4PM7A

Crystal structure of ctx-m-14 s70g:s237a in complex with cefotaxime at 1.29 angstroms resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGAGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/antibiotic
molecule keywords Beta-lactamase CTX-M-14
publication title Molecular Basis for the Catalytic Specificity of the CTX-M Extended-Spectrum beta-Lactamases.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
total genus 96
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4pm7A00
4P0MA 2P9VA 1NZOA 5F1FA 3S1YA 5CHJA 3Q07A 2V20A 1Z6FA 3VSLA 1NZUA 4QHCA 5FQJA 2XDMA 4E6XA 5GL9A 4JXSA 2HPBA 3HVFA 5GLAA 3V50A 1W8QA 3Q1FA 2V1ZA 5AQ9A 3Q81A 3UDIA 4E3MA 4OH0A 2IWBA 1PWCA 2EFUA 3C7UA 2ZMAA 4N1HA 5CERA 5HAQA 3OCLA 4ZAMA 5GHXA 3FKVA 1PZPA 1L0GA 1K56A 1BT5A 1L0EA 4OQGA 5CGWA 4LV1A 4S2KA 5E2HA 3IXDA 4KZ8A 5FI2A 2Y2MA 5E2EA 2WK0A 2EXAA 5GLDA 1KGFA 4S2NA 3O86A 1XGJA 1ZG4A 3IWOA 4IBRA 4KZAA 3M2KA 4ZTKA 4OP5A 1HTZA 3HL9A 5J8XA 1KE3A 1TVFA 2WGWA 2Y2NA 3GR2A 3HLEA 5FASA 5FQQA 2ZQDA 4KZ6A 2Y2OA 4KG2A 5DF9A 3G2YA 5JYOA 2ZM0A 4WM9A 3OZHA 1K38A 4S2OA 4JF6A 4OP8A 5FQ9A 3W8KA 3Q7VB 4OLGA 1K56D 5CGXA 1H8ZA 1HD8A 4JF5A 3RXWA 3UDXA 4B88A 2Z2MB 4S2JA 4JBFA 4OONA 4GD8A 1E4DA 2OLVA 1BLHA 5BOHA 3PBNA 1W79A 1M40A 4U0XA 4GDNA 2Y91A 1SDEA 3SS5A 3D4FA 4OPYA 3G35A 1NXYA 1BLCA 3BFDA 4BENA 3WRZA 3S22A 1GA9A 1N4OA 4EBPA 2EX8A 3AGFA 3MZFA 1TDLA 1LL9A 1MKIA 3PBTA 3IF6A 5FAPA 2QPNA 4KENB 1FSYA 3CG5A 4N1XA 5F83A 4BJPA 4DF6A 5EOOA 1J9MA 2Y2QA 3UPNA 2J8YA 1FCMA 1WE4A 3C7VA 5EVIA 4E6WA 3A3FA 3HUMA 4Y7PA 4NK3A 4BD1A 2EX2A 2Q9MA 3FV7A 4XUZA 1ESIA 3AGEA 4S2PA 4WELA 3DWKA 5TGFA 5KMWA 2HDUA 4HBUA 1C3BA 3ZG0A 4K0XA 1CI8A 1K4FA 1Q2PA 4HESA 4Y0OA 4UAAA 3SH8A 4Q8IA 4B4ZA 2G2WA 4S2IA 3Q82A 4LV3A 2Y55A 4WZ4A 5EVLA 4PM6A 3AGDA 3TSGA 4EV4A 3PBRA 3MZDA 2Y2LA 4R23A 3OCNA 3W4OA 1BUEA 5M19A 3ZVWA 4S2MA 3O3VA 5CRFA 5EE8A 3RXXA 2XR0A 1RGYA 1L0FA 1BULA 3O87A 1XP4A 1JWVA 1K6SA 3UE3A 2EX6A 4DDYA 1BTLA 2ZQCA 4IEDA 5EVID 4RA7A 5HW3A 1GCEA 5DF8A 5HARA 1KE0A 4BD0A 2H10A 3MXSA 5U47A 4Y0TA 1KGEA 4K91A 2A3UA 1PI5A 3DWZA 2RCXA 4OQHA 4NETA 5DTTA 5F82A 4S2NC 3A3IA 1ESUA 4UA7A 1JTGA 3ZNYA 1K57A 3HREA 3N6IA 2XH9A 1CEGA 3MFDA 3WS0A 3GRJA 2ZM8A 4WYYA 4X68A 1DJCA 3V3RA 2Y4AA 3A3JA 4PMAA 1K25A 1YLPA 4R3JA 1OMEA 2Y2PA 2WZZA 2HP9A 3OPLA 4DE2A 3TG9A 5L2FA 1BLSA 2WZXA 1TEMA 2ZQ9A 4MBFA 5CHUA 2H5SA 3UN7A 2E8IA 2UWXA 4OLDA 4EBNA 1WYCA 1ONGA 5CTMA 3SS3A 3ZG9B 2XD1A 4IBXA 4RX2A 4A5RA 3BLMA 3BM6A 3V3SA 2QMIA 3GV9A 5A93A 2VGKA 5FDHA 3ZFZA 4P85A 4GNUA 3ZVTA 5FAQA 4P87A 4FSFA 3VP4A 3NY4A 5HFOA 1ONHA 3VMAA 3N7WA 2WUQA 3DW0A 4R0QA 1YLYA 3OPHA 4GKUA 4GD6A 2HP6A 4QD4A 3WS1A 1ERMA 4UHUA 4BQMA 5CEDA 3ZG7B 1JWZA 4IVKA 3HLGA 1ERQA 1W8YA 5HAIA 4KQQA 3UDFA 3HUNA 1SKFA 3NCKA 1PZOA 4PM5A 4BL2A 1L0DA 4PM9A 2WGIA 1YT4A 4OKPA 4K0WA 3IF6C 4R4RA 3ZHHA 3O88A 3DTMA 1U60A 3VP1A 2EX9A 3FZCA 3OC2A 2IWCA 1G68A 2PBYA 4ZDXA 4MBHA 3BLSA 3P09A 1VQQA 4KZ9A 3LEZA 3N4IA 1JWPA 4EWFA 2G2UA 2DNSA 3G30A 5FQKA 3WS4A 4L0LA 3IT9A 5EUAA 1SDNA 3C4PA 4MBKA 2GDNA 4PM8A 4ZBEA 1FR6A 3WS5A 1FQGA 3PBQA 3VOYA 4U0TA 3UPOA 1JVJA 2HP5A 3NIAA 3V39A 3BFFA 1L2SA 5FAOA 2HDSA 1K54C 4DE3A 3UNWA 2DCFA 3ZG5A 1O7EA 4DXCA 3BYDA 4WZ5C 4JXVA 2BG1A 4DE1A 4KQRA 3IXGA 4FH4A 5CGSA 5FQMA 4GN2A 5M1AA 2WKIA 3VOZA 3G31A 5GHZA 1K4EA 1IYSA 4GB7A 1ZKJA 4LV2A 3BFCA 4KG6A 3IHAA 4OQIA 3FKWA 2WKHA 2OSUA 3QHYA 3RJUA 5GLCA 5FI6A 5KSHA 1YLTA 1M6KA 1VM1A 1JTDA 4QJGA 1SHVA 2I72A 4MNRA 2WGWB 2WAFA 4E3NA 1K55A 3IH8A 1MBLA 4IVIA 4E3JA 4EQIA 4WMCA 2XD5A 2EFXA 4DE0A 1XKZA 2X71A 4JKTA 2WGVA 4MEZA 1K57C 3BFEA 4WBGA 3ZGAB 5DTKA 4OPQA 2Y2GA 1DJBA 1KVLA 5CHMA 4X56A 1ES3A 1ZC2A 3VP3A 4GOGA 2PU4A 5EOEA 1K6RA 3PAEA 5AQAA 1IYOA 5IHVA 1IKGA 3CMZA 1FR1A 5AQ7A 4BL3A 2ZLYA 4DKIA 2ZJ9A 1CK3A 1RGZA 2J9OA 2WAEA 4QU3A 3BECA 1XA1A 2WKEA 3BRMA 3GMWA 4LCLA 3ZDJA 5DTSA 1ES2A 1HZOA 1GA0A 3PTEA 4KZ5A 1WYBA 5I94A 2XF3A 4JXWA 1LI9A 4O7DA 1ES4A 1YLZA 4M3KA 1NRFA 4WMCD 4X69A 3M2JA 4F94A 2BLSA 3VFHA 1IYPA 4Y0UA 3VSKA 2ZD8A 2Y2KA 3SS4A 3OPRA 5TR7A 4WEJA 3IF6B 4HEFA 4BLMA 4KG5A 4GZBA 1QMEA 3NBLA 3NI9A 3N8RA 2V2FF 1LI0A 3MBZA 4Z9QA 1KGGA 3BFGA 2H0YA 3IWQA 2J7VA 2EXBA 3MZEA 5FATA 1PWGA 3VFFA 3UO9A 3W4QA 4JXGA 2C6WB 1EROA 2FFYA 1SCWA 2B5RA 1MWSA 5KSCA 1KDWA 2RL3A 5EPHA 5TFQA 3CJMA 3FWLA 3MKEA 5D3OA 5FA7A 2XK1A 3JYIA 3LCEA 4D2OA 3QNBA 1E25A 3CZDA 2JBFA 1XXMA 2ZQAA 4XUXA 4OOMA 3BEBA 3Q7ZA 1BSGA 3IWIA 4KZBA 5A92A 4KZ7A 2HDRA 1LL5A 4PM7A 1Y54A 2Q9NA 3C4OA 4CPKA 5A91A 1MWUA 4E3IA 1G6AA 4RX3A 3SOIA 1H8YA 1Q2QA 2QZ6A 1CI9A 3M6BA 3GTCA 4C3QA 4UA6A 3VP2A 1PYYA 1EWZA 2JC7A 5DF7A 5F1GA 3LY3A 1PW8A 4OOYA 1PW1A 3A3EA 5CEBA 1TDGA 3WWXA 3NDEA 1GHPA 3IH9A 3Q7VA 4ZJ3A 3MXRA 4QY5A 5EECA 1GHMA 5AQBA 4C75A 3PBOA 3IQAA 1YMSA 2Y2HA 3HLCA 3I7JA 4B4XA 1HVBA 2ZC4B 4OPZA 5E2GA 5GHYA 1K55C 2ZC3B 3GSGA 3G4PA 3IF5A 2A49A 3G34A 1XX2A 5EVIC 1IKIA 4N9KA 2IWDA 1H5XA 4HBTA 2P9VB 2R9XA 1KDSA 3NDGA 5CECA 4E3OA 3IXHA 3WS2A 2CC1A 4KQOA 1NJ4A 3N8SA 5CXWA 3UPPA 1MWRA 4N9LA 4R4SA 2OLUA 5A90A 4QY6A 5M18A 2H0TA 2ZQ8A 1XPBA 4KZ3A 1W5DA 3A3DA 2C5WB 1DY6A 1I2SA 5HAPA 1ZG6A 3VP0A 4P6BA 1KVMA 2WADA 4YINA 2ZC5B 1MWTA 3P98A 3M6HA 5JYPA 2FFFB 3N8LA 4R1GA 4U3TA 4FCFA 4JF4A 4DDSA 4JPMA 2P74A 4ZJ2A 3SH9A 3OPPA 1W7FA 3NC8A 1FOFA 5E2FA 4UA9A 5FSRA 1FCNA 1IEMA 1O07A 4LENA 1XA7A 3GVBA 3IHBA 1NYMA 3HUOA 1QMFA 1AXBA 3PBSA 4LV0A 4X55A 2XLNA 3UY6A 1XGIA 1DJAA 1I5QA 4QB8A 3TOIA 1FSWA 1YMXA 4OOLA 3G2ZA 2X02A 3E2KA 4S2LA 4H8RA 1KE4A 4EBLA 1YLWA 2OV5A 2Y2IA 1N9BA 3HBRA 4X6TA 1E3UA 2JE5A 1YQSA 4KZ4A 3SH7A 1EI5A 5HX9A 2WYXA 2J9PA 3B3XA 3ZNTA 2HDQA 3C5AA 1YM1A 2JCHA 3ISGA 4N92A 2ZQ7A 4OQ0A 2R9WA 3ITAA 3ITBA 3LO7A 3W4PA 1CEFA 2VGJA 4YFMA 5E43A 3PAGA 4ZJ1A 3E2LA 4JLFA 4X53A 4XXRA 3MKFA 4PPRA 3UE1A 5HL1A 1PI4A 5CTNA 5DVAA 1K54A 3GQZA 4FD8A 4CJNA 1ES5A 3HLFA 4WZ5A 1LHYA 3EQUA 4ID4A 3QNCA 5EVIB 4OPRA 1YLJA 4EUZA 3HLDA 2Y59A 1GHIA 2XEPA 1I2WA 5G18A 5KZHA 1FCOA 4GDBA 2XGNA 4RYEA 1E3UD 4FH2A 4MLLA 4DRTA 1NY0A 1PIOA 4E3KA 3FYZA 3ZCZA 4WEKA 4DXBA 1S6RA 3HLWA 1BZAA 2ZC7A 4C6YA 4OVDA 3G32A 1RP5A 4RVAA 1PWDA 5GLBA 3UE0A 2XQZA 1MY8A 1IYQA 3EQVA 2ZM2A 1MXOA 1ALQA 1BLPA 1RCJA 3WRTA 1S0WA 2X01A 5FI7A 2Y2JA 3LY4A 2PU2A 1LLBA 4E3LA 2ZC6B 2Z2LB 2XFTA 3V5MA 4LCMA 3IXBA 3S4XA 1MPLA 4R3BA 2XFSA 3HLBA 1IELA 1NYYA 5FQIA 2DRWA 3ZG8B
chains in the Genus database with same CATH superfamily
