA 3RXXA 3WS1A 4MDZA 3EWKA 4L9GA 3UNWA 1GSVA 2ZL1A 4KZAA 1NLZA 3LY4A 3LFVA 3UDIA 2B18A 4UQIS 4EESA 4EEPA 3CWFA 4PM6A 1SKFA 2W0NA 2JN7A 1SCWA 2JBFA 4EW7A 5IT5A 2ZQ9A 3G6OA 1WYCA 1CI9A 4JF4A 3T4QA 3E2LA 5DTKA 1EROA 5EECA 1PWGA 2X71A 3NBLA 5AQ9A 2C6WB 3VSLA 5HARA 1GA9A 1W5DA 3GVBA 3HLEA 1LI0A 5HD3A 1ZTUA 3KSFA 1PRQA 3HLWA 4EERA 4PM7A 5FQMA 4UHUA 1F5MA 3UB5P 3E4PA 3ITBA 4KQQA 3MF0A 5M19A 1BT5A 2O99A 1ERQA 3IWQA 1Z6FA 2W1RA 3T1QB 3C30A 3MMHA 3PBTA 1K57C 5JYPA 3BJNA 4GCZA 2GDNA 3CITA 1KGFA 1N9LA 2I9VA 4EBPA 4YOFA 4Y17A 5J7EA 4JXGA 4OQHA 3BLSA 2VA0A 1K55C 2LB9A 5FAPA 1KE3A 2P08A 1ZKJA 4DXBA 4M4XA 2LB5A 2A49A 4BQMA 3IX3A 3JVVA 1GHIA 2FH5A 1G6OA 3P09A 2JKRM 2G7UA 5HDCA 4I39A 4Y7PA 5HSQA 2EXAA 4GS9B 2Y8HA 4II7A 3LI8A 1S66L 4DXCA 1KGEA 2PBYA 4EBNA 3EGXC 1HVBA 4BJPA 3EQUA 2Y2OA 4X25A 4OP8A 3UB6A 3RH8B 3O86A 1NLYA 3NOUC 3ZG0A 4BENA 4GDNA 2INWA 3HUMA 1XX2A 3GMWA 4UAAA 1MWUA 4X55A 1NXYA 1ODVA 4IJGA 2NUTC 5A93A 2XFTA 2IWBA 5A8BA 4AFIA 2QYBA 3CPTA 3TOIA 4KENB 4O7DA 2JCHA 1NZUA 3ZCZA 1SDEA 3ULFA 5DVAA 5CERA 4ID4A 2XR0A 2IWDA 3G4PA 2VV7A 1NY0A 3FZCA 1FQGA 2EX2A 2H5SA 1N9BA 2Y2LA 1VHMA 5EPHA 3V50A 4MN5A 4FSFA 1S6RA 5FA7A 1VEUA 5DF8A 4GD6A 3MQQA 2RL3A 2V2FF 1JVJA 4GHIB 1M40A 5FAQA 4ZJ2A 2BG1A 3W4PA 4Y2FA 1D06A 1XA7A 1P9RA 4Q0HA 1PYYA 5CHUA 1YLYA 2Y2JA 2B5RA 1J3WA 1T1CA 2ZC3B 3T4SA 3IBRA 3ZGAB 3C5AA 4HJ6A 4ZAMA 2P9VA 4N9LA 3ZNYA 3LEZA 1F2KA 3MXSA 1S1ZA 4PM5A 1SKOA 3OLOA 5KMWA 3V39A 3D3OA 3ZNTA 5FASA 5EVEA 3W4OA 3GRJA 3UE0A 4IBRA 4K0XA 1U60A 2ZC6B 2QPNA 3ZG5A 4DE0A 1AWIA 1KVMA 4PM9A 3P7NA 2I72A 5FQ9A 5KSHA 5HAQA 3KO6A 5AQ7A 1RGYA 1DP9A 1KOUA 3UE3A 4OQGA 2W3GA 2Y2QA 3HBRA 1LT0A 1VETB 4CLCE 2YKHA 4LPZA 2VGLM 1OTIA 3GV9A 1TF1A 1YMSA 1L3LA 4KUOA 2XGNA 1XXMA 3MQ0A 5G18A 4WMCD 3BECA 2ZC4B 2OLVA 3WS2A 1TEMA 5DJTA 3LICA 1ONHA 3UE1A 3CJMA 1BUEA 4KQRA 3DBAA 5TGFA 2JKTI 4QHCA 3O3VA 1L0DA 3KSIA 4LRZE 1DRMA 1CEFA 1F9IA 3LIEA 4BD1A 3IX8A 3BFDA 1P9WA 3T1RA 5L07A 2PYPA 4GZBA 1Q2PA 4GW9A 4JGQA 5EVIC 3IWIA 3TG9A 1DJCA 1OJ5A 1P97A 3C4PA 5TFQA 3LR4A 3F1OA 4HP4A 3NHQA 4ETXA 4S2OA 1ZC2A 3NCKA 4B88A 2H0YA 4GS9A 2O9AA 1XGIA 4OLGA 3Q82A 3OCNA 1TS0A 3HREA 4KZ6A 3KSHA 2JKTM 3B42A 1SHVA 4BD0A 4HBUA 5TBMB 5AVFA 4D60A 3MFXA 2EWVA 4QWOA 2ZM0A 3UMEA 3LYXA 4EQ1A 2HDQA 4L0LA 1PNEA 2WGVA 3AGDA 2PHYA 1TDGA 2HP6A 1G28A 2ZOHA 1ES5A 2ZLYA 3K3DA 2VGLS 3QP8A 2QMIA 2QZ6A 1YLZA 5L2FA 2J3WA 2ZQDA 3V5MA 3M6BA 4PM8A 1YMXA 4LLOB 5E2HA 4LFUA 5AVEA 4WBGA 1KE0A 4QY5A 2R78A 4RX2A 5L10A 2QWSA 4IUKA 3HLCA 4GHIA 3IXDA 4RYEA 3G30A 2JC7A 2EX6A 1H8MA 3L7HA 3OPPA 3BFFA 2Y4AA 4XUZA 1NWZA 1CQAA 3N4IA 3PBOA 2Z2MB 3MFDA 5G4ZA 3CHWP 4E04A 3NECA 4QB8A 2ZD8A 5J3WA 1YLPA 3W8KA 4N9KA 1BLPA 2OAP1 4N92A 3BFEA 4XT2B 3WS0A 3CLOA 4I5SA 1D7EA 5DKLA 3T4OA 2VLGA 2EFUA 1JTGA 2R9WA 3T4LA 3G2ZA 3QP2A 3AGEA 2RCXA 4G3VA 2R9XA 2HPBA 5EM0A 3TE8A 1W8YA 4K91A 4A5RA 3SS3A 4IVIA 5DF7A 4BWIA 1LSXA 4JPMA 4FOFA 5HDDA 2J8YA 1G5UA 3BYDA 2WAFA 4MBKA 1K57A 1YLTA 3DW0A 5FQKA 2G2WA 4P6ZM 4RX3A 5K5BA 1ACFA 2XA7M 3C8CA 3WWXA 3UPOA 4R3BA 3U2AA 1XJ2A 1K55A 5FEFA 5HL1A 2H0TA 1OTEA 4G3WA 2VEAA 5E2EA 4LGWA 1XJ4A 2XFSA 2WKRA 1FCMA 3HCYA 3HJKA 4B4ZA 5F83A 2PAVP 1H0MA 1A0KA 4GNUA 1J9MA 1YLWA 3E4QA 2FZ0A 3FG8A 1I5QA 2ZM2A 3UB8A 3WS5A 4Z9QA 1OT6A 3TW8A 4O0PA 3E0YA 4H8RA 4E3OA 3PXPA 2M1CA 5G4YA 2K2NA 3PTEA 2PDRA 3C2WA 2ACGA 1TS8A 2EX8A 5A92A 3FKVA 1K56D 5CHMA 5E2FA 5IU1A 3B47A 4KUKA 5F1FA 2QKPA 3VP0A 2HJ9C 2V1BA 1H3QA 3MZEA 1T18A 5FEGA 1S4RA 4E3NA 5AJGA 4K08A 3H82B 4HH2A 3PAGA 1E3UD 5KSCA 2WYXA 2P04A 3HLBA 2ZC5B 2OOLA 4KZ4A 3D4FA 2H28A 5TBMA 1SDNA 4P0MA 3UPNA 4BMWA 2A3UA 3N8SA 1BZAA 1TD5A 1RP5A 3ZQ5A 3G2YA 1O07A 2V1ZA 5EFWA 5A90A 3LIFA 1GHPA 2PU4A 2Z6DA 4P85A 1PW8A 3GR2A 5TJJA 3VV4A 3PBQA 4P6ZS 3U4LP 4IUHA 1V9YA 2XA7S 3BEBA 3B3XA 3UY6A 3EEHA 1HZOA 2Y59A 4RA7A 4MEZA 1OTAA 1Z09A 3RXWA 3SH9A 4NETA 3IHAA 4I3AA 1XJ6A 3ZG8B 3W2ZA 1GHMA 4FH2A 3V67A 3BFGA 3IF5A 3SS5A 3SW1A 3Q7ZA 4X6TA 4JBFA 4NK3A 3UMDA 5EV0A 2KLIA 1I2SA 3NJAA 4BL3A 4LV0A 1PI4A 1YSPA 2Y2MA 2PRFA 4XT2A 2J3TD 4ZJ1A 3TJZC 4B93A 3OPHA 4MNRA 4HY8A 5I94A 4JKTA 4KZ5A 3F1NA 3Q7VB 5DFYA 2X02A 1NRJA 4HI4A 1BYWA 4IVKA 1UGUA 3IF6C 1IKIA 2WADA 1TVFA 3C7UA 4S2MA 4WMCA 3PR6A 2Q9NA 5EUAA 2K31A 2MJ6A 4HNBA 4DDSA 4B9OA 1LL9A 5DKKA 1K25A 3A0SA 1K54C 2HV1A 3S22A 4HESA 2WKIA 1S1YA 5F68A 4FCFA 1DJAA 3GQZA 3BFCA 2KDKA 3S1YA 2K7SA 5F6AA 2HJEA 3IQAA 5EVIA 3PBRA 1WYBA 1CI8A 4H6JA 3MXQA 2BLSA 5DFXA 1S67L 2Y55A 4GD8A 3ZVWA 1W63Q 5CEDA 3N6IA 2UWXA 2Y2GA 2EX9A 2G2UA 2QJ7A 5IHVA 4WF0A 5E43A 5GL9A 4WELA 3NC8A 4X68A 4DE1A 2XD1A 3H9WA 2V0WA 2VX8A 5TR7A 4OQIA 2VGKA 4Z1WA 3UPPA 4RVAA 1H8YA 4OKPA 1BLCA 2W3HA 3MBZA 3NIAA 2W1TB 4R70A 2ZQ8A 4KQDA 2PR6A 4LRYC 4DRTA 4LV2A 1FCOA 4R4SA 4NKPA 3QP5A 4EEUA 2KX6A 1PZOA 4KG5A 1NRFA 1ZG4A 3G34A 4JLFA 4JXVA 4HBTA 4P87A 1DP6A 4ZBEA 1IFQA 4X53A 1Y28A 2J7VA 3C38A 1PW1A 5HWVA 2P74A 2ZBBA 4E3IA 3NULA 4X1LA 1LL5A 3ZG7B 1OJGA 5FI7A 2V8FA 3LY3A 3JVUA 2C5WB 2PT7A 2Y2HA 3FPWA 2UV0E 4BBUA 3CAXA 2JHEA 4OQ0A 2WKPA 1MWRA 2OLUA 4WN5A 1LHYA 4GKUA 1K6SA 4WEJA 4ETZA 2FFYA 1MBLA 1GA0A 3VOLA 2B02A 3DWKA 3HUNA 5HAPA 2Z2LB 3VP3A 4WYYA 5LBRA 2QJ5A 2ZOIA 1W63M 1SZVA 1KE4A 4GB7A 3MQOA 1YAXA 1K6RA 2VV8A 4U0XA 4F3LB 5CTNA 3FPVA 1OT9A 3FKWA 5CGWA 4MMNA 1FSYA 4HIAA 4JXWA 1MPLA 3ZVTA 4EV4A 3Q07A 1NZOA 2V8CA 1VQQA 4K0WA 1XFNA 4WLAA 5HL6A 3ZG9B 2A24B 1IOUA 3T4TA 3IBJA 4XUXA 3IF6B 3MR0A 3LIBA 1KGGA 4C75A 4DN0A 3ZDJA 1IYSA 2VV6A 4WUJA 3LI9A 3MKEA 2ZMAA 4BLMA 3OOVA 4DDYA 1MKIA 2ZL1B 4LRXC 3PHYA 1YQSA 2DMWA 3T1XA 2E8JA 3L9KA 2A2LA 2GJ3A 3Q7VA 1WA9A 4Y0OA 2Y91A 1CJFA 3IHBA 4B4XA 1Y4OA 3NOPC 3UE6A 4HOIA 3LR3A 1ES2A 4GJ4A 3UDXA 3A3JA 2HP5A 5DTSA 4G3KA 4S2LA 1Q2QA 4ARZB 5CECA 4Q0IA 4PKYG 3TRCA 4OLDA 3OZHA 3PBNA 1ALQA 2CC1A 3MZFA 4R4RA 1IELA 1STZA 1YT4A 1S0WA 2L0WA 4LV3A 1LSWA 4CQHA 1MKMA 4D2OA 2X01A 4N1HA 3VSKA 3H7WB 4Y0UA 1PZPA 2ZMVA 3CG5A 1W7FA 3BWLA 5CXWA 1K0KA 3IXGA
