4CLCC

Crystal structure of ybr137w protein
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
173
structure length
173
Chain Sequence
b'MVVLDKKLLERLTSRKVPLEELEDMEKRCFLSTFTYQDAFDLGTYIRNAVKENFPEKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSDYPYACLTISGLKQEEDHLMAVSSLIAFANESLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0303 PROTEIN YBR137W
publication title Structural and Functional Characterization of Ybr137Wp Implicate its Involvement in the Targeting of Tail-Anchored Proteins to Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 53
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4clcC00
4CLCB 5CX7A 2A2LA 4BMWA 4CLCA 4CLCD 4CLCE 4NKPA 3FPWA 3FPVA 4CLCC
chains in the Genus database with same CATH superfamily
4KUOA 4UAAA 4MBFA 3Q07A 3LY3A 5E2EA 3VFHA 1SKOA 4KENB 3LIEA 4QWOA 3KSFA 4NXFA 4PMAA 5L8MA 3HLEA 4WZ5C 1XPBA 1KDSA 2NUTC 4HJ6A 2OAQ1 4EBNA 1OT9A 1MKIA 1GSXA 3CI6A 4KQQA 1SHVA 5EUAA 1CI9A 1I5QA 4R23A 5F82A 3JYIA 2ACGA 1P9WA 3B33A 3VP1A 4MLLA 1BSGA 5GHZA 3ZVTA 3DBAA 1STZA 4DKIA 1LSVA 4OP5A 3EWKA 4Y0UA 5E2FA 1ODVA 2ZMFA 4OPYA 5K5BA 1WYBA 1OMEA 2J3TD 2RCXA 1YLYA 2O9CA 5GLAA 2R9XA 4JF5A 1RCJA 2JE5A 3SH9A 2ZJ9A 1JWZA 4X69A 2Q9NA 2JCHA 3ZNYA 2Y2NA 2PHYA 1VEUB 4WZ5A 2CMNA 2V1AA 5FI6A 2ZM0A 2DCFA 3U2AA 4R3AA 4LRZE 4P85A 1M6KA 4GB7A 1MWTA 3BECA 4WN5A 5CERA 1TDGA 4N1HA 4DXBA 2ZBBA 2C5WB 3BRMA 2JKRI 3ZDJA 3RFBA 1MPLA 4K0XA 3CWFA 4OQGA 4Y3IA 5EM0A 4NEED 2Y59A 1CF0A 2WAEA 2WZZA 3C5AA 5F6AA 2HP5A 3C7UA 3NI9A 4FD8A 4OQHA 4FUWA 2DNSA 3DTKA 2VGLS 4EBLA 2QMIA 2P7JA 4QD4A 1BYWA 3CAXA 4L9FA 2Y4AA 4X55A 2XRNA 5DTSA 1N9NA 1GHIA 1XA7A 4KZ3A 1BULA 4ID4A 2J80A 4HNBA 1SKFA 4HBUA 2X71A 3SS5A 1VETA 4YINA 3E4QA 1L0EA 1ESUA 1EROA 2HGVA 2RL3A 4I39A 1G6AA 1ZKJA 2HP6A 3UB6A 3W4PA 3T4LA 3OZHA 5DFXA 3UB7A 3BY9A 2G2UA 1K6SA 5L09A 3K3CA 4N1XA 3WS1A 3S22A 5G18A 2VKSA 5HWVA 4ZBEA 2H10A 5J3WA 4BLMA 1D06A 4FCFA 5DTTA 4MNRA 3V5MA 4HIAA 2X01A 2P08A 3NOTC 3BFCA 2QKPA 1ACFA 4S2OA 5GLCA 3W8KA 3MFDA 3OCLA 3VV4A 5D3OA 1P0ZA 5HZHA 3IBRA 3F1PA 4B4XA 1T18A 2XD5A 2HJ9C 2EA9A 2A24B 3MS6A 5A91A 3IXDA 3ITAA 1O07A 3AGDA 3D3OA 1W5DA 5FL3A 2HPBA 5HL6A 3IX3A 1XX2A 2BASA 1CI8A 1UWPX 1YKDA 2Y2QA 2BTFP 1KE3A 4QB8A 4XT2B 3O87A 1FCNA 5EV0A 1GHPA 4OQIA 2V20A 2ZQ7A 1ONGA 3QP8A 1SDNA 3A3EA 1Z6FA 4OPZA 1PZOA 4OQ0A 3OPPA 5IT5A 4NXEA 4KQRA 3S7QA 4ZJ2A 5TBMB 1K55A 2A3UA 3OLOA 3A3IA 3V3SA 2KLIA 1NWZA 2WZXA 3VE4A 3LIAA 3T4TA 1JTDA 2XEPA 2EWVA 1KVLA 3CLOA 4WMCD 5HWTA 3VSKA 1FILA 1XGJA 3H82A 1BZAA 1ES2A 1OTAA 4F3LB 4KZ8A 3A0SA 4WF0A 2FZ0A 2X02A 3GV9A 4JGPA 2ZQCA 4U0XA 2WGVA 1OTBA 1LLBA 2J3WA 4KZ6A 4LCLA 4DJ3A 4OOLA 2ZC5B 4BL3A 3CUEC 4OONA 2ZQAA 2EFXA 1Z09A 5HDSA 1TDLA 5HL1A 3MKEA 5HSQA 1YSQA 5A90A 5FQ9A 2HV1A 2L0WA 4EV4A 1LL9A 4KG2A 4KG6A 2PAVP 3HBRA 2OOLA 4HP9A 3IF6B 1O7EA 5E2HA 4IJGA 1VQQA 5HAPA 1SKOB 1I2WA 4M3KA 4LFUA 4Q0JA 3UDFA 2PBYA 1ZC2A 2JKGA 1PIOA 2W1TB 1JNUA 4CLCD 5CEBA 1NJ4A 3OC2A 1FSWA 2W3GA 3BEBA 5DKKA 3S1YA 1T1BA 1K4EA 3SW1A 1LT0A 4JGRA 4UA6A 2VX8A 1TD5A 4LV2A 4MDZA 4EUZA 2VA0A 2KOIA 3CUEA 4I38A 4P6ZS 3UPOA 4Y17A 2QHKA 5FI2A 3ZG5A 4DE0A 5EE8A 5E43A 4QY6A 2ZQ9A 5TFQA 2D01A 4ME4A 2MJ6A 4MN7A 3MZFA 3Q81A 1XA1A 2JN7A 5AQ9A 1NYMA 2OSUA 3RXXA 2ZMVA 4O0PA 3DTMA 4WYYA 3ZGAB 1TS7A 4WBGA 5FA7A 1NZUA 5F1GA 4HOIA 2VK3A 2GZAA 4LCMA 1PRQA 2J9OA 4KZBA 3CHWP 3BW6A 3ZNTA 3R7WA 1I2SA 2DMWA 4C6YA 3E98A 2ZMAA 1XJ6A 5EFWA 3TW8A 2IA2A 2VGJA 4I3JA 2G7UA 2GX5A 5CX7A 3F1NA 2XF3A 3T4OA 1L0DA 3HLGA 1N9BA 5KSCA 4GLQA 3PR6A 3UB9A 4EEPA 4NK3A 1GSWA 1DP8A 5F1FA 1VHMA 2L1MA 3HJIA 3UMEA 4RX3A 4B88A 1Q2PA 4Y13A 2EX9A 4DDYA 5CXWA 4YWZA 2EWWA 3WRTA 5FQJA 4IBXA 1G28A 4L0LA 4E3KA 3IBJA 1M40A 5HDDA 2PT7A 1QMFA 1VETB 3HLDA 4GDNA 4CLCC 3A0RA 1DP9A 4ETZA 2HDSA 3M6BA 4ZAMA 4EEUA 3BY8A 2PYRA 4UQIM 1TEMA 2XD1A 5FEFA 3IXHA 1K25A 4E3NA 3GTCA 3LO7A 1YT4A 1FR6A 4JXGA 1NRFA 4RYEA 4KZ9A 4OPQA 3QP1A 1IOUA 1GSVA 5KZHA 3F1OB 3S7PA 1CJFA 4KUKA 1PW8A 5EECA 3VMAA 1UWNX 3W2ZA 3C8CA 1YAXA 1P97A 2KDKA 3QP2A 2V1BA 4X53A 3E4PA 4C3QA 3F1PB 4S2IA 2QJ5A 3FZCA 4GCZA 1PW1A 5CTNA 4BQMA 2XLNA 5HFOA 4HY8A 1H8ZA 4CLCA 4QJGA 4JXSA 4PM5A 4E3OA 1QMEA 3GR2A 1K54C 3GMWA 1YPRA 2V1ZA 3A0VA 3HLWA 4DXCA 1HD8A 4S2PA 3K3DA 2PR6A 3LICA 3VOYA 3G2YA 3N8LA 1OTDA 3SH7A 4S2NC 3CPTA 3HLBA 1W7FA 4WEJA 1W63Q 4Y15A 3KO6A 2WK0A 2Y55A 5AQBA 3NECA 3SS3A 4RQ9A 5FQQA 4JPMA 1TS8A 1E25A 1L0FA 3GDIA 4XXRA 3M2JA 2V0WA 2XQZA 2W3HA 1KGGA 4H6JA 2ZL1A 4I5SA 5IS1A 3RXWA 2WYXA 5HAQA 