2ACGA 2P9VA 1NZOA 3Q07A 2V0WA 2V20A 4ARZB 5GL9A 2LB5A 4AFIA 3V50A 2BASA 1W8QA 2V1ZA 4OH0A 4O8GA 5GHXA 5CGWA 5FI2A 4KZ8A 4GLQA 5FDSA 3MR0A 1OTAA 4ZTKA 5J8XA 3F1PA 3GR2A 2LB9A 3T4TA 2JKRI 4XT2B 5JYOA 4JF6A 4OP8A 3W8KA 3T1QB 4OLGA 3PYPA 1HD8A 4JF5A 2Z2MB 2KLIA 1BLHA 3QP1A 2R78A 3PBNA 1PNEA 4GDNA 2M7UA 3D4FA 3WRZA 1N4OA 3A0RA 5FL3A 1LL9A 2NUPC 2QPNA 5F83A 4N1XA 4BJPA 4DF6A 2FZ0A 4ESPA 1S1ZA 1XJ4A 4Y7PA 4BD1A 4WELA 1CI8A 1K4FA 1Q2PA 4Y0OA 3SH8A 3VE3A 2G2WA 5I5LA 3Q82A 4LV3A 5EVLA 3OCNA 1BUEA 3LR5A 4S2MA 1G6OA 5EE8A 3RXXA 5L09A 2XR0A 2O9CA 1BTLA 2ZQCA 4IEDA 1TS8A 3E0YA 3E98A 1KE0A 1VHMA 4LRYC 1PI5A 2RCXA 5DTTA 5F82A 3CITA 1K57A 3HREA 2XH9A 4PMAA 3BWLA 1K25A 4R3JA 1OMEA 2WZZA 4DE2A 1F2KA 2HF6A 3NHQA 4MBFA 5CHUA 1T1BA 3LI9A 3S7NA 3BLMA 3V3SA 3ZFZA 3ZVTA 1H3QA 3SZTA 3VMAA 2WUQA 4QD4A 1S67L 3O5YA 1ACFA 4BL2A 4K0WA 3ZHHA 3DTMA 3VP1A 4HJ3A 3BLSA 1XFQA 3UMDA 3WS4A 2HZ5A 4Q0HA 5EUAA 3C4PA 2XSSA 2O9BA 4PM8A 3UPOA 3PBQA 3VOYA 3NIAA 3BFFA 1L2SA 2P08A 1FILA 4WL9A 2IA2A 1LT0A 4FH4A 3MF0A 3VOZA 1K4EA 4LV2A 4BBUA 2MJ6A 1YAXA 2D02A 3JVVA 1P9RA 3QHYA 5GLCA 4L9FA 3H9WA 2FH5A 1MBLA 3T50A 4EQIA 4JKTA 4MEZA 4WBGA 3R7WB 5HWVA 4K08A 1KVLA 1ZC2A 2OOLA 3OBFA 4PHTA 1IKGA 3K3CA 3T1SA 2ZLYA 2ZJ9A 4UEYA 2VK3A 4QU3A 1VETB 2V8CA 3ZDJA 3EEAA 2QJ7A 4JXWA 4WMCD 4F94A 2GZAA 3VSKA 2ZD8A 4WEJA 2VGLS 3EWKA 4X1MA 3MBZA 3IWQA 3MZEA 4MN7A 5FATA 4MN5A 5TJJA 3V67A 4RQ9A 4F3LA 3T12B 3W4QA 4G3KA 1MWSA 3UE6A 5TFQA 4DN0A 2A24A 5FA7A 3JYIA 3LCEA 1E25A 2ZQAA 3K2NA 5EV0A 3BEBA 4KZ7A 3LEQA 1LL5A 1Y54A 2Q9NA 2INWA 4C3QA 2W3GA 3F1NB 3B42A 1PW1A 1VEUB 2V0UA 4GJ4A 3NDEA 5HSQA 3CWFA 4QY5A 5EECA 1YMSA 3I7JA 4B4XA 4MDZA 5E2GA 4CLCE 4DMZA 2K2NA 3GSGA 3G34A 4N9KA 2IWDA 4HP4A 1P0ZA 5AVEA 5CECA 5IS1A 5L8MA 4E3OA 3CHWP 1NJ4A 1DRMA 3N8SA 4R4SA 4I38A 2ZQ8A 1XPBA 4KZ3A 3A3DA 2C5WB 4HY8A 1DY6A 3TW8A 5G4YA 2KDKA 4I3IA 2VGLM 1ZG6A 3VOLA 1MWTA 4G3WA 4R1GA 4DDSA 1FOFA 3LIBA 2JHEA 5FSRA 1IEMA 4CLCD 3PBSA 5EFWA 4QB8A 1DJAA 1I5QA 3IX3A 3TOIA 1YMXA 4OOLA 3MJQA 4H8RA 4HHDA 1YSPA 1YLWA 4X6TA 2JE5A 1W63Q 3KSFA 3B3XA 4EXOA 3EGXC 2JCHA 2ZQ7A 4IUHA 3CLOA 5E43A 3E2LA 3S7QA 4XXRA 4PPRA 5HD5A 4FD8A 4BBVA 1ES5A 1LHYA 1BYWA 3EQUA 2L1MA 4OPRA 2Y59A 3PHYA 3G6OA 3LGOA 2XGNA 4DRTA 3FYZA 3PR6A 3ZCZA 5EM0A 3HLWA 1BZAA 4C6YA 3G32A 1RP5A 3UE0A 1MY8A 1IYQA 3EQVA 1GSXA 5HPIA 3LY4A 4E3LA 4II7A 1OT6A 2PR5A 1NYYA 1WA9A 4MCWA 4BENA 4P0MA 5A8BA 1S4SA 1D1JA 5CHJA 3KYEA 2XDMA 4F3LB 3UDIA 1PWCA 3C7UA 2VV6A 4N1HA 5CERA 2A24B 3FKVA 1PZPA 3S7OA 1YKDA 2Y2MA 2JKFA 2WK0A 5GLDA 2O9AA 5HL6A 2KOIA 1XGJA 1ZG4A 4IBRA 2V8FA 1HTZA 3HL9A 4X1LA 2WGWA 2Y2NA 5EM1A 3IX8A 5FASA 4KZ6A 2Y2OA 2M1CA 2ZM0A 3OZHA 4G3VA 4B88A 2HJ9C 3UDXA 4OONA 4GD8A 2ZOIA 1M40A 4R6LA 4KUKA 1OTIA 3MQ0A 1T18A 3SS5A 1S1YA 4OPYA 1NXYA 1BLCA 5FEFA 4GHIA 1GA9A 3S22A 3T4QA 4EBPA 3AGFA 3T4OA 1XJ2A 3IF6A 1KOUA 2PHYA 2Y2QA 4QPRA 3A3FA 3NOUC 4NK3A 3FV7A 5KMWA 1ESIA 3AGEA 2HDUA 4HBUA 3ZG0A 4K0XA 2VX8A 5KIZA 4B4ZA 2BTFP 3TSGA 4EV4A 3AGDA 3U4LP 3T4LA 5CRFA 1RGYA 1L0FA 1BULA 3UE3A 3QP6A 5EVID 1OJ5A 5DF8A 5C5KA 4BD0A 3DTIA 2W3EA 4LFUA 1OTBA 3DWZA 4P6ZS 4S2NC 5HDCA 1ESUA 3ZNYA 3WS0A 2EWWA 1DJCA 1MZUA 1T19A 2W1TB 3H7WB 1OT9A 3H82A 2Y2PA 2HP9A 5L2FA 4NXBA 2WZXA 5HZHA 1TEMA 2ZQ9A 2W3HA 2ZL1B 2E8IA 1EW0A 1ONGA 5CTMA 5J7EA 3MMHA 4A5RA 3BM6A 5FDHA 3U2AA 3LR0A 2JKTM 3IX4A 3N7WA 4R0QA 4GD6A 2HP6A 4BQMA 5CEDA 2AVXA 1ERQA 1W8YA 4KQQA 1HLUP 3HUNA 1PZOA 1LL8A 2QHKA 1U60A 3FZCA 3OC2A 2IWCA 2PBYA 4ZDXA 5LBRA 1V9ZA 1NRJA 4KZ9A 4X25A 2G2UA 4JGPA 3G30A 2OWHA 3IT9A 4LRZE 5L10A 2VKSA 1NWZA 1FR6A 3R4KA 1K54C 1T1AA 1SKOB 3ZG5A 1O7EA 4DXCA 4WZ5C 1PRQA 2WKIA 4NKPA 2Q0OA 4KG6A 4OQIA 2XRNA 4P6ZM 2OSUA 4NXFA 4E3NA 2WGWB 2WAFA 3IH8A 4HIAA 4WMCA 2P04A 3BFEA 1XJ3A 4OPQA 1DJBA 5CHMA 3SW1A 4GOGA 5EOEA 5IHVA 3MFXA 5AQ7A 5TBMA 1FIKA 4DKIA 1RGZA 4WUJA 3CI6A 1XA1A 3GMWA 4LCLA 5DTSA 3PTEA 1GA0A 4KZ5A 5I94A 1YLZA 1P97A 4M3KA 4H6JA 1IYPA 3KX0X 3SS4A 3OPRA 5TR7A 3VV4A 3IF6B 4HEFA 1QMEA 3NBLA 2J80A 2HGVA 4Z9QA 1KGGA 2G7UA 1W63M 3C38A 1EROA 2FFYA 1SCWA 3FWLA 3MKEA 3QNBA 1XXMA 2O99A 3Q7ZA 1BSGA 3IWIA 4KZBA 4Y13A 4PM7A 1GSVA 1MWUA 3CUEC 4RX3A 2Z6CA 2VLGA 4HI4A 1EWZA 2UV0E 3A3EA 3OOVA 1GHPA 3IH9A 3LIFA 4ZJ3A 1OTEA 4MN6A 1GHMA 2GNXA 4C75A 3PBOA 3F1OA 3IQAA 2Y2HA 3HLCA 1HVBA 5GHYA 2PT7A 1K55C 2ZC3B 3G4PA 3IS2B 2A49A 5EVIC 1H5XA 2P9VB 3QP2A 1KDSA 3NDGA 5CX7A 3WS2A 2O0YA 4HH3A 4B93A 3UPPA 4N9LA 5F5YA 4GS9A 4CLCA 3L9KA 3ULFA 5G4ZA 1I2SA 1UGUA 5J4EA 2XROA 4Y5FA 2WADA 4BWIA 2ZC5B 3P98A 2FFFB 3N8LA 4JF4A 4FUWA 4JPMA 4ZJ2A 3QP8A 3F1PB 3CPTA 2Y79A 4UA9A 1FCNA 1T1CA 1XA7A 3IHBA 1NYMA 1OJGA 1AXBA 3DBAA 4NXGA 3TRCA 3G2ZA 5HDSA 3E2KA 3MSHA 5K5BA 3RTYA 5MC7A 3KSGA 1YM1A 2M7VA 3T4SA 4OQ0A 2R9WA 1DP8A 4YFMA 3PAGA 3MKFA 5HL1A 4EUVA 1K54A 2HJEA 4CJNA 4WZ5A 1F5MA 5IT5A 4ID4A 3QNCA 3HLDA 2XEPA 4GDBA 4E3KA 1NY0A 3LUQA 5TBMB 2ZC7A 4OVDA 4RVAA 2XQZA 4YOFA 3FC7A 3WRTA 1S0WA 2X01A 3FPVA 1N9NA 3V5MA 4LCMA 4EW7A 3IXBA 3S4XA 2XFSA 3HLBA 3NJAA 2ZMFA 2QWSA 1VB6A 5AJGA 2PD7A 3DTKA 3NOTC 1NZUA 4EU0A 4E6XA 3LYXA 4JXSA 3Q1FA 5AQ9A 4E3MA 2IWBA 2ZMAA 5HAQA 3OCLA 1L0GA 1YPRA 3IXDA 3P7NA 3UB6A 4ZRRA 3IWOA 5DJUA 1LSXA 1CF0A 4Y15A 1A0KA 2ZQDA 3G2YA 4WM9A 4I39A 2NUTC 3BQAA 1K38A 2W1RA 4S2OA 2VJWA 1D06A 1K56D 5CGXA 2CMNA 4S2JA 3CUEA 3UB9A 2OLVA 5BOHA 5DFXA 2W3FA 1SDEA 4R70A 3BFDA 3EGDC 2QJ5A 5L07A 3MZFA 1MKIA 5FAPA 4CLCB 2JKRM 2PDRA 1FSYA 5EOOA 1J9MA 3UPNA 1WE4A 5EVIA 4E6WA 2Q9MA 5TGFA 4S2PA 3GDIA 1C3BA 5HWTA 4Q8IA 3RFBA 4PM6A 4R23A 3ZVWA 3O3VA 1P9WA 4FTXA 3B47A 3W2ZA 3BQ8A 2EX6A 4DDYA 5FEGA 5HW3A 2H10A 3MXSA 5U47A 4HNBA 2A3UA 3T4JA 4NETA 3TJZC 1JTGA 3N6IA 2E8JA 3MFDA 3GRJA 2ZM8A 4WYYA 4X68A 4ETXA 3HCYA 3V3RA 2Y4AA 4HOIA 3EEHA 3QP5A 1YLPA 3D9YA 1BLSA 3RH8B 3UN7A 4OLDA 4EBNA 1WYCA 3ZG9B 4L9EA 3C2WA 2QMIA 3GV9A 5A93A 3K3DA 5FAQA 3DTEA 3VP4A 4XT2A 5HWWA 1YLYA 3OPHA 3WS1A 1ERMA 3FPWA 1MC0A 4Q0IA 1JWZA 2PRFA 2JKGA 4IVKA 4PM5A 1SKFA 3NCKA 2WGIA 1YT4A 4R4RA 4MBHA 2PAVP 3LICA 4EERA 1VQQA 3N4IA 1JWPA 5FQKA 4BBTA 2WKRA 1IOUA 1TS7A 4U0TA 1CJFA 2HP5A 3V39A 5FAOA 1GSWA 4HP9A 3OLOA 4ETZA 4JXVA 4DE1A 2V1BA 5CGSA 3IXGA 1N9LA 3FG8A 5M1AA 5GHZA 1S4RA 3BFCA 1G28A 3IHAA 3FKWA 4WLAA 2I9VA 3RJUA 5FI6A 3S7PA 1YLTA 1JNUA 1M6KA 1PFLA 1JTDA 2YKFA 4Y2FA 4NXEA 4QJGA 1SHVA 4MNRA 4E3JA 2VZWA 3IBJA 4DE0A 1XKZA 4GCZA 2WGVA 1K57C 1SZVA 5DTKA 4X56A 3VP3A 2PU4A 1OPXA 3CMZA 1FR1A 4DJ3A 3KYZA 2J9OA 3BECA 2WKEA 1ZHHB 2OAP1 2XF3A 1ES4A 4UQIS 1LSWA 4X69A 3M2JA 4Y3IA 2BLSA 2Y2KA 3C8CA 5HPFA 4KG5A 4ME4A 3N8RA 1LI0A 3BFGA 2H0YA 2B18A 1TS0A 3NULA 2EXBA 2EWVA 3VFFA 3UO9A 2C6WB 5EPHA 1N9OA 2XK1A 4EETB 3CZDA 2JBFA 4DJ2A 4LGWA 4OOMA 3LFVA 5A92A 5A91A 1H8YA 2QZ6A 1CI9A 3M6BA 1K0KA 2B02A 2ZMVA 3VP2A 2JC7A 5F1GA 3LY3A 5AVFA 1TDGA 3Q7VA 1NLYA 4JGQA 5AQBA 2ZC4B 3VE4A 1IKIA 4HBTA 2J3WA 2PBDP 5CXWA 1MWRA 5M18A 2H0TA 4UQIM 1W5DA 2J3TD 1XFNA 3VP0A 4IUKA 3R7WA 1D7EA 3PXPA 4YINA 3M6HA 3BW6A 1DP6A 1ODVA 5DKLA 2P74A 3MQQA 1W7FA 5F6AA 3NC8A 1VETA 4QWOA 4LENA 3GVBA 3HUOA 3KSIA 5DKKA 3UY6A 3ZQ5A 4GW9A 4EBLA 1KE4A 5DJTA 2Y2IA 3HBRA 3SH7A 4KZ4A 1G5UA 1EI5A 2W3DA 5HX9A 3ZNTA 2HDQA 2WKPA 3C5AA 4GHIB 3ITAA 3ITBA 4ZJ1A 4JLFA 1PI4A 5CTNA 5DVAA 2WKQA 4EUZA 1YLJA 5IU1A 1I2WA 1FCOA 3HJKA 4RYEA 1CQAA 1E3UD 4FH2A 4MLLA 4YWZA 3BJNA 4WEKA 4DXBA 2L4RA 3F1NA 5GLBA 1PWDA 3C30A 4LLOB 2W27A 1YSQA 1BLPA 1VEUA 1RCJA 5HD3A 5FI7A 1UWNX 4KUOA 2D01A 4MMNA 1H8MA 