chains in the Genus database with same CATH topology
3GMWA 4R1GA 2JE5A 4UAAA 5F1FA 1MWUA 4X55A 1ES4A 1NXYA 3Q81A 5A93A 2XFTA 2IWBA 1K56A 4OONA 1BSGA 3VP0A 3VP4A 3TOIA 4EUZA 1MWTA 1KVLA 4KENB 4O7DA 2JCHA 3MZEA 1NZUA 3SH8A 3ZCZA 1LI9A 5FAOA 1SDEA 4ZJ3A 5DVAA 4E3NA 5CERA 4ID4A 5FATA 2XR0A 4E6WA 4Q8IA 2IWDA 3O87A 3G4PA 3N7WA 1E25A 3PAGA 4IEDA 1E3UD 5KSCA 2WYXA 4FD8A 1E4DA 1IYOA 3OCLA 5EVID 3HLBA 1NY0A 4HEFA 2WGWB 2ZC5B 3FZCA 1FQGA 4Y0TA 4KZ4A 1VM1A 3D4FA 2EX2A 1E3UA 2H5SA 1PWDA 1K4EA 3M6HA 3P98A 1N9BA 2XD5A 1SDNA 2Y2LA 3AGFA 5EPHA 5EOEA 4P0MA 3V50A 1NYYA 3UPNA 2ZM8A 4FSFA 2A3UA 3JYIA 3N8SA 1S6RA 1BZAA 1RP5A 5FA7A 4EWFA 3IT9A 3G2YA 1JWVA 3MXRA 1O07A 2V1ZA 4GD6A 5DF8A 5A90A 2RL3A 2V2FF 5KZHA 1GHPA 2PU4A 1JVJA 1L2SA 1M40A 4P85A 5FAQA 4ZJ2A 2BG1A 3LO7A 3W4PA 4KG6A 1PW8A 1O7EA 1XA7A 4FH4A 4QJGA 2Q9MA 5GLBA 2WGIA 1PYYA 4LCLA 5GHYA 3GR2A 5CHUA 1YLYA 5HW3A 3PBQA 2Y2JA 1N4OA 2B5RA 2ZC3B 4U3TA 3ZGAB 3C5AA 1YLJA 4ZAMA 2P9VA 4N9LA 3ZNYA 3IWOA 3BEBA 3B3XA 3UY6A 3LEZA 4UA6A 1HZOA 4LV1A 2Y59A 3SS4A 1HD8A 1XPBA 3MXSA 4RA7A 4MEZA 4PM5A 5KMWA 1FCNA 5M18A 3GSGA 3V39A 3RXWA 3SH9A 2J9PA 1BTLA 3ZNTA 5FASA 4NETA 1G6AA 3NI9A 4JF6A 3W4OA 3IHAA 3IXHA 1L0EA 3GRJA 1Y54A 3UE0A 4IBRA 3HLGA 4K0XA 3NDGA 3FKVA 4OPQA 1U60A 4DKIA 3ZG8B 5FI2A 2ZC6B 4DE3A 3QNBA 1GHMA 1IYQA 2QPNA 1HTZA 2VGJA 4FH2A 3BFGA 4QU3A 1KDWA 3IF5A 3SS5A 3MKFA 2Y2NA 3DWZA 5FDHA 3ZG5A 4DE0A 3Q7ZA 4X6TA 1W79A 5DF9A 4F94A 4MBHA 4JBFA 4P6BA 1K38A 4NK3A 4OOLA 1I2WA 1KVMA 4KZ9A 4PM9A 1I2SA 4LCMA 3PBSA 2I72A 5FQ9A 2OV5A 5KSHA 5HAQA 4OVDA 3QHYA 3N8LA 1ESUA 4BL3A 3EQVA 1FR6A 4LV0A 1RGYA 5AQ7A 3ZFZA 3UE3A 4OQGA 1PI4A 3GTCA 2Y2MA 2WZXA 1ES3A 1H8ZA 4EBLA 4ZJ1A 4S2KA 2Y2QA 3HBRA 4XXRA 3OPHA 3CMZA 4GDBA 4YINA 3I7JA 4MNRA 1FOFA 1M6KA 3BLMA 4KZ8A 4KQOA 3WS4A 1K4FA 2E8IA 3M2JA 3VMAA 5I94A 3GV9A 3HLFA 1WE4A 4JKTA 4ZTKA 4KZ5A 5JYOA 4E3MA 1YMSA 3Q7VB 3IF6A 3OC2A 1MY8A 2XGNA 4S2JA 1XXMA 5CGXA 3RJUA 2X02A 5E2GA 5G18A 4WMCD 3BECA 3VOZA 2ZC4B 2OLVA 4IVKA 2EXBA 3WS2A 1TEMA 3IF6C 1IKIA 2WADA 1TVFA 1K54A 3C7UA 3FWLA 4S2MA 4S2NA 3VP2A 4WMCA 3LCEA 5CTMA 4UA9A 1ONHA 2Q9NA 5EUAA 1JWPA 4OOYA 3UE1A 3CJMA 3NDEA 4OP5A 4C3QA 5EVLA 4BL2A 3OPLA 4DDSA 1BUEA 2ZC7A 4KQRA 2XEPA 1LL9A 5TGFA 1PIOA 1K25A 1K54C 4QHCA 4S2NC 5D3OA 3FV7A 4E3JA 3S22A 3O3VA 4HESA 2WKIA 1RCJA 2XLNA 5CGSA 1L0DA 5AQAA 5BOHA 4KZ7A 1L0GA 1QMEA 1TDLA 3ITAA 4FCFA 1CEFA 1DJAA 1ERMA 3GQZA 3BFCA 4BD1A 2WUQA 3S1YA 1AXBA 3QNCA 5FQIA 3IQAA 3E2KA 5CHJA 2DRWA 5EVIA 3IH9A 3PBRA 4OPRA 1WYBA 1CI8A 1XA1A 3BFDA 1BULA 5GHZA 4JF5A 3ZHHA 4EQIA 5EOOA 1ONGA 2BLSA 4GZBA 1Q2PA 1MWSA 4S2PA 4D2OA 1G68A 1XP4A 2Y55A 1IYPA 4GD8A 5EE8A 2EFXA 5EVIC 3IWIA 4CJNA 3TG9A 1FR1A 1DJCA 1PI5A 4WZ4A 3ZVWA 5U47A 4C6YA 5CEDA 2ZQAA 3C4PA 2UWXA 2Y2GA 3N6IA 5TFQA 2EX9A 2G2UA 3IH8A 5IHVA 1W8QA 3SH7A 5E43A 5GL9A 4WELA 3PAEA 3NC8A 4X68A 4DE1A 1CEGA 2XD1A 3G32A 4S2OA 1DJBA 1ZC2A 3NCKA 5CRFA 5TR7A 4GN2A 4OQIA 2VGKA 5F1GA 3UPPA 4B88A 2H0YA 1QMFA 2Y2PA 3UO9A 4RVAA 1H8YA 4U0TA 4OKPA 1XGIA 3NY4A 1BLCA 3DTMA 4OLGA 3Q82A 3MBZA 3NIAA 1CK3A 3OCNA 3FYZA 2DCFA 4R0QA 2ZQ8A 3N8RA 2V20A 1BLHA 3HREA 4KZ6A 4PPRA 4DRTA 4LV2A 1ZG6A 1FCOA 4R3JA 3M2KA 1SHVA 4LENA 4R4SA 4BD0A 4E3KA 4HBUA 1EWZA 5FQJA 4YFMA 3HL9A 5EVIB 1PZOA 3V3RA 4KG5A 4CPKA 2XDMA 1NRFA 1ZG4A 3G34A 4JLFA 4OPZA 5A91A 3S4XA 4JXSA 2PU2A 3UN7A 4QY6A 4JXVA 5FQQA 3HUOA 2ZM0A 4HBTA 4S2IA 4P87A 1MXOA 2HDQA 2WAEA 4OOMA 1EI5A 4ZBEA 4X53A 5AQBA 4X56A 4L0LA 2J7VA 2WGVA 1H5XA 3AGDA 1PW1A 2IWCA 4OH0A 1TDGA 2HP6A 3O88A 4OPYA 2P74A 4M3KA 3WRTA 3A3DA 4WZ5A 3UDFA 4E3IA 2Y2IA 4ZDXA 1LL5A 3VP1A 1ES5A 2XH9A 2ZLYA 4GOGA 2ZQCA 3ZG7B 5FI7A 3ISGA 3LY3A 2QMIA 2WGWA 2QZ6A 4DF6A 1NYMA 3G31A 1L0FA 1YLZA 3OPRA 2FFFB 3BM6A 2P9VB 5L2FA 5FI6A 1KDSA 1BLSA 2ZQDA 4KG2A 4KZBA 5M1AA 3V5MA 3M6BA 2C5WB 1JWZA 4PM8A 4WZ5C 5J8XA 1YMXA 1LLBA 5E2HA 2Y2HA 2XQZA 2XK1A 3VFFA 1PWCA 3A3FA 4WBGA 1KE0A 4OQ0A 4QY5A 3G35A 4RX2A 1MWRA 2XF3A 2OLUA 1LHYA 1JTDA 3HLCA 1K6SA 4GKUA 4WEJA 4UA7A 2FFYA 1MBLA 1GA0A 3IXDA 4WM9A 4RYEA 3DWKA 3V3SA 3HUNA 5HAPA 2Z2LB 3G30A 4MBFA 3RXXA 3VP3A 2JC7A 2EX6A 4WYYA 3WS1A 3OPPA 3BFFA 2Y4AA 4XUZA 4N1XA 3UNWA 1KE4A 3N4IA 4GB7A 4KZAA 2HDUA 3W4QA 1K6RA 4E3LA 5CEBA 3LY4A 4U0XA 2ZJ9A 3UDIA 3C4OA 3MZDA 3PBOA 5CTNA 2Z2MB 1SKFA 3C7VA 3MFDA 4PM6A 2HDSA 3FKWA 4MLLA 5CGWA 4QB8A 1FSYA 2ZD8A 4JXWA 5HAIA 1SCWA 1YLPA 3W8KA 1MPLA 4N9KA 3ZVTA 1BLPA 4EV4A 3Q07A 5GHXA 2JBFA 1NZOA 5GLDA 4N92A 1VQQA 2ZQ9A 1IKGA 3BFEA 2WKHA 4K0WA 1WYCA 1CI9A 1GCEA 4JF4A 3WS0A 3ZG9B 3E2LA 3HLDA 5DTKA 3TSGA 1EROA 2H10A 3A3IA 2X71A 1PWGA 5EECA 2EFUA 3NBLA 5AQ9A 2C6WB 1JTGA 5DTTA 3VSLA 5HARA 4IBXA 2R9WA 1GA9A 2WK0A 1W5DA 4XUXA 3GVBA 3HLEA 3G2ZA 3IF6B 5GLAA 3AGEA 1LI0A 2WZZA 2RCXA 3A3EA 1KGGA 1C3BA 2R9XA 4C75A 2HPBA 5HX9A 3ZDJA 3HLWA 1W8YA 2ZQ7A 4PM7A 4K91A 4A5RA 5FQMA 3SS3A 4IVIA 5DF7A 1IYSA 4UHUA 4JPMA 4X69A 2J8YA 3BYDA 2WAFA 3ITBA 4MBKA 4KQQA 1K57A 5M19A 1YLTA 3Q1FA 3MKEA 2ZMAA 4BLMA 4DE2A 3DW0A 3HVFA 1BT5A 1K56D 4DDYA 1IEMA 1MKIA 1ERQA 3IWQA 5FQKA 1Z6FA 1YQSA 2G2WA 2WKEA 3VOYA 3CZDA 3PBTA 4RX3A 1K57C 1XKZA 3Q7VA 4Y0OA 2Y91A 3SOIA 5JYPA 3IHBA 4B4XA 3WWXA 3UPOA 4KZ3A 4R3BA 2GDNA 1KGFA 2HDRA 5GLCA 1YM1A 1K55A 4EBPA 2DNSA 1ES2A 5HL1A 