4CLCC

Crystal structure of ybr137w protein
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
173
structure length
173
Chain Sequence
MVVLDKKLLERLTSRKVPLEELEDMEKRCFLSTFTYQDAFDLGTYIRNAVKENFPEKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSDYPYACLTISGLKQEEDHLMAVSSLIAFANESLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords UPF0303 PROTEIN YBR137W
publication title Structural and Functional Characterization of Ybr137Wp Implicate its Involvement in the Targeting of Tail-Anchored Proteins to Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 53
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4clcC00
4NKPA 3FPVA 4BMWA 4CLCE 2A2LA 4CLCC 5CX7A 4CLCD 4CLCA 4CLCB 3FPWA
chains in the Genus database with same CATH superfamily
3OOVA 2DCFA 5IS1A 3RTYA 2VGLM 4Q0JA 3M2KA 3VFFA 1DJAA 2VV7A 2Y79A 3HREA 5HDCA 4EUZA 1WYCA 5J8XA 1DRMA 3NI9A 3T50A 3Q07A 2O9BA 2BG1A 3AGDA 3ZGAB 2Q9MA 1K54C 1PI4A 2ZMAA 4OP5A 3KX0X 5TFQA 5HX9A 3K3DA 3A0SA 2WGWB 2W1RA 3WRZA 2B5RA 3LIAA 4C75A 1H8MA 4UHUA 3G2YA 3GTCA 5IT5A 4PKYA 2HP5A 4MNRA 5TBMB 1S66L 4DE0A 5FAPA 4JGQA 1EI5A 2EXBA 4KQOA 2ZOHA 2V2FF 4I3JA 3BFCA 4YFMA 1PWDA 4H6JB 1YAXA 4PM9A 4GW9A 1ERMA 2XGNA 2PU4A 3HJKA 3BWLA 1KGFA 1XJ6A 3BM6A 1EWZA 2WGIA 4LGWA 4JGRA 3T4QA 3MQ0A 1IELA 2W3DA 2W3EA 4OLGA 1L0GA 3A3FA 5CX7A 4P85A 2Y2MA 3G4PA 4KENB 5CHMA 3GDIA 5HPIA 3E4PA 4QWOA 3OPPA 3ICYA 3BEBA 5AQ7A 3T4TA 3UMEA 1RGZA 1LHYA 4R3AA 2XQZA 2EXAA 3LY3A 3SH9A 4KZ9A 3GECA 4PHTA 3HBRA 3AGEA 4KZAA 2OWHA 4CLCE 2XDMA 3FZCA 4Y0OA 4HP4A 4IBRA 3S4XA 5F1GA 3C30A 5GLDA 2WZXA 4QPRA 1SHVA 1H3QA 5CHUA 3H7WB 2W3FA 3MZFA 1S1ZA 4X56A 4HBTA 4JLFA 2ZM8A 5L10A 3DTEA 4P0MA 2OAQ1 2Y2HA 3O87A 2ZQ9A 3IWOA 1SDNA 4ARZB 1NY0A 1JWPA 2DMWA 4DF6A 4EBPA 2O0YA 3JVVA 1G28A 1H5XA 4WZ4A 5HAQA 4EEPA 5KIZA 4RA7A 4G3VA 4S2MA 4IUHA 3T1RA 5HAIA 4LV1A 4IVKA 3OZHA 5FQ9A 3IF6B 4ID4A 3U4LP 2R9WA 3ZHHA 4L9EA 4FUWA 1DP6A 3M6BA 3NHQA 4ESPA 3PBTA 3EEHA 3W4OA 3NOUC 5E43A 1GCEA 3CWFA 2EX8A 2W1TA 4EESA 4RVAA 2NUPC 2WUQA 3M2JA 3ZQ5A 1ES2A 4PMAA 5EV0A 1FQGA 1J3WA 3ZG5A 1LL8A 2JE5A 2W3HA 1PI5A 4ETZA 5DVAA 3IBRA 1BZAA 3RFBA 1MY8A 4D60A 1VB6A 4R3BA 1F98A 4HP9A 4NG2A 2ACGA 2ZQ8A 3LR0A 3D9YA 2ZC3B 1SKFA 2G7UA 2EX9A 4K0XA 2ZC6B 1X0OA 2XFSA 4HY8A 5HD3A 2WAEA 2ZMFA 4G3WA 3MJQA 4E3KA 4DXBA 1IEMA 5E2HA 2ZQ7A 3E2KA 4NXGA 5F69A 2Y55A 5CGWA 1YMSA 4I38A 3VE4A 2Y91A 3PAGA 3V50A 4EU0A 3UB8A 1CI8A 1LL5A 4F3LA 1U60A 2LB5A 2GJ3A 1IYOA 3NY4A 1N4OA 1L2SA 4UA7A 3RH8B 3GV9A 1ZHHB 2EX6A 4KG2A 1XFNA 3IF5A 5DTKA 3KSIA 4O01A 3UE3A 2V9AA 3UDFA 2PYPA 5FSRA 2XK1A 3ZG0A 5FQKA 2OLUA 1IOUA 4KQQA 2PDRA 2GX5A 1IYSA 3JYIA 1CQAA 1F5MA 5FL3A 3S22A 5HARA 4LV2A 1DP9A 1MZUA 1TS7A 3C2WA 3VP3A 2HPBA 3DTKA 3ZVTA 3CZDA 3B47A 1Y28A 4K91A 4ETXA 5CXWA 1ES3A 3OPHA 4UA9A 3ITBA 1KE3A 4KUOA 1G68A 4IEDA 5FDHA 5M18A 3UB9A 1MPLA 5LBRA 3IHAA 4EBLA 4DE3A 3W8KA 1PWCA 4CQHA 3HUOA 4DKIA 1S4RA 5IHVA 4Q8IA 2J9PA 5CEDA 1SZVA 5A93A 1XJ2A 4BWIA 4X53A 3MBZA 2DRWA 4DJ2A 3A3IA 5E2EA 3CMZA 3HVFA 5FI7A 1OMEA 4X1MA 3IX4A 5CTNA 4BMWA 3IQAA 3IS2B 4E3LA 3HUMA 2IWCA 3GSGA 3NCKA 1JTGA 4GNUA 3MQOA 2IA2A 1KE4A 2KOIA 3WWXA 4JGOA 4Y17A 1YLWA 4OPYA 4S2PA 1W63Q 3ISGA 4E04A 3B33A 1E25A 4WN5A 4DMZA 4N9KA 3EOIA 3Q7VB 4H6JA 1ESIA 2GNXA 3KSFA 4FOFA 1YM1A 3CI6A 3UE1A 4WM9A 5K5BA 4LRXC 3VP1A 2DNSA 3PYPA 5AQAA 2ZLYA 4B4XA 2E8IA 5M1AA 1TS6A 4EEUA 2UV0E 1YMXA 4ZTKA 3SZTA 1PZOA 5KZHA 5CRFA 2EFUA 1OTDA 2X71A 4MN6A 3K2NA 2R78A 5DF9A 1H0MA 3GMWA 1KDWA 3L7HA 4X69A 5EOEA 5DJUA 4HJ6A 5HWWA 2XEPA 1OTEA 3OC2A 3A0RA 3MS6A 4U3TA 4Z1WA 4MEZA 1XJ3A 1K6RA 3E4OA 4HOIA 2H10A 1MBLA 5EVLA 3N7WA 4BD0A 4XXRA 1W8YA 4F3LB 2CC1A 4LRZE 5L2FA 4L9FA 1ESUA 2JBFA 3CHWP 5EUAA 3NOPC 2OSUA 2J7VA 2I72A 2Y2KA 3HL9A 3VOLA 3CJMA 1ES4A 4BJPA 4X55A 4X25A 4WBGA 4JXSA 4NEED 3WRTA 4LV0A 2H0TA 4E3OA 4JF6A 4KG6A 3DWKA 5FAOA 2HJEA 4FH2A 3FYZA 1I2WA 2KX6A 3DTMA 3T1XA 3LR5A 2OLVA 3TW8A 4EBNA 4FCFA 4PKYG 3FWLA 4LRYC 5MC7A 3UPOA 3SS5A 1JVJA 3MXQA 4B4ZA 1MKMA 3T12B 3FC7A 3BFDA 1QMEA 2M7VA 4R3JA 4DE1A 2XF3A 1WE4A 4ZBEA 1K6SA 4S2NA 4S2IA 5HW3A 2J8YA 4Y2FA 5A8BA 3PHYA 2HP6A 4WLAA 1F9IA 1IFQA 1YKDA 5FEGA 1GHMA 1YLJA 3P98A 1K38A 1Z6FA 3BYDA 1QMFA 2VX8A 4GD8A 3RXXA 4LFUA 4Z9QA 1XFQA 5DKLA 4KZ8A 2INWA 2JC7A 3NDEA 3MSHA 1NRJA 4K0WA 4OP8A 1BSGA 3VE3A 4MN5A 2PBDP 1DY6A 3G2ZA 4S2NC 3A3DA 1CEGA 1MWUA 5FI2A 4GJ4A 3N8RA 1A0KA 3HLCA 1ZKJA 4HJ3A 4MBHA 1TF1A 3G32A 4EXOA 4GS9B 3PBOA 3T4OA 3VP0A 1DJBA 1SKOA 4OOLA 4N1XA 1PWGA 2HZ5A 