4CLCC

Crystal structure of ybr137w protein
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
173
structure length
173
Chain Sequence
MVVLDKKLLERLTSRKVPLEELEDMEKRCFLSTFTYQDAFDLGTYIRNAVKENFPEKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSDYPYACLTISGLKQEEDHLMAVSSLIAFANESLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0303 PROTEIN YBR137W
publication title Structural and Functional Characterization of Ybr137Wp Implicate its Involvement in the Targeting of Tail-Anchored Proteins to Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 53
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4clcC00
4CLCD 3FPWA 4NKPA 3FPVA 2A2LA 4CLCB 4CLCA 5CX7A 4CLCE 4BMWA 4CLCC
chains in the Genus database with same CATH superfamily
4RVAA 3E2LA 2DNSA 1GHIA 3N8SA 3UB5P 1IOUA 3NY4A 5U47A 3LO7A 2QJ5A 5GLBA 1PWDA 3ZVWA 5EUAA 4EETB 1K54A 3T1XA 1DJBA 3QP2A 4B9OA 1G28A 5TJJA 4AFIA 1BLCA 2ZQ7A 1W63M 2P74A 4KENB 4JXGA 4Z9QA 4ZBEA 3FKVA 5TBMA 3VP1A 1I2WA 3LI8A 5K5BA 3T4SA 4MMNA 1OTAA 4Y15A 3GR2A 1XP4A 4GW9A 4GD6A 3G2ZA 1LSXA 1V9YA 1BUEA 2QZ6A 4Y0TA 3JPUA 3LYXA 2XD1A 2W3EA 1VETB 4S2NC 4UEYA 4HJ3A 3D4FA 3GMWA 5FAQA 3PR6A 1LL5A 1IYOA 4U0XA 1AWIA 5EVEA 4JGRA 3PBQA 2ZOIA 1FSYA 4QWOA 5DF9A 3HJIA 2JKTM 2PD7A 2Y2NA 2B95A 4BENA 2IWCA 3IQAA 3FV7A 2OAP1 1OMEA 3W8KA 2FFFB 3G35A 2BTFP 2CMNA 3C4PA 5EVLA 1TS8A 3Q82A 5DKLA 3B47A 1ERMA 4U0TA 1K55C 4UQIM 5M18A 2O9CA 2VV6A 1PYYA 2VA0A 2XK1A 4E3OA 1TS6A 3EWKA 2Q0OA 3PHYA 4DN0A 4EW7A 1S66L 1RCJA 1ZG4A 3W4QA 5EVID 1NZUA 3GECA 4G3VA 5GLDA 4RX2A 4EU0A 1C3BA 3NC8A 4UA9A 3O3VA 4JPMA 1JNUA 5L09A 2J3WA 4KZ5A 5EV0A 1G6OA 4R1GA 5FDHA 4JKTA 2PBYA 3FG8A 3QHYA 1NLYA 3BEBA 4K91A 2PBDP 4LFUA 1MY8A 2W0NA 4KZ4A 4LV0A 3TSGA 1IYPA 1DP9A 1PRQA 5J7EA 4KUOA 3UE3A 2H28A 5G18A 1KVMA 4XXRA 5AQBA 5I94A 3JVUA 4LRYC 1K6RA 3DWKA 4GKUA 1DY6A 3UPPA 2ZMFA 4GD8A 3NOUC 1ACFA 3U4LP 1S4RA 4MNRA 5TBMB 3IF6A 1YSPA 3BY9A 5F1GA 1ZHHB 4Y0OA 3ZHHA 2OLVA 2PAVP 3VP4A 5J8XA 1LL8A 5CHJA 3D9YA 1FSWA 2HP6A 1IELA 3TE8A 5LBRA 1W79A 4HBUA 1MC0A 1OTEA 4NXEA 4EQIA 1BT5A 2W3FA 2Y2KA 5FL3A 2FZ0A 2Y55A 4JF5A 2VEAA 4KG5A 2J80A 1KVLA 1BZAA 1YLWA 4M4XA 1ES2A 2X71A 1FCOA 3G6OA 4WN5A 4B4XA 3VFFA 5F68A 2W3HA 2NUPC 1S1YA 2K31A 4RA7A 4WM9A 3FWLA 3T4TA 5CGWA 1JVJA 1T1AA 3BECA 3H82A 3P98A 5HDSA 3FKWA 2Q9MA 2V8FA 3HUOA 4KQRA 1IYSA 4OVDA 3E4OA 3C2WA 3OPRA 1FOFA 3PAGA 3S7QA 1ODVA 4PHTA 3JVVA 1CEGA 3NCKA 2W27A 2GZAA 3NECA 2WAFA 2FFYA 3V5MA 4WUJA 3UNWA 4N92A 1M6KA 4HIAA 5F6AA 4KQQA 1H8YA 4LCLA 3S1YA 2WKRA 3PBSA 3UDIA 2BG1A 3UDFA 3DWZA 1NYYA 2WZXA 5G4YA 1ONGA 5AQAA 2C6WB 2XA7S 4L9FA 4DJ3A 1UGUA 3RXWA 1YAXA 2WUQA 1PWGA 2DCFA 2KLIA 4JGPA 3N8LA 4EBNA 2XF3A 4H8RA 4LENA 4PAUA 1PW1A 2VGLM 1MZUA 3O87A 1GHPA 1T18A 3VOYA 1MKIA 3S7PA 4OH0A 3IF6B 2R9WA 3BLSA 3OCLA 4ARZA 3QP1A 3IHAA 3C30A 5GLCA 4UA6A 2XEPA 2ZQAA 3EGXC 3EEAA 2QYBA 3UB6A 1XFQA 2D01A 2DRWA 2O9AA 3VMAA 5HPFA 1J9MA 4OPQA 3M2KA 2G7UA 3NI9A 2LB5A 4NXFA 3UY6A 1T19A 1S6RA 3ZG7B 3NBLA 5M1AA 2OOLA 1XKZA 1K0KA 3F1OA 1WE4A 1PIOA 3F1PA 4WMCD 1G5UA 3A3JA 4ZTKA 5FATA 1KE4A 1GA9A 4X68A 4WBGA 1JTGA 3IXGA 1IFQA 3MXRA 2V9AA 3FPWA 2B5RA 4IBRA 3H82B 5CTNA 4EBPA 4P87A 1EWZA 1D7EA 1K56A 1KE0A 4L9GA 3F1NA 4OPRA 2EFUA 2HZ5A 3T12B 3MKFA 1L0EA 2PU4A 1XJ4A 2HGVA 3MXSA 3E0YA 3WS5A 5CECA 3IH9A 4BMWA 3C38A 5FQIA 4P6ZS 1L3LA 4JXVA 3QP8A 2VK3A 2A49A 3UE0A 3UO9A 2EXAA 3KYEA 5FA7A 3BY8A 4MDZA 1XXMA 2Y2GA 1TDGA 1W63Q 4OQGA 3NIAA 2Y2PA 5HWWA 2Z6CA 2V0UA 1ZTUA 4FH4A 3DAVA 2XLNA 1PWCA 3W4PA 3EEHA 4Y13A 3VSKA 2PDRA 3FYZA 4JXWA 1DJAA 2EX9A 3T1SA 3HLWA 4CJNA 3IXHA 4NG2A 1K25A 3T50A 4MBFA 3TRCA 2PU2A 1BLPA 4OP8A 3CWFA 1M40A 1JTDA 3LUQA 3VE3A 3UB9A 1FCNA 1MXOA 2HDRA 4O0PA 1H5XA 1YSQA 1HTZA 5CEDA 3L9KA 3CPTA 5EM1A 1OT9A 1TEMA 4RQ9A 3VP3A 4C6YA 3HUMA 2CC1A 2P08A 4ARZB 1NRFA 3ISGA 2X01A 2JKGA 3FC7A 5EVIC 3OBFA 3PBNA 3BYDA 2VGKA 4CLCC 1Y28A 5FQKA 1FIKA 3T4KA 2WGVA 4R4RA 1KDSA 4DE1A 4S2LA 2K2NA 2ZQ9A 3KSFA 5A91A 3DTIA 2HPBA 2M1CA 2WKPA 4JXSA 3F1OB 4BQMA 3NHQA 3F1PB 4QHCA 4Q0IA 5EOOA 1CK3A 1L0GA 2ZBBA 4MBHA 4BJPA 3LIEA 4C75A 3WRZA 4WZ5C 4DDYA 1OJGA 2EXBA 3F1NB 1GSWA 4MN6A 4EEPA 5EECA 3T1QB 2OLUA 2Y2HA 3CHWP 3VSLA 3GDIA 4ZDXA 4LRZE 1ZKJA 2ZOHA 1KDWA 1FR6A 2X02A 3ZDJA 2XFTA 2O9BA 3HLCA 2YKHA 1IYQA 1YLPA 4R3AA 2H0TA 1TS7A 5FQ9A 5IT5A 3MFXA 1S0WA 3OLOA 2W3DA 1XFNA 2J9OA 3LCEA 1FQGA 3EQVA 4R6LA 4WL9A 1DJCA 2GX5A 4K08A 1YMXA 4KZ9A 4X1LA 2XQZA 4NETA 1L0FA 3UDXA 3D72A 4PMAA 1G6AA 1W8YA 4Q8IA 2ZQDA 