2H0TA 3UDXA 3A3JA 2HP5A 5DTSA 4JXGA 4S2LA 2HP9A 4OQHA 1Q2QA 3BLSA 5CECA 2J9OA 5E2EA 4PMAA 1ESIA 1K55C 2XFSA 5FAPA 1KE3A 1FCMA 3BRMA 4OLDA 1ZKJA 2OSUA 4DXBA 2A49A 4BQMA 5F82A 3OZHA 1GHIA 4B4ZA 5FSRA 1RGZA 1FSWA 1ALQA 2CC1A 3MZFA 3PBNA 5F83A 4R4RA 3IXBA 4GNUA 3P09A 1J9MA 1IELA 1YLWA 4QD4A 1YT4A 1S0WA 1NJ4A 2Y2KA 1I5QA 2ZM2A 3WS5A 4LV3A 4Y7PA 4Z9QA 2EXAA 3VFHA 3WRZA 4E6XA 4DXCA 1KGEA 1OMEA 2PBYA 1DY6A 4EBNA 4R23A 1XGJA 1HVBA 4BJPA 3EQUA 4H8RA 5HFOA 4N1HA 2Y2OA 2X01A 4OP8A 3VSKA 4E3OA 3PTEA 4Y0UA 3O86A 1PZPA 4WEKA 3ZG0A 3CG5A 4BENA 4GDNA 1W7FA 2EX8A 5CXWA 5A92A 3IXGA 3HUMA 1XX2A 5CHMA 5E2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GMW A;  4R1G A;  2JE5 A;  4UAA A;  5F1F A;  1MWU A;  4X55 A;  1ES4 A;  1NXY A;  3Q81 A;  5A93 A;  2XFT A;  2IWB A;  1K56 A;  4OON A;  1BSG A;  3VP0 A;  3VP4 A;  3TOI A;  4EUZ A;  1MWT A;  1KVL A;  4KEN B;  4O7D A;  2JCH A;  3MZE A;  1NZU A;  3SH8 A;  3ZCZ A;  1LI9 A;  5FAO A;  1SDE A;  4ZJ3 A;  5DVA A;  4E3N A;  5CER A;  4ID4 A;  5FAT A;  2XR0 A;  4E6W A;  4Q8I A;  2IWD A;  3O87 A;  3G4P A;  3N7W A;  1E25 A;  3PAG A;  4IED A;  1E3U D;  5KSC A;  2WYX A;  4FD8 A;  1E4D A;  1IYO A;  3OCL A;  5EVI D;  3HLB A;  1NY0 A;  4HEF A;  2WGW B;  2ZC5 B;  3FZC A;  1FQG A;  4Y0T A;  4KZ4 A;  1VM1 A;  3D4F A;  2EX2 A;  1E3U A;  2H5S A;  1PWD A;  1K4E A;  3M6H A;  3P98 A;  1N9B A;  2XD5 A;  1SDN A;  2Y2L A;  3AGF A;  5EPH A;  5EOE A;  4P0M A;  3V50 A;  1NYY A;  3UPN A;  2ZM8 A;  4FSF A;  2A3U A;  3JYI A;  3N8S A;  1S6R A;  1BZA A;  1RP5 A;  5FA7 A;  4EWF A;  3IT9 A;  3G2Y A;  1JWV A;  3MXR A;  1O07 A;  2V1Z A;  4GD6 A;  5DF8 A;  5A90 A;  2RL3 A;  2V2F F;  5KZH A;  1GHP A;  2PU4 A;  1JVJ A;  1L2S A;  1M40 A;  4P85 A;  5FAQ A;  4ZJ2 A;  2BG1 A;  3LO7 A;  3W4P A;  4KG6 A;  1PW8 A;  1O7E A;  1XA7 A;  4FH4 A;  4QJG A;  2Q9M A;  5GLB A;  2WGI A;  1PYY A;  4LCL A;  5GHY A;  3GR2 A;  5CHU A;  1YLY A;  5HW3 A;  3PBQ A;  2Y2J A;  1N4O A;  2B5R A;  2ZC3 B;  4U3T A;  3ZGA B;  3C5A A;  1YLJ A;  4ZAM A;  2P9V A;  4N9L A;  3ZNY A;  3IWO A;  3BEB A;  3B3X A;  3UY6 A;  3LEZ A;  4UA6 A;  1HZO A;  4LV1 A;  2Y59 A;  3SS4 A;  1HD8 A;  1XPB A;  3MXS A;  4RA7 A;  4MEZ A;  4PM5 A;  5KMW A;  1FCN A;  5M18 A;  3GSG A;  3V39 A;  3RXW A;  3SH9 A;  2J9P A;  1BTL A;  3ZNT A;  5FAS A;  4NET A;  1G6A A;  3NI9 A;  4JF6 A;  3W4O A;  3IHA A;  3IXH A;  1L0E A;  3GRJ A;  1Y54 A;  3UE0 A;  4IBR A;  3HLG A;  4K0X A;  3NDG A;  3FKV A;  4OPQ A;  1U60 A;  4DKI A;  3ZG8 B;  5FI2 A;  2ZC6 B;  4DE3 A;  3QNB A;  1GHM A;  1IYQ A;  2QPN A;  1HTZ A;  2VGJ A;  4FH2 A;  3BFG A;  4QU3 A;  1KDW A;  3IF5 A;  3SS5 A;  3MKF A;  2Y2N A;  3DWZ A;  5FDH A;  3ZG5 A;  4DE0 A;  3Q7Z A;  4X6T A;  1W79 A;  5DF9 A;  4F94 A;  4MBH A;  4JBF A;  4P6B A;  1K38 A;  4NK3 A;  4OOL A;  1I2W A;  1KVM A;  4KZ9 A;  4PM9 A;  1I2S A;  4LCM A;  3PBS A;  2I72 A;  5FQ9 A;  2OV5 A;  5KSH A;  5HAQ A;  4OVD A;  3QHY A;  3N8L A;  1ESU A;  4BL3 A;  3EQV A;  1FR6 A;  4LV0 A;  1RGY A;  5AQ7 A;  3ZFZ A;  3UE3 A;  4OQG A;  1PI4 A;  3GTC A;  2Y2M A;  2WZX A;  1ES3 A;  1H8Z A;  4EBL A;  4ZJ1 A;  4S2K A;  2Y2Q A;  3HBR A;  4XXR A;  3OPH A;  3CMZ A;  4GDB A;  4YIN A;  3I7J A;  4MNR A;  1FOF A;  1M6K A;  3BLM A;  4KZ8 A;  4KQO A;  3WS4 A;  1K4F A;  2E8I A;  3M2J A;  3VMA A;  5I94 A;  3GV9 A;  3HLF A;  1WE4 A;  4JKT A;  4ZTK A;  4KZ5 A;  5JYO A;  4E3M A;  1YMS A;  3Q7V B;  3IF6 A;  3OC2 A;  1MY8 A;  2XGN A;  4S2J A;  1XXM A;  5CGX A;  3RJU A;  2X02 A;  5E2G A;  5G18 A;  4WMC D;  3BEC A;  3VOZ A;  2ZC4 B;  2OLV A;  4IVK A;  2EXB A;  3WS2 A;  1TEM A;  3IF6 C;  1IKI A;  2WAD A;  1TVF A;  1K54 A;  3C7U A;  3FWL A;  4S2M A;  4S2N A;  3VP2 A;  4WMC A;  3LCE A;  5CTM A;  4UA9 A;  1ONH A;  2Q9N A;  5EUA A;  1JWP A;  4OOY A;  3UE1 A;  3CJM A;  3NDE A;  4OP5 A;  4C3Q A;  5EVL A;  4BL2 A;  3OPL A;  4DDS A;  1BUE A;  2ZC7 A;  4KQR A;  2XEP A;  1LL9 A;  5TGF A;  1PIO A;  1K25 A;  1K54 C;  4QHC A;  4S2N C;  5D3O A;  3FV7 A;  4E3J A;  3S22 A;  3O3V A;  4HES A;  2WKI A;  1RCJ A;  2XLN A;  5CGS A;  1L0D A;  5AQA A;  5BOH A;  4KZ7 A;  1L0G A;  1QME A;  1TDL A;  3ITA A;  4FCF A;  1CEF A;  1DJA A;  1ERM A;  3GQZ A;  3BFC A;  4BD1 A;  2WUQ A;  3S1Y A;  1AXB A;  3QNC A;  5FQI A;  3IQA A;  3E2K A;  5CHJ A;  2DRW A;  5EVI A;  3IH9 A;  3PBR A;  4OPR A;  1WYB A;  1CI8 A;  1XA1 A;  3BFD A;  1BUL A;  5GHZ A;  4JF5 A;  3ZHH A;  4EQI A;  5EOO A;  1ONG A;  2BLS A;  4GZB A;  1Q2P A;  1MWS A;  4S2P A;  4D2O A;  1G68 A;  1XP4 A;  2Y55 A;  1IYP A;  4GD8 A;  5EE8 A;  2EFX A;  5EVI C;  3IWI A;  4CJN A;  3TG9 A;  1FR1 A;  1DJC A;  1PI5 A;  4WZ4 A;  3ZVW A;  5U47 A;  4C6Y A;  5CED A;  2ZQA A;  3C4P A;  2UWX A;  2Y2G A;  3N6I A;  5TFQ A;  2EX9 A;  2G2U A;  3IH8 A;  5IHV A;  1W8Q A;  3SH7 A;  5E43 A;  5GL9 A;  4WEL A;  3PAE A;  3NC8 A;  4X68 A;  4DE1 A;  1CEG A;  2XD1 A;  3G32 A;  4S2O A;  1DJB A;  1ZC2 A;  3NCK A;  5CRF A;  5TR7 A;  4GN2 A;  4OQI A;  2VGK A;  5F1G A;  3UPP A;  4B88 A;  2H0Y A;  1QMF A;  2Y2P A;  3UO9 A;  4RVA A;  1H8Y A;  4U0T A;  4OKP A;  1XGI A;  3NY4 A;  1BLC A;  3DTM A;  4OLG A;  3Q82 A;  3MBZ A;  3NIA A;  1CK3 A;  3OCN A;  3FYZ A;  2DCF A;  4R0Q A;  2ZQ8 A;  3N8R A;  2V20 A;  1BLH A;  3HRE A;  4KZ6 A;  4PPR A;  4DRT A;  4LV2 A;  1ZG6 A;  1FCO A;  4R3J A;  3M2K A;  1SHV A;  4LEN A;  4R4S A;  4BD0 A;  4E3K A;  4HBU A;  1EWZ A;  5FQJ A;  4YFM A;  3HL9 A;  5EVI B;  1PZO A;  3V3R A;  4KG5 A;  4CPK A;  2XDM A;  1NRF A;  1ZG4 A;  3G34 A;  4JLF