4PM7A

Crystal structure of ctx-m-14 s70g:s237a in complex with cefotaxime at 1.29 angstroms resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGAGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-14
publication title Molecular Basis for the Catalytic Specificity of the CTX-M Extended-Spectrum beta-Lactamases.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Hydrolase/antibiotic
total genus 96
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4pm7A00
4BL2A 1IYSA 4JXWA 4RYEA 4DF6A 1EROA 4GKUA 4GD8A 1DJCA 3IT9A 3VFHA 4DRTA 3QHYA 4N92A 3WS0A 1RGYA 1K57C 3LY4A 2XFSA 2GDNA 3O86A 4R1GA 1YLPA 1NJ4A 1KE0A 4N1HA 5CEBA 1FCNA 1YLJA 3ZG5A 1HTZA 1NYMA 5AQBA 5M19A 3WRTA 3BLSA 4JPMA 2HP6A 3NDGA 1IYOA 1MWTA 5F83A 4KZ7A 1Z6FA 4JBFA 5GHYA 4X53A 3UN7A 5AQ9A 1H5XA 2WGWA 2ZC7A 3M6HA 2PU2A 3AGFA 4WEKA 1K38A 2HPBA 2WUQA 5DTTA 5FQMA 3BEBA 2EX8A 4P85A 3S22A 1PW1A 4C3QA 4EQIA 3OPLA 4WM9A 1KGFA 1IELA 4OKPA 3C7UA 5GLDA 3EQVA 2Y2MA 1HZOA 3O87A 3V39A 2P74A 1FQGA 1JTGA 3HLDA 3DWZA 5DF7A 5CGWA 3G34A 2J7VA 3FV7A 2XK1A 3JYIA 4OQIA 5FA7A 1FR6A 5FASA 5BOHA 3CMZA 4EV4A 4PM9A 3CZDA 3NIAA 5M1AA 2ZQAA 4U0XA 5GLBA 5HAIA 5TGFA 3N8SA 4EWFA 4S2JA 4IEDA 3UNWA 3UDXA 2JE5A 3PTEA 4HESA 4R4SA 4E3IA 3SH7A 4WBGA 3VOZA 1W79A 5CECA 2V2FF 3A3EA 1PWGA 3VSKA 5CHUA 3G30A 3NDEA 3DTMA 4S2MA 5L2FA 1LI9A 5I94A 1KDWA 1YLZA 1CI8A 4WZ4A 5KSCA 5GHXA 4LCLA 4GOGA 1CI9A 1VM1A 2XQZA 3TG9A 5J8XA 4ZJ3A 3ZG9B 4Y7PA 1HVBA 3GVBA 3MFDA 2DNSA 1GCEA 2H10A 1NZOA 2WKIA 1BZAA 2H5SA 2Y91A 4S2IA 1L2SA 2UWXA 5AQ7A 3UE0A 3WS4A 3UE3A 1M6KA 3VP0A 4KZ3A 5A91A 4E6WA 1CEGA 3PAGA 1MWRA 4Q8IA 5FAQA 1PWDA 3IXBA 2ZD8A 5IHVA 2ZM2A 4P6BA 5TFQA 1NY0A 5FQQA 1C3BA 2WAFA 5FI6A 2OLVA 4HBTA 2J9OA 4S2OA 2Z2LB 4X68A 1PZOA 3EQUA 3M2KA 2G2WA 2JCHA 4HBUA 3BM6A 1IYQA 4P87A 2ZC5B 4S2NA 5DTSA 5FAPA 4MNRA 5U47A 3IWOA 1GHPA 2Y59A 4QD4A 4E3KA 1L0EA 4R4RA 4Y0TA 1K55C 5F1GA 1O7EA 3FYZA 1YT4A 4LV0A 1K57A 4OONA 4YFMA 1JWZA 4BD0A 2XD1A 4UHUA 4LV3A 3A3JA 4OQHA 3PBOA 4OOMA 1BLSA 4KQRA 5E2FA 5EOOA 3SS3A 3GQZA 3M6BA 2CC1A 3PAEA 5FSRA 5JYOA 1NXYA 4OOYA 1KVLA 5EPHA 4E6XA 1ONHA 3WRZA 4OPQA 1XPBA 5FQ9A 2P9VA 1VQQA 1SKFA 2DCFA 4FSFA 4KZBA 4QB8A 1GHIA 3MZEA 3NBLA 4FCFA 3G32A 4S2NC 1NYYA 1W7FA 1MBLA 1MY8A 2BLSA 5A90A 4B4ZA 2Y2LA 4R0QA 5HARA 4DXCA 3ZG7B 1HD8A 3M2JA 3G31A 3UDIA 2Y2JA 3SS5A 1XX2A 1ESUA 3LY3A 3Q82A 1CK3A 1YLYA 3UDFA 1L0GA 4C75A 4EBPA 1JVJA 1TEMA 4OP8A 4LV2A 1K54C 4PMAA 3CG5A 4MBKA 4E3NA 3UO9A 4RVAA 2J9PA 4KZ9A 3B3XA 1PW8A 4E3MA 3IXHA 4KZ6A 5CGXA 3OCLA 3QNBA 2J8YA 5DF8A 2X01A 4OPRA 2G2UA 4X56A 5JYPA 3D4FA 4UA7A 2HDSA 2C5WB 2DRWA 4GB7A 2XLNA 1BULA 1W8YA 4H8RA 2Y2IA 3SS4A 1G6AA 4KZ5A 5CTNA 4X69A 5FI2A 3IH9A 3A3DA 3DW0A 1K4FA 3OZHA 3RJUA 5HW3A 5E2GA 5E2HA 3VP4A 2WAEA 4N1XA 3UPPA 1ES3A 1XXMA 3PBNA 3MZFA 3BFDA 3IF6B 1L0FA 2R9XA 3C4PA 2WK0A 3G35A 5CHMA 4KQOA 2WADA 3IQAA 5EUAA 4GDBA 3Q1FA 4BL3A 1BLCA 1RP5A 5E2EA 2Y2OA 3BFFA 1YMSA 5FQJA 3GMWA 2Y2PA 3UY6A 2V1ZA 1SHVA 4KG5A 4P0MA 4A5RA 1OMEA 4WZ5C 4ZJ2A 2OLUA 3IH8A 4OPYA 4R23A 5KSHA 4ZDXA 3IXGA 4OLDA 4CPKA 1MPLA 4WYYA 1JWPA 3ITAA 2XDMA 1ZG6A 3PBTA 1NRFA 4BENA 1S6RA 4OPZA 3W4QA 4KG2A 1JTDA 2X02A 1DJBA 3BFGA 4F94A 3FZCA 1PIOA 3NCKA 4GDNA 4KQQA 1IEMA 1SCWA 4OP5A 2ZQ9A 4HEFA 1MWUA 2QMIA 5FATA 1AXBA 5FDHA 5FI7A 3OPHA 4QJGA 3A3IA 2HP5A 3I7JA 2JBFA 1K55A 5EVIB 4X6TA 2ZLYA 2IWCA 3MXRA 2Q9NA 3ZVWA 4DE0A 3OPRA 2XF3A 4B88A 2ZM8A 4PM7A 2XGNA 3QNCA 1QMFA 2RL3A 4MEZA 2HDUA 2A3UA 3PBRA 1K6SA 3G2ZA 1ZG4A 3BECA 3GR2A 5CRFA 3MKFA 4RX3A 5CHJA 2EFXA 1WYBA 4QY5A 4FD8A 4CJNA 5HL1A 5HAQA 1L0DA 3VFFA 4DDSA 5KZHA 1XGIA 3P98A 1RCJA 2XR0A 2WKEA 1LI0A 3O88A 1EWZA 3IF6C 2H0YA 3C4OA 5CERA 2XEPA 1I2SA 1QMEA 1E25A 5DTKA 4E3LA 2RCXA 3Q7VB 2ZQDA 1K25A 3BLMA 2WGVA 4GNUA 1K54A 2HP9A 4PM5A 5KMWA 3W4PA 2WKHA 1BLHA 4QU3A 3HBRA 4S2PA 3VOYA 3FKVA 3N7WA 1KE3A 3FKWA 3NI9A 5CXWA 1GA9A 3RXXA 3HLFA 1GHMA 4BD1A 1KGEA 1TDLA 3OPPA 3TSGA 1KVMA 3HREA 4R3JA 4BJPA 1CEFA 1GA0A 5CEDA 1SDEA 2PBYA 1BLPA 5HX9A 1ES5A 2HDQA 1TDGA 2ZC3B 1YM1A 2Y55A 1KDSA 4GZBA 3WS1A 3ZFZA 1FOFA 4FH4A 3MKEA 4NK3A 2VGJA 5F82A 3SOIA 4DDYA 4KZ4A 2ZQCA 4QHCA 5D3OA 4U3TA 5GL9A 1W5DA 2OV5A 4N9LA 3C7VA 4OVDA 1ES4A 3NY4A 3HLWA 3AGDA 4WMCD 2Y4AA 2ZJ9A 2QPNA 3G4PA 1PZPA 4X55A 4Y0UA 5EVIC 3V3SA 5M18A 4JXGA 5FAOA 1MXOA 4DE2A 2V20A 2Z2MB 2WGWB 3A3FA 4GD6A 4ZJ1A 1ERQA 5A92A 2EXBA 4KG6A 1M40A 1MWSA 2B5RA 3IWQA 1DJAA 1BT5A 1PWCA 3LEZA 2XFTA 1K56D 3UPNA 1Q2PA 2ZC6B 3HLEA 4JKTA 5E43A 3IHAA 4NETA 1KGGA 3HLBA 2XD5A 5FQIA 4WZ5A 4PM6A 1J9MA 1LHYA 4OQGA 3GTCA 1IKGA 2FFFB 4OQ0A 2R9WA 2E8IA 1G68A 5DF9A 1H8ZA 3VMAA 3N4IA 3NC8A 3VP2A 1PI5A 3ZG0A 2I72A 2OSUA 4DE1A 4QY6A 3ITBA 5G18A 