1YLTA 3Q7ZA 3QP5A 2FFFB 3LYXA 5IHVA 3MFXA 1IKGA 1K54A 4JGQA 3WS5A 5FAQA 2WAFA 3T50A 4WEKA 4ESPA 2HZ5A 4EW7A 3V39A 4WLAA 1ZTUA 4S2NA 2QPNA 4GZBA 5EPHA 3HUOA 4OKPA 5DKLA 1HLUP 1ES3A 4PM8A 2PU2A 1TS0A 3ULFA 2VV6A 3WS2A 5F69A 3MZEA 4MN6A 2O0YA 4BD0A 1W8QA 2YKFA 4M4XA 3OBFA 1PI5A 4QHCA 5KMWA 3V50A 3MQOA 4GHIB 4YFMA 4B9OA 5M19A 1SDEA 1K57C 4H8RA 1DRMA 1S4RA 1K56D 4E3MA 3LUQA 3EEAA 4ZJ1A 2M1CA 1KVMA 4KZ7A 1KOUA 3IQAA 5EVLA 4JKTA 4MBHA 2BLSA 3IXBA 1FCOA 4DE2A 3CJMA 4OP8A 1RGZA 4R38A 4R1GA 1CQAA 4Y2FA 4X68A 5AQAA 4C75A 4CQHA 2W0NA 3PTEA 3VSLA 3PBQA 3LI8A 1ES5A 1SCWA 2H0TA 3ZG8B 5U47A 2HJEA 4JXVA 3LI9A 1LL8A 2ZD8A 3VP4A 4Y0TA 2W3FA 4ARZB 4Y5FA 1K57A 4EUVA 3BFGA 5J4EA 4BWIA 2ZC7A 4KZ4A 3R7WB 5DF7A 3DAVA 4EXOA 3EQVA 1OPXA 3MQQA 5A8BA 2W27A 1S67L 4GS9A 2JKFA 3HUNA 1Q2QA 4GKUA 2VGLM 3VP3A 3F1NB 5DTKA 3EOIA 5FSRA 5M18A 2OAP1 1VM1A 2Y79A 3M2KA 2ZLYA 1NLYA 2XSSA 2IWCA 1S4SA 3C4PA 5CHMA 4BENA 3NDGA 5HPIA 3PYPA 3LFVA 1S0WA 3N7WA 1MWSA 2PBDP 3E4OA 2QYBA 3IWOA 5I94A 3GVBA 1E3UD 1NYYA 5M1AA 3NIAA 3VE3A 3ZG9B 5AVEA 4IHQA 2HDUA 4ZJ3A 1C3BA 2WGIA 5CGSA 5GLBA 3VP2A 5FQMA 4O01A 3G34A 5HW3A 3MXRA 4PKYA 2XFTA 3FKVA 1TS6A 3NC8A 3N4IA 2OWHA 3MXSA 5CGWA 4OLGA 3IS2B 3ZYTA 3S7OA 2HF6A 3Q7VA 1OJ5A 4UEYA 3T4KA 1XGIA 4X25A 1ERMA 2GJ3A 5FAOA 4KZ5A 4GD8A 3JVUA 2VZWA 3O3VA 1LSXA 1PI4A 2UWXA 3LEZA 5HX9A 1K4FA 2EX6A 5F83A 3OCNA 4OOYA 5CHUA 3G4PA 2P9VA 3IWIA 2WKRA 3O88A 1MXOA 2PRFA 4WL9A 1MKMA 2K2NA 4CLCB 2OV5A 2O9AA 1K56A 3NJAA 4E3IA 3NY4A 3S7NA 3RTYA 4GDBA 2Y91A 3G6OA 4L9GA 2Q0OA 3A3DA 3P01A 4YOFA 4K0WA 3Q1FA 5CTMA 3H7WA 4R6LA 1XXMA 2VV7A 2WKHA 3CPTB 4UA7A 3WWXA 1XJ2A 1XJ4A 2Y2KA 3C30A 1DY6A 2H0YA 1L0GA 4EBPA 3T1QB 3QHYA 2JBFA 1IYPA 4HBTA 2EXBA 1S1ZA 4S2LA 1VEUA 2OLUA 2EXAA 5TJJA 2ZL1B 3LGOA 2PD8A 3FWLA 1TVFA 2ZOIA 2Q9MA 2Y2HA 1YM1A 1AXBA 2VV8A 3IX8A 2VGKA 3P7NA 4S2KA 1LSWA 1MBLA 3BFFA 1D7EA 1W79A 3GQZA 2XGNA 3BJNA 4DDSA 1PWDA 4B4ZA 2LB5A 5HPFA 3DWKA 4MEZA 5EOEA 4KG5A 4FSFA 2B95A 4B93A 4LRYC 4RX2A 3FG8A 4JGOA 4R0QA 4NG2A 5FDHA 3ZCZA 3FC7A 4G3VA 4L9EA 3ISGA 4S2JA 1ESIA 4MBKA 2XA7M 4X1MA 2UV0E 3CZDA 1HVBA 2AVXA 2G2WA 1FIKA 2OWJA 4P6ZM 1BLSA 4BBVA 1E3UA 5HAIA 4K08A 2W1RA 2XROA 3H9WA 3VFFA 3VOZA 2VJWA 3OOVA 1H0MA 1IELA 3MBZA 2I9VA 1YLZA 5MC7A 5E2GA 4HEFA 5EVID 3T4SA 2XH9A 3ZG7B 5C5KA 2XK1A 3FKWA 3U4LP 3G31A 1N4OA 3C4OA 4RA7A 4EESA 3LR4A 2LB9A 3EEHA 4IVKA 2WKPA 1CK3A 3DTEA 2Y8HA 5GLDA 4EU0A 4UQIS 2ZM8A 2E8JA 2PDRA 3IF5A 4AFIA 1E4DA 3LR3A 3MR0A 4IBRA 1FR1A 2A24A 2FFYA 3C38A 3BYDA 3S4XA 4LGWA 1MWRA 1YSPA 1YLWA 3ZVWA 5HD5A 4DE3A 2V0UA 3UDXA 4GS9B 1MZUA 4BBUA 3VP0A 4DMZA 1EI5A 4MMNA 1OTIA 1N9OA 3PBTA 4OH0A 3PBNA 1GA9A 3BFDA 4IVIA 1P9RA 2JKTI 3R4KA 2FH5A 4O8GA 1W8YA 3IF6C 1ES4A 2PYPA 5TBMA 1SZVA 3BM6A 2WGWA 2ZOHA 3BQAA 4HHDA 5L2FA 3BLSA 4Z1WA 1FQGA 4R4SA 5KIZA 4EERA 3UB8A 4E6WA 3ZG0A 1KDWA 2QZ6A 4LPZA 4G3WA 1KGEA 3MMHA 3L7HA 4R3JA 1OJGA 2NUPC 3EGDC 5A93A 1YMSA 1OTEA 1JWVA 5L07A 4EWFA 4P6BA 3QNBA 4LV1A 1LL5A 4N9KA 4NXBA 1EWZA 3T1RA 5EVIC 2IWDA 4WELA 1J3WA 3PBSA 4OVDA 1IYSA 3UE0A 1LI0A 1F2KA 2YKHA 3Q7VB 2WKIA 3FPWA 4OPRA 5DF9A 3HCYA 3I7JA 4PM9A 3IF6A 4Z9QA 1VB6A 2PD7A 3C2WA 5FQKA 4LENA 3B47A 3C7VA 5HARA 5TR7A 3IX4A 1BTLA 3IH8A 2V9AA 3HJKA 4WM9A 1PWGA 4KZAA 2P9VB 4X6TA 2ZM2A 5HWWA 3DW0A 3H82B 2W1TA 1X0OA 3O5YA 1YLJA 4EQIA 4WZ4A 3OPHA 2A2LA 1NLZA 1TF1A 4GJ4A 2ZC6B 5EVIA 1EW0A 3MKFA 5DJTA 2EX8A 3NHQA 3H7WB 3UE3A 3JVVA 3UB5P 1DJCA 2W3EA 2PR5A 3KYZA 2JKRM 3ICYA 1YMXA 1KE4A 4BL2A 3GRJA 3E0YA 3KX0X 4ZDXA 3UMDA 3PBOA 4DN0A 2V8FA 2Y2OA 4BMWA 4DF6A 4ETXA 4JLFA 2PU4A 4Y0OA 1IKIA 1KE0A 4HI4A 2WKQA 3UN7A 3P98A 4Q8IA 1MWUA 2J7VA 3TSGA 3N8SA 1GA0A 3AGEA 5DJUA 5HDCA 1KGFA 1V9YA 3TRCA 3G35A 3PXPA 3N6IA 2Y2JA 4HP4A 3KYQA 4FH2A 2XR0A 5AVFA 1H5XA 4D60A 3VOLA 4DE1A 1H8YA 3V67A 1BLHA 3FPVA 2Y2PA 2A49A 1S1YA 3G30A 4G3KA 3PAGA 5AQ7A 2HDQA 1AWIA 4MN5A 3PHYA 1PFLA 4E04A 1XJ3A 4PPRA 5DFYA 1NY0A 3BFEA 3MQ0A 1S6RA 5F5YA 3G2ZA 5GHYA 1LHYA 2M7UA 3ZQ5A 2WADA 4BJPA 3NOUC 1F98A 1G68A 3HVFA 3IH9A 1WE4A 3HLCA 3MZDA 3UO9A 3LIFA 4I3AA 1DJBA 3UE6A 4IUKA 1G6OA 2JHEA 2K31A 4EQ1A 3JPUA 3LR0A 2V2FF 5EOOA 4WUJA 5TGFA 4P0MA 2GNXA 2P04A 2J3TC 3F1OA 3IWQA 2ZQ8A 3SOIA 1Y54A 2VEAA 4KQDA 1K55C 5FASA 3TOIA 1ONHA 2H5SA 3QNCA 4HJ3A 4KQOA 2QWSA 3RJUA 4HESA 1HZOA 3FYZA 4LRXC 4EETB 1BLCA 5DF8A 3IT9A 3L9KA 4ZRRA 1K6RA 3UE1A 4HQAA 1YLPA 4NKPA 2B18A 3P09A 3TG9A 3SZTA 3TE8A 1IFQA 3LCEA 4HH3A 1HTZA 4HH2A 5G4ZA 3KSHA 1FSYA 1A0KA 4JF4A 2C6WB 5G4YA 1NXYA 