A;  4OPZ A;  5A91 A;  3S4X A;  4JXS A;  2PU2 A;  3UN7 A;  4QY6 A;  4JXV A;  5FQQ A;  3HUO A;  2ZM0 A;  4HBT A;  4S2I A;  4P87 A;  1MXO A;  2HDQ A;  2WAE A;  4OOM A;  1EI5 A;  4ZBE A;  4X53 A;  5AQB A;  4X56 A;  4L0L A;  2J7V A;  2WGV A;  1H5X A;  3AGD A;  1PW1 A;  2IWC A;  4OH0 A;  1TDG A;  2HP6 A;  3O88 A;  4OPY A;  2P74 A;  4M3K A;  3WRT A;  3A3D A;  4WZ5 A;  3UDF A;  4E3I A;  2Y2I A;  4ZDX A;  1LL5 A;  3VP1 A;  1ES5 A;  2XH9 A;  2ZLY A;  4GOG A;  2ZQC A;  3ZG7 B;  5FI7 A;  3ISG A;  3LY3 A;  2QMI A;  2WGW A;  2QZ6 A;  4DF6 A;  1NYM A;  3G31 A;  1L0F A;  1YLZ A;  3OPR A;  2FFF B;  3BM6 A;  2P9V B;  5L2F A;  5FI6 A;  1KDS A;  1BLS A;  2ZQD A;  4KG2 A;  4KZB A;  5M1A A;  3V5M A;  3M6B A;  2C5W B;  1JWZ A;  4PM8 A;  4WZ5 C;  5J8X A;  1YMX A;  1LLB A;  5E2H A;  2Y2H A;  2XQZ A;  2XK1 A;  3VFF A;  1PWC A;  3A3F A;  4WBG A;  1KE0 A;  4OQ0 A;  4QY5 A;  3G35 A;  4RX2 A;  1MWR A;  2XF3 A;  2OLU A;  1LHY A;  1JTD A;  3HLC A;  1K6S A;  4GKU A;  4WEJ A;  4UA7 A;  2FFY A;  1MBL A;  1GA0 A;  3IXD A;  4WM9 A;  4RYE A;  3DWK A;  3V3S A;  3HUN A;  5HAP A;  2Z2L B;  3G30 A;  4MBF A;  3RXX A;  3VP3 A;  2JC7 A;  2EX6 A;  4WYY A;  3WS1 A;  3OPP A;  3BFF A;  2Y4A A;  4XUZ A;  4N1X A;  3UNW A;  1KE4 A;  3N4I A;  4GB7 A;  4KZA A;  2HDU A;  3W4Q A;  1K6R A;  4E3L A;  5CEB A;  3LY4 A;  4U0X A;  2ZJ9 A;  3UDI A;  3C4O A;  3MZD A;  3PBO A;  5CTN A;  2Z2M B;  1SKF A;  3C7V A;  3MFD A;  4PM6 A;  2HDS A;  3FKW A;  4MLL A;  5CGW A;  4QB8 A;  1FSY A;  2ZD8 A;  4JXW A;  5HAI A;  1SCW A;  1YLP A;  3W8K A;  1MPL A;  4N9K A;  3ZVT A;  1BLP A;  4EV4 A;  3Q07 A;  5GHX A;  2JBF A;  1NZO A;  5GLD A;  4N92 A;  1VQQ A;  2ZQ9 A;  1IKG A;  3BFE A;  2WKH A;  4K0W A;  1WYC A;  1CI9 A;  1GCE A;  4JF4 A;  3WS0 A;  3ZG9 B;  3E2L A;  3HLD A;  5DTK A;  3TSG A;  1ERO A;  2H10 A;  3A3I A;  2X71 A;  1PWG A;  5EEC A;  2EFU A;  3NBL A;  5AQ9 A;  2C6W B;  1JTG A;  5DTT A;  3VSL A;  5HAR A;  4IBX A;  2R9W A;  1GA9 A;  2WK0 A;  1W5D A;  4XUX A;  3GVB A;  3HLE A;  3G2Z A;  3IF6 B;  5GLA A;  3AGE A;  1LI0 A;  2WZZ A;  2RCX A;  3A3E A;  1KGG A;  1C3B A;  2R9X A;  4C75 A;  2HPB A;  5HX9 A;  3ZDJ A;  3HLW A;  1W8Y A;  2ZQ7 A;  4PM7 A;  4K91 A;  4A5R A;  5FQM A;  3SS3 A;  4IVI A;  5DF7 A;  1IYS A;  4UHU A;  4JPM A;  4X69 A;  2J8Y A;  3BYD A;  2WAF A;  3ITB A;  4MBK A;  4KQQ A;  1K57 A;  5M19 A;  1YLT A;  3Q1F A;  3MKE A;  2ZMA A;  4BLM A;  4DE2 A;  3DW0 A;  3HVF A;  1BT5 A;  1K56 D;  4DDY A;  1IEM A;  1MKI A;  1ERQ A;  3IWQ A;  5FQK A;  1Z6F A;  1YQS A;  2G2W A;  2WKE A;  3VOY A;  3CZD A;  3PBT A;  4RX3 A;  1K57 C;  1XKZ A;  3Q7V A;  4Y0O A;  2Y91 A;  3SOI A;  5JYP A;  3IHB A;  4B4X A;  3WWX A;  3UPO A;  4KZ3 A;  4R3B A;  2GDN A;  1KGF A;  2HDR A;  5GLC A;  1YM1 A;  1K55 A;  4EBP A;  2DNS A;  1ES2 A;  5HL1 A;  2H0T A;  3UDX A;  3A3J A;  2HP5 A;  5DTS A;  4JXG A;  4S2L A;  2HP9 A;  4OQH A;  1Q2Q A;  3BLS A;  5CEC A;  2J9O A;  5E2E A;  4PMA A;  1ESI A;  1K55 C;  2XFS A;  5FAP A;  1KE3 A;  1FCM A;  3BRM A;  4OLD A;  1ZKJ A;  2OSU A;  4DXB A;  2A49 A;  4BQM A;  5F82 A;  3OZH A;  1GHI A;  4B4Z A;  5FSR A;  1RGZ A;  1FSW A;  1ALQ A;  2CC1 A;  3MZF A;  3PBN A;  5F83 A;  4R4R A;  3IXB A;  4GNU A;  3P09 A;  1J9M A;  1IEL A;  1YLW A;  4QD4 A;  1YT4 A;  1S0W A;  1NJ4 A;  2Y2K A;  1I5Q A;  2ZM2 A;  3WS5 A;  4LV3 A;  4Y7P A;  4Z9Q A;  2EXA A;  3VFH A;  3WRZ A;  4E6X A;  4DXC A;  1KGE A;  1OME A;  2PBY A;  1DY6 A;  4EBN A;  4R23 A;  1XGJ A;  1HVB A;  4BJP A;  3EQU A;  4H8R A;  5HFO A;  4N1H A;  2Y2O A;  2X01 A;  4OP8 A;  3VSK A;  4E3O A;  3PTE A;  4Y0U A;  3O86 A;  1PZP A;  4WEK A;  3ZG0 A;  3CG5 A;  4BEN A;  4GDN A;  1W7F A;  2EX8 A;  5CXW A;  5A92 A;  3IXG A;  3HUM A;  1XX2 A;  5CHM A;  5E2F A; 
#chains in the Genus database with same CATH topology
 2JE5 A;  3EEA A;  3NOT C;  2OWH A;  1K56 A;  4OON A;  3VP4 A;  4EUZ A;  5HZH A;  4NXB A;  4ZJ3 A;  5FAT A;  3O87 A;  3P01 A;  4PAU A;  1E25 A;  4WL9 A;  2D02 A;  1E4D A;  1IYO A;  4CLC D;  2WGW B;  1N9O A;  1VM1 A;  1TS6 A;  1E3U A;  1K4E A;  3P98 A;  4O01 A;  2XD5 A;  1MC0 A;  5EOE A;  1NYY A;  2ZM8 A;  3JYI A;  4EWF A;  3IT9 A;  5KZH A;  2L1M A;  4CLC C;  1L2S A;  2M7U A;  3VE3 A;  4R38 A;  4KG6 A;  4FH4 A;  5L8M A;  2Q9M A;  5GLB A;  2WGI A;  4LCL A;  5GHY A;  5HW3 A;  1VET A;  1N4O A;  4U3T A;  2GNX A;  3IS2 B;  4I3J A;  5I5L A;  2M7V A;  3IWO A;  4I3I A;  2HZ5 A;  3LGO A;  1FCN A;  3S7P A;  3ICY A;  3SZT A;  4DJ2 A;  3GSG A;  2J9P A;  3NI9 A;  3HLG A;  4DKI A;  5FI2 A;  2W3F A;  5IS1 A;  3D9Y A;  1KDW A;  4FTX A;  3MKF A;  3DWZ A;  3BY9 A;  5FDH A;  1W79 A;  4F94 A;  4P6B A;  1K38 A;  1I2W A;  2HGV A;  4KZ9 A;  3T12 B;  2OV5 A;  5DJU A;  4OVD A;  3DTI A;  1FIL A;  3N8L A;  3EQV A;  3ZFZ A;  3CMZ A;  4KZ8 A;  4KQO A;  1K4F A;  2E8I A;  3M2J A;  2PD8 A;  4DMZ A;  4ZTK A;  4Y5F A;  5JYO A;  4E3M A;  3IF6 A;  4X1M A;  3B33 A;  3OBF A;  1MY8 A;  5CGX A;  3RJU A;  5E2G A;  1XJ3 A;  3VOZ A;  3FC7 A;  3E98 A;  2EXB A;  4ESP A;  1K54 A;  3E4O A;  3FWL A;  3IX4 A;  3LCE A;  3S7Q A;  2P7J A;  1JWP A;  4OP5 A;  4ZRR A;  3ZYT A;  5EVL A;  4C3Q A;  3OPL A;  2ZC7 A;  1PIO A;  4S2N C;  3K2N A;  4NXF A;  1RCJ A;  5BOH A;  5AQA A;  2AVX A;  1QME A;  3DAV A;  3ITA A;  1ERM A;  2PYR A;  3GDI A;  4HHD A;  1AXB A;  3QNC A;  5FQI A;  5CHJ A;  2DRW A;  4NXE A;  1XA1 A;  1BUL A;  3CUE C;  3ZHH A;  4EQI A;  5EOO A;  1ONG A;  5F5Y A;  2XRN A;  2Y79 A;  1G68 A;  5EE8 A;  3PYP A;  4ARZ A;  4WZ4 