2H28A 1MPLA 5FQIA 1NLZA 3UB8A 3ZG8B 1TD5A 3UB7A 5F1FA 3S1YA 2Z6DA 1Z6FA 3VSLA 4QHCA 5FQJA 3ZYTA 2HPBA 3HVFA 5GLAA 2PYRA 3Q81A 1J3WA 3H82B 2EFUA 2GJ3A 4ZAMA 1K56A 1BT5A 1L0EA 4OQGA 5E2HA 4LV1A 4S2KA 4B9OA 5E2EA 2EXAA 1KGFA 2PR6A 4S2NA 3O86A 4KZAA 3M2KA 4FOFA 4OP5A 1KE3A 1TVFA 3IBRA 3BY9A 3HLEA 5FQQA 4KG2A 5DF9A 5FQ9A 3Q7VB 4HJ4A 1UWPX 1H8ZA 3RXWA 4JBFA 1E4DA 1W79A 4U0XA 2Y91A 2XA7S 3G35A 2P7JA 1F9IA 2QKPA 2EX8A 1TDLA 2ZBBA 3PBTA 4PKYA 2ZOHA 4KENB 2YKHA 1AWIA 3CG5A 2J8YA 1FCMA 3C7VA 3E4PA 3HUMA 2EX2A 4XUZA 3DWKA 1F98A 3D3OA 4HESA 4UAAA 4IJGA 4S2IA 4WZ4A 2Y55A 3PBRA 3MZDA 2Y2LA 3W4OA 2QYBA 5M19A 3LR3A 2J3TC 2OWJA 1MKMA 3O87A 1XP4A 1JWVA 1K6SA 2VV7A 3T1RA 1DP9A 4RA7A 1GCEA 5HARA 4E04A 3QP4A 2V1AA 4Y0TA 1KGEA 4JGOA 2JKTI 4K91A 4OQHA 3A3IA 4UA7A 4YNRA 1CEGA 1TF1A 3A3JA 4H6JB 3GECA 3EOIA 3JPUA 3OPLA 3NECA 3TG9A 3B33A 4CQHA 2H5SA 3HJIA 2UWXA 1XJ6A 2PD8A 3SS3A 2XD1A 1V9YA 4IBXA 4RX2A 2XA7M 4O01A 1IFQA 2VGKA 4P85A 4GNUA 3L7HA 4P87A 4FSFA 3NY4A 5HFOA 1ONHA 4NG2A 3DW0A 2DMWA 4GKUA 4UHUA 4WN5A 3ZG7B 3HLGA 5HAIA 3UDFA 1L0DA 4PM9A 4OKPA 3IF6C 3O88A 2PYPA 4JGRA 2EX9A 1G68A 3P09A 4R3AA 4Q0JA 3LEZA 4EWFA 2DNSA 4L0LA 3E4QA 1SDNA 4MBKA 2GDNA 4ZBEA 3WS5A 1FQGA 1JVJA 3F1OB 2HDSA 4DE3A 3UNWA 2DCFA 3BYDA 2BG1A 4KQRA 5FQMA 4GN2A 3G31A 1IYSA 4GB7A 1ZKJA 2W0NA 3TE8A 2WKHA 5KSHA 5DFYA 1VM1A 4GS9B 2I72A 4WF0A 1K55A 2Y8HA 4IVIA 2XD5A 2EFXA 2X71A 4BMWA 3LIDA 4HQAA 3ZGAB 2Y2GA 1ES3A 2GX5A 5AQAA 1K6RA 3PAEA 4BL3A 1IYOA 4I3JA 2JN7A 3CPTB 1CK3A 2WAEA 3BRMA 3ICYA 2KX6A 1ES2A 1HZOA 1WYBA 3CAXA 1LI9A 4NEED 4O7DA 1NRFA 2W1TA 3VFHA 3DAVA 3H7WA 4Y0UA 3JVUA 4BLMA 4GZBA 3NI9A 2V2FF 2ZL1A 4ARZA 2J7VA 3T4KA 1PWGA 4EEUA 2HV1A 3D72A 4JXGA 2K7SA 2B5RA 5KSCA 1KDWA 2RL3A 3CJMA 4KQDA 5D3OA 2K31A 4D2OA 4PKYG 4XUXA 4LPZA 2HDRA 3C4OA 4CPKA 4E3IA 1G6AA 1L3LA 3SOIA 1Q2QA 3LI8A 1Y4OA 3GTCA 4UA6A 2EA9A 3E4OA 1PYYA 4L9GA 5DF7A 1PW8A 4OOYA 5CEBA 3A0VA 3T1XA 3WWXA 1TS6A 4PAUA 2V9AA 3MXRA 4OPZA 5F69A 1SKOA 3UMEA 3IF5A 3MS6A 3NOPC 1XX2A 4I3AA 2R9XA 2B95A 3LIEA 3IXHA 2CC1A 3KYQA 5HDDA 2VEAA 4IHQA 4KQOA 2OLUA 3KSHA 5J3WA 5A90A 4QY6A 2VA0A 3A0SA 4I5SA 5HAPA 4HH2A 4P6BA 1KVMA 5JYPA 4U3TA 4EQ1A 4FCFA 1S66L 3SH9A 3OPPA 5E2FA 2L0WA 1O07A 3LR4A 1QMFA 4D60A 5EVEA 2VV8A 4LV0A 4LRXC 4X55A 2XLNA 1XGIA 3KO6A 2OAQ1 1Y28A 1FSWA 2X02A 4S2LA 2OV5A 1N9BA 1E3UA 1YQSA 1OTDA 4EEPA 4R38A 2WYXA 2J9PA 3ISGA 4N92A 1Z09A 3LO7A 3W4PA 1CEFA 2VGJA 4O0PA 4Y17A 4X53A 3UE1A 4M4XA 1LSVA 3GQZA 3HLFA 3LIAA 5EVIB 1GHIA 5G18A 5KZHA 1PIOA 4Z1WA 4EESA 1STZA 1H0MA 1S6RA 3UB5P 2ZM2A 1MXOA 1ALQA 3MQOA 5F68A 2Y2JA 2PU2A 1LLBA 2ZC6B 2Z2LB 3MXQA 4CLCC 2XFTA 4HJ6A 1X0OA 2A2LA 1ZTUA 3IS2A 4R3BA 3BY8A 1IELA 3P01A 2DRWA
chains in the Genus database with same CATH topology
4P0MA 2P9VA 1NZOA 5F1FA 3S1YA 5CHJA 3Q07A 2V20A 1Z6FA 3VSLA 1NZUA 4QHCA 5FQJA 2XDMA 4E6XA 5GL9A 4JXSA 2HPBA 3HVFA 5GLAA 3V50A 1W8QA 3Q1FA 2V1ZA 5AQ9A 3Q81A 3UDIA 4E3MA 4OH0A 2IWBA 1PWCA 2EFUA 3C7UA 2ZMAA 4N1HA 5CERA 5HAQA 3OCLA 4ZAMA 5GHXA 3FKVA 1PZPA 1L0GA 1K56A 1BT5A 1L0EA 4OQGA 5CGWA 4LV1A 4S2KA 5E2HA 3IXDA 4KZ8A 5FI2A 2Y2MA 5E2EA 2WK0A 2EXAA 5GLDA 1KGFA 4S2NA 3O86A 1XGJA 1ZG4A 3IWOA 4IBRA 4KZAA 3M2KA 4ZTKA 4OP5A 1HTZA 3HL9A 5J8XA 1KE3A 1TVFA 2WGWA 2Y2NA 3GR2A 3HLEA 5FASA 5FQQA 2ZQDA 4KZ6A 2Y2OA 4KG2A 5DF9A 3G2YA 5JYOA 2ZM0A 4WM9A 3OZHA 1K38A 4S2OA 4JF6A 4OP8A 5FQ9A 3W8KA 3Q7VB 4OLGA 1K56D 5CGXA 1H8ZA 1HD8A 4JF5A 3RXWA 3UDXA 4B88A 2Z2MB 4S2JA 4JBFA 4OONA 4GD8A 1E4DA 2OLVA 1BLHA 5BOHA 3PBNA 1W79A 1M40A 4U0XA 4GDNA 2Y91A 1SDEA 3SS5A 3D4FA 4OPYA 3G35A 1NXYA 1BLCA 3BFDA 4BENA 3WRZA 3S22A 1GA9A 1N4OA 4EBPA 2EX8A 3AGFA 3MZFA 1TDLA 1LL9A 1MKIA 3PBTA 3IF6A 5FAPA 2QPNA 4KENB 1FSYA 3CG5A 4N1XA 5F83A 4BJPA 4DF6A 5EOOA 1J9MA 2Y2QA 3UPNA 2J8YA 1FCMA 1WE4A 3C7VA 5EVIA 4E6WA 3A3FA 3HUMA 4Y7PA 4NK3A 4BD1A 2EX2A 2Q9MA 3FV7A 4XUZA 1ESIA 3AGEA 4S2PA 4WELA 3DWKA 5TGFA 5KMWA 2HDUA 4HBUA 1C3BA 3ZG0A 4K0XA 1CI8A 1K4FA 1Q2PA 4HESA 4Y0OA 4UAAA 3SH8A 4Q8IA 4B4ZA 2G2WA 4S2IA 3Q82A 4LV3A 2Y55A 4WZ4A 5EVLA 4PM6A 3AGDA 3TSGA 4EV4A 3PBRA 3MZDA 2Y2LA 4R23A 3OCNA 3W4OA 1BUEA 5M19A 3ZVWA 4S2MA 3O3VA 5CRFA 5EE8A 3RXXA 2XR0A 1RGYA 1L0FA 1BULA 3O87A 1XP4A 1JWVA 1K6SA 3UE3A 2EX6A 4DDYA 1BTLA 2ZQCA 4IEDA 5EVID 4RA7A 5HW3A 1GCEA 5DF8A 5HARA 1KE0A 4BD0A 2H10A 3MXSA 5U47A 4Y0TA 1KGEA 4K91A 2A3UA 1PI5A 3DWZA 2RCXA 4OQHA 4NETA 5DTTA 5F82A 4S2NC 3A3IA 1ESUA 4UA7A 1JTGA 3ZNYA 1K57A 3HREA 3N6IA 2XH9A 1CEGA 3MFDA 3WS0A 3GRJA 2ZM8A 4WYYA 4X68A 1DJCA 3V3RA 2Y4AA 3A3JA 4PMAA 1K25A 1YLPA 4R3JA 1OMEA 2Y2PA 2WZZA 2HP9A 3OPLA 4DE2A 3TG9A 5L2FA 1BLSA 2WZXA 1TEMA 2ZQ9A 4MBFA 5CHUA 2H5SA 3UN7A 2E8IA 2UWXA 4OLDA 4EBNA 1WYCA 1ONGA 5CTMA 3SS3A 3ZG9B 2XD1A 4IBXA 4RX2A 4A5RA 3BLMA 3BM6A 3V3SA 2QMIA 3GV9A 5A93A 2VGKA 5FDHA 3ZFZA 4P85A 4GNUA 3ZVTA 5FAQA 4P87A 4FSFA 3VP4A 3NY4A 5HFOA 1ONHA 3VMAA 3N7WA 2WUQA 3DW0A 4R0QA 1YLYA 3OPHA 4GKUA 4GD6A 2HP6A 4QD4A 3WS1A 1ERMA 4UHUA 4BQMA 5CEDA 3ZG7B 1JWZA 4IVKA 3HLGA 1ERQA 1W8YA 5HAIA 4KQQA 3UDFA 3HUNA 1SKFA 3NCKA 1PZOA 4PM5A 4BL2A 1L0DA 4PM9A 2WGIA 1YT4A 4OKPA 4K0WA 3IF6C 4R4RA 3ZHHA 3O88A 3DTMA 1U60A 3VP1A 2EX9A 3FZCA 3OC2A 2IWCA 1G68A 2PBYA 4ZDXA 4MBHA 3BLSA 3P09A 1VQQA 4KZ9A 3LEZA 3N4IA 1JWPA 4EWFA 2G2UA 2DNSA 3G30A 5FQKA 3WS4A 4L0LA 3IT9A 5EUAA 1SDNA 3C4PA 4MBKA 2GDNA 4PM8A 4ZBEA 1FR6A 3WS5A 1FQGA 3PBQA 3VOYA 4U0TA 3UPOA 1JVJA 2HP5A 3NIAA 3V39A 3BFFA 1L2SA 5FAOA 2HDSA 1K54C 4DE3A 3UNWA 2DCFA 3ZG5A 1O7EA 4DXCA 3BYDA 4WZ5C 4JXVA 2BG1A 4DE1A 4KQRA 3IXGA 4FH4A 5CGSA 5FQMA 4GN2A 5M1AA 2WKIA 3VOZA 3G31A 5GHZA 1K4EA 1IYSA 4GB7A 1ZKJA 4LV2A 3BFCA 4KG6A 3IHAA 4OQIA 3FKWA 2WKHA 2OSUA 3QHYA 3RJUA 5GLCA 5FI6A 5KSHA 1YLTA 1M6KA 1VM1A 1JTDA 4QJGA 1SHVA 2I72A 4MNRA 2WGWB 2WAFA 4E3NA 1K55A 3IH8A 1MBLA 4IVIA 4E3JA 4EQIA 4WMCA 2XD5A 2EFXA 4DE0A 1XKZA 2X71A 4JKTA 2WGVA 4MEZA 1K57C 3BFEA 4WBGA 3ZGAB 5DTKA 4OPQA 2Y2GA 1DJBA 1KVLA 5CHMA 4X56A 1ES3A 1ZC2A 3VP3A 4GOGA 2PU4A 5EOEA 1K6RA 3PAEA 5AQAA 1IYOA 5IHVA 1IKGA 3CMZA 1FR1A 5AQ7A 4BL3A 2ZLYA 4DKIA 2ZJ9A 1CK3A 1RGZA 2J9OA 2WAEA 4QU3A 3BECA 1XA1A 2WKEA 3BRMA 3GMWA 4LCLA 3ZDJA 5DTSA 1ES2A 1HZOA 1GA0A 3PTEA 4KZ5A 1WYBA 5I94A 2XF3A 4JXWA 1LI9A 4O7DA 1ES4A 1YLZA 4M3KA 1NRFA 4WMCD 4X69A 3M2JA 4F94A 2BLSA 3VFHA 1IYPA 4Y0UA 3VSKA 2ZD8A 2Y2KA 3SS4A 3OPRA 5TR7A 4WEJA 3IF6B 4HEFA 4BLMA 4KG5A 4GZBA 1QMEA 3NBLA 3NI9A 3N8RA 2V2FF 1LI0A 3MBZA 4Z9QA 1KGGA 3BFGA 2H0YA 3IWQA 2J7VA 2EXBA 3MZEA 5FATA 1PWGA 3VFFA 3UO9A 3W4QA 4JXGA 2C6WB 1EROA 2FFYA 1SCWA 2B5RA 1MWSA 5KSCA 1KDWA 2RL3A 5EPHA 5TFQA 3CJMA 3FWLA 3MKEA 5D3OA 5FA7A 2XK1A 3JYIA 3LCEA 4D2OA 3QNBA 1E25A 3CZDA 2JBFA 1XXMA 2ZQAA 4XUXA 4OOMA 3BEBA 3Q7ZA 1BSGA 3IWIA 4KZBA 5A92A 4KZ7A 2HDRA 1LL5A 4PM7A 1Y54A 2Q9NA 3C4OA 4CPKA 5A91A 1MWUA 4E3IA 1G6AA 4RX3A 3SOIA 1H8YA 1Q2QA 2QZ6A 1CI9A 3M6BA 3GTCA 4C3QA 4UA6A 3VP2A 1PYYA 1EWZA 2JC7A 5DF7A 5F1GA 3LY3A 1PW8A 4OOYA 