3MXQA 1O7EA 2HP9A 3IS2A 1X0OA 1GCEA 4LCMA 3BFCA 3C4OA 5HX9A 5GHZA 3K2NA 4N1HA 5FDSA 5HDDA 4X69A 3SH8A 4Y0UA 5I5LA 1YQSA 2J3TC 3HCYA 5HW3A 3RXXA 3BFEA 1Z09A 4LPZA 2XFSA 4MLLA 2ZQCA 2ZMAA 1VHMA 3CPTB 5FEGA 3HJKA 3LR4A 5HFOA 1KOUA 2R9XA 1PI4A 5FASA 2E8IA 2HDUA 3A3IA 1YT4A 4XUZA 4X53A 4HY8A 5HAQA 4H6JA 4DE2A 3VP0A 2V1ZA 4P0MA 1ES3A 3ITAA 3ZFZA 2BASA 4CLCD 3N8RA 1SHVA 2OWJA 3LIAA 2QPNA 4L9EA 4JF6A 5IU1A 2Y2MA 1EROA 1LSVA 3S7NA 1MWRA 1BLSA 3GSGA 4HBTA 3KSIA 3LEZA 2Y2LA 4ID4A 3M6BA 3KO6A 4BL3A 3MQQA 3UB8A 1HZOA 3MSHA 1YM1A 1VEUA 1T1BA 3UMEA 2H0YA 3CUEA 1K57A 1AXBA 2A24A 3OCNA 2HV1A 2J8YA 3AGFA 2Y2JA 4QD4A 3AGDA 4L0LA 2XA7M 5CGXA 4E3MA 2EWWA 3T1RA 2PT7A 4HP4A 4X6TA 3QP6A 4Y7PA 3OZHA 2W1RA 1OJ5A 4EUZA 3JYIA 2INWA 2WKEA 3G31A 4EESA 1LI9A 3ZNYA 4NEED 2VGJA 5M19A 4ZJ1A 5E2FA 4EEUA 4S2KA 1E3UD 4E3LA 2V1BA 3LY3A 1P97A 4R38A 1ESUA 1PFLA 1YKDA 4I3IA 3Q07A 1S1ZA 3L7HA 3MF0A 2ZC5B 2ZJ9A 2D02A 4R0QA 3N6IA 2LB9A 3VE4A 4S2IA 2JKRM 4KG2A 1Q2QA 3IXBA 3IS2B 3CJMA 4DF6A 4E3NA 1ERQA 2PR5A 3LIDA 2JBFA 3MZEA 4PPRA 5CX7A 3CG5A 2ACGA 2L1MA 2Y91A 1EW0A 2QKPA 4OONA 5F83A 1VB6A 2J3TD 2HJ9C 2J9PA 3NDEA 3FZCA 4P85A 3OPHA 5E2HA 1N9LA 3O88A 1YMSA 3D3OA 4OQ0A 4P6BA 2V20A 3SW1A 4BLMA 3MZFA 5FI6A 5DKKA 4H6JB 2AVXA 2WK0A 4EQ1A 3T4LA 3BLMA 3IWIA 5E2GA 4IEDA 4YINA 1H8MA 4P6ZM 4PKYG 3M6HA 5DF7A 2JN7A 1ZC2A 3PBOA 2ZLYA 1DP6A 3H7WA 1ZG6A 3ZG8B 1KGFA 5A8BA 5F1FA 3Q81A 4K0WA 1K54C 4MN5A 1VEUB 1A0KA 4F94A 2RCXA 5AQ7A 2UV0E 1L2SA 2A24B 3CI6A 5KSCA 2KX6A 1LSWA 2O99A 3GV9A 1CJFA 3O5YA 4YFMA 4Y3IA 2MJ6A 3ZVTA 1OTDA 4JF4A 4S2NA 2WKIA 4X55A 5F69A 5FAPA 2Y8HA 1IKGA 4R3JA 3ZCZA 4XT2A 3HL9A 4FD8A 3C5AA 3BW6A 3CMZA 3HLDA 2BLSA 4GCZA 3Q7ZA 1MWTA 1MWUA 2I72A 1XX2A 4KZ8A 1YLTA 2HF6A 3O86A 2FH5A 1UWNX 4M3KA 3SOIA 4DXCA 4HNBA 4BBUA 1S67L 4OPYA 2L4RA 4G3KA 4Y17A 3VP2A 4IHQA 5KZHA 1CEFA 1K55A 3V39A 3E98A 3FPVA 4PM8A 3EOIA 5HZHA 1K6SA 3WS4A 3PBRA 3IXDA 4GHIA 2P9VA 1LLBA 2WKHA 5TR7A 2JKTI 1PI5A 1HLUP 4QY5A 2OAQ1 3UE6A 3LEQA 1ALQA 2O0YA 3TW8A 3C7VA 1E4DA 5CTMA 5DTTA 3MQOA 4KUKA 1XGJA 2OWHA 3PTEA 1LI0A 3R4KA 2A3UA 3C7UA 4KZ6A 2I9VA 2J7VA 2GJ3A 5E2EA 4GNUA 4GS9A 4E3KA 5CHUA 3DTMA 3PAEA 3N4IA 3OPPA 4F3LA 5KMWA 1LL9A 4G3WA 1F2KA 3PBTA 5CERA 4EV4A 4E3JA 2Z2LB 1DP8A 3IHBA 3T4QA 4DMZA 4IBXA 3BWLA 2UWXA 1MWSA 3UPNA 3M2JA 1KE3A 3IBRA 4YWZA 4OQIA 3H7WB 5A92A 3P01A 5KIZA 4O8GA 4I39A 2OV5A 5GLAA 2XD5A 2JCHA 5CEBA 3OPLA 3IWOA 5DTKA 2WZZA 1T1CA 2P04A 4NXBA 1JWPA 3P7NA 4GZBA 4IUHA 5C5KA 3NULA 1BSGA 3CAXA 1BLHA 2IWBA 3BJNA 3IF6C 4EXOA 3QP4A 4XT2B 4E3IA 5FSRA 1XJ3A 4LV3A 4FSFA 4DKIA 1XA7A 4OOMA 2V0WA 1D06A 1CF0A 3NDGA 3ZGAB 5CRFA 3ICYA 1PW8A 1CQAA 5AJGA 2XGNA 3PXPA 2K7SA 2IWDA 4II7A 3G2YA 3G4PA 5HARA 1SKFA 4C3QA 2DMWA 4JGQA 3WS1A 2ZC6B 4MBKA 1PZOA 4LV1A 3W4OA 1SDNA 1NLZA 1GSXA 4WZ4A 1IEMA 1N4OA 3ZG9B 4JGOA 2XDMA 4GHIB 1Y4OA 2P9VB 4Z1WA 5MC7A 2KOIA 1S4SA 1JWVA 2E8JA 1ES4A 3SZTA 2NUTC 5HAIA 4ZRRA 4BD1A 4LGWA 1DRMA 4FOFA 2PHYA 3QNBA 4EBLA 1IKIA 2ZQ8A 4B93A 2Q9NA 4RYEA 4ZJ3A 4D60A 3BQ8A 1RGZA 4ETXA 5JYOA 2XROA 2V8CA 3BQAA 1MBLA 3UMDA 4OOYA 3KSHA 4OLGA 4GS9B 2Z6DA 4ETZA 4S2MA 3ZG0A 1LT0A 1K4FA 1VM1A 4UAAA 4GDBA 3WS0A 2B02A 5HDCA 2EFXA 4F3LB 3V3RA 4GDNA 1CI9A 3A0VA 2QHKA 2L0WA 1BYWA 1NZOA 4Y2FA 5TFQA 3ZG5A 3V3SA 1SCWA 1NXYA 1JWZA 5DF8A 4QJGA 4N9LA 1NYMA 4ESPA 3UPOA 5L2FA 2ZC3B 3C8CA 2JE5A 2ZM0A 1OTIA 1P9RA 1LHYA 5FAOA 1Y54A 2EX6A 1N9OA 2EX2A 4I5SA 5CXWA 1OTBA 2Y59A 5CGSA 5FEFA 3KYZA 5GHXA 4KZ3A 3ZNTA 2ZM2A 2PYRA 3IH8A 5EPHA 1XPBA 2PRFA 2HDQA 4IVIA 3BFDA 1WYBA 4U3TA 4BL2A 3N7WA 3RJUA 4OLDA 5L07A 1KGEA 1J3WA 3CZDA 4HESA 3U2AA 3HLBA 2HDSA 4ZJ2A 5F82A 4WF0A 4WEJA 4GB7A 4I38A 3K3CA 4HJ4A 1CI8A 2EX8A 3LR3A 5DVAA 5HAPA 3MJQA 1OPXA 5AQ9A 3WRTA 3LY4A 3AGEA 1HD8A 1NWZA 2XRNA 2M7UA 1XA1A 1I5QA 4OOLA 5J4EA 5HD3A 1EI5A 5JYPA 2PYPA 3MBZA 3HBRA 2VX8A 4CQHA 2WADA 1NJ4A 4LRXC 3ZQ5A 3GTCA 3B3XA 3HLFA 3S4XA 2KDKA 4KZBA 3CLOA 1O07A 3MS6A 3IBJA 4FCFA 4UA7A 1UWPX 3DBAA 4JBFA 5HL1A 3G34A 3NJAA 3HLEA 3LFVA 2WAEA 4QY6A 1QMEA 2Y2OA 5DJUA 4O01A 1STZA 3A3EA 3GVBA 2XH9A 4WELA 1BTLA 3H9WA 4KQOA 4N1XA 5HL6A 4NXGA 4WLAA 1ESIA 3B33A 1NRJA 1N9BA 2ZM8A 3NOTC 3RFBA 5EE8A 1F5MA 4Q0JA 2Y4AA 1XJ2A 3S22A 4K0XA 1WYCA 1TVFA 2EA9A 4X25A 1E25A 2H5SA 5GL9A 5E43A 4D2OA 4DJ2A 4O7DA 2WYXA 4PM9A 4EERA 3IX3A 4CLCE 1MKMA 1P0ZA 5IHVA 1KGGA 3TJZC 1K4EA 3MKEA 3NOPC 5EVIA 4E04A 1V9ZA 4HI4A 2VV7A 4CLCA 3Q7VA 3MZDA 1SKOA 4DDSA 4XUXA 4PKYA 4CPKA 3HUNA 1VQQA 1D1JA 1F9IA 3E4PA 2ZD8A 1XGIA 4UQIS 