4CLCC

Crystal structure of ybr137w protein
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
173
structure length
173
Chain Sequence
MVVLDKKLLERLTSRKVPLEELEDMEKRCFLSTFTYQDAFDLGTYIRNAVKENFPEKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSDYPYACLTISGLKQEEDHLMAVSSLIAFANESLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of Ybr137Wp Implicate its Involvement in the Targeting of Tail-Anchored Proteins to Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords UPF0303 PROTEIN YBR137W
total genus 53
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4clcC00
3FPWA 4CLCB 4NKPA 4CLCD 4CLCE 5CX7A 3FPVA 4CLCC 4CLCA 2A2LA 4BMWA
chains in the Genus database with same CATH superfamily
5CTMA 3T1RA 4EESA 4G3WA 4JPMA 1VEUB 3T4SA 1L0FA 1VETB 1NLZA 4S2KA 2B02A 3WRTA 5CGWA 2AVXA 1SZVA 4GS9A 5J4EA 1YLTA 4ME4A 4BBTA 1FCNA 1OJGA 4IBXA 2EXAA 4ZRRA 1BT5A 2CMNA 3H7WB 4E3JA 1I2WA 3EGDC 3NIAA 2WAEA 1NRJA 4QB8A 1MKIA 1L3LA 1IKGA 2J9OA 4X69A 5TGFA 1ZTUA 3AGDA 3H82B 3IF6A 5EV0A 2WGWA 1K56D 4KZ8A 3SOIA 2ZD8A 1YKDA 3MFDA 3BQAA 2DNSA 4Y15A 2H10A 3ZQ5A 3F1OB 5J7EA 1PWGA 4UA6A 4HHDA 2QZ6A 3T12B 5A91A 3WS5A 3G6OA 3K3CA 2HZ5A 3QNBA 4IUKA 4JGPA 4OQHA 5A93A 4IHQA 1MBLA 5J3WA 4G3KA 1N9LA 5M1AA 4KUOA 1N9NA 1TF1A 3LI9A 4PMAA 5CECA 4WZ4A 1HZOA 5FATA 3MQQA 2HJ9C 2KDKA 2YKHA 3UE6A 3RTYA 3LO7A 4DDYA 4U0TA 3SS4A 4O0PA 3HLWA 3WS2A 4F3LA 1Q2QA 4R3BA 4UA7A 3T1SA 5AJGA 3ZDJA 2FZ0A 1XX2A 2PU4A 2V1AA 3OPPA 3MMHA 1Z6FA 4KZBA 3UPPA 5EUAA 2HP5A 4XT2B 5EPHA 2HDSA 2FFFB 2Z2LB 1K54C 1CI8A 2O99A 4RX3A 2Y2KA 5AQ9A 1DY6A 2B5RA 4OLDA 3IX3A 2K7SA 3FKVA 4ETZA 1H8MA 4FUWA 2PU2A 4LENA 5HD5A 4QU3A 3BFEA 4Y0OA 2L1MA 4OP5A 5HWVA 2L4RA 4B4ZA 1AWIA 2ZMFA 3W4PA 3MR0A 2Y8HA 4HJ6A 3LIEA 4IEDA 4I5SA 1X0OA 3O3VA 3HCYA 4EBPA 4NK3A 1LSWA 1NLYA 1IYSA 1W8YA 1IYOA 2W3FA 2W3GA 1S67L 2Y79A 4QJGA 2ZM0A 5HPFA 5JYOA 1DJCA 5FQIA 4P6ZM 3PBOA 2Y91A 5TR7A 2Z6DA 3SH8A 2CC1A 4ARZA 2JKTI 5GHZA 2Q9NA 2VKSA 4KZ9A 1EWZA 4DE2A 2W1TA 3LUQA 1GHPA 3KSGA 2WYXA 3UB7A 2V9AA 3IF5A 3SH7A 4HESA 2DMWA 4LPZA 5CEDA 3M6HA 4WM9A 1XJ4A 2R9XA 1KVLA 4OOYA 4I3IA 2O0YA 3FZCA 3Q1FA 1WA9A 3BLSA 1HTZA 1K57A 2J3WA 3LEQA 1T18A 2G7UA 4DXCA 4DDSA 2O9AA 2VK3A 3HUOA 3MQOA 3HLCA 3A3EA 1CF0A 5FAQA 3QP6A 3LIFA 3IWIA 3P98A 3BFCA 4LRZE 4X1LA 3BYDA 3C8CA 4ZJ3A 5G4ZA 4U3TA 4EERA 2C6WB 1LT0A 1MPLA 5FQJA 4EEUA 3CZDA 1J9MA 2EWVA 1XFQA 4ZBEA 1JWPA 2OLUA 2WUQA 2ZM8A 3LR5A 4MEZA 1OPXA 3BM6A 4YOFA 3ITBA 5F83A 3QP4A 3FKWA 2ZQDA 3F1NA 5AVEA 3UMDA 4OLGA 4PPRA 4WF0A 1CEGA 4C3QA 4E3NA 2BLSA 3N8SA 2E8JA 3A3FA 3L9KA 4R6LA 1P9RA 1ZC2A 2ZJ9A 3LIAA 2VZWA 5KIZA 3LR0A 3M2JA 3S4XA 4QHCA 3CWFA 4KG2A 3B3XA 3H9WA 1P97A 2QJ7A 2R9WA 2Z2MB 3O88A 4ZJ2A 2PR5A 3VMAA 3GR2A 3W4OA 3G2YA 2BG1A 4WEJA 1KE4A 3DBAA 4OQIA 2XFSA 1S1YA 2Q9MA 2PR6A 5CTNA 1UWPX 1ZHHB 4EUZA 2LB9A 2OWJA 4GCZA 1V9YA 3GECA 2PRFA 2HDRA 3BWLA 1L0DA 4EXOA 3FPVA 2XDMA 4Y17A 3OZHA 4JXGA 5IS1A 4S2NC 2V1BA 2HV1A 1PZOA 4K0WA 1G6OA 3PTEA 3VOLA 1T19A 2JC7A 3Q82A 1DP9A 1JWVA 4GLQA 4GHIB 3IS2A 2H0TA 5GLAA 4G3VA 2WKHA 3DTEA 2QPNA 3F1NB 3HVFA 2B18A 3C2WA 4HQAA 3NDGA 1NY0A 2JKRM 3AGFA 3QP2A 1W5DA 2PBDP 2OOLA 3UDFA 3KO6A 5FA7A 4JGQA 4IUHA 5FI6A 2GNXA 2PHYA 4YFMA 5DJTA 3FG8A 2XA7M 3NOTC 3AGEA 4Q0IA 3VSKA 4GOGA 2VV6A 1C3BA 2OWHA 2ZC7A 1KOUA 2OAP1 4JGRA 4BL2A 1BULA 5TFQA 1ES2A 2M7UA 4KQDA 1FCMA 4S2PA 3T1XA 1BLHA 4UQIM 3VSLA 2EWWA 1TEMA 5AVFA 2VA0A 3PBTA 4GDNA 4GDBA 1SCWA 2J80A 1HD8A 4JGOA 5FDHA 3LICA 1UGUA 5EVID 2QMIA 5L07A 5KMWA 4R38A 5HAIA 4Y3IA 5F1GA 3ZG7B 2JHEA 4ARZB 2D01A 3IXGA 4OPZA 1HLUP 1TS6A 3LY4A 3VOZA 2WZXA 3CHWP 3V3SA 4JLFA 3LI8A 4K08A 1PYYA 1WYBA 2Y2IA 1PIOA 1D06A 3WWXA 5A90A 5KZHA 4I3JA 3MSHA 5F5YA 4HP9A 4GB7A 5FEGA 3OC2A 4ZAMA 1YPRA 4S2NA 4D2OA 3NOUC 3G4PA 2XF3A 2ZC6B 1DJBA 3UO9A 3VP0A 1YT4A 4FTXA 4JKTA 4GZBA 3UE0A 2GJ3A 2PBYA 3G2ZA 2A24A 4X53A 1IFQA 1H5XA 3LR4A 5FI7A 3ZFZA 3HLEA 4NKPA 3S7PA 4PM9A 2PYRA 3DWZA 5AQBA 4CLCC 4KUKA 2RCXA 1XFNA 1ESUA 2QKPA 4BENA 4OVDA 4LCMA 3SZTA 4DF6A 2W0NA 1E3UD 1NYMA 1G5UA 1MWRA 4OOLA 4DE0A 1XA1A 4PM7A 3SS3A 4Q0JA 3HJKA 1PNEA 3D9YA 1LLBA 3JVVA 2Y2QA 5MC7A 4HNBA 1CQAA 4BBVA 3O87A 4RX2A 4P6BA 2WZZA 1EROA 4P85A 1VB6A 5DKLA 3D4FA 1BLSA 2ZMVA 4EW7A 5HX9A 2DCFA 3HUMA 1N4OA 2EX9A 4HI4A 4KG5A 1ZKJA 3S1YA 5DTKA 3IQAA 1F98A 1GA9A 2GX5A 3MF0A 1NRFA 4MN5A 3OBFA 5F68A 2UV0E 4HOIA 4U0XA 1XP4A 2X71A 1STZA 2J8YA 3ZGAB 2ZQ7A 2JBFA 3DW0A 2DRWA 2O9BA 3ZYTA 2Y2OA 4MNRA 3BY9A 3NBLA 5HDCA 4I39A 3H82A 4BWIA 