1PW1A 3A3EA 5CEBA 1TDGA 3WWXA 3NDEA 1GHPA 3IH9A 3Q7VA 4ZJ3A 3MXRA 4QY5A 5EECA 1GHMA 5AQBA 4C75A 3PBOA 3IQAA 1YMSA 2Y2HA 3HLCA 3I7JA 4B4XA 1HVBA 2ZC4B 4OPZA 5E2GA 5GHYA 1K55C 2ZC3B 3GSGA 3G4PA 3IF5A 2A49A 3G34A 1XX2A 5EVIC 1IKIA 4N9KA 2IWDA 1H5XA 4HBTA 2P9VB 2R9XA 1KDSA 3NDGA 5CECA 4E3OA 3IXHA 3WS2A 2CC1A 4KQOA 1NJ4A 3N8SA 5CXWA 3UPPA 1MWRA 4N9LA 4R4SA 2OLUA 5A90A 4QY6A 5M18A 2H0TA 2ZQ8A 1XPBA 4KZ3A 1W5DA 3A3DA 2C5WB 1DY6A 1I2SA 5HAPA 1ZG6A 3VP0A 4P6BA 1KVMA 2WADA 4YINA 2ZC5B 1MWTA 3P98A 3M6HA 5JYPA 2FFFB 3N8LA 4R1GA 4U3TA 4FCFA 4JF4A 4DDSA 4JPMA 2P74A 4ZJ2A 3SH9A 3OPPA 1W7FA 3NC8A 1FOFA 5E2FA 4UA9A 5FSRA 1FCNA 1IEMA 1O07A 4LENA 1XA7A 3GVBA 3IHBA 1NYMA 3HUOA 1QMFA 1AXBA 3PBSA 4LV0A 4X55A 2XLNA 3UY6A 1XGIA 1DJAA 1I5QA 4QB8A 3TOIA 1FSWA 1YMXA 4OOLA 3G2ZA 2X02A 3E2KA 4S2LA 4H8RA 1KE4A 4EBLA 1YLWA 2OV5A 2Y2IA 1N9BA 3HBRA 4X6TA 1E3UA 2JE5A 1YQSA 4KZ4A 3SH7A 1EI5A 5HX9A 2WYXA 2J9PA 3B3XA 3ZNTA 2HDQA 3C5AA 1YM1A 2JCHA 3ISGA 4N92A 2ZQ7A 4OQ0A 2R9WA 3ITAA 3ITBA 3LO7A 3W4PA 1CEFA 2VGJA 4YFMA 5E43A 3PAGA 4ZJ1A 3E2LA 4JLFA 4X53A 4XXRA 3MKFA 4PPRA 3UE1A 5HL1A 1PI4A 5CTNA 5DVAA 1K54A 3GQZA 4FD8A 4CJNA 1ES5A 3HLFA 4WZ5A 1LHYA 3EQUA 4ID4A 3QNCA 5EVIB 4OPRA 1YLJA 4EUZA 3HLDA 2Y59A 1GHIA 2XEPA 1I2WA 5G18A 5KZHA 1FCOA 4GDBA 2XGNA 4RYEA 1E3UD 4FH2A 4MLLA 4DRTA 1NY0A 1PIOA 4E3KA 3FYZA 3ZCZA 4WEKA 4DXBA 1S6RA 3HLWA 1BZAA 2ZC7A 4C6YA 4OVDA 3G32A 1RP5A 4RVAA 1PWDA 5GLBA 3UE0A 2XQZA 1MY8A 1IYQA 3EQVA 2ZM2A 1MXOA 1ALQA 1BLPA 1RCJA 3WRTA 1S0WA 2X01A 5FI7A 2Y2JA 3LY4A 2PU2A 1LLBA 4E3LA 2ZC6B 2Z2LB 2XFTA 3V5MA 4LCMA 3IXBA 3S4XA 1MPLA 4R3BA 2XFSA 3HLBA 1IELA 1NYYA 5FQIA 2DRWA 3ZG8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P0M A;  2P9V A;  1NZO A;  5F1F A;  3S1Y A;  5CHJ A;  3Q07 A;  2V20 A;  1Z6F A;  3VSL A;  1NZU A;  4QHC A;  5FQJ A;  2XDM A;  4E6X A;  5GL9 A;  4JXS A;  2HPB A;  3HVF A;  5GLA A;  3V50 A;  1W8Q A;  3Q1F A;  2V1Z A;  5AQ9 A;  3Q81 A;  3UDI A;  4E3M A;  4OH0 A;  2IWB A;  1PWC A;  2EFU A;  3C7U A;  2ZMA A;  4N1H A;  5CER A;  5HAQ A;  3OCL A;  4ZAM A;  5GHX A;  3FKV A;  1PZP A;  1L0G A;  1K56 A;  1BT5 A;  1L0E A;  4OQG A;  5CGW A;  4LV1 A;  4S2K A;  5E2H A;  3IXD A;  4KZ8 A;  5FI2 A;  2Y2M A;  5E2E A;  2WK0 A;  2EXA A;  5GLD A;  1KGF A;  4S2N A;  3O86 A;  1XGJ A;  1ZG4 A;  3IWO A;  4IBR A;  4KZA A;  3M2K A;  4ZTK A;  4OP5 A;  1HTZ A;  3HL9 A;  5J8X A;  1KE3 A;  1TVF A;  2WGW A;  2Y2N A;  3GR2 A;  3HLE A;  5FAS A;  5FQQ A;  2ZQD A;  4KZ6 A;  2Y2O A;  4KG2 A;  5DF9 A;  3G2Y A;  5JYO A;  2ZM0 A;  4WM9 A;  3OZH A;  1K38 A;  4S2O A;  4JF6 A;  4OP8 A;  5FQ9 A;  3W8K A;  3Q7V B;  4OLG A;  1K56 D;  5CGX A;  1H8Z A;  1HD8 A;  4JF5 A;  3RXW A;  3UDX A;  4B88 A;  2Z2M B;  4S2J A;  4JBF A;  4OON A;  4GD8 A;  1E4D A;  2OLV A;  1BLH A;  5BOH A;  3PBN A;  1W79 A;  1M40 A;  4U0X A;  4GDN A;  2Y91 A;  1SDE A;  3SS5 A;  3D4F A;  4OPY A;  3G35 A;  1NXY A;  1BLC A;  3BFD A;  4BEN A;  3WRZ A;  3S22 A;  1GA9 A;  1N4O A;  4EBP A;  2EX8 A;  3AGF A;  3MZF A;  1TDL A;  1LL9 A;  1MKI A;  3PBT A;  3IF6 A;  5FAP A;  2QPN A;  4KEN B;  1FSY A;  3CG5 A;  4N1X A;  5F83 A;  4BJP A;  4DF6 A;  5EOO A;  1J9M A;  2Y2Q A;  3UPN A;  2J8Y A;  1FCM A;  1WE4 A;  3C7V A;  5EVI A;  4E6W A;  3A3F A;  3HUM A;  4Y7P A;  4NK3 A;  4BD1 A;  2EX2 A;  2Q9M A;  3FV7 A;  4XUZ A;  1ESI A;  3AGE A;  4S2P A;  4WEL A;  3DWK A;  5TGF A;  5KMW A;  2HDU A;  4HBU A;  1C3B A;  3ZG0 A;  4K0X A;  1CI8 A;  1K4F A;  1Q2P A;  4HES A;  4Y0O A;  4UAA A;  3SH8 A;  4Q8I A;  4B4Z A;  2G2W A;  4S2I A;  3Q82 A;  4LV3 A;  2Y55 A;  4WZ4 A;  5EVL A;  4PM6 A;  3AGD A;  3TSG A;  4EV4 A;  3PBR A;  3MZD A;  2Y2L A;  4R23 A;  3OCN A;  3W4O A;  1BUE A;  5M19 A;  3ZVW A;  4S2M A;  3O3V A;  5CRF A;  5EE8 A;  3RXX A;  2XR0 A;  1RGY A;  1L0F A;  1BUL A;  3O87 A;  1XP4 A;  1JWV A;  1K6S A;  3UE3 A;  2EX6 A;  4DDY A;  1BTL A;  2ZQC A;  4IED A;  5EVI D;  4RA7 A;  5HW3 A;  1GCE A;  5DF8 A;  5HAR A;  1KE0 A;  4BD0 A;  2H10 A;  3MXS A;  5U47 A;  4Y0T A;  1KGE A;  4K91 A;  2A3U A;  1PI5 A;  3DWZ A;  2RCX A;  4OQH A;  4NET A;  5DTT A;  5F82 A;  4S2N C;  3A3I A;  1ESU A;  4UA7 A;  1JTG A;  3ZNY A;  1K57 A;  3HRE A;  3N6I A;  2XH9 A;  1CEG A;  3MFD A;  3WS0 A;  3GRJ A;  2ZM8 A;  4WYY A;  4X68 A;  1DJC A;  3V3R A;  2Y4A A;  3A3J A;  4PMA A;  1K25 A;  1YLP A;  4R3J A;  1OME A;  2Y2P A;  2WZZ A;  2HP9 A;  3OPL A;  4DE2 A;  3TG9 A;  5L2F A;  1BLS A;  2WZX A;  1TEM A;  2ZQ9 A;  4MBF A;  5CHU A;  2H5S A;  3UN7 A;  2E8I A;  2UWX A;  4OLD A;  4EBN A;  1WYC A;  1ONG A;  5CTM A;  3SS3 A;  3ZG9 B;  2XD1 A;  4IBX A;  4RX2 A;  4A5R A;  3BLM A;  3BM6 A;  3V3S A;  2QMI A;  3GV9 A;  5A93 A;  2VGK A;  5FDH A;  3ZFZ A;  4P85 A;  4GNU A;  3ZVT A;  5FAQ A;  4P87 A;  4FSF A;  3VP4 A;  3NY4 A;  5HFO A;  1ONH A;  3VMA A;  3N7W A;  2WUQ A;  3DW0 A;  4R0Q A;  1YLY A;  3OPH A;  4GKU A;  4GD6 A;  2HP6 A;  4QD4 A;  3WS1 A;  1ERM A;  4UHU A;  4BQM A;  5CED A;  3ZG7 B;  1JWZ A;  4IVK A;  3HLG A;  1ERQ A;  1W8Y A;  5HAI A;  4KQQ A;  3UDF A;  3HUN A;  1SKF A;  3NCK A;  1PZO A;  4PM5 A;  4BL2 A;  1L0D A;  4PM9 A;  2WGI A;  1YT4 A;  4OKP A;  4K0W A;  3IF6 C;  4R4R A;  3ZHH A;  3O88 A;  3DTM A;  1U60 A;  3VP1 A;  2EX9 A;  3FZC A;  3OC2 A;  2IWC A;  1G68 A;  2PBY A;  4ZDX A;  4MBH A;  3BLS A;  3P09 A;  1VQQ A;  4KZ9 A;  3LEZ A;  3N4I A;  1JWP A;  4EWF A;  2G2U A;  2DNS A;  3G30 A;  5FQK A;  3WS4 A;  4L0L A;  3IT9 A;  5EUA A;  1SDN A;  3C4P A;  4MBK A;  2GDN A;  4PM8 A;  4ZBE A;  1FR6 A;  3WS5 A;  1FQG A;  3PBQ A;  3VOY A;  4U0T A;  3UPO A;  1JVJ A;  2HP5 A;  3NIA A;  3V39 A;  3BFF A;  1L2S A;  5FAO A;  2HDS A;  1K54 C;  4DE3 A;  3UNW A;  2DCF A;  3ZG5 A;  1O7E A;  4DXC A;  3BYD A;  4WZ5 C;  4JXV A;  2BG1 A;  4DE1 A;  4KQR A;  3IXG A;  4FH4 A;  5CGS A;  5FQM A;  4GN2 A;  5M1A A;  2WKI A;  3VOZ A;  3G31 A;  5GHZ A;  1K4E A;  1IYS A;  4GB7 A;  1ZKJ A;  4LV2 A;  3BFC A;  4KG6 A;  3IHA A;  4OQI A;  3FKW A;  2WKH A;  2OSU A;  3QHY A;  3RJU A;  5GLC A;  5FI6 A;  5KSH A;  1YLT A;  1M6K A;  1VM1 A;  1JTD A;  4QJG A;  1SHV A;  2I72 A;  4MNR A;  2WGW B;  2WAF A;  4E3N A;  1K55 A;  3IH8 A;  1MBL A;  4IVI A;  4E3J A;  4EQI A;  4WMC A;  2XD5 A;  2EFX A;  4DE0 A;  1XKZ A;  2X71 A;  4JKT A;  2WGV A;  4MEZ A;  1K57 C;  3BFE A;  4WBG A;  3ZGA B;  5DTK A;  4OPQ A;  2Y2G A;  1DJB A;  1KVL A;  5CHM A;  4X56 A;  1ES3 A;  1ZC2 A;  3VP3 A;  4GOG A;  2PU4 A;  5EOE A;  1K6R A;  3PAE A;  5AQA A;  1IYO A;  5IHV A;  1IKG A;  3CMZ A;  1FR1 A;  5AQ7 A;  4BL3 A;  2ZLY A;  4DKI A;  2ZJ9 A;  1CK3 A;  1RGZ A;  2J9O A;  2WAE A;  4QU3 A;  3BEC A;  1XA1 A;  2WKE A;  3BRM A;  3GMW A;  4LCL A;  3ZDJ A;  5DTS A;  1ES2 A;  1HZO A;  1GA0 A;  3PTE A;  4KZ5 A;  1WYB A;  5I94 A;  2XF3 A;  4JXW A;  1LI9 A;  4O7D A;  1ES4 A;  1YLZ A;  4M3K A;  1NRF