4CLCC

Crystal structure of ybr137w protein
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
173
structure length
173
Chain Sequence
MVVLDKKLLERLTSRKVPLEELEDMEKRCFLSTFTYQDAFDLGTYIRNAVKENFPEKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSDYPYACLTISGLKQEEDHLMAVSSLIAFANESLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0303 PROTEIN YBR137W
publication title Structural and Functional Characterization of Ybr137Wp Implicate its Involvement in the Targeting of Tail-Anchored Proteins to Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 53
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4clcC00
2A2LA 4CLCA 5CX7A 4CLCC 3FPWA 4CLCE 4CLCD 4NKPA 4CLCB 4BMWA 3FPVA
chains in the Genus database with same CATH superfamily
2V1AA 4WZ4A 2B5RA 4BJPA 3N7WA 3UN7A 1YAXA 1SZVA 4KZ5A 4K91A 4X55A 3BECA 1IYSA 4OPQA 3A0SA 4WMCD 4JGRA 4UAAA 4XUXA 1KGEA 2WZXA 4FD8A 4U3TA 2W3DA 1SKFA 4UQIM 4MBKA 4OOLA 3BFGA 1PIOA 2JKTM 4PAUA 4PHTA 4QY5A 2W1RA 1NLYA 2PAVP 5AQBA 3WS0A 1UGUA 2OSUA 3CWFA 4LV0A 4ZRRA 1W63Q 3BW6A 1DRMA 2GX5A 1K55A 3FKVA 4LENA 4MBHA 1GSWA 4S2PA 3PXPA 3SH7A 1ERMA 2BG1A 4BQMA 4LV1A 5FQQA 3OLOA 2VK3A 4H6JA 3BYDA 4ZTKA 1JWPA 3G30A 5A90A 1M6KA 3UB6A 3DTIA 1ONGA 2Q0OA 3DTKA 4H8RA 3AGDA 4MLLA 1K56A 4P6BA 2PHYA 2Z6CA 4NETA 4P85A 4ZJ1A 1YLWA 5KSHA 1PNEA 4MBFA 4M3KA 5HFOA 1NWZA 5EVIC 1V9YA 1L0DA 5FATA 4DXCA 4X25A 2GDNA 4P87A 1XJ6A 5FAOA 1FOFA 2OAQ1 1BULA 5F6AA 2J9PA 2Y2LA 3NC8A 3ICYA 4N1HA 3UDXA 4E3LA 4Y15A 1LSWA 2Y2MA 3FKWA 4WEKA 4KQDA 3LFVA 4GDNA 5FAQA 3KYEA 3NHQA 3H7WB 1DP8A 2XR0A 1S4RA 3GVBA 3LIBA 4I38A 2WZZA 3CLOA 4R6LA 2JKTI 2PYRA 3UDFA 1D1JA 4QPRA 2Y2IA 4ME4A 3IH8A 5E43A 5DF8A 3QNBA 2XEPA 4JPMA 5HSQA 3NOPC 4ZDXA 2W3EA 3WRTA 4WL9A 3T50A 1D06A 4HOIA 1CQAA 2V0WA 3C5AA 1K4EA 2GJ3A 3LIDA 4JGQA 1H0MA 5CRFA 3VMAA 3UB5P 3A3IA 4B88A 4N9KA 4R3AA 3S22A 5M1AA 4R23A 4DJ3A 1IYPA 4Z9QA 4O01A 4HP4A 1LL5A 4LLOB 5F5YA 1FILA 1MY8A 3UE3A 1T1BA 1HTZA 3EOIA 2I9VA 3AGEA 3NY4A 5EVLA 2JBFA 4OVDA 2Z6DA 4X56A 3W4OA 3HUMA 3T4KA 4GKUA 1K56D 1I2WA 3G6OA 4HY8A 3G32A 4R3JA 4EBLA 1GHMA 2EXAA 1WYBA 1ES4A 3VOYA 4BMWA 4EV4A 4ZJ3A 2G2WA 3FZCA 2B02A 5CX7A 2H0YA 2PYPA 4Y5FA 3LR5A 3UMEA 4Y0OA 5FQMA 4OQ0A 5DFYA 4E3MA 2V9AA 1E4DA 1XFQA 2INWA 1GSXA 4MN5A 3B42A 3IBRA 5FQJA 3R7WA 2OWHA 3ZG0A 3TRCA 2ZQCA 4OP5A 1MPLA 3GDIA 3OCNA 3PBRA 2W3HA 4D2OA 2IWDA 5EVIB 3T4OA 1XP4A 5FL3A 1MKMA 4HQAA 4KZ9A 5AQ9A 5LBRA 2KOIA 5HZHA 4IUKA 3T4JA 4AFIA 1ODVA 4ZJ2A 1T1CA 2B95A 4Y3IA 3F1PB 3F1PA 2Z2MB 5TBMB 2ZQ8A 2V1ZA 1W8QA 1GHIA 4KG2A 3JVVA 5FA7A 1K6SA 1QMEA 4L0LA 1LL8A 1OT6A 4OONA 5HD5A 1OTBA 2WGWB 3T4QA 1XJ3A 2BASA 1S66L 3BWLA 3H9WA 5TJJA 5AQAA 5BOHA 1OJGA 5F83A 5I5LA 1VQQA 2Y2JA 3RXWA 1NY0A 5AQ7A 2WAEA 4DE2A 1MC0A 2DRWA 4XUZA 1VETA 4PM7A 3FV7A 5CTMA 4EETB 2WKHA 4JLFA 5DF9A 5TFQA 1M40A 3H82A 4N1XA 3RXXA 4DDYA 3MQQA 4N9LA 3ZCZA 1S6RA 1EW0A 4XT2A 3Q81A 4MMNA 2QMIA 3PBQA 4S2JA 1LLBA 1XKZA 1BZAA 3GECA 4RVAA 1GCEA 1NZUA 1YLYA 1D7EA 4O0PA 5J4EA 1FR6A 4PM9A 3HLCA 1F98A 2PBDP 4WZ5C 2NUPC 1KVMA 5EVEA 3LEQA 4JBFA 4R3BA 4KZBA 1DP6A 2PU2A 1SDEA 3W4PA 3DAVA 3K3DA 3G2ZA 4ARZB 4ARZA 1XFNA 5L10A 1LT0A 1IELA 3FG8A 3ITAA 1TVFA 3MMHA 4NKPA 2X02A 3OCLA 3UE6A 2L0WA 1L2SA 2A3UA 1Q2PA 3EEAA 2YKHA 5L8MA 1AXBA 1JTGA 5CHMA 1RGZA 2XQZA 4GD8A 3IF6B 3BRMA 3CAXA 4YNRA 2CC1A 1AWIA 3LR0A 3ZG8B 3P01A 1CEFA 3V3RA 3VSLA 2DMWA 1VEUA 3OPRA 2ZD8A 4S2OA 1V9ZA 4N92A 4OPYA 2BLSA 4XXRA 3CPTB 4DF6A 3WS5A 4MNRA 4OOYA 1TDGA 5FDHA 2EA9A 3AGFA 5FQ9A 3ZG7B 5F1FA 2VA0A 3BM6A 4NXGA 4S2MA 1S1ZA 2ZMVA 2ZC4B 4KQQA 2J3TC 4RA7A 3IX8A 3LI8A 3GQZA 3W2ZA 1KDWA 1ZG4A 1DY6A 3HLFA 2JKFA 4PKYA 4IHQA 4EWFA 2J7VA 1JWZA 5DF7A 4EEPA 2CMNA 1L0EA 5FDSA 3IF5A 1FCNA 3IHAA 3NECA 3CJMA 4HBTA 1NRJA 3S7OA 3VP3A 2G2UA 1WYCA 3IBJA 5CECA 1DP9A 4DJ2A 2WGVA 3HCYA 5CERA 4B93A 3IHBA 3O5YA 3UB7A 2LB9A 3ZG5A 4WBGA 4CLCB 1K54A 2OLVA 4CLCA 4Q0IA 4IBXA 3FYZA 3JYIA 1OPXA 1CK3A 4UA6A 1F2KA 3DWKA 3NCKA 3G4PA 4B4ZA 5CXWA 4LFUA 3TW8A 5EOOA 2ZQ7A 4JXVA 4D60A 1P97A 4II7A 2PDRA 3GMWA 2VV7A 3MXQA 5HPIA 1XXMA 2EXBA 4KQRA 1YPRA 3GV9A 5FAPA 1C3BA 1SKOB 4X6TA 3F1NA 3GRJA 3D4FA 3HREA 3VFHA 1J9MA 5EE8A 3QP8A 3V39A 5J3WA 4LPZA 2EX2A 4GB7A 3S7PA 2PR5A 3HJIA 5HPFA 3FWLA 5HWVA 5MC7A 4B4XA 4HI4A 4RQ9A 3VP0A 5HDSA 2ZMFA 4GJ4A 2OLUA 2ZQ9A 3UB9A 1H8ZA 4GN2A 2ZM8A 1Z6FA 3C4OA 1CI8A 3GSGA 1O7EA 4K0XA 1IOUA 2W0NA 2JKRM 5DTTA 5EV0A 1F5MA 1HLUP 4CLCE 2Z2LB 2I72A 4YOFA 3HBRA 1T18A 3ISGA 3BFCA 1GA9A 2O9AA 2UWXA 5DKKA 