5DKKA 4C3QA 5AQBA 5CECA 2QMIA 4MLLA 5DJTA 3T1SA 4GDNA 2YKFA 2J80A 3FKWA 1O07A 1ERQA 3CUEA 5TJJA 4Y0UA 1FCOA 1YSPA 4Y15A 3UN7A 2CMNA 3ZFZA 3N8LA 5GHYA 3EGDC 2QKPA 3E98A 4MBFA 4HESA 4GCZA 2P74A 4WEJA 2G2WA 5AVFA 3HCYA 4LLOB 1AXBA 3IWQA 3QP2A 4OONA 3U2AA 3R7WB 5TR7A 5DFXA 3ITAA 4RX2A 1TVFA 4CLCD 2HGVA 1PNEA 3ZG9B 3CUEC 4PM5A 1NXYA 3BQ8A 2QWSA 3NDGA 2OWJA 3NULA 1DJCA 4DN0A 2Y8HA 5G4YA 4MDZA 4DE2A 1HD8A 2V8CA 1KDSA 2QPNA 1LSXA 2H5SA 1FCMA 5L09A 1O7EA 4YNRA 3BLSA 3IS2A 2OV5A 4EERA 5HPFA 4KZ6A 1T19A 1ZG4A 3S7OA 1IYQA 2FZ0A 3UY6A 3HJIA 3FPVA 4YOFA 3LEZA 4CJNA 4U0XA 3IXHA 2ZM0A 2P7JA 2QHKA 5CTMA 4PAUA 3ULFA 4QD4A 4OPQA 3OLOA 4HJ4A 5FQMA 2V1BA 1XA1A 4HNBA 1BULA 3IHBA 2XR0A 1K57C 1TD5A 2KLIA 3Q7VA 3TRCA 3FPWA 1WA9A 3ZG7B 4MCWA 2XH9A 3C4OA 1W79A 2RCXA 3V3RA 3T1QB 4JGPA 4QHCA 5A91A 3Q7ZA 1FR1A 3E0YA 2VGJA 3SOIA 3EGXC 4QY5A 5KMWA 2HDUA 2ZOIA 4KUKA 2YKHA 5EVID 4CLCA 2PYRA 4P6ZS 1GSWA 4BBUA 5J3WA 3HLDA 1L0DA 1Y54A 4L9GA 3LEQA 3WS5A 5HDDA 1SKOB 1N9LA 4WZ5C 3TG9A 2Z6DA 1T1CA 4LENA 3DAVA 1BYWA 3F1NB 4JKTA 2XFTA 2Y2OA 2W0NA 1ONHA 1OT9A 1LLBA 3NECA 2PR6A 2V0UA 2Y2QA 5EE8A 2B02A 3ZCZA 3PAEA 4GKUA 2ZL1A 2WGVA 3T4KA 4CLCC 3P09A 2MJ6A 3KSHA 4I5SA 2HDRA 2XA7S 1BT5A 1YPRA 3ZVWA 2V0WA 1K56D 3NIAA 3LIEA 1NZUA 5F82A 3LIFA 4IHQA 3C7UA 1PW1A 5GLBA 4E6XA 4O0PA 4P87A 1LI0A 2Z2LB 1Q2QA 2C6WB 2GZAA 3O3VA 3IX3A 1FILA 2EX2A 4S2KA 4JF4A 4OQHA 3BFFA 2ZM2A 2JHEA 2VEAA 5FEFA 1MXOA 1K25A 5EFWA 1HZOA 3TOIA 3QP1A 2Y2NA 4OKPA 3EEAA 5GHZA 5HD5A 4KZ7A 3SH8A 1OJ5A 4XUZA 4R70A 1OTIA 1YLPA 3QP6A 3EWKA 3BECA 3A0VA 5F68A 2A49A 3QP8A 2PT7A 1CEFA 4P6ZM 2ZC5B 3UB7A 2QJ7A 2C5WB 2VLGA 1FSYA 1YLYA 3A3JA 1F2KA 2Y2LA 3KO6A 2HDSA 5G4ZA 2V1AA 2XRNA 4JXWA 5KSCA 3S7NA 2B18A 2V20A 1K4FA 1GSVA 4PPRA 1NZOA 2WYXA 5EVEA 2WK0A 5HL1A 2ZQDA 1K55A 4F94A 2JKFA 4KZ5A 2FH5A 2L4RA 2L0WA 5U47A 3HLBA 3OPLA 3S1YA 3V5MA 4NK3A 4GS9A 3VP2A 1YLZA 1LI9A 5EOOA 1RCJA 2Y2PA 1W5DA 3IXDA 1K0KA 5EVIC 3UE0A 4B93A 3IX8A 2G2UA 1S1YA 3LIBA 4UQIS 4NXBA 1LL9A 3MXSA 5CGXA 5DF8A 3A3EA 1BLHA 1XPBA 5EM1A 2WKRA 5EECA 1YLTA 2V1ZA 1JNUA 1S67L 3LCEA 3NC8A 1XXMA 1K55C 1NJ4A 1CF0A 3H9WA 2PU2A 1BLSA 3G30A 2WKIA 3GR2A 4ZDXA 4KZ4A 3CPTA 4Y7PA 4IUKA 3MZDA 3PBNA 2XROA 3PBQA 3N4IA 5JYOA 3IH8A 3MKFA 5F6AA 4QY6A 2J3TD 4HIAA 5AVEA 1MWTA 1OTAA 1XGJA 3PXPA 4E3IA 4P6BA 3MZEA 4CLCB 2M7UA 1NRFA 1XX2A 4IVIA 3UE6A 2HV1A 2ZJ9A 3B3XA 2VA0A 1KOUA 2H28A 5FQQA 1IKIA 1N9BA 4S2OA 1ZTUA 3Q82A 3IT9A 1N9NA 3R7WA 1AWIA 5EPHA 4OOMA 3HLFA 1PZPA 5F83A 1IKGA 3C4PA 5AQ9A 1PIOA 3LYXA 1GHPA 3KYEA 3O5YA 4CPKA 4BD1A 4ZRRA 1LT0A 3E2LA 4HHDA 2ZC4B 2PD7A 3BRMA 2W3GA 2ZL1B 2JKRM 5F5YA 5JYPA 3LGOA 4FD8A 3MR0A 3Q1FA 2ZQAA 3H82A 5CHJA 4UAAA 4U0TA 5C5KA 1NLZA 1GHIA 5HWVA 4UEYA 4EQ1A 1SCWA 1M6KA 1M40A 4JBFA 4UQIM 3UPPA 3GVBA 1KVMA 3BW6A 2PD8A 4X6TA 3LR4A 1TDGA 5A90A 1TDLA 4LCMA 4Y13A 4GDBA 3K3CA 2WKHA 4R6LA 2HF6A 3LI9A 4GOGA 4RYEA 4ZJ1A 1ACFA 2WZZA 1YSQA 4NXFA 3V67A 1HTZA 4FTXA 1VEUB 4Q0IA 2HDQA 4QB8A 4XUXA 3NBLA 2W27A 3QP4A 1XGIA 2ZQCA 5DF7A 4YWZA 4S2LA 5HZHA 2R9XA 5HFOA 3JVUA 4O8GA 3Q81A 1TS8A 2L1MA 5HWTA 2PRFA 1N9OA 5EVIB 3T4SA 5L8MA 1FSWA 2IWDA 4IJGA 5GLAA 3C38A 5DTTA 4OPZA 3L9KA 4GZBA 1ZG6A 4QU3A 2OAP1 3N6IA 5FDSA 3LFVA 4HEFA 2VGKA 1KGEA 4XT2A 1TEMA 4K08A 1RGYA 1ONGA 1NYMA 1OJGA 1Z09A 2OOLA 3IF6C 4E3NA 4KQRA 3VFHA 4I39A 4OPRA 5CERA 2PHYA 2J3TC 2WKQA 1UGUA 1W7FA 5BOHA 2GDNA 1ALQA 3F1NA 3RJUA 1H8ZA 3QNCA 2B95A 2PBYA 3G6OA 2XD1A 3HUNA 5A92A 3DBAA 1OTBA 1MWRA 4GLQA 3E4QA 3QHYA 5HSQA 3OBFA 2WAFA 3CPTB 1Y4OA 5KSHA 4EUVA 5GL9A 1P9WA 2K7SA 3PBRA 5FQJA 3AGFA 5I5LA 4BLMA 5FI6A 3FKVA 4R4RA 1UWPX 2BTFP 4JXVA 4N1HA 4R38A 1KGGA 3VOZA 1LSWA 5DFYA 2UWXA 3T4JA 1W8QA 3C8CA 1FOFA 5HAPA 2QJ5A 2JKRI 2FFYA 5HL6A 1TS0A 5DTSA 1S4SA 3C7VA 2E8JA 3ZDJA 2JKTM 3KYZA 3BFEA 1SDEA 1CJFA 3UB5P 2Z2MB 1VETB 3EQVA 3VMAA 3FV7A 1S6RA 3IXGA 4GHIA 5GLCA 3H82B 3BLMA 4OH0A 3HLWA 4M4XA 3UNWA 2JCHA 1HVBA 4BL2A 2I9VA 1L3LA 3UPNA 1K57A 2ZBBA 1BLCA 1FIKA 1EROA 3NJAA 3PR6A 2PR5A 2VK3A 3FG8A 4Y0TA 1I5QA 3MF0A 2V8FA 4ZJ2A 4B9OA 1VHMA 3JPUA 3GQZA 4RQ9A 3D4FA 1D1JA 3UB6A 5FATA 1K4EA 1Q2PA 3CAXA 3MFDA 2RL3A 1P97A 4YINA 3HLEA 1BTLA 4IBXA 1YQSA 2PAVP 1V9ZA 3CLOA 3TE8A 2EWVA 2P9VA 3CITA 4WZ5A 4PM8A 2X02A 2WKEA 1T18A 1L0EA 3ZNTA 2P08A 1W63M 5CGSA 3IH9A 4ZAMA 2NUTC 5AJGA 3LICA 1ZC2A 3R4KA 4DJ3A 1ODVA 1OPXA 1P0ZA 2VV6A 5J7EA 5FASA 4I3IA 1H8YA 1P9RA 4WELA 4FSFA 1G6OA 3CG5A 4XT2B 4LPZA 4HH2A 3D3OA 5TGFA 4MBKA 1S0WA 2A24A 2O9AA 3RXWA 3DTIA 3W4PA 3WS1A 