A;  4WMC D;  4X69 A;  3M2J A;  4F94 A;  2BLS A;  3VFH A;  1IYP A;  4Y0U A;  3VSK A;  2ZD8 A;  2Y2K A;  3SS4 A;  3OPR A;  5TR7 A;  4WEJ A;  3IF6 B;  4HEF A;  4BLM A;  4KG5 A;  4GZB A;  1QME A;  3NBL A;  3NI9 A;  3N8R A;  2V2F F;  1LI0 A;  3MBZ A;  4Z9Q A;  1KGG A;  3BFG A;  2H0Y A;  3IWQ A;  2J7V A;  2EXB A;  3MZE A;  5FAT A;  1PWG A;  3VFF A;  3UO9 A;  3W4Q A;  4JXG A;  2C6W B;  1ERO A;  2FFY A;  1SCW A;  2B5R A;  1MWS A;  5KSC A;  1KDW A;  2RL3 A;  5EPH A;  5TFQ A;  3CJM A;  3FWL A;  3MKE A;  5D3O A;  5FA7 A;  2XK1 A;  3JYI A;  3LCE A;  4D2O A;  3QNB A;  1E25 A;  3CZD A;  2JBF A;  1XXM A;  2ZQA A;  4XUX A;  4OOM A;  3BEB A;  3Q7Z A;  1BSG A;  3IWI A;  4KZB A;  5A92 A;  4KZ7 A;  2HDR A;  1LL5 A;  4PM7 A;  1Y54 A;  2Q9N A;  3C4O A;  4CPK A;  5A91 A;  1MWU A;  4E3I A;  1G6A A;  4RX3 A;  3SOI A;  1H8Y A;  1Q2Q A;  2QZ6 A;  1CI9 A;  3M6B A;  3GTC A;  4C3Q A;  4UA6 A;  3VP2 A;  1PYY A;  1EWZ A;  2JC7 A;  5DF7 A;  5F1G A;  3LY3 A;  1PW8 A;  4OOY A;  1PW1 A;  3A3E A;  5CEB A;  1TDG A;  3WWX A;  3NDE A;  1GHP A;  3IH9 A;  3Q7V A;  4ZJ3 A;  3MXR A;  4QY5 A;  5EEC A;  1GHM A;  5AQB A;  4C75 A;  3PBO A;  3IQA A;  1YMS A;  2Y2H A;  3HLC A;  3I7J A;  4B4X A;  1HVB A;  2ZC4 B;  4OPZ A;  5E2G A;  5GHY A;  1K55 C;  2ZC3 B;  3GSG A;  3G4P A;  3IF5 A;  2A49 A;  3G34 A;  1XX2 A;  5EVI C;  1IKI A;  4N9K A;  2IWD A;  1H5X A;  4HBT A;  2P9V B;  2R9X A;  1KDS A;  3NDG A;  5CEC A;  4E3O A;  3IXH A;  3WS2 A;  2CC1 A;  4KQO A;  1NJ4 A;  3N8S A;  5CXW A;  3UPP A;  1MWR A;  4N9L A;  4R4S A;  2OLU A;  5A90 A;  4QY6 A;  5M18 A;  2H0T A;  2ZQ8 A;  1XPB A;  4KZ3 A;  1W5D A;  3A3D A;  2C5W B;  1DY6 A;  1I2S A;  5HAP A;  1ZG6 A;  3VP0 A;  4P6B A;  1KVM A;  2WAD A;  4YIN A;  2ZC5 B;  1MWT A;  3P98 A;  3M6H A;  5JYP A;  2FFF B;  3N8L A;  4R1G A;  4U3T A;  4FCF A;  4JF4 A;  4DDS A;  4JPM A;  2P74 A;  4ZJ2 A;  3SH9 A;  3OPP A;  1W7F A;  3NC8 A;  1FOF A;  5E2F A;  4UA9 A;  5FSR A;  1FCN A;  1IEM A;  1O07 A;  4LEN A;  1XA7 A;  3GVB A;  3IHB A;  1NYM A;  3HUO A;  1QMF A;  1AXB A;  3PBS A;  4LV0 A;  4X55 A;  2XLN A;  3UY6 A;  1XGI A;  1DJA A;  1I5Q A;  4QB8 A;  3TOI A;  1FSW A;  1YMX A;  4OOL A;  3G2Z A;  2X02 A;  3E2K A;  4S2L A;  4H8R A;  1KE4 A;  4EBL A;  1YLW A;  2OV5 A;  2Y2I A;  1N9B A;  3HBR A;  4X6T A;  1E3U A;  2JE5 A;  1YQS A;  4KZ4 A;  3SH7 A;  1EI5 A;  5HX9 A;  2WYX A;  2J9P A;  3B3X A;  3ZNT A;  2HDQ A;  3C5A A;  1YM1 A;  2JCH A;  3ISG A;  4N92 A;  2ZQ7 A;  4OQ0 A;  2R9W A;  3ITA A;  3ITB A;  3LO7 A;  3W4P A;  1CEF A;  2VGJ A;  4YFM A;  5E43 A;  3PAG A;  4ZJ1 A;  3E2L A;  4JLF A;  4X53 A;  4XXR A;  3MKF A;  4PPR A;  3UE1 A;  5HL1 A;  1PI4 A;  5CTN A;  5DVA A;  1K54 A;  3GQZ A;  4FD8 A;  4CJN A;  1ES5 A;  3HLF A;  4WZ5 A;  1LHY A;  3EQU A;  4ID4 A;  3QNC A;  5EVI B;  4OPR A;  1YLJ A;  4EUZ A;  3HLD A;  2Y59 A;  1GHI A;  2XEP A;  1I2W A;  5G18 A;  5KZH A;  1FCO A;  4GDB A;  2XGN A;  4RYE A;  1E3U D;  4FH2 A;  4MLL A;  4DRT A;  1NY0 A;  1PIO A;  4E3K A;  3FYZ A;  3ZCZ A;  4WEK A;  4DXB A;  1S6R A;  3HLW A;  1BZA A;  2ZC7 A;  4C6Y A;  4OVD A;  3G32 A;  1RP5 A;  4RVA A;  1PWD A;  5GLB A;  3UE0 A;  2XQZ A;  1MY8 A;  1IYQ A;  3EQV A;  2ZM2 A;  1MXO A;  1ALQ A;  1BLP A;  1RCJ A;  3WRT A;  1S0W A;  2X01 A;  5FI7 A;  2Y2J A;  3LY4 A;  2PU2 A;  1LLB A;  4E3L A;  2ZC6 B;  2Z2L B;  2XFT A;  3V5M A;  4LCM A;  3IXB A;  3S4X A;  1MPL A;  4R3B A;  2XFS A;  3HLB A;  1IEL A;  1NYY A;  5FQI A;  2DRW A;  3ZG8 B; 
#chains in the Genus database with same CATH topology
 2ACG A;  2P9V A;  1NZO A;  3Q07 A;  2V0W A;  2V20 A;  4ARZ B;  5GL9 A;  2LB5 A;  4AFI A;  3V50 A;  2BAS A;  1W8Q A;  2V1Z A;  4OH0 A;  4O8G A;  5GHX A;  5CGW A;  5FI2 A;  4KZ8 A;  4GLQ A;  5FDS A;  3MR0 A;  1OTA A;  4ZTK A;  5J8X A;  3F1P A;  3GR2 A;  2LB9 A;  3T4T A;  2JKR I;  4XT2 B;  5JYO A;  4JF6 A;  4OP8 A;  3W8K A;  3T1Q B;  4OLG A;  3PYP A;  1HD8 A;  4JF5 A;  2Z2M B;  2KLI A;  1BLH A;  3QP1 A;  2R78 A;  3PBN A;  1PNE A;  4GDN A;  2M7U A;  3D4F A;  3WRZ A;  1N4O A;  3A0R A;  5FL3 A;  1LL9 A;  2NUP C;  2QPN A;  5F83 A;  4N1X A;  4BJP A;  4DF6 A;  2FZ0 A;  4ESP A;  1S1Z A;  1XJ4 A;  4Y7P A;  4BD1 A;  4WEL A;  1CI8 A;  1K4F A;  1Q2P A;  4Y0O A;  3SH8 A;  3VE3 A;  2G2W A;  5I5L A;  3Q82 A;  4LV3 A;  5EVL A;  3OCN A;  1BUE A;  3LR5 A;  4S2M A;  1G6O A;  5EE8 A;  3RXX A;  5L09 A;  2XR0 A;  2O9C A;  1BTL A;  2ZQC A;  4IED A;  1TS8 A;  3E0Y A;  3E98 A;  1KE0 A;  1VHM A;  4LRY C;  1PI5 A;  2RCX A;  5DTT A;  5F82 A;  3CIT A;  1K57 A;  3HRE A;  2XH9 A;  4PMA A;  3BWL A;  1K25 A;  4R3J A;  1OME A;  2WZZ A;  4DE2 A;  1F2K A;  2HF6 A;  3NHQ A;  4MBF A;  5CHU A;  1T1B A;  3LI9 A;  3S7N A;  3BLM A;  3V3S A;  3ZFZ A;  3ZVT A;  1H3Q A;  3SZT A;  3VMA A;  2WUQ A;  4QD4 A;  1S67 L;  3O5Y A;  1ACF A;  4BL2 A;  4K0W A;  3ZHH A;  3DTM A;  3VP1 A;  4HJ3 A;  3BLS A;  1XFQ A;  3UMD A;  3WS4 A;  2HZ5 A;  4Q0H A;  5EUA A;  3C4P A;  2XSS A;  2O9B A;  4PM8 A;  3UPO A;  3PBQ A;  3VOY A;  3NIA A;  3BFF A;  1L2S A;  2P08 A;  1FIL A;  4WL9 A;  2IA2 A;  1LT0 A;  4FH4 A;  3MF0 A;  3VOZ A;  1K4E A;  4LV2 A;  4BBU A;  2MJ6 A;  1YAX A;  2D02 A;  3JVV A;  1P9R A;  3QHY A;  5GLC A;  4L9F A;  3H9W A;  2FH5 A;  1MBL A;  3T50 A;  4EQI A;  4JKT A;  4MEZ A;  4WBG A;  3R7W B;  5HWV A;  4K08 A;  1KVL A;  1ZC2 A;  2OOL A;  3OBF A;  4PHT A;  1IKG A;  3K3C A;  3T1S A;  2ZLY A;  2ZJ9 A;  4UEY A;  2VK3 A;  4QU3 A;  1VET B;  2V8C A;  3ZDJ A;  3EEA A;  2QJ7 A;  4JXW A;  4WMC D;  4F94 A;  2GZA A;  3VSK A;  2ZD8 A;  4WEJ A;  2VGL S;  3EWK A;  4X1M A;  3MBZ A;  3IWQ A;  3MZE A;  4MN7 A;  5FAT A;  4MN5 A;  5TJJ A;  3V67 A;  4RQ9 A;  4F3L A;  3T12 B;  3W4Q A;  4G3K A;  1MWS A;  3UE6 A;  5TFQ A;  4DN0 A;  2A24 A;  5FA7 A;  3JYI A;  3LCE A;  1E25 A;  2ZQA A;  3K2N A;  5EV0 A;  3BEB A;  4KZ7 A;  3LEQ A;  1LL5 A;  1Y54 A;  2Q9N A;  2INW A;  4C3Q A;  2W3G A;  3F1N B;  3B42 A;  1PW1 A;  1VEU B;  2V0U A;  4GJ4 A;  3NDE A;  5HSQ A;  3CWF A;  4QY5 A;  5EEC A;  1YMS A;  3I7J A;  4B4X A;  4MDZ A;  5E2G A;  4CLC E;  4DMZ A;  2K2N A;  3GSG A;  3G34 A;  4N9K A;  2IWD A;  4HP4 A;  1P0Z A;  5AVE A;  5CEC A;  5IS1 A;  5L8M A;  4E3O A;  3CHW P;  1NJ4 A;  1DRM A;  3N8S A;  4R4S A;  4I38 A;  2ZQ8 A;  1XPB A;  4KZ3 A;  3A3D A;  2C5W B;  4HY8 A;  1DY6 A;  3TW8 A;  5G4Y A;  2KDK A;  4I3I A;  2VGL M;  1ZG6 A;  3VOL A;  1MWT A;  4G3W A;  4R1G A;  4DDS A;  1FOF A;  3LIB A;  2JHE A;  5FSR A;  1IEM A;  4CLC D;  3PBS A;  5EFW A;  4QB8 A;  1DJA A;  1I5Q A;  3IX3 A;  3TOI A;  1YMX A;  4OOL A;  3MJQ A;  4H8R A;  4HHD A;  1YSP A;  1YLW A;  4X6T A;  2JE5 A;  1W63 Q;  3KSF A;  3B3X A;  4EXO A;  3EGX C;  2JCH A;  2ZQ7 A;  4IUH A;  3CLO A;  5E43 A;  3E2L A;  3S7Q A;  4XXR A;  4PPR A;  5HD5 A;  4FD8 A;  4BBV A;  1ES5 A;  1LHY A;  1BYW