4JGOA 4EXOA 4A5RA 5KIZA 5KMWA 3SS5A 4P6ZS 4H6JB 5JYPA 1OTDA 3BY8A 3G34A 1ES5A 3BFDA 3CUEA 1XPBA 4HJ3A 4HJ4A 1UWNX 2V2FF 3UB8A 4NXFA 3V50A 1H8MA 1K57A 4LRZE 2P7JA 3U4LP 1Y4OA 4CLCD 5FQKA 1NXYA 2FFYA 2XA7M 3CMZA 1ACFA 4EUVA 2JC7A 2IA2A 4R38A 2QYBA 3PBOA 5AVEA 3HUNA 5F69A 4HP9A 2M7VA 1MWTA 2Y2GA 1YQSA 3LIAA 4OKPA 2WADA 2ZC6B 3NBLA 2R9XA 2JKGA 3IQAA 3IWQA 3SH8A 3BQAA 2PU4A 3N8SA 1KE4A 3WS1A 4HNBA 2XFTA 1VB6A 1YM1A 2WKQA 4GOGA 3K2NA 2WKPA 4Y2FA 4PM6A 2QWSA 2PD7A 1WA9A 5G4YA 5F1GA 2M7UA 2Y2NA 4S2NA 3ZVTA 4RYEA 1TS7A 4KG5A 5GHYA 1VHMA 4MN7A 5DFXA 2QKPA 3SH9A 3A3FA 5DJUA 2JKRI 2H5SA 2QJ7A 5CGSA 2ACGA 1W63M 3HLDA 3IXHA 3QP4A 1G5UA 3T1XA 5FI7A 4DKIA 2ZOIA 2VX8A 2GNXA 1RCJA 1CJFA 5EECA 3VE3A 1G68A 1HZOA 3KO6A 3QP1A 1W7FA 3T1RA 2C6WB 2ZM2A 4F3LA 5L07A 2K7SA 1YLZA 2IWBA 3P09A 2WKIA 3Q7VA 5HDDA 2HF6A 1RGYA 1PZPA 1TS8A 2RCXA 4KZ4A 2EWWA 2B18A 1BLSA 3MFDA 3LIEA 2ZBBA 4I3IA 4KZAA 4EU0A 5K5BA 4L9FA 1KE3A 5HAPA 3RJUA 3TJZC 1P9WA 3LYXA 5IHVA 1IKGA 3UE1A 2WAFA 3IF6C 3T4LA 3UNWA 4EEUA 3E4QA 1CEGA 3SS4A 3EEHA 3IXDA 4C6YA 4OLDA 3QNCA 2D02A 3R7WB 1Z09A 1PZOA 3UY6A 2XD1A 5M19A 3IWOA 4GW9A 3MKEA 3LY3A 1FSWA 3KSHA 3M6HA 3VP2A 5CEDA 3Q82A 1G6OA 5FI6A 4E04A 2AVXA 1FSYA 3LGOA 4OPRA 5FEGA 3ZGAB 4RX3A 4X68A 4UQIS 3MR0A 2UV0E 3BLSA 5KZHA 1XGJA 2WYXA 2P9VA 1XA1A 1TD5A 4LGWA 1KGFA 1BLCA 3N6IA 2Q9MA 3C8CA 3MQOA 4UA7A 3OZHA 1Y54A 2XDMA 3TOIA 4ID4A 4Q8IA 4FH2A 2QZ6A 1O07A 1W8YA 2Y91A 1I5QA 2R78A 1HD8A 4X1MA 1J3WA 1NYYA 1A0KA 3A0VA 2XROA 2HP6A 3Q1FA 4LRYC 4WM9A 4Z1WA 3ZVWA 3VSKA 3IX4A 3OC2A 1VETB 2C5WB 4KUOA 4WELA 3ZQ5A 2FZ0A 3HVFA 2V8FA 3D72A 3M2KA 4BD1A 3H82B 4S2LA 3IX3A 4GHIA 1ES2A 4XT2B 3HLEA 1K54C 4CLCC 4Q0HA 4E3IA 1OT9A 3MFXA 5HW3A 3FPVA 1OTEA 2Y2QA 3B33A 3A3DA 2O9CA 2O9BA 2Y2KA 4JXSA 3KSIA 4Y0UA 4IVKA 3MSHA 3EWKA 2A24A 4KZ3A 3I7JA 3T4SA 2ZC7A 5DTSA 3F1OA 2XD5A 3LR4A 3W8KA 3KSFA 3IWIA 3CITA 2HP9A 5EPHA 2RL3A 3K3CA 4R4RA 3B47A 2K31A 4HESA 5KSCA 1EROA 4EBPA 3TG9A 2W1TA 1ZTUA 5AVFA 4QB8A 2O99A 3Q7ZA 4BL2A 1DJCA 4HIAA 5FQIA 1G28A 3EQVA 3IH9A 3C38A 1EI5A 1JWVA 2VGJA 3NDGA 1S1YA 3A3JA 1BLHA 4G3KA 4QHCA 4E3NA 4YWZA 2WKEA 3CHWP 1VEUB 4CQHA 1IFQA 1U60A 1K55C 4FCFA 2GZAA 2ZC5B 4JF6A 1YSPA 5HAQA 4OLGA 1YLJA 2ZL1A 4S2IA 4UEYA 1PFLA 2HDSA 2Y8HA 1ZHHB 3LUQA 3UE0A 4GLQA 3ZDJA 3NI9A 5FSRA 1ESIA 1Q2QA 5E2FA 1GSVA 4I39A 4PM8A 4QJGA 1OTIA 4LCMA 4QY6A 1IYQA 4OH0A 4UA9A 3CUEC 1KDSA 3BQ8A 1PI5A 2Y4AA 3JVUA 5A91A 2EWVA 3DTMA 4ZAMA 2K2NA 4JGPA 2VV8A 1MWUA 2KDKA 2BTFP 3G31A 2FFFB 4C75A 5GLCA 1K57C 4LRXC 4O8GA 4MDZA 4HJ6A 2XK1A 2PBYA 2WGIA 5CGXA 4HEFA 3UDIA 1FR1A 4WYYA 4JXWA 4DDSA 1BTLA 2HDRA 2R9WA 4E3OA 1GHPA 4NXBA 1LL9A 3MJQA 1NRFA 3MZDA 3QP2A 2J8YA 3MXSA 3LEZA 3C2WA 3MXRA 2ZLYA 3UO9A 2X01A 3LCEA 3HLWA 1F9IA 3ZG9B 4BD0A 1N9BA 4U0XA 4HH2A 4NG2A 3VFFA 5EFWA 4GCZA 2H0TA 3GTCA 4Y13A 2ZM0A 3U2AA 1PW1A 4MN6A 5FEFA 3F1NB 1OJ5A 3QHYA 4KQOA 4WEJA 3O88A 3DWZA 1KGGA 3HUOA 1MWSA 1LSVA 4L9GA 3IS2A 4HHDA 3L9KA 4IVIA 5GHZA 3CZDA 3LIFA 1PWGA 3M6BA 3VP4A 5IU1A 3OPLA 4R0QA 3WRZA 3FPWA 4PKYG 2HDQA 5D3OA 2VGLS 1SCWA 3SZTA 5F68A 5HARA 3ZNTA 4X69A 3HLBA 3O86A 5E2EA 3SW1A 1S4SA 3IXBA 5J7EA 5DTKA 1P9RA 1PWDA 4ESPA 4QD4A 2H10A 3LR3A 2VV6A 3E98A 2HP5A 5G18A 4EQIA 5L09A 1NYMA 2KLIA 4O7DA 2XGNA 3LO7A 4BWIA 1ES3A 3FC7A 2OAP1 1BSGA 5HDCA 1H3QA 3O3VA 3HL9A 5CHUA 2PRFA 4B9OA 4EBNA 5DJTA 1JVJA 3BLMA 2J9OA 1YMSA 3DW0A 5EUAA 3D9YA 2HZ5A 2ZQDA 3G2YA 1YKDA 4I3JA 2Y59A 5E2HA 3S7NA 1YSQA 5EOEA 3KX0X 3MBZA 1UWPX 5HWTA 1JNUA 4GNUA 1IEMA 3T4TA 3LY4A 1RP5A 3VV4A 5EM1A 3ZNYA 3M2JA 1YLTA 4IUHA 4JF5A 1ONHA 4I3AA 3VE4A 1L3LA 3LICA 2OOLA 1ALQA 4KENB 1MWRA 3PR6A 1PI4A 4FH4A 1FCOA 1ZKJA 3PBSA 3KYZA 2FH5A 4NK3A 2E8IA 4IBRA 2XSSA 1BT5A 3H7WA 2PT7A 2VJWA 4IJGA 4EUZA 1N9OA 3CI6A 4DXBA 1BUEA 3B3XA 5I94A 3BEBA 2P08A 5HX9A 1X0OA 2Y2OA 5J8XA 4QU3A 3C7UA 1TEMA 1N9NA 2E8JA 2JHEA 4F3LB 3IT9A 5FI2A 2YKFA 4L9EA 4X53A 4MEZA 3A3EA 1DJAA 3Q07A 4Y17A 1MBLA 3Q7VB 3V67A 3T1SA 2KX6A 1W5DA 3MZEA 5E2GA 2Y79A 4BLMA 3PAEA 1JTDA 1L0GA 1XA7A 1IKIA 1E3UA 1YMXA 4NXEA 5TR7A 2XF3A 2DNSA 4WF0A 1ESUA 2WUQA 5CTNA 2J3TD 2QPNA 4MCWA 5HL6A 5HD3A 2VLGA 3S1YA 1K38A 3ZYTA 1XGIA 5EM0A 5L2FA 4CJNA 3KYQA 1CF0A 5C5KA 3JPUA 2PD8A 3V5MA 4PM5A 2HJEA 2QJ5A 3MQ0A 1S0WA 1MXOA 3C30A 4GZBA 1XX2A 3OPHA 4U0TA 4FUWA 1WE4A 2V0UA 2VZWA 2WK0A 2G7UA 1QMFA 3ZFZA 1OMEA 1SDNA 4P0MA 1H8YA 3SS3A 1LI9A 4FTXA 1K25A 4R4SA 4WLAA 4KUKA 2A2LA 2Q9NA 5CHJA 5GLDA 1H5XA 1Y28A 2HV1A 4S2KA 3UPPA 5FASA 1T1AA 1GA0A 1FCMA 5HWWA 