3KYQA 4E3IA 1T1CA 1ONHA 2G2WA 1K57C 3H7WA 4E3MA 3BFDA 3BJNA 4E3KA 3BECA 2ZC5B 3S22A 3T4LA 3KSFA 5HDDA 3DTKA 1KDWA 5EVEA 1TDGA 3BW6A 5A8BA 1G68A 5FQMA 3QP1A 1IKIA 3QP5A 4KZAA 1KGFA 4OQ0A 5F69A 5G4YA 3F1OA 3BQ8A 4FSFA 1YMXA 2PT7A 5HD3A 4C6YA 4EUVA 1Y4OA 4HH3A 3OOVA 3IF6B 1XGIA 3MKEA 1F2KA 2H5SA 1JTDA 3B42A 3MXSA 3KYEA 1N9BA 2WKIA 2W27A 3W8KA 5HARA 1H0MA 3SS5A 5IT5A 5L8MA 4E3OA 1LSXA 3TOIA 2HP6A 1GCEA 4L9FA 4C75A 4FH4A 4BLMA 2HDQA 1FR1A 4R4RA 2WADA 2XFTA 1BLCA 5JYPA 3CLOA 1ESIA 1DP6A 3IX8A 3PYPA 1EW0A 1CI9A 3E0YA 4OPRA 4FD8A 1K55C 2W1RA 3UY6A 2H28A 2WKRA 4FOFA 1KDSA 4N9KA 1YLZA 4H6JA 4LFUA 4Y2FA 4O7DA 2P7JA 4S2IA 2JKGA 4E6XA 4EQIA 1KGGA 3C30A 2OV5A 4M4XA 4WL9A 3C4PA 5FAPA 2XQZA 4L9GA 4KZ5A 1Y54A 4HP4A 3BY8A 1SKOA 1VQQA 1YLYA 4NXEA 5EM0A 1S66L 5EVLA 4DRTA 4EETB 2UWXA 2A2LA 5L09A 2XROA 3WS4A 1JTGA 1DJAA 4BL3A 1K4EA 5CHUA 5LBRA 5G18A 1O07A 4L0LA 4WMCD 2C5WB 5E2HA 2EA9A 5DF7A 3FV7A 4BMWA 1YMSA 2XSSA 4B88A 3PXPA 4O8GA 2H0YA 5EECA 3UB6A 5EE8A 1CEFA 3LCEA 1BYWA 2ZC3B 5J8XA 2V8CA 1NXYA 4CJNA 3KYZA 1MWUA 2VGLM 3LEZA 4F3LB 1TDLA 3TJZC 2JN7A 4R23A 5CERA 3N8RA 4DN0A 4II7A 3JYIA 4HEFA 4CQHA 1OTEA 5DJUA 1W7FA 4Y7PA 4BBUA 2PD7A 5FQKA 3P09A 2Y2HA 3K2NA 5IU1A 5FDSA 2XA7S 3CUEA 4PAUA 5FSRA 2XLNA 3VP2A 3MQ0A 3LGOA 3NHQA 2JKTM 1YM1A 1O7EA 4CLCE 1PI5A 1S6RA 1L2SA 1PI4A 4HH2A 1HVBA 1SDNA 1MWTA 5HFOA 3B33A 4H8RA 1S4SA 3MZDA 1FIKA 1G28A 2A24B 2ZC4B 1S4RA 1LL8A 1ERMA 1XGJA 3IXBA 3A0RA 5FL3A 5EOEA 4S2LA 3VFHA 2GDNA 2ZOHA 3RFBA 3MZEA 4GD6A 3EQUA 3V5MA 3NY4A 4RA7A 1M6KA 2ZQ8A 3EOIA 2KX6A 2HPBA 3RXXA 4JF4A 5KSHA 3NCKA 2HGVA 4IBRA 1F5MA 4EBNA 3HLBA 3OLOA 1G6AA 2M1CA 5CXWA 1IOUA 2KOIA 1VETA 2XK1A 1VEUA 3T4JA 1OT9A 2Y2NA 1YSQA 2IWDA 3VP4A 2VV8A 1K0KA 1LSVA 3M2KA 4HBUA 1UWNX 4IVIA 2L0WA 5AQAA 5HPIA 4LRXC 4AFIA 4WZ5A 2PAVP 2EX6A 3TW8A 3NC8A 1W63Q 1BLPA 3ZHHA 2J9PA 4Y13A 5F1FA 5E43A 1PW1A 4P87A 3KSIA 3S7OA 2IA2A 2NUPC 2OSUA 4LRYC 1WE4A 4DJ2A 2EX8A 2FFYA 3ZVTA 1W79A 4IVKA 4OKPA 2VGKA 3DWKA 2VLGA 1OT6A 2BASA 4MN6A 3ULFA 2J3TC 2P04A 1LHYA 2JCHA 2JE5A 4GNUA 3O5YA 5EFWA 1H8ZA 3UE1A 1DP8A 2P9VB 2EX2A 5E2EA 2VGJA 2XEPA 3TSGA 2WK0A 2INWA 4GN2A 4E6WA 1K55A 1JNUA 2VX8A 5E2GA 1T1AA 4LV2A 4ESPA 3W4QA 3TE8A 3C7VA 3ZNYA 5CGSA 1ES4A 2YKFA 4MMNA 4X25A 1RGZA 3KX0X 3V67A 1BZAA 4EWFA 3IS2B 5DF9A 5HAPA 4DXBA 4B4XA 4E3LA 1LI0A 5FQ9A 1P0ZA 1XA7A 1XXMA 1KGEA 3P7NA 4PM5A 2EFXA 3A3DA 2OLVA 3HBRA 4BD1A 2ZMAA 3VE4A 4PM8A 2VEAA 2GZAA 1ES3A 4QD4A 4Q8IA 3CJMA 1XKZA 4WEKA 3N6IA 5DTTA 3T4KA 4WELA 3M6BA 4N92A 1YLWA 1W63M 4UEYA 3LFVA 3D72A 4X56A 3IHBA 4MBFA 4Y0TA 3PBSA 3E4QA 5DFXA 5GL9A 2PDRA 4LLOB 1OTDA 4QWOA 1RGYA 3UDIA 5FI2A 4R3JA 3EGXC 4LGWA 1FCOA 5EVIC 3QP8A 1Q2PA 2IWCA 4CLCA 2WGIA 3PR6A 4ZTKA 1K38A 4KZ3A 4E04A 3IXHA 4R4SA 3T1QB 3GVBA 3DTIA 3GQZA 4FCFA 3ZG9B 5L2FA 4OPQA 2FH5A 3MXQA 4Q0HA 3TG9A 5D3OA 4UAAA 1ODVA 1OTBA 4PHTA 2P08A 3C7UA 4KZ6A 1XJ6A 2I72A 4JBFA 3CPTB 3EEHA 4MBHA 3R7WA 1JWZA 2J3TD 5F82A 1F9IA 3G31A 3ZG0A 4L9EA 4EQ1A 1MWSA 1D1JA 4X55A 1XJ2A 2Y2JA 2XD5A 3MKFA 1LI9A 3ITAA 5HZHA 2ZL1B 1YSPA 1MKMA 3O86A 3ZVWA 2VJWA 2Q0OA 4RVAA 5EOOA 1BSGA 2Y55A 3CUEC 1SHVA 5EVIB 3Q7VB 3N8LA 3PBQA 3IBRA 5HDSA 3F1PB 3NULA 4IJGA 4Y5FA 1RCJA 3GRJA 5I94A 4MLLA 2K31A 4KQQA 1KVMA 1IYQA 5CGXA 5CHMA 3UE3A 4HJ3A 5TBMA 5CHJA 1BTLA 4WBGA 1YQSA 5HWTA 3CG5A 3LY3A 3CMZA 1TS0A 2K2NA 2QWSA 5K5BA 3UPOA 3G35A 4M3KA 3UB5P 4R3AA 4HBTA 1MZUA 3KSHA 4X6TA 3UB9A 5M19A 3IH9A 3V3RA 2G2UA 3E2LA 1FOFA 4MN7A 2KLIA 3EQVA 1J3WA 4GHIA 1S1ZA 3OPRA 3S7QA 4NXBA 1MY8A 1V9ZA 4ETXA 1NWZA 4LCLA 4EEPA 5I5LA 3B47A 2V8FA 4YINA 5CRFA 5GLBA 3CI6A 3VP3A 4K0XA 3BFFA 3GV9A 3IHAA 4P0MA 5GHYA 3A3IA 5GLCA 5F6AA 3UN7A 4O01A 1ES5A 2VGLS 3QNCA 1CK3A 2EXBA 3FPWA 5HAQA 2VV7A 4RYEA 3G30A 3F1PA 3RXWA 3E2KA 4XXRA 2ZBBA 1FR6A 3Q7VA 3MS6A 1GHMA 3HLGA 4EV4A 3CAXA 3E4PA 2B95A 1TS8A 4CLCB 5U47A 5HW3A 1FILA 4OPYA 2HF6A 4OOMA 3OPHA 3GDIA 3IXDA 2OAQ1 3ISGA 5KSCA 4HJ4A 1AXBA 3V39A 4BD0A 3A3JA 2Y2PA 4K91A 4KZ7A 1PZPA 1K54A 3FYZA 2HP9A 3NOPC 3V50A 4GKUA 5E2FA 2XD1A 1KE3A 4GJ4A 1PRQA 1SKFA 3ZCZA 3T50A 4KENB 3OCLA 2XGNA 2NUTC 1L0GA 3WS0A 3PBRA 1Z09A 5L10A 1RP5A 1LL5A 4OONA 3GTCA 3U2AA 4ZJ1A 4GS9B 5C5KA 3U4LP 1ZG6A 4I3AA 4S2MA 4ZDXA 1I5QA 2HDUA 5M18A 3N7WA 1IELA 4MCWA 1PWDA 4S2OA 2I9VA 1MC0A 3NJAA 4S2JA 2W3DA 2WKQA 3E98A 4OP8A 1FQGA 4NXGA 3BRMA 3S7NA 4R70A 1VM1A 4GD8A 1QMEA 2ZOIA 4CLCD 2ZQ9A 3BLMA 1NYYA 4WYYA 1Y28A 3C4OA 2ZQCA 5EM1A 4D60A 2QHKA 4N1XA 4JXVA 3UB8A 4ID4A 2D02A 4DE1A 2LB5A 