1NYYA 3UDXA 4JPMA 2WKPA 4AFIA 1XA7A 1KE0A 3VV4A 5IU1A 3MQQA 3BY8A 4WYYA 1EW0A 3F1OA 3W2ZA 2BASA 1XP4A 2A3UA 2LB9A 2KDKA 4EV4A 2O99A 2EA9A 4OQGA 3O86A 4KG5A 2XD5A 4RX3A 2Y2JA 2VJWA 5HDSA 4E3JA 1JTDA 2Y2GA 5J4EA 3SH7A 5FQIA 4DDYA 5EM0A 5G18A 4S2JA 3G34A 4JF5A 3SS4A 4UA6A 4Y5FA 1RP5A 1BUEA 2Y4AA 3S7QA 3WS2A 3P7NA 3VSKA 1V9YA 3C5AA 3QNBA 3HLGA 2EWWA 5GHXA 1E3UD 3S7PA 3MFXA 4DXCA 4I3AA 2VV8A 3N8SA 4N92A 1L0FA 2JKTI 1PYYA 4GB7A 3UDIA 1UWNX 1G5UA 2VZWA 1ES5A 3D72A 2X01A 4MMNA 3VSLA 1HLUP 3KSGA 3B42A 4MN7A 1VEUA 2P04A 3F1PA 4O7DA 1GSXA 1MKIA 2J3WA 1D06A 4EWFA 2JKGA 3P01A 4ME4A 1GA9A 1I2SA 4GHIB 5FA7A 5E2FA 3VP4A 3BY9A 4LV3A 3OCLA 2AVXA 3DWZA 4WMCD 3PTEA 3OCNA 5EVIA 3SS3A 4BL3A 3DW0A 5FAQA 3LIDA 1LSVA 1STZA 3LI8A 3TSGA 3BFGA 3TJZC 4KZBA 4HQAA 2Y2IA 2D02A 4DRTA 1NLYA 3LO7A 5D3OA 2O9CA 3WS4A 4WUJA 3MMHA 3UMDA 5CEBA 3ZG8B 3O88A 2J9OA 3NOTC 1XJ4A 4M3KA 3IWIA 4GD6A 4FH4A 2ZC7A 2XA7M 4KQDA 4BQMA 2QZ6A 2WGWA 3M6HA 3ZNYA 2EFXA 4OOYA 4N9LA 3LUQA 5TBMA 3G31A 3MXRA 4BBTA 4QJGA 1MC0A 2P9VB 2Q0OA 1K56A 4B88A 1FR6A 4JXGA 4HI4A 1T1BA 1OT6A 2A2LA 3WS0A 2BLSA 1KVLA 1CK3A 3LR3A 1E4DA 2W1TB 3ZYTA 3IXBA 3I7JA 4II7A 4EETB 1E3UA 3VOYA 4R23A 3V3SA 4E3MA 2FFFB 1VM1A 4KZ3A 5L07A 4OQ0A 2Y59A 2JN7A 4WF0A 4EQIA 3W4QA 3T4LA 4X68A 2H0YA 2QYBA 4DDSA 4BENA 2IWBA 4HBUA 2A24B 2Z6CA 4R0QA 1JWVA 4WL9A 4LCLA 1CI9A 1MWSA 1XKZA 4D2OA 4WMCA 5F1FA 3SW1A 3F1OB 1YT4A 2VGLS 4PM6A 1PFLA 1VETA 3KYQA 4NETA 4PM7A 2M1CA 5M19A 5I94A 2D01A 4OQIA 4HH3A 4X1LA 3H7WA 1C3BA 3BJNA 4A5RA 3GRJA 4OVDA 1J9MA 2HJ9C 3BQAA 4Y3IA 4EW7A 1T1AA 4ZJ3A 4R4SA 4ARZA 1PRQA 3UO9A 1GA0A 4WEKA 4E6WA 2Q9NA 3OPRA 3EQUA 3PBSA 4BBVA 2K31A 1DP8A 4L0LA 3LY4A 1JWZA 2VKSA 3F1PB 1PW8A 2HP9A 2ZMVA 4GN2A 2ZD8A 4NXEA 3V39A 4G3KA 4H8RA 3QP5A 3G35A 4C6YA 3MKEA 4NKPA 2XLNA 3IF6A 2K2NA 4R1GA 1K54A 1IYPA 1VQQA 4OLDA 4Q0HA 3IBJA 1WYBA 2XSSA 2WADA 1BLPA 1NWZA 5E2GA 1D7EA 1FCNA 1G6AA
chains in the Genus database with same CATH topology
3OOVA 2MJ6A 5IS1A 3KSHA 4I5SA 3RTYA 2XA7S 1TS6A 4EEUA 2VGLM 4Q0JA 3NJAA 3PR6A 2V0WA 2PR5A 2VV7A 2Y79A 3LIEA 5HDCA 3FG8A 1DRMA 3T50A 3LIFA 3MF0A 4IHQA 2O9BA 1OTDA 4B9OA 1VHMA 4MN6A 4O0PA 4RQ9A 3K2NA 2R78A 3KX0X 5DF9A 2GZAA 3UB6A 3K3DA 3A0SA 2W1RA 5DJUA 4HJ6A 3LIAA 5HWWA 2JHEA 1H8MA 2VEAA 3CAXA 1OTEA 3OC2A 5EFWA 3A0RA 5IT5A 4PKYA 3EEAA 1P97A 1XJ3A 4Z1WA 5TBMB 5HD5A 3E4OA 1S66L 4HOIA 1OJ5A 4JGQA 4KQOA 4R70A 2ZOHA 1OTIA 1V9ZA 4LRZE 4I3JA 3CLOA 4F3LB 3EWKA 3A0VA 4L9FA 5F68A 3TE8A 3NOPC 2EWVA 2PT7A 4H6JB 4P6ZM 3CITA 1YAXA 3UB7A 2QJ7A 1T18A 2VLGA 4GW9A 3VOLA 2P08A 1W63M 4BJPA 3KO6A 4NEED 3HJKA 2NUTC 5AJGA 3LICA 3R4KA 5G4ZA 2V1AA 4DJ3A 3BWLA 2XRNA 1ODVA 1OPXA 1P0ZA 1XJ6A 2VV6A 5J7EA 3S7NA 2B18A 4I3IA 1P9RA 2HJEA 4WELA 4JGRA 2KX6A 3T4QA 1GSVA 3LR5A 1G6OA 3MQ0A 4FSFA 4XT2B 3TW8A 2W3DA 2W3EA 4LPZA 5CX7A 4PKYG 4HH2A 4LRYC 3D3OA 5MC7A 3GDIA 5HPIA 3E4PA 2FH5A 3MXQA 2A24A 2O9AA 1MKMA 3ICYA 3T4TA 3UMEA 2L4RA 2L0WA 3FC7A 4R3AA 4GS9A 3GECA 4PHTA 2WKPA 2M7VA 4AFIA 3VV4A 5IU1A 2OWHA 4CLCE 3MQQA 3BY8A 4B93A 1S1YA 3LIBA 4UQIS 1EW0A 3F1OA 4NXBA 3W2ZA 4HP4A 2BASA 4Y2FA 5A8BA 3PHYA 4WLAA 1F9IA 1IFQA 3C30A 2LB9A 1YKDA 2KDKA 2O99A 2WKRA 2EA9A 1JNUA 1S67L 4QPRA 2VJWA 5HDSA 1H3QA 2VX8A 3H7WB 2W3FA 1S1ZA 5J4EA 3H9WA 1XFQA 5DKLA 2INWA 4IUKA 1NRJA 3PBNA 2XROA 3PBQA 2OAQ1 4Y5FA 3VE3A 5F6AA 2J3TD 3S7QA 4HIAA 5AVEA 4ARZB 3P7NA 2DMWA 1OTAA 4MN5A 1V9YA 3PXPA 4CLCB 2EWWA 2M7UA 3S7PA 2O0YA 3MFXA 3UE6A 2HV1A 4I3AA 3JVVA 1G28A 2VV8A 2VA0A 4GJ4A 2JKTI 1KOUA 2H28A 4EEPA 5KIZA 1ZTUA 4G3VA 4HJ3A 1UWNX 1N9NA 2VZWA 3R7WA 3D72A 4IUHA 1TF1A 4MMNA 4EXOA 4GS9B 4OOMA 3PBOA 3KSGA 3B42A 4MN7A 2P04A 3F1PA 3LYXA 1GSXA 3O5YA 2J3WA 3T4OA 4ZRRA 1D06A 4ME4A 3P01A 4L9EA 1LT0A 4GHIB 4OOLA 4HHDA 1DP6A 3NHQA 3PBTA 5DKKA 3BY9A 2PD7A 3EEHA 2W3GA 3OCLA 3NOUC 2JKRM 3CWFA 5F5YA 2W1TA 3MR0A 3H82A 5DJTA 4EESA 3OCNA 2NUPC 5C5KA 3ZQ5A 3LIDA 1NLZA 5HWVA 2YKFA 4UEYA 1LSVA 2J80A 1STZA 4EQ1A 1LL8A 3LI8A 2W3HA 3CUEA 5TJJA 1YSPA 3TJZC 4ETZA 3IBRA 4UQIM 4HQAA 2D02A 3RFBA 3BW6A 1NLYA 2PD8A 1VB6A 2O9CA 4WUJA 1F98A 2CMNA 3MMHA 4HP9A 3UMDA 3LR0A 3LR4A 3EGDC 2QKPA 3E98A 4GCZA 3K3CA 4WEJA 5AVFA 2G7UA 3HCYA 3NOTC 4LLOB 1XJ4A 4R6LA 2HF6A 3LI9A 2XA7M 1X0OA 3U2AA 1YSQA 4HY8A 4KQDA 5HD3A 3R7WB 4NXFA 3V67A 5DFXA 2ZMFA 4G3WA 3MJQA 4Q0IA 4CLCD 2W27A 3LUQA 2HGVA 4YWZA 5TBMA 3CUEC 4NXGA 5F69A 4BBTA 1MC0A 3BQ8A 4I38A 5HZHA 3VE4A 4HI4A 3JVUA 2QWSA 4EU0A 1T1BA 3UB8A 1OT6A 2A2LA 2OWJA 4F3LA 3LR3A 2LB5A 2GJ3A 4DN0A 