3UY6A 1W63M 4IUHA 4BD1A 3ZFZA 1L3LA 5EM1A 1LI9A 2B5RA 5FDSA 3BLMA 2M7VA 1NRJA 3NDEA 2R9WA 2EFUA 4CLCE 4D2OA 4Q0HA 4JXWA 3T12B 1RGYA 5CRFA 1H3QA 1U60A 2QJ7A 4GN2A 3O86A 4I3IA 3SH8A 2GDNA 2WGWB 1XP4A 1ERQA 4U3TA 5FQIA 4E3JA 2KX6A 5IU1A 4PM7A 4UHUA 3T1XA 3E2KA 3PAEA 2I72A 2P74A 4N92A 1PWCA 2W3DA 3SS4A 3A3JA 3W4OA 1J9MA 3B3XA 4R4RA 4A5RA 5FI7A 4K91A 3HUMA 3IHAA 3G32A 4BBTA 3EQUA 4PAUA 2H28A 3KSGA 3BQ8A 2Y2GA 3CMZA 4CJNA 4UA9A 4R3BA 1JTGA 3OPLA 5GHXA 4X1LA 4GD6A 3K2NA 1T1CA 2Z6CA 4N9LA 4XUXA 1MC0A 3D4FA 1ALQA 3LIBA 1WYCA 4DJ2A 4NETA 3CITA 4OOMA 5EVEA 4H6JB 4FTXA 2CC1A 1IYOA 4LLOB 3LEQA 1XFQA 1FCMA 5BOHA 4OLDA 5CGXA 4GHIA 3FV7A 3T4JA 1IEMA 2K7SA 4R70A 1F9IA 3UDIA 2XA7S 4YNRA 1H8MA 1V9ZA 4ZTKA 5J7EA 2EX2A 4QU3A 5EVIB 2Y2MA 3D72A 2J9PA 3M6HA 1MY8A 2DRWA 2ZC3B 5FATA 3MF0A 3A3FA 1N9LA 4F94A 2O99A 3GSGA 5AJGA 4QPRA 3UPNA 4GOGA 3T4QA 5DVAA 3LR5A 2HDRA 3KYEA 3KSIA 2Y2IA 4GNUA 3E2LA 3IXGA 2WKEA 3RH8B 1DJAA 1OT6A 4PKYG 2Y2LA 1RP5A 3IHBA 4LV0A 1T19A 4ARZA 3W4QA 2IWBA 4JF6A 1Y28A 1BLPA 4U0TA 2R78A 4Q0IA 1PYYA 3BWLA 5CEDA 2Z2MB 1XFNA 5F68A 2OLVA 1BUEA 3NOPC 2VLGA 3MJQA 5HD3A 2J8YA 3D9YA 1PZPA 4XUZA 2BG1A 4E3LA 3N8RA 2O9BA 3HREA 1CEGA 1DP6A 1L2SA 2Z6DA 5FAPA 2XFSA 3LIDA 1BT5A 3UPPA 3MSHA 1K0KA 2E8IA 3DWZA 3Q82A 4MCWA 4O7DA 4JBFA 4CPKA 3GECA 5JYPA 1JWPA 5J8XA 4Y7PA 1D1JA 4DRTA 1FOFA 4LV3A 1PNEA 3ZHHA 1WA9A 4HJ4A 1K38A 5KSHA 3QP4A 3OPRA 3NULA 2JKTM 3UNWA 3WRZA 1XKZA 4WMCA 3EGXC 3HLFA 3NCKA 4P87A 4PM6A 3DTIA 5LBRA 1GHMA 3NBLA 3WS4A 2B02A 4XT2A 4PHTA 2XDMA 2ZC4B 1YQSA 4IEDA 4II7A 3T1SA 5CHJA 4NXGA 4QY5A 3CG5A 3IS2A 4X56A 1T1AA 4E6XA 1JVJA 2D02A 5L10A 4FOFA 3PBRA 1F5MA 3V3RA 3TJZC 3LY4A 3AGFA 2HP9A 1NZOA 4RVAA 1UGUA 3MXQA 1IYQA 1ZG6A 4S2MA 2V8CA 3ITBA 4F3LA 5JYOA 5FEGA 4GW9A 2ZQDA 1GCEA 1Y4OA 4FH4A 3QP6A 1CEFA 5CECA 2JC7A 2WUQA 1ZG4A 2INWA 2Z2LB 5I5LA 3HL9A 1G5UA 1ZHHB 5GL9A 5A92A 1S66L 2L4RA 3WS0A 3B42A
chains in the Genus database with same CATH topology
2K2NA 4KUOA 4CLCB 5CX7A 2O9AA 3F1NA 3T4OA 3NJAA 4E04A 1XJ3A 3S7NA 5DFYA 3LIEA 3RTYA 4GLQA 3KSFA 4NXFA 3PR6A 5L8MA 3UB9A 4EEPA 1GSWA 3MQ0A 5F5YA 3G6OA 4L9GA 1DP8A 2M7UA 3ZQ5A 3P01A 4YOFA 1VHMA 2L1MA 3HJIA 2NUTC 4BJPA 4HJ6A 3UMEA 2OAQ1 3NOUC 3H7WA 1F98A 4R6LA 2VV7A 1OT9A 1GSXA 3CI6A 4YWZA 2EWWA 1XJ2A 1XJ4A 3C30A 1G28A 4L0LA 1P9WA 3B33A 3LIFA 4I3AA 3UE6A 4IUKA 3IBJA 3DBAA 1STZA 1LSVA 1G6OA 5HDDA 2PT7A 2JHEA 2K31A 4EQ1A 4CLCC 3EWKA 3LR0A 1S1ZA 4WUJA 3A0RA 1DP9A 4ETZA 5TJJA 2GNXA 2P04A 2J3TC 1ODVA 2ZMFA 3F1OA 5K5BA 4EEUA 2PD8A 3BY8A 2J3TD 2PYRA 4UQIM 2ZOIA 2VEAA 2O9CA 4KQDA 2VV8A 3P7NA 1LSWA 4HJ3A 4KQOA 2QWSA 1D7EA 2PHYA 1MKMA 1IOUA 3BJNA 4LRXC 1GSVA 4EETB 3F1OB 2LB5A 5HPFA 3S7PA 4KUKA 2CMNA 1UWNX 2V1AA 4ZRRA 3W2ZA 3C8CA 1YAXA 1P97A 4HQAA 3U2AA 4R3AA 4FSFA 2KDKA 4NKPA 2B18A 4B93A 4LRYC 2V1BA 4LRZE 3TE8A 3FG8A 1IFQA 4HH3A 3E4PA 3F1PB 4HH2A 4JGOA 3KSHA 5G4ZA 5G4YA 2QJ5A 4GCZA 1W63M 4IUHA 4WN5A 2ZBBA 3FC7A 4G3VA 4L9EA 4HY8A 2XA7M 2JKRI 4CLCA 3RFBA 3CWFA 4Y3IA 2M7VA 1NRJA 4CLCE 4NEED 2OWJA 4Q0HA 3A0VA 4P6ZM 4BBVA 4K08A 2W1RA 2XROA 3K3DA 2PR6A 1H3QA 3H9WA 3LICA 2QJ7A 4I3IA 5F6AA 2VJWA 1OTDA 2KX6A 3OOVA 5IU1A 2VGLS 2P7JA 1BYWA 4WEJA 1W63Q 3CAXA 4L9FA 2I9VA 3KO6A 5MC7A 2XRNA 3T4SA 1N9NA 5C5KA 2J80A 2W3DA 4HNBA 4RQ9A 1TS8A 4EESA 3GDIA 3LR4A 3E4QA 2V0WA 4BBTA 3EQUA 2HGVA 2LB9A 4I39A 3EEHA 2W3HA 4PAUA 2H28A 3KSGA 3BQ8A 3UB6A 2WKPA 4H6JA 3T4LA 2Y8HA 5DFXA 3UB7A 3BY9A 4EU0A 4I5SA 5IS1A 4UQIS 3K3CA 2PDRA 2VKSA 4AFIA 3LR3A 5HWVA 5J3WA 3K2NA 1T1CA 2Z6CA 3LYXA 3MFXA 1MC0A 4JGQA 3MR0A 3LIBA 1D06A 4DJ2A 2A24A 3T50A 3C38A 3CITA 4WEKA 4HIAA 4OOMA 2P08A 4EW7A 3NOTC 4H6JB 4WLAA 2QKPA 1ZTUA 1YSPA 4LLOB 5HD5A 3OCLA 2V0UA 3VV4A 1XFQA 1P0ZA 5HZHA 3IBRA 3F1PA 4GS9B 1MZUA 4GHIA 1T18A 4BBUA 5DKLA 3T4JA 4DMZA 2HJ9C 4MMNA 2EA9A 2A24B 4R70A 2K7SA 1OTIA 1N9OA 3PBTA 1TS0A 1F9IA 3PBNA 3ULFA 2XA7S 4YNRA 2VV6A 1H8MA 1V9ZA 5F69A 4MN6A 5J7EA 2O0YA 2GX5A 2YKFA 3D3OA 1P9RA 2JKTI 3R4KA 4M4XA 3OBFA 2FH5A 5FL3A 4O8GA 3D72A 5HL6A 3MQOA 2BASA 4GHIB 1UWPX 1YKDA 4B9OA 2PYPA 5TBMA 3MF0A 1DRMA 1S4RA 4XT2B 1N9LA 3LUQA 2O99A 3EEAA 2ZOHA 2M1CA 5AJGA 3BQAA 4HHDA 1KOUA 4Z1WA 4QPRA 3T4QA 5KIZA 4EERA 3UB8A 3LR5A 4LPZA 4G3WA 3KSIA 5IT5A 4NXEA 3MMHA 3S7QA 1OJGA 2NUPC 3EGDC 5TBMB 3OLOA 3RH8B 4R38A 1OTEA 1OT6A 2KLIA 4PKYG 1NWZA 4Y2FA 3VE4A 4NXBA 1T19A 4ARZA 3LIAA 4CQHA 3T4TA 1Y28A 4WELA 2R78A 4Q0IA 2EWVA 3PBSA 2W0NA 3CLOA 5HWTA 3BWLA 2YKHA 3PBQA 3LI8A 1XFNA 5F68A 3FPWA 3H82A 5DF9A 