1E4DA 5EOEA 1K6RA 1U60A 3ZHHA 1KE4A 4ZAMA 4C6YA 4S2LA 2ZQ8A 3Q7ZA 4UAAA 3HVFA 1YLWA 1I2WA 5EVID 1XP4A 3UE1A 1E3UD 3BRMA 4ID4A 4WELA 3WWXA 3ZGAB 2JC7A 4PPRA 4ZTKA 3FWLA 3HLGA 5AQAA 1XA1A 2H0TA 2EX9A 1IYPA 2Y2KA 1Y54A 4Y0OA 1W8QA 2EX2A 5DVAA 3V3RA 3TOIA 4DKIA 5GHZA 2WGIA 2Y2NA 1ZC2A 4KENB 5GLAA 1ZKJA 3WS5A 5EECA 1K4EA 4OLGA 3ZDJA 3N6IA 4JF6A 4BLMA 2PU4A 1WE4A 1SDNA 3O3VA 3ZNYA 4YINA 4LENA 3HLCA 2X71A 3Q81A 4DE3A 2Y2GA 3CJMA 4WEJA 3SH9A 4BQMA 1YLTA 1H8YA 3LCEA 3MZDA 1JWVA 4K0XA 1LL5A 1ERMA 2ZQ7A 3OCNA 4GN2A 3DWKA 4Z9QA 4IBXA 3PBQA 2VGKA 3IF6A 4RX2A 2IWDA 4WMCA 2Q9MA 3BFCA 5A93A 3N8LA 4JXVA 4KZAA 2EX6A 3VP3A 4K91A 2Y2HA 3IXDA 2XH9A 3BFEA 4FH2A 4MLLA 4OH0A 4UA6A 4KZ8A 3GSGA 3UPOA 1XGJA 1K56A 3P09A 1FSYA 4EUZA 3E2KA 4M3KA 3HL9A 3OC2A 4O7DA 1S0WA 2C6WB 1ONGA 4ZBEA 2BG1A 2Y2QA 2ZMAA 3W4OA 4U0TA 3HUNA 3W8KA 1PI4A 3SH8A 3MXSA 3IF5A 4IVKA 4XUXA 5FQKA 1ESIA 3G2YA 2WZZA 1EI5A 4JF5A 1BSGA 3N8RA 2QZ6A 1PYYA 4MBFA 1Q2QA 3S1YA 4B4XA 3LO7A 5GLCA 1YQSA 5CTMA 4D2OA 3S4XA 4XUZA 3V50A 1I5QA 1MKIA 1O07A 4IVIA 4K0WA 5EVIA 1N9BA 1E3UA 2EXAA 2P9VB 4R3BA 5CGSA 1FCMA 1FR1A 4E3OA 2ZM0A 4JF4A 2IWBA 4EBLA 2WZXA 4S2KA 3HUOA 1BTLA 1BUEA 3BYDA 3Q07A 3C5AA 5F1FA 1NZUA 3GV9A 2A49A 3HUMA 4UA9A 4DXBA 5EVLA 3ZCZA 1FSWA 4RA7A 4OOLA 4XXRA 1N4OA 5HFOA 3AGEA 4LV1A 1XKZA 1LLBA 4EBNA 2ZC4B 3ISGA 3RXWA 1RGZA 4PM8A 3E2LA 1WYCA 3VP1A 3IHBA 4LCMA 3V5MA 1ES2A 4E3JA 3GRJA 2EFUA 4N9KA 1IKIA 1DY6A 3WS2A 2FFYA 4MBHA 3Q7VA 1ALQA 1LL9A 2WYXA 3MBZA 4L0LA 4IBRA 4JLFA 5EE8A 5TR7A 3ZNTA 1TVFA 2HDRA 3ZG8B 5HAPA 1XA7A 3PBSA 4JXSA 3ZVTA 3IWIA 1YMXA 1FCOA 3VSLA
chains in the Genus database with same CATH superfamily
4RYEA 1EROA 3IT9A 3VFHA 4R38A 3WS0A 1YLPA 5FEGA 1GSXA 1FCNA 1HTZA 3BLSA 1MWTA 5F83A 1BYWA 4JBFA 1XJ2A 4CQHA 2JKFA 4WEKA 3LGOA 1OJGA 1JNUA 2WUQA 5DTTA 3BEBA 4KQDA 5F6AA 1IELA 1HZOA 5TBMA 2P74A 3DWZA 5CGWA 3G34A 1FR6A 4EV4A 2VV7A 5HAIA 1HLUP 3UNWA 1VEUA 4F3LB 4E3IA 3SH7A 3SW1A 5CHUA 3G30A 3NDEA 1LI9A 3T12B 1YLZA 1CI8A 4I3JA 5J8XA 4EQ1A 3UB9A 3GVBA 3MFDA 3MR0A 3TJZC 1L2SA 5A8BA 1M6KA 3PR6A 5HD5A 4E6WA 1CEGA 1MWRA 3IXBA 2QKPA 2ZD8A 5L09A 5F68A 1DP6A 4PKYG 1C3BA 2WAFA 3S7OA 4E04A 2JKTI 5DJTA 4S2NA 2ZC5B 5DTSA 2WKPA 5HWTA 4E3KA 2B18A 2W1TA 2XA7M 1YT4A 2PRFA 5L07A 4LV3A 4OOMA 1BLSA 3EOIA 2PDRA 3EEAA 3SS3A 3GQZA 3LI9A 2CC1A 3PAEA 5FSRA 1GSWA 2KX6A 3DTEA 4PHTA 3G32A 2BLSA 5DFYA 1IFQA 3EWKA 5HARA 4Q0HA 5HD3A 2Y2JA 1ESUA 3UDFA 4EBPA 1JVJA 1TEMA 4LV2A 4ESPA 3ICYA 4RVAA 4KZ9A 3B3XA 3MQ0A 3OCLA 4EU0A 2J8YA 5DF8A 1IOUA 4JGPA 4X56A 2HDSA 2YKHA 1G6AA 2V1BA 5FI2A 4L9GA 3IH9A 4IHQA 1OTBA 3OZHA 4KUOA 5E2HA 1VETA 1ES3A 3PBNA 4R3AA 3MZFA 5FL3A 3IF6B 2R9XA 4MN7A 2WADA 3Q1FA 2Y2OA 3BFFA 1KOUA 2HJ9C 2VJWA 3MXQA 4A5RA 4WZ5C 5KSHA 4IUHA 4OLDA 1MPLA 4WYYA 1S6RA 5G4ZA 4KQQA 2ZQ9A 5FDHA 5FI7A 3PYPA 2HP5A 4LPZA 2VX8A 3ZVWA 4DE0A 3OPRA 2ZM8A 4YOFA 4HY8A 2RL3A 3GR2A 4F3LA 5CHJA 1WYBA 2GZAA 5HL1A 5HAQA 1XGIA 1RCJA 1Y4OA 2XR0A 1LI0A 2VV8A 1EWZA 3IF6C 1PFLA 2NUTC 2XEPA 1I2SA 5DTKA 1V9YA 2WGVA 3W4PA 5EVEA 1BLHA 3N7WA 3ZCZA 5CXWA 3FKWA 1TS6A 2D02A 2VA0A 4BJPA 1CEFA 3UB7A 5F5YA 1ES5A 2HDQA 1TDGA 1KDSA 3IX8A 3QP6A 4QHCA 3TRCA 3C7VA 1ES4A 2W3GA 3AGDA 4WMCD 4ARZA 2HF6A 5FAOA 2WGWB 3LIDA 4CLCB 3CLOA 4ZJ1A 2EXBA 2B5RA 3E4QA 4AFIA 1BT5A 1PWCA 1K56D 4Y15A 4JKTA 3ZQ5A 4NETA 4WZ5A 3T4JA 3DBAA 1J9MA 2K31A 4OQGA 5HSQA 2VV6A 2R9WA 2E8IA 5DF9A 2EWVA 4DE1A 4QY6A 3ITBA 3O5YA 5EOEA 4ZAMA 4S2LA 3Q7ZA 2QHKA 5EVID 3UE1A 1E3UD 4ID4A 3WWXA 2JC7A 4JGQA 3FWLA 3EGDC 2H0TA 4CPKA 1IYPA 3LR0A 2EX2A 4DKIA 3QP4A 3F1NB 5GHZA 2Y2NA 4KENB 3ULFA 3LR3A 1SDNA 4HH2A 3Q81A 4DE3A 4BQMA 4K08A 3BQAA 1ERMA 2ZQ7A 3OCNA 3PBQA 3IF6A 4Y17A 2IWDA 1OTDA 4CLCC 3U2AA 3SZTA 4NKPA 3VP3A 3IX4A 5EM0A 2XH9A 3BFEA 3VV4A 5AJGA 1XGJA 1FSYA 2FZ0A 4M3KA 4O7DA 2BG1A 2Y2QA 3BY8A 5L8MA 3SH8A 4GLQA 2W27A 1ESIA 1EI5A 1T1BA 4JF5A 4CLCE 4MBFA 1Q2QA 2J3WA 3V50A 4K0WA 2PAVP 1N9BA 1FR1A 2IWBA 2WZXA 1ACFA 2P04A 1CQAA 3C5AA 4UA9A 4DXBA 4RA7A 4XXRA 4P6ZM 4LV1A 3ISGA 4PM8A 2V9AA 3EGXC 3JVVA 3T4SA 4EW7A 2VK3A 4N9KA 4GW9A 3WS2A 2FFYA 4HQAA 1G6OA 2OAP1 1TS8A 5TR7A 4JLFA 2XROA 1TVFA 5HAPA 1XA7A 3PBSA 4JXSA 5EFWA 1OT6A 4GD8A 1T1CA 3LIFA 4DRTA 2A2LA 5TBMB 3HJKA 1NRJA 2XFSA 1NJ4A 4LRZE 1KE0A 1CF0A 5CEBA 1S4SA 1YLJA 2LB5A 3KX0X 5M19A 4JPMA 2HP6A 1IYOA 5GHYA 2WGWA 3IBRA 1AWIA 1VEUB 1K38A 3S22A 4C3QA 4EQIA 1DRMA 4OKPA 3C7UA 3EQVA 2Y2MA 3O87A 1JTGA 5DJUA 2Z6DA 3R7WA 2MJ6A 2PBDP 2J7VA 3FV7A 2XK1A 2UV0E 5BOHA 3B47A 3CZDA 3IBJA 5M1AA 2OWJA 4U0XA 5GLBA 5TGFA 2HZ5A 4IEDA 3PTEA 4HESA 2ZOHA 4WBGA 3VOZA 1W79A 1PWGA 5L2FA 5AVEA 3R4KA 5KSCA 3H82B 4GOGA 1VM1A 2XQZA 4HJ3A 4Y7PA 1HVBA 2XSSA 5C5KA 4HJ6A 2DNSA 