4C3QA 4Q0JA 2NUTC 4OPZA 4F94A 2H28A 2Y2HA 5EVIA 1SHVA 3R4KA 2P9VB 2JE5A 4WUJA 4M4XA 1YT4A 1VM1A 4BENA 1OTAA 1LHYA 1BYWA 1K0KA 4FOFA 1S67L 4OOMA 3OPPA 1IYOA 5IS1A 4G3VA 3E4OA 3WWXA 4RX2A 4QWOA 4ETXA 2HGVA 3ZHHA 5TBMA 5CEBA 2PR6A 5U47A 4EERA 1I2SA 3OBFA 1PWCA 1NZOA 1PRQA 5HL1A 4JKTA 4OQIA 4E3KA 2V20A 4OQHA 2WGWA 3MF0A 2VGLM 2W3FA 3RTYA 2VEAA 5AJGA 2MJ6A 4Y0TA 3ITBA 1E3UD 2OV5A 2HJ9C 3HLGA 4GHIB 3PTEA 3GR2A 2EX8A 4K08A 3TE8A 1E25A 2WKRA 4LV2A 3E4PA 4NEED 2W3GA 2XH9A 3CG5A 1ERQA 2VKSA 2XA7S 3IXGA 2A24B 3N8LA 5A8BA 4I5SA 5TGFA 3F1OB 4E3JA 3LI9A 3BFFA 3EGDC 1LI0A 4YFMA 3KSGA 3PBTA 2J80A 3N4IA 4P6ZM 3E0YA 5DKLA 4X1LA 1MZUA 3VP1A 2XFSA 2IWCA 5F82A 3HJKA 4BBUA 4KZ6A 3WS4A 3G35A 1HVBA 3MS6A 1XJ4A 4FSFA 4DE3A 2EX9A 2JCHA 2W1TB 4UHUA 4EW7A 2OWJA 3TSGA 1FQGA 5M18A 3BJNA 1TS6A 1NLZA 3EGXC 4BBTA 1ZG6A 2V8CA 3UMDA 4K0WA 3UPNA 2ZMAA 3P7NA 2JN7A 4IEDA 5EVID 3PBNA 3WS2A 4CPKA 4LV3A 1PYYA 2EFXA 1TS0A 3PAGA 3V3SA 1NJ4A 2XLNA 4YINA 3IF6A 3DBAA 3OOVA 1KOUA 3T12B 2ZL1B 3NDEA 4DRTA 3VOZA 3N8RA 2HDUA 4GDBA 2L1MA 4R70A 3T1QB 2J3WA 1L0FA 1K6RA 3W4QA 2QHKA 2W27A 1BLPA 4WMCA 3P98A 3CPTA 3MKFA 4KZ8A 5JYOA 4KG6A 2X71A 3RH8B 2EX6A 1XJ2A 1MKIA 4G3WA 5GLAA 3E2LA 5A92A 2Y55A 1LSXA 3PYPA 1YLPA 2D01A 4DE1A 4EESA 2L4RA 4HH3A 4E6WA 2HPBA 4HBUA 2LB5A 1W79A 4OP8A 3NIAA 4PPRA 1TF1A 3NJAA 4ETZA 1PW8A 3L7HA 3ULFA 4DE0A 3RFBA 3E2KA 2P74A 1K4FA 1DJBA 4JXGA 4EQ1A 5IT5A 1TDLA 1N4OA 3EQUA 3QP6A 3S4XA 5GLBA 4GS9B 3C7VA 4GS9A 1N9LA 1P0ZA 4KZ7A 3QP5A 2M1CA 3BY9A 3C4PA 2EFUA 4Y7PA 4BBVA 2V1BA 3A0RA 2P04A 5DVAA 4DN0A 2A49A 4S2NC 2XRNA 2ZQAA 3BFEA 3UPOA 1CI9A 4PMAA 3MZFA 2ZC3B 2DCFA 4GD6A 4ZBEA 5G4ZA 1KE0A 4BL3A 3PHYA 1STZA 3D3OA 3O87A 1G6AA 1KVLA 1FIKA 3NULA 4WN5A 3IS2B 5A93A 4LCLA 2ZOHA 2Y2PA 2VGKA 3S7QA 5CGWA 3DTEA 4E6XA 4WZ5A 1ZC2A 4R1GA 4DMZA 1T19A 3VOLA 3NOTC 3SOIA 5GHXA 2O0YA 4OQGA 4JF4A 1SKOA 2ZJ9A 5HAIA 1EWZA 5GL9A 3NOUC
chains in the Genus database with same CATH topology
2V1AA 3CAXA 4YNRA 2XSSA 3H7WA 3LR0A 2PT7A 4UQIS 3MR0A 4BJPA 3P01A 2VJWA 1YAXA 4IJGA 1N9OA 3CI6A 2DMWA 3A0SA 4JGRA 1TD5A 1V9ZA 2P08A 1X0OA 3C8CA 3MQOA 1N9NA 2W3DA 4UQIM 4OOLA 2EA9A 2JHEA 4F3LB 2VA0A 4NXGA 2JKTM 4PAUA 4PHTA 2R78A 1S1ZA 2ZMVA 2W1RA 2J3TC 1NLYA 2YKFA 4L9EA 3A0VA 2XROA 4LRYC 1UGUA 4Z1WA 3LI8A 3CWFA 3W2ZA 3OC2A 4KUOA 4WELA 3ZQ5A 4ZRRA 1W63Q 3V67A 4PKYA 2KX6A 3BW6A 1DRMA 2FZ0A 4IHQA 3D72A 2GX5A 3H82B 2Y79A 4EEPA 2CMNA 4GHIA 1GSWA 4XT2B 4NXEA 4CLCC 4Q0HA 3PXPA 1OT9A 3MFXA 3FPVA 1OTEA 4WF0A 3B33A 2O9CA 2J3TD 2O9BA 3OLOA 4H6JA 4MCWA 5HL6A 5HD3A 1NRJA 2VLGA 3KSIA 3S7OA 3EWKA 3ZYTA 2A24A 3UB6A 3IBJA 3T4SA 1DP9A 4DJ2A 3F1OA 3KYQA 3HCYA 5C5KA 3LR4A 4B93A 3O5YA 3KSFA 2PD8A 2HJEA 2QJ5A 3UB7A 3CITA 3MQ0A 2PHYA 2LB9A 2Z6CA 3K3CA 3B47A 3C30A 4CLCB 4CLCA 4Q0IA 5KSHA 2K31A 2V0UA 2VZWA 2G7UA 1OPXA 1NWZA 1V9YA 2W1TA 1ZTUA 5AVFA 4WLAA 3TW8A 4KUKA 2O99A 1XJ6A 2A2LA 1P97A 4II7A 2PDRA 4HIAA 2VV7A 1G28A 2OAQ1 3MXQA 5HPIA 5F6AA 3EQVA 3C38A 3ICYA 2HV1A 1Y28A 1LSWA 3F1NA 1T1AA 4WEKA 1S1YA 4KQDA 3LFVA 4G3KA 5HWWA 3NHQA 3H7WB 1DP8A 4Q0JA 2NUTC 1S4RA 5J3WA 4LPZA 4YWZA 3LIBA 3S7PA 4I38A 2PR5A 3CLOA 2H28A 3HJIA 4R6LA 2JKTI 2PYRA 4CQHA 5HPFA 3R4KA 4QPRA 1IFQA 5HWVA 4WUJA 4ME4A 4M4XA 5MC7A 4HI4A 1OTAA 2GZAA 1BYWA 4RQ9A 1YSPA 4FOFA 1S67L 4OOMA 5HDSA 5HSQA 4UEYA 2Y8HA 1ZHHB 2ZMFA 3LUQA 4G3VA 4GLQA 5IS1A 3E4OA 3NOPC 4GJ4A 2W3EA 2HGVA 4ETXA 1GSVA 4WL9A 5TBMA 3T50A 3UB9A 2PR6A 4EERA 3OBFA 4I39A 1D06A 1OTIA 4HOIA 3CUEC 2V0WA 3BQ8A 3JVUA 2GJ3A 3LIDA 4JGQA 2EWVA 1IOUA 2K2NA 3MF0A 2W0NA 2JKRM 2VV8A 4JGPA 2VGLM 1F5MA 2W3FA 2KDKA 4CLCE 3RTYA 2VEAA 5AJGA 4YOFA 4LRXC 4O8GA 1T18A 2MJ6A 4R3AA 2HJ9C 4DJ3A 4GHIB 2O9AA 4MDZA 5DKKA 4O01A 4HJ6A 4JGOA 4HP4A 4EXOA 4K08A 5KIZA 4LLOB 5F5YA 3TE8A 3UE3A 1T1BA 3EOIA 2I9VA 2WKRA 4P6ZS 4H6JB 3E4PA 1OTDA 2W3GA 3BY8A 4NEED 2VKSA 3CUEA 2XA7S 2Z6DA 4HJ3A 4HJ4A 2A24B 5A8BA 4I5SA 1UWNX 3T4KA 3F1OB 3UB8A 3G6OA 3LI9A 4NXFA 3EGDC 4HY8A 1H8MA 4NXBA 3MJQA 3KSGA 4LRZE 2P7JA 3PBTA 2J80A 4P6ZM 3C2WA 3E0YA 5DKLA 4CLCD 1MZUA 4BMWA 2XA7M 4EUVA 3HJKA 4BBUA 1F9IA 2B02A 2IA2A 4R38A 2QYBA 5CX7A 1XJ4A 4FSFA 3PBOA 2PYPA 4Y5FA 3LR5A 5AVEA 4HH2A 3UMEA 2W1TB 5F69A 5EFWA 4HP9A 4GCZA 5DFYA 2M7VA 4EW7A 2V9AA 2OWJA 1XFQA 2INWA 1GSXA 4MN5A 3B42A 3U2AA 3LIAA 3IBRA 3BJNA 4MN6A 3R7WA 1TS6A 2OWHA 3TRCA 3F1NB 1NLZA 1OJ5A 3BQAA 3EGXC 4BBTA 4KQOA 4WEJA 4HNBA 3GDIA 3OCNA 1VB6A 2WKQA 3PBRA 3UMDA 1LSVA 4L9GA 2W3HA 3IS2A 2WKPA 3K2NA 2JN7A 3P7NA 4HHDA 4Y2FA 2QWSA 