2OSUA 4BBTA 3VFHA 4ZAMA 2VJWA 5L8MA 4DE0A 3IT9A 1ONHA 5AVFA 1W5DA 1BULA 2WGIA 1K38A 3A3DA 1U60A 3P09A 1FR1A 5HD5A 4GLQA 4WZ5A 1TF1A 2W1TA 4GJ4A 4I3AA 3SS3A 2HP5A 5J3WA 1H0MA 3HREA 3LR5A 3A0SA 2VKSA 3E4QA 4MEZA 5EM0A 3KYQA 4A5RA 1SZVA 2JC7A 5FI2A 5FQQA 4MN7A 3TG9A 3MFDA 3LI9A 5HWVA 5DJTA 4IUKA 3VOLA 1TD5A 3LIFA 2JHEA 4LLOB 4MCWA 2XR0A 4R3BA 3SH7A 2QWSA 5G4ZA 3DW0A 2EWVA 3IX4A 4IVKA 1K56D 2C5WB 3BFFA 4E6WA 4EUVA 2IA2A 3G30A 4EWFA 4UHUA 4HH3A 4E6XA 1E3UA 3WWXA 4QU3A 3E2KA 5IS1A 4ME4A 3LIBA 4BWIA 4I3JA 4HQAA 4PM5A 3BM6A 1NY0A 2Y2IA 2RL3A 3OOVA 2B18A 2ZL1A 1MPLA 5HSQA 2Y2QA 1FCMA 4KZ7A 5F5YA 3UB7A 3CITA 3VV4A 3KSGA 2WGWA 4HJ6A 3PYPA 1QMFA 1G68A 4HHDA 2YKFA 5CHMA 3R7WA 2M7VA 5DFXA 4IJGA 3TOIA 3KX0X 3SS5A 4GN2A 2G2WA 2Y79A 1RGYA 4BD0A 3GRJA 4BBVA 2ZC7A 3SS4A 3MQ0A 1OT6A 5L10A 4KG6A 2VLGA 3LICA 1YLYA 1Z6FA 2WKQA 4NKPA 3W2ZA 5FQJA 3QNCA 5EVIB 4B88A 4CLCB 3Q7VB 4PM6A 1SKOB 4S2PA 3ITBA 4B4ZA 5EOEA 3DTEA 3ULFA 1GHMA 4HEFA 4OKPA 3LR0A 4HOIA 2PR6A 1L0DA 4NK3A 1H8ZA 3T4JA 4DRTA 4Q0HA 5D3OA 5FQMA 1W7FA 4FUWA 4WYYA 1WA9A 4OQHA 1GSVA 2HJEA 5A90A 4QPRA 3A0RA 2P7JA 2W1TB 4WEKA 3A3FA 2ZC4B 3HLGA 2XSSA 3QP5A 4R23A 1TS0A 5BOHA 3EQUA 1HVBA 2ZMVA 1XJ6A 4DXBA 2A2LA 1YLZA 4JLFA 3V67A 1GA0A 2G2UA 2VZWA 3CUEC 3HVFA 1K57C 3IX8A 1ES5A 4KZAA 5HPIA 3T4OA 1VETA 4Y5FA 2V1AA 3SH9A 3BFGA 5AVEA 2GNXA 5A93A 3S7OA 3UN7A 3ZYTA 4X1MA 3EGDC 4KQDA 5KSHA 2VGLS 4FTXA 1SDEA 2QMIA 4X56A 3IF5A 1F98A 4RX3A 4QB8A 1W8QA 2ZL1B 1YLJA 2PD8A 1P9WA 4GOGA 3K3DA 4WMCA 1I2SA 3BRMA 3B42A 3IWQA 2WGWB 4HH2A 4S2OA 3MMHA 4FH2A 1N9NA 4OPZA 3R7WB 3WS2A 2QJ7A 3RTYA 3DTKA 3I7JA 2Z2MB 4LV2A 2H10A 2W3GA 5TGFA 4OP5A 1PZPA 3UE1A 2JKRI 3V50A 3Q1FA 4HP9A 4PM7A 1TDLA 2JKFA 5EFWA 1Q2PA 1FILA 5HWTA 4YNRA 2R78A 5GHYA 4S2JA 5DTSA 1YPRA 5FI7A 3VOZA 1RP5A 2GDNA 4R4SA 3MR0A 4N9KA 5DFYA 3G32A 2VV8A 3GQZA 1PNEA 3OC2A 2V2FF 1H3QA 3RH8B 3LGOA 4DE3A 4YOFA 4R70A
chains in the Genus database with same CATH topology
2VX8A 3E0YA 4CQHA 1IOUA 4LRXC 3ZQ5A 4BMWA 2QJ5A 3C38A 1H8MA 4P6ZM 4PKYG 2KDKA 4P6ZS 4EETB 3CLOA 4B9OA 1G28A 5TJJA 2JN7A 3IBJA 1UWPX 3DBAA 3PBOA 3H7WA 1DP6A 3BY8A 4MDZA 4AFIA 5A8BA 3NJAA 1W63Q 1W63M 3LFVA 4MN5A 5HWWA 5DJUA 4O01A 1STZA 2Z6CA 2V0UA 4WELA 3H9WA 4KQOA 1ZTUA 2A24B 3CI6A 5HL6A 4NXGA 2KX6A 1LSWA 2O99A 5TBMA 3LI8A 5K5BA 3T4SA 4MMNA 1OTAA 4WLAA 3O5YA 4Y3IA 2MJ6A 1OTDA 3B33A 4GW9A 3EEHA 1LSXA 2PDRA 1NRJA 1V9YA 5F69A 2Y8HA 3LYXA 3NOTC 4XT2A 3RFBA 1F5MA 4Q0JA 2W3EA 1XJ2A 3BW6A 3T50A 4UEYA 3TRCA 4GCZA 4HJ3A 2EA9A 4DJ2A 3CWFA 3PR6A 2HF6A 2FH5A 1UWNX 3LUQA 3VE3A 3UB9A 4HNBA 4JGRA 4BBUA 4O0PA 4EERA 4CLCE 1S67L 1YSQA 2L4RA 1MKMA 3PBQA 1P0ZA 3TJZC 2ZOIA 4G3KA 5DF9A 3HJIA 1OT9A 3NOPC 4IHQA 2JKTM 4RQ9A 4E04A 1V9ZA 2PD7A 4HI4A 2VV7A 3E98A 4CLCA 2OAP1 2P08A 3FPVA 4ARZB 3EOIA 2CMNA 4PKYA 5HZHA 1TS8A 3PBRA 5DKLA 3B47A 4GHIA 3FC7A 1F9IA 3OBFA 3PBNA 3E4PA 4UQIM 4CLCC 4UQIS 2O9CA 2JKTI 2VV6A 4BBTA 2VA0A 1Y28A 3T4KA 2OAQ1 1TS6A 2VJWA 3EWKA 3UE6A 2O0YA 5L8MA 3TW8A 2K2NA 3PHYA 5AVFA 3KSFA 2M1CA 2WKPA 4DN0A 4EW7A 1S66L 5HD5A 3MQOA 3F1OB 4GLQA 4KUKA 3NHQA 3F1PB 2OWHA 4Q0IA 1TF1A 3R4KA 2W1TA 3GECA 4G3VA 4GJ4A 4I3AA 5J3WA 2ZBBA 4EU0A 4BJPA 3LR5A 3LIEA 2I9VA 3A0SA 2VKSA 3E4QA 2GJ3A 4GS9A 3KYQA 4MN7A 1OJGA 3LI9A 1JNUA 3F1NB 5HWVA 1GSWA 5DJTA 4MN6A 2J3WA 4IUKA 4EEPA 3VOLA 1TD5A 3LIFA 1G6OA 2JHEA 4LLOB 4MCWA 3GDIA 4F3LA 2QWSA 5G4ZA 3FG8A 4LRZE 1NLYA 2EWVA 4G3WA 2ZOHA 3PBTA 2W0NA 4EUVA 2IA2A 1DP8A 3T4QA 2O9BA 2YKHA 4HH3A 4DMZA 1DP9A 3BWLA 4R3AA 5J7EA 3IBRA 4KUOA 4ME4A 2H28A 3LIBA 1TS7A 4YWZA 3UE3A 5IS1A 5IT5A 3MFXA 3H7WB 4BWIA 3P01A 3OLOA 5KIZA 2W3DA 3JVUA 1XFNA 4I3JA 4O8GA 4HQAA 4LRYC 4I39A 3EQVA 4R6LA 4WL9A 2GX5A 3OOVA 2B18A 4K08A 2ZMFA 3NOUC 1S4RA 5HSQA 5TBMB 1YSPA 3BY9A 1T1CA 1ZHHB 3UB7A 5F5YA 2P04A 3CITA 4NXBA 3P7NA 3KSGA 3VV4A 3D72A 4HJ6A 4IUHA 5C5KA 1LL8A 3PYPA 3MXQA 4HHDA 2YKFA 3TE8A 3R7WA 3CAXA 5LBRA 2M7VA 5DFXA 4IJGA 3BJNA 1MC0A 1OTEA 3IS2A 4NXEA 3KX0X 4XT2B 2W3FA 4EXOA 1X0OA 1XJ3A 5FL3A 2Y79A 2FZ0A 4FSFA 2VEAA 4OOMA 4BBVA 3K2NA 2V0WA 2J80A 3MQ0A 1D06A 1OT6A 5HDDA 3ICYA 2VLGA 5AJGA 3LICA 3HCYA 2J3TC 4M4XA 5I5LA 4LPZA 3PXPA 3G6OA 4WN5A 2K7SA 4II7A 5F68A 2WKQA 2W3HA 2NUPC 1S1YA 2K31A 4NKPA 1VHMA 2DMWA 4JGQA 3T4TA 3W2ZA 3HJKA 3LR4A 1T1AA 1KOUA 4CLCB 3H82A 1NLZA 1GSXA 5HDSA 4HY8A 4H6JA 4JGOA 4GHIB 3E4OA 4Z1WA 3C2WA 5MC7A 2KOIA 1S4SA 3ULFA 2BASA 4CLCD 2NUTC 3S7QA 1ODVA 3LR0A 4HOIA 4PHTA 4ZRRA 3JVVA 2OWJA 2PR6A 2W27A 3LIAA 2GZAA 1DRMA 