4O8GA 3RH8B 1TS8A 2L1MA 2W1TB 1ZHHB 2Y8HA 5HWTA 3ZYTA 1N9OA 1XFNA 5G4YA 4II7A 3T4SA 5L8MA 3KSIA 4MDZA 4EETB 4O01A 4IJGA 3C38A 3UE3A 2V9AA 1LSXA 2PYPA 2JN7A 4WF0A 2OAP1 4YNRA 1IOUA 2PDRA 2GX5A 3T4LA 3IS2A 1F5MA 3LFVA 5FL3A 4EERA 5HPFA 2QYBA 4XT2A 1DP9A 1MZUA 1T19A 4K08A 1TS7A 2A24B 3C2WA 2Z6CA 3S7OA 1OJGA 2FZ0A 2OOLA 4WL9A 3HJIA 3B47A 1Y28A 4ETXA 3FPVA 4YOFA 4I39A 2P7JA 2PHYA 2QHKA 2J3TC 2WKQA 1UGUA 4PAUA 3ULFA 3SW1A 4KUOA 3F1OB 3UB9A 2VGLS 3OLOA 4HJ4A 5LBRA 3F1NA 2V1BA 3KYQA 4HNBA 3G6OA 4CQHA 1TD5A 2KLIA 1S4RA 3TRCA 3FPWA 3DBAA 1OTBA 4GLQA 1WA9A 4MCWA 3E4QA 2M1CA 1XJ2A 5HSQA 3OBFA 2D01A 4BWIA 4JGPA 4DJ2A 4HH3A 3H7WA 5KSHA 3BJNA 4EUVA 1P9WA 3E0YA 2HJ9C 2K7SA 3BQAA 3PBRA 4Y3IA 5I5LA 4BMWA 4EW7A 3EGXC 3IS2B 1T1AA 2ZOIA 1UWPX 4KUKA 4ARZA 2YKHA 3MQOA 4R38A 4WEKA 4CLCA 2PYRA 1LSWA 5DFYA 2IA2A 4P6ZS 1GSWA 3EQUA 2KOIA 4BBUA 3PBSA 4BBVA 2K31A 1DP8A 5J3WA 4JGOA 4L0LA 3T4JA 2VKSA 3F1PB 3C8CA 2ZMVA 4NXEA 4G3KA 2QJ5A 4L9GA 2JKRI 5HL6A 5HDDA 1N9LA 1TS0A 1S4SA 2Z6DA 1T1CA 1W63Q 1BYWA 2JKTM 3F1NB 3KYZA 4NKPA 2K2NA 4E04A 3B33A 2W0NA 3EQVA 1OT9A 4WN5A 4Q0HA 4DMZA 4GHIA 3EOIA 2PR6A 2V0UA 3H82B 4H6JA 3IBJA 2B02A 4M4XA 2XSSA 2GNXA 3KSFA 4FOFA 3CI6A 1NWZA 2I9VA 1D7EA 5K5BA 3T4KA 4LRXC 4CLCC 3PYPA 2ZBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NKP A;  3FPV A;  4BMW A;  4CLC E;  2A2L A;  4CLC C;  5CX7 A;  4CLC D;  4CLC A;  4CLC B;  3FPW A; 
#chains in the Genus database with same CATH topology
 3OOV A;  2DCF A;  5IS1 A;  3RTY A;  2VGL M;  4Q0J A;  3M2K A;  3VFF A;  1DJA A;  2VV7 A;  2Y79 A;  3HRE A;  5HDC A;  4EUZ A;  1WYC A;  5J8X A;  1DRM A;  3NI9 A;  3T50 A;  3Q07 A;  2O9B A;  2BG1 A;  3AGD A;  3ZGA B;  2Q9M A;  1K54 C;  1PI4 A;  2ZMA A;  4OP5 A;  3KX0 X;  5TFQ A;  5HX9 A;  3K3D A;  3A0S A;  2WGW B;  2W1R A;  3WRZ A;  2B5R A;  3LIA A;  4C75 A;  1H8M A;  4UHU A;  3G2Y A;  3GTC A;  5IT5 A;  4PKY A;  2HP5 A;  4MNR A;  5TBM B;  1S66 L;  4DE0 A;  5FAP A;  4JGQ A;  1EI5 A;  2EXB A;  4KQO A;  2ZOH A;  2V2F F;  4I3J A;  3BFC A;  4YFM A;  1PWD A;  4H6J B;  1YAX A;  4PM9 A;  4GW9 A;  1ERM A;  2XGN A;  2PU4 A;  3HJK A;  3BWL A;  1KGF A;  1XJ6 A;  3BM6 A;  1EWZ A;  2WGI A;  4LGW A;  4JGR A;  3T4Q A;  3MQ0 A;  1IEL A;  2W3D A;  2W3E A;  4OLG A;  1L0G A;  3A3F A;  5CX7 A;  4P85 A;  2Y2M A;  3G4P A;  4KEN B;  5CHM A;  3GDI A;  5HPI A;  3E4P A;  4QWO A;  3OPP A;  3ICY A;  3BEB A;  5AQ7 A;  3T4T A;  3UME A;  1RGZ A;  1LHY A;  4R3A A;  2XQZ A;  2EXA A;  3LY3 A;  3SH9 A;  4KZ9 A;  3GEC A;  4PHT A;  3HBR A;  3AGE A;  4KZA A;  2OWH A;  4CLC E;  2XDM A;  3FZC A;  4Y0O A;  4HP4 A;  4IBR A;  3S4X A;  5F1G A;  3C30 A;  5GLD A;  2WZX A;  4QPR A;  1SHV A;  1H3Q A;  5CHU A;  3H7W B;  2W3F A;  3MZF A;  1S1Z A;  4X56 A;  4HBT A;  4JLF A;  2ZM8 A;  5L10 A;  3DTE A;  4P0M A;  2OAQ 1;  2Y2H A;  3O87 A;  2ZQ9 A;  3IWO A;  1SDN A;  4ARZ B;  1NY0 A;  1JWP A;  2DMW A;  4DF6 A;  4EBP A;  2O0Y A;  3JVV A;  1G28 A;  1H5X A;  4WZ4 A;  5HAQ A;  4EEP A;  5KIZ A;  4RA7 A;  4G3V A;  4S2M A;  4IUH A;  3T1R A;  5HAI A;  4LV1 A;  4IVK A;  3OZH A;  5FQ9 A;  3IF6 B;  4ID4 A;  3U4L P;  2R9W A;  3ZHH A;  4L9E A;  4FUW A;  1DP6 A;  3M6B A;  3NHQ A;  4ESP A;  3PBT A;  3EEH A;  3W4O A;  3NOU C;  5E43 A;  1GCE A;  3CWF A;  2EX8 A;  2W1T A;  4EES A;  4RVA A;  2NUP C;  2WUQ A;  3M2J A;  3ZQ5 A;  1ES2 A;  4PMA A;  5EV0 A;  1FQG A;  1J3W A;  3ZG5 A;  1LL8 A;  2JE5 A;  2W3H A;  1PI5 A;  4ETZ A;  5DVA A;  3IBR A;  1BZA A;  3RFB A;  1MY8 A;  4D60 A;  1VB6 A;  4R3B A;  1F98 A;  4HP9 A;  4NG2 A;  2ACG A;  2ZQ8 A;  3LR0 A;  3D9Y A;  2ZC3 B;  1SKF A;  2G7U A;  2EX9 A;  4K0X A;  2ZC6 B;  1X0O A;  2XFS A;  4HY8 A;  5HD3 A;  2WAE A;  2ZMF A;  4G3W A;  3MJQ A;  4E3K A;  4DXB A;  1IEM A;  5E2H A;  2ZQ7 A;  3E2K A;  4NXG A;  5F69 A;  2Y55 A;  5CGW A;  1YMS A;  4I38 A;  3VE4 A;  2Y91 A;  3PAG A;  3V50 A;  4EU0 A;  3UB8 A;  1CI8 A;  1LL5 A;  4F3L A;  1U60 A;  2LB5 A;  2GJ3 A;  1IYO A;  3NY4 A;  1N4O A;  1L2S A;  4UA7 A;  3RH8 B;  3GV9 A;  1ZHH B;  2EX6 A;  4KG2 A;  1XFN A;  3IF5 A;  5DTK A;  3KSI A;  4O01 A;  3UE3 A;  2V9A A;  3UDF A;  2PYP A;  5FSR A;  2XK1 A;  3ZG0 A;  5FQK A;  2OLU A;  1IOU A;  4KQQ A;  2PDR A;  2GX5 A;  1IYS A;  3JYI A;  1CQA A;  1F5M A;  5FL3 A;  3S22 A;  5HAR A;  4LV2 A;  1DP9 A;  1MZU A;  1TS7 A;  3C2W A;  3VP3 A;  2HPB A;  3DTK A;  3ZVT A;  3CZD A;  3B47 A;  1Y28 A;  4K91 A;  4ETX A;  5CXW A;  1ES3 A;  