1OTAA 3HCYA 4F3LB 3A0SA 2FZ0A 2HJEA 3NOPC 4WF0A 4JGPA 2VLGA 3MJQA 3LI9A 5HD3A 1LL8A 1OTBA 1VB6A 2J3WA 2PD7A 2O9BA 4DJ3A 3C2WA 4OOLA 2W3FA 4ARZB 1DP6A 3B47A 4Y5FA 2Z6DA 3CUEC 4EUVA 5J4EA 4BWIA 5HDSA 3LIDA 3R7WB 2V9AA 4EXOA 3HJKA 5HSQA 1YSQA 3EQVA 4MCWA 1OPXA 3MQQA 2HV1A 2L0WA 5HWWA 5A8BA 3GECA 2W27A 3H82B 1S67L 4GS9A 2W1TA 1X0OA 3O5YA 2VGLM 2OOLA 4HP9A 3F1NB 3EOIA 2A2LA 4IJGA 1NLZA 1WA9A 2OAP1 4HJ4A 5KSHA 4Q0JA 2Y79A 1TF1A 2JKTM 4GJ4A 1NLYA 2XSSA 1EW0A 5DJTA 1S4SA 3EGXC 3NHQA 2W1TB 1JNUA 3H7WB 3UE3A 3JVVA 2W3EA 5LBRA 2PR5A 4CLCD 5HPIA 2B02A 3KYZA 4PHTA 4XT2A 3OC2A 3PYPA 2JKRM 2W3GA 3LFVA 3ICYA 5DKKA 1T1BA 4II7A 3E4OA 3SW1A 1LT0A 4NXGA 2QYBA 2VX8A 3E0YA 4JGRA 3KX0X 1TD5A 3IS2A 1T1AA 3UMDA 3PBOA 4DN0A 4MDZA 3VE3A 2VA0A 2KOIA 2D02A 3CUEA 4I38A 4IHQA 4P6ZS 5AVEA 4BMWA 4ETXA 4FOFA 4HI4A 3PBRA 2QHKA 2WKQA 1F5MA 3TJZC 4O01A 1UGUA 5DJUA 5HDCA 4PKYA 1V9YA 2D01A 3MXQA 3TRCA 3PXPA 1TS6A 4ME4A 2MJ6A 4MN7A 4HP4A 2OWHA 3KYQA 3IS2B 5AVFA 2JN7A 3ZYTA 3S7OA 2HF6A 1OJ5A 4UEYA 2ZMVA 4O0PA 3VOLA 1TS7A 3T4KA 4F3LA 3V67A 2GJ3A 3FPVA 4HOIA 4GW9A 2GZAA 3JVUA 2VZWA 1LSXA 1S1YA 3BW6A 3R7WA 4G3KA 3OCNA 2INWA 5I5LA 2DMWA 3E98A 2WKRA 1XJ6A 1ZHHB 5EFWA 3TW8A 1S66L 2L4RA 2IA2A 4MN5A 3PHYA 4I3JA 3B42A 4WL9A 2G7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLC B;  5CX7 A;  2A2L A;  4BMW A;  4CLC A;  4CLC D;  4CLC E;  4NKP A;  3FPW A;  3FPV A;  4CLC C; 
#chains in the Genus database with same CATH topology
 4KUO A;  4UAA A;  4MBF A;  3Q07 A;  3LY3 A;  5E2E A;  3VFH A;  1SKO A;  4KEN B;  3LIE A;  4QWO A;  3KSF A;  4NXF A;  4PMA A;  5L8M A;  3HLE A;  4WZ5 C;  1XPB A;  1KDS A;  2NUT C;  4HJ6 A;  2OAQ 1;  4EBN A;  1OT9 A;  1MKI A;  1GSX A;  3CI6 A;  4KQQ A;  1SHV A;  5EUA A;  1CI9 A;  1I5Q A;  4R23 A;  5F82 A;  3JYI A;  2ACG A;  1P9W A;  3B33 A;  3VP1 A;  4MLL A;  1BSG A;  5GHZ A;  3ZVT A;  3DBA A;  1STZ A;  4DKI A;  1LSV A;  4OP5 A;  3EWK A;  4Y0U A;  5E2F A;  1ODV A;  2ZMF A;  4OPY A;  5K5B A;  1WYB A;  1OME A;  2J3T D;  2RCX A;  1YLY A;  2O9C A;  5GLA A;  2R9X A;  4JF5 A;  1RCJ A;  2JE5 A;  3SH9 A;  2ZJ9 A;  1JWZ A;  4X69 A;  2Q9N A;  2JCH A;  3ZNY A;  2Y2N A;  2PHY A;  1VEU B;  4WZ5 A;  2CMN A;  2V1A A;  5FI6 A;  2ZM0 A;  2DCF A;  3U2A A;  4R3A A;  4LRZ E;  4P85 A;  1M6K A;  4GB7 A;  1MWT A;  3BEC A;  4WN5 A;  5CER A;  1TDG A;  4N1H A;  4DXB A;  2ZBB A;  2C5W B;  3BRM A;  2JKR I;  3ZDJ A;  3RFB A;  1MPL A;  4K0X A;  3CWF A;  4OQG A;  4Y3I A;  5EM0 A;  4NEE D;  2Y59 A;  1CF0 A;  2WAE A;  2WZZ A;  3C5A A;  5F6A A;  2HP5 A;  3C7U A;  3NI9 A;  4FD8 A;  4OQH A;  4FUW A;  2DNS A;  3DTK A;  2VGL S;  4EBL A;  2QMI A;  2P7J A;  4QD4 A;  1BYW A;  3CAX A;  4L9F A;  2Y4A A;  4X55 A;  2XRN A;  5DTS A;  1N9N A;  1GHI A;  1XA7 A;  4KZ3 A;  1BUL A;  4ID4 A;  2J80 A;  4HNB A;  1SKF A;  4HBU A;  2X71 A;  3SS5 A;  1VET A;  4YIN A;  3E4Q A;  1L0E A;  1ESU A;  1ERO A;  2HGV A;  2RL3 A;  4I39 A;  1G6A A;  1ZKJ A;  2HP6 A;  3UB6 A;  3W4P A;  3T4L A;  3OZH A;  5DFX A;  3UB7 A;  3BY9 A;  2G2U A;  1K6S A;  5L09 A;  3K3C A;  4N1X A;  3WS1 A;  3S22 A;  5G18 A;  2VKS A;  5HWV A;  4ZBE A;  2H10 A;  5J3W A;  4BLM A;  1D06 A;  4FCF A;  5DTT A;  4MNR A;  3V5M A;  4HIA A;  2X01 A;  2P08 A;  3NOT C;  3BFC A;  2QKP A;  1ACF A;  4S2O A;  5GLC A;  3W8K A;  3MFD A;  3OCL A;  3VV4 A;  5D3O A;  1P0Z A;  5HZH A;  3IBR A;  3F1P A;  4B4X A;  1T18 A;  2XD5 A;  2HJ9 C;  2EA9 A;  2A24 B;  3MS6 A;  5A91 A;  3IXD A;  3ITA A;  1O07 A;  3AGD A;  3D3O A;  1W5D A;  5FL3 A;  2HPB A;  5HL6 A;  3IX3 A;  1XX2 A;  2BAS A;  1CI8 A;  1UWP X;  1YKD A;  2Y2Q A;  2BTF P;  1KE3 A;  4QB8 A;  4XT2 B;  3O87 A;  1FCN A;  5EV0 A;  1GHP A;  4OQI A;  2V20 A;  2ZQ7 A;  1ONG A;  3QP8 A;  1SDN A;  3A3E A;  1Z6F A;  4OPZ A;  1PZO A;  4OQ0 A;  3OPP A;  5IT5 A;  4NXE A;  4KQR A;  3S7Q A;  4ZJ2 A;  5TBM B;  1K55 A;  2A3U A;  3OLO A;  3A3I A;  3V3S A;  2KLI A;  1NWZ A;  2WZX A;  3VE4 A;  3LIA A;  3T4T A;  1JTD A;  2XEP A;  2EWV A;  1KVL A;  3CLO A;  4WMC D;  5HWT A;  3VSK A;  1FIL A;  1XGJ A;  3H82 A;  1BZA A;  1ES2 A;  1OTA A;  4F3L B;  4KZ8 A;  3A0S A;  4WF0 A;  2FZ0 A;  2X02 A;  3GV9 A;  4JGP A;  2ZQC A;  4U0X A;  2WGV A;  1OTB A;  1LLB A;  2J3W A;  4KZ6 A;  4LCL A;  4DJ3 A;  4OOL A;  2ZC5 B;  4BL3 A;  3CUE C;  4OON A;  2ZQA A;  2EFX A;  1Z09 A;  5HDS A;  1TDL A;  5HL1 A;  3MKE A;  5HSQ A;  1YSQ A;  5A90 A;  5FQ9 A;  2HV1 A;  2L0W A;  4EV4 A;  1LL9 