A;  3EQU A;  2L1M A;  4OPR A;  2Y59 A;  3PHY A;  3G6O A;  3LGO A;  2XGN A;  4DRT A;  3FYZ A;  3PR6 A;  3ZCZ A;  5EM0 A;  3HLW A;  1BZA A;  4C6Y A;  3G32 A;  1RP5 A;  3UE0 A;  1MY8 A;  1IYQ A;  3EQV A;  1GSX A;  5HPI A;  3LY4 A;  4E3L A;  4II7 A;  1OT6 A;  2PR5 A;  1NYY A;  1WA9 A;  4MCW A;  4BEN A;  4P0M A;  5A8B A;  1S4S A;  1D1J A;  5CHJ A;  3KYE A;  2XDM A;  4F3L B;  3UDI A;  1PWC A;  3C7U A;  2VV6 A;  4N1H A;  5CER A;  2A24 B;  3FKV A;  1PZP A;  3S7O A;  1YKD A;  2Y2M A;  2JKF A;  2WK0 A;  5GLD A;  2O9A A;  5HL6 A;  2KOI A;  1XGJ A;  1ZG4 A;  4IBR A;  2V8F A;  1HTZ A;  3HL9 A;  4X1L A;  2WGW A;  2Y2N A;  5EM1 A;  3IX8 A;  5FAS A;  4KZ6 A;  2Y2O A;  2M1C A;  2ZM0 A;  3OZH A;  4G3V A;  4B88 A;  2HJ9 C;  3UDX A;  4OON A;  4GD8 A;  2ZOI A;  1M40 A;  4R6L A;  4KUK A;  1OTI A;  3MQ0 A;  1T18 A;  3SS5 A;  1S1Y A;  4OPY A;  1NXY A;  1BLC A;  5FEF A;  4GHI A;  1GA9 A;  3S22 A;  3T4Q A;  4EBP A;  3AGF A;  3T4O A;  1XJ2 A;  3IF6 A;  1KOU A;  2PHY A;  2Y2Q A;  4QPR A;  3A3F A;  3NOU C;  4NK3 A;  3FV7 A;  5KMW A;  1ESI A;  3AGE A;  2HDU A;  4HBU A;  3ZG0 A;  4K0X A;  2VX8 A;  5KIZ A;  4B4Z A;  2BTF P;  3TSG A;  4EV4 A;  3AGD A;  3U4L P;  3T4L A;  5CRF A;  1RGY A;  1L0F A;  1BUL A;  3UE3 A;  3QP6 A;  5EVI D;  1OJ5 A;  5DF8 A;  5C5K A;  4BD0 A;  3DTI A;  2W3E A;  4LFU A;  1OTB A;  3DWZ A;  4P6Z S;  4S2N C;  5HDC A;  1ESU A;  3ZNY A;  3WS0 A;  2EWW A;  1DJC A;  1MZU A;  1T19 A;  2W1T B;  3H7W B;  1OT9 A;  3H82 A;  2Y2P A;  2HP9 A;  5L2F A;  4NXB A;  2WZX A;  5HZH A;  1TEM A;  2ZQ9 A;  2W3H A;  2ZL1 B;  2E8I A;  1EW0 A;  1ONG A;  5CTM A;  5J7E A;  3MMH A;  4A5R A;  3BM6 A;  5FDH A;  3U2A A;  3LR0 A;  2JKT M;  3IX4 A;  3N7W A;  4R0Q A;  4GD6 A;  2HP6 A;  4BQM A;  5CED A;  2AVX A;  1ERQ A;  1W8Y A;  4KQQ A;  1HLU P;  3HUN A;  1PZO A;  1LL8 A;  2QHK A;  1U60 A;  3FZC A;  3OC2 A;  2IWC A;  2PBY A;  4ZDX A;  5LBR A;  1V9Z A;  1NRJ A;  4KZ9 A;  4X25 A;  2G2U A;  4JGP A;  3G30 A;  2OWH A;  3IT9 A;  4LRZ E;  5L10 A;  2VKS A;  1NWZ A;  1FR6 A;  3R4K A;  1K54 C;  1T1A A;  1SKO B;  3ZG5 A;  1O7E A;  4DXC A;  4WZ5 C;  1PRQ A;  2WKI A;  4NKP A;  2Q0O A;  4KG6 A;  4OQI A;  2XRN A;  4P6Z M;  2OSU A;  4NXF A;  4E3N A;  2WGW B;  2WAF A;  3IH8 A;  4HIA A;  4WMC A;  2P04 A;  3BFE A;  1XJ3 A;  4OPQ A;  1DJB A;  5CHM A;  3SW1 A;  4GOG A;  5EOE A;  5IHV A;  3MFX A;  5AQ7 A;  5TBM A;  1FIK A;  4DKI A;  1RGZ A;  4WUJ A;  3CI6 A;  1XA1 A;  3GMW A;  4LCL A;  5DTS A;  3PTE A;  1GA0 A;  4KZ5 A;  5I94 A;  1YLZ A;  1P97 A;  4M3K A;  4H6J A;  1IYP A;  3KX0 X;  3SS4 A;  3OPR A;  5TR7 A;  3VV4 A;  3IF6 B;  4HEF A;  1QME A;  3NBL A;  2J80 A;  2HGV A;  4Z9Q A;  1KGG A;  2G7U A;  1W63 M;  3C38 A;  1ERO A;  2FFY A;  1SCW A;  3FWL A;  3MKE A;  3QNB A;  1XXM A;  2O99 A;  3Q7Z A;  1BSG A;  3IWI A;  4KZB A;  4Y13 A;  4PM7 A;  1GSV A;  1MWU A;  3CUE C;  4RX3 A;  2Z6C A;  2VLG A;  4HI4 A;  1EWZ A;  2UV0 E;  3A3E A;  3OOV A;  1GHP A;  3IH9 A;  3LIF A;  4ZJ3 A;  1OTE A;  4MN6 A;  1GHM A;  2GNX A;  4C75 A;  3PBO A;  3F1O A;  3IQA A;  2Y2H A;  3HLC A;  1HVB A;  5GHY A;  2PT7 A;  1K55 C;  2ZC3 B;  3G4P A;  3IS2 B;  2A49 A;  5EVI C;  1H5X A;  2P9V B;  3QP2 A;  1KDS A;  3NDG A;  5CX7 A;  3WS2 A;  2O0Y A;  4HH3 A;  4B93 A;  3UPP A;  4N9L A;  5F5Y A;  4GS9 A;  4CLC A;  3L9K A;  3ULF A;  5G4Z A;  1I2S A;  1UGU A;  5J4E A;  2XRO A;  4Y5F A;  2WAD A;  4BWI A;  2ZC5 B;  3P98 A;  2FFF B;  3N8L A;  4JF4 A;  4FUW A;  4JPM A;  4ZJ2 A;  3QP8 A;  3F1P B;  3CPT A;  2Y79 A;  4UA9 A;  1FCN A;  1T1C A;  1XA7 A;  3IHB A;  1NYM A;  1OJG A;  1AXB A;  3DBA A;  4NXG A;  3TRC A;  3G2Z A;  5HDS A;  3E2K A;  3MSH A;  5K5B A;  3RTY A;  5MC7 A;  3KSG A;  1YM1 A;  2M7V A;  3T4S A;  4OQ0 A;  2R9W A;  1DP8 A;  4YFM A;  3PAG A;  3MKF A;  5HL1 A;  4EUV A;  1K54 A;  2HJE A;  4CJN A;  4WZ5 A;  1F5M A;  5IT5 A;  4ID4 A;  3QNC A;  3HLD A;  2XEP A;  4GDB A;  4E3K A;  1NY0 A;  3LUQ A;  5TBM B;  2ZC7 A;  4OVD A;  4RVA A;  2XQZ A;  4YOF A;  3FC7 A;  3WRT A;  1S0W A;  2X01 A;  3FPV A;  1N9N A;  3V5M A;  4LCM A;  4EW7 A;  3IXB A;  3S4X A;  2XFS A;  3HLB A;  3NJA A;  2ZMF A;  2QWS A;  1VB6 A;  5AJG A;  2PD7 A;  3DTK A;  3NOT C;  1NZU A;  4EU0 A;  4E6X A;  3LYX A;  4JXS A;  3Q1F A;  5AQ9 A;  4E3M A;  2IWB A;  2ZMA A;  5HAQ A;  3OCL A;  1L0G A;  1YPR A;  3IXD A;  3P7N A;  3UB6 A;  4ZRR A;  3IWO A;  5DJU A;  1LSX A;  1CF0 A;  4Y15 A;  1A0K A;  2ZQD A;  3G2Y A;  4WM9 A;  4I39 A;  2NUT C;  3BQA A;  1K38 A;  2W1R A;  4S2O A;  2VJW A;  1D06 A;  1K56 D;  5CGX A;  2CMN A;  4S2J A;  3CUE A;  3UB9 A;  2OLV A;  5BOH A;  5DFX A;  2W3F A;  1SDE A;  4R70 A;  3BFD A;  3EGD C;  2QJ5 A;  5L07 A;  3MZF A;  1MKI A;  5FAP A;  4CLC B;  2JKR M;  2PDR A;  1FSY A;  5EOO A;  1J9M A;  3UPN A;  1WE4 A;  5EVI A;  4E6W A;  2Q9M A;  5TGF A;  4S2P A;  3GDI A;  1C3B A;  5HWT A;  4Q8I A;  3RFB A;  4PM6 A;  4R23 A;  3ZVW A;  3O3V A;  1P9W A;  4FTX A;  3B47 A;  3W2Z A;  3BQ8 A;  2EX6 A;  4DDY A;  5FEG A;  5HW3 A;  2H10 A;  3MXS A;  5U47 A;  4HNB A;  2A3U A;  3T4J A;  4NET A;  3TJZ C;  1JTG A;  3N6I A;  2E8J A;  3MFD A;  3GRJ A;  2ZM8 A;  4WYY A;  4X68 A;  4ETX A;  3HCY A;  3V3R A;  2Y4A A;  4HOI A;  3EEH A;  3QP5 A;  1YLP A;  3D9Y A;  1BLS A;  3RH8 B;  3UN7 A;  4OLD A;  4EBN A;  1WYC A;  3ZG9 B;  4L9E A;  3C2W A;  2QMI A;  3GV9 A;  5A93 A;  3K3D A;  5FAQ A;  3DTE A;  3VP4 A;  4XT2 A;  5HWW A;  1YLY A;  3OPH A;  3WS1 A;  1ERM A;  3FPW A;  1MC0 A;  4Q0I A;  1JWZ A;  2PRF A;  2JKG A;  4IVK A;  4PM5 A;  1SKF A;  3NCK A;  2WGI A;  1YT4 A;  4R4R A;  4MBH A;  2PAV P;  3LIC A;  4EER A;  1VQQ A;  3N4I A;  1JWP A;  5FQK A;  4BBT A;  2WKR A;  1IOU A;  1TS7 A;  4U0T A;  1CJF A;  2HP5 A;  3V39 A;  5FAO A;  1GSW A;  4HP9 A;  3OLO A;  4ETZ A;  4JXV A;  4DE1 A;  2V1B A;  5CGS A;  3IXG A;  1N9L A;  3FG8 A;  5M1A A;  5GHZ A;  1S4R A;  3BFC A;  1G28 A;  3IHA A;  3FKW A;  4WLA A;  2I9V A;  3RJU A;  5FI6 A;  3S7P A;  1YLT A;  1JNU A;  1M6K A;  1PFL A;  1JTD A;  2YKF A;  4Y2F A;  4NXE A;  4QJG A;  1SHV A;  4MNR A;  4E3J A;  2VZW A;  3IBJ A;  4DE0 A;  1XKZ A;  4GCZ A;  2WGV A;  1K57 C;  1SZV A;  5DTK A;  4X56 A;  3VP3 A;  2PU4 A;  1OPX A;  3CMZ A;  1FR1 A;  4DJ3 A;  3KYZ A;  2J9O A;  3BEC A;  2WKE A;  1ZHH B;  2OAP 1;  2XF3 A;  1ES4 A;  4UQI S;  1LSW A;  4X69 A;  3M2J A;  4Y3I A;  2BLS A;  2Y2K A;  3C8C A;  5HPF A;  4KG5 A;  4ME4 A;  3N8R A;  1LI0 A;  3BFG A;  2H0Y A;  2B18 A;  1TS0 A;  3NUL A;  2EXB A;  2EWV A;  3VFF A;  3UO9 A;  2C6W B;  5EPH A;  1N9O A;  2XK1 A;  4EET B;  3CZD A;  2JBF A;  4DJ2 A;  4LGW A;  4OOM A;  3LFV A;  5A92 A;  5A91 A;  1H8Y A;  2QZ6 A;  1CI9 A;  3M6B A;  1K0K A;  2B02 A;  2ZMV A;  3VP2 A;  2JC7 A;  5F1G A;  3LY3 A;  5AVF A;  1TDG A;  3Q7V A;  1NLY A;  4JGQ A;  5AQB A;  2ZC4 B;  3VE4 A;  1IKI A;  