2PD7A 1WA9A 3PBNA 5G4YA 3T4OA 3LIFA 2M7UA 5FL3A 1TS0A 1MKMA 4HQAA 5LBRA 5IU1A 1TS7A 2KOIA 5HZHA 4IUKA 3T4JA 4AFIA 1ODVA 3FPWA 1VHMA 4MN7A 1T1CA 3DBAA 3OOVA 4PKYG 1KOUA 5DFXA 2QKPA 4Y3IA 5DJUA 2VGLS 2JKRI 2QJ7A 4R70A 2L1MA 1W63M 3F1PB 3F1PA 5TBMB 5F68A 2J3WA 2QHKA 2ZOIA 3JVVA 2VX8A 2W27A 2GNXA 4L0LA 1LL8A 1OT6A 3SW1A 3VE3A 5HD5A 1OTBA 1S4SA 3T4QA 1XJ3A 3KO6A 3RH8B 1XJ2A 2BASA 5J7EA 4G3WA 4F3LA 1S66L 1P9RA 3BWLA 3H9WA 5TJJA 1OJGA 2K7SA 1LSXA 3PYPA 5I5LA 2D01A 3LR3A 2VV6A 3E98A 4EESA 2L4RA 4HH3A 2KLIA 1MC0A 2LB5A 4EETB 5HDDA 2HF6A 1TF1A 4BWIA 5DF9A 3NJAA 4ETZA 3ULFA 1TS8A 3H82A 3RFBA 3FC7A 2OAP1 2EWWA 3MQQA 5HDCA 1H3QA 2B18A 1EW0A 4XT2A 4B9OA 4MMNA 3PBQA 5DJTA 4EQ1A 5IT5A 3EQUA 3LIEA 3GECA 2ZBBA 4I3IA 1D7EA 4GS9B 4GS9A 4O0PA 4EU0A 1N9LA 5K5BA 1P0ZA 5J4EA 2M1CA 3BY9A 4L9FA 1YKDA 4I3JA 4BBVA 2V1BA 1F98A 2P04A 3A0RA 3S7NA 3TJZC 1P9WA 2NUPC 4DN0A 2XRNA 3LYXA 1YSQA 1DP6A 3T4LA 3KX0X 3E4QA 4EEUA 5G4ZA 3EEHA 3K3DA 1UWPX 2D02A 5HWTA 1JNUA 3R7WB 4ARZB 4ARZA 3PHYA 1STZA 3T4TA 1XFNA 3D3OA 3VV4A 1LT0A 3FG8A 4NKPA 3MMHA 4IUHA 4WN5A 4I3AA 4GW9A 3IS2B 2ZOHA 3VE4A 3LICA 3S7QA 3KSHA 3OCLA 3UE6A 2L0WA 4DMZA 2OOLA 1T19A 1G6OA 3EEAA 3PR6A 2YKHA 5L8MA 3VOLA 3NOTC 4E04A 2O0YA 3PBSA 3KYZA 2FH5A 3NOUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A2L A;  4CLC A;  5CX7 A;  4CLC C;  3FPW A;  4CLC E;  4CLC D;  4NKP A;  4CLC B;  4BMW A;  3FPV A; 
#chains in the Genus database with same CATH topology
 2V1A A;  4WZ4 A;  2B5R A;  4BJP A;  3N7W A;  3UN7 A;  1YAX A;  1SZV A;  4KZ5 A;  4K91 A;  4X55 A;  3BEC A;  1IYS A;  4OPQ A;  3A0S A;  4WMC D;  4JGR A;  4UAA A;  4XUX A;  1KGE A;  2WZX A;  4FD8 A;  4U3T A;  2W3D A;  1SKF A;  4UQI M;  4MBK A;  4OOL A;  3BFG A;  1PIO A;  2JKT M;  4PAU A;  4PHT A;  4QY5 A;  2W1R A;  1NLY A;  2PAV P;  5AQB A;  3WS0 A;  1UGU A;  2OSU A;  3CWF A;  4LV0 A;  4ZRR A;  1W63 Q;  3BW6 A;  1DRM A;  2GX5 A;  1K55 A;  3FKV A;  4LEN A;  4MBH A;  1GSW A;  4S2P A;  3PXP A;  3SH7 A;  1ERM A;  2BG1 A;  4BQM A;  4LV1 A;  5FQQ A;  3OLO A;  2VK3 A;  4H6J A;  3BYD A;  4ZTK A;  1JWP A;  3G30 A;  5A90 A;  1M6K A;  3UB6 A;  3DTI A;  1ONG A;  2Q0O A;  3DTK A;  4H8R A;  3AGD A;  4MLL A;  1K56 A;  4P6B A;  2PHY A;  2Z6C A;  4NET A;  4P85 A;  4ZJ1 A;  1YLW A;  5KSH A;  1PNE A;  4MBF A;  4M3K A;  5HFO A;  1NWZ A;  5EVI C;  1V9Y A;  1L0D A;  5FAT A;  4DXC A;  4X25 A;  2GDN A;  4P87 A;  1XJ6 A;  5FAO A;  1FOF A;  2OAQ 1;  1BUL A;  5F6A A;  2J9P A;  2Y2L A;  3NC8 A;  3ICY A;  4N1H A;  3UDX A;  4E3L A;  4Y15 A;  1LSW A;  2Y2M A;  3FKW A;  4WEK A;  4KQD A;  3LFV A;  4GDN A;  5FAQ A;  3KYE A;  3NHQ A;  3H7W B;  1DP8 A;  2XR0 A;  1S4R A;  3GVB A;  3LIB A;  4I38 A;  2WZZ A;  3CLO A;  4R6L A;  2JKT I;  2PYR A;  3UDF A;  1D1J A;  4QPR A;  2Y2I A;  4ME4 A;  3IH8 A;  5E43 A;  5DF8 A;  3QNB A;  2XEP A;  4JPM A;  5HSQ A;  3NOP C;  4ZDX A;  2W3E A;  3WRT A;  4WL9 A;  3T50 A;  1D06 A;  4HOI A;  1CQA A;  2V0W A;  3C5A A;  1K4E A;  2GJ3 A;  3LID A;  4JGQ A;  1H0M A;  5CRF A;  3VMA A;  3UB5 P;  3A3I A;  4B88 A;  4N9K A;  4R3A A;  3S22 A;  5M1A A;  4R23 A;  4DJ3 A;  1IYP A;  4Z9Q A;  4O01 A;  4HP4 A;  1LL5 A;  4LLO B;  5F5Y A;  1FIL A;  1MY8 A;  3UE3 A;  1T1B A;  1HTZ A;  3EOI A;  2I9V A;  3AGE A;  3NY4 A;  5EVL A;  2JBF A;  4OVD A;  2Z6D A;  4X56 A;  3W4O A;  3HUM A;  3T4K A;  4GKU A;  1K56 D;  1I2W A;  3G6O A;  4HY8 A;  3G32 A;  4R3J A;  4EBL A;  1GHM A;  2EXA A;  1WYB A;  1ES4 A;  3VOY A;  4BMW A;  4EV4 A;  4ZJ3 A;  2G2W A;  3FZC A;  2B02 A;  5CX7 A;  2H0Y A;  2PYP A;  4Y5F A;  3LR5 A;  3UME A;  4Y0O A;  5FQM A;  4OQ0 A;  5DFY A;  4E3M A;  2V9A A;  1E4D A;  1XFQ A;  2INW A;  1GSX A;  4MN5 A;  3B42 A;  3IBR A;  5FQJ A;  3R7W A;  2OWH A;  3ZG0 A;  3TRC A;  2ZQC A;  4OP5 A;  1MPL A;  3GDI A;  3OCN A;  3PBR A;  2W3H A;  4D2O A;  2IWD A;  5EVI B;  3T4O A;  1XP4 A;  5FL3 A;  1MKM A;  4HQA A;  4KZ9 A;  5AQ9 A;  5LBR A;  2KOI A;  5HZH A;  4IUK A;  3T4J A;  4AFI A;  1ODV A;  4ZJ2 A;  1T1C A;  2B95 A;  4Y3I A;  3F1P B;  3F1P A;  2Z2M B;  5TBM B;  2ZQ8 A;  2V1Z A;  1W8Q A;  1GHI A;  4KG2 A;  3JVV A;  5FA7 A;  1K6S A;  1QME A;  4L0L A;  1LL8 A;  1OT6 A;  4OON A;  5HD5 A;  1OTB A;  2WGW B;  3T4Q A;  1XJ3 A;  2BAS A;  1S66 L;  3BWL A;  3H9W A;  5TJJ A;  5AQA A;  5BOH A;  1OJG A;  5F83 A;  5I5L A;  1VQQ A;  2Y2J A;  3RXW A;  1NY0 A;  5AQ7 A;  2WAE A;  4DE2 A;  1MC0 A;  2DRW A;  4XUZ A;  1VET A;  4PM7 