3OPH A;  4UA9 A;  3ITB A;  1KE3 A;  4KUO A;  1G68 A;  4IED A;  5FDH A;  5M18 A;  3UB9 A;  1MPL A;  5LBR A;  3IHA A;  4EBL A;  4DE3 A;  3W8K A;  1PWC A;  4CQH A;  3HUO A;  4DKI A;  1S4R A;  5IHV A;  4Q8I A;  2J9P A;  5CED A;  1SZV A;  5A93 A;  1XJ2 A;  4BWI A;  4X53 A;  3MBZ A;  2DRW A;  4DJ2 A;  3A3I A;  5E2E A;  3CMZ A;  3HVF A;  5FI7 A;  1OME A;  4X1M A;  3IX4 A;  5CTN A;  4BMW A;  3IQA A;  3IS2 B;  4E3L A;  3HUM A;  2IWC A;  3GSG A;  3NCK A;  1JTG A;  4GNU A;  3MQO A;  2IA2 A;  1KE4 A;  2KOI A;  3WWX A;  4JGO A;  4Y17 A;  1YLW A;  4OPY A;  4S2P A;  1W63 Q;  3ISG A;  4E04 A;  3B33 A;  1E25 A;  4WN5 A;  4DMZ A;  4N9K A;  3EOI A;  3Q7V B;  4H6J A;  1ESI A;  2GNX A;  3KSF A;  4FOF A;  1YM1 A;  3CI6 A;  3UE1 A;  4WM9 A;  5K5B A;  4LRX C;  3VP1 A;  2DNS A;  3PYP A;  5AQA A;  2ZLY A;  4B4X A;  2E8I A;  5M1A A;  1TS6 A;  4EEU A;  2UV0 E;  1YMX A;  4ZTK A;  3SZT A;  1PZO A;  5KZH A;  5CRF A;  2EFU A;  1OTD A;  2X71 A;  4MN6 A;  3K2N A;  2R78 A;  5DF9 A;  1H0M A;  3GMW A;  1KDW A;  3L7H A;  4X69 A;  5EOE A;  5DJU A;  4HJ6 A;  5HWW A;  2XEP A;  1OTE A;  3OC2 A;  3A0R A;  3MS6 A;  4U3T A;  4Z1W A;  4MEZ A;  1XJ3 A;  1K6R A;  3E4O A;  4HOI A;  2H10 A;  1MBL A;  5EVL A;  3N7W A;  4BD0 A;  4XXR A;  1W8Y A;  4F3L B;  2CC1 A;  4LRZ E;  5L2F A;  4L9F A;  1ESU A;  2JBF A;  3CHW P;  5EUA A;  3NOP C;  2OSU A;  2J7V A;  2I72 A;  2Y2K A;  3HL9 A;  3VOL A;  3CJM A;  1ES4 A;  4BJP A;  4X55 A;  4X25 A;  4WBG A;  4JXS A;  4NEE D;  3WRT A;  4LV0 A;  2H0T A;  4E3O A;  4JF6 A;  4KG6 A;  3DWK A;  5FAO A;  2HJE A;  4FH2 A;  3FYZ A;  1I2W A;  2KX6 A;  3DTM A;  3T1X A;  3LR5 A;  2OLV A;  3TW8 A;  4EBN A;  4FCF A;  4PKY G;  3FWL A;  4LRY C;  5MC7 A;  3UPO A;  3SS5 A;  1JVJ A;  3MXQ A;  4B4Z A;  1MKM A;  3T12 B;  3FC7 A;  3BFD A;  1QME A;  2M7V A;  4R3J A;  4DE1 A;  2XF3 A;  1WE4 A;  4ZBE A;  1K6S A;  4S2N A;  4S2I A;  5HW3 A;  2J8Y A;  4Y2F A;  5A8B A;  3PHY A;  2HP6 A;  4WLA A;  1F9I A;  1IFQ A;  1YKD A;  5FEG A;  1GHM A;  1YLJ A;  3P98 A;  1K38 A;  1Z6F A;  3BYD A;  1QMF A;  2VX8 A;  4GD8 A;  3RXX A;  4LFU A;  4Z9Q A;  1XFQ A;  5DKL A;  4KZ8 A;  2INW A;  2JC7 A;  3NDE A;  3MSH A;  1NRJ A;  4K0W A;  4OP8 A;  1BSG A;  3VE3 A;  4MN5 A;  2PBD P;  1DY6 A;  3G2Z A;  4S2N C;  3A3D A;  1CEG A;  1MWU A;  5FI2 A;  4GJ4 A;  3N8R A;  1A0K A;  3HLC A;  1ZKJ A;  4HJ3 A;  4MBH A;  1TF1 A;  3G32 A;  4EXO A;  4GS9 B;  3PBO A;  3T4O A;  3VP0 A;  1DJB A;  1SKO A;  4OOL A;  4N1X A;  1PWG A;  2HZ5 A;  5DKK A;  4C3Q A;  5AQB A;  5CEC A;  2QMI A;  4MLL A;  5DJT A;  3T1S A;  4GDN A;  2YKF A;  2J80 A;  3FKW A;  1O07 A;  1ERQ A;  3CUE A;  5TJJ A;  4Y0U A;  1FCO A;  1YSP A;  4Y15 A;  3UN7 A;  2CMN A;  3ZFZ A;  3N8L A;  5GHY A;  3EGD C;  2QKP A;  3E98 A;  4MBF A;  4HES A;  4GCZ A;  2P74 A;  4WEJ A;  2G2W A;  5AVF A;  3HCY A;  4LLO B;  1AXB A;  3IWQ A;  3QP2 A;  4OON A;  3U2A A;  3R7W B;  5TR7 A;  5DFX A;  3ITA A;  4RX2 A;  1TVF A;  4CLC D;  2HGV A;  1PNE A;  3ZG9 B;  3CUE C;  4PM5 A;  1NXY A;  3BQ8 A;  2QWS A;  3NDG A;  2OWJ A;  3NUL A;  1DJC A;  4DN0 A;  2Y8H A;  5G4Y A;  4MDZ A;  4DE2 A;  1HD8 A;  2V8C A;  1KDS A;  2QPN A;  1LSX A;  2H5S A;  1FCM A;  5L09 A;  1O7E A;  4YNR A;  3BLS A;  3IS2 A;  2OV5 A;  4EER A;  5HPF A;  4KZ6 A;  1T19 A;  1ZG4 A;  3S7O A;  1IYQ A;  2FZ0 A;  3UY6 A;  3HJI A;  3FPV A;  4YOF A;  3LEZ A;  4CJN A;  4U0X A;  3IXH A;  2ZM0 A;  2P7J A;  2QHK A;  5CTM A;  4PAU A;  3ULF A;  4QD4 A;  4OPQ A;  3OLO A;  4HJ4 A;  5FQM A;  2V1B A;  1XA1 A;  4HNB A;  1BUL A;  3IHB A;  2XR0 A;  1K57 C;  1TD5 A;  2KLI A;  3Q7V A;  3TRC A;  3FPW A;  1WA9 A;  3ZG7 B;  4MCW A;  2XH9 A;  3C4O A;  1W79 A;  2RCX A;  3V3R A;  3T1Q B;  4JGP A;  4QHC A;  5A91 A;  3Q7Z A;  1FR1 A;  3E0Y A;  2VGJ A;  3SOI A;  3EGX C;  4QY5 A;  5KMW A;  2HDU A;  2ZOI A;  4KUK A;  2YKH A;  5EVI D;  4CLC A;  2PYR A;  4P6Z S;  1GSW A;  4BBU A;  5J3W A;  3HLD A;  1L0D A;  1Y54 A;  4L9G A;  3LEQ A;  3WS5 A;  5HDD A;  1SKO B;  1N9L A;  4WZ5 C;  3TG9 A;  2Z6D A;  1T1C A;  4LEN A;  3DAV A;  1BYW A;  3F1N B;  4JKT A;  2XFT A;  2Y2O A;  2W0N A;  1ONH A;  1OT9 A;  1LLB A;  3NEC A;  2PR6 A;  2V0U A;  2Y2Q A;  5EE8 A;  2B02 A;  3ZCZ A;  3PAE A;  4GKU A;  2ZL1 A;  2WGV A;  3T4K A;  4CLC C;  3P09 A;  2MJ6 A;  3KSH A;  4I5S A;  2HDR A;  2XA7 S;  1BT5 A;  1YPR A;  3ZVW A;  2V0W A;  1K56 D;  3NIA A;  3LIE A;  1NZU A;  5F82 A;  3LIF A;  4IHQ A;  