4HBT A;  2J3W A;  2PBD P;  5CXW A;  1MWR A;  5M18 A;  2H0T A;  4UQI M;  1W5D A;  2J3T D;  1XFN A;  3VP0 A;  4IUK A;  3R7W A;  1D7E A;  3PXP A;  4YIN A;  3M6H A;  3BW6 A;  1DP6 A;  1ODV A;  5DKL A;  2P74 A;  3MQQ A;  1W7F A;  5F6A A;  3NC8 A;  1VET A;  4QWO A;  4LEN A;  3GVB A;  3HUO A;  3KSI A;  5DKK A;  3UY6 A;  3ZQ5 A;  4GW9 A;  4EBL A;  1KE4 A;  5DJT A;  2Y2I A;  3HBR A;  3SH7 A;  4KZ4 A;  1G5U A;  1EI5 A;  2W3D A;  5HX9 A;  3ZNT A;  2HDQ A;  2WKP A;  3C5A A;  4GHI B;  3ITA A;  3ITB A;  4ZJ1 A;  4JLF A;  1PI4 A;  5CTN A;  5DVA A;  2WKQ A;  4EUZ A;  1YLJ A;  5IU1 A;  1I2W A;  1FCO A;  3HJK A;  4RYE A;  1CQA A;  1E3U D;  4FH2 A;  4MLL A;  4YWZ A;  3BJN A;  4WEK A;  4DXB A;  2L4R A;  3F1N A;  5GLB A;  1PWD A;  3C30 A;  4LLO B;  2W27 A;  1YSQ A;  1BLP A;  1VEU A;  1RCJ A;  5HD3 A;  5FI7 A;  1UWN X;  4KUO A;  2D01 A;  4MMN A;  1H8M A;  2H28 A;  1MPL A;  5FQI A;  1NLZ A;  3UB8 A;  3ZG8 B;  1TD5 A;  3UB7 A;  5F1F A;  3S1Y A;  2Z6D A;  1Z6F A;  3VSL A;  4QHC A;  5FQJ A;  3ZYT A;  2HPB A;  3HVF A;  5GLA A;  2PYR A;  3Q81 A;  1J3W A;  3H82 B;  2EFU A;  2GJ3 A;  4ZAM A;  1K56 A;  1BT5 A;  1L0E A;  4OQG A;  5E2H A;  4LV1 A;  4S2K A;  4B9O A;  5E2E A;  2EXA A;  1KGF A;  2PR6 A;  4S2N A;  3O86 A;  4KZA A;  3M2K A;  4FOF A;  4OP5 A;  1KE3 A;  1TVF A;  3IBR A;  3BY9 A;  3HLE A;  5FQQ A;  4KG2 A;  5DF9 A;  5FQ9 A;  3Q7V B;  4HJ4 A;  1UWP X;  1H8Z A;  3RXW A;  4JBF A;  1E4D A;  1W79 A;  4U0X A;  2Y91 A;  2XA7 S;  3G35 A;  2P7J A;  1F9I A;  2QKP A;  2EX8 A;  1TDL A;  2ZBB A;  3PBT A;  4PKY A;  2ZOH A;  4KEN B;  2YKH A;  1AWI A;  3CG5 A;  2J8Y A;  1FCM A;  3C7V A;  3E4P A;  3HUM A;  2EX2 A;  4XUZ A;  3DWK A;  1F98 A;  3D3O A;  4HES A;  4UAA A;  4IJG A;  4S2I A;  4WZ4 A;  2Y55 A;  3PBR A;  3MZD A;  2Y2L A;  3W4O A;  2QYB A;  5M19 A;  3LR3 A;  2J3T C;  2OWJ A;  1MKM A;  3O87 A;  1XP4 A;  1JWV A;  1K6S A;  2VV7 A;  3T1R A;  1DP9 A;  4RA7 A;  1GCE A;  5HAR A;  4E04 A;  3QP4 A;  2V1A A;  4Y0T A;  1KGE A;  4JGO A;  2JKT I;  4K91 A;  4OQH A;  3A3I A;  4UA7 A;  4YNR A;  1CEG A;  1TF1 A;  3A3J A;  4H6J B;  3GEC A;  3EOI A;  3JPU A;  3OPL A;  3NEC A;  3TG9 A;  3B33 A;  4CQH A;  2H5S A;  3HJI A;  2UWX A;  1XJ6 A;  2PD8 A;  3SS3 A;  2XD1 A;  1V9Y A;  4IBX A;  4RX2 A;  2XA7 M;  4O01 A;  1IFQ A;  2VGK A;  4P85 A;  4GNU A;  3L7H A;  4P87 A;  4FSF A;  3NY4 A;  5HFO A;  1ONH A;  4NG2 A;  3DW0 A;  2DMW A;  4GKU A;  4UHU A;  4WN5 A;  3ZG7 B;  3HLG A;  5HAI A;  3UDF A;  1L0D A;  4PM9 A;  4OKP A;  3IF6 C;  3O88 A;  2PYP A;  4JGR A;  2EX9 A;  1G68 A;  3P09 A;  4R3A A;  4Q0J A;  3LEZ A;  4EWF A;  2DNS A;  4L0L A;  3E4Q A;  1SDN A;  4MBK A;  2GDN A;  4ZBE A;  3WS5 A;  1FQG A;  1JVJ A;  3F1O B;  2HDS A;  4DE3 A;  3UNW A;  2DCF A;  3BYD A;  2BG1 A;  4KQR A;  5FQM A;  4GN2 A;  3G31 A;  1IYS A;  4GB7 A;  1ZKJ A;  2W0N A;  3TE8 A;  2WKH A;  5KSH A;  5DFY A;  1VM1 A;  4GS9 B;  2I72 A;  4WF0 A;  1K55 A;  2Y8H A;  4IVI A;  2XD5 A;  2EFX A;  2X71 A;  4BMW A;  3LID A;  4HQA A;  3ZGA B;  2Y2G A;  1ES3 A;  2GX5 A;  5AQA A;  1K6R A;  3PAE A;  4BL3 A;  1IYO A;  4I3J A;  2JN7 A;  3CPT B;  1CK3 A;  2WAE A;  3BRM A;  3ICY A;  2KX6 A;  1ES2 A;  1HZO A;  1WYB A;  3CAX A;  1LI9 A;  4NEE D;  4O7D A;  1NRF A;  2W1T A;  3VFH A;  3DAV A;  3H7W A;  4Y0U A;  3JVU A;  4BLM A;  4GZB A;  3NI9 A;  2V2F F;  2ZL1 A;  4ARZ A;  2J7V A;  3T4K A;  1PWG A;  4EEU A;  2HV1 A;  3D72 A;  4JXG A;  2K7S A;  2B5R A;  5KSC A;  1KDW A;  2RL3 A;  3CJM A;  4KQD A;  5D3O A;  2K31 A;  4D2O A;  4PKY G;  4XUX A;  4LPZ A;  2HDR A;  3C4O A;  4CPK A;  4E3I A;  1G6A A;  1L3L A;  3SOI A;  1Q2Q A;  3LI8 A;  1Y4O A;  3GTC A;  4UA6 A;  2EA9 A;  3E4O A;  1PYY A;  4L9G A;  5DF7 A;  1PW8 A;  4OOY A;  5CEB A;  3A0V A;  3T1X A;  3WWX A;  1TS6 A;  4PAU A;  2V9A A;  3MXR A;  4OPZ A;  5F69 A;  1SKO A;  3UME A;  3IF5 A;  3MS6 A;  3NOP C;  1XX2 A;  4I3A A;  2R9X A;  2B95 A;  3LIE A;  3IXH A;  2CC1 A;  3KYQ A;  5HDD A;  2VEA A;  4IHQ A;  4KQO A;  2OLU A;  3KSH A;  5J3W A;  5A90 A;  4QY6 A;  2VA0 A;  3A0S A;  4I5S A;  5HAP A;  4HH2 A;  4P6B A;  1KVM A;  5JYP A;  4U3T A;  4EQ1 A;  4FCF A;  1S66 L;  3SH9 A;  3OPP A;  5E2F A;  2L0W A;  1O07 A;  3LR4 A;  1QMF A;  4D60 A;  5EVE A;  2VV8 A;  4LV0 A;  4LRX C;  4X55 A;  2XLN A;  1XGI A;  3KO6 A;  2OAQ 1;  1Y28 A;  1FSW A;  2X02 A;  4S2L A;  2OV5 A;  1N9B A;  1E3U A;  1YQS A;  1OTD A;  4EEP A;  4R38 A;  2WYX A;  2J9P A;  3ISG A;  4N92 A;  1Z09 A;  3LO7 A;  3W4P A;  1CEF A;  2VGJ A;  4O0P A;  4Y17 A;  4X53 A;  3UE1 A;  4M4X A;  1LSV A;  3GQZ A;  3HLF A;  3LIA A;  5EVI B;  1GHI A;  5G18 A;  5KZH A;  1PIO A;  4Z1W A;  4EES A;  1STZ A;  1H0M A;  1S6R A;  3UB5 P;  2ZM2 A;  1MXO A;  1ALQ A;  3MQO A;  5F68 A;  2Y2J A;  2PU2 A;  1LLB A;  2ZC6 B;  2Z2L B;  3MXQ A;  4CLC C;  2XFT A;  4HJ6 A;  1X0O A;  2A2L A;  1ZTU A;  3IS2 A;  4R3B A;  3BY8 A;  1IEL A;  3P01 A;  2DRW A; 
#chains in the Genus database with same CATH homology
 4P0M A;  2P9V A;  1NZO A;  5F1F A;  3S1Y A;  5CHJ A;  3Q07 A;  2V20 A;  1Z6F A;  3VSL A;  1NZU A;  4QHC A;  5FQJ A;  2XDM A;  4E6X A;  5GL9 A;  4JXS A;  2HPB A;  3HVF A;  5GLA A;  3V50 A;  1W8Q A;  3Q1F A;  2V1Z A;  5AQ9 A;  3Q81 A;  3UDI A;  4E3M A;  4OH0 A;  2IWB A;  1PWC A;  2EFU A;  3C7U A;  2ZMA A;  4N1H A;  5CER A;  5HAQ A;  3OCL A;  4ZAM A;  5GHX A;  3FKV A;  1PZP A;  1L0G A;  1K56 A;  1BT5 A;  1L0E A;  4OQG A;  5CGW A;  4LV1 A;  4S2K A;  5E2H A;  3IXD A;  4KZ8 A;  5FI2 A;  2Y2M A;  5E2E A;  2WK0 A;  2EXA A;  5GLD A;  1KGF A;  4S2N A;  3O86 A;  1XGJ A;  1ZG4 A;  3IWO A;  4IBR A;  4KZA A;  3M2K A;  4ZTK A;  4OP5 A;  1HTZ A;  3HL9 A;  5J8X A;  1KE3 A;  1TVF A;  2WGW A;  2Y2N A;  3GR2 A;  3HLE A;  5FAS A;  5FQQ A;  2ZQD A;  4KZ6 A;  2Y2O A;  4KG2 A;  5DF9 A;  3G2Y A;  5JYO A;  2ZM0 A;  4WM9 A;  3OZH A;  1K38 A;  4S2O A;  4JF6 A;  4OP8 A;  5FQ9 A;  3W8K A;  3Q7V B;  4OLG A;  1K56 D;  5CGX A;  1H8Z A;  1HD8 A;  4JF5 A;  3RXW A;  3UDX A;  4B88 A;  2Z2M B;  4S2J A;  4JBF A;  4OON A;  4GD8 A;  1E4D A;  2OLV A;  1BLH A;  5BOH A;  3PBN A;  1W79 A;  1M40 A;  4U0X A;  4GDN A;  2Y91 A;  1SDE A;  3SS5 A;  3D4F A;  4OPY A;  3G35 A;  1NXY A;  1BLC A;  3BFD A;  4BEN A;  3WRZ A;  3S22 A;  1GA9 A;  1N4O A;  4EBP A;  2EX8 A;  3AGF A;  3MZF A;  1TDL A;  1LL9 A;  1MKI A;  3PBT A;  3IF6 A;  5FAP A;  2QPN A;  4KEN B;  1FSY A;  3CG5 A;  4N1X A;  5F83 A;  4BJP A;  4DF6 A;  5EOO A;  1J9M A;  2Y2Q A;  3UPN A;  2J8Y A;  1FCM A;  1WE4 A;  3C7V A;  5EVI A;  4E6W A;  3A3F A;  3HUM A;  4Y7P A;  4NK3 A;  4BD1 A;  2EX2 A;  2Q9M A;  3FV7 A;  4XUZ A;  1ESI A;  3AGE A;  4S2P A;  4WEL A;  3DWK A;  5TGF A;  5KMW A;  2HDU A;  4HBU A;  1C3B A;  3ZG0 A;  4K0X A;  1CI8 A;  1K4F A;  1Q2P A;  4HES A;  4Y0O A;  4UAA A;  3SH8 A;  4Q8I A;  4B4Z A;  2G2W A;  4S2I