A;  3FV7 A;  5CTM A;  4EET B;  2WKH A;  4JLF A;  5DF9 A;  5TFQ A;  1M40 A;  3H82 A;  4N1X A;  3RXX A;  4DDY A;  3MQQ A;  4N9L A;  3ZCZ A;  1S6R A;  1EW0 A;  4XT2 A;  3Q81 A;  4MMN A;  2QMI A;  3PBQ A;  4S2J A;  1LLB A;  1XKZ A;  1BZA A;  3GEC A;  4RVA A;  1GCE A;  1NZU A;  1YLY A;  1D7E A;  4O0P A;  5J4E A;  1FR6 A;  4PM9 A;  3HLC A;  1F98 A;  2PBD P;  4WZ5 C;  2NUP C;  1KVM A;  5EVE A;  3LEQ A;  4JBF A;  4R3B A;  4KZB A;  1DP6 A;  2PU2 A;  1SDE A;  3W4P A;  3DAV A;  3K3D A;  3G2Z A;  4ARZ B;  4ARZ A;  1XFN A;  5L10 A;  1LT0 A;  1IEL A;  3FG8 A;  3ITA A;  1TVF A;  3MMH A;  4NKP A;  2X02 A;  3OCL A;  3UE6 A;  2L0W A;  1L2S A;  2A3U A;  1Q2P A;  3EEA A;  2YKH A;  5L8M A;  1AXB A;  1JTG A;  5CHM A;  1RGZ A;  2XQZ A;  4GD8 A;  3IF6 B;  3BRM A;  3CAX A;  4YNR A;  2CC1 A;  1AWI A;  3LR0 A;  3ZG8 B;  3P01 A;  1CEF A;  3V3R A;  3VSL A;  2DMW A;  1VEU A;  3OPR A;  2ZD8 A;  4S2O A;  1V9Z A;  4N92 A;  4OPY A;  2BLS A;  4XXR A;  3CPT B;  4DF6 A;  3WS5 A;  4MNR A;  4OOY A;  1TDG A;  5FDH A;  2EA9 A;  3AGF A;  5FQ9 A;  3ZG7 B;  5F1F A;  2VA0 A;  3BM6 A;  4NXG A;  4S2M A;  1S1Z A;  2ZMV A;  2ZC4 B;  4KQQ A;  2J3T C;  4RA7 A;  3IX8 A;  3LI8 A;  3GQZ A;  3W2Z A;  1KDW A;  1ZG4 A;  1DY6 A;  3HLF A;  2JKF A;  4PKY A;  4IHQ A;  4EWF A;  2J7V A;  1JWZ A;  5DF7 A;  4EEP A;  2CMN A;  1L0E A;  5FDS A;  3IF5 A;  1FCN A;  3IHA A;  3NEC A;  3CJM A;  4HBT A;  1NRJ A;  3S7O A;  3VP3 A;  2G2U A;  1WYC A;  3IBJ A;  5CEC A;  1DP9 A;  4DJ2 A;  2WGV A;  3HCY A;  5CER A;  4B93 A;  3IHB A;  3O5Y A;  3UB7 A;  2LB9 A;  3ZG5 A;  4WBG A;  4CLC B;  1K54 A;  2OLV A;  4CLC A;  4Q0I A;  4IBX A;  3FYZ A;  3JYI A;  1OPX A;  1CK3 A;  4UA6 A;  1F2K A;  3DWK A;  3NCK A;  3G4P A;  4B4Z A;  5CXW A;  4LFU A;  3TW8 A;  5EOO A;  2ZQ7 A;  4JXV A;  4D60 A;  1P97 A;  4II7 A;  2PDR A;  3GMW A;  2VV7 A;  3MXQ A;  5HPI A;  1XXM A;  2EXB A;  4KQR A;  1YPR A;  3GV9 A;  5FAP A;  1C3B A;  1SKO B;  4X6T A;  3F1N A;  3GRJ A;  3D4F A;  3HRE A;  3VFH A;  1J9M A;  5EE8 A;  3QP8 A;  3V39 A;  5J3W A;  4LPZ A;  2EX2 A;  4GB7 A;  3S7P A;  2PR5 A;  3HJI A;  5HPF A;  3FWL A;  5HWV A;  5MC7 A;  4B4X A;  4HI4 A;  4RQ9 A;  3VP0 A;  5HDS A;  2ZMF A;  4GJ4 A;  2OLU A;  2ZQ9 A;  3UB9 A;  1H8Z A;  4GN2 A;  2ZM8 A;  1Z6F A;  3C4O A;  1CI8 A;  3GSG A;  1O7E A;  4K0X A;  1IOU A;  2W0N A;  2JKR M;  5DTT A;  5EV0 A;  1F5M A;  1HLU P;  4CLC E;  2Z2L B;  2I72 A;  4YOF A;  3HBR A;  1T18 A;  3ISG A;  3BFC A;  1GA9 A;  2O9A A;  2UWX A;  5DKK A;  4JGO A;  4EXO A;  4A5R A;  5KIZ A;  5KMW A;  3SS5 A;  4P6Z S;  4H6J B;  5JYP A;  1OTD A;  3BY8 A;  3G34 A;  1ES5 A;  3BFD A;  3CUE A;  1XPB A;  4HJ3 A;  4HJ4 A;  1UWN X;  2V2F F;  3UB8 A;  4NXF A;  3V50 A;  1H8M A;  1K57 A;  4LRZ E;  2P7J A;  3U4L P;  1Y4O A;  4CLC D;  5FQK A;  1NXY A;  2FFY A;  2XA7 M;  3CMZ A;  1ACF A;  4EUV A;  2JC7 A;  2IA2 A;  4R38 A;  2QYB A;  3PBO A;  5AVE A;  3HUN A;  5F69 A;  4HP9 A;  2M7V A;  1MWT A;  2Y2G A;  1YQS A;  3LIA A;  4OKP A;  2WAD A;  2ZC6 B;  3NBL A;  2R9X A;  2JKG A;  3IQA A;  3IWQ A;  3SH8 A;  3BQA A;  2PU4 A;  3N8S A;  1KE4 A;  3WS1 A;  4HNB A;  2XFT A;  1VB6 A;  1YM1 A;  2WKQ A;  4GOG A;  3K2N A;  2WKP A;  4Y2F A;  4PM6 A;  2QWS A;  2PD7 A;  1WA9 A;  5G4Y A;  5F1G A;  2M7U A;  2Y2N A;  4S2N A;  3ZVT A;  4RYE A;  1TS7 A;  4KG5 A;  5GHY A;  1VHM A;  4MN7 A;  5DFX A;  2QKP A;  3SH9 A;  3A3F A;  5DJU A;  2JKR I;  2H5S A;  2QJ7 A;  5CGS A;  2ACG A;  1W63 M;  3HLD A;  3IXH A;  3QP4 A;  1G5U A;  3T1X A;  5FI7 A;  4DKI A;  2ZOI A;  2VX8 A;  2GNX A;  1RCJ A;  1CJF A;  5EEC A;  3VE3 A;  1G68 A;  1HZO A;  3KO6 A;  3QP1 A;  1W7F A;  3T1R A;  2C6W B;  2ZM2 A;  4F3L A;  5L07 A;  2K7S A;  1YLZ A;  2IWB A;  3P09 A;  2WKI A;  3Q7V A;  5HDD A;  2HF6 A;  1RGY A;  1PZP A;  1TS8 A;  2RCX A;  4KZ4 A;  2EWW A;  2B18 A;  1BLS A;  3MFD A;  3LIE A;  2ZBB A;  4I3I A;  4KZA A;  4EU0 A;  5K5B A;  4L9F A;  1KE3 A;  5HAP A;  3RJU A;  3TJZ C;  1P9W A;  3LYX A;  5IHV A;  1IKG A;  3UE1 A;  2WAF A;  3IF6 C;  3T4L A;  3UNW A;  4EEU A;  3E4Q A;  1CEG A;  3SS4 A;  3EEH A;  3IXD A;  4C6Y A;  4OLD A;  3QNC A;  2D02 A;  3R7W B;  1Z09 A;  1PZO A;  3UY6 A;  2XD1 A;  5M19 A;  3IWO A;  4GW9 A;  3MKE A;  3LY3 A;  1FSW A;  3KSH A;  3M6H A;  3VP2 A;  5CED A;  3Q82 A;  1G6O A;  5FI6 A;  4E04 A;  2AVX A;  1FSY A;  3LGO A;  4OPR A;  5FEG A;  3ZGA B;  4RX3 A;  4X68 A;  4UQI S;  3MR0 A;  2UV0 E;  3BLS