A;  4KG2 A;  4KG6 A;  2PAV P;  3HBR A;  2OOL A;  4HP9 A;  3IF6 B;  1O7E A;  5E2H A;  4IJG A;  1VQQ A;  5HAP A;  1SKO B;  1I2W A;  4M3K A;  4LFU A;  4Q0J A;  3UDF A;  2PBY A;  1ZC2 A;  2JKG A;  1PIO A;  2W1T B;  1JNU A;  4CLC D;  5CEB A;  1NJ4 A;  3OC2 A;  1FSW A;  2W3G A;  3BEB A;  5DKK A;  3S1Y A;  1T1B A;  1K4E A;  3SW1 A;  1LT0 A;  4JGR A;  4UA6 A;  2VX8 A;  1TD5 A;  4LV2 A;  4MDZ A;  4EUZ A;  2VA0 A;  2KOI A;  3CUE A;  4I38 A;  4P6Z S;  3UPO A;  4Y17 A;  2QHK A;  5FI2 A;  3ZG5 A;  4DE0 A;  5EE8 A;  5E43 A;  4QY6 A;  2ZQ9 A;  5TFQ A;  2D01 A;  4ME4 A;  2MJ6 A;  4MN7 A;  3MZF A;  3Q81 A;  1XA1 A;  2JN7 A;  5AQ9 A;  1NYM A;  2OSU A;  3RXX A;  2ZMV A;  4O0P A;  3DTM A;  4WYY A;  3ZGA B;  1TS7 A;  4WBG A;  5FA7 A;  1NZU A;  5F1G A;  4HOI A;  2VK3 A;  2GZA A;  4LCM A;  1PRQ A;  2J9O A;  4KZB A;  3CHW P;  3BW6 A;  3ZNT A;  3R7W A;  1I2S A;  2DMW A;  4C6Y A;  3E98 A;  2ZMA A;  1XJ6 A;  5EFW A;  3TW8 A;  2IA2 A;  2VGJ A;  4I3J A;  2G7U A;  2GX5 A;  5CX7 A;  3F1N A;  2XF3 A;  3T4O A;  1L0D A;  3HLG A;  1N9B A;  5KSC A;  4GLQ A;  3PR6 A;  3UB9 A;  4EEP A;  4NK3 A;  1GSW A;  1DP8 A;  5F1F A;  1VHM A;  2L1M A;  3HJI A;  3UME A;  4RX3 A;  4B88 A;  1Q2P A;  4Y13 A;  2EX9 A;  4DDY A;  5CXW A;  4YWZ A;  2EWW A;  3WRT A;  5FQJ A;  4IBX A;  1G28 A;  4L0L A;  4E3K A;  3IBJ A;  1M40 A;  5HDD A;  2PT7 A;  1QMF A;  1VET B;  3HLD A;  4GDN A;  4CLC C;  3A0R A;  1DP9 A;  4ETZ A;  2HDS A;  3M6B A;  4ZAM A;  4EEU A;  3BY8 A;  2PYR A;  4UQI M;  1TEM A;  2XD1 A;  5FEF A;  3IXH A;  1K25 A;  4E3N A;  3GTC A;  3LO7 A;  1YT4 A;  1FR6 A;  4JXG A;  1NRF A;  4RYE A;  4KZ9 A;  4OPQ A;  3QP1 A;  1IOU A;  1GSV A;  5KZH A;  3F1O B;  3S7P A;  1CJF A;  4KUK A;  1PW8 A;  5EEC A;  3VMA A;  1UWN X;  3W2Z A;  3C8C A;  1YAX A;  1P97 A;  2KDK A;  3QP2 A;  2V1B A;  4X53 A;  3E4P A;  4C3Q A;  3F1P B;  4S2I A;  2QJ5 A;  3FZC A;  4GCZ A;  1PW1 A;  5CTN A;  4BQM A;  2XLN A;  5HFO A;  4HY8 A;  1H8Z A;  4CLC A;  4QJG A;  4JXS A;  4PM5 A;  4E3O A;  1QME A;  3GR2 A;  1K54 C;  3GMW A;  1YPR A;  2V1Z A;  3A0V A;  3HLW A;  4DXC A;  1HD8 A;  4S2P A;  3K3D A;  2PR6 A;  3LIC A;  3VOY A;  3G2Y A;  3N8L A;  1OTD A;  3SH7 A;  4S2N C;  3CPT A;  3HLB A;  1W7F A;  4WEJ A;  1W63 Q;  4Y15 A;  3KO6 A;  2WK0 A;  2Y55 A;  5AQB A;  3NEC A;  3SS3 A;  4RQ9 A;  5FQQ A;  4JPM A;  1TS8 A;  1E25 A;  1L0F A;  3GDI A;  4XXR A;  3M2J A;  2V0W A;  2XQZ A;  2W3H A;  1KGG A;  4H6J A;  2ZL1 A;  4I5S A;  5IS1 A;  3RXW A;  2WYX A;  5HAQ A;  1YLT A;  3Q7Z A;  3QP5 A;  2FFF B;  3LYX A;  5IHV A;  3MFX A;  1IKG A;  1K54 A;  4JGQ A;  3WS5 A;  5FAQ A;  2WAF A;  3T50 A;  4WEK A;  4ESP A;  2HZ5 A;  4EW7 A;  3V39 A;  4WLA A;  1ZTU A;  4S2N A;  2QPN A;  4GZB A;  5EPH A;  3HUO A;  4OKP A;  5DKL A;  1HLU P;  1ES3 A;  4PM8 A;  2PU2 A;  1TS0 A;  3ULF A;  2VV6 A;  3WS2 A;  5F69 A;  3MZE A;  4MN6 A;  2O0Y A;  4BD0 A;  1W8Q A;  2YKF A;  4M4X A;  3OBF A;  1PI5 A;  4QHC A;  5KMW A;  3V50 A;  3MQO A;  4GHI B;  4YFM A;  4B9O A;  5M19 A;  1SDE A;  1K57 C;  4H8R A;  1DRM A;  1S4R A;  1K56 D;  4E3M A;  3LUQ A;  3EEA A;  4ZJ1 A;  2M1C A;  1KVM A;  4KZ7 A;  1KOU A;  3IQA A;  5EVL A;  4JKT A;  4MBH A;  2BLS A;  3IXB A;  1FCO A;  4DE2 A;  3CJM A;  4OP8 A;  1RGZ A;  4R38 A;  4R1G A;  1CQA A;  4Y2F A;  4X68 A;  5AQA A;  4C75 A;  4CQH A;  2W0N A;  3PTE A;  3VSL A;  3PBQ A;  3LI8 A;  1ES5 A;  1SCW A;  2H0T A;  3ZG8 B;  5U47 A;  2HJE A;  4JXV A;  3LI9 A;  1LL8 A;  2ZD8 A;  3VP4 A;  4Y0T A;  2W3F A;  4ARZ B;  4Y5F A;  1K57 A;  4EUV A;  3BFG A;  5J4E A;  4BWI A;  2ZC7 A;  4KZ4 A;  3R7W B;  5DF7 A;  3DAV A;  4EXO A;  3EQV A;  1OPX A;  3MQQ A;  5A8B A;  2W27 A;  1S67 L;  4GS9 A;  2JKF A;  3HUN A;  1Q2Q A;  4GKU A;  2VGL M;  3VP3 A;  3F1N B;  5DTK A;  3EOI A;  5FSR A;  5M18 A;  2OAP 1;  1VM1 A;  2Y79 A;  3M2K A;  2ZLY A;  1NLY A;  2XSS A;  2IWC A;  1S4S A;  3C4P A;  5CHM A;  4BEN A;  3NDG A;  5HPI A;  3PYP A;  3LFV A;  1S0W A;  3N7W A;  1MWS A;  2PBD P;  3E4O A;  2QYB A;  3IWO A;  5I94 A;  3GVB A;  1E3U D;  1NYY A;  5M1A A;  3NIA A;  3VE3 A;  3ZG9 B;  5AVE A;  4IHQ A;  2HDU A;  4ZJ3 A;  1C3B A;  2WGI A;  5CGS A;  5GLB A;  3VP2 A;  5FQM A;  4O01 A;  3G34 A;  5HW3 A;  3MXR A;  4PKY A;  2XFT A;  3FKV A;  1TS6 A;  3NC8 A;  3N4I A;  2OWH A;  3MXS A;  5CGW A;  4OLG A;  3IS2 B;  3ZYT A;  3S7O A;  2HF6 A;  3Q7V A;  1OJ5 A;  4UEY A;  3T4K A;  1XGI A;  4X25 A;  1ERM A;  2GJ3 