A;  3IH8 A;  1LL8 A;  1W8Q A;  1S4S A;  1XFQ A;  3PAE A;  2IA2 A;  3BW6 A;  1YPR A;  3G32 A;  4HH3 A;  2JKR I;  1DJB A;  4GN2 A;  5F1G A;  4U0T A;  3NY4 A;  3DTM A;  1CK3 A;  3FYZ A;  2DCF A;  4R0Q A;  4PPR A;  1ZG6 A;  3H7W A;  1OTD A;  4R3J A;  1T1A A;  4LEN A;  3T4K A;  4EUV A;  5L09 A;  5FQJ A;  4YFM A;  3HL9 A;  2GZA A;  4CLC B;  4OPZ A;  3S4X A;  3T4J A;  3UN7 A;  4JXS A;  2PU2 A;  4QY6 A;  5FQQ A;  3HUO A;  2WKQ A;  4S2I A;  1MXO A;  2JKF A;  2W3E A;  2CMN A;  4OOM A;  3KSG A;  5AQB A;  4X56 A;  1H5X A;  2V9A A;  2IWC A;  4OH0 A;  4M3K A;  3A3D A;  4ME4 A;  2Y2I A;  1FIK A;  3F1O B;  4BBT A;  5HPF A;  2WGW A;  4Y3I A;  3F1P B;  4DF6 A;  3G31 A;  1V9Z A;  4R3A A;  3BM6 A;  1HLU P;  5FI6 A;  5M1A A;  4KZB A;  4WZ5 C;  5KIZ A;  5J8X A;  4R6L A;  2W27 A;  1LLB A;  2J3T C;  2XQZ A;  3A0V A;  2XF3 A;  3V3S A;  2O9B A;  4N1X A;  2HDU A;  3W4Q A;  4E3L A;  5CEB A;  3EOI A;  2ZJ9 A;  3IS2 A;  3C4O A;  3MZD A;  3C7V A;  2BAS A;  2HDS A;  2V1A A;  4MLL A;  5HAI A;  3BQ8 A;  5GHX A;  5GLD A;  1IKG A;  2XSS A;  2WKH A;  1GCE A;  3HLD A;  3TSG A;  2H10 A;  3A3I A;  4HP9 A;  5DTT A;  3S7O A;  4IBX A;  2WK0 A;  2B95 A;  3LEQ A;  5GLA A;  3RTY A;  2WZZ A;  3A3E A;  1C3B A;  5F69 A;  1T1B A;  5HX9 A;  2ZQ7 A;  4HJ4 A;  4X69 A;  3Q1F A;  1DP8 A;  2OAQ 1;  4DE2 A;  3HVF A;  1IEM A;  3R7W B;  2WKE A;  3VOY A;  3CZD A;  1XKZ A;  1OPX A;  1GSX A;  3SOI A;  4KZ3 A;  4NG2 A;  2HDR A;  5GLC A;  5MC7 A;  1YM1 A;  4HQA A;  4Y15 A;  2DNS A;  4EXO A;  3JPU A;  4JGR A;  2HP9 A;  2Z6C A;  2J9O A;  4PMA A;  1ESI A;  2QHK A;  3QP4 A;  3T1S A;  3BRM A;  2OSU A;  3H82 A;  3BY8 A;  5F82 A;  4Q0J A;  5FSR A;  1RGZ A;  1FSW A;  2V0U A;  3IXB A;  5CX7 A;  4QD4 A;  4QPR A;  1NJ4 A;  2Y2K A;  2OWJ A;  1F98 A;  3MS6 A;  3VFH A;  3WRZ A;  4E6X A;  2L4R A;  1OME A;  5HD5 A;  1DY6 A;  4R23 A;  1XGJ A;  4DE3 A;  2EA9 A;  5HFO A;  3CI6 A;  3KYZ A;  4WEK A;  2PR5 A;  3O5Y A;  4EET B;  1TS7 A;  4R1G A;  1ES4 A;  3Q81 A;  1BSG A;  4UEY A;  1MWT A;  1KVL A;  1LSV A;  3SH8 A;  4IHQ A;  1LI9 A;  5FAO A;  1PFL A;  4Q8I A;  3LID A;  4E6W A;  3N7W A;  4I38 A;  4IED A;  4FD8 A;  3OCL A;  5EVI D;  4HEF A;  4Y0T A;  2PD7 A;  1PWD A;  3M6H A;  4CLC A;  3LUQ A;  3AGF A;  3UB9 A;  3GEC A;  1JWV A;  3KYQ A;  3MXR A;  5HDS A;  3LO7 A;  5J4E A;  2NUP C;  1O7E A;  4QJG A;  2VZW A;  2YKF A;  4JGO A;  5FDS A;  1VB6 A;  4FUW A;  2J80 A;  5EM1 A;  3F1P A;  1YKD A;  1P0Z A;  1YLJ A;  4HJ3 A;  4UA6 A;  4LV1 A;  3SS4 A;  1XPB A;  1HD8 A;  5M18 A;  1MZU A;  1UWP X;  1BTL A;  1G6A A;  4JF6 A;  3IXH A;  1L0E A;  2VJW A;  1Y54 A;  3NDG A;  3LR5 A;  4OPQ A;  1GSW A;  3QNB A;  1IYQ A;  1HTZ A;  2VGJ A;  4QU3 A;  2ZMF A;  2Y2N A;  5DF9 A;  4MBH A;  4OOL A;  3K3C A;  3RFB A;  3BQA A;  4EU0 A;  4LCM A;  3PBS A;  1JNU A;  3QHY A;  1ESU A;  5HWT A;  4BBV A;  2PBD P;  4Y13 A;  2BTF P;  1FR6 A;  4RQ9 A;  3GTC A;  2WZX A;  1ES3 A;  1H8Z A;  4EBL A;  4S2K A;  4XXR A;  4YIN A;  4GDB A;  3I7J A;  1FOF A;  1M6K A;  3BLM A;  3WS4 A;  3VMA A;  3R4K A;  3HLF A;  1WE4 A;  4NXG A;  3OC2 A;  4S2J A;  2D01 A;  3UB7 A;  3VP2 A;  4S2N A;  2KOI A;  5CTM A;  4UA9 A;  1YSQ A;  4OOY A;  3NDE A;  3LR0 A;  4BL2 A;  2W1T A;  3EGD C;  2XEP A;  2JKG A;  3S7N A;  5D3O A;  3FV7 A;  4E3J A;  3R7W A;  5HWW A;  2XLN A;  3CUE A;  5CGS A;  4KZ7 A;  1L0G A;  1TDL A;  4UQI M;  5HPI A;  3T50 A;  2WUQ A;  3E2K A;  3IH9 A;  4OPR A;  5C5K A;  5GHZ A;  3A0R A;  4JF5 A;  2Q0O A;  2O0Y A;  1MWS A;  4S2P A;  1XP4 A;  1IYP A;  2EFX A;  4CJN A;  1FR1 A;  1PI5 A;  5U47 A;  4C6Y A;  2ZQA A;  4JGP A;  4L9F A;  3F1N B;  3SH7 A;  2HF6 A;  1CEG A;  4PKY A;  3DTK A;  5CRF A;  4PHT A;  3CPT B;  1QMF A;  2Y2P A;  3UO9 A;  4YNR A;  2GX5 A;  1ZHH B;  4L9E A;  3N8R A;  2V20 A;  1BLH A;  4MN7 A;  3KYE A;  3M2K A;  1OTB A;  1UWN X;  3MSH A;  4E3K A;  1EWZ A;  2W3D A;  3HJI A;  5EVI B;  1CF0 A;  3V3R A;  4H6J B;  3DTE A;  1X0O A;  4CPK A;  2XDM A;  4F3L A;  3KX0 X;  5A91 A;  1VEU B;  2O9C A;  3QP1 A;  3LIA A;  2WAE A;  1EI5 A;  3D72 A;  3QP6 A;  2EWW A;  3O88 A;  4OPY A;  5FL3 A;  3WRT A;  4DJ3 A;  2XRO A;  4WZ5 A;  3UDF A;  4ZDX A;  4NEE D;  4YWZ A;  3VP1 A;  2XH9 A;  4GOG A;  1T19 A;  2A24 A;  2ZQC A;  3ISG A;  4MCW A;  4GLQ A;  1NYM A;  1N9N A;  1L0F A;  3OPR A;  2FFF B;  2P9V B;  1KDS A;  1BLS A;  4KG2 A;  1JWZ A;  4O8G A;  1SKO B;  2XK1 A;  3VFF A;  1PWC A;  3A3F A;  3MJQ A;  1D1J A;  4MN6 A;  2VKS A;  3G35 A;  1JTD A;  2VK3 A;  1EW0 A;  4UA7 A;  4WM9 A;  3VE4 A;  4MBF A;  3RXX A;  3WS1 A;  4MDZ A;  3EWK A;  4L9G A;  3UNW A;  1GSV A;  2ZL1 A;  4KZA A;  1NLZ A;  3LY4 A;  3LFV A;  3UDI A;  2B18 A;  4UQI S;  4EES A;  4EEP A;  3CWF A;  4PM6 A;  1SKF A;  2W0N A;  2JN7 A;  1SCW A;  2JBF A;  4EW7 A;  5IT5 A;  2ZQ9 A;  3G6O A;  1WYC A;  1CI9 A;  4JF4 A;  3T4Q A;  3E2L A;  5DTK A;  1ERO A;  5EEC A;  1PWG A;  2X71 A;  3NBL A;  5AQ9 A;  2C6W B;  3VSL A;  5HAR A;  1GA9 A;  1W5D A;  3GVB A;  3HLE A;  1LI0 A;  5HD3 A;  1ZTU A;  3KSF A;  1PRQ A;  3HLW A;  4EER A;  4PM7 A;  5FQM A;  4UHU A;  1F5M A;  3UB5 P;  3E4P A;  3ITB A;  4KQQ A;  3MF0 A;  5M19 A;  1BT5 A;  2O99 A;  1ERQ A;  3IWQ A;  1Z6F A;  2W1R A;  3T1Q B;  3C30 A;  3MMH A;  3PBT A;  1K57 C;  5JYP A;  3BJN A;  4GCZ A;  2GDN A;  3CIT A;  1KGF A;  1N9L A;  2I9V A;  4EBP A;  4YOF A;  4Y17 A;  5J7E A;  4JXG A;  4OQH A;  3BLS A;  2VA0 A;  1K55 C;  2LB9 A;  5FAP A;  1KE3 A;  2P08 A;  1ZKJ A;  4DXB A;  4M4X A;  2LB5 A;  2A49 A;  4BQM