A;  5KZH A;  1XGJ A;  2WYX A;  2P9V A;  1XA1 A;  1TD5 A;  4LGW A;  1KGF A;  1BLC A;  3N6I A;  2Q9M A;  3C8C A;  3MQO A;  4UA7 A;  3OZH A;  1Y54 A;  2XDM A;  3TOI A;  4ID4 A;  4Q8I A;  4FH2 A;  2QZ6 A;  1O07 A;  1W8Y A;  2Y91 A;  1I5Q A;  2R78 A;  1HD8 A;  4X1M A;  1J3W A;  1NYY A;  1A0K A;  3A0V A;  2XRO A;  2HP6 A;  3Q1F A;  4LRY C;  4WM9 A;  4Z1W A;  3ZVW A;  3VSK A;  3IX4 A;  3OC2 A;  1VET B;  2C5W B;  4KUO A;  4WEL A;  3ZQ5 A;  2FZ0 A;  3HVF A;  2V8F A;  3D72 A;  3M2K A;  4BD1 A;  3H82 B;  4S2L A;  3IX3 A;  4GHI A;  1ES2 A;  4XT2 B;  3HLE A;  1K54 C;  4CLC C;  4Q0H A;  4E3I A;  1OT9 A;  3MFX A;  5HW3 A;  3FPV A;  1OTE A;  2Y2Q A;  3B33 A;  3A3D A;  2O9C A;  2O9B A;  2Y2K A;  4JXS A;  3KSI A;  4Y0U A;  4IVK A;  3MSH A;  3EWK A;  2A24 A;  4KZ3 A;  3I7J A;  3T4S A;  2ZC7 A;  5DTS A;  3F1O A;  2XD5 A;  3LR4 A;  3W8K A;  3KSF A;  3IWI A;  3CIT A;  2HP9 A;  5EPH A;  2RL3 A;  3K3C A;  4R4R A;  3B47 A;  2K31 A;  4HES A;  5KSC A;  1ERO A;  4EBP A;  3TG9 A;  2W1T A;  1ZTU A;  5AVF A;  4QB8 A;  2O99 A;  3Q7Z A;  4BL2 A;  1DJC A;  4HIA A;  5FQI A;  1G28 A;  3EQV A;  3IH9 A;  3C38 A;  1EI5 A;  1JWV A;  2VGJ A;  3NDG A;  1S1Y A;  3A3J A;  1BLH A;  4G3K A;  4QHC A;  4E3N A;  4YWZ A;  2WKE A;  3CHW P;  1VEU B;  4CQH A;  1IFQ A;  1U60 A;  1K55 C;  4FCF A;  2GZA A;  2ZC5 B;  4JF6 A;  1YSP A;  5HAQ A;  4OLG A;  1YLJ A;  2ZL1 A;  4S2I A;  4UEY A;  1PFL A;  2HDS A;  2Y8H A;  1ZHH B;  3LUQ A;  3UE0 A;  4GLQ A;  3ZDJ A;  3NI9 A;  5FSR A;  1ESI A;  1Q2Q A;  5E2F A;  1GSV A;  4I39 A;  4PM8 A;  4QJG A;  1OTI A;  4LCM A;  4QY6 A;  1IYQ A;  4OH0 A;  4UA9 A;  3CUE C;  1KDS A;  3BQ8 A;  1PI5 A;  2Y4A A;  3JVU A;  5A91 A;  2EWV A;  3DTM A;  4ZAM A;  2K2N A;  4JGP A;  2VV8 A;  1MWU A;  2KDK A;  2BTF P;  3G31 A;  2FFF B;  4C75 A;  5GLC A;  1K57 C;  4LRX C;  4O8G A;  4MDZ A;  4HJ6 A;  2XK1 A;  2PBY A;  2WGI A;  5CGX A;  4HEF A;  3UDI A;  1FR1 A;  4WYY A;  4JXW A;  4DDS A;  1BTL A;  2HDR A;  2R9W A;  4E3O A;  1GHP A;  4NXB A;  1LL9 A;  3MJQ A;  1NRF A;  3MZD A;  3QP2 A;  2J8Y A;  3MXS A;  3LEZ A;  3C2W A;  3MXR A;  2ZLY A;  3UO9 A;  2X01 A;  3LCE A;  3HLW A;  1F9I A;  3ZG9 B;  4BD0 A;  1N9B A;  4U0X A;  4HH2 A;  4NG2 A;  3VFF A;  5EFW A;  4GCZ A;  2H0T A;  3GTC A;  4Y13 A;  2ZM0 A;  3U2A A;  1PW1 A;  4MN6 A;  5FEF A;  3F1N B;  1OJ5 A;  3QHY A;  4KQO A;  4WEJ A;  3O88 A;  3DWZ A;  1KGG A;  3HUO A;  1MWS A;  1LSV A;  4L9G A;  3IS2 A;  4HHD A;  3L9K A;  4IVI A;  5GHZ A;  3CZD A;  3LIF A;  1PWG A;  3M6B A;  3VP4 A;  5IU1 A;  3OPL A;  4R0Q A;  3WRZ A;  3FPW A;  4PKY G;  2HDQ A;  5D3O A;  2VGL S;  1SCW A;  3SZT A;  5F68 A;  5HAR A;  3ZNT A;  4X69 A;  3HLB A;  3O86 A;  5E2E A;  3SW1 A;  1S4S A;  3IXB A;  5J7E A;  5DTK A;  1P9R A;  1PWD A;  4ESP A;  4QD4 A;  2H10 A;  3LR3 A;  2VV6 A;  3E98 A;  2HP5 A;  5G18 A;  4EQI A;  5L09 A;  1NYM A;  2KLI A;  4O7D A;  2XGN A;  3LO7 A;  4BWI A;  1ES3 A;  3FC7 A;  2OAP 1;  1BSG A;  5HDC A;  1H3Q A;  3O3V A;  3HL9 A;  5CHU A;  2PRF A;  4B9O A;  4EBN A;  5DJT A;  1JVJ A;  3BLM A;  2J9O A;  1YMS A;  3DW0 A;  5EUA A;  3D9Y A;  2HZ5 A;  2ZQD A;  3G2Y A;  1YKD A;  4I3J A;  2Y59 A;  5E2H A;  3S7N A;  1YSQ A;  5EOE A;  3KX0 X;  3MBZ A;  1UWP X;  5HWT A;  1JNU A;  4GNU A;  1IEM A;  3T4T A;  3LY4 A;  1RP5 A;  3VV4 A;  5EM1 A;  3ZNY A;  3M2J A;  1YLT A;  4IUH A;  4JF5 A;  1ONH A;  4I3A A;  3VE4 A;  1L3L A;  3LIC A;  2OOL A;  1ALQ A;  4KEN B;  1MWR A;  3PR6 A;  1PI4 A;  4FH4 A;  1FCO A;  1ZKJ A;  3PBS A;  3KYZ A;  2FH5 A;  4NK3 A;  2E8I A;  4IBR A;  2XSS A;  1BT5 A;  3H7W A;  2PT7 A;  2VJW A;  4IJG A;  4EUZ A;  1N9O A;  3CI6 A;  4DXB A;  1BUE A;  3B3X A;  5I94 A;  3BEB A;  2P08 A;  5HX9 A;  1X0O A;  2Y2O A;  5J8X A;  4QU3 A;  3C7U A;  1TEM A;  1N9N A;  2E8J A;  2JHE A;  4F3L B;  3IT9 A;  5FI2 A;  2YKF A;  4L9E A;  4X53 A;  4MEZ A;  3A3E A;  1DJA A;  3Q07 A;  4Y17 A;  1MBL A;  3Q7V B;  3V67 A;  3T1S A;  2KX6 A;  1W5D A;  3MZE A;  5E2G A;  2Y79 A;  4BLM A;  3PAE A;  1JTD A;  1L0G A;  1XA7 A;  1IKI A;  1E3U A;  1YMX A;  4NXE A;  5TR7 A;  2XF3 A;  2DNS A;  4WF0 A;  1ESU A;  2WUQ A;  5CTN A;  2J3T D;  2QPN A;  4MCW A;  5HL6 A;  5HD3 A;  2VLG A;  3S1Y A;  1K38 A;  3ZYT A;  1XGI A;  5EM0 A;  5L2F A;  4CJN A;  3KYQ A;  1CF0 A;  5C5K A;  3JPU A;  2PD8 A;  3V5M A;  4PM5 A;  2HJE A;  2QJ5 A;  3MQ0 A;  1S0W A;  1MXO A;  3C30 A;  4GZB A;  1XX2 A;  3OPH A;  4U0T A;  4FUW