A;  5FAO A;  4KZ5 A;  4GD8 A;  3JVU A;  2VZW A;  3O3V A;  1LSX A;  1PI4 A;  2UWX A;  3LEZ A;  5HX9 A;  1K4F A;  2EX6 A;  5F83 A;  3OCN A;  4OOY A;  5CHU A;  3G4P A;  2P9V A;  3IWI A;  2WKR A;  3O88 A;  1MXO A;  2PRF A;  4WL9 A;  1MKM A;  2K2N A;  4CLC B;  2OV5 A;  2O9A A;  1K56 A;  3NJA A;  4E3I A;  3NY4 A;  3S7N A;  3RTY A;  4GDB A;  2Y91 A;  3G6O A;  4L9G A;  2Q0O A;  3A3D A;  3P01 A;  4YOF A;  4K0W A;  3Q1F A;  5CTM A;  3H7W A;  4R6L A;  1XXM A;  2VV7 A;  2WKH A;  3CPT B;  4UA7 A;  3WWX A;  1XJ2 A;  1XJ4 A;  2Y2K A;  3C30 A;  1DY6 A;  2H0Y A;  1L0G A;  4EBP A;  3T1Q B;  3QHY A;  2JBF A;  1IYP A;  4HBT A;  2EXB A;  1S1Z A;  4S2L A;  1VEU A;  2OLU A;  2EXA A;  5TJJ A;  2ZL1 B;  3LGO A;  2PD8 A;  3FWL A;  1TVF A;  2ZOI A;  2Q9M A;  2Y2H A;  1YM1 A;  1AXB A;  2VV8 A;  3IX8 A;  2VGK A;  3P7N A;  4S2K A;  1LSW A;  1MBL A;  3BFF A;  1D7E A;  1W79 A;  3GQZ A;  2XGN A;  3BJN A;  4DDS A;  1PWD A;  4B4Z A;  2LB5 A;  5HPF A;  3DWK A;  4MEZ A;  5EOE A;  4KG5 A;  4FSF A;  2B95 A;  4B93 A;  4LRY C;  4RX2 A;  3FG8 A;  4JGO A;  4R0Q A;  4NG2 A;  5FDH A;  3ZCZ A;  3FC7 A;  4G3V A;  4L9E A;  3ISG A;  4S2J A;  1ESI A;  4MBK A;  2XA7 M;  4X1M A;  2UV0 E;  3CZD A;  1HVB A;  2AVX A;  2G2W A;  1FIK A;  2OWJ A;  4P6Z M;  1BLS A;  4BBV A;  1E3U A;  5HAI A;  4K08 A;  2W1R A;  2XRO A;  3H9W A;  3VFF A;  3VOZ A;  2VJW A;  3OOV A;  1H0M A;  1IEL A;  3MBZ A;  2I9V A;  1YLZ A;  5MC7 A;  5E2G A;  4HEF A;  5EVI D;  3T4S A;  2XH9 A;  3ZG7 B;  5C5K A;  2XK1 A;  3FKW A;  3U4L P;  3G31 A;  1N4O A;  3C4O A;  4RA7 A;  4EES A;  3LR4 A;  2LB9 A;  3EEH A;  4IVK A;  2WKP A;  1CK3 A;  3DTE A;  2Y8H A;  5GLD A;  4EU0 A;  4UQI S;  2ZM8 A;  2E8J A;  2PDR A;  3IF5 A;  4AFI A;  1E4D A;  3LR3 A;  3MR0 A;  4IBR A;  1FR1 A;  2A24 A;  2FFY A;  3C38 A;  3BYD A;  3S4X A;  4LGW A;  1MWR A;  1YSP A;  1YLW A;  3ZVW A;  5HD5 A;  4DE3 A;  2V0U A;  3UDX A;  4GS9 B;  1MZU A;  4BBU A;  3VP0 A;  4DMZ A;  1EI5 A;  4MMN A;  1OTI A;  1N9O A;  3PBT A;  4OH0 A;  3PBN A;  1GA9 A;  3BFD A;  4IVI A;  1P9R A;  2JKT I;  3R4K A;  2FH5 A;  4O8G A;  1W8Y A;  3IF6 C;  1ES4 A;  2PYP A;  5TBM A;  1SZV A;  3BM6 A;  2WGW A;  2ZOH A;  3BQA A;  4HHD A;  5L2F A;  3BLS A;  4Z1W A;  1FQG A;  4R4S A;  5KIZ A;  4EER A;  3UB8 A;  4E6W A;  3ZG0 A;  1KDW A;  2QZ6 A;  4LPZ A;  4G3W A;  1KGE A;  3MMH A;  3L7H A;  4R3J A;  1OJG A;  2NUP C;  3EGD C;  5A93 A;  1YMS A;  1OTE A;  1JWV A;  5L07 A;  4EWF A;  4P6B A;  3QNB A;  4LV1 A;  1LL5 A;  4N9K A;  4NXB A;  1EWZ A;  3T1R A;  5EVI C;  2IWD A;  4WEL A;  1J3W A;  3PBS A;  4OVD A;  1IYS A;  3UE0 A;  1LI0 A;  1F2K A;  2YKH A;  3Q7V B;  2WKI A;  3FPW A;  4OPR A;  5DF9 A;  3HCY A;  3I7J A;  4PM9 A;  3IF6 A;  4Z9Q A;  1VB6 A;  2PD7 A;  3C2W A;  5FQK A;  4LEN A;  3B47 A;  3C7V A;  5HAR A;  5TR7 A;  3IX4 A;  1BTL A;  3IH8 A;  2V9A A;  3HJK A;  4WM9 A;  1PWG A;  4KZA A;  2P9V B;  4X6T A;  2ZM2 A;  5HWW A;  3DW0 A;  3H82 B;  2W1T A;  1X0O A;  3O5Y A;  1YLJ A;  4EQI A;  4WZ4 A;  3OPH A;  2A2L A;  1NLZ A;  1TF1 A;  4GJ4 A;  2ZC6 B;  5EVI A;  1EW0 A;  3MKF A;  5DJT A;  2EX8 A;  3NHQ A;  3H7W B;  3UE3 A;  3JVV A;  3UB5 P;  1DJC A;  2W3E A;  2PR5 A;  3KYZ A;  2JKR M;  3ICY A;  1YMX A;  1KE4 A;  4BL2 A;  3GRJ A;  3E0Y A;  3KX0 X;  4ZDX A;  3UMD A;  3PBO A;  4DN0 A;  2V8F A;  2Y2O A;  4BMW A;  4DF6 A;  4ETX A;  4JLF A;  2PU4 A;  4Y0O A;  1IKI A;  1KE0 A;  4HI4 A;  2WKQ A;  3UN7 A;  3P98 A;  4Q8I A;  1MWU A;  2J7V A;  3TSG A;  3N8S A;  1GA0 A;  3AGE A;  5DJU A;  5HDC A;  1KGF A;  1V9Y A;  3TRC A;  3G35 A;  3PXP A;  3N6I A;  2Y2J A;  4HP4 A;  3KYQ A;  4FH2 A;  2XR0 A;  5AVF A;  1H5X A;  4D60 A;  3VOL A;  4DE1 A;  1H8Y A;  3V67 A;  1BLH A;  3FPV A;  2Y2P A;  2A49 A;  1S1Y A;  3G30 A;  4G3K A;  3PAG A;  5AQ7 A;  2HDQ A;  1AWI A;  4MN5 A;  3PHY A;  1PFL A;  4E04 A;  1XJ3 A;  4PPR A;  5DFY A;  1NY0 A;  3BFE A;  3MQ0 A;  1S6R A;  5F5Y A;  3G2Z A;  5GHY A;  1LHY A;  2M7U A;  3ZQ5 A;  2WAD A;  4BJP A;  3NOU C;  1F98 A;  1G68 A;  3HVF A;  3IH9 A;  1WE4 A;  3HLC A;  3MZD A;  3UO9 A;  3LIF A;  4I3A A;  1DJB A;  3UE6 A;  4IUK A;  1G6O A;  2JHE A;  2K31 A;  4EQ1 A;  3JPU A;  3LR0 A;  2V2F F;  5EOO A;  4WUJ A;  5TGF A;  4P0M A;  2GNX A;  2P04 A;  2J3T C;  3F1O A;  3IWQ A;  2ZQ8 A;  3SOI A;  1Y54 A;  2VEA A;  4KQD A;  1K55 C;  5FAS A;  3TOI A;  1ONH A;  2H5S A;  3QNC A;  4HJ3 A;  4KQO A;  2QWS A;  3RJU A;  4HES A;  1HZO