3LR3A 4Z9QA 3VOYA 2ACGA 3SH9A 3E4OA 1K56A 5DTSA 2E8IA 5HL6A 5DF8A 1W8QA 1GHIA 2WKEA 1WYCA 1PW8A 3I7JA 3ZG5A 4NEED 3VE3A 3JPUA 2W3HA 3HJIA 3GSGA 1YAXA 1BUEA 1GSXA 5AQ7A 5FEFA 1T1BA 2WAFA 4UA9A 3P01A 2P9VA 3HUNA 3VFFA 4PKYG 5TBMB 4QY5A 3PBNA 3DTMA 1QMFA 2Y2MA 1VHMA 1NZUA 3RH8B 2XRNA 3HL9A 3Q7ZA 5DVAA 1SDEA 2M7VA 4NG2A 3IWQA 3WS1A 2Z6CA 3EWKA 4JXSA 5HL1A 3L7HA 2Y2GA 3TRCA 5FASA 4UHUA 1E4DA 4CPKA 1U60A 2Y4AA 5EVIA 1I2SA 2JKFA 1YLPA 3PAEA 3FC7A 3UDXA 4DKIA 3MZFA 4NXFA 4BQMA 1YLJA 4HY8A 2ZQAA 3ICYA 4LV1A 5DFYA 2W1TB 3MBZA 4JF6A 2PD8A 5BOHA 2W3EA 1ONGA 2ZL1A 2Y2LA 1K6SA 2IWBA 3MJQA 4YNRA 2Y59A 3VV4A 3PAGA 3IF6C 3RJUA 2X02A 1OJ5A 4XT2A 3SW1A 4HIAA 3BFGA 3R7WB 3CPTA 2A3UA 3FWLA 3EEAA 1GSVA 3A0SA 4BJPA 2QYBA 2BTFP 5IHVA 4X1MA 1TS7A 3LIDA 4PKYA 1ALQA 3JVUA 3PHYA 2JKRI 2QJ5A 5GLDA 4Z1WA 3W2ZA 4EU0A 3MXRA 1L0EA 2ZM2A 1SKOB 1K6RA 1FSWA 4DE3A 2WGVA 2V2FF 1OTIA 3NDEA 4N9LA 1E3UA 4OQGA 2V1ZA 4XUZA 2XH9A 3C38A 4KZ4A 4A5RA 3UNWA 2EFUA 4FH2A 1ACFA 3OPLA 1OTAA 3UMEA 5HSQA 2HJEA 4KQOA 4KG6A 1FSYA 3VP1A 3HLFA 3G32A 1ERQA 3CITA 2XR0A 3LYXA 4MBKA 1EI5A 4WUJA 1ZG4A 1KE0A 3C5AA 3QHYA 2V20A 4NETA 4LV0A 4F94A 3IH8A 3HREA 3T4OA 3DAVA 2J7VA 3A0VA 4I38A 5A92A 3D3OA 1GA0A 4QPRA 1XPBA 4DMZA 4WZ5C 2PYPA 5CEBA 2WKPA 2RL3A 2X01A 3IX4A 4P6ZS 4WMCA 1D7EA 4WLAA 5FQQA 4GW9A 3K3DA 3NECA 3NI9A 3ZNTA 4B9OA 1XJ3A 3IBJA 3IT9A 4JXWA 2MJ6A 4H6JB 1IYPA 4Y0UA 1A0KA 3G34A 5FAOA 3UPNA 1IEMA 2WGWB 1TD5A 4KQRA 1TVFA 3LIBA 3N4IA 4XUXA 5CX7A 1E25A 1M40A 4LV3A 1JVJA 3Q81A 3MFXA 4EBLA 1H3QA 4B93A 4RQ9A 1CJFA 4R1GA 1GSWA 3T4QA 5GHXA 4MDZA 1MXOA 3IWOA 3BEBA 3Q07A 1P9WA 4DJ3A 4JF5A 1K4FA 1K25A 1NJ4A 5HWWA 1OMEA 4R0QA 2V0UA 2R78A 4N1HA 3HLDA 2A49A 2P74A 3ZG8B 2V0WA 5TJJA 4UQIS 1S0WA 1PWCA 1LL9A 3GMWA 4PM6A 5DKKA 1H8YA 1DRMA 1PFLA 3OCNA 4WN5A 1N9OA 3R4KA 4YWZA 2O9CA 2ZLYA 4QY6A 4OH0A 1NZOA 3T4TA 4X68A 3WRZA
chains in the Genus database with same CATH topology
1TS8A 2VA0A 3PBTA 4CLCB 4HH2A 4G3WA 4EESA 2J80A 3T4SA 4JGOA 1NLZA 3B33A 3LICA 1S4SA 1UGUA 2HF6A 2B02A 4OOMA 3GDIA 1G28A 4R38A 2A24B 4Y3IA 1S4RA 1LL8A 2OAQ1 4GS9A 5J4EA 2JHEA 4ME4A 4ARZB 3A0RA 2D01A 4BBTA 4HJ4A 5FL3A 1OJGA 1TS6A 2ZOHA 3RFBA 4ZRRA 3LI8A 3EQUA 4K08A 2CMNA 3H7WB 1D06A 3EGDC 3NOPC 1NRJA 3EOIA 2KX6A 4I3JA 5F5YA 4HP9A 3OC2A 5KSHA 4GJ4A 2HGVA 1F5MA 1ZTUA 3T50A 3H82B 3OLOA 2M1CA 3OCLA 1IOUA 3NOUC 2KOIA 2NUTC 1YKDA 3PBRA 3BQAA 3T4JA 1OT9A 3U2AA 3ZQ5A 3F1OB 5J7EA 1YSQA 4GS9B 5C5KA 2GJ3A 4HHDA 2VV8A 1LSVA 2A24A 1UWNX 2L0WA 1IFQA 4I3AA 3LR4A 3G6OA 5HPIA 3K3CA 4LRXC 4AFIA 4NKPA 3S7PA 2PYRA 3TW8A 4IUKA 1W63Q 4JGPA 4MCWA 2I9VA 4IHQA 1MC0A 3NJAA 5J3WA 4G3KA 2W3DA 1N9LA 3KSIA 2IA2A 3S7OA 4KUKA 4CLCC 2NUPC 2WKQA 3E98A 4LRYC 4DJ2A 1N9NA 1TF1A 1XFNA 3LI9A 4KUOA 4NXGA 2QKPA 3S7NA 4R70A 2W0NA 2VLGA 4OOLA 1OT6A 3MQQA 2HJ9C 2BASA 2KDKA 2YKHA 4MN6A 3RTYA 3UE6A 4Q0JA 3ULFA 3HJKA 2J3TC 2ZOIA 2P04A 4CLCD 4O0PA 3JVVA 1Y28A 5MC7A 3O5YA 2QHKA 5EFWA 4F3LA 4HNBA 1DP8A 4BBVA 5AJGA 2FZ0A 1VB6A 5DKLA 3UB8A 2V1AA 3MMHA 2D02A 2LB5A 3LR3A 2INWA 2ZMVA 1JNUA 4EW7A 2VX8A 4XT2B 1T1AA 3E4OA 4HI4A 3TE8A 2O99A 1F98A 2YKFA 4MMNA 2GX5A 5HL6A 3MF0A 4MN5A 2K7SA 3KX0X 3OBFA 5F68A 3V67A 4HOIA 4ETZA 1H8MA 1STZA 3IS2B 5DF9A 4NEED 5HD5A 3VE3A 2W3HA 3HJIA 1YAXA 2L1MA 5HWVA 2L4RA 1GSXA 1T1BA 1P0ZA 2ZMFA 3P01A 2O9BA 3ZYTA 3P7NA 3MR0A 2Y8HA 4HJ6A 3LIEA 3BY9A 5HDCA 4I5SA 4I39A 4PKYG 5TBMB 1X0OA 3H82A 3VE4A 4BWIA 2VEAA 2GZAA 3HCYA 3PBNA 1LSWA 1NLYA 1VHMA 3RH8B 3KYQA 1T1CA 2XRNA 4WEKA 2M7VA 2Z6CA 3T4KA 4WELA 3EWKA 2W3FA 2W3GA 1S67L 3H7WA 2Y79A 5HPFA 3BJNA 1W63M 3TRCA 4P6ZM 3PBOA 3LFVA 3D72A 4UEYA 2Z6DA 3PBSA 3E4QA 5DFXA 3T4LA 4ARZA 3KSFA 5HDDA 2JKTI 2PDRA 3BW6A 2VKSA 3FC7A 4LLOB 5A8BA 2W1TA 3LUQA 4NXFA 1OTDA 3KSGA 3UB7A 2V9AA 3EGXC 4HY8A 2DMWA 4LPZA 3ICYA 5DFYA 2W1TB 1XJ4A 2PD8A 5F69A 4CLCA 2W3EA 5G4YA 3PR6A 4I3IA 3F1OA 3BQ8A 4FSFA 2O0YA 2PT7A 4E04A 3MJQA 4YNRA 1WA9A 2J3WA 5HD3A 3VV4A 1T18A 4EUVA 1OJ5A 2G7UA 4HH3A 3OOVA 2FH5A 2O9AA 4XT2A 3MXQA 4Q0HA 3MQOA 1ODVA 3SW1A 1OTBA 3LIFA 4HIAA 4PHTA 2P08A 4LRZE 3B42A 3C8CA 3R7WB 5G4ZA 1XJ6A 4EERA 1LT0A 2W27A 4EEUA 3EEAA 3EEHA 1GSVA 3R7WA 2EWVA 1XFQA 3A0SA 5IT5A 2J3TD 5L8MA 1LSXA 4BJPA 2QYBA 4L9FA 1F9IA 3LR5A 1OPXA 1TS7A 4L9EA 3LIDA 4PKYA 4EQ1A 4YOFA 3JVUA 3PHYA 2JKRI 2QJ5A 3CLOA 4Z1WA 1DP6A 3W2ZA 1XJ2A 3F1NA 5AVEA 4EU0A 3PYPA 5HZHA 1EW0A 3UMDA 3E0YA 1YSPA 1MKMA 4WF0A 1OTIA 2VJWA 2W1RA 2H28A 2WKRA 4FOFA 3C38A 4R6LA 3CUEC 1P9RA 4H6JA 4Y2FA 3LIAA 2P7JA 