3C7U A;  1PW1 A;  5GLB A;  4E6X A;  4O0P A;  4P87 A;  1LI0 A;  2Z2L B;  1Q2Q A;  2C6W B;  2GZA A;  3O3V A;  3IX3 A;  1FIL A;  2EX2 A;  4S2K A;  4JF4 A;  4OQH A;  3BFF A;  2ZM2 A;  2JHE A;  2VEA A;  5FEF A;  1MXO A;  1K25 A;  5EFW A;  1HZO A;  3TOI A;  3QP1 A;  2Y2N A;  4OKP A;  3EEA A;  5GHZ A;  5HD5 A;  4KZ7 A;  3SH8 A;  1OJ5 A;  4XUZ A;  4R70 A;  1OTI A;  1YLP A;  3QP6 A;  3EWK A;  3BEC A;  3A0V A;  5F68 A;  2A49 A;  3QP8 A;  2PT7 A;  1CEF A;  4P6Z M;  2ZC5 B;  3UB7 A;  2QJ7 A;  2C5W B;  2VLG A;  1FSY A;  1YLY A;  3A3J A;  1F2K A;  2Y2L A;  3KO6 A;  2HDS A;  5G4Z A;  2V1A A;  2XRN A;  4JXW A;  5KSC A;  3S7N A;  2B18 A;  2V20 A;  1K4F A;  1GSV A;  4PPR A;  1NZO A;  2WYX A;  5EVE A;  2WK0 A;  5HL1 A;  2ZQD A;  1K55 A;  4F94 A;  2JKF A;  4KZ5 A;  2FH5 A;  2L4R A;  2L0W A;  5U47 A;  3HLB A;  3OPL A;  3S1Y A;  3V5M A;  4NK3 A;  4GS9 A;  3VP2 A;  1YLZ A;  1LI9 A;  5EOO A;  1RCJ A;  2Y2P A;  1W5D A;  3IXD A;  1K0K A;  5EVI C;  3UE0 A;  4B93 A;  3IX8 A;  2G2U A;  1S1Y A;  3LIB A;  4UQI S;  4NXB A;  1LL9 A;  3MXS A;  5CGX A;  5DF8 A;  3A3E A;  1BLH A;  1XPB A;  5EM1 A;  2WKR A;  5EEC A;  1YLT A;  2V1Z A;  1JNU A;  1S67 L;  3LCE A;  3NC8 A;  1XXM A;  1K55 C;  1NJ4 A;  1CF0 A;  3H9W A;  2PU2 A;  1BLS A;  3G30 A;  2WKI A;  3GR2 A;  4ZDX A;  4KZ4 A;  3CPT A;  4Y7P A;  4IUK A;  3MZD A;  3PBN A;  2XRO A;  3PBQ A;  3N4I A;  5JYO A;  3IH8 A;  3MKF A;  5F6A A;  4QY6 A;  2J3T D;  4HIA A;  5AVE A;  1MWT A;  1OTA A;  1XGJ A;  3PXP A;  4E3I A;  4P6B A;  3MZE A;  4CLC B;  2M7U A;  1NRF A;  1XX2 A;  4IVI A;  3UE6 A;  2HV1 A;  2ZJ9 A;  3B3X A;  2VA0 A;  1KOU A;  2H28 A;  5FQQ A;  1IKI A;  1N9B A;  4S2O A;  1ZTU A;  3Q82 A;  3IT9 A;  1N9N A;  3R7W A;  1AWI A;  5EPH A;  4OOM A;  3HLF A;  1PZP A;  5F83 A;  1IKG A;  3C4P A;  5AQ9 A;  1PIO A;  3LYX A;  1GHP A;  3KYE A;  3O5Y A;  4CPK A;  4BD1 A;  4ZRR A;  1LT0 A;  3E2L A;  4HHD A;  2ZC4 B;  2PD7 A;  3BRM A;  2W3G A;  2ZL1 B;  2JKR M;  5F5Y A;  5JYP A;  3LGO A;  4FD8 A;  3MR0 A;  3Q1F A;  2ZQA A;  3H82 A;  5CHJ A;  4UAA A;  4U0T A;  5C5K A;  1NLZ A;  1GHI A;  5HWV A;  4UEY A;  4EQ1 A;  1SCW A;  1M6K A;  1M40 A;  4JBF A;  4UQI M;  3UPP A;  3GVB A;  1KVM A;  3BW6 A;  2PD8 A;  4X6T A;  3LR4 A;  1TDG A;  5A90 A;  1TDL A;  4LCM A;  4Y13 A;  4GDB A;  3K3C A;  2WKH A;  4R6L A;  2HF6 A;  3LI9 A;  4GOG A;  4RYE A;  4ZJ1 A;  1ACF A;  2WZZ A;  1YSQ A;  4NXF A;  3V67 A;  1HTZ A;  4FTX A;  1VEU B;  4Q0I A;  2HDQ A;  4QB8 A;  4XUX A;  3NBL A;  2W27 A;  3QP4 A;  1XGI A;  2ZQC A;  5DF7 A;  4YWZ A;  4S2L A;  5HZH A;  2R9X A;  5HFO A;  3JVU A;  4O8G A;  3Q81 A;  1TS8 A;  2L1M A;  5HWT A;  2PRF A;  1N9O A;  5EVI B;  3T4S A;  5L8M A;  1FSW A;  2IWD A;  4IJG A;  5GLA A;  3C38 A;  5DTT A;  4OPZ A;  3L9K A;  4GZB A;  1ZG6 A;  4QU3 A;  2OAP 1;  3N6I A;  5FDS A;  3LFV A;  4HEF A;  2VGK A;  1KGE A;  4XT2 A;  1TEM A;  4K08 A;  1RGY A;  1ONG A;  1NYM A;  1OJG A;  1Z09 A;  2OOL A;  3IF6 C;  4E3N A;  4KQR A;  3VFH A;  4I39 A;  4OPR A;  5CER A;  2PHY A;  2J3T C;  2WKQ A;  1UGU A;  1W7F A;  5BOH A;  2GDN A;  1ALQ A;  3F1N A;  3RJU A;  1H8Z A;  3QNC A;  2B95 A;  2PBY A;  3G6O A;  2XD1 A;  3HUN A;  5A92 A;  3DBA A;  1OTB A;  1MWR A;  4GLQ A;  3E4Q A;  3QHY A;  5HSQ A;  3OBF A;  2WAF A;  3CPT B;  1Y4O A;  5KSH A;  4EUV A;  5GL9 A;  1P9W A;  2K7S A;  3PBR A;  5FQJ A;  3AGF A;  5I5L A;  4BLM A;  5FI6 A;  3FKV A;  4R4R A;  1UWP X;  2BTF P;  4JXV A;  4N1H A;  4R38 A;  1KGG A;  3VOZ A;  1LSW A;  5DFY A;  2UWX A;  3T4J A;  1W8Q A;  3C8C A;  1FOF A;  5HAP A;  2QJ5 A;  2JKR I;  2FFY A;  5HL6 A;  1TS0 A;  5DTS A;  1S4S A;  3C7V A;  2E8J A;  3ZDJ A;  2JKT M;  3KYZ A;  3BFE A;  1SDE A;  1CJF A;  3UB5 P;  2Z2M B;  1VET B;  3EQV A;  3VMA A;  3FV7 A;  1S6R A;  3IXG A;  4GHI A;  5GLC A;  3H82 B;  3BLM A;  4OH0 A;  3HLW A;  4M4X A;  3UNW A;  2JCH A;  1HVB A;  4BL2 A;  2I9V A;  1L3L A;  3UPN A;  1K57 A;  2ZBB A;  1BLC A;  1FIK A;  1ERO A;  3NJA A;  3PR6 A;  2PR5 A;  2VK3 A;  3FG8 A;  4Y0T A;  1I5Q A;  3MF0 A;  2V8F A;  4ZJ2 A;  4B9O A;  1VHM A;  3JPU A;  3GQZ A;  4RQ9 A;  3D4F A;  1D1J A;  3UB6 A;  5FAT A;  1K4E A;  1Q2P A;  3CAX A;  3MFD A;  2RL3 A;  1P97 A;  4YIN A;  3HLE A;  1BTL A;  4IBX A;  1YQS A;  2PAV P;  1V9Z A;  3CLO A;  3TE8 A;  2EWV A;  2P9V A;  3CIT A;  4WZ5 A;  4PM8 A;  2X02 A;  2WKE A;  1T18 A;  1L0E A;  3ZNT A;  2P08 A;  1W63 M;  5CGS A;  3IH9 A;  4ZAM A;  2NUT