A;  3IX3 A;  3JVV A;  1GHI A;  2FH5 A;  1G6O A;  3P09 A;  2JKR M;  2G7U A;  5HDC A;  4I39 A;  4Y7P A;  5HSQ A;  2EXA A;  4GS9 B;  2Y8H A;  4II7 A;  3LI8 A;  1S66 L;  4DXC A;  1KGE A;  2PBY A;  4EBN A;  3EGX C;  1HVB A;  4BJP A;  3EQU A;  2Y2O A;  4X25 A;  4OP8 A;  3UB6 A;  3RH8 B;  3O86 A;  1NLY A;  3NOU C;  3ZG0 A;  4BEN A;  4GDN A;  2INW A;  3HUM A;  1XX2 A;  3GMW A;  4UAA A;  1MWU A;  4X55 A;  1NXY A;  1ODV A;  4IJG A;  2NUT C;  5A93 A;  2XFT A;  2IWB A;  5A8B A;  4AFI A;  2QYB A;  3CPT A;  3TOI A;  4KEN B;  4O7D A;  2JCH A;  1NZU A;  3ZCZ A;  1SDE A;  3ULF A;  5DVA A;  5CER A;  4ID4 A;  2XR0 A;  2IWD A;  3G4P A;  2VV7 A;  1NY0 A;  3FZC A;  1FQG A;  2EX2 A;  2H5S A;  1N9B A;  2Y2L A;  1VHM A;  5EPH A;  3V50 A;  4MN5 A;  4FSF A;  1S6R A;  5FA7 A;  1VEU A;  5DF8 A;  4GD6 A;  3MQQ A;  2RL3 A;  2V2F F;  1JVJ A;  4GHI B;  1M40 A;  5FAQ A;  4ZJ2 A;  2BG1 A;  3W4P A;  4Y2F A;  1D06 A;  1XA7 A;  1P9R A;  4Q0H A;  1PYY A;  5CHU A;  1YLY A;  2Y2J A;  2B5R A;  1J3W A;  1T1C A;  2ZC3 B;  3T4S A;  3IBR A;  3ZGA B;  3C5A A;  4HJ6 A;  4ZAM A;  2P9V A;  4N9L A;  3ZNY A;  3LEZ A;  1F2K A;  3MXS A;  1S1Z A;  4PM5 A;  1SKO A;  3OLO A;  5KMW A;  3V39 A;  3D3O A;  3ZNT A;  5FAS A;  5EVE A;  3W4O A;  3GRJ A;  3UE0 A;  4IBR A;  4K0X A;  1U60 A;  2ZC6 B;  2QPN A;  3ZG5 A;  4DE0 A;  1AWI A;  1KVM A;  4PM9 A;  3P7N A;  2I72 A;  5FQ9 A;  5KSH A;  5HAQ A;  3KO6 A;  5AQ7 A;  1RGY A;  1DP9 A;  1KOU A;  3UE3 A;  4OQG A;  2W3G A;  2Y2Q A;  3HBR A;  1LT0 A;  1VET B;  4CLC E;  2YKH A;  4LPZ A;  2VGL M;  1OTI A;  3GV9 A;  1TF1 A;  1YMS A;  1L3L A;  4KUO A;  2XGN A;  1XXM A;  3MQ0 A;  5G18 A;  4WMC D;  3BEC A;  2ZC4 B;  2OLV A;  3WS2 A;  1TEM A;  5DJT A;  3LIC A;  1ONH A;  3UE1 A;  3CJM A;  1BUE A;  4KQR A;  3DBA A;  5TGF A;  2JKT I;  4QHC A;  3O3V A;  1L0D A;  3KSI A;  4LRZ E;  1DRM A;  1CEF A;  1F9I A;  3LIE A;  4BD1 A;  3IX8 A;  3BFD A;  1P9W A;  3T1R A;  5L07 A;  2PYP A;  4GZB A;  1Q2P A;  4GW9 A;  4JGQ A;  5EVI C;  3IWI A;  3TG9 A;  1DJC A;  1OJ5 A;  1P97 A;  3C4P A;  5TFQ A;  3LR4 A;  3F1O A;  4HP4 A;  3NHQ A;  4ETX A;  4S2O A;  1ZC2 A;  3NCK A;  4B88 A;  2H0Y A;  4GS9 A;  2O9A A;  1XGI A;  4OLG A;  3Q82 A;  3OCN A;  1TS0 A;  3HRE A;  4KZ6 A;  3KSH A;  2JKT M;  3B42 A;  1SHV A;  4BD0 A;  4HBU A;  5TBM B;  5AVF A;  4D60 A;  3MFX A;  2EWV A;  4QWO A;  2ZM0 A;  3UME A;  3LYX A;  4EQ1 A;  2HDQ A;  4L0L A;  1PNE A;  2WGV A;  3AGD A;  2PHY A;  1TDG A;  2HP6 A;  1G28 A;  2ZOH A;  1ES5 A;  2ZLY A;  3K3D A;  2VGL S;  3QP8 A;  2QMI A;  2QZ6 A;  1YLZ A;  5L2F A;  2J3W A;  2ZQD A;  3V5M A;  3M6B A;  4PM8 A;  1YMX A;  4LLO B;  5E2H A;  4LFU A;  5AVE A;  4WBG A;  1KE0 A;  4QY5 A;  2R78 A;  4RX2 A;  5L10 A;  2QWS A;  4IUK A;  3HLC A;  4GHI A;  3IXD A;  4RYE A;  3G30 A;  2JC7 A;  2EX6 A;  1H8M A;  3L7H A;  3OPP A;  3BFF A;  2Y4A A;  4XUZ A;  1NWZ A;  1CQA A;  3N4I A;  3PBO A;  2Z2M B;  3MFD A;  5G4Z A;  3CHW P;  4E04 A;  3NEC A;  4QB8 A;  2ZD8 A;  5J3W A;  1YLP A;  3W8K A;  4N9K A;  1BLP A;  2OAP 1;  4N92 A;  3BFE A;  4XT2 B;  3WS0 A;  3CLO A;  4I5S A;  1D7E A;  5DKL A;  3T4O A;  2VLG A;  2EFU A;  1JTG A;  2R9W A;  3T4L A;  3G2Z A;  3QP2 A;  3AGE A;  2RCX A;  4G3V A;  2R9X A;  2HPB A;  5EM0 A;  3TE8 A;  1W8Y A;  4K91 A;  4A5R A;  3SS3 A;  4IVI A;  5DF7 A;  4BWI A;  1LSX A;  4JPM A;  4FOF A;  5HDD A;  2J8Y A;  1G5U A;  3BYD A;  2WAF A;  4MBK A;  1K57 A;  1YLT A;  3DW0 A;  5FQK A;  2G2W A;  4P6Z M;  4RX3 A;  5K5B A;  1ACF A;  2XA7 M;  3C8C A;  3WWX A;  3UPO A;  4R3B A;  3U2A A;  1XJ2 A;  1K55 A;  5FEF A;  5HL1 A;  2H0T A;  1OTE A;  4G3W A;  2VEA A;  5E2E A;  4LGW A;  1XJ4 A;  2XFS A;  2WKR A;  1FCM A;  3HCY A;  3HJK A;  4B4Z A;  5F83 A;  2PAV P;  1H0M A;  1A0K A;  4GNU A;  1J9M A;  1YLW A;  3E4Q A;  2FZ0 A;  3FG8 A;  1I5Q A;  2ZM2 A;  3UB8 A;  3WS5 A;  4Z9Q A;  1OT6 A;  3TW8 A;  4O0P A;  3E0Y A;  4H8R A;  4E3O A;  3PXP A;  2M1C A;  5G4Y A;  2K2N A;  3PTE A;  2PDR A;  3C2W A;  2ACG A;  1TS8 A;  2EX8 A;  5A92 A;  3FKV A;  1K56 D;  5CHM A;  5E2F A;  5IU1 A;  3B47 A;  4KUK A;  5F1F A;  2QKP A;  3VP0 A;  2HJ9 C;  2V1B A;  1H3Q A;  3MZE A;  1T18 A;  5FEG A;  1S4R A;  4E3N A;  5AJG A;  4K08 A;  3H82 B;  4HH2 A;  3PAG A;  1E3U D;  5KSC A;  2WYX A;  2P04 A;  3HLB A;  2ZC5 B;  2OOL A;  4KZ4 A;  3D4F A;  2H28 A;  5TBM A;  1SDN A;  4P0M A;  3UPN A;  4BMW A;  2A3U A;  3N8S A;  1BZA A;  1TD5 A;  1RP5 A;  3ZQ5 A;  3G2Y A;  1O07 A;  2V1Z A;  5EFW A;  5A90 A;  3LIF A;  1GHP A;  2PU4 A;  2Z6D A;  4P85 A;  1PW8 A;  3GR2 A;  5TJJ A;  3VV4 A;  3PBQ A;  4P6Z S;  3U4L P;  4IUH A;  1V9Y A;  2XA7 S;  3BEB A;  3B3X A;  3UY6 A;  3EEH A;  1HZO A;  2Y59 A;  4RA7 A;  4MEZ A;  1OTA A;  1Z09 A;  3RXW A;  3SH9 A;  4NET A;  3IHA A;  4I3A A;  1XJ6 A;  3ZG8 B;  3W2Z A;  1GHM A;  4FH2 A;  3V67 A;  3BFG A;  3IF5 A;  3SS5 A;  3SW1 A;  3Q7Z A;  4X6T A;  4JBF A;  4NK3 A;  3UMD A;  5EV0 A;  2KLI A;  1I2S A;  3NJA A;  4BL3 A;  4LV0 A;  1PI4 A;  1YSP A;  2Y2M A;  2PRF A;  4XT2 A;  2J3T D;  4ZJ1 A;  3TJZ C;  4B93 A;  3OPH A;  4MNR A;  4HY8 A;  5I94 A;  4JKT A;  4KZ5 A;  3F1N A;  3Q7V B;  5DFY A;  2X02 A;  1NRJ A;  4HI4 A;  1BYW A;  4IVK A;  1UGU A;  3IF6 C;  1IKI A;  2WAD A;  1TVF A;  3C7U A;  4S2M A;  4WMC A;  3PR6 A;  2Q9N A;  5EUA A;  2K31 A;  2MJ6 A;  4HNB A;  4DDS A;  4B9O A;  1LL9 A;  5DKK A;  1K25 A;  3A0S A;  1K54 C;  2HV1 A;  3S22 A;  4HES A;  2WKI A;  1S1Y A;  5F68 A;  4FCF A;  1DJA A;  3GQZ A;  3BFC A;  2KDK A;  3S1Y