1OTAA 3UMEA 2VZWA 5HSQA 5KIZA 2HJEA 4KQOA 3LR0A 3C30A 3PBQA 3CWFA 3IBRA 5HDSA 4M4XA 4WL9A 3F1PB 3CITA 3LYXA 3H9WA 1P97A 2QJ7A 4WUJA 4IJGA 4Y5FA 4L9GA 2PR5A 2K31A 4HP4A 3BY8A 4NXEA 3T4OA 3UE3A 4HJ3A 4WEJA 3A0VA 4I38A 5TBMA 3D3OA 1S66L 3DBAA 4EETB 2A2LA 4QPRA 4DMZA 1S1YA 5HWTA 2PR6A 2PYPA 1UWPX 1TS0A 2WKPA 2XROA 2K2NA 2QWSA 5K5BA 1ZHHB 4P6ZS 1D7EA 4WLAA 2LB9A 2OWJA 4GCZA 1V9YA 3GECA 4R3AA 5LBRA 4GW9A 3BWLA 3K3DA 4EXOA 1MZUA 3FPVA 3KSHA 3UB9A 4B9OA 1XJ3A 4L0LA 3IBJA 2MJ6A 4H6JB 2EA9A 4MN7A 5IS1A 2KLIA 2V1BA 3EQVA 4BMWA 2HV1A 4GHIA 1TD5A 2XSSA 1S1ZA 1G6OA 3LIBA 3VOLA 1T19A 3PXPA 3S7QA 4NXBA 1V9ZA 4ETXA 1DP9A 4O8GA 4GLQA 4GHIB 1NWZA 5CX7A 3IS2A 4EEPA 5I5LA 3UB6A 3B47A 3MFXA 4G3VA 3CI6A 1BYWA 3F1NB 2B18A 1H3QA 4B93A 3KYZA 2VGLM 4RQ9A 4F3LB 3C2WA 3TJZC 1GSWA 3T4QA 4HQAA 2JN7A 4MDZA 2JKRM 5F6AA 2OOLA 4O01A 3KO6A 1P9WA 4JGQA 4DJ3A 4IUHA 4DN0A 4II7A 4CQHA 1OTEA 2GNXA 2VGLS 5DJUA 5HWWA 4BBUA 2PHYA 2PD7A 3FG8A 5DJTA 3FPWA 2XA7M 2VV7A 2V0UA 2R78A 3NOTC 3F1PA 4Q0IA 5IU1A 3K2NA 2V0WA 5TJJA 4UQIS 2VV6A 2ZBBA 2OWHA 2XA7S 3CUEA 1KOUA 2OAP1 4PAUA 4JGRA 5DKKA 1DRMA 3MQ0A 3NHQA 2M7UA 2JKTM 4KQDA 3OCNA 4WN5A 1N9OA 3R4KA 4UQIM 2EWWA 4YWZA 2O9CA 4CLCE 3CAXA 3T4TA 5AVFA 3E4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPW A;  4CLC B;  4NKP A;  4CLC D;  4CLC E;  5CX7 A;  3FPV A;  4CLC C;  4CLC A;  2A2L A;  4BMW A; 
#chains in the Genus database with same CATH topology
 5CTM A;  3T1R A;  4EES A;  4G3W A;  4JPM A;  1VEU B;  3T4S A;  1L0F A;  1VET B;  1NLZ A;  4S2K A;  2B02 A;  3WRT A;  5CGW A;  2AVX A;  1SZV A;  4GS9 A;  5J4E A;  1YLT A;  4ME4 A;  4BBT A;  1FCN A;  1OJG A;  4IBX A;  2EXA A;  4ZRR A;  1BT5 A;  2CMN A;  3H7W B;  4E3J A;  1I2W A;  3EGD C;  3NIA A;  2WAE A;  1NRJ A;  4QB8 A;  1MKI A;  1L3L A;  1IKG A;  2J9O A;  4X69 A;  5TGF A;  1ZTU A;  3AGD A;  3H82 B;  3IF6 A;  5EV0 A;  2WGW A;  1K56 D;  4KZ8 A;  3SOI A;  2ZD8 A;  1YKD A;  3MFD A;  3BQA A;  2DNS A;  4Y15 A;  2H10 A;  3ZQ5 A;  3F1O B;  5J7E A;  1PWG A;  4UA6 A;  4HHD A;  2QZ6 A;  3T12 B;  5A91 A;  3WS5 A;  3G6O A;  3K3C A;  2HZ5 A;  3QNB A;  4IUK A;  4JGP A;  4OQH A;  5A93 A;  4IHQ A;  1MBL A;  5J3W A;  4G3K A;  1N9L A;  5M1A A;  4KUO A;  1N9N A;  1TF1 A;  3LI9 A;  4PMA A;  5CEC A;  4WZ4 A;  1HZO A;  5FAT A;  3MQQ A;  2HJ9 C;  2KDK A;  2YKH A;  3UE6 A;  3RTY A;  3LO7 A;  4DDY A;  4U0T A;  3SS4 A;  4O0P A;  3HLW A;  3WS2 A;  4F3L A;  1Q2Q A;  4R3B A;  4UA7 A;  3T1S A;  5AJG A;  3ZDJ A;  2FZ0 A;  1XX2 A;  2PU4 A;  2V1A A;  3OPP A;  3MMH A;  1Z6F A;  4KZB A;  3UPP A;  5EUA A;  2HP5 A;  4XT2 B;  5EPH A;  2HDS A;  2FFF B;  2Z2L B;  1K54 C;  1CI8 A;  2O99 A;  4RX3 A;  2Y2K A;  5AQ9 A;  1DY6 A;  2B5R A;  4OLD A;  3IX3 A;  2K7S A;  3FKV A;  4ETZ A;  1H8M A;  4FUW A;  2PU2 A;  4LEN A;  5HD5 A;  4QU3 A;  3BFE A;  4Y0O A;  2L1M A;  4OP5 A;  5HWV A;  2L4R A;  4B4Z A;  1AWI A;  2ZMF A;  3W4P A;  3MR0 A;  2Y8H A;  4HJ6 A;  3LIE A;  4IED A;  4I5S A;  1X0O A;  3O3V A;  3HCY A;  4EBP A;  4NK3 A;  1LSW A;  1NLY A;  1IYS A;  1W8Y A;  1IYO A;  2W3F A;  2W3G A;  1S67 L;  2Y79 A;  4QJG A;  2ZM0 A;  5HPF A;  5JYO A;  1DJC A;  5FQI A;  4P6Z M;  3PBO A;  2Y91 A;  5TR7 A;  2Z6D A;  3SH8 A;  2CC1 A;  4ARZ A;  2JKT I;  5GHZ A;  2Q9N A;  2VKS A;  4KZ9 A;  1EWZ A;  4DE2 A;  2W1T A;  3LUQ A;  1GHP A;  3KSG A;  2WYX A;  3UB7 A;  2V9A A;  3IF5 A;  3SH7 A;  4HES A;  2DMW A;  4LPZ A;  5CED A;  3M6H A;  4WM9 A;  1XJ4 A;  2R9X A;  1KVL A;  4OOY A;  4I3I A;  2O0Y A;  3FZC A;  3Q1F A;  1WA9 A;  3BLS A;  1HTZ A;  1K57 A;  2J3W A;  3LEQ A;  1T18 A;  2G7U A;  4DXC A;  4DDS A;  2O9A A;  2VK3 A;  3HUO A;  3MQO A;  3HLC A;  3A3E A;  1CF0 A;  5FAQ A;  3QP6 A;  3LIF A;  3IWI A;  3P98 A;  3BFC A;  4LRZ E;  4X1L A;  3BYD A;  3C8C A;  4ZJ3 A;  5G4Z A;  4U3T A;  4EER A;  2C6W B;  1LT0 A;  1MPL A;  5FQJ A;  4EEU A;  3CZD A;  1J9M A;  2EWV A;  1XFQ A;  4ZBE A;  1JWP A;  2OLU A;  2WUQ A;  2ZM8 A;  3LR5 A;  4MEZ A;  1OPX A;  3BM6 A;  4YOF A;  3ITB A;  5F83 A;  3QP4 A;  3FKW A;  2ZQD A;  3F1N A;  5AVE A;  3UMD A;  4OLG A;  4PPR A;  4WF0 A;  1CEG A;  4C3Q A;  4E3N A;  2BLS A;  3N8S A;  2E8J A;  3A3F A;  3L9K A;  4R6L A;  1P9R A;  1ZC2 A;  2ZJ9 A;  3LIA A;  2VZW A;  5KIZ A;  3LR0 A;  3M2J A;  3S4X A;  4QHC A;  3CWF A;  4KG2 A;  3B3X A;  3H9W A;  1P97 A;  2QJ7 A;  2R9W A;  2Z2M B;  3O88 A;  4ZJ2 A;  2PR5 A;  3VMA A;  3GR2 A;  3W4O A;  3G2Y A;  2BG1 A;  