C;  5AJG A;  3LIC A;  1ZC2 A;  3R4K A;  4DJ3 A;  1ODV A;  1OPX A;  1P0Z A;  2VV6 A;  5J7E A;  5FAS A;  4I3I A;  1H8Y A;  1P9R A;  4WEL A;  4FSF A;  1G6O A;  3CG5 A;  4XT2 B;  4LPZ A;  4HH2 A;  3D3O A;  5TGF A;  4MBK A;  1S0W A;  2A24 A;  2O9A A;  3RXW A;  3DTI A;  3W4P A;  3WS1 A;  1NYY A;  3UDX A;  4JPM A;  2WKP A;  4AFI A;  1XA7 A;  1KE0 A;  3VV4 A;  5IU1 A;  3MQQ A;  3BY8 A;  4WYY A;  1EW0 A;  3F1O A;  3W2Z A;  2BAS A;  1XP4 A;  2A3U A;  2LB9 A;  2KDK A;  4EV4 A;  2O99 A;  2EA9 A;  4OQG A;  3O86 A;  4KG5 A;  2XD5 A;  4RX3 A;  2Y2J A;  2VJW A;  5HDS A;  4E3J A;  1JTD A;  2Y2G A;  5J4E A;  3SH7 A;  5FQI A;  4DDY A;  5EM0 A;  5G18 A;  4S2J A;  3G34 A;  4JF5 A;  3SS4 A;  4UA6 A;  4Y5F A;  1RP5 A;  1BUE A;  2Y4A A;  3S7Q A;  3WS2 A;  3P7N A;  3VSK A;  1V9Y A;  3C5A A;  3QNB A;  3HLG A;  2EWW A;  5GHX A;  1E3U D;  3S7P A;  3MFX A;  4DXC A;  4I3A A;  2VV8 A;  3N8S A;  4N92 A;  1L0F A;  2JKT I;  1PYY A;  4GB7 A;  3UDI A;  1UWN X;  1G5U A;  2VZW A;  1ES5 A;  3D72 A;  2X01 A;  4MMN A;  3VSL A;  1HLU P;  3KSG A;  3B42 A;  4MN7 A;  1VEU A;  2P04 A;  3F1P A;  4O7D A;  1GSX A;  1MKI A;  2J3W A;  1D06 A;  4EWF A;  2JKG A;  3P01 A;  4ME4 A;  1GA9 A;  1I2S A;  4GHI B;  5FA7 A;  5E2F A;  3VP4 A;  3BY9 A;  4LV3 A;  3OCL A;  2AVX A;  3DWZ A;  4WMC D;  3PTE A;  3OCN A;  5EVI A;  3SS3 A;  4BL3 A;  3DW0 A;  5FAQ A;  3LID A;  1LSV A;  1STZ A;  3LI8 A;  3TSG A;  3BFG A;  3TJZ C;  4KZB A;  4HQA A;  2Y2I A;  2D02 A;  4DRT A;  1NLY A;  3LO7 A;  5D3O A;  2O9C A;  3WS4 A;  4WUJ A;  3MMH A;  3UMD A;  5CEB A;  3ZG8 B;  3O88 A;  2J9O A;  3NOT C;  1XJ4 A;  4M3K A;  3IWI A;  4GD6 A;  4FH4 A;  2ZC7 A;  2XA7 M;  4KQD A;  4BQM A;  2QZ6 A;  2WGW A;  3M6H A;  3ZNY A;  2EFX A;  4OOY A;  4N9L A;  3LUQ A;  5TBM A;  3G31 A;  3MXR A;  4BBT A;  4QJG A;  1MC0 A;  2P9V B;  2Q0O A;  1K56 A;  4B88 A;  1FR6 A;  4JXG A;  4HI4 A;  1T1B A;  1OT6 A;  2A2L A;  3WS0 A;  2BLS A;  1KVL A;  1CK3 A;  3LR3 A;  1E4D A;  2W1T B;  3ZYT A;  3IXB A;  3I7J A;  4II7 A;  4EET B;  1E3U A;  3VOY A;  4R23 A;  3V3S A;  4E3M A;  2FFF B;  1VM1 A;  4KZ3 A;  5L07 A;  4OQ0 A;  2Y59 A;  2JN7 A;  4WF0 A;  4EQI A;  3W4Q A;  3T4L A;  4X68 A;  2H0Y A;  2QYB A;  4DDS A;  4BEN A;  2IWB A;  4HBU A;  2A24 B;  2Z6C A;  4R0Q A;  1JWV A;  4WL9 A;  4LCL A;  1CI9 A;  1MWS A;  1XKZ A;  4D2O A;  4WMC A;  5F1F A;  3SW1 A;  3F1O B;  1YT4 A;  2VGL S;  4PM6 A;  1PFL A;  1VET A;  3KYQ A;  4NET A;  4PM7 A;  2M1C A;  5M19 A;  5I94 A;  2D01 A;  4OQI A;  4HH3 A;  4X1L A;  3H7W A;  1C3B A;  3BJN A;  4A5R A;  3GRJ A;  4OVD A;  1J9M A;  2HJ9 C;  3BQA A;  4Y3I A;  4EW7 A;  1T1A A;  4ZJ3 A;  4R4S A;  4ARZ A;  1PRQ A;  3UO9 A;  1GA0 A;  4WEK A;  4E6W A;  2Q9N A;  3OPR A;  3EQU A;  3PBS A;  4BBV A;  2K31 A;  1DP8 A;  4L0L A;  3LY4 A;  1JWZ A;  2VKS A;  3F1P B;  1PW8 A;  2HP9 A;  2ZMV A;  4GN2 A;  2ZD8 A;  4NXE A;  3V39 A;  4G3K A;  4H8R A;  3QP5 A;  3G35 A;  4C6Y A;  3MKE A;  4NKP A;  2XLN A;  3IF6 A;  2K2N A;  4R1G A;  1K54 A;  1IYP A;  1VQQ A;  4OLD A;  4Q0H A;  3IBJ A;  1WYB A;  2XSS A;  2WAD A;  1BLP A;  1NWZ A;  5E2G A;  1D7E A;  1FCN A;  1G6A A; 
#chains in the Genus database with same CATH homology
 3OOV A;  2MJ6 A;  5IS1 A;  3KSH A;  4I5S A;  3RTY A;  2XA7 S;  1TS6 A;  4EEU A;  2VGL M;  4Q0J A;  3NJA A;  3PR6 A;  2V0W A;  2PR5 A;  2VV7 A;  2Y79 A;  3LIE A;  5HDC A;  3FG8 A;  1DRM A;  3T50 A;  3LIF A;  3MF0 A;  4IHQ A;  2O9B A;  1OTD A;  4B9O A;  1VHM A;  4MN6 A;  4O0P A;  4RQ9 A;  3K2N A;  2R78 A;  3KX0 X;  5DF9 A;  2GZA A;  3UB6 A;  3K3D A;  3A0S A;  2W1R A;  5DJU A;  4HJ6 A;  3LIA A;  5HWW A;  2JHE A;  1H8M A;  2VEA A;  3CAX A;  1OTE A;  3OC2 A;  5EFW A;  3A0R A;  5IT5 A;  4PKY A;  3EEA A;  1P97 A;  1XJ3 A;  4Z1W A;  5TBM B;  5HD5 A;  3E4O A;  1S66 L;  4HOI A;  1OJ5 A;  4JGQ A;  4KQO A;  4R70 A;  2ZOH A;  1OTI A;  1V9Z A;  4LRZ E;  4I3J A;  3CLO A;  4F3L B;  3EWK A;  3A0V A;  4L9F A;  5F68 A;  3TE8 A;  3NOP C;  2EWV A;  2PT7 A;  4H6J B;  4P6Z M;  3CIT A;  1YAX A;  3UB7 A;  2QJ7 A;  1T18 A;  2VLG A;  4GW9 A;  3VOL A;  2P08 A;  1W63 M;  4BJP A;  3KO6 A;  4NEE D;  3HJK A;  2NUT C;  5AJG A;  3LIC A;  3R4K A;  5G4Z A;  2V1A A;  4DJ3 A;  3BWL A;  2XRN A;  1ODV A;  1OPX A;  1P0Z A;  1XJ6 A;  2VV6 A;  5J7E A;  3S7N A;  2B18 A;  4I3I A;  1P9R A;  2HJE A;  4WEL A;  4JGR A;  2KX6 A;  3T4Q A;  1GSV A;  3LR5 A;  1G6O A;  3MQ0 A;  4FSF A;  4XT2 B;  3TW8 