4FOFA 4L9EA 3T4JA 2PHYA 4Q0HA 5IU1A 1LSVA 3S7NA 4B93A 4WUJA 3BQ8A 1WA9A 1GSVA 3KSIA 4ETXA 2HJEA 2XROA 4HIAA 3BQAA 4QPRA 3A0RA 2P7JA 5F6AA 2W1TB 4WEKA 3UMDA 3KO6A 3MQQA 3UB8A 2XSSA 1T1BA 3KSHA 4GS9B 2Z6DA 1TS0A 3UMEA 4ETZA 2WKRA 3PBSA 3CUEA 3EQUA 1LT0A 2A24A 2ZMVA 3OCNA 2HV1A 1XJ6A 4L0LA 2A2LA 2B02A 5HDCA 5G4YA 2XA7M 4F3LB 3V67A 2XA7S 4L9FA 2VZWA 2EWWA 4DJ3A 1UGUA 3A0VA 3CUEC 2QHKA 2L0WA 1BYWA 5HPIA 2PT7A 4HP4A 4Y2FA 1YAXA 2W1RA 3T4OA 4Y5FA 1OJ5A 2V1AA 5AVEA 2GNXA 2INWA 2KLIA 4JGPA 3S7OA 3ZYTA 3EGDC 4EESA 4PAUA 4KQDA 5KSHA 2VGLM 4NEED 1MZUA 2VGLS 4EEUA 1F98A 2V1BA 3C8CA 1OTIA 1P9RA 1T18A 1P97A 4R38A 1N9OA 1YKDA 4I5SA 3S7PA 4I3IA 1S1ZA 2PD8A 1P9WA 3K3DA 3MF0A 2D02A 3OCLA 3B42A 1OTBA 2LB9A 3VE4A 2JKRM 4HH2A 4ARZA 3MMHA 3KYZA 1N9NA 3C30A 3R7WB 2QJ7A 3EGXC 3IS2B 2PYRA 3EEAA 3RTYA 2PR5A 3LIDA 2QYBA 5CX7A 3UB6A 2W3GA 1XFQA 2D01A 2O9AA 2L1MA 5HPFA 2JKRI 4HP9A 1EW0A 2QKPA 2G7UA 2LB5A 4NXFA 1VB6A 1T19A 2J3TD 5EFWA 3U2AA 2OOLA 2HJ9C 3F1OA 5HWTA 4WF0A 4WEJA 3F1PA 4YNRA 2R78A 4I38A 3K3CA 1N9LA 4HJ4A 3LR3A 3D3OA 1IFQA 3MJQA 1OPXA 3SW1A 2V9AA 3FPWA 3H82B 3MR0A 5DFYA 1D7EA 2VV8A 3OC2A 4L9GA 5DKKA 1NWZA 4H6JB 2XRNA 3F1NA 1H3QA 2M7UA 3RH8B 5J4EA 4OOLA 5HD3A 4EQ1A 2PYPA 4YOFA 1XJ4A 4R70A 3T4LA 2HGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLC D;  3FPW A;  4NKP A;  3FPV A;  2A2L A;  4CLC B;  4CLC A;  5CX7 A;  4CLC E;  4BMW A;  4CLC C; 
#chains in the Genus database with same CATH topology
 4RVA A;  3E2L A;  2DNS A;  1GHI A;  3N8S A;  3UB5 P;  1IOU A;  3NY4 A;  5U47 A;  3LO7 A;  2QJ5 A;  5GLB A;  1PWD A;  3ZVW A;  5EUA A;  4EET B;  1K54 A;  3T1X A;  1DJB A;  3QP2 A;  4B9O A;  1G28 A;  5TJJ A;  4AFI A;  1BLC A;  2ZQ7 A;  1W63 M;  2P74 A;  4KEN B;  4JXG A;  4Z9Q A;  4ZBE A;  3FKV A;  5TBM A;  3VP1 A;  1I2W A;  3LI8 A;  5K5B A;  3T4S A;  4MMN A;  1OTA A;  4Y15 A;  3GR2 A;  1XP4 A;  4GW9 A;  4GD6 A;  3G2Z A;  1LSX A;  1V9Y A;  1BUE A;  2QZ6 A;  4Y0T A;  3JPU A;  3LYX A;  2XD1 A;  2W3E A;  1VET B;  4S2N C;  4UEY A;  4HJ3 A;  3D4F A;  3GMW A;  5FAQ A;  3PR6 A;  1LL5 A;  1IYO A;  4U0X A;  1AWI A;  5EVE A;  4JGR A;  3PBQ A;  2ZOI A;  1FSY A;  4QWO A;  5DF9 A;  3HJI A;  2JKT M;  2PD7 A;  2Y2N A;  2B95 A;  4BEN A;  2IWC A;  3IQA A;  3FV7 A;  2OAP 1;  1OME A;  3W8K A;  2FFF B;  3G35 A;  2BTF P;  2CMN A;  3C4P A;  5EVL A;  1TS8 A;  3Q82 A;  5DKL A;  3B47 A;  1ERM A;  4U0T A;  1K55 C;  4UQI M;  5M18 A;  2O9C A;  2VV6 A;  1PYY A;  2VA0 A;  2XK1 A;  4E3O A;  1TS6 A;  3EWK A;  2Q0O A;  3PHY A;  4DN0 A;  4EW7 A;  1S66 L;  1RCJ A;  1ZG4 A;  3W4Q A;  5EVI D;  1NZU A;  3GEC A;  4G3V A;  5GLD A;  4RX2 A;  4EU0 A;  1C3B A;  3NC8 A;  4UA9 A;  3O3V A;  4JPM A;  1JNU A;  5L09 A;  2J3W A;  4KZ5 A;  5EV0 A;  1G6O A;  4R1G A;  5FDH A;  4JKT A;  2PBY A;  3FG8 A;  3QHY A;  1NLY A;  3BEB A;  4K91 A;  2PBD P;  4LFU A;  1MY8 A;  2W0N A;  4KZ4 A;  4LV0 A;  3TSG A;  1IYP A;  1DP9 A;  1PRQ A;  5J7E A;  4KUO A;  3UE3 A;  2H28 A;  5G18 A;  1KVM A;  4XXR A;  5AQB A;  5I94 A;  3JVU A;  4LRY C;  1K6R A;  3DWK A;  4GKU A;  1DY6 A;  3UPP A;  2ZMF A;  4GD8 A;  3NOU C;  1ACF A;  3U4L P;  1S4R A;  4MNR A;  5TBM B;  3IF6 A;  1YSP A;  3BY9 A;  5F1G A;  1ZHH B;  4Y0O A;  3ZHH A;  2OLV A;  2PAV P;  3VP4 A;  5J8X A;  1LL8 A;  5CHJ A;  3D9Y A;  1FSW A;  2HP6 A;  1IEL A;  3TE8 A;  5LBR A;  1W79 A;  4HBU A;  1MC0 A;  1OTE A;  4NXE A;  4EQI A;  1BT5 A;  2W3F A;  2Y2K A;  5FL3 A;  2FZ0 A;  2Y55 A;  4JF5 A;  2VEA A;  4KG5 A;  2J80 A;  1KVL A;  1BZA A;  1YLW A;  4M4X A;  1ES2 A;  2X71 A;  1FCO A;  3G6O A;  4WN5 A;  4B4X A;  3VFF A;  5F68 A;  2W3H A;  2NUP C;  1S1Y A;  2K31 A;  4RA7 A;  4WM9 A;  3FWL A;  3T4T A;  5CGW A;  1JVJ A;  1T1A A;  3BEC A;  3H82 A;  3P98 A;  5HDS A;  3FKW A;  2Q9M A;  2V8F A;  3HUO A;  4KQR A;  1IYS A;  4OVD A;  3E4O A;  3C2W A;  3OPR A;  1FOF A;  3PAG A;  3S7Q A;  1ODV A;  4PHT A;  3JVV A;  1CEG A;  3NCK A;  2W27 A;  2GZA A;  3NEC A;  2WAF A;  2FFY A;  3V5M A;  4WUJ A;  3UNW A;  4N92 A;  1M6K A;  4HIA A;  5F6A A;  4KQQ A;  1H8Y A;  4LCL A;  3S1Y A;  2WKR A;  3PBS A;  3UDI A;  2BG1 A;  3UDF A;  3DWZ A;  1NYY A;  2WZX A;  5G4Y A;  1ONG A;  5AQA A;  2C6W B;  2XA7 S;  4L9F A;  4DJ3 A;  1UGU A;  3RXW A;  1YAX A;  2WUQ A;  1PWG A;  2DCF A;  2KLI A;  4JGP A;  3N8L A;  4EBN A;  2XF3 A;  4H8R A;  4LEN A;  4PAU A;  1PW1 A;  2VGL M;  1MZU A;  3O87 A;  1GHP A;  1T18 A;  3VOY A;  1MKI A;  3S7P A;  4OH0 