4WEJ A;  1KE4 A;  3DBA A;  4OQI A;  2XFS A;  1S1Y A;  2Q9M A;  2PR6 A;  5CTN A;  1UWP X;  1ZHH B;  4EUZ A;  2LB9 A;  2OWJ A;  4GCZ A;  1V9Y A;  3GEC A;  2PRF A;  2HDR A;  3BWL A;  1L0D A;  4EXO A;  3FPV A;  2XDM A;  4Y17 A;  3OZH A;  4JXG A;  5IS1 A;  4S2N C;  2V1B A;  2HV1 A;  1PZO A;  4K0W A;  1G6O A;  3PTE A;  3VOL A;  1T19 A;  2JC7 A;  3Q82 A;  1DP9 A;  1JWV A;  4GLQ A;  4GHI B;  3IS2 A;  2H0T A;  5GLA A;  4G3V A;  2WKH A;  3DTE A;  2QPN A;  3F1N B;  3HVF A;  2B18 A;  3C2W A;  4HQA A;  3NDG A;  1NY0 A;  2JKR M;  3AGF A;  3QP2 A;  1W5D A;  2PBD P;  2OOL A;  3UDF A;  3KO6 A;  5FA7 A;  4JGQ A;  4IUH A;  5FI6 A;  2GNX A;  2PHY A;  4YFM A;  5DJT A;  3FG8 A;  2XA7 M;  3NOT C;  3AGE A;  4Q0I A;  3VSK A;  4GOG A;  2VV6 A;  1C3B A;  2OWH A;  2ZC7 A;  1KOU A;  2OAP 1;  4JGR A;  4BL2 A;  1BUL A;  5TFQ A;  1ES2 A;  2M7U A;  4KQD A;  1FCM A;  4S2P A;  3T1X A;  1BLH A;  4UQI M;  3VSL A;  2EWW A;  1TEM A;  5AVF A;  2VA0 A;  3PBT A;  4GDN A;  4GDB A;  1SCW A;  2J80 A;  1HD8 A;  4JGO A;  5FDH A;  3LIC A;  1UGU A;  5EVI D;  2QMI A;  5L07 A;  5KMW A;  4R38 A;  5HAI A;  4Y3I A;  5F1G A;  3ZG7 B;  2JHE A;  4ARZ B;  2D01 A;  3IXG A;  4OPZ A;  1HLU P;  1TS6 A;  3LY4 A;  3VOZ A;  2WZX A;  3CHW P;  3V3S A;  4JLF A;  3LI8 A;  4K08 A;  1PYY A;  1WYB A;  2Y2I A;  1PIO A;  1D06 A;  3WWX A;  5A90 A;  5KZH A;  4I3J A;  3MSH A;  5F5Y A;  4HP9 A;  4GB7 A;  5FEG A;  3OC2 A;  4ZAM A;  1YPR A;  4S2N A;  4D2O A;  3NOU C;  3G4P A;  2XF3 A;  2ZC6 B;  1DJB A;  3UO9 A;  3VP0 A;  1YT4 A;  4FTX A;  4JKT A;  4GZB A;  3UE0 A;  2GJ3 A;  2PBY A;  3G2Z A;  2A24 A;  4X53 A;  1IFQ A;  1H5X A;  3LR4 A;  5FI7 A;  3ZFZ A;  3HLE A;  4NKP A;  3S7P A;  4PM9 A;  2PYR A;  3DWZ A;  5AQB A;  4CLC C;  4KUK A;  2RCX A;  1XFN A;  1ESU A;  2QKP A;  4BEN A;  4OVD A;  4LCM A;  3SZT A;  4DF6 A;  2W0N A;  1E3U D;  1NYM A;  1G5U A;  1MWR A;  4OOL A;  4DE0 A;  1XA1 A;  4PM7 A;  3SS3 A;  4Q0J A;  3HJK A;  1PNE A;  3D9Y A;  1LLB A;  3JVV A;  2Y2Q A;  5MC7 A;  4HNB A;  1CQA A;  4BBV A;  3O87 A;  4RX2 A;  4P6B A;  2WZZ A;  1ERO A;  4P85 A;  1VB6 A;  5DKL A;  3D4F A;  1BLS A;  2ZMV A;  4EW7 A;  5HX9 A;  2DCF A;  3HUM A;  1N4O A;  2EX9 A;  4HI4 A;  4KG5 A;  1ZKJ A;  3S1Y A;  5DTK A;  3IQA A;  1F98 A;  1GA9 A;  2GX5 A;  3MF0 A;  1NRF A;  4MN5 A;  3OBF A;  5F68 A;  2UV0 E;  4HOI A;  4U0X A;  1XP4 A;  2X71 A;  1STZ A;  2J8Y A;  3ZGA B;  2ZQ7 A;  2JBF A;  3DW0 A;  2DRW A;  2O9B A;  3ZYT A;  2Y2O A;  4MNR A;  3BY9 A;  3NBL A;  5HDC A;  4I39 A;  3H82 A;  4BWI A;  3KYQ A;  4E3I A;  1T1C A;  1ONH A;  2G2W A;  1K57 C;  3H7W A;  4E3M A;  3BFD A;  3BJN A;  4E3K A;  3BEC A;  2ZC5 B;  3S22 A;  3T4L A;  3KSF A;  5HDD A;  3DTK A;  1KDW A;  5EVE A;  1TDG A;  3BW6 A;  5A8B A;  1G68 A;  5FQM A;  3QP1 A;  1IKI A;  3QP5 A;  4KZA A;  1KGF A;  4OQ0 A;  5F69 A;  5G4Y A;  3F1O A;  3BQ8 A;  4FSF A;  1YMX A;  2PT7 A;  5HD3 A;  4C6Y A;  4EUV A;  1Y4O A;  4HH3 A;  3OOV A;  3IF6 B;  1XGI A;  3MKE A;  1F2K A;  2H5S A;  1JTD A;  3B42 A;  3MXS A;  3KYE A;  1N9B A;  2WKI A;  2W27 A;  3W8K A;  5HAR A;  1H0M A;  3SS5 A;  5IT5 A;  5L8M A;  4E3O A;  1LSX A;  3TOI A;  2HP6 A;  1GCE A;  4L9F A;  4C75 A;  4FH4 A;  4BLM A;  2HDQ A;  1FR1 A;  4R4R A;  2WAD A;  2XFT A;  1BLC A;  5JYP A;  3CLO A;  1ESI A;  1DP6 A;  3IX8 A;  3PYP A;  1EW0 A;  1CI9 A;  3E0Y A;  4OPR A;  4FD8 A;  1K55 C;  2W1R A;  3UY6 A;  2H28 A;  2WKR A;  4FOF A;  1KDS A;  4N9K A;  1YLZ A;  4H6J A;  4LFU A;  4Y2F A;  4O7D A;  2P7J A;  4S2I A;  2JKG A;  4E6X A;  4EQI A;  1KGG A;  3C30 A;  2OV5 A;  4M4X A;  4WL9 A;  3C4P A;  5FAP A;  2XQZ A;  4L9G A;  4KZ5 A;  1Y54 A;  4HP4 A;  3BY8 A;  1SKO A;  1VQQ A;  1YLY A;  4NXE A;  5EM0 A;  1S66 L;  5EVL A;  4DRT A;  4EET B;  2UWX A;  2A2L A;  5L09 A;  2XRO A;  3WS4 A;  1JTG A;  1DJA A;  4BL3 A;  1K4E A;  5CHU A;  5LBR A;  5G18 A;  1O07 A;  4L0L A;  4WMC D;  2C5W B;  5E2H A;  2EA9 A;  5DF7 A;  3FV7 A;  4BMW A;  1YMS A;  2XSS A;  4B88 A;  3PXP A;  4O8G A;  2H0Y A;  5EEC A;  3UB6 A;  5EE8 A;  1CEF A;  3LCE A;  1BYW A;  2ZC3 B;  5J8X A;  2V8C A;  1NXY A;  4CJN A;  3KYZ A;  1MWU A;  2VGL M;  3LEZ A;  4F3L B;  1TDL A;  3TJZ C;  2JN7 A;  4R23 A;  5CER A;  3N8R A;  4DN0 A;  4II7 A;  3JYI A;  4HEF A;  4CQH A;  1OTE A;  5DJU A;  1W7F A;  4Y7P A;  4BBU A;  2PD7 A;  5FQK A;  3P09 A;  2Y2H A;  3K2N A;  5IU1 A;  5FDS A;  2XA7 S;  3CUE A;  4PAU A;  5FSR A;  2XLN