2H5SA 4S2IA 1PNEA 3VP0A 4KZ3A 5A91A 4R70A 2QWSA 3F1OB 5K5BA 3E0YA 4S2OA 1PZOA 2G2WA 3OLOA 4MNRA 3IWOA 2Y59A 4R4RA 4Y0TA 2CMNA 3FYZA 4BD0A 1V9ZA 4BMWA 5E2FA 3B42A 1FIKA 4OOYA 5DKKA 5EPHA 5FQ9A 1D7EA 1SKFA 4QB8A 3UMDA 2QJ7A 4S2NC 1NYYA 4B4ZA 1VETB 3M2JA 3UDIA 2W1RA 3Q82A 4C75A 1L0GA 3C38A 4OP8A 2V8CA 2M7VA 4PMAA 1K54C 3T1QB 4E3NA 1S1ZA 2J9PA 4E3MA 3T4KA 5CGXA 4HNBA 2X01A 3VOLA 4UQIS 3P7NA 5JYPA 3D4FA 1P97A 2M7UA 3MQOA 1OTEA 4X69A 3CWFA 1NLZA 4O01A 5HW3A 3VP4A 3LIEA 1P0ZA 3QP8A 2ZL1A 1L0FA 2WK0A 4KQOA 4GDBA 3JPUA 5J3WA 5FQJA 3GMWA 2Y2PA 3UY6A 4GS9A 4P0MA 4ZJ2A 2OLUA 3IH8A 4OPYA 4R23A 3IXGA 1DP8A 3PBTA 2EWWA 4OPZA 3OBFA 3FZCA 3A0RA 3NCKA 4GDNA 1IEMA 1SCWA 1MWUA 2QMIA 3NOUC 3A3IA 5EVIB 3LUQA 4LFUA 3MXRA 3NJAA 2XF3A 4B88A 4PM7A 3QNCA 5G4YA 5MC7A 4MEZA 3RFBA 5HPFA 2KOIA 4RX3A 3NOTC 2W0NA 1TD5A 4FD8A 3TW8A 1L0DA 3VFFA 4DDSA 2JHEA 5KZHA 3H82A 3P98A 3FG8A 2J3TC 2H0YA 1MKMA 1QMEA 4ARZB 3OOVA 2ZQDA 1K25A 3BLMA 1K54A 5KMWA 2WKHA 3FKVA 3NI9A 3CUEC 4BD1A 3F1OA 1GA9A 3HLFA 3K3DA 3OPPA 3TSGA 4R3JA 1GA0A 1PRQA 4X1MA 3WS1A 2ZC3B 4GZBA 2Y55A 3E4PA 4I38A 4I39A 4KZ4A 4N9LA 4OVDA 3MJQA 3NY4A 4Y0UA 2Y4AA 2ZJ9A 2QPNA 3G4PA 1PZPA 5EVIC 2VLGA 1MXOA 3UPNA 3LEZA 2XFTA 5IU1A 5FQIA 4Y5FA 2PYRA 2PR5A 3GTCA 1IKGA 1H8ZA 4IUKA 2HGVA 1F2KA 3VMAA 3N4IA 3ZG0A 2I72A 2OSUA 5G18A 2HJEA 1K6RA 2W3HA 1YLWA 3CITA 3ZGAB 4I3IA 1LT0A 4PPRA 4Y0OA 1T19A 1ZKJA 4OLGA 1LSVA 3N6IA 4JF6A 2PU4A 1WE4A 3O3VA 4LGWA 4LENA 3CJMA 3SH9A 5HPIA 4K0XA 1SKOB 4PAUA 4GN2A 4NXGA 3S7PA 3DWKA 4Z9QA 4WMCA 2Q9MA 3BFCA 5A93A 2G7UA 2JN7A 4K91A 3CHWP 2Y2HA 4KZ8A 3GSGA 1K56A 4EUZA 4DN0A 3CUEA 4ZBEA 1S0WA 2VKSA 2J80A 3W4OA 5KIZA 4MN6A 3IF5A 4IVKA 4MN5A 3G2YA 2NUPC 1OTIA 2QZ6A 3HCYA 1K0KA 5GLCA 4D2OA 3S4XA 3KO6A 4XUZA 1O07A 1MKIA 5EVIA 1E3UA 2EXAA 5CGSA 3RH8B 4JF4A 3KSFA 3HUOA 3RTYA 1OJ5A 5F1FA 3GV9A 1UGUA 5HFOA 3AGEA 2K2NA 1LLBA 4EBNA 1RGZA 3E2LA 1WYCA 2I9VA 1S1YA 4LCMA 4HH3A 3V5MA 1N9OA 2EFUA 1IKIA 1N9NA 1LL9A 2WYXA 5EE8A 3ZNTA 2PHYA 3A0SA 4M4XA 3IWIA 3T4LA 5CHMA 4EUVA 5A92A 3F1PB 1DJCA 2ZMVA 3QHYA 1LL8A 1RGYA 3R7WB 4R1GA 1S67L 3A0VA 4YWZA 4N1HA 1LSXA 3BY9A 4Y3IA 4Y13A 3NDGA 5HDSA 4KZ7A 1Z6FA 1OTAA 3LFVA 2ZC7A 2E8JA 3M6HA 2PU2A 5FQMA 4UEYA 4P85A 4ZRRA 4WM9A 4BBVA 3UB5P 3NULA 5GLDA 1YKDA 3V39A 5DF7A 3CPTB 3JYIA 3CAXA 4OQIA 4MCWA 5TJJA 4PM9A 5L10A 2ZQAA 2ZMFA 4EWFA 3N8SA 4S2JA 5HZHA 3A3EA 3VSKA 1A0KA 5I5LA 5I94A 4L9FA 4WZ4A 5GHXA 2VGLM 4HJ4A 2GNXA 4LRYC 1FILA 3C2WA 1GCEA 2H10A 2WKIA 4O0PA 2Y91A 2UWXA 1SKOA 3UE3A 4QPRA 1T18A 4Q8IA 2VZWA 2V1AA 4P6BA 5TFQA 1NY0A 5FQQA 5FI6A 2OLVA 1GSVA 4HBTA 2J9OA 4X68A 2Z2LB 2O9BA 4HBUA 3NHQA 3BM6A 4P87A 5FAPA 4HI4A 4EETB 3S7QA 2P7JA 4QD4A 1L0EA 4LV0A 4OONA 1DP9A 2GJ3A 4KQRA 5EOOA 5HDCA 5JYOA 4MMNA 1NXYA 1KVLA 3WRZA 4JGRA 4OPQA 1VQQA 4FSFA 4KZBA 1D06A 1GHIA 3NBLA 4FCFA 1W7FA 1MY8A 3B33A 3P01A 4DXCA 3KSGA 1HD8A 3G31A 3SS5A 3LY3A 3PXPA 1TF1A 2ZL1B 4R6LA 3DTKA 4MBKA 3UO9A 2A24A 1PW8A 3IXHA 3QNBA 4GS9B 1ZTUA 4UA7A 2C5WB 2DRWA 4GB7A 2XLNA 1BULA 1ZHHB 2Y2IA 3SS4A 5CTNA 3A3DA 3F1PA 1K4FA 3RJUA 1MC0A 5CX7A 1XXMA 1NWZA 2PR6A 1YPRA 3BFDA 2KLIA 3IS2B 5HDDA 3G35A 5EUAA 1BLCA 3GECA 2V1ZA 4EEPA 4ZDXA 3KSHA 2JKRI 2K7SA 3ITAA 2XDMA 4BENA 1G28A 3LYXA 3W4QA 2X02A 4P6ZS 5FDSA 5FATA 1AXBA 3CPTA 2JBFA 2WKRA 4EXOA 1XJ6A 2ZLYA 1NLYA 3D9YA 2Q9NA 3GDIA 2XGNA 3LIAA 3C8CA 2A3UA 3PBRA 1K6SA 4XT2A 1ZG4A 5CRFA 3MKFA 2VEAA 2EFXA 2XRNA 3VE3A 2ZBBA 2P08A 1CJFA 4HOIA 5CERA 2HV1A 1E25A 4NXEA 3Q7VB 2HP9A 2IA2A 2L0WA 1X0OA 1KVMA 1P9RA 2M1CA 4EERA 2PBYA 5F69A 3ZFZA 1EW0A 3MKEA 4WN5A 4NK3A 2ZQCA 5D3OA 5GL9A 2O9CA 2OV5A 3H9WA 5M18A 2ZOIA 4JXGA 4DE2A 3A3FA 4GD6A 1ERQA 2Y8HA 4Y2FA 1N9LA 4KG6A 3JVUA 1DJAA 1Q2PA 2ZC6B 5E43A 3U4LP 3HLBA 4PM6A 2INWA 4B9OA 1G68A 3NC8A 4IJGA 3MSHA 2BTFP 4DMZA 1U60A 1KE4A 2ZQ8A 4UAAA 3HVFA 1XP4A 3BRMA 4WELA 3UE6A 2PYPA 3HJIA 3HLGA 5AQAA 5HWWA 2B95A 1Y54A 3V3RA 5DVAA 3V67A 4NXBA 4FUWA 2WGIA 1ZC2A 3WS5A 5EECA 4BLMA 3DAVA 1VB6A 1L3LA 3K3CA 3K2NA 4NG2A 2Y2GA 2Z6CA 4WEJA 1YLTA 3MZDA 1W63Q 3BQ8A 1LL5A 1J3WA 1H8MA 3IS2A 3LR4A 4RX2A 4DJ3A 4JXVA 4KZAA 3MQQA 1TS7A 2GX5A 4MLLA 4OH0A 3UPOA 3P09A 3E2KA 2C6WB 2ZMAA 1YSPA 4XUXA 2WZZA 1BSGA 3N8RA 1PYYA 3S1YA 2WKQA 5EV0A 1YQSA 5CTMA 3LIBA 3T1SA 4R3BA 2P9VB 3KYEA 1H0MA 2O9AA 1BTLA 1BUEA 3BYDA 1NZUA 2L4RA 5HWVA 2A49A 3E4OA 1FSWA 4OOLA 3E98A 2PT7A 4HIAA 3RXWA 3MFXA 3VP1A 3NOPC 3BJNA 2OAQ1 4MBHA 3Q7VA 1ALQA 3MBZA 3MS6A 2QJ5A 4GHIB 2HDRA 4ME4A 3T4QA 1YMXA 1FCOA 3VSLA 5IT5A 4BL2A 1IYSA 4JXWA 4DF6A 4GKUA 2JKGA 4N92A 1K57C 3LY4A 2GDNA 3O86A 2R78A 4X1LA 3ZG5A 1NYMA 5AQBA 2PD8A 3WRTA 4NEED 4X53A 3UN7A 5AQ9A 1H5XA 1XJ4A 4LLOB 3VE4A 3AGFA 2HPBA 4D60A 2EX8A 4MDZA 