A;  1WE4 A;  2V0U A;  2VZW A;  2WK0 A;  2G7U A;  1QMF A;  3ZFZ A;  1OME A;  1SDN A;  4P0M A;  1H8Y A;  3SS3 A;  1LI9 A;  4FTX A;  1K25 A;  4R4S A;  4WLA A;  4KUK A;  2A2L A;  2Q9N A;  5CHJ A;  5GLD A;  1H5X A;  1Y28 A;  2HV1 A;  4S2K A;  3UPP A;  5FAS A;  1T1A A;  1GA0 A;  1FCM A;  5HWW A;  4C3Q A;  4Q0J A;  2NUT C;  4OPZ A;  4F94 A;  2H28 A;  2Y2H A;  5EVI A;  1SHV A;  3R4K A;  2P9V B;  2JE5 A;  4WUJ A;  4M4X A;  1YT4 A;  1VM1 A;  4BEN A;  1OTA A;  1LHY A;  1BYW A;  1K0K A;  4FOF A;  1S67 L;  4OOM A;  3OPP A;  1IYO A;  5IS1 A;  4G3V A;  3E4O A;  3WWX A;  4RX2 A;  4QWO A;  4ETX A;  2HGV A;  3ZHH A;  5TBM A;  5CEB A;  2PR6 A;  5U47 A;  4EER A;  1I2S A;  3OBF A;  1PWC A;  1NZO A;  1PRQ A;  5HL1 A;  4JKT A;  4OQI A;  4E3K A;  2V20 A;  4OQH A;  2WGW A;  3MF0 A;  2VGL M;  2W3F A;  3RTY A;  2VEA A;  5AJG A;  2MJ6 A;  4Y0T A;  3ITB A;  1E3U D;  2OV5 A;  2HJ9 C;  3HLG A;  4GHI B;  3PTE A;  3GR2 A;  2EX8 A;  4K08 A;  3TE8 A;  1E25 A;  2WKR A;  4LV2 A;  3E4P A;  4NEE D;  2W3G A;  2XH9 A;  3CG5 A;  1ERQ A;  2VKS A;  2XA7 S;  3IXG A;  2A24 B;  3N8L A;  5A8B A;  4I5S A;  5TGF A;  3F1O B;  4E3J A;  3LI9 A;  3BFF A;  3EGD C;  1LI0 A;  4YFM A;  3KSG A;  3PBT A;  2J80 A;  3N4I A;  4P6Z M;  3E0Y A;  5DKL A;  4X1L A;  1MZU A;  3VP1 A;  2XFS A;  2IWC A;  5F82 A;  3HJK A;  4BBU A;  4KZ6 A;  3WS4 A;  3G35 A;  1HVB A;  3MS6 A;  1XJ4 A;  4FSF A;  4DE3 A;  2EX9 A;  2JCH A;  2W1T B;  4UHU A;  4EW7 A;  2OWJ A;  3TSG A;  1FQG A;  5M18 A;  3BJN A;  1TS6 A;  1NLZ A;  3EGX C;  4BBT A;  1ZG6 A;  2V8C A;  3UMD A;  4K0W A;  3UPN A;  2ZMA A;  3P7N A;  2JN7 A;  4IED A;  5EVI D;  3PBN A;  3WS2 A;  4CPK A;  4LV3 A;  1PYY A;  2EFX A;  1TS0 A;  3PAG A;  3V3S A;  1NJ4 A;  2XLN A;  4YIN A;  3IF6 A;  3DBA A;  3OOV A;  1KOU A;  3T12 B;  2ZL1 B;  3NDE A;  4DRT A;  3VOZ A;  3N8R A;  2HDU A;  4GDB A;  2L1M A;  4R70 A;  3T1Q B;  2J3W A;  1L0F A;  1K6R A;  3W4Q A;  2QHK A;  2W27 A;  1BLP A;  4WMC A;  3P98 A;  3CPT A;  3MKF A;  4KZ8 A;  5JYO A;  4KG6 A;  2X71 A;  3RH8 B;  2EX6 A;  1XJ2 A;  1MKI A;  4G3W A;  5GLA A;  3E2L A;  5A92 A;  2Y55 A;  1LSX A;  3PYP A;  1YLP A;  2D01 A;  4DE1 A;  4EES A;  2L4R A;  4HH3 A;  4E6W A;  2HPB A;  4HBU A;  2LB5 A;  1W79 A;  4OP8 A;  3NIA A;  4PPR A;  1TF1 A;  3NJA A;  4ETZ A;  1PW8 A;  3L7H A;  3ULF A;  4DE0 A;  3RFB A;  3E2K A;  2P74 A;  1K4F A;  1DJB A;  4JXG A;  4EQ1 A;  5IT5 A;  1TDL A;  1N4O A;  3EQU A;  3QP6 A;  3S4X A;  5GLB A;  4GS9 B;  3C7V A;  4GS9 A;  1N9L A;  1P0Z A;  4KZ7 A;  3QP5 A;  2M1C A;  3BY9 A;  3C4P A;  2EFU A;  4Y7P A;  4BBV A;  2V1B A;  3A0R A;  2P04 A;  5DVA A;  4DN0 A;  2A49 A;  4S2N C;  2XRN A;  2ZQA A;  3BFE A;  3UPO A;  1CI9 A;  4PMA A;  3MZF A;  2ZC3 B;  2DCF A;  4GD6 A;  4ZBE A;  5G4Z A;  1KE0 A;  4BL3 A;  3PHY A;  1STZ A;  3D3O A;  3O87 A;  1G6A A;  1KVL A;  1FIK A;  3NUL A;  4WN5 A;  3IS2 B;  5A93 A;  4LCL A;  2ZOH A;  2Y2P A;  2VGK A;  3S7Q A;  5CGW A;  3DTE A;  4E6X A;  4WZ5 A;  1ZC2 A;  4R1G A;  4DMZ A;  1T19 A;  3VOL A;  3NOT C;  3SOI A;  5GHX A;  2O0Y A;  4OQG A;  4JF4 A;  1SKO A;  2ZJ9 A;  5HAI A;  1EWZ A;  5GL9 A;  3NOU C; 
#chains in the Genus database with same CATH homology
 2V1A A;  3CAX A;  4YNR A;  2XSS A;  3H7W A;  3LR0 A;  2PT7 A;  4UQI S;  3MR0 A;  4BJP A;  3P01 A;  2VJW A;  1YAX A;  4IJG A;  1N9O A;  3CI6 A;  2DMW A;  3A0S A;  4JGR A;  1TD5 A;  1V9Z A;  2P08 A;  1X0O A;  3C8C A;  3MQO A;  1N9N A;  2W3D A;  4UQI M;  4OOL A;  2EA9 A;  2JHE A;  4F3L B;  2VA0 A;  4NXG A;  2JKT M;  4PAU A;  4PHT A;  2R78 A;  1S1Z A;  2ZMV A;  2W1R A;  2J3T C;  1NLY A;  2YKF A;  4L9E A;  3A0V A;  2XRO A;  4LRY C;  1UGU A;  4Z1W A;  3LI8 A;  3CWF A;  3W2Z A;  3OC2 A;  4KUO A;  4WEL A;  3ZQ5 A;  4ZRR A;  1W63 Q;  3V67 A;  4PKY A;  2KX6 A;  3BW6 A;  1DRM A;  2FZ0 A;  4IHQ A;  3D72 A;  2GX5 A;  3H82 B;  2Y79 A;  4EEP A;  2CMN A;  4GHI A;  1GSW A;  4XT2 B;  4NXE A;  4CLC C;  4Q0H A;  3PXP A;  1OT9 A;  3MFX A;  3FPV A;  1OTE A;  4WF0 A;  3B33 A;  2O9C A;  2J3T D;  2O9B A;  3OLO A;  4H6J A;  4MCW A;  5HL6 A;  5HD3 A;  1NRJ A;  2VLG A;  3KSI A;  3S7O A;  3EWK A;  3ZYT A;  2A24 A;  3UB6 A;  3IBJ A;  3T4S A;  1DP9 A;  4DJ2 A;  3F1O A;  3KYQ A;  3HCY A;  5C5K A;  3LR4 A;  4B93 A;  3O5Y A;  3KSF A;  2PD8 A;  2HJE A;  2QJ5 A;  3UB7 A;  3CIT A;  3MQ0 A;  2PHY A;  2LB9 A;  2Z6C A;  3K3C A;  3B47 A;  3C30 A;  4CLC B;  4CLC A;  4Q0I A;  5KSH A;  2K31 