A;  3VP2 A;  3MQ0 A;  3LGO A;  3NHQ A;  2JKT M;  1YM1 A;  1O7E A;  4CLC E;  1PI5 A;  1S6R A;  1L2S A;  1PI4 A;  4HH2 A;  1HVB A;  1SDN A;  1MWT A;  5HFO A;  3B33 A;  4H8R A;  1S4S A;  3MZD A;  1FIK A;  1G28 A;  2A24 B;  2ZC4 B;  1S4R A;  1LL8 A;  1ERM A;  1XGJ A;  3IXB A;  3A0R A;  5FL3 A;  5EOE A;  4S2L A;  3VFH A;  2GDN A;  2ZOH A;  3RFB A;  3MZE A;  4GD6 A;  3EQU A;  3V5M A;  3NY4 A;  4RA7 A;  1M6K A;  2ZQ8 A;  3EOI A;  2KX6 A;  2HPB A;  3RXX A;  4JF4 A;  5KSH A;  3NCK A;  2HGV A;  4IBR A;  1F5M A;  4EBN A;  3HLB A;  3OLO A;  1G6A A;  2M1C A;  5CXW A;  1IOU A;  2KOI A;  1VET A;  2XK1 A;  1VEU A;  3T4J A;  1OT9 A;  2Y2N A;  1YSQ A;  2IWD A;  3VP4 A;  2VV8 A;  1K0K A;  1LSV A;  3M2K A;  4HBU A;  1UWN X;  4IVI A;  2L0W A;  5AQA A;  5HPI A;  4LRX C;  4AFI A;  4WZ5 A;  2PAV P;  2EX6 A;  3TW8 A;  3NC8 A;  1W63 Q;  1BLP A;  3ZHH A;  2J9P A;  4Y13 A;  5F1F A;  5E43 A;  1PW1 A;  4P87 A;  3KSI A;  3S7O A;  2IA2 A;  2NUP C;  2OSU A;  4LRY C;  1WE4 A;  4DJ2 A;  2EX8 A;  2FFY A;  3ZVT A;  1W79 A;  4IVK A;  4OKP A;  2VGK A;  3DWK A;  2VLG A;  1OT6 A;  2BAS A;  4MN6 A;  3ULF A;  2J3T C;  2P04 A;  1LHY A;  2JCH A;  2JE5 A;  4GNU A;  3O5Y A;  5EFW A;  1H8Z A;  3UE1 A;  1DP8 A;  2P9V B;  2EX2 A;  5E2E A;  2VGJ A;  2XEP A;  3TSG A;  2WK0 A;  2INW A;  4GN2 A;  4E6W A;  1K55 A;  1JNU A;  2VX8 A;  5E2G A;  1T1A A;  4LV2 A;  4ESP A;  3W4Q A;  3TE8 A;  3C7V A;  3ZNY A;  5CGS A;  1ES4 A;  2YKF A;  4MMN A;  4X25 A;  1RGZ A;  3KX0 X;  3V67 A;  1BZA A;  4EWF A;  3IS2 B;  5DF9 A;  5HAP A;  4DXB A;  4B4X A;  4E3L A;  1LI0 A;  5FQ9 A;  1P0Z A;  1XA7 A;  1XXM A;  1KGE A;  3P7N A;  4PM5 A;  2EFX A;  3A3D A;  2OLV A;  3HBR A;  4BD1 A;  2ZMA A;  3VE4 A;  4PM8 A;  2VEA A;  2GZA A;  1ES3 A;  4QD4 A;  4Q8I A;  3CJM A;  1XKZ A;  4WEK A;  3N6I A;  5DTT A;  3T4K A;  4WEL A;  3M6B A;  4N92 A;  1YLW A;  1W63 M;  4UEY A;  3LFV A;  3D72 A;  4X56 A;  3IHB A;  4MBF A;  4Y0T A;  3PBS A;  3E4Q A;  5DFX A;  5GL9 A;  2PDR A;  4LLO B;  1OTD A;  4QWO A;  1RGY A;  3UDI A;  5FI2 A;  4R3J A;  3EGX C;  4LGW A;  1FCO A;  5EVI C;  3QP8 A;  1Q2P A;  2IWC A;  4CLC A;  2WGI A;  3PR6 A;  4ZTK A;  1K38 A;  4KZ3 A;  4E04 A;  3IXH A;  4R4S A;  3T1Q B;  3GVB A;  3DTI A;  3GQZ A;  4FCF A;  3ZG9 B;  5L2F A;  4OPQ A;  2FH5 A;  3MXQ A;  4Q0H A;  3TG9 A;  5D3O A;  4UAA A;  1ODV A;  1OTB A;  4PHT A;  2P08 A;  3C7U A;  4KZ6 A;  1XJ6 A;  2I72 A;  4JBF A;  3CPT B;  3EEH A;  4MBH A;  3R7W A;  1JWZ A;  2J3T D;  5F82 A;  1F9I A;  3G31 A;  3ZG0 A;  4L9E A;  4EQ1 A;  1MWS A;  1D1J A;  4X55 A;  1XJ2 A;  2Y2J A;  2XD5 A;  3MKF A;  1LI9 A;  3ITA A;  5HZH A;  2ZL1 B;  1YSP A;  1MKM A;  3O86 A;  3ZVW A;  2VJW A;  2Q0O A;  4RVA A;  5EOO A;  1BSG A;  2Y55 A;  3CUE C;  1SHV A;  5EVI B;  3Q7V B;  3N8L A;  3PBQ A;  3IBR A;  5HDS A;  3F1P B;  3NUL A;  4IJG A;  4Y5F A;  1RCJ A;  3GRJ A;  5I94 A;  4MLL A;  2K31 A;  4KQQ A;  1KVM A;  1IYQ A;  5CGX A;  5CHM A;  3UE3 A;  4HJ3 A;  5TBM A;  5CHJ A;  1BTL A;  4WBG A;  1YQS A;  5HWT A;  3CG5 A;  3LY3 A;  3CMZ A;  1TS0 A;  2K2N A;  2QWS A;  5K5B A;  3UPO A;  3G35 A;  4M3K A;  3UB5 P;  4R3A A;  4HBT A;  1MZU A;  3KSH A;  4X6T A;  3UB9 A;  5M19 A;  3IH9 A;  3V3R A;  2G2U A;  3E2L A;  1FOF A;  4MN7 A;  2KLI A;  3EQV A;  1J3W A;  4GHI A;  1S1Z A;  3OPR A;  3S7Q A;  4NXB A;  1MY8 A;  1V9Z A;  4ETX A;  1NWZ A;  4LCL A;  4EEP A;  5I5L A;  3B47 A;  2V8F A;  4YIN A;  5CRF A;  5GLB A;  3CI6 A;  3VP3 A;  4K0X A;  3BFF A;  3GV9 A;  3IHA A;  4P0M A;  5GHY A;  3A3I A;  5GLC A;  5F6A A;  3UN7 A;  4O01 A;  1ES5 A;  2VGL S;  3QNC A;  1CK3 A;  2EXB A;  3FPW A;  5HAQ A;  2VV7 A;  4RYE A;  3G30 A;  3F1P A;  3RXW A;  3E2K A;  4XXR A;  2ZBB A;  1FR6 A;  3Q7V A;  3MS6 A;  1GHM A;  3HLG A;  4EV4 A;  3CAX A;  3E4P A;  2B95 A;  1TS8 A;  4CLC B;  5U47 A;  5HW3 A;  1FIL A;  4OPY A;  2HF6 A;  4OOM A;  3OPH A;  3GDI A;  3IXD A;  2OAQ 1;  3ISG A;  5KSC A;  4HJ4 A;  1AXB A;  3V39 A;  4BD0 A;  3A3J A;  2Y2P A;  4K91 A;  4KZ7 A;  1PZP A;  1K54 A;  3FYZ A;  2HP9 A;  3NOP C;  3V50 A;  4GKU A;  5E2F A;  2XD1 A;  1KE3 A;  4GJ4 A;  1PRQ A;  1SKF A;  3ZCZ A;  3T50 A;  4KEN B;  3OCL A;  2XGN A;  2NUT C;  1L0G A;  3WS0 A;  3PBR A;  1Z09 A;  5L10 A;  1RP5 A;  1LL5 A;  4OON A;  3GTC A;  3U2A A;  4ZJ1 A;  4GS9 B;  5C5K A;  3U4L P;  1ZG6 A;  4I3A A;  4S2M A;  4ZDX A;  1I5Q A;  2HDU A;  5M18 A;  3N7W A;  1IEL A;  4MCW A;  1PWD