4WL9A 4G3VA 1PW1A 3T1RA 4JGOA 3OPLA 1KGFA 1TS0A 1P9WA 5FEFA 4ETZA 1FQGA 3HLDA 1XFNA 5FA7A 3L7HA 5FASA 3CMZA 3T4TA 4LRXC 3NIAA 1UWPX 2XA7S 3MMHA 3UDXA 2JE5A 4R4SA 4QWOA 3LI8A 5CECA 4BBTA 2V2FF 4Q0IA 1F5MA 3DTMA 1S4RA 4S2MA 3MF0A 1KDWA 4G3KA 4HHDA 4LCLA 2DMWA 1H3QA 5IS1A 1CI9A 3TG9A 4ZJ3A 3ZG9B 4HP9A 1NZOA 3UE0A 1BZAA 3IX3A 5AQ7A 3WS4A 3BW6A 3PAGA 5FAQA 1PWDA 3L9KA 3QP1A 2Q0OA 5IHVA 2ZM2A 3FC7A 3EQUA 3M2KA 2JCHA 1IYQA 4EESA 3D3OA 5U47A 3C30A 3DTIA 1GHPA 4WLAA 4G3WA 1WA9A 1K55C 5F1GA 1O7EA 1K57A 4YFMA 1JWZA 2FH5A 1F98A 2XD1A 4UHUA 4BWIA 3A3JA 4OQHA 3PBOA 2A24B 1ODVA 3UB8A 3LR5A 3M6BA 2KDKA 1OPXA 4E6XA 1ONHA 1XPBA 2P9VA 2DCFA 3MZEA 1S66L 1MBLA 5A90A 1T1AA 2Y2LA 4R0QA 1OT9A 5HL6A 3ZG7B 1XX2A 2J3TD 1CK3A 1YLYA 5J4EA 2ACGA 2JKRM 3T50A 3CG5A 3T1XA 4EEUA 4OPRA 2AVXA 1MZUA 4HP4A 2G2UA 4GHIA 1W8YA 4H8RA 3KYZA 4KZ5A 4O8GA 3DW0A 5E2GA 2WAEA 4N1XA 3UPPA 5LBRA 4GCZA 3C4PA 4B93A 3IQAA 4BL3A 1RP5A 5E2EA 1YMSA 2W3EA 2W3DA 2O0YA 1SHVA 4KG5A 1OMEA 4NXFA 3EEHA 3ZYTA 3W2ZA 5EM1A 1JWPA 4XT2B 1ZG6A 1NRFA 4KG2A 1JTDA 5AVFA 1DJBA 3BFGA 4F94A 4Z1WA 1PIOA 4OP5A 4HEFA 3OPHA 3FPWA 3NECA 4QJGA 3H7WB 3CI6A 2L1MA 3I7JA 1Y28A 1K55A 3FPVA 4X6TA 2IWCA 1QMFA 2HDUA 2QYBA 1XJ3A 3G2ZA 1W63M 2EA9A 3BECA 3LEQA 4QY5A 4CJNA 2WKEA 3O88A 4KUKA 3C4OA 1Z09A 4E3LA 2RCXA 4H6JB 2B02A 4GNUA 4PM5A 1LSWA 4QU3A 3HBRA 4S2PA 4ETXA 3VOYA 1KE3A 3RXXA 4II7A 1YAXA 1GHMA 2PD7A 3TE8A 1KGEA 1TDLA 3HREA 5CEDA 1SDEA 5DKLA 1UWNX 1BLPA 5HX9A 1YM1A 1XFQA 1FOFA 4FH4A 2VGJA 5F82A 2BASA 1D1JA 3SOIA 4DDYA 3UMEA 4U3TA 3LICA 1W5DA 3KYQA 3HLWA 4L9EA 4X55A 3V3SA 2V20A 2Z2MB 4BBUA 2V0UA 1M40A 1MWSA 3IWQA 3G6OA 1SZVA 3HLEA 1F9IA 3IHAA 1KGGA 2XD5A 1LHYA 2FFFB 4OQ0A 3VP2A 1PI5A 3PHYA 4YNRA 3KSIA 2VGLS 2LB9A 3S7NA 1E4DA 3ZHHA 4C6YA 1I2WA 2V0WA 3QP2A 4CLCA 4WUJA 4ZTKA 1XA1A 2EX9A 2Y2KA 1W8QA 3TOIA 5GLAA 1STZA 1K4EA 3ZDJA 5J7EA 3ZNYA 4YINA 3HLCA 2X71A 2OWHA 4GJ4A 2O99A 1H8YA 2W3FA 3LCEA 1JWVA 2JKTM 1VHMA 4IBXA 2VGKA 4PKYA 4UQIM 3N8LA 2YKFA 2EX6A 3IXDA 4FH2A 4UA6A 3F1NA 3HL9A 3OC2A 1ONGA 2D01A 4U0TA 3HUNA 3W8KA 1PI4A 2W1TB 2H28A 3MXSA 5FQKA 3BWLA 4B4XA 3LO7A 4X25A 3H7WA 1YSQA 1I5QA 4IVIA 4DJ2A 4CLCD 1FCMA 4E3OA 2ZM0A 4EBLA 4S2KA 3Q07A 3HUMA 5EVLA 1N4OA 2Y79A 5DFXA 1XKZA 4Q0JA 3D72A 2ZC4B 3QP5A 3IHBA 1ES2A 4E3JA 3GRJA 4RQ9A 4I3AA 1DY6A 4WF0A 4FTXA 1G5UA 2V8FA 3T4OA 4L0LA 4H6JA 4IBRA 3UB6A 4FOFA 3ZG8B 4I5SA 3ZVTA 2OOLA 4KZ6A
chains in the Genus database with same CATH topology
4BL2A 1IYSA 4JXWA 4RYEA 4DF6A 1EROA 4GKUA 4GD8A 1DJCA 3IT9A 3VFHA 4DRTA 3QHYA 4N92A 3WS0A 1RGYA 1K57C 3LY4A 2XFSA 2GDNA 3O86A 4R1GA 1YLPA 1NJ4A 1KE0A 4N1HA 5CEBA 1FCNA 1YLJA 3ZG5A 1HTZA 1NYMA 5AQBA 5M19A 3WRTA 3BLSA 4JPMA 2HP6A 3NDGA 1IYOA 1MWTA 5F83A 4KZ7A 1Z6FA 4JBFA 5GHYA 4X53A 3UN7A 5AQ9A 1H5XA 2WGWA 2ZC7A 3M6HA 2PU2A 3AGFA 4WEKA 1K38A 2HPBA 2WUQA 5DTTA 5FQMA 3BEBA 2EX8A 4P85A 3S22A 1PW1A 4C3QA 4EQIA 3OPLA 4WM9A 1KGFA 1IELA 4OKPA 3C7UA 5GLDA 3EQVA 2Y2MA 1HZOA 3O87A 3V39A 2P74A 1FQGA 1JTGA 3HLDA 3DWZA 5DF7A 5CGWA 3G34A 2J7VA 3FV7A 2XK1A 3JYIA 4OQIA 5FA7A 1FR6A 5FASA 5BOHA 3CMZA 4EV4A 4PM9A 3CZDA 3NIAA 5M1AA 2ZQAA 4U0XA 5GLBA 5HAIA 5TGFA 3N8SA 4EWFA 4S2JA 4IEDA 3UNWA 3UDXA 2JE5A 3PTEA 4HESA 4R4SA 4E3IA 3SH7A 4WBGA 3VOZA 1W79A 5CECA 2V2FF 3A3EA 1PWGA 3VSKA 5CHUA 3G30A 3NDEA 3DTMA 4S2MA 5L2FA 1LI9A 5I94A 1KDWA 1YLZA 1CI8A 4WZ4A 5KSCA 5GHXA 4LCLA 4GOGA 1CI9A 1VM1A 2XQZA 3TG9A 5J8XA 4ZJ3A 3ZG9B 4Y7PA 1HVBA 3GVBA 3MFDA 2DNSA 1GCEA 2H10A 1NZOA 2WKIA 1BZAA 2H5SA 2Y91A 4S2IA 1L2SA 2UWXA 5AQ7A 3UE0A 3WS4A 3UE3A 1M6KA 3VP0A 4KZ3A 5A91A 4E6WA 1CEGA 3PAGA 1MWRA 4Q8IA 5FAQA 1PWDA 3IXBA 2ZD8A 5IHVA 2ZM2A 4P6BA 5TFQA 1NY0A 5FQQA 1C3BA 2WAFA 5FI6A 2OLVA 4HBTA 2J9OA 4S2OA 2Z2LB 4X68A 1PZOA 3EQUA 3M2KA 2G2WA 2JCHA 4HBUA 3BM6A 1IYQA 4P87A 2ZC5B 4S2NA 5DTSA 5FAPA 4MNRA 5U47A 3IWOA 1GHPA 2Y59A 4QD4A 4E3KA 1L0EA 4R4RA 4Y0TA 1K55C 5F1GA 1O7EA 3FYZA 1YT4A 4LV0A 1K57A 4OONA 4YFMA 1JWZA 4BD0A 2XD1A 4UHUA 4LV3A 3A3JA 4OQHA 3PBOA 4OOMA 1BLSA 4KQRA 5E2FA 5EOOA 3SS3A 3GQZA 3M6BA 2CC1A 3PAEA 5FSRA 5JYOA 1NXYA 4OOYA 1KVLA 5EPHA 4E6XA 1ONHA 3WRZA 4OPQA 1XPBA 5FQ9A 2P9VA 1VQQA 1SKFA 2DCFA 4FSFA 4KZBA 4QB8A 1GHIA 3MZEA 3NBLA 4FCFA 3G32A 4S2NC 1NYYA 1W7FA 1MBLA 1MY8A 2BLSA 5A90A 4B4ZA 2Y2LA 4R0QA 5HARA 4DXCA 3ZG7B 1HD8A 3M2JA 3G31A 3UDIA 2Y2JA 3SS5A 1XX2A 1ESUA 3LY3A 3Q82A 1CK3A 1YLYA 3UDFA 1L0GA 4C75A 4EBPA 1JVJA 1TEMA 4OP8A 4LV2A 1K54C 4PMAA 3CG5A 4MBKA 4E3NA 3UO9A 4RVAA 2J9PA 4KZ9A 3B3XA 1PW8A 4E3MA 3IXHA 4KZ6A 5CGXA 3OCLA 3QNBA 2J8YA 5DF8A 2X01A 4OPRA 2G2UA 4X56A 5JYPA 3D4FA 4UA7A 2HDSA 2C5WB 2DRWA 4GB7A 2XLNA 1BULA 1W8YA 4H8RA 2Y2IA 3SS4A 1G6AA 4KZ5A 5CTNA 