A;  3IF6 B;  2R9W A;  3BLS A;  3OCL A;  4ARZ A;  3QP1 A;  3IHA A;  3C30 A;  5GLC A;  4UA6 A;  2XEP A;  2ZQA A;  3EGX C;  3EEA A;  2QYB A;  3UB6 A;  1XFQ A;  2D01 A;  2DRW A;  2O9A A;  3VMA A;  5HPF A;  1J9M A;  4OPQ A;  3M2K A;  2G7U A;  3NI9 A;  2LB5 A;  4NXF A;  3UY6 A;  1T19 A;  1S6R A;  3ZG7 B;  3NBL A;  5M1A A;  2OOL A;  1XKZ A;  1K0K A;  3F1O A;  1WE4 A;  1PIO A;  3F1P A;  4WMC D;  1G5U A;  3A3J A;  4ZTK A;  5FAT A;  1KE4 A;  1GA9 A;  4X68 A;  4WBG A;  1JTG A;  3IXG A;  1IFQ A;  3MXR A;  2V9A A;  3FPW A;  2B5R A;  4IBR A;  3H82 B;  5CTN A;  4EBP A;  4P87 A;  1EWZ A;  1D7E A;  1K56 A;  1KE0 A;  4L9G A;  3F1N A;  4OPR A;  2EFU A;  2HZ5 A;  3T12 B;  3MKF A;  1L0E A;  2PU4 A;  1XJ4 A;  2HGV A;  3MXS A;  3E0Y A;  3WS5 A;  5CEC A;  3IH9 A;  4BMW A;  3C38 A;  5FQI A;  4P6Z S;  1L3L A;  4JXV A;  3QP8 A;  2VK3 A;  2A49 A;  3UE0 A;  3UO9 A;  2EXA A;  3KYE A;  5FA7 A;  3BY8 A;  4MDZ A;  1XXM A;  2Y2G A;  1TDG A;  1W63 Q;  4OQG A;  3NIA A;  2Y2P A;  5HWW A;  2Z6C A;  2V0U A;  1ZTU A;  4FH4 A;  3DAV A;  2XLN A;  1PWC A;  3W4P A;  3EEH A;  4Y13 A;  3VSK A;  2PDR A;  3FYZ A;  4JXW A;  1DJA A;  2EX9 A;  3T1S A;  3HLW A;  4CJN A;  3IXH A;  4NG2 A;  1K25 A;  3T50 A;  4MBF A;  3TRC A;  2PU2 A;  1BLP A;  4OP8 A;  3CWF A;  1M40 A;  1JTD A;  3LUQ A;  3VE3 A;  3UB9 A;  1FCN A;  1MXO A;  2HDR A;  4O0P A;  1H5X A;  1YSQ A;  1HTZ A;  5CED A;  3L9K A;  3CPT A;  5EM1 A;  1OT9 A;  1TEM A;  4RQ9 A;  3VP3 A;  4C6Y A;  3HUM A;  2CC1 A;  2P08 A;  4ARZ B;  1NRF A;  3ISG A;  2X01 A;  2JKG A;  3FC7 A;  5EVI C;  3OBF A;  3PBN A;  3BYD A;  2VGK A;  4CLC C;  1Y28 A;  5FQK A;  1FIK A;  3T4K A;  2WGV A;  4R4R A;  1KDS A;  4DE1 A;  4S2L A;  2K2N A;  2ZQ9 A;  3KSF A;  5A91 A;  3DTI A;  2HPB A;  2M1C A;  2WKP A;  4JXS A;  3F1O B;  4BQM A;  3NHQ A;  3F1P B;  4QHC A;  4Q0I A;  5EOO A;  1CK3 A;  1L0G A;  2ZBB A;  4MBH A;  4BJP A;  3LIE A;  4C75 A;  3WRZ A;  4WZ5 C;  4DDY A;  1OJG A;  2EXB A;  3F1N B;  1GSW A;  4MN6 A;  4EEP A;  5EEC A;  3T1Q B;  2OLU A;  2Y2H A;  3CHW P;  3VSL A;  3GDI A;  4ZDX A;  4LRZ E;  1ZKJ A;  2ZOH A;  1KDW A;  1FR6 A;  2X02 A;  3ZDJ A;  2XFT A;  2O9B A;  3HLC A;  2YKH A;  1IYQ A;  1YLP A;  4R3A A;  2H0T A;  1TS7 A;  5FQ9 A;  5IT5 A;  3MFX A;  1S0W A;  3OLO A;  2W3D A;  1XFN A;  2J9O A;  3LCE A;  1FQG A;  3EQV A;  4R6L A;  4WL9 A;  1DJC A;  2GX5 A;  4K08 A;  1YMX A;  4KZ9 A;  4X1L A;  2XQZ A;  4NET A;  1L0F A;  3UDX A;  3D72 A;  4PMA A;  1G6A A;  1W8Y A;  4Q8I A;  2ZQD A;  3MXQ A;  1O7E A;  2HP9 A;  3IS2 A;  1X0O A;  1GCE A;  4LCM A;  3BFC A;  3C4O A;  5HX9 A;  5GHZ A;  3K2N A;  4N1H A;  5FDS A;  5HDD A;  4X69 A;  3SH8 A;  4Y0U A;  5I5L A;  1YQS A;  2J3T C;  3HCY A;  5HW3 A;  3RXX A;  3BFE A;  1Z09 A;  4LPZ A;  2XFS A;  4MLL A;  2ZQC A;  2ZMA A;  1VHM A;  3CPT B;  5FEG A;  3HJK A;  3LR4 A;  5HFO A;  1KOU A;  2R9X A;  1PI4 A;  5FAS A;  2E8I A;  2HDU A;  3A3I A;  1YT4 A;  4XUZ A;  4X53 A;  4HY8 A;  5HAQ A;  4H6J A;  4DE2 A;  3VP0 A;  2V1Z A;  4P0M A;  1ES3 A;  3ITA A;  3ZFZ A;  2BAS A;  4CLC D;  3N8R A;  1SHV A;  2OWJ A;  3LIA A;  2QPN A;  4L9E A;  4JF6 A;  5IU1 A;  2Y2M A;  1ERO A;  1LSV A;  3S7N A;  1MWR A;  1BLS A;  3GSG A;  4HBT A;  3KSI A;  3LEZ A;  2Y2L A;  4ID4 A;  3M6B A;  3KO6 A;  4BL3 A;  3MQQ A;  3UB8 A;  1HZO A;  3MSH A;  1YM1 A;  1VEU A;  1T1B A;  3UME A;  2H0Y A;  3CUE A;  1K57 A;  1AXB A;  2A24 A;  3OCN A;  2HV1 A;  2J8Y A;  3AGF A;  2Y2J A;  4QD4 A;  3AGD A;  4L0L A;  2XA7 M;  5CGX A;  4E3M A;  2EWW A;  3T1R A;  2PT7 A;  4HP4 A;  4X6T A;  3QP6 A;  4Y7P A;  3OZH A;  2W1R A;  1OJ5 A;  4EUZ A;  3JYI A;  2INW A;  2WKE A;  3G31 A;  4EES A;  1LI9 A;  3ZNY A;  4NEE D;  2VGJ A;  5M19 A;  4ZJ1 A;  5E2F A;  4EEU A;  4S2K A;  1E3U D;  4E3L A;  2V1B A;  3LY3 A;  1P97 A;  4R38 A;  1ESU A;  1PFL A;  1YKD A;  4I3I A;  3Q07 A;  1S1Z A;  3L7H A;  3MF0 A;  2ZC5 B;  2ZJ9 A;  2D02 A;  4R0Q A;  3N6I A;  2LB9 A;  3VE4 A;  4S2I A;  2JKR M;  4KG2 A;  1Q2Q A;  3IXB A;  3IS2 B;  3CJM A;  4DF6 A;  4E3N A;  1ERQ A;  2PR5 A;  3LID A;  2JBF A;  3MZE A;  4PPR A;  5CX7 A;  3CG5 A;  2ACG A;  2L1M A;  2Y91 A;  1EW0 A;  2QKP A;  4OON A;  5F83 A;  1VB6 A;  2J3T D;  2HJ9 C;  2J9P A;  3NDE A;  3FZC A;  4P85 A;  3OPH A;  5E2H A;  1N9L A;  3O88 A;  1YMS A;  3D3O A;  4OQ0 A;  4P6B A;  2V20 A;  3SW1 A;  4BLM A;  3MZF A;  5FI6 A;  5DKK A;  4H6J B;  2AVX A;  2WK0 A;  4EQ1 A;  3T4L A;  3BLM