A;  4S2O A;  2I9V A;  1MC0 A;  3NJA A;  4S2J A;  2W3D A;  2WKQ A;  3E98 A;  4OP8 A;  1FQG A;  4NXG A;  3BRM A;  3S7N A;  4R70 A;  1VM1 A;  4GD8 A;  1QME A;  2ZOI A;  4CLC D;  2ZQ9 A;  3BLM A;  1NYY A;  4WYY A;  1Y28 A;  3C4O A;  2ZQC A;  5EM1 A;  4D60 A;  2QHK A;  4N1X A;  4JXV A;  3UB8 A;  4ID4 A;  2D02 A;  4DE1 A;  2LB5 A;  3LR3 A;  4Z9Q A;  3VOY A;  2ACG A;  3SH9 A;  3E4O A;  1K56 A;  5DTS A;  2E8I A;  5HL6 A;  5DF8 A;  1W8Q A;  1GHI A;  2WKE A;  1WYC A;  1PW8 A;  3I7J A;  3ZG5 A;  4NEE D;  3VE3 A;  3JPU A;  2W3H A;  3HJI A;  3GSG A;  1YAX A;  1BUE A;  1GSX A;  5AQ7 A;  5FEF A;  1T1B A;  2WAF A;  4UA9 A;  3P01 A;  2P9V A;  3HUN A;  3VFF A;  4PKY G;  5TBM B;  4QY5 A;  3PBN A;  3DTM A;  1QMF A;  2Y2M A;  1VHM A;  1NZU A;  3RH8 B;  2XRN A;  3HL9 A;  3Q7Z A;  5DVA A;  1SDE A;  2M7V A;  4NG2 A;  3IWQ A;  3WS1 A;  2Z6C A;  3EWK A;  4JXS A;  5HL1 A;  3L7H A;  2Y2G A;  3TRC A;  5FAS A;  4UHU A;  1E4D A;  4CPK A;  1U60 A;  2Y4A A;  5EVI A;  1I2S A;  2JKF A;  1YLP A;  3PAE A;  3FC7 A;  3UDX A;  4DKI A;  3MZF A;  4NXF A;  4BQM A;  1YLJ A;  4HY8 A;  2ZQA A;  3ICY A;  4LV1 A;  5DFY A;  2W1T B;  3MBZ A;  4JF6 A;  2PD8 A;  5BOH A;  2W3E A;  1ONG A;  2ZL1 A;  2Y2L A;  1K6S A;  2IWB A;  3MJQ A;  4YNR A;  2Y59 A;  3VV4 A;  3PAG A;  3IF6 C;  3RJU A;  2X02 A;  1OJ5 A;  4XT2 A;  3SW1 A;  4HIA A;  3BFG A;  3R7W B;  3CPT A;  2A3U A;  3FWL A;  3EEA A;  1GSV A;  3A0S A;  4BJP A;  2QYB A;  2BTF P;  5IHV A;  4X1M A;  1TS7 A;  3LID A;  4PKY A;  1ALQ A;  3JVU A;  3PHY A;  2JKR I;  2QJ5 A;  5GLD A;  4Z1W A;  3W2Z A;  4EU0 A;  3MXR A;  1L0E A;  2ZM2 A;  1SKO B;  1K6R A;  1FSW A;  4DE3 A;  2WGV A;  2V2F F;  1OTI A;  3NDE A;  4N9L A;  1E3U A;  4OQG A;  2V1Z A;  4XUZ A;  2XH9 A;  3C38 A;  4KZ4 A;  4A5R A;  3UNW A;  2EFU A;  4FH2 A;  1ACF A;  3OPL A;  1OTA A;  3UME A;  5HSQ A;  2HJE A;  4KQO A;  4KG6 A;  1FSY A;  3VP1 A;  3HLF A;  3G32 A;  1ERQ A;  3CIT A;  2XR0 A;  3LYX A;  4MBK A;  1EI5 A;  4WUJ A;  1ZG4 A;  1KE0 A;  3C5A A;  3QHY A;  2V20 A;  4NET A;  4LV0 A;  4F94 A;  3IH8 A;  3HRE A;  3T4O A;  3DAV A;  2J7V A;  3A0V A;  4I38 A;  5A92 A;  3D3O A;  1GA0 A;  4QPR A;  1XPB A;  4DMZ A;  4WZ5 C;  2PYP A;  5CEB A;  2WKP A;  2RL3 A;  2X01 A;  3IX4 A;  4P6Z S;  4WMC A;  1D7E A;  4WLA A;  5FQQ A;  4GW9 A;  3K3D A;  3NEC A;  3NI9 A;  3ZNT A;  4B9O A;  1XJ3 A;  3IBJ A;  3IT9 A;  4JXW A;  2MJ6 A;  4H6J B;  1IYP A;  4Y0U A;  1A0K A;  3G34 A;  5FAO A;  3UPN A;  1IEM A;  2WGW B;  1TD5 A;  4KQR A;  1TVF A;  3LIB A;  3N4I A;  4XUX A;  5CX7 A;  1E25 A;  1M40 A;  4LV3 A;  1JVJ A;  3Q81 A;  3MFX A;  4EBL A;  1H3Q A;  4B93 A;  4RQ9 A;  1CJF A;  4R1G A;  1GSW A;  3T4Q A;  5GHX A;  4MDZ A;  1MXO A;  3IWO A;  3BEB A;  3Q07 A;  1P9W A;  4DJ3 A;  4JF5 A;  1K4F A;  1K25 A;  1NJ4 A;  5HWW A;  1OME A;  4R0Q A;  2V0U A;  2R78 A;  4N1H A;  3HLD A;  2A49 A;  2P74 A;  3ZG8 B;  2V0W A;  5TJJ A;  4UQI S;  1S0W A;  1PWC A;  1LL9 A;  3GMW A;  4PM6 A;  5DKK A;  1H8Y A;  1DRM A;  1PFL A;  3OCN A;  4WN5 A;  1N9O A;  3R4K A;  4YWZ A;  2O9C A;  2ZLY A;  4QY6 A;  4OH0 A;  1NZO A;  3T4T A;  4X68 A;  3WRZ A; 
#chains in the Genus database with same CATH homology
 1TS8 A;  2VA0 A;  3PBT A;  4CLC B;  4HH2 A;  4G3W A;  4EES A;  2J80 A;  3T4S A;  4JGO A;  1NLZ A;  3B33 A;  3LIC A;  1S4S A;  1UGU A;  2HF6 A;  2B02 A;  4OOM A;  3GDI A;  1G28 A;  4R38 A;  2A24 B;  4Y3I A;  1S4R A;  1LL8 A;  2OAQ 1;  4GS9 A;  5J4E A;  2JHE A;  4ME4 A;  4ARZ B;  3A0R A;  2D01 A;  4BBT A;  4HJ4 A;  5FL3 A;  1OJG A;  1TS6 A;  2ZOH A;  3RFB A;  4ZRR A;  3LI8 A;  3EQU A;  4K08 A;  2CMN A;  3H7W B;  1D06 A;  3EGD C;  3NOP C;  1NRJ A;  3EOI A;  2KX6 A;  4I3J A;  5F5Y A;  4HP9 A;  3OC2 A;  5KSH A;  4GJ4 A;  2HGV A;  1F5M A;  1ZTU A;  3T50 A;  3H82 B;  3OLO A;  2M1C A;  3OCL A;  1IOU A;  3NOU C;  2KOI A;  2NUT C;  1YKD A;  3PBR A;  3BQA A;  3T4J A;  1OT9 A;  3U2A A;  3ZQ5 A;  3F1O B;  5J7E A;  1YSQ A;  4GS9 B;  5C5K A;  2GJ3 A;  4HHD A;  2VV8 A;  1LSV A;  2A24 A;  1UWN X;  2L0W A;  1IFQ A;  4I3A A;  3LR4 A;  3G6O A;  5HPI A;  3K3C A;  4LRX C;  4AFI A;  4NKP A;  3S7P A;  2PYR A;  3TW8 A;  4IUK A;  1W63 Q;  4JGP A;  4MCW A;  2I9V A;  4IHQ A;  1MC0 A;  3NJA A;  5J3W A;  4G3K A;  2W3D A;  1N9L A;  3KSI A;  2IA2 A;  3S7O A;  4KUK A;  4CLC C;  2NUP C;  2WKQ A;  3E98 A;  4LRY C;  4DJ2 A;  1N9N A;  1TF1 A;  1XFN A;  3LI9 A;  4KUO A;  4NXG A;  2QKP A;  