4X69A 5FI2A 3IH9A 3A3DA 3DW0A 1K4FA 3OZHA 3RJUA 5HW3A 5E2GA 5E2HA 3VP4A 2WAEA 4N1XA 3UPPA 1ES3A 1XXMA 3PBNA 3MZFA 3BFDA 3IF6B 1L0FA 2R9XA 3C4PA 2WK0A 3G35A 5CHMA 4KQOA 2WADA 3IQAA 5EUAA 4GDBA 3Q1FA 4BL3A 1BLCA 1RP5A 5E2EA 2Y2OA 3BFFA 1YMSA 5FQJA 3GMWA 2Y2PA 3UY6A 2V1ZA 1SHVA 4KG5A 4P0MA 4A5RA 1OMEA 4WZ5C 4ZJ2A 2OLUA 3IH8A 4OPYA 4R23A 5KSHA 4ZDXA 3IXGA 4OLDA 4CPKA 1MPLA 4WYYA 1JWPA 3ITAA 2XDMA 1ZG6A 3PBTA 1NRFA 4BENA 1S6RA 4OPZA 3W4QA 4KG2A 1JTDA 2X02A 1DJBA 3BFGA 4F94A 3FZCA 1PIOA 3NCKA 4GDNA 4KQQA 1IEMA 1SCWA 4OP5A 2ZQ9A 4HEFA 1MWUA 2QMIA 5FATA 1AXBA 5FDHA 5FI7A 3OPHA 4QJGA 3A3IA 2HP5A 3I7JA 2JBFA 1K55A 5EVIB 4X6TA 2ZLYA 2IWCA 3MXRA 2Q9NA 3ZVWA 4DE0A 3OPRA 2XF3A 4B88A 2ZM8A 4PM7A 2XGNA 3QNCA 1QMFA 2RL3A 4MEZA 2HDUA 2A3UA 3PBRA 1K6SA 3G2ZA 1ZG4A 3BECA 3GR2A 5CRFA 3MKFA 4RX3A 5CHJA 2EFXA 1WYBA 4QY5A 4FD8A 4CJNA 5HL1A 5HAQA 1L0DA 3VFFA 4DDSA 5KZHA 1XGIA 3P98A 1RCJA 2XR0A 2WKEA 1LI0A 3O88A 1EWZA 3IF6C 2H0YA 3C4OA 5CERA 2XEPA 1I2SA 1QMEA 1E25A 5DTKA 4E3LA 2RCXA 3Q7VB 2ZQDA 1K25A 3BLMA 2WGVA 4GNUA 1K54A 2HP9A 4PM5A 5KMWA 3W4PA 2WKHA 1BLHA 4QU3A 3HBRA 4S2PA 3VOYA 3FKVA 3N7WA 1KE3A 3FKWA 3NI9A 5CXWA 1GA9A 3RXXA 3HLFA 1GHMA 4BD1A 1KGEA 1TDLA 3OPPA 3TSGA 1KVMA 3HREA 4R3JA 4BJPA 1CEFA 1GA0A 5CEDA 1SDEA 2PBYA 1BLPA 5HX9A 1ES5A 2HDQA 1TDGA 2ZC3B 1YM1A 2Y55A 1KDSA 4GZBA 3WS1A 3ZFZA 1FOFA 4FH4A 3MKEA 4NK3A 2VGJA 5F82A 3SOIA 4DDYA 4KZ4A 2ZQCA 4QHCA 5D3OA 4U3TA 5GL9A 1W5DA 2OV5A 4N9LA 3C7VA 4OVDA 1ES4A 3NY4A 3HLWA 3AGDA 4WMCD 2Y4AA 2ZJ9A 2QPNA 3G4PA 1PZPA 4X55A 4Y0UA 5EVIC 3V3SA 5M18A 4JXGA 5FAOA 1MXOA 4DE2A 2V20A 2Z2MB 2WGWB 3A3FA 4GD6A 4ZJ1A 1ERQA 5A92A 2EXBA 4KG6A 1M40A 1MWSA 2B5RA 3IWQA 1DJAA 1BT5A 1PWCA 3LEZA 2XFTA 1K56D 3UPNA 1Q2PA 2ZC6B 3HLEA 4JKTA 5E43A 3IHAA 4NETA 1KGGA 3HLBA 2XD5A 5FQIA 4WZ5A 4PM6A 1J9MA 1LHYA 4OQGA 3GTCA 1IKGA 2FFFB 4OQ0A 2R9WA 2E8IA 1G68A 5DF9A 1H8ZA 3VMAA 3N4IA 3NC8A 3VP2A 1PI5A 3ZG0A 2I72A 2OSUA 4DE1A 4QY6A 3ITBA 5G18A 1E4DA 5EOEA 1K6RA 1U60A 3ZHHA 1KE4A 4ZAMA 4C6YA 4S2LA 2ZQ8A 3Q7ZA 4UAAA 3HVFA 1YLWA 1I2WA 5EVID 1XP4A 3UE1A 1E3UD 3BRMA 4ID4A 4WELA 3WWXA 3ZGAB 2JC7A 4PPRA 4ZTKA 3FWLA 3HLGA 5AQAA 1XA1A 2H0TA 2EX9A 1IYPA 2Y2KA 1Y54A 4Y0OA 1W8QA 2EX2A 5DVAA 3V3RA 3TOIA 4DKIA 5GHZA 2WGIA 2Y2NA 1ZC2A 4KENB 5GLAA 1ZKJA 3WS5A 5EECA 1K4EA 4OLGA 3ZDJA 3N6IA 4JF6A 4BLMA 2PU4A 1WE4A 1SDNA 3O3VA 3ZNYA 4YINA 4LENA 3HLCA 2X71A 3Q81A 4DE3A 2Y2GA 3CJMA 4WEJA 3SH9A 4BQMA 1YLTA 1H8YA 3LCEA 3MZDA 1JWVA 4K0XA 1LL5A 1ERMA 2ZQ7A 3OCNA 4GN2A 3DWKA 4Z9QA 4IBXA 3PBQA 2VGKA 3IF6A 4RX2A 2IWDA 4WMCA 2Q9MA 3BFCA 5A93A 3N8LA 4JXVA 4KZAA 2EX6A 3VP3A 4K91A 2Y2HA 3IXDA 2XH9A 3BFEA 4FH2A 4MLLA 4OH0A 4UA6A 4KZ8A 3GSGA 3UPOA 1XGJA 1K56A 3P09A 1FSYA 4EUZA 3E2KA 4M3KA 3HL9A 3OC2A 4O7DA 1S0WA 2C6WB 1ONGA 4ZBEA 2BG1A 2Y2QA 2ZMAA 3W4OA 4U0TA 3HUNA 3W8KA 1PI4A 3SH8A 3MXSA 3IF5A 4IVKA 4XUXA 5FQKA 1ESIA 3G2YA 2WZZA 1EI5A 4JF5A 1BSGA 3N8RA 2QZ6A 1PYYA 4MBFA 1Q2QA 3S1YA 4B4XA 3LO7A 5GLCA 1YQSA 5CTMA 4D2OA 3S4XA 4XUZA 3V50A 1I5QA 1MKIA 1O07A 4IVIA 4K0WA 5EVIA 1N9BA 1E3UA 2EXAA 2P9VB 4R3BA 5CGSA 1FCMA 1FR1A 4E3OA 2ZM0A 4JF4A 2IWBA 4EBLA 2WZXA 4S2KA 3HUOA 1BTLA 1BUEA 3BYDA 3Q07A 3C5AA 5F1FA 1NZUA 3GV9A 2A49A 3HUMA 4UA9A 4DXBA 5EVLA 3ZCZA 1FSWA 4RA7A 4OOLA 4XXRA 1N4OA 5HFOA 3AGEA 4LV1A 1XKZA 1LLBA 4EBNA 2ZC4B 3ISGA 3RXWA 1RGZA 4PM8A 3E2LA 1WYCA 3VP1A 3IHBA 4LCMA 3V5MA 1ES2A 4E3JA 3GRJA 2EFUA 4N9KA 1IKIA 1DY6A 3WS2A 2FFYA 4MBHA 3Q7VA 1ALQA 1LL9A 2WYXA 3MBZA 4L0LA 4IBRA 4JLFA 5EE8A 5TR7A 3ZNTA 1TVFA 2HDRA 3ZG8B 5HAPA 1XA7A 3PBSA 4JXSA 3ZVTA 3IWIA 1YMXA 1FCOA 3VSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BL2 A;  1IYS A;  4JXW A;  4RYE A;  4DF6 A;  1ERO A;  4GKU A;  4GD8 A;  1DJC A;  3IT9 A;  3VFH A;  4DRT A;  3QHY A;  4N92 A;  3WS0 A;  1RGY A;  1K57 C;  3LY4 A;  2XFS A;  2GDN A;  3O86 A;  4R1G A;  1YLP A;  1NJ4 A;  1KE0 A;  4N1H A;  5CEB A;  1FCN A;  1YLJ A;  3ZG5 A;  1HTZ A;  1NYM A;  5AQB A;  5M19 A;  3WRT A;  3BLS A;  4JPM A;  2HP6 A;  3NDG A;  1IYO A;  1MWT A;  5F83 A;  4KZ7 A;  1Z6F A;  4JBF A;  5GHY A;  4X53 A;  3UN7 A;  5AQ9 A;  1H5X A;  2WGW A;  2ZC7 A;  3M6H A;  2PU2 A;  3AGF A;  4WEK A;  1K38 A;  2HPB A;  2WUQ A;  5DTT A;  5FQM A;  3BEB A;  2EX8 A;  4P85 A;  3S22 A;  1PW1 A;  4C3Q A;  4EQI A;  3OPL A;  4WM9 A;  1KGF A;  1IEL A;  4OKP A;  3C7U A;  5GLD A;  3EQV A;  2Y2M A;  1HZO A;  3O87 A;  3V39 A;  2P74 A;  1FQG A;  1JTG A;  3HLD A;  3DWZ A;  5DF7 A;  5CGW A;  3G34 A;  2J7V A;  3FV7 A;  2XK1 A;  3JYI A;  4OQI A;  5FA7 A;  1FR6 A;  5FAS A;  5BOH A;  3CMZ A;  4EV4 A;  4PM9 A;  3CZD A;  3NIA A;  5M1A A;  2ZQA A;  4U0X A;  5GLB A;  5HAI A;  5TGF