A;  3IWI A;  5E2G A;  4IED A;  4YIN A;  1H8M A;  4P6Z M;  4PKY G;  3M6H A;  5DF7 A;  2JN7 A;  1ZC2 A;  3PBO A;  2ZLY A;  1DP6 A;  3H7W A;  1ZG6 A;  3ZG8 B;  1KGF A;  5A8B A;  5F1F A;  3Q81 A;  4K0W A;  1K54 C;  4MN5 A;  1VEU B;  1A0K A;  4F94 A;  2RCX A;  5AQ7 A;  2UV0 E;  1L2S A;  2A24 B;  3CI6 A;  5KSC A;  2KX6 A;  1LSW A;  2O99 A;  3GV9 A;  1CJF A;  3O5Y A;  4YFM A;  4Y3I A;  2MJ6 A;  3ZVT A;  1OTD A;  4JF4 A;  4S2N A;  2WKI A;  4X55 A;  5F69 A;  5FAP A;  2Y8H A;  1IKG A;  4R3J A;  3ZCZ A;  4XT2 A;  3HL9 A;  4FD8 A;  3C5A A;  3BW6 A;  3CMZ A;  3HLD A;  2BLS A;  4GCZ A;  3Q7Z A;  1MWT A;  1MWU A;  2I72 A;  1XX2 A;  4KZ8 A;  1YLT A;  2HF6 A;  3O86 A;  2FH5 A;  1UWN X;  4M3K A;  3SOI A;  4DXC A;  4HNB A;  4BBU A;  1S67 L;  4OPY A;  2L4R A;  4G3K A;  4Y17 A;  3VP2 A;  4IHQ A;  5KZH A;  1CEF A;  1K55 A;  3V39 A;  3E98 A;  3FPV A;  4PM8 A;  3EOI A;  5HZH A;  1K6S A;  3WS4 A;  3PBR A;  3IXD A;  4GHI A;  2P9V A;  1LLB A;  2WKH A;  5TR7 A;  2JKT I;  1PI5 A;  1HLU P;  4QY5 A;  2OAQ 1;  3UE6 A;  3LEQ A;  1ALQ A;  2O0Y A;  3TW8 A;  3C7V A;  1E4D A;  5CTM A;  5DTT A;  3MQO A;  4KUK A;  1XGJ A;  2OWH A;  3PTE A;  1LI0 A;  3R4K A;  2A3U A;  3C7U A;  4KZ6 A;  2I9V A;  2J7V A;  2GJ3 A;  5E2E A;  4GNU A;  4GS9 A;  4E3K A;  5CHU A;  3DTM A;  3PAE A;  3N4I A;  3OPP A;  4F3L A;  5KMW A;  1LL9 A;  4G3W A;  1F2K A;  3PBT A;  5CER A;  4EV4 A;  4E3J A;  2Z2L B;  1DP8 A;  3IHB A;  3T4Q A;  4DMZ A;  4IBX A;  3BWL A;  2UWX A;  1MWS A;  3UPN A;  3M2J A;  1KE3 A;  3IBR A;  4YWZ A;  4OQI A;  3H7W B;  5A92 A;  3P01 A;  5KIZ A;  4O8G A;  4I39 A;  2OV5 A;  5GLA A;  2XD5 A;  2JCH A;  5CEB A;  3OPL A;  3IWO A;  5DTK A;  2WZZ A;  1T1C A;  2P04 A;  4NXB A;  1JWP A;  3P7N A;  4GZB A;  4IUH A;  5C5K A;  3NUL A;  1BSG A;  3CAX A;  1BLH A;  2IWB A;  3BJN A;  3IF6 C;  4EXO A;  3QP4 A;  4XT2 B;  4E3I A;  5FSR A;  1XJ3 A;  4LV3 A;  4FSF A;  4DKI A;  1XA7 A;  4OOM A;  2V0W A;  1D06 A;  1CF0 A;  3NDG A;  3ZGA B;  5CRF A;  3ICY A;  1PW8 A;  1CQA A;  5AJG A;  2XGN A;  3PXP A;  2K7S A;  2IWD A;  4II7 A;  3G2Y A;  3G4P A;  5HAR A;  1SKF A;  4C3Q A;  2DMW A;  4JGQ A;  3WS1 A;  2ZC6 B;  4MBK A;  1PZO A;  4LV1 A;  3W4O A;  1SDN A;  1NLZ A;  1GSX A;  4WZ4 A;  1IEM A;  1N4O A;  3ZG9 B;  4JGO A;  2XDM A;  4GHI B;  1Y4O A;  2P9V B;  4Z1W A;  5MC7 A;  2KOI A;  1S4S A;  1JWV A;  2E8J A;  1ES4 A;  3SZT A;  2NUT C;  5HAI A;  4ZRR A;  4BD1 A;  4LGW A;  1DRM A;  4FOF A;  2PHY A;  3QNB A;  4EBL A;  1IKI A;  2ZQ8 A;  4B93 A;  2Q9N A;  4RYE A;  4ZJ3 A;  4D60 A;  3BQ8 A;  1RGZ A;  4ETX A;  5JYO A;  2XRO A;  2V8C A;  3BQA A;  1MBL A;  3UMD A;  4OOY A;  3KSH A;  4OLG A;  4GS9 B;  2Z6D A;  4ETZ A;  4S2M A;  3ZG0 A;  1LT0 A;  1K4F A;  1VM1 A;  4UAA A;  4GDB A;  3WS0 A;  2B02 A;  5HDC A;  2EFX A;  4F3L B;  3V3R A;  4GDN A;  1CI9 A;  3A0V A;  2QHK A;  2L0W A;  1BYW A;  1NZO A;  4Y2F A;  5TFQ A;  3ZG5 A;  3V3S A;  1SCW A;  1NXY A;  1JWZ A;  5DF8 A;  4QJG A;  4N9L A;  1NYM A;  4ESP A;  3UPO A;  5L2F A;  2ZC3 B;  3C8C A;  2JE5 A;  2ZM0 A;  1OTI A;  1P9R A;  1LHY A;  5FAO A;  1Y54 A;  2EX6 A;  1N9O A;  2EX2 A;  4I5S A;  5CXW A;  1OTB A;  2Y59 A;  5CGS A;  5FEF A;  3KYZ A;  5GHX A;  4KZ3 A;  3ZNT A;  2ZM2 A;  2PYR A;  3IH8 A;  5EPH A;  1XPB A;  2PRF A;  2HDQ A;  4IVI A;  3BFD A;  1WYB A;  4U3T A;  4BL2 A;  3N7W A;  3RJU A;  4OLD A;  5L07 A;  1KGE A;  1J3W A;  3CZD A;  4HES A;  3U2A A;  3HLB A;  2HDS A;  4ZJ2 A;  5F82 A;  4WF0 A;  4WEJ A;  4GB7 A;  4I38 A;  3K3C A;  4HJ4 A;  1CI8 A;  2EX8 A;  3LR3 A;  5DVA A;  5HAP A;  3MJQ A;  1OPX A;  5AQ9 A;  3WRT A;  3LY4 A;  3AGE A;  1HD8 A;  1NWZ A;  2XRN A;  2M7U A;  1XA1 A;  1I5Q A;  4OOL A;  5J4E A;  5HD3 A;  1EI5 A;  5JYP A;  2PYP A;  3MBZ A;  3HBR A;  2VX8 A;  4CQH A;  2WAD A;  1NJ4 A;  4LRX C;  3ZQ5 A;  3GTC A;  3B3X A;  3HLF A;  3S4X A;  2KDK A;  4KZB A;  3CLO A;  1O07 A;  3MS6 A;  3IBJ A;  4FCF A;  4UA7 A;  1UWP X;  3DBA A;  4JBF A;  5HL1 A;  3G34 A;  3NJA A;  3HLE A;  3LFV A;  2WAE A;  4QY6 A;  1QME A;  2Y2O A;  5DJU A;  4O01 A;  1STZ A;  3A3E A;  3GVB A;  2XH9 A;  4WEL A;  1BTL A;  3H9W A;  4KQO A;  4N1X A;  5HL6 A;  4NXG A;  4WLA A;  1ESI A;  3B33 A;  1NRJ A;  1N9B A;  2ZM8 A;  3NOT C;  3RFB A;  5EE8 A;  1F5M A;  4Q0J A;  2Y4A A;  1XJ2 A;  3S22 A;  4K0X A;  1WYC A;  1TVF A;  2EA9 A;  4X25 A;  1E25 A;  2H5S A;  5GL9 A;  5E43 A;  4D2O A;  4DJ2 A;  4O7D A;  2WYX A;  4PM9 