A;  2K7S A;  5F6A A;  2HJE A;  3IQA A;  5EVI A;  3PBR A;  1WYB A;  1CI8 A;  4H6J A;  3MXQ A;  2BLS A;  5DFX A;  1S67 L;  2Y55 A;  4GD8 A;  3ZVW A;  1W63 Q;  5CED A;  3N6I A;  2UWX A;  2Y2G A;  2EX9 A;  2G2U A;  2QJ7 A;  5IHV A;  4WF0 A;  5E43 A;  5GL9 A;  4WEL A;  3NC8 A;  4X68 A;  4DE1 A;  2XD1 A;  3H9W A;  2V0W A;  2VX8 A;  5TR7 A;  4OQI A;  2VGK A;  4Z1W A;  3UPP A;  4RVA A;  1H8Y A;  4OKP A;  1BLC A;  2W3H A;  3MBZ A;  3NIA A;  2W1T B;  4R70 A;  2ZQ8 A;  4KQD A;  2PR6 A;  4LRY C;  4DRT A;  4LV2 A;  1FCO A;  4R4S A;  4NKP A;  3QP5 A;  4EEU A;  2KX6 A;  1PZO A;  4KG5 A;  1NRF A;  1ZG4 A;  3G34 A;  4JLF A;  4JXV A;  4HBT A;  4P87 A;  1DP6 A;  4ZBE A;  1IFQ A;  4X53 A;  1Y28 A;  2J7V A;  3C38 A;  1PW1 A;  5HWV A;  2P74 A;  2ZBB A;  4E3I A;  3NUL A;  4X1L A;  1LL5 A;  3ZG7 B;  1OJG A;  5FI7 A;  2V8F A;  3LY3 A;  3JVU A;  2C5W B;  2PT7 A;  2Y2H A;  3FPW A;  2UV0 E;  4BBU A;  3CAX A;  2JHE A;  4OQ0 A;  2WKP A;  1MWR A;  2OLU A;  4WN5 A;  1LHY A;  4GKU A;  1K6S A;  4WEJ A;  4ETZ A;  2FFY A;  1MBL A;  1GA0 A;  3VOL A;  2B02 A;  3DWK A;  3HUN A;  5HAP A;  2Z2L B;  3VP3 A;  4WYY A;  5LBR A;  2QJ5 A;  2ZOI A;  1W63 M;  1SZV A;  1KE4 A;  4GB7 A;  3MQO A;  1YAX A;  1K6R A;  2VV8 A;  4U0X A;  4F3L B;  5CTN A;  3FPV A;  1OT9 A;  3FKW A;  5CGW A;  4MMN A;  1FSY A;  4HIA A;  4JXW A;  1MPL A;  3ZVT A;  4EV4 A;  3Q07 A;  1NZO A;  2V8C A;  1VQQ A;  4K0W A;  1XFN A;  4WLA A;  5HL6 A;  3ZG9 B;  2A24 B;  1IOU A;  3T4T A;  3IBJ A;  4XUX A;  3IF6 B;  3MR0 A;  3LIB A;  1KGG A;  4C75 A;  4DN0 A;  3ZDJ A;  1IYS A;  2VV6 A;  4WUJ A;  3LI9 A;  3MKE A;  2ZMA A;  4BLM A;  3OOV A;  4DDY A;  1MKI A;  2ZL1 B;  4LRX C;  3PHY A;  1YQS A;  2DMW A;  3T1X A;  2E8J A;  3L9K A;  2A2L A;  2GJ3 A;  3Q7V A;  1WA9 A;  4Y0O A;  2Y91 A;  1CJF A;  3IHB A;  4B4X A;  1Y4O A;  3NOP C;  3UE6 A;  4HOI A;  3LR3 A;  1ES2 A;  4GJ4 A;  3UDX A;  3A3J A;  2HP5 A;  5DTS A;  4G3K A;  4S2L A;  1Q2Q A;  4ARZ B;  5CEC A;  4Q0I A;  4PKY G;  3TRC A;  4OLD A;  3OZH A;  3PBN A;  1ALQ A;  2CC1 A;  3MZF A;  4R4R A;  1IEL A;  1STZ A;  1YT4 A;  1S0W A;  2L0W A;  4LV3 A;  1LSW A;  4CQH A;  1MKM A;  4D2O A;  2X01 A;  4N1H A;  3VSK A;  3H7W B;  4Y0U A;  1PZP A;  2ZMV A;  3CG5 A;  1W7F A;  3BWL A;  5CXW A;  1K0K A;  3IXG A; 
#chains in the Genus database with same CATH homology
 3GMW A;  4R1G A;  2JE5 A;  4UAA A;  5F1F A;  1MWU A;  4X55 A;  1ES4 A;  1NXY A;  3Q81 A;  5A93 A;  2XFT A;  2IWB A;  1K56 A;  4OON A;  1BSG A;  3VP0 A;  3VP4 A;  3TOI A;  4EUZ A;  1MWT A;  1KVL A;  4KEN B;  4O7D A;  2JCH A;  3MZE A;  1NZU A;  3SH8 A;  3ZCZ A;  1LI9 A;  5FAO A;  1SDE A;  4ZJ3 A;  5DVA A;  4E3N A;  5CER A;  4ID4 A;  5FAT A;  2XR0 A;  4E6W A;  4Q8I A;  2IWD A;  3O87 A;  3G4P A;  3N7W A;  1E25 A;  3PAG A;  4IED A;  1E3U D;  5KSC A;  2WYX A;  4FD8 A;  1E4D A;  1IYO A;  3OCL A;  5EVI D;  3HLB A;  1NY0 A;  4HEF A;  2WGW B;  2ZC5 B;  3FZC A;  1FQG A;  4Y0T A;  4KZ4 A;  1VM1 A;  3D4F A;  2EX2 A;  1E3U A;  2H5S A;  1PWD A;  1K4E A;  3M6H A;  3P98 A;  1N9B A;  2XD5 A;  1SDN A;  2Y2L A;  3AGF A;  5EPH A;  5EOE A;  4P0M A;  3V50 A;  1NYY A;  3UPN A;  2ZM8 A;  4FSF A;  2A3U A;  3JYI A;  3N8S A;  1S6R A;  1BZA A;  1RP5 A;  5FA7 A;  4EWF A;  3IT9 A;  3G2Y A;  1JWV A;  3MXR A;  1O07 A;  2V1Z A;  4GD6 A;  5DF8 A;  5A90 A;  2RL3 A;  2V2F F;  5KZH A;  1GHP A;  2PU4 A;  1JVJ A;  1L2S A;  1M40 A;  4P85 A;  5FAQ A;  4ZJ2 A;  2BG1 A;  3LO7 A;  3W4P A;  4KG6 A;  1PW8 A;  1O7E A;  1XA7 A;  4FH4 A;  4QJG A;  2Q9M A;  5GLB A;  2WGI A;  1PYY A;  4LCL A;  5GHY A;  3GR2 A;  5CHU A;  1YLY A;  5HW3 A;  3PBQ A;  2Y2J A;  1N4O A;  2B5R A;  2ZC3 B;  4U3T A;  3ZGA B;  3C5A A;  1YLJ A;  4ZAM A;  2P9V A;  4N9L A;  3ZNY A;  3IWO A;  3BEB A;  3B3X A;  3UY6 A;  3LEZ A;  4UA6 A;  1HZO A;  4LV1 A;  2Y59 A;  3SS4 A;  1HD8 A;  1XPB A;  3MXS A;  4RA7 A;  4MEZ A;  4PM5 A;  5KMW A;  1FCN A;  5M18 A;  3GSG A;  3V39 A;  3RXW A;  3SH9 A;  2J9P A;  1BTL A;  3ZNT A;  5FAS A;  4NET A;  1G6A A;  3NI9 A;  4JF6 A;  3W4O A;  3IHA A;  3IXH A;  1L0E A;  3GRJ A;  1Y54 A;  3UE0 A;  4IBR A;  3HLG A;  4K0X A;  3NDG A;  3FKV A;  4OPQ A;  1U60 A;  4DKI A;  3ZG8 B;  5FI2 A;  2ZC6 B;  4DE3 A;  3QNB A;  1GHM A;  1IYQ A;  2QPN A;  1HTZ A;  2VGJ A;  4FH2 A;  3BFG A;  4QU3 A;  1KDW A;  3IF5 A;  3SS5 A;  3MKF A;  2Y2N A;  3DWZ A;  5FDH A;  3ZG5 A;  4DE0 A;  3Q7Z A;  4X6T A;  1W79 A;  5DF9 A;  4F94 A;  4MBH A;  4JBF A;  4P6B A;  1K38 A;  4NK3 A;  4OOL A;  1I2W A;  1KVM A;  4KZ9 A;  4PM9 A;  1I2S A;  4LCM A;  3PBS A;  2I72 A;  5FQ9 A;  2OV5 A;  5KSH A;  5HAQ A;  4OVD A;  3QHY A;  3N8L A;  1ESU A;  4BL3 A;  3EQV A;  1FR6 A;  4LV0 A;  1RGY A;  5AQ7 A;  3ZFZ A;  3UE3 A;  4OQG A;  1PI4 A;  3GTC A;  2Y2M A;  2WZX A;  1ES3 A;  1H8Z A;  4EBL A;  4ZJ1 A;  4S2K A;  2Y2Q A;  3HBR A;  4XXR A;  3OPH A;  3CMZ A;  4GDB A;  4YIN A;  3I7J A;  4MNR A;  1FOF A;  1M6K A;  3BLM A;  4KZ8 A;  4KQO A;  3WS4 A;  1K4F A;  2E8I A;  3M2J A;  3VMA A;  5I94 A;  3GV9 A;  3HLF A;  1WE4 A;  4JKT A;  4ZTK A;  4KZ5 A;  5JYO A;  4E3M A;  1YMS A;  3Q7V B;  3IF6 A;  3OC2 A;  1MY8 A;  2XGN A;  4S2J A;  1XXM A;  5CGX A;  3RJU A;  2X02 A;  5E2G A;  5G18 A;  4WMC D;  3BEC A;  3VOZ A;  2ZC4 B;  2OLV A;  4IVK A;  2EXB A;  3WS2 A;  1TEM A;  3IF6 C;  1IKI A;  2WAD A;  1TVF A;  1K54 A;  3C7U A;  3FWL A;  4S2M A;  4S2N A;  3VP2 A;  4WMC A;  3LCE A;  5CTM A;  4UA9 A;  1ONH A;  2Q9N A;  5EUA A;  1JWP A;  4OOY A;  3UE1 A;  3CJM A;  3NDE A;  4OP5 