3S7N A;  4R70 A;  2W0N A;  2VLG A;  4OOL A;  1OT6 A;  3MQQ A;  2HJ9 C;  2BAS A;  2KDK A;  2YKH A;  4MN6 A;  3RTY A;  3UE6 A;  4Q0J A;  3ULF A;  3HJK A;  2J3T C;  2ZOI A;  2P04 A;  4CLC D;  4O0P A;  3JVV A;  1Y28 A;  5MC7 A;  3O5Y A;  2QHK A;  5EFW A;  4F3L A;  4HNB A;  1DP8 A;  4BBV A;  5AJG A;  2FZ0 A;  1VB6 A;  5DKL A;  3UB8 A;  2V1A A;  3MMH A;  2D02 A;  2LB5 A;  3LR3 A;  2INW A;  2ZMV A;  1JNU A;  4EW7 A;  2VX8 A;  4XT2 B;  1T1A A;  3E4O A;  4HI4 A;  3TE8 A;  2O99 A;  1F98 A;  2YKF A;  4MMN A;  2GX5 A;  5HL6 A;  3MF0 A;  4MN5 A;  2K7S A;  3KX0 X;  3OBF A;  5F68 A;  3V67 A;  4HOI A;  4ETZ A;  1H8M A;  1STZ A;  3IS2 B;  5DF9 A;  4NEE D;  5HD5 A;  3VE3 A;  2W3H A;  3HJI A;  1YAX A;  2L1M A;  5HWV A;  2L4R A;  1GSX A;  1T1B A;  1P0Z A;  2ZMF A;  3P01 A;  2O9B A;  3ZYT A;  3P7N A;  3MR0 A;  2Y8H A;  4HJ6 A;  3LIE A;  3BY9 A;  5HDC A;  4I5S A;  4I39 A;  4PKY G;  5TBM B;  1X0O A;  3H82 A;  3VE4 A;  4BWI A;  2VEA A;  2GZA A;  3HCY A;  3PBN A;  1LSW A;  1NLY A;  1VHM A;  3RH8 B;  3KYQ A;  1T1C A;  2XRN A;  4WEK A;  2M7V A;  2Z6C A;  3T4K A;  4WEL A;  3EWK A;  2W3F A;  2W3G A;  1S67 L;  3H7W A;  2Y79 A;  5HPF A;  3BJN A;  1W63 M;  3TRC A;  4P6Z M;  3PBO A;  3LFV A;  3D72 A;  4UEY A;  2Z6D A;  3PBS A;  3E4Q A;  5DFX A;  3T4L A;  4ARZ A;  3KSF A;  5HDD A;  2JKT I;  2PDR A;  3BW6 A;  2VKS A;  3FC7 A;  4LLO B;  5A8B A;  2W1T A;  3LUQ A;  4NXF A;  1OTD A;  3KSG A;  3UB7 A;  2V9A A;  3EGX C;  4HY8 A;  2DMW A;  4LPZ A;  3ICY A;  5DFY A;  2W1T B;  1XJ4 A;  2PD8 A;  5F69 A;  4CLC A;  2W3E A;  5G4Y A;  3PR6 A;  4I3I A;  3F1O A;  3BQ8 A;  4FSF A;  2O0Y A;  2PT7 A;  4E04 A;  3MJQ A;  4YNR A;  1WA9 A;  2J3W A;  5HD3 A;  3VV4 A;  1T18 A;  4EUV A;  1OJ5 A;  2G7U A;  4HH3 A;  3OOV A;  2FH5 A;  2O9A A;  4XT2 A;  3MXQ A;  4Q0H A;  3MQO A;  1ODV A;  3SW1 A;  1OTB A;  3LIF A;  4HIA A;  4PHT A;  2P08 A;  4LRZ E;  3B42 A;  3C8C A;  3R7W B;  5G4Z A;  1XJ6 A;  4EER A;  1LT0 A;  2W27 A;  4EEU A;  3EEA A;  3EEH A;  1GSV A;  3R7W A;  2EWV A;  1XFQ A;  3A0S A;  5IT5 A;  2J3T D;  5L8M A;  1LSX A;  4BJP A;  2QYB A;  4L9F A;  1F9I A;  3LR5 A;  1OPX A;  1TS7 A;  4L9E A;  3LID A;  4PKY A;  4EQ1 A;  4YOF A;  3JVU A;  3PHY A;  2JKR I;  2QJ5 A;  3CLO A;  4Z1W A;  1DP6 A;  3W2Z A;  1XJ2 A;  3F1N A;  5AVE A;  4EU0 A;  3PYP A;  5HZH A;  1EW0 A;  3UMD A;  3E0Y A;  1YSP A;  1MKM A;  4WF0 A;  1OTI A;  2VJW A;  2W1R A;  2H28 A;  2WKR A;  4FOF A;  3C38 A;  4R6L A;  3CUE C;  1P9R A;  4H6J A;  4Y2F A;  3LIA A;  2P7J A;  1OTA A;  3UME A;  2VZW A;  5HSQ A;  5KIZ A;  2HJE A;  4KQO A;  3LR0 A;  3C30 A;  3PBQ A;  3CWF A;  3IBR A;  5HDS A;  4M4X A;  4WL9 A;  3F1P B;  3CIT A;  3LYX A;  3H9W A;  1P97 A;  2QJ7 A;  4WUJ A;  4IJG A;  4Y5F A;  4L9G A;  2PR5 A;  2K31 A;  4HP4 A;  3BY8 A;  4NXE A;  3T4O A;  3UE3 A;  4HJ3 A;  4WEJ A;  3A0V A;  4I38 A;  5TBM A;  3D3O A;  1S66 L;  3DBA A;  4EET B;  2A2L A;  4QPR A;  4DMZ A;  1S1Y A;  5HWT A;  2PR6 A;  2PYP A;  1UWP X;  1TS0 A;  2WKP A;  2XRO A;  2K2N A;  2QWS A;  5K5B A;  1ZHH B;  4P6Z S;  1D7E A;  4WLA A;  2LB9 A;  2OWJ A;  4GCZ A;  1V9Y A;  3GEC A;  4R3A A;  5LBR A;  4GW9 A;  3BWL A;  3K3D A;  4EXO A;  1MZU A;  3FPV A;  3KSH A;  3UB9 A;  4B9O A;  1XJ3 A;  4L0L A;  3IBJ A;  2MJ6 A;  4H6J B;  2EA9 A;  4MN7 A;  5IS1 A;  2KLI A;  2V1B A;  3EQV A;  4BMW A;  2HV1 A;  4GHI A;  1TD5 A;  2XSS A;  1S1Z A;  1G6O A;  3LIB A;  3VOL A;  1T19 A;  3PXP A;  3S7Q A;  4NXB A;  1V9Z A;  4ETX A;  1DP9 A;  4O8G A;  4GLQ A;  4GHI B;  1NWZ A;  5CX7 A;  3IS2 A;  4EEP A;  5I5L A;  3UB6 A;  3B47 A;  3MFX A;  4G3V A;  3CI6 A;  1BYW A;  3F1N B;  2B18 A;  1H3Q A;  4B93 A;  3KYZ A;  2VGL M;  4RQ9 A;  4F3L B;  3C2W A;  3TJZ C;  1GSW A;  3T4Q A;  4HQA A;  2JN7 A;  4MDZ A;  2JKR M;  5F6A A;  2OOL A;  4O01 A;  3KO6 A;  1P9W A;  4JGQ A;  4DJ3 A;  4IUH A;  4DN0 A;  4II7 A;  4CQH A;  1OTE A;  2GNX A;  2VGL S;  5DJU A;  5HWW A;  4BBU A;  2PHY A;  2PD7 A;  3FG8 A;  5DJT A;  3FPW A;  2XA7 M;  2VV7 A;  2V0U A;  2R78 A;  3NOT C;  3F1P A;  4Q0I A;  5IU1 A;  3K2N A;  2V0W A;  5TJJ A;  4UQI S;  2VV6 A;  2ZBB A;  2OWH A;  2XA7 S;  3CUE A;  1KOU A;  2OAP 1;  4PAU A;  4JGR A;  5DKK A;  1DRM A;  3MQ0 A;  3NHQ A;  2M7U A;  2JKT M;  4KQD A;  3OCN A;  4WN5 A;  1N9O A;  3R4K A;  4UQI M;  2EWW A;  4YWZ A;  2O9C A;  4CLC E;  3CAX A;  3T4T A;  5AVF A;  3E4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...