A;  2V0U A;  2VZW A;  2G7U A;  1OPX A;  1NWZ A;  1V9Y A;  2W1T A;  1ZTU A;  5AVF A;  4WLA A;  3TW8 A;  4KUK A;  2O99 A;  1XJ6 A;  2A2L A;  1P97 A;  4II7 A;  2PDR A;  4HIA A;  2VV7 A;  1G28 A;  2OAQ 1;  3MXQ A;  5HPI A;  5F6A A;  3EQV A;  3C38 A;  3ICY A;  2HV1 A;  1Y28 A;  1LSW A;  3F1N A;  1T1A A;  4WEK A;  1S1Y A;  4KQD A;  3LFV A;  4G3K A;  5HWW A;  3NHQ A;  3H7W B;  1DP8 A;  4Q0J A;  2NUT C;  1S4R A;  5J3W A;  4LPZ A;  4YWZ A;  3LIB A;  3S7P A;  4I38 A;  2PR5 A;  3CLO A;  2H28 A;  3HJI A;  4R6L A;  2JKT I;  2PYR A;  4CQH A;  5HPF A;  3R4K A;  4QPR A;  1IFQ A;  5HWV A;  4WUJ A;  4ME4 A;  4M4X A;  5MC7 A;  4HI4 A;  1OTA A;  2GZA A;  1BYW A;  4RQ9 A;  1YSP A;  4FOF A;  1S67 L;  4OOM A;  5HDS A;  5HSQ A;  4UEY A;  2Y8H A;  1ZHH B;  2ZMF A;  3LUQ A;  4G3V A;  4GLQ A;  5IS1 A;  3E4O A;  3NOP C;  4GJ4 A;  2W3E A;  2HGV A;  4ETX A;  1GSV A;  4WL9 A;  5TBM A;  3T50 A;  3UB9 A;  2PR6 A;  4EER A;  3OBF A;  4I39 A;  1D06 A;  1OTI A;  4HOI A;  3CUE C;  2V0W A;  3BQ8 A;  3JVU A;  2GJ3 A;  3LID A;  4JGQ A;  2EWV A;  1IOU A;  2K2N A;  3MF0 A;  2W0N A;  2JKR M;  2VV8 A;  4JGP A;  2VGL M;  1F5M A;  2W3F A;  2KDK A;  4CLC E;  3RTY A;  2VEA A;  5AJG A;  4YOF A;  4LRX C;  4O8G A;  1T18 A;  2MJ6 A;  4R3A A;  2HJ9 C;  4DJ3 A;  4GHI B;  2O9A A;  4MDZ A;  5DKK A;  4O01 A;  4HJ6 A;  4JGO A;  4HP4 A;  4EXO A;  4K08 A;  5KIZ A;  4LLO B;  5F5Y A;  3TE8 A;  3UE3 A;  1T1B A;  3EOI A;  2I9V A;  2WKR A;  4P6Z S;  4H6J B;  3E4P A;  1OTD A;  2W3G A;  3BY8 A;  4NEE D;  2VKS A;  3CUE A;  2XA7 S;  2Z6D A;  4HJ3 A;  4HJ4 A;  2A24 B;  5A8B A;  4I5S A;  1UWN X;  3T4K A;  3F1O B;  3UB8 A;  3G6O A;  3LI9 A;  4NXF A;  3EGD C;  4HY8 A;  1H8M A;  4NXB A;  3MJQ A;  3KSG A;  4LRZ E;  2P7J A;  3PBT A;  2J80 A;  4P6Z M;  3C2W A;  3E0Y A;  5DKL A;  4CLC D;  1MZU A;  4BMW A;  2XA7 M;  4EUV A;  3HJK A;  4BBU A;  1F9I A;  2B02 A;  2IA2 A;  4R38 A;  2QYB A;  5CX7 A;  1XJ4 A;  4FSF A;  3PBO A;  2PYP A;  4Y5F A;  3LR5 A;  5AVE A;  4HH2 A;  3UME A;  2W1T B;  5F69 A;  5EFW A;  4HP9 A;  4GCZ A;  5DFY A;  2M7V A;  4EW7 A;  2V9A A;  2OWJ A;  1XFQ A;  2INW A;  1GSX A;  4MN5 A;  3B42 A;  3U2A A;  3LIA A;  3IBR A;  3BJN A;  4MN6 A;  3R7W A;  1TS6 A;  2OWH A;  3TRC A;  3F1N B;  1NLZ A;  1OJ5 A;  3BQA A;  3EGX C;  4BBT A;  4KQO A;  4WEJ A;  4HNB A;  3GDI A;  3OCN A;  1VB6 A;  2WKQ A;  3PBR A;  3UMD A;  1LSV A;  4L9G A;  2W3H A;  3IS2 A;  2WKP A;  3K2N A;  2JN7 A;  3P7N A;  4HHD A;  4Y2F A;  2QWS A;  2PD7 A;  1WA9 A;  3PBN A;  5G4Y A;  3T4O A;  3LIF A;  2M7U A;  5FL3 A;  1TS0 A;  1MKM A;  4HQA A;  5LBR A;  5IU1 A;  1TS7 A;  2KOI A;  5HZH A;  4IUK A;  3T4J A;  4AFI A;  1ODV A;  3FPW A;  1VHM A;  4MN7 A;  1T1C A;  3DBA A;  3OOV A;  4PKY G;  1KOU A;  5DFX A;  2QKP A;  4Y3I A;  5DJU A;  2VGL S;  2JKR I;  2QJ7 A;  4R70 A;  2L1M A;  1W63 M;  3F1P B;  3F1P A;  5TBM B;  5F68 A;  2J3W A;  2QHK A;  2ZOI A;  3JVV A;  2VX8 A;  2W27 A;  2GNX A;  4L0L A;  1LL8 A;  1OT6 A;  3SW1 A;  3VE3 A;  5HD5 A;  1OTB A;  1S4S A;  3T4Q A;  1XJ3 A;  3KO6 A;  3RH8 B;  1XJ2 A;  2BAS A;  5J7E A;  4G3W A;  4F3L A;  1S66 L;  1P9R A;  3BWL A;  3H9W A;  5TJJ A;  1OJG A;  2K7S A;  1LSX A;  3PYP A;  5I5L A;  2D01 A;  3LR3 A;  2VV6 A;  3E98 A;  4EES A;  2L4R A;  4HH3 A;  2KLI A;  1MC0 A;  2LB5 A;  4EET B;  5HDD A;  2HF6 A;  1TF1 A;  4BWI A;  5DF9 A;  3NJA A;  4ETZ A;  3ULF A;  1TS8 A;  3H82 A;  3RFB A;  3FC7 A;  2OAP 1;  2EWW A;  3MQQ A;  5HDC A;  1H3Q A;  2B18 A;  1EW0 A;  4XT2 A;  4B9O A;  4MMN A;  3PBQ A;  5DJT A;  4EQ1 A;  5IT5 A;  3EQU A;  3LIE A;  3GEC A;  2ZBB A;  4I3I A;  1D7E A;  4GS9 B;  4GS9 A;  4O0P A;  4EU0 A;  1N9L A;  5K5B A;  1P0Z A;  5J4E A;  2M1C A;  3BY9 A;  4L9F A;  1YKD A;  4I3J A;  4BBV A;  2V1B A;  1F98 A;  2P04 A;  3A0R A;  3S7N A;  3TJZ C;  1P9W A;  2NUP C;  4DN0 A;  2XRN A;  3LYX A;  1YSQ A;  1DP6 A;  3T4L A;  3KX0 X;  3E4Q A;  4EEU A;  5G4Z A;  3EEH A;  3K3D A;  1UWP X;  2D02 A;  5HWT A;  1JNU A;  3R7W B;  4ARZ B;  4ARZ A;  3PHY A;  1STZ A;  3T4T A;  1XFN A;  3D3O A;  3VV4 A;  1LT0 A;  3FG8 A;  4NKP A;  3MMH A;  4IUH A;  4WN5 A;  4I3A A;  4GW9 A;  3IS2 B;  2ZOH A;  3VE4 A;  3LIC A;  3S7Q A;  3KSH A;  3OCL A;  3UE6 A;  2L0W A;  4DMZ A;  2OOL A;  1T19 A;  1G6O A;  3EEA A;  3PR6 A;  2YKH A;  5L8M A;  3VOL A;  3NOT C;  4E04 A;  2O0Y A;  3PBS A;  3KYZ A;  2FH5 A;  3NOU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...