A;  4C3Q A;  5EVL A;  4BL2 A;  3OPL A;  4DDS A;  1BUE A;  2ZC7 A;  4KQR A;  2XEP A;  1LL9 A;  5TGF A;  1PIO A;  1K25 A;  1K54 C;  4QHC A;  4S2N C;  5D3O A;  3FV7 A;  4E3J A;  3S22 A;  3O3V A;  4HES A;  2WKI A;  1RCJ A;  2XLN A;  5CGS A;  1L0D A;  5AQA A;  5BOH A;  4KZ7 A;  1L0G A;  1QME A;  1TDL A;  3ITA A;  4FCF A;  1CEF A;  1DJA A;  1ERM A;  3GQZ A;  3BFC A;  4BD1 A;  2WUQ A;  3S1Y A;  1AXB A;  3QNC A;  5FQI A;  3IQA A;  3E2K A;  5CHJ A;  2DRW A;  5EVI A;  3IH9 A;  3PBR A;  4OPR A;  1WYB A;  1CI8 A;  1XA1 A;  3BFD A;  1BUL A;  5GHZ A;  4JF5 A;  3ZHH A;  4EQI A;  5EOO A;  1ONG A;  2BLS A;  4GZB A;  1Q2P A;  1MWS A;  4S2P A;  4D2O A;  1G68 A;  1XP4 A;  2Y55 A;  1IYP A;  4GD8 A;  5EE8 A;  2EFX A;  5EVI C;  3IWI A;  4CJN A;  3TG9 A;  1FR1 A;  1DJC A;  1PI5 A;  4WZ4 A;  3ZVW A;  5U47 A;  4C6Y A;  5CED A;  2ZQA A;  3C4P A;  2UWX A;  2Y2G A;  3N6I A;  5TFQ A;  2EX9 A;  2G2U A;  3IH8 A;  5IHV A;  1W8Q A;  3SH7 A;  5E43 A;  5GL9 A;  4WEL A;  3PAE A;  3NC8 A;  4X68 A;  4DE1 A;  1CEG A;  2XD1 A;  3G32 A;  4S2O A;  1DJB A;  1ZC2 A;  3NCK A;  5CRF A;  5TR7 A;  4GN2 A;  4OQI A;  2VGK A;  5F1G A;  3UPP A;  4B88 A;  2H0Y A;  1QMF A;  2Y2P A;  3UO9 A;  4RVA A;  1H8Y A;  4U0T A;  4OKP A;  1XGI A;  3NY4 A;  1BLC A;  3DTM A;  4OLG A;  3Q82 A;  3MBZ A;  3NIA A;  1CK3 A;  3OCN A;  3FYZ A;  2DCF A;  4R0Q A;  2ZQ8 A;  3N8R A;  2V20 A;  1BLH A;  3HRE A;  4KZ6 A;  4PPR A;  4DRT A;  4LV2 A;  1ZG6 A;  1FCO A;  4R3J A;  3M2K A;  1SHV A;  4LEN A;  4R4S A;  4BD0 A;  4E3K A;  4HBU A;  1EWZ A;  5FQJ A;  4YFM A;  3HL9 A;  5EVI B;  1PZO A;  3V3R A;  4KG5 A;  4CPK A;  2XDM A;  1NRF A;  1ZG4 A;  3G34 A;  4JLF A;  4OPZ A;  5A91 A;  3S4X A;  4JXS A;  2PU2 A;  3UN7 A;  4QY6 A;  4JXV A;  5FQQ A;  3HUO A;  2ZM0 A;  4HBT A;  4S2I A;  4P87 A;  1MXO A;  2HDQ A;  2WAE A;  4OOM A;  1EI5 A;  4ZBE A;  4X53 A;  5AQB A;  4X56 A;  4L0L A;  2J7V A;  2WGV A;  1H5X A;  3AGD A;  1PW1 A;  2IWC A;  4OH0 A;  1TDG A;  2HP6 A;  3O88 A;  4OPY A;  2P74 A;  4M3K A;  3WRT A;  3A3D A;  4WZ5 A;  3UDF A;  4E3I A;  2Y2I A;  4ZDX A;  1LL5 A;  3VP1 A;  1ES5 A;  2XH9 A;  2ZLY A;  4GOG A;  2ZQC A;  3ZG7 B;  5FI7 A;  3ISG A;  3LY3 A;  2QMI A;  2WGW A;  2QZ6 A;  4DF6 A;  1NYM A;  3G31 A;  1L0F A;  1YLZ A;  3OPR A;  2FFF B;  3BM6 A;  2P9V B;  5L2F A;  5FI6 A;  1KDS A;  1BLS A;  2ZQD A;  4KG2 A;  4KZB A;  5M1A A;  3V5M A;  3M6B A;  2C5W B;  1JWZ A;  4PM8 A;  4WZ5 C;  5J8X A;  1YMX A;  1LLB A;  5E2H A;  2Y2H A;  2XQZ A;  2XK1 A;  3VFF A;  1PWC A;  3A3F A;  4WBG A;  1KE0 A;  4OQ0 A;  4QY5 A;  3G35 A;  4RX2 A;  1MWR A;  2XF3 A;  2OLU A;  1LHY A;  1JTD A;  3HLC A;  1K6S A;  4GKU A;  4WEJ A;  4UA7 A;  2FFY A;  1MBL A;  1GA0 A;  3IXD A;  4WM9 A;  4RYE A;  3DWK A;  3V3S A;  3HUN A;  5HAP A;  2Z2L B;  3G30 A;  4MBF A;  3RXX A;  3VP3 A;  2JC7 A;  2EX6 A;  4WYY A;  3WS1 A;  3OPP A;  3BFF A;  2Y4A A;  4XUZ A;  4N1X A;  3UNW A;  1KE4 A;  3N4I A;  4GB7 A;  4KZA A;  2HDU A;  3W4Q A;  1K6R A;  4E3L A;  5CEB A;  3LY4 A;  4U0X A;  2ZJ9 A;  3UDI A;  3C4O A;  3MZD A;  3PBO A;  5CTN A;  2Z2M B;  1SKF A;  3C7V A;  3MFD A;  4PM6 A;  2HDS A;  3FKW A;  4MLL A;  5CGW A;  4QB8 A;  1FSY A;  2ZD8 A;  4JXW A;  5HAI A;  1SCW A;  1YLP A;  3W8K A;  1MPL A;  4N9K A;  3ZVT A;  1BLP A;  4EV4 A;  3Q07 A;  5GHX A;  2JBF A;  1NZO A;  5GLD A;  4N92 A;  1VQQ A;  2ZQ9 A;  1IKG A;  3BFE A;  2WKH A;  4K0W A;  1WYC A;  1CI9 A;  1GCE A;  4JF4 A;  3WS0 A;  3ZG9 B;  3E2L A;  3HLD A;  5DTK A;  3TSG A;  1ERO A;  2H10 A;  3A3I A;  2X71 A;  1PWG A;  5EEC A;  2EFU A;  3NBL A;  5AQ9 A;  2C6W B;  1JTG A;  5DTT A;  3VSL A;  5HAR A;  4IBX A;  2R9W A;  1GA9 A;  2WK0 A;  1W5D A;  4XUX A;  3GVB A;  3HLE A;  3G2Z A;  3IF6 B;  5GLA A;  3AGE A;  1LI0 A;  2WZZ A;  2RCX A;  3A3E A;  1KGG A;  1C3B A;  2R9X A;  4C75 A;  2HPB A;  5HX9 A;  3ZDJ A;  3HLW A;  1W8Y A;  2ZQ7 A;  4PM7 A;  4K91 A;  4A5R A;  5FQM A;  3SS3 A;  4IVI A;  5DF7 A;  1IYS A;  4UHU A;  4JPM A;  4X69 A;  2J8Y A;  3BYD A;  2WAF A;  3ITB A;  4MBK A;  4KQQ A;  1K57 A;  5M19 A;  1YLT A;  3Q1F A;  3MKE A;  2ZMA A;  4BLM A;  4DE2 A;  3DW0 A;  3HVF A;  1BT5 A;  1K56 D;  4DDY A;  1IEM A;  1MKI A;  1ERQ A;  3IWQ A;  5FQK A;  1Z6F A;  1YQS A;  2G2W A;  2WKE A;  3VOY A;  3CZD A;  3PBT A;  4RX3 A;  1K57 C;  1XKZ A;  3Q7V A;  4Y0O A;  2Y91 A;  3SOI A;  5JYP A;  3IHB A;  4B4X A;  3WWX A;  3UPO A;  4KZ3 A;  4R3B A;  2GDN A;  1KGF A;  2HDR A;  5GLC A;  1YM1 A;  1K55 A;  4EBP A;  2DNS A;  1ES2 A;  5HL1 A;  2H0T A;  3UDX A;  3A3J A;  2HP5 A;  5DTS A;  4JXG A;  4S2L A;  2HP9 A;  4OQH A;  1Q2Q A;  3BLS A;  5CEC A;  2J9O A;  5E2E A;  4PMA A;  1ESI A;  1K55 C;  2XFS A;  5FAP A;  1KE3 A;  1FCM A;  3BRM A;  4OLD A;  1ZKJ A;  2OSU A;  4DXB A;  2A49 A;  4BQM A;  5F82 A;  3OZH A;  1GHI A;  4B4Z A;  5FSR A;  1RGZ A;  1FSW A;  1ALQ A;  2CC1 A;  3MZF A;  3PBN A;  5F83 A;  4R4R A;  3IXB A;  4GNU A;  3P09 A;  1J9M A;  1IEL A;  1YLW A;  4QD4 A;  1YT4 A;  1S0W A;  1NJ4 A;  2Y2K A;  1I5Q A;  2ZM2 A;  3WS5 A;  4LV3 A;  4Y7P A;  4Z9Q A;  2EXA A;  3VFH A;  3WRZ A;  4E6X A;  4DXC A;  1KGE A;  1OME A;  2PBY A;  1DY6 A;  4EBN A;  4R23 A;  1XGJ A;  1HVB A;  4BJP A;  3EQU A;  4H8R A;  5HFO A;  4N1H A;  2Y2O A;  2X01 A;  4OP8 A;  3VSK A;  4E3O A;  3PTE A;  4Y0U A;  3O86 A;  1PZP A;  4WEK A;  3ZG0 A;  3CG5 A;  4BEN A;  4GDN A;  1W7F A;  2EX8 A;  5CXW A;  5A92 A;  3IXG A;  3HUM A;  1XX2 A;  5CHM A;  5E2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...