A;  3N8S A;  4EWF A;  4S2J A;  4IED A;  3UNW A;  3UDX A;  2JE5 A;  3PTE A;  4HES A;  4R4S A;  4E3I A;  3SH7 A;  4WBG A;  3VOZ A;  1W79 A;  5CEC A;  2V2F F;  3A3E A;  1PWG A;  3VSK A;  5CHU A;  3G30 A;  3NDE A;  3DTM A;  4S2M A;  5L2F A;  1LI9 A;  5I94 A;  1KDW A;  1YLZ A;  1CI8 A;  4WZ4 A;  5KSC A;  5GHX A;  4LCL A;  4GOG A;  1CI9 A;  1VM1 A;  2XQZ A;  3TG9 A;  5J8X A;  4ZJ3 A;  3ZG9 B;  4Y7P A;  1HVB A;  3GVB A;  3MFD A;  2DNS A;  1GCE A;  2H10 A;  1NZO A;  2WKI A;  1BZA A;  2H5S A;  2Y91 A;  4S2I A;  1L2S A;  2UWX A;  5AQ7 A;  3UE0 A;  3WS4 A;  3UE3 A;  1M6K A;  3VP0 A;  4KZ3 A;  5A91 A;  4E6W A;  1CEG A;  3PAG A;  1MWR A;  4Q8I A;  5FAQ A;  1PWD A;  3IXB A;  2ZD8 A;  5IHV A;  2ZM2 A;  4P6B A;  5TFQ A;  1NY0 A;  5FQQ A;  1C3B A;  2WAF A;  5FI6 A;  2OLV A;  4HBT A;  2J9O A;  4S2O A;  2Z2L B;  4X68 A;  1PZO A;  3EQU A;  3M2K A;  2G2W A;  2JCH A;  4HBU A;  3BM6 A;  1IYQ A;  4P87 A;  2ZC5 B;  4S2N A;  5DTS A;  5FAP A;  4MNR A;  5U47 A;  3IWO A;  1GHP A;  2Y59 A;  4QD4 A;  4E3K A;  1L0E A;  4R4R A;  4Y0T A;  1K55 C;  5F1G A;  1O7E A;  3FYZ A;  1YT4 A;  4LV0 A;  1K57 A;  4OON A;  4YFM A;  1JWZ A;  4BD0 A;  2XD1 A;  4UHU A;  4LV3 A;  3A3J A;  4OQH A;  3PBO A;  4OOM A;  1BLS A;  4KQR A;  5E2F A;  5EOO A;  3SS3 A;  3GQZ A;  3M6B A;  2CC1 A;  3PAE A;  5FSR A;  5JYO A;  1NXY A;  4OOY A;  1KVL A;  5EPH A;  4E6X A;  1ONH A;  3WRZ A;  4OPQ A;  1XPB A;  5FQ9 A;  2P9V A;  1VQQ A;  1SKF A;  2DCF A;  4FSF A;  4KZB A;  4QB8 A;  1GHI A;  3MZE A;  3NBL A;  4FCF A;  3G32 A;  4S2N C;  1NYY A;  1W7F A;  1MBL A;  1MY8 A;  2BLS A;  5A90 A;  4B4Z A;  2Y2L A;  4R0Q A;  5HAR A;  4DXC A;  3ZG7 B;  1HD8 A;  3M2J A;  3G31 A;  3UDI A;  2Y2J A;  3SS5 A;  1XX2 A;  1ESU A;  3LY3 A;  3Q82 A;  1CK3 A;  1YLY A;  3UDF A;  1L0G A;  4C75 A;  4EBP A;  1JVJ A;  1TEM A;  4OP8 A;  4LV2 A;  1K54 C;  4PMA A;  3CG5 A;  4MBK A;  4E3N A;  3UO9 A;  4RVA A;  2J9P A;  4KZ9 A;  3B3X A;  1PW8 A;  4E3M A;  3IXH A;  4KZ6 A;  5CGX A;  3OCL A;  3QNB A;  2J8Y A;  5DF8 A;  2X01 A;  4OPR A;  2G2U A;  4X56 A;  5JYP A;  3D4F A;  4UA7 A;  2HDS A;  2C5W B;  2DRW A;  4GB7 A;  2XLN A;  1BUL A;  1W8Y A;  4H8R A;  2Y2I A;  3SS4 A;  1G6A A;  4KZ5 A;  5CTN A;  4X69 A;  5FI2 A;  3IH9 A;  3A3D A;  3DW0 A;  1K4F A;  3OZH A;  3RJU A;  5HW3 A;  5E2G A;  5E2H A;  3VP4 A;  2WAE A;  4N1X A;  3UPP A;  1ES3 A;  1XXM A;  3PBN A;  3MZF A;  3BFD A;  3IF6 B;  1L0F A;  2R9X A;  3C4P A;  2WK0 A;  3G35 A;  5CHM A;  4KQO A;  2WAD A;  3IQA A;  5EUA A;  4GDB A;  3Q1F A;  4BL3 A;  1BLC A;  1RP5 A;  5E2E A;  2Y2O A;  3BFF A;  1YMS A;  5FQJ A;  3GMW A;  2Y2P A;  3UY6 A;  2V1Z A;  1SHV A;  4KG5 A;  4P0M A;  4A5R A;  1OME A;  4WZ5 C;  4ZJ2 A;  2OLU A;  3IH8 A;  4OPY A;  4R23 A;  5KSH A;  4ZDX A;  3IXG A;  4OLD A;  4CPK A;  1MPL A;  4WYY A;  1JWP A;  3ITA A;  2XDM A;  1ZG6 A;  3PBT A;  1NRF A;  4BEN A;  1S6R A;  4OPZ A;  3W4Q A;  4KG2 A;  1JTD A;  2X02 A;  1DJB A;  3BFG A;  4F94 A;  3FZC A;  1PIO A;  3NCK A;  4GDN A;  4KQQ A;  1IEM A;  1SCW A;  4OP5 A;  2ZQ9 A;  4HEF A;  1MWU A;  2QMI A;  5FAT A;  1AXB A;  5FDH A;  5FI7 A;  3OPH A;  4QJG A;  3A3I A;  2HP5 A;  3I7J A;  2JBF A;  1K55 A;  5EVI B;  4X6T A;  2ZLY A;  2IWC A;  3MXR A;  2Q9N A;  3ZVW A;  4DE0 A;  3OPR A;  2XF3 A;  4B88 A;  2ZM8 A;  4PM7 A;  2XGN A;  3QNC A;  1QMF A;  2RL3 A;  4MEZ A;  2HDU A;  2A3U A;  3PBR A;  1K6S A;  3G2Z A;  1ZG4 A;  3BEC A;  3GR2 A;  5CRF A;  3MKF A;  4RX3 A;  5CHJ A;  2EFX A;  1WYB A;  4QY5 A;  4FD8 A;  4CJN A;  5HL1 A;  5HAQ A;  1L0D A;  3VFF A;  4DDS A;  5KZH A;  1XGI A;  3P98 A;  1RCJ A;  2XR0 A;  2WKE A;  1LI0 A;  3O88 A;  1EWZ A;  3IF6 C;  2H0Y A;  3C4O A;  5CER A;  2XEP A;  1I2S A;  1QME A;  1E25 A;  5DTK A;  4E3L A;  2RCX A;  3Q7V B;  2ZQD A;  1K25 A;  3BLM A;  2WGV A;  4GNU A;  1K54 A;  2HP9 A;  4PM5 A;  5KMW A;  3W4P A;  2WKH A;  1BLH A;  4QU3 A;  3HBR A;  4S2P A;  3VOY A;  3FKV A;  3N7W A;  1KE3 A;  3FKW A;  3NI9 A;  5CXW A;  1GA9 A;  3RXX A;  3HLF A;  1GHM A;  4BD1 A;  1KGE A;  1TDL A;  3OPP A;  3TSG A;  1KVM A;  3HRE A;  4R3J A;  4BJP A;  1CEF A;  1GA0 A;  5CED A;  1SDE A;  2PBY A;  1BLP A;  5HX9 A;  1ES5 A;  2HDQ A;  1TDG A;  2ZC3 B;  1YM1 A;  2Y55 A;  1KDS A;  4GZB A;  3WS1 A;  3ZFZ A;  1FOF A;  4FH4 A;  3MKE A;  4NK3 A;  2VGJ A;  5F82 A;  3SOI A;  4DDY A;  4KZ4 A;  2ZQC A;  4QHC A;  5D3O A;  4U3T A;  5GL9 A;  1W5D A;  2OV5 A;  4N9L A;  3C7V A;  4OVD A;  1ES4 A;  3NY4 A;  3HLW A;  3AGD A;  4WMC D;  2Y4A A;  2ZJ9 A;  2QPN A;  3G4P A;  1PZP A;  4X55 A;  4Y0U A;  5EVI C;  3V3S A;  5M18 A;  4JXG A;  5FAO A;  1MXO A;  4DE2 