A;  3FYZ A;  4LRX C;  4EET B;  1BLC A;  5DF8 A;  3IT9 A;  3L9K A;  4ZRR A;  1K6R A;  3UE1 A;  4HQA A;  1YLP A;  4NKP A;  2B18 A;  3P09 A;  3TG9 A;  3SZT A;  3TE8 A;  1IFQ A;  3LCE A;  4HH3 A;  1HTZ A;  4HH2 A;  5G4Z A;  3KSH A;  1FSY A;  1A0K A;  4JF4 A;  2C6W B;  5G4Y A;  1NXY A;  3UY6 A;  1W63 M;  4IUH A;  4BD1 A;  3ZFZ A;  1L3L A;  5EM1 A;  1LI9 A;  2B5R A;  5FDS A;  3BLM A;  2M7V A;  1NRJ A;  3NDE A;  2R9W A;  2EFU A;  4CLC E;  4D2O A;  4Q0H A;  4JXW A;  3T12 B;  1RGY A;  5CRF A;  1H3Q A;  1U60 A;  2QJ7 A;  4GN2 A;  3O86 A;  4I3I A;  3SH8 A;  2GDN A;  2WGW B;  1XP4 A;  1ERQ A;  4U3T A;  5FQI A;  4E3J A;  2KX6 A;  5IU1 A;  4PM7 A;  4UHU A;  3T1X A;  3E2K A;  3PAE A;  2I72 A;  2P74 A;  4N92 A;  1PWC A;  2W3D A;  3SS4 A;  3A3J A;  3W4O A;  1J9M A;  3B3X A;  4R4R A;  4A5R A;  5FI7 A;  4K91 A;  3HUM A;  3IHA A;  3G32 A;  4BBT A;  3EQU A;  4PAU A;  2H28 A;  3KSG A;  3BQ8 A;  2Y2G A;  3CMZ A;  4CJN A;  4UA9 A;  4R3B A;  1JTG A;  3OPL A;  5GHX A;  4X1L A;  4GD6 A;  3K2N A;  1T1C A;  2Z6C A;  4N9L A;  4XUX A;  1MC0 A;  3D4F A;  1ALQ A;  3LIB A;  1WYC A;  4DJ2 A;  4NET A;  3CIT A;  4OOM A;  5EVE A;  4H6J B;  4FTX A;  2CC1 A;  1IYO A;  4LLO B;  3LEQ A;  1XFQ A;  1FCM A;  5BOH A;  4OLD A;  5CGX A;  4GHI A;  3FV7 A;  3T4J A;  1IEM A;  2K7S A;  4R70 A;  1F9I A;  3UDI A;  2XA7 S;  4YNR A;  1H8M A;  1V9Z A;  4ZTK A;  5J7E A;  2EX2 A;  4QU3 A;  5EVI B;  2Y2M A;  3D72 A;  2J9P A;  3M6H A;  1MY8 A;  2DRW A;  2ZC3 B;  5FAT A;  3MF0 A;  3A3F A;  1N9L A;  4F94 A;  2O99 A;  3GSG A;  5AJG A;  4QPR A;  3UPN A;  4GOG A;  3T4Q A;  5DVA A;  3LR5 A;  2HDR A;  3KYE A;  3KSI A;  2Y2I A;  4GNU A;  3E2L A;  3IXG A;  2WKE A;  3RH8 B;  1DJA A;  1OT6 A;  4PKY G;  2Y2L A;  1RP5 A;  3IHB A;  4LV0 A;  1T19 A;  4ARZ A;  3W4Q A;  2IWB A;  4JF6 A;  1Y28 A;  1BLP A;  4U0T A;  2R78 A;  4Q0I A;  1PYY A;  3BWL A;  5CED A;  2Z2M B;  1XFN A;  5F68 A;  2OLV A;  1BUE A;  3NOP C;  2VLG A;  3MJQ A;  5HD3 A;  2J8Y A;  3D9Y A;  1PZP A;  4XUZ A;  2BG1 A;  4E3L A;  3N8R A;  2O9B A;  3HRE A;  1CEG A;  1DP6 A;  1L2S A;  2Z6D A;  5FAP A;  2XFS A;  3LID A;  1BT5 A;  3UPP A;  3MSH A;  1K0K A;  2E8I A;  3DWZ A;  3Q82 A;  4MCW A;  4O7D A;  4JBF A;  4CPK A;  3GEC A;  5JYP A;  1JWP A;  5J8X A;  4Y7P A;  1D1J A;  4DRT A;  1FOF A;  4LV3 A;  1PNE A;  3ZHH A;  1WA9 A;  4HJ4 A;  1K38 A;  5KSH A;  3QP4 A;  3OPR A;  3NUL A;  2JKT M;  3UNW A;  3WRZ A;  1XKZ A;  4WMC A;  3EGX C;  3HLF A;  3NCK A;  4P87 A;  4PM6 A;  3DTI A;  5LBR A;  1GHM A;  3NBL A;  3WS4 A;  2B02 A;  4XT2 A;  4PHT A;  2XDM A;  2ZC4 B;  1YQS A;  4IED A;  4II7 A;  3T1S A;  5CHJ A;  4NXG A;  4QY5 A;  3CG5 A;  3IS2 A;  4X56 A;  1T1A A;  4E6X A;  1JVJ A;  2D02 A;  5L10 A;  4FOF A;  3PBR A;  1F5M A;  3V3R A;  3TJZ C;  3LY4 A;  3AGF A;  2HP9 A;  1NZO A;  4RVA A;  1UGU A;  3MXQ A;  1IYQ A;  1ZG6 A;  4S2M A;  2V8C A;  3ITB A;  4F3L A;  5JYO A;  5FEG A;  4GW9 A;  2ZQD A;  1GCE A;  1Y4O A;  4FH4 A;  3QP6 A;  1CEF A;  5CEC A;  2JC7 A;  2WUQ A;  1ZG4 A;  2INW A;  2Z2L B;  5I5L A;  3HL9 A;  1G5U A;  1ZHH B;  5GL9 A;  5A92 A;  1S66 L;  2L4R A;  3WS0 A;  3B42 A; 
#chains in the Genus database with same CATH homology
 2K2N A;  4KUO A;  4CLC B;  5CX7 A;  2O9A A;  3F1N A;  3T4O A;  3NJA A;  4E04 A;  1XJ3 A;  3S7N A;  5DFY A;  3LIE A;  3RTY A;  4GLQ A;  3KSF A;  4NXF A;  3PR6 A;  5L8M A;  3UB9 A;  4EEP A;  1GSW A;  3MQ0 A;  5F5Y A;  3G6O A;  4L9G A;  1DP8 A;  2M7U A;  3ZQ5 A;  3P01 A;  4YOF A;  1VHM A;  2L1M A;  3HJI A;  2NUT C;  4BJP A;  4HJ6 A;  3UME A;  2OAQ 1;  3NOU C;  3H7W A;  1F98 A;  4R6L A;  2VV7 A;  1OT9 A;  1GSX A;  3CI6 A;  4YWZ A;  2EWW A;  1XJ2 A;  1XJ4 A;  3C30 A;  1G28 A;  4L0L A;  1P9W A;  3B33 A;  3LIF A;  4I3A A;  3UE6 A;  4IUK A;  3IBJ A;  3DBA A;  1STZ A;  1LSV A;  1G6O A;  5HDD A;  2PT7 A;  2JHE A;  2K31 A;  4EQ1 A;  4CLC C;  3EWK A;  3LR0 A;  1S1Z A;  4WUJ A;  3A0R A;  1DP9 A;  4ETZ A;  5TJJ A;  2GNX A;  2P04 A;  2J3T C;  1ODV A;  2ZMF A;  3F1O A;  5K5B A;  4EEU A;  2PD8 A;  3BY8 A;  2J3T D;  2PYR A;  4UQI M;  2ZOI A;  2VEA A;  2O9C A;  4KQD A;  2VV8 A;  3P7N A;  1LSW A;  4HJ3 A;  4KQO A;  2QWS A;  1D7E A;  2PHY A;  1MKM A;  1IOU A;  3BJN A;  4LRX C;  1GSV A;  4EET B;  3F1O B;  2LB5 A;  5HPF A;  3S7P A;  4KUK A;  2CMN A;  1UWN X;  2V1A A;  4ZRR A;  3W2Z A;  3C8C A;  1YAX A;  1P97 A;  4HQA A;  3U2A A;  4R3A A;  4FSF A;  2KDK A;  4NKP A;  2B18 