A;  4EER A;  3IX3 A;  4CLC E;  1MKM A;  1P0Z A;  5IHV A;  1KGG A;  3TJZ C;  1K4E A;  3MKE A;  3NOP C;  5EVI A;  4E04 A;  1V9Z A;  4HI4 A;  2VV7 A;  4CLC A;  3Q7V A;  3MZD A;  1SKO A;  4DDS A;  4XUX A;  4PKY A;  4CPK A;  3HUN A;  1VQQ A;  1D1J A;  1F9I A;  3E4P A;  2ZD8 A;  1XGI A;  4UQI S;  2OSU A;  4BBT A;  3VFH A;  4ZAM A;  2VJW A;  5L8M A;  4DE0 A;  3IT9 A;  1ONH A;  5AVF A;  1W5D A;  1BUL A;  2WGI A;  1K38 A;  3A3D A;  1U60 A;  3P09 A;  1FR1 A;  5HD5 A;  4GLQ A;  4WZ5 A;  1TF1 A;  2W1T A;  4GJ4 A;  4I3A A;  3SS3 A;  2HP5 A;  5J3W A;  1H0M A;  3HRE A;  3LR5 A;  3A0S A;  2VKS A;  3E4Q A;  4MEZ A;  5EM0 A;  3KYQ A;  4A5R A;  1SZV A;  2JC7 A;  5FI2 A;  5FQQ A;  4MN7 A;  3TG9 A;  3MFD A;  3LI9 A;  5HWV A;  5DJT A;  4IUK A;  3VOL A;  1TD5 A;  3LIF A;  2JHE A;  4LLO B;  4MCW A;  2XR0 A;  4R3B A;  3SH7 A;  2QWS A;  5G4Z A;  3DW0 A;  2EWV A;  3IX4 A;  4IVK A;  1K56 D;  2C5W B;  3BFF A;  4E6W A;  4EUV A;  2IA2 A;  3G30 A;  4EWF A;  4UHU A;  4HH3 A;  4E6X A;  1E3U A;  3WWX A;  4QU3 A;  3E2K A;  5IS1 A;  4ME4 A;  3LIB A;  4BWI A;  4I3J A;  4HQA A;  4PM5 A;  3BM6 A;  1NY0 A;  2Y2I A;  2RL3 A;  3OOV A;  2B18 A;  2ZL1 A;  1MPL A;  5HSQ A;  2Y2Q A;  1FCM A;  4KZ7 A;  5F5Y A;  3UB7 A;  3CIT A;  3VV4 A;  3KSG A;  2WGW A;  4HJ6 A;  3PYP A;  1QMF A;  1G68 A;  4HHD A;  2YKF A;  5CHM A;  3R7W A;  2M7V A;  5DFX A;  4IJG A;  3TOI A;  3KX0 X;  3SS5 A;  4GN2 A;  2G2W A;  2Y79 A;  1RGY A;  4BD0 A;  3GRJ A;  4BBV A;  2ZC7 A;  3SS4 A;  3MQ0 A;  1OT6 A;  5L10 A;  4KG6 A;  2VLG A;  3LIC A;  1YLY A;  1Z6F A;  2WKQ A;  4NKP A;  3W2Z A;  5FQJ A;  3QNC A;  5EVI B;  4B88 A;  4CLC B;  3Q7V B;  4PM6 A;  1SKO B;  4S2P A;  3ITB A;  4B4Z A;  5EOE A;  3DTE A;  3ULF A;  1GHM A;  4HEF A;  4OKP A;  3LR0 A;  4HOI A;  2PR6 A;  1L0D A;  4NK3 A;  1H8Z A;  3T4J A;  4DRT A;  4Q0H A;  5D3O A;  5FQM A;  1W7F A;  4FUW A;  4WYY A;  1WA9 A;  4OQH A;  1GSV A;  2HJE A;  5A90 A;  4QPR A;  3A0R A;  2P7J A;  2W1T B;  4WEK A;  3A3F A;  2ZC4 B;  3HLG A;  2XSS A;  3QP5 A;  4R23 A;  1TS0 A;  5BOH A;  3EQU A;  1HVB A;  2ZMV A;  1XJ6 A;  4DXB A;  2A2L A;  1YLZ A;  4JLF A;  3V67 A;  1GA0 A;  2G2U A;  2VZW A;  3CUE C;  3HVF A;  1K57 C;  3IX8 A;  1ES5 A;  4KZA A;  5HPI A;  3T4O A;  1VET A;  4Y5F A;  2V1A A;  3SH9 A;  3BFG A;  5AVE A;  2GNX A;  5A93 A;  3S7O A;  3UN7 A;  3ZYT A;  4X1M A;  3EGD C;  4KQD A;  5KSH A;  2VGL S;  4FTX A;  1SDE A;  2QMI A;  4X56 A;  3IF5 A;  1F98 A;  4RX3 A;  4QB8 A;  1W8Q A;  2ZL1 B;  1YLJ A;  2PD8 A;  1P9W A;  4GOG A;  3K3D A;  4WMC A;  1I2S A;  3BRM A;  3B42 A;  3IWQ A;  2WGW B;  4HH2 A;  4S2O A;  3MMH A;  4FH2 A;  1N9N A;  4OPZ A;  3R7W B;  3WS2 A;  2QJ7 A;  3RTY A;  3DTK A;  3I7J A;  2Z2M B;  4LV2 A;  2H10 A;  2W3G A;  5TGF A;  4OP5 A;  1PZP A;  3UE1 A;  2JKR I;  3V50 A;  3Q1F A;  4HP9 A;  4PM7 A;  1TDL A;  2JKF A;  5EFW A;  1Q2P A;  1FIL A;  5HWT A;  4YNR A;  2R78 A;  5GHY A;  4S2J A;  5DTS A;  1YPR A;  5FI7 A;  3VOZ A;  1RP5 A;  2GDN A;  4R4S A;  3MR0 A;  4N9K A;  5DFY A;  3G32 A;  2VV8 A;  3GQZ A;  1PNE A;  3OC2 A;  2V2F F;  1H3Q A;  3RH8 B;  3LGO A;  4DE3 A;  4YOF A;  4R70 A; 
#chains in the Genus database with same CATH homology
 2VX8 A;  3E0Y A;  4CQH A;  1IOU A;  4LRX C;  3ZQ5 A;  4BMW A;  2QJ5 A;  3C38 A;  1H8M A;  4P6Z M;  4PKY G;  2KDK A;  4P6Z S;  4EET B;  3CLO A;  4B9O A;  1G28 A;  5TJJ A;  2JN7 A;  3IBJ A;  1UWP X;  3DBA A;  3PBO A;  3H7W A;  1DP6 A;  3BY8 A;  4MDZ A;  4AFI A;  5A8B A;  3NJA A;  1W63 Q;  1W63 M;  3LFV A;  4MN5 A;  5HWW A;  5DJU A;  4O01 A;  1STZ A;  2Z6C A;  2V0U A;  4WEL A;  3H9W A;  4KQO A;  1ZTU A;  2A24 B;  3CI6 A;  5HL6 A;  4NXG A;  2KX6 A;  1LSW A;  2O99 A;  5TBM A;  3LI8 A;  5K5B A;  3T4S A;  4MMN A;  1OTA A;  4WLA A;  3O5Y A;  4Y3I A;  2MJ6 A;  1OTD A;  3B33 A;  4GW9 A;  3EEH A;  1LSX A;  2PDR A;  1NRJ A;  1V9Y A;  5F69 A;  2Y8H A;  3LYX A;  3NOT C;  4XT2 A;  3RFB A;  1F5M A;  4Q0J A;  2W3E A;  1XJ2 A;  3BW6 A;  3T50 A;  4UEY A;  3TRC A;  4GCZ A;  4HJ3 A;  2EA9 A;  4DJ2 A;  3CWF A;  3PR6 A;  2HF6 A;  2FH5 A;  1UWN X;  3LUQ A;  3VE3 A;  3UB9 A;  4HNB A;  4JGR A;  4BBU A;  4O0P A;  4EER A;  4CLC E;  1S67 L;  1YSQ A;  2L4R A;  1MKM A;  3PBQ A;  1P0Z A;  3TJZ C;  2ZOI A;  4G3K A;  5DF9 A;  3HJI A;  1OT9 A;  3NOP C;  4IHQ A;  2JKT M;  4RQ9 A;  4E04 A;  1V9Z A;  2PD7 A;  4HI4 A;  2VV7 A;  3E98 A;  4CLC A;  2OAP 1;  2P08 A;  3FPV A;  4ARZ B;  3EOI