A;  3Q82 A;  4LV3 A;  2Y55 A;  4WZ4 A;  5EVL A;  4PM6 A;  3AGD A;  3TSG A;  4EV4 A;  3PBR A;  3MZD A;  2Y2L A;  4R23 A;  3OCN A;  3W4O A;  1BUE A;  5M19 A;  3ZVW A;  4S2M A;  3O3V A;  5CRF A;  5EE8 A;  3RXX A;  2XR0 A;  1RGY A;  1L0F A;  1BUL A;  3O87 A;  1XP4 A;  1JWV A;  1K6S A;  3UE3 A;  2EX6 A;  4DDY A;  1BTL A;  2ZQC A;  4IED A;  5EVI D;  4RA7 A;  5HW3 A;  1GCE A;  5DF8 A;  5HAR A;  1KE0 A;  4BD0 A;  2H10 A;  3MXS A;  5U47 A;  4Y0T A;  1KGE A;  4K91 A;  2A3U A;  1PI5 A;  3DWZ A;  2RCX A;  4OQH A;  4NET A;  5DTT A;  5F82 A;  4S2N C;  3A3I A;  1ESU A;  4UA7 A;  1JTG A;  3ZNY A;  1K57 A;  3HRE A;  3N6I A;  2XH9 A;  1CEG A;  3MFD A;  3WS0 A;  3GRJ A;  2ZM8 A;  4WYY A;  4X68 A;  1DJC A;  3V3R A;  2Y4A A;  3A3J A;  4PMA A;  1K25 A;  1YLP A;  4R3J A;  1OME A;  2Y2P A;  2WZZ A;  2HP9 A;  3OPL A;  4DE2 A;  3TG9 A;  5L2F A;  1BLS A;  2WZX A;  1TEM A;  2ZQ9 A;  4MBF A;  5CHU A;  2H5S A;  3UN7 A;  2E8I A;  2UWX A;  4OLD A;  4EBN A;  1WYC A;  1ONG A;  5CTM A;  3SS3 A;  3ZG9 B;  2XD1 A;  4IBX A;  4RX2 A;  4A5R A;  3BLM A;  3BM6 A;  3V3S A;  2QMI A;  3GV9 A;  5A93 A;  2VGK A;  5FDH A;  3ZFZ A;  4P85 A;  4GNU A;  3ZVT A;  5FAQ A;  4P87 A;  4FSF A;  3VP4 A;  3NY4 A;  5HFO A;  1ONH A;  3VMA A;  3N7W A;  2WUQ A;  3DW0 A;  4R0Q A;  1YLY A;  3OPH A;  4GKU A;  4GD6 A;  2HP6 A;  4QD4 A;  3WS1 A;  1ERM A;  4UHU A;  4BQM A;  5CED A;  3ZG7 B;  1JWZ A;  4IVK A;  3HLG A;  1ERQ A;  1W8Y A;  5HAI A;  4KQQ A;  3UDF A;  3HUN A;  1SKF A;  3NCK A;  1PZO A;  4PM5 A;  4BL2 A;  1L0D A;  4PM9 A;  2WGI A;  1YT4 A;  4OKP A;  4K0W A;  3IF6 C;  4R4R A;  3ZHH A;  3O88 A;  3DTM A;  1U60 A;  3VP1 A;  2EX9 A;  3FZC A;  3OC2 A;  2IWC A;  1G68 A;  2PBY A;  4ZDX A;  4MBH A;  3BLS A;  3P09 A;  1VQQ A;  4KZ9 A;  3LEZ A;  3N4I A;  1JWP A;  4EWF A;  2G2U A;  2DNS A;  3G30 A;  5FQK A;  3WS4 A;  4L0L A;  3IT9 A;  5EUA A;  1SDN A;  3C4P A;  4MBK A;  2GDN A;  4PM8 A;  4ZBE A;  1FR6 A;  3WS5 A;  1FQG A;  3PBQ A;  3VOY A;  4U0T A;  3UPO A;  1JVJ A;  2HP5 A;  3NIA A;  3V39 A;  3BFF A;  1L2S A;  5FAO A;  2HDS A;  1K54 C;  4DE3 A;  3UNW A;  2DCF A;  3ZG5 A;  1O7E A;  4DXC A;  3BYD A;  4WZ5 C;  4JXV A;  2BG1 A;  4DE1 A;  4KQR A;  3IXG A;  4FH4 A;  5CGS A;  5FQM A;  4GN2 A;  5M1A A;  2WKI A;  3VOZ A;  3G31 A;  5GHZ A;  1K4E A;  1IYS A;  4GB7 A;  1ZKJ A;  4LV2 A;  3BFC A;  4KG6 A;  3IHA A;  4OQI A;  3FKW A;  2WKH A;  2OSU A;  3QHY A;  3RJU A;  5GLC A;  5FI6 A;  5KSH A;  1YLT A;  1M6K A;  1VM1 A;  1JTD A;  4QJG A;  1SHV A;  2I72 A;  4MNR A;  2WGW B;  2WAF A;  4E3N A;  1K55 A;  3IH8 A;  1MBL A;  4IVI A;  4E3J A;  4EQI A;  4WMC A;  2XD5 A;  2EFX A;  4DE0 A;  1XKZ A;  2X71 A;  4JKT A;  2WGV A;  4MEZ A;  1K57 C;  3BFE A;  4WBG A;  3ZGA B;  5DTK A;  4OPQ A;  2Y2G A;  1DJB A;  1KVL A;  5CHM A;  4X56 A;  1ES3 A;  1ZC2 A;  3VP3 A;  4GOG A;  2PU4 A;  5EOE A;  1K6R A;  3PAE A;  5AQA A;  1IYO A;  5IHV A;  1IKG A;  3CMZ A;  1FR1 A;  5AQ7 A;  4BL3 A;  2ZLY A;  4DKI A;  2ZJ9 A;  1CK3 A;  1RGZ A;  2J9O A;  2WAE A;  4QU3 A;  3BEC A;  1XA1 A;  2WKE A;  3BRM A;  3GMW A;  4LCL A;  3ZDJ A;  5DTS A;  1ES2 A;  1HZO A;  1GA0 A;  3PTE A;  4KZ5 A;  1WYB A;  5I94 A;  2XF3 A;  4JXW A;  1LI9 A;  4O7D A;  1ES4 A;  1YLZ A;  4M3K A;  1NRF A;  4WMC D;  4X69 A;  3M2J A;  4F94 A;  2BLS A;  3VFH A;  1IYP A;  4Y0U A;  3VSK A;  2ZD8 A;  2Y2K A;  3SS4 A;  3OPR A;  5TR7 A;  4WEJ A;  3IF6 B;  4HEF A;  4BLM A;  4KG5 A;  4GZB A;  1QME A;  3NBL A;  3NI9 A;  3N8R A;  2V2F F;  1LI0 A;  3MBZ A;  4Z9Q A;  1KGG A;  3BFG A;  2H0Y A;  3IWQ A;  2J7V A;  2EXB A;  3MZE A;  5FAT A;  1PWG A;  3VFF A;  3UO9 A;  3W4Q A;  4JXG A;  2C6W B;  1ERO A;  2FFY A;  1SCW A;  2B5R A;  1MWS A;  5KSC A;  1KDW A;  2RL3 A;  5EPH A;  5TFQ A;  3CJM A;  3FWL A;  3MKE A;  5D3O A;  5FA7 A;  2XK1 A;  3JYI A;  3LCE A;  4D2O A;  3QNB A;  1E25 A;  3CZD A;  2JBF A;  1XXM A;  2ZQA A;  4XUX A;  4OOM A;  3BEB A;  3Q7Z A;  1BSG A;  3IWI A;  4KZB A;  5A92 A;  4KZ7 A;  2HDR A;  1LL5 A;  4PM7 A;  1Y54 A;  2Q9N A;  3C4O A;  4CPK A;  5A91 A;  1MWU A;  4E3I A;  1G6A A;  4RX3 A;  3SOI A;  1H8Y A;  1Q2Q A;  2QZ6 A;  1CI9 A;  3M6B A;  3GTC A;  4C3Q A;  4UA6 A;  3VP2 A;  1PYY A;  1EWZ A;  2JC7 A;  5DF7 A;  5F1G A;  3LY3 A;  1PW8 A;  4OOY A;  1PW1 A;  3A3E A;  5CEB A;  1TDG A;  3WWX A;  3NDE A;  1GHP A;  3IH9 A;  3Q7V A;  4ZJ3 A;  3MXR A;  4QY5 A;  5EEC A;  1GHM A;  5AQB A;  4C75 A;  3PBO A;  3IQA A;  1YMS A;  2Y2H A;  3HLC A;  3I7J A;  4B4X A;  1HVB A;  2ZC4 B;  4OPZ A;  5E2G A;  5GHY A;  1K55 C;  2ZC3 B;  3GSG A;  3G4P A;  3IF5 A;  2A49 A;  3G34 A;  1XX2 A;  5EVI C;  1IKI A;  4N9K A;  2IWD A;  1H5X A;  4HBT A;  2P9V B;  2R9X A;  1KDS A;  3NDG A;  5CEC A;  4E3O A;  3IXH A;  3WS2 A;  2CC1 A;  4KQO A;  1NJ4 A;  3N8S A;  5CXW A;  3UPP A;  1MWR A;  4N9L A;  4R4S A;  2OLU A;  5A90 A;  4QY6 A;  5M18 A;  2H0T A;  2ZQ8 A;  1XPB A;  4KZ3 A;  1W5D A;  3A3D A;  2C5W B;  1DY6 A;  1I2S A;  5HAP A;  1ZG6 A;  3VP0 A;  4P6B A;  1KVM A;  2WAD A;  4YIN A;  2ZC5 B;  1MWT A;  3P98 A;  3M6H A;  5JYP A;  2FFF B;  3N8L A;  4R1G A;  4U3T A;  4FCF A;  4JF4 A;  4DDS A;  4JPM A;  2P74 A;  4ZJ2 A;  3SH9 A;  3OPP A;  1W7F A;  3NC8 A;  1FOF A;  5E2F A;  4UA9 A;  5FSR A;  1FCN A;  1IEM A;  1O07 A;  4LEN A;  1XA7 A;  3GVB A;  3IHB A;  1NYM A;  3HUO A;  1QMF A;  1AXB A;  3PBS A;  4LV0 A;  4X55 A;  2XLN A;  3UY6 A;  1XGI A;  1DJA A;  1I5Q A;  4QB8 A;  3TOI A;  1FSW A;  1YMX A;  4OOL A;  3G2Z A;  2X02 A;  3E2K A;  4S2L A;  4H8R A;  1KE4 A;  4EBL A;  1YLW A;  2OV5 A;  2Y2I A;  1N9B A;  3HBR A;  4X6T A;  1E3U A;  2JE5 A;  1YQS A;  4KZ4 A;  3SH7 A;  1EI5 A;  5HX9 A;  2WYX A;  2J9P A;  3B3X A;  3ZNT A;  2HDQ A;  3C5A A;  1YM1 A;  2JCH A;  3ISG A;  4N92 A;  2ZQ7 A;  4OQ0 A;  2R9W A;  3ITA A;  3ITB A;  3LO7 A;  3W4P A;  1CEF A;  2VGJ A;  4YFM A;  5E43 A;  3PAG A;  4ZJ1 A;  3E2L A;  4JLF A;  4X53 A;  4XXR A;  3MKF A;  4PPR A;  3UE1 A;  5HL1 A;  1PI4 A;  5CTN A;  5DVA A;  1K54 A;  3GQZ A;  4FD8 A;  4CJN A;  1ES5 A;  3HLF A;  4WZ5 A;  1LHY A;  3EQU A;  4ID4 A;  3QNC A;  5EVI B;  4OPR A;  1YLJ A;  4EUZ A;  3HLD A;  2Y59 A;  1GHI A;  2XEP A;  1I2W A;  5G18 A;  5KZH A;  1FCO A;  4GDB A;  2XGN A;  4RYE A;  1E3U D;  4FH2 A;  4MLL A;  4DRT A;  1NY0 A;  1PIO A;  4E3K A;  3FYZ A;  3ZCZ A;  4WEK A;  4DXB A;  1S6R A;  3HLW A;  1BZA A;  2ZC7 A;  4C6Y A;  4OVD A;  3G32 A;  1RP5 A;  4RVA A;  1PWD A;  5GLB A;  3UE0 A;  2XQZ A;  1MY8 A;  1IYQ A;  3EQV A;  2ZM2 A;  1MXO A;  1ALQ A;  1BLP A;  1RCJ A;  3WRT A;  1S0W A;  2X01 A;  5FI7 A;  2Y2J A;  3LY4 A;  2PU2 A;  1LLB A;  4E3L A;  2ZC6 B;  2Z2L B;  2XFT A;  3V5M A;  4LCM A;  3IXB A;  3S4X A;  1MPL A;  4R3B A;  2XFS A;  3HLB A;  1IEL A;  1NYY A;  5FQI A;  2DRW A;  3ZG8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...