A;  4B93 A;  4LRY C;  2V1B A;  4LRZ E;  3TE8 A;  3FG8 A;  1IFQ A;  4HH3 A;  3E4P A;  3F1P B;  4HH2 A;  4JGO A;  3KSH A;  5G4Z A;  5G4Y A;  2QJ5 A;  4GCZ A;  1W63 M;  4IUH A;  4WN5 A;  2ZBB A;  3FC7 A;  4G3V A;  4L9E A;  4HY8 A;  2XA7 M;  2JKR I;  4CLC A;  3RFB A;  3CWF A;  4Y3I A;  2M7V A;  1NRJ A;  4CLC E;  4NEE D;  2OWJ A;  4Q0H A;  3A0V A;  4P6Z M;  4BBV A;  4K08 A;  2W1R A;  2XRO A;  3K3D A;  2PR6 A;  1H3Q A;  3H9W A;  3LIC A;  2QJ7 A;  4I3I A;  5F6A A;  2VJW A;  1OTD A;  2KX6 A;  3OOV A;  5IU1 A;  2VGL S;  2P7J A;  1BYW A;  4WEJ A;  1W63 Q;  3CAX A;  4L9F A;  2I9V A;  3KO6 A;  5MC7 A;  2XRN A;  3T4S A;  1N9N A;  5C5K A;  2J80 A;  2W3D A;  4HNB A;  4RQ9 A;  1TS8 A;  4EES A;  3GDI A;  3LR4 A;  3E4Q A;  2V0W A;  4BBT A;  3EQU A;  2HGV A;  2LB9 A;  4I39 A;  3EEH A;  2W3H A;  4PAU A;  2H28 A;  3KSG A;  3BQ8 A;  3UB6 A;  2WKP A;  4H6J A;  3T4L A;  2Y8H A;  5DFX A;  3UB7 A;  3BY9 A;  4EU0 A;  4I5S A;  5IS1 A;  4UQI S;  3K3C A;  2PDR A;  2VKS A;  4AFI A;  3LR3 A;  5HWV A;  5J3W A;  3K2N A;  1T1C A;  2Z6C A;  3LYX A;  3MFX A;  1MC0 A;  4JGQ A;  3MR0 A;  3LIB A;  1D06 A;  4DJ2 A;  2A24 A;  3T50 A;  3C38 A;  3CIT A;  4WEK A;  4HIA A;  4OOM A;  2P08 A;  4EW7 A;  3NOT C;  4H6J B;  4WLA A;  2QKP A;  1ZTU A;  1YSP A;  4LLO B;  5HD5 A;  3OCL A;  2V0U A;  3VV4 A;  1XFQ A;  1P0Z A;  5HZH A;  3IBR A;  3F1P A;  4GS9 B;  1MZU A;  4GHI A;  1T18 A;  4BBU A;  5DKL A;  3T4J A;  4DMZ A;  2HJ9 C;  4MMN A;  2EA9 A;  2A24 B;  4R70 A;  2K7S A;  1OTI A;  1N9O A;  3PBT A;  1TS0 A;  1F9I A;  3PBN A;  3ULF A;  2XA7 S;  4YNR A;  2VV6 A;  1H8M A;  1V9Z A;  5F69 A;  4MN6 A;  5J7E A;  2O0Y A;  2GX5 A;  2YKF A;  3D3O A;  1P9R A;  2JKT I;  3R4K A;  4M4X A;  3OBF A;  2FH5 A;  5FL3 A;  4O8G A;  3D72 A;  5HL6 A;  3MQO A;  2BAS A;  4GHI B;  1UWP X;  1YKD A;  4B9O A;  2PYP A;  5TBM A;  3MF0 A;  1DRM A;  1S4R A;  4XT2 B;  1N9L A;  3LUQ A;  2O99 A;  3EEA A;  2ZOH A;  2M1C A;  5AJG A;  3BQA A;  4HHD A;  1KOU A;  4Z1W A;  4QPR A;  3T4Q A;  5KIZ A;  4EER A;  3UB8 A;  3LR5 A;  4LPZ A;  4G3W A;  3KSI A;  5IT5 A;  4NXE A;  3MMH A;  3S7Q A;  1OJG A;  2NUP C;  3EGD C;  5TBM B;  3OLO A;  3RH8 B;  4R38 A;  1OTE A;  1OT6 A;  2KLI A;  4PKY G;  1NWZ A;  4Y2F A;  3VE4 A;  4NXB A;  1T19 A;  4ARZ A;  3LIA A;  4CQH A;  3T4T A;  1Y28 A;  4WEL A;  2R78 A;  4Q0I A;  2EWV A;  3PBS A;  2W0N A;  3CLO A;  5HWT A;  3BWL A;  2YKH A;  3PBQ A;  3LI8 A;  1XFN A;  5F68 A;  3FPW A;  3H82 A;  5DF9 A;  1OTA A;  3HCY A;  4F3L B;  3A0S A;  2FZ0 A;  2HJE A;  3NOP C;  4WF0 A;  4JGP A;  2VLG A;  3MJQ A;  3LI9 A;  5HD3 A;  1LL8 A;  1OTB A;  1VB6 A;  2J3W A;  2PD7 A;  2O9B A;  4DJ3 A;  3C2W A;  4OOL A;  2W3F A;  4ARZ B;  1DP6 A;  3B47 A;  4Y5F A;  2Z6D A;  3CUE C;  4EUV A;  5J4E A;  4BWI A;  5HDS A;  3LID A;  3R7W B;  2V9A A;  4EXO A;  3HJK A;  5HSQ A;  1YSQ A;  3EQV A;  4MCW A;  1OPX A;  3MQQ A;  2HV1 A;  2L0W A;  5HWW A;  5A8B A;  3GEC A;  2W27 A;  3H82 B;  1S67 L;  4GS9 A;  2W1T A;  1X0O A;  3O5Y A;  2VGL M;  2OOL A;  4HP9 A;  3F1N B;  3EOI A;  2A2L A;  4IJG A;  1NLZ A;  1WA9 A;  2OAP 1;  4HJ4 A;  5KSH A;  4Q0J A;  2Y79 A;  1TF1 A;  2JKT M;  4GJ4 A;  1NLY A;  2XSS A;  1EW0 A;  5DJT A;  1S4S A;  3EGX C;  3NHQ A;  2W1T B;  1JNU A;  3H7W B;  3UE3 A;  3JVV A;  2W3E A;  5LBR A;  2PR5 A;  4CLC D;  5HPI A;  2B02 A;  3KYZ A;  4PHT A;  4XT2 A;  3OC2 A;  3PYP A;  2JKR M;  2W3G A;  3LFV A;  3ICY A;  5DKK A;  1T1B A;  4II7 A;  3E4O A;  3SW1 A;  1LT0 A;  4NXG A;  2QYB A;  2VX8 A;  3E0Y A;  4JGR A;  3KX0 X;  1TD5 A;  3IS2 A;  1T1A A;  3UMD A;  3PBO A;  4DN0 A;  4MDZ A;  3VE3 A;  2VA0 A;  2KOI A;  2D02 A;  3CUE A;  4I38 A;  4IHQ A;  4P6Z S;  5AVE A;  4BMW A;  4ETX A;  4FOF A;  4HI4 A;  3PBR A;  2QHK A;  2WKQ A;  1F5M A;  3TJZ C;  4O01 A;  1UGU A;  5DJU A;  5HDC A;  4PKY A;  1V9Y A;  2D01 A;  3MXQ A;  3TRC A;  3PXP A;  1TS6 A;  4ME4 A;  2MJ6 A;  4MN7 A;  4HP4 A;  2OWH A;  3KYQ A;  3IS2 B;  5AVF A;  2JN7 A;  3ZYT A;  3S7O A;  2HF6 A;  1OJ5 A;  4UEY A;  2ZMV A;  4O0P A;  3VOL A;  1TS7 A;  3T4K A;  4F3L A;  3V67 A;  2GJ3 A;  3FPV A;  4HOI A;  4GW9 A;  2GZA A;  3JVU A;  2VZW A;  1LSX A;  1S1Y A;  3BW6 A;  3R7W A;  4G3K A;  3OCN A;  2INW A;  5I5L A;  2DMW A;  3E98 A;  2WKR A;  1XJ6 A;  1ZHH B;  5EFW A;  3TW8 A;  1S66 L;  2L4R A;  2IA2 A;  4MN5 A;  3PHY A;  4I3J A;  3B42 A;  4WL9 A;  2G7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...