A;  2V20 A;  2Z2M B;  2WGW B;  3A3F A;  4GD6 A;  4ZJ1 A;  1ERQ A;  5A92 A;  2EXB A;  4KG6 A;  1M40 A;  1MWS A;  2B5R A;  3IWQ A;  1DJA A;  1BT5 A;  1PWC A;  3LEZ A;  2XFT A;  1K56 D;  3UPN A;  1Q2P A;  2ZC6 B;  3HLE A;  4JKT A;  5E43 A;  3IHA A;  4NET A;  1KGG A;  3HLB A;  2XD5 A;  5FQI A;  4WZ5 A;  4PM6 A;  1J9M A;  1LHY A;  4OQG A;  3GTC A;  1IKG A;  2FFF B;  4OQ0 A;  2R9W A;  2E8I A;  1G68 A;  5DF9 A;  1H8Z A;  3VMA A;  3N4I A;  3NC8 A;  3VP2 A;  1PI5 A;  3ZG0 A;  2I72 A;  2OSU A;  4DE1 A;  4QY6 A;  3ITB A;  5G18 A;  1E4D A;  5EOE A;  1K6R A;  1U60 A;  3ZHH A;  1KE4 A;  4ZAM A;  4C6Y A;  4S2L A;  2ZQ8 A;  3Q7Z A;  4UAA A;  3HVF A;  1YLW A;  1I2W A;  5EVI D;  1XP4 A;  3UE1 A;  1E3U D;  3BRM A;  4ID4 A;  4WEL A;  3WWX A;  3ZGA B;  2JC7 A;  4PPR A;  4ZTK A;  3FWL A;  3HLG A;  5AQA A;  1XA1 A;  2H0T A;  2EX9 A;  1IYP A;  2Y2K A;  1Y54 A;  4Y0O A;  1W8Q A;  2EX2 A;  5DVA A;  3V3R A;  3TOI A;  4DKI A;  5GHZ A;  2WGI A;  2Y2N A;  1ZC2 A;  4KEN B;  5GLA A;  1ZKJ A;  3WS5 A;  5EEC A;  1K4E A;  4OLG A;  3ZDJ A;  3N6I A;  4JF6 A;  4BLM A;  2PU4 A;  1WE4 A;  1SDN A;  3O3V A;  3ZNY A;  4YIN A;  4LEN A;  3HLC A;  2X71 A;  3Q81 A;  4DE3 A;  2Y2G A;  3CJM A;  4WEJ A;  3SH9 A;  4BQM A;  1YLT A;  1H8Y A;  3LCE A;  3MZD A;  1JWV A;  4K0X A;  1LL5 A;  1ERM A;  2ZQ7 A;  3OCN A;  4GN2 A;  3DWK A;  4Z9Q A;  4IBX A;  3PBQ A;  2VGK A;  3IF6 A;  4RX2 A;  2IWD A;  4WMC A;  2Q9M A;  3BFC A;  5A93 A;  3N8L A;  4JXV A;  4KZA A;  2EX6 A;  3VP3 A;  4K91 A;  2Y2H A;  3IXD A;  2XH9 A;  3BFE A;  4FH2 A;  4MLL A;  4OH0 A;  4UA6 A;  4KZ8 A;  3GSG A;  3UPO A;  1XGJ A;  1K56 A;  3P09 A;  1FSY A;  4EUZ A;  3E2K A;  4M3K A;  3HL9 A;  3OC2 A;  4O7D A;  1S0W A;  2C6W B;  1ONG A;  4ZBE A;  2BG1 A;  2Y2Q A;  2ZMA A;  3W4O A;  4U0T A;  3HUN A;  3W8K A;  1PI4 A;  3SH8 A;  3MXS A;  3IF5 A;  4IVK A;  4XUX A;  5FQK A;  1ESI A;  3G2Y A;  2WZZ A;  1EI5 A;  4JF5 A;  1BSG A;  3N8R A;  2QZ6 A;  1PYY A;  4MBF A;  1Q2Q A;  3S1Y A;  4B4X A;  3LO7 A;  5GLC A;  1YQS A;  5CTM A;  4D2O A;  3S4X A;  4XUZ A;  3V50 A;  1I5Q A;  1MKI A;  1O07 A;  4IVI A;  4K0W A;  5EVI A;  1N9B A;  1E3U A;  2EXA A;  2P9V B;  4R3B A;  5CGS A;  1FCM A;  1FR1 A;  4E3O A;  2ZM0 A;  4JF4 A;  2IWB A;  4EBL A;  2WZX A;  4S2K A;  3HUO A;  1BTL A;  1BUE A;  3BYD A;  3Q07 A;  3C5A A;  5F1F A;  1NZU A;  3GV9 A;  2A49 A;  3HUM A;  4UA9 A;  4DXB A;  5EVL A;  3ZCZ A;  1FSW A;  4RA7 A;  4OOL A;  4XXR A;  1N4O A;  5HFO A;  3AGE A;  4LV1 A;  1XKZ A;  1LLB A;  4EBN A;  2ZC4 B;  3ISG A;  3RXW A;  1RGZ A;  4PM8 A;  3E2L A;  1WYC A;  3VP1 A;  3IHB A;  4LCM A;  3V5M A;  1ES2 A;  4E3J A;  3GRJ A;  2EFU A;  4N9K A;  1IKI A;  1DY6 A;  3WS2 A;  2FFY A;  4MBH A;  3Q7V A;  1ALQ A;  1LL9 A;  2WYX A;  3MBZ A;  4L0L A;  4IBR A;  4JLF A;  5EE8 A;  5TR7 A;  3ZNT A;  1TVF A;  2HDR A;  3ZG8 B;  5HAP A;  1XA7 A;  3PBS A;  4JXS A;  3ZVT A;  3IWI A;  1YMX A;  1FCO A;  3VSL A; 
#chains in the Genus database with same CATH topology
 4RYE A;  1ERO A;  3IT9 A;  3VFH A;  4R38 A;  3WS0 A;  1YLP A;  5FEG A;  1GSX A;  1FCN A;  1HTZ A;  3BLS A;  1MWT A;  5F83 A;  1BYW A;  4JBF A;  1XJ2 A;  4CQH A;  2JKF A;  4WEK A;  3LGO A;  1OJG A;  1JNU A;  2WUQ A;  5DTT A;  3BEB A;  4KQD A;  5F6A A;  1IEL A;  1HZO A;  5TBM A;  2P74 A;  3DWZ A;  5CGW A;  3G34 A;  1FR6 A;  4EV4 A;  2VV7 A;  5HAI A;  1HLU P;  3UNW A;  1VEU A;  4F3L B;  4E3I A;  3SH7 A;  3SW1 A;  5CHU A;  3G30 A;  3NDE A;  1LI9 A;  3T12 B;  1YLZ A;  1CI8 A;  4I3J A;  5J8X A;  4EQ1 A;  3UB9 A;  3GVB A;  3MFD A;  3MR0 A;  3TJZ C;  1L2S A;  5A8B A;  1M6K A;  3PR6 A;  5HD5 A;  4E6W A;  1CEG A;  1MWR A;  3IXB A;  2QKP A;  2ZD8 A;  5L09 A;  5F68 A;  1DP6 A;  4PKY G;  1C3B A;  2WAF A;  3S7O A;  4E04 A;  2JKT I;  5DJT A;  4S2N A;  2ZC5 B;  5DTS A;  2WKP A;  5HWT A;  4E3K A;  2B18 A;  2W1T A;  2XA7 M;  1YT4 A;  2PRF A;  5L07 A;  4LV3 A;  4OOM A;  1BLS A;  3EOI A;  2PDR A;  3EEA A;  3SS3 A;  3GQZ A;  3LI9 A;  2CC1 A;  3PAE A;  5FSR A;  1GSW A;  2KX6 A;  3DTE A;  4PHT A;  3G32 A;  2BLS A;  5DFY A;  1IFQ A;  3EWK A;  5HAR A;  4Q0H A;  5HD3 A;  2Y2J A;  1ESU A;  3UDF A;  4EBP A;  1JVJ A;  1TEM A;  4LV2 A;  4ESP A;  3ICY A;  4RVA A;  4KZ9 A;  3B3X A;  3MQ0 A;  3OCL A;  4EU0 A;  2J8Y A;  5DF8 A;  1IOU A;  4JGP A;  4X56 A;  2HDS A;  2YKH A;  1G6A A;  2V1B A;  5FI2 A;  4L9G A;  3IH9 A;  4IHQ A;  1OTB A;  3OZH A;  4KUO A;  5E2H A;  1VET A;  1ES3 A;  3PBN A;  4R3A A;  3MZF A;  5FL3 A;  3IF6 B;  2R9X A;  4MN7 A;  2WAD A;  3Q1F A;  2Y2O A;  3BFF A;  1KOU A;  2HJ9 C;  2VJW A;  3MXQ A;  4A5R A;  4WZ5 C;  5KSH A;  4IUH