A;  2W3D A;  2W3E A;  4LPZ A;  5CX7 A;  4PKY G;  4HH2 A;  4LRY C;  3D3O A;  5MC7 A;  3GDI A;  5HPI A;  3E4P A;  2FH5 A;  3MXQ A;  2A24 A;  2O9A A;  1MKM A;  3ICY A;  3T4T A;  3UME A;  2L4R A;  2L0W A;  3FC7 A;  4R3A A;  4GS9 A;  3GEC A;  4PHT A;  2WKP A;  2M7V A;  4AFI A;  3VV4 A;  5IU1 A;  2OWH A;  4CLC E;  3MQQ A;  3BY8 A;  4B93 A;  1S1Y A;  3LIB A;  4UQI S;  1EW0 A;  3F1O A;  4NXB A;  3W2Z A;  4HP4 A;  2BAS A;  4Y2F A;  5A8B A;  3PHY A;  4WLA A;  1F9I A;  1IFQ A;  3C30 A;  2LB9 A;  1YKD A;  2KDK A;  2O99 A;  2WKR A;  2EA9 A;  1JNU A;  1S67 L;  4QPR A;  2VJW A;  5HDS A;  1H3Q A;  2VX8 A;  3H7W B;  2W3F A;  1S1Z A;  5J4E A;  3H9W A;  1XFQ A;  5DKL A;  2INW A;  4IUK A;  1NRJ A;  3PBN A;  2XRO A;  3PBQ A;  2OAQ 1;  4Y5F A;  3VE3 A;  5F6A A;  2J3T D;  3S7Q A;  4HIA A;  5AVE A;  4ARZ B;  3P7N A;  2DMW A;  1OTA A;  4MN5 A;  1V9Y A;  3PXP A;  4CLC B;  2EWW A;  2M7U A;  3S7P A;  2O0Y A;  3MFX A;  3UE6 A;  2HV1 A;  4I3A A;  3JVV A;  1G28 A;  2VV8 A;  2VA0 A;  4GJ4 A;  2JKT I;  1KOU A;  2H28 A;  4EEP A;  5KIZ A;  1ZTU A;  4G3V A;  4HJ3 A;  1UWN X;  1N9N A;  2VZW A;  3R7W A;  3D72 A;  4IUH A;  1TF1 A;  4MMN A;  4EXO A;  4GS9 B;  4OOM A;  3PBO A;  3KSG A;  3B42 A;  4MN7 A;  2P04 A;  3F1P A;  3LYX A;  1GSX A;  3O5Y A;  2J3W A;  3T4O A;  4ZRR A;  1D06 A;  4ME4 A;  3P01 A;  4L9E A;  1LT0 A;  4GHI B;  4OOL A;  4HHD A;  1DP6 A;  3NHQ A;  3PBT A;  5DKK A;  3BY9 A;  2PD7 A;  3EEH A;  2W3G A;  3OCL A;  3NOU C;  2JKR M;  3CWF A;  5F5Y A;  2W1T A;  3MR0 A;  3H82 A;  5DJT A;  4EES A;  3OCN A;  2NUP C;  5C5K A;  3ZQ5 A;  3LID A;  1NLZ A;  5HWV A;  2YKF A;  4UEY A;  1LSV A;  2J80 A;  1STZ A;  4EQ1 A;  1LL8 A;  3LI8 A;  2W3H A;  3CUE A;  5TJJ A;  1YSP A;  3TJZ C;  4ETZ A;  3IBR A;  4UQI M;  4HQA A;  2D02 A;  3RFB A;  3BW6 A;  1NLY A;  2PD8 A;  1VB6 A;  2O9C A;  4WUJ A;  1F98 A;  2CMN A;  3MMH A;  4HP9 A;  3UMD A;  3LR0 A;  3LR4 A;  3EGD C;  2QKP A;  3E98 A;  4GCZ A;  3K3C A;  4WEJ A;  5AVF A;  2G7U A;  3HCY A;  3NOT C;  4LLO B;  1XJ4 A;  4R6L A;  2HF6 A;  3LI9 A;  2XA7 M;  1X0O A;  3U2A A;  1YSQ A;  4HY8 A;  4KQD A;  5HD3 A;  3R7W B;  4NXF A;  3V67 A;  5DFX A;  2ZMF A;  4G3W A;  3MJQ A;  4Q0I A;  4CLC D;  2W27 A;  3LUQ A;  2HGV A;  4YWZ A;  5TBM A;  3CUE C;  4NXG A;  5F69 A;  4BBT A;  1MC0 A;  3BQ8 A;  4I38 A;  5HZH A;  3VE4 A;  4HI4 A;  3JVU A;  2QWS A;  4EU0 A;  1T1B A;  3UB8 A;  1OT6 A;  2A2L A;  2OWJ A;  4F3L A;  3LR3 A;  2LB5 A;  2GJ3 A;  4DN0 A;  4O8G A;  3RH8 B;  1TS8 A;  2L1M A;  2W1T B;  1ZHH B;  2Y8H A;  5HWT A;  3ZYT A;  1N9O A;  1XFN A;  5G4Y A;  4II7 A;  3T4S A;  5L8M A;  3KSI A;  4MDZ A;  4EET B;  4O01 A;  4IJG A;  3C38 A;  3UE3 A;  2V9A A;  1LSX A;  2PYP A;  2JN7 A;  4WF0 A;  2OAP 1;  4YNR A;  1IOU A;  2PDR A;  2GX5 A;  3T4L A;  3IS2 A;  1F5M A;  3LFV A;  5FL3 A;  4EER A;  5HPF A;  2QYB A;  4XT2 A;  1DP9 A;  1MZU A;  1T19 A;  4K08 A;  1TS7 A;  2A24 B;  3C2W A;  2Z6C A;  3S7O A;  1OJG A;  2FZ0 A;  2OOL A;  4WL9 A;  3HJI A;  3B47 A;  1Y28 A;  4ETX A;  3FPV A;  4YOF A;  4I39 A;  2P7J A;  2PHY A;  2QHK A;  2J3T C;  2WKQ A;  1UGU A;  4PAU A;  3ULF A;  3SW1 A;  4KUO A;  3F1O B;  3UB9 A;  2VGL S;  3OLO A;  4HJ4 A;  5LBR A;  3F1N A;  2V1B A;  3KYQ A;  4HNB A;  3G6O A;  4CQH A;  1TD5 A;  2KLI A;  1S4R A;  3TRC A;  3FPW A;  3DBA A;  1OTB A;  4GLQ A;  1WA9 A;  4MCW A;  3E4Q A;  2M1C A;  1XJ2 A;  5HSQ A;  3OBF A;  2D01 A;  4BWI A;  4JGP A;  4DJ2 A;  4HH3 A;  3H7W A;  5KSH A;  3BJN A;  4EUV A;  1P9W A;  3E0Y A;  2HJ9 C;  2K7S A;  3BQA A;  3PBR A;  4Y3I A;  5I5L A;  4BMW A;  4EW7 A;  3EGX C;  3IS2 B;  1T1A A;  2ZOI A;  1UWP X;  4KUK A;  4ARZ A;  2YKH A;  3MQO A;  4R38 A;  4WEK A;  4CLC A;  2PYR A;  1LSW A;  5DFY A;  2IA2 A;  4P6Z S;  1GSW A;  3EQU A;  2KOI A;  4BBU A;  3PBS A;  4BBV A;  2K31 A;  1DP8 A;  5J3W A;  4JGO A;  4L0L A;  3T4J A;  2VKS A;  3F1P B;  3C8C A;  2ZMV A;  4NXE A;  4G3K A;  2QJ5 A;  4L9G A;  2JKR I;  5HL6 A;  5HDD A;  1N9L A;  1TS0 A;  1S4S A;  2Z6D A;  1T1C A;  1W63 Q;  1BYW A;  2JKT M;  3F1N B;  3KYZ A;  4NKP A;  2K2N A;  4E04 A;  3B33 A;  2W0N A;  3EQV A;  1OT9 A;  4WN5 A;  4Q0H A;  4DMZ A;  4GHI A;  3EOI A;  2PR6 A;  2V0U A;  3H82 B;  4H6J A;  3IBJ A;  2B02 A;  4M4X A;  2XSS A;  2GNX A;  3KSF A;  4FOF A;  3CI6 A;  1NWZ A;  2I9V A;  1D7E A;  5K5B A;  3T4K A;  4LRX C;  4CLC C;  3PYP A;  2ZBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...