A;  2CMN A;  4PKY A;  5HZH A;  1TS8 A;  3PBR A;  5DKL A;  3B47 A;  4GHI A;  3FC7 A;  1F9I A;  3OBF A;  3PBN A;  3E4P A;  4UQI M;  4CLC C;  4UQI S;  2O9C A;  2JKT I;  2VV6 A;  4BBT A;  2VA0 A;  1Y28 A;  3T4K A;  2OAQ 1;  1TS6 A;  2VJW A;  3EWK A;  3UE6 A;  2O0Y A;  5L8M A;  3TW8 A;  2K2N A;  3PHY A;  5AVF A;  3KSF A;  2M1C A;  2WKP A;  4DN0 A;  4EW7 A;  1S66 L;  5HD5 A;  3MQO A;  3F1O B;  4GLQ A;  4KUK A;  3NHQ A;  3F1P B;  2OWH A;  4Q0I A;  1TF1 A;  3R4K A;  2W1T A;  3GEC A;  4G3V A;  4GJ4 A;  4I3A A;  5J3W A;  2ZBB A;  4EU0 A;  4BJP A;  3LR5 A;  3LIE A;  2I9V A;  3A0S A;  2VKS A;  3E4Q A;  2GJ3 A;  4GS9 A;  3KYQ A;  4MN7 A;  1OJG A;  3LI9 A;  1JNU A;  3F1N B;  5HWV A;  1GSW A;  5DJT A;  4MN6 A;  2J3W A;  4IUK A;  4EEP A;  3VOL A;  1TD5 A;  3LIF A;  1G6O A;  2JHE A;  4LLO B;  4MCW A;  3GDI A;  4F3L A;  2QWS A;  5G4Z A;  3FG8 A;  4LRZ E;  1NLY A;  2EWV A;  4G3W A;  2ZOH A;  3PBT A;  2W0N A;  4EUV A;  2IA2 A;  1DP8 A;  3T4Q A;  2O9B A;  2YKH A;  4HH3 A;  4DMZ A;  1DP9 A;  3BWL A;  4R3A A;  5J7E A;  3IBR A;  4KUO A;  4ME4 A;  2H28 A;  3LIB A;  1TS7 A;  4YWZ A;  3UE3 A;  5IS1 A;  5IT5 A;  3MFX A;  3H7W B;  4BWI A;  3P01 A;  3OLO A;  5KIZ A;  2W3D A;  3JVU A;  1XFN A;  4I3J A;  4O8G A;  4HQA A;  4LRY C;  4I39 A;  3EQV A;  4R6L A;  4WL9 A;  2GX5 A;  3OOV A;  2B18 A;  4K08 A;  2ZMF A;  3NOU C;  1S4R A;  5HSQ A;  5TBM B;  1YSP A;  3BY9 A;  1T1C A;  1ZHH B;  3UB7 A;  5F5Y A;  2P04 A;  3CIT A;  4NXB A;  3P7N A;  3KSG A;  3VV4 A;  3D72 A;  4HJ6 A;  4IUH A;  5C5K A;  1LL8 A;  3PYP A;  3MXQ A;  4HHD A;  2YKF A;  3TE8 A;  3R7W A;  3CAX A;  5LBR A;  2M7V A;  5DFX A;  4IJG A;  3BJN A;  1MC0 A;  1OTE A;  3IS2 A;  4NXE A;  3KX0 X;  4XT2 B;  2W3F A;  4EXO A;  1X0O A;  1XJ3 A;  5FL3 A;  2Y79 A;  2FZ0 A;  4FSF A;  2VEA A;  4OOM A;  4BBV A;  3K2N A;  2V0W A;  2J80 A;  3MQ0 A;  1D06 A;  1OT6 A;  5HDD A;  3ICY A;  2VLG A;  5AJG A;  3LIC A;  3HCY A;  2J3T C;  4M4X A;  5I5L A;  4LPZ A;  3PXP A;  3G6O A;  4WN5 A;  2K7S A;  4II7 A;  5F68 A;  2WKQ A;  2W3H A;  2NUP C;  1S1Y A;  2K31 A;  4NKP A;  1VHM A;  2DMW A;  4JGQ A;  3T4T A;  3W2Z A;  3HJK A;  3LR4 A;  1T1A A;  1KOU A;  4CLC B;  3H82 A;  1NLZ A;  1GSX A;  5HDS A;  4HY8 A;  4H6J A;  4JGO A;  4GHI B;  3E4O A;  4Z1W A;  3C2W A;  5MC7 A;  2KOI A;  1S4S A;  3ULF A;  2BAS A;  4CLC D;  2NUT C;  3S7Q A;  1ODV A;  3LR0 A;  4HOI A;  4PHT A;  4ZRR A;  3JVV A;  2OWJ A;  2PR6 A;  2W27 A;  3LIA A;  2GZA A;  1DRM A;  4FOF A;  4L9E A;  3T4J A;  2PHY A;  4Q0H A;  5IU1 A;  1LSV A;  3S7N A;  4B93 A;  4WUJ A;  3BQ8 A;  1WA9 A;  1GSV A;  3KSI A;  4ETX A;  2HJE A;  2XRO A;  4HIA A;  3BQA A;  4QPR A;  3A0R A;  2P7J A;  5F6A A;  2W1T B;  4WEK A;  3UMD A;  3KO6 A;  3MQQ A;  3UB8 A;  2XSS A;  1T1B A;  3KSH A;  4GS9 B;  2Z6D A;  1TS0 A;  3UME A;  4ETZ A;  2WKR A;  3PBS A;  3CUE A;  3EQU A;  1LT0 A;  2A24 A;  2ZMV A;  3OCN A;  2HV1 A;  1XJ6 A;  4L0L A;  2A2L A;  2B02 A;  5HDC A;  5G4Y A;  2XA7 M;  4F3L B;  3V67 A;  2XA7 S;  4L9F A;  2VZW A;  2EWW A;  4DJ3 A;  1UGU A;  3A0V A;  3CUE C;  2QHK A;  2L0W A;  1BYW A;  5HPI A;  2PT7 A;  4HP4 A;  4Y2F A;  1YAX A;  2W1R A;  3T4O A;  4Y5F A;  1OJ5 A;  2V1A A;  5AVE A;  2GNX A;  2INW A;  2KLI A;  4JGP A;  3S7O A;  3ZYT A;  3EGD C;  4EES A;  4PAU A;  4KQD A;  5KSH A;  2VGL M;  4NEE D;  1MZU A;  2VGL S;  4EEU A;  1F98 A;  2V1B A;  3C8C A;  1OTI A;  1P9R A;  1T18 A;  1P97 A;  4R38 A;  1N9O A;  1YKD A;  4I5S A;  3S7P A;  4I3I A;  1S1Z A;  2PD8 A;  1P9W A;  3K3D A;  3MF0 A;  2D02 A;  3OCL A;  3B42 A;  1OTB A;  2LB9 A;  3VE4 A;  2JKR M;  4HH2 A;  4ARZ A;  3MMH A;  3KYZ A;  1N9N A;  3C30 A;  3R7W B;  2QJ7 A;  3EGX C;  3IS2 B;  2PYR A;  3EEA A;  3RTY A;  2PR5 A;  3LID A;  2QYB A;  5CX7 A;  3UB6 A;  2W3G A;  1XFQ A;  2D01 A;  2O9A A;  2L1M A;  5HPF A;  2JKR I;  4HP9 A;  1EW0 A;  2QKP A;  2G7U A;  2LB5 A;  4NXF A;  1VB6 A;  1T19 A;  2J3T D;  5EFW A;  3U2A A;  2OOL A;  2HJ9 C;  3F1O A;  5HWT A;  4WF0 A;  4WEJ A;  3F1P A;  4YNR A;  2R78 A;  4I38 A;  3K3C A;  1N9L A;  4HJ4 A;  3LR3 A;  3D3O A;  1IFQ A;  3MJQ A;  1OPX A;  3SW1 A;  2V9A A;  3FPW A;  3H82 B;  3MR0 A;  5DFY A;  1D7E A;  2VV8 A;  3OC2 A;  4L9G A;  5DKK A;  1NWZ A;  4H6J B;  2XRN A;  3F1N A;  1H3Q A;  2M7U A;  3RH8 B;  5J4E A;  4OOL A;  5HD3 A;  4EQ1 A;  2PYP A;  4YOF A;  1XJ4 A;  4R70 A;  3T4L A;  2HGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...