A;  4OLD A;  1MPL A;  4WYY A;  1S6R A;  5G4Z A;  4KQQ A;  2ZQ9 A;  5FDH A;  5FI7 A;  3PYP A;  2HP5 A;  4LPZ A;  2VX8 A;  3ZVW A;  4DE0 A;  3OPR A;  2ZM8 A;  4YOF A;  4HY8 A;  2RL3 A;  3GR2 A;  4F3L A;  5CHJ A;  1WYB A;  2GZA A;  5HL1 A;  5HAQ A;  1XGI A;  1RCJ A;  1Y4O A;  2XR0 A;  1LI0 A;  2VV8 A;  1EWZ A;  3IF6 C;  1PFL A;  2NUT C;  2XEP A;  1I2S A;  5DTK A;  1V9Y A;  2WGV A;  3W4P A;  5EVE A;  1BLH A;  3N7W A;  3ZCZ A;  5CXW A;  3FKW A;  1TS6 A;  2D02 A;  2VA0 A;  4BJP A;  1CEF A;  3UB7 A;  5F5Y A;  1ES5 A;  2HDQ A;  1TDG A;  1KDS A;  3IX8 A;  3QP6 A;  4QHC A;  3TRC A;  3C7V A;  1ES4 A;  2W3G A;  3AGD A;  4WMC D;  4ARZ A;  2HF6 A;  5FAO A;  2WGW B;  3LID A;  4CLC B;  3CLO A;  4ZJ1 A;  2EXB A;  2B5R A;  3E4Q A;  4AFI A;  1BT5 A;  1PWC A;  1K56 D;  4Y15 A;  4JKT A;  3ZQ5 A;  4NET A;  4WZ5 A;  3T4J A;  3DBA A;  1J9M A;  2K31 A;  4OQG A;  5HSQ A;  2VV6 A;  2R9W A;  2E8I A;  5DF9 A;  2EWV A;  4DE1 A;  4QY6 A;  3ITB A;  3O5Y A;  5EOE A;  4ZAM A;  4S2L A;  3Q7Z A;  2QHK A;  5EVI D;  3UE1 A;  1E3U D;  4ID4 A;  3WWX A;  2JC7 A;  4JGQ A;  3FWL A;  3EGD C;  2H0T A;  4CPK A;  1IYP A;  3LR0 A;  2EX2 A;  4DKI A;  3QP4 A;  3F1N B;  5GHZ A;  2Y2N A;  4KEN B;  3ULF A;  3LR3 A;  1SDN A;  4HH2 A;  3Q81 A;  4DE3 A;  4BQM A;  4K08 A;  3BQA A;  1ERM A;  2ZQ7 A;  3OCN A;  3PBQ A;  3IF6 A;  4Y17 A;  2IWD A;  1OTD A;  4CLC C;  3U2A A;  3SZT A;  4NKP A;  3VP3 A;  3IX4 A;  5EM0 A;  2XH9 A;  3BFE A;  3VV4 A;  5AJG A;  1XGJ A;  1FSY A;  2FZ0 A;  4M3K A;  4O7D A;  2BG1 A;  2Y2Q A;  3BY8 A;  5L8M A;  3SH8 A;  4GLQ A;  2W27 A;  1ESI A;  1EI5 A;  1T1B A;  4JF5 A;  4CLC E;  4MBF A;  1Q2Q A;  2J3W A;  3V50 A;  4K0W A;  2PAV P;  1N9B A;  1FR1 A;  2IWB A;  2WZX A;  1ACF A;  2P04 A;  1CQA A;  3C5A A;  4UA9 A;  4DXB A;  4RA7 A;  4XXR A;  4P6Z M;  4LV1 A;  3ISG A;  4PM8 A;  2V9A A;  3EGX C;  3JVV A;  3T4S A;  4EW7 A;  2VK3 A;  4N9K A;  4GW9 A;  3WS2 A;  2FFY A;  4HQA A;  1G6O A;  2OAP 1;  1TS8 A;  5TR7 A;  4JLF A;  2XRO A;  1TVF A;  5HAP A;  1XA7 A;  3PBS A;  4JXS A;  5EFW A;  1OT6 A;  4GD8 A;  1T1C A;  3LIF A;  4DRT A;  2A2L A;  5TBM B;  3HJK A;  1NRJ A;  2XFS A;  1NJ4 A;  4LRZ E;  1KE0 A;  1CF0 A;  5CEB A;  1S4S A;  1YLJ A;  2LB5 A;  3KX0 X;  5M19 A;  4JPM A;  2HP6 A;  1IYO A;  5GHY A;  2WGW A;  3IBR A;  1AWI A;  1VEU B;  1K38 A;  3S22 A;  4C3Q A;  4EQI A;  1DRM A;  4OKP A;  3C7U A;  3EQV A;  2Y2M A;  3O87 A;  1JTG A;  5DJU A;  2Z6D A;  3R7W A;  2MJ6 A;  2PBD P;  2J7V A;  3FV7 A;  2XK1 A;  2UV0 E;  5BOH A;  3B47 A;  3CZD A;  3IBJ A;  5M1A A;  2OWJ A;  4U0X A;  5GLB A;  5TGF A;  2HZ5 A;  4IED A;  3PTE A;  4HES A;  2ZOH A;  4WBG A;  3VOZ A;  1W79 A;  1PWG A;  5L2F A;  5AVE A;  3R4K A;  5KSC A;  3H82 B;  4GOG A;  1VM1 A;  2XQZ A;  4HJ3 A;  4Y7P A;  1HVB A;  2XSS A;  5C5K A;  4HJ6 A;  2DNS A;  2H5S A;  4S2I A;  1PNE A;  3VP0 A;  4KZ3 A;  5A91 A;  4R70 A;  2QWS A;  3F1O B;  5K5B A;  3E0Y A;  4S2O A;  1PZO A;  2G2W A;  3OLO A;  4MNR A;  3IWO A;  2Y59 A;  4R4R A;  4Y0T A;  2CMN A;  3FYZ A;  4BD0 A;  1V9Z A;  4BMW A;  5E2F A;  3B42 A;  1FIK A;  4OOY A;  5DKK A;  5EPH A;  5FQ9 A;  1D7E A;  1SKF A;  4QB8 A;  3UMD A;  2QJ7 A;  4S2N C;  1NYY A;  4B4Z A;  1VET B;  3M2J A;  3UDI A;  2W1R A;  3Q82 A;  4C75 A;  1L0G A;  3C38 A;  4OP8 A;  2V8C A;  2M7V A;  4PMA A;  1K54 C;  3T1Q B;  4E3N A;  1S1Z A;  2J9P A;  4E3M A;  3T4K A;  5CGX A;  4HNB A;  2X01 A;  3VOL A;  4UQI S;  3P7N A;  5JYP A;  3D4F A;  1P97 A;  2M7U A;  3MQO A;  1OTE A;  4X69 A;  3CWF A;  1NLZ A;  4O01 A;  5HW3 A;  3VP4 A;  3LIE A;  1P0Z A;  3QP8 A;  2ZL1 A;  1L0F A;  2WK0 A;  4KQO A;  4GDB A;  3JPU A;  5J3W A;  5FQJ A;  3GMW A;  2Y2P A;  3UY6 A;  4GS9 A;  4P0M A;  4ZJ2 A;  2OLU A;  3IH8 A;  4OPY A;  4R23 A;  3IXG A;  1DP8 A;  3PBT A;  2EWW A;  4OPZ A;  3OBF A;  3FZC A;  3A0R A;  3NCK A;  4GDN A;  1IEM A;  1SCW A;  1MWU A;  2QMI A;  3NOU C;  3A3I A;  5EVI B;  3LUQ A;  4LFU A;  3MXR A;  3NJA A;  2XF3 A;  4B88 A;  4PM7 A;  3QNC A;  5G4Y A;  5MC7 A;  4MEZ A;  3RFB A;  5HPF A;  2KOI A;  4RX3 A;  3NOT C;  2W0N A;  1TD5 A;  4FD8 A;  3TW8 A;  1L0D A;  3VFF A;  4DDS A;  2JHE A;  5KZH A;  3H82 A;  3P98 A;  3FG8 A;  2J3T C;  2H0Y A;  1MKM A;  1QME A;  4ARZ B;  3OOV A;  2ZQD A;  1K25 A;  3BLM A;  1K54 A;  5KMW A;  2WKH A;  3FKV A;  3NI9 A;  3CUE C;  4BD1 A;  3F1O A;  1GA9 A;  3HLF A;  3K3D A;  3OPP A;  3TSG A;  4R3J A;  1GA0 A;  1PRQ A;  4X1M A;  3WS1 A;  2ZC3 B;  4GZB A;  2Y55 A;  3E4P A;  4I38 A;  4I39 A;  4KZ4 A;  4N9L A;  4OVD A;  3MJQ A;  3NY4 A;  4Y0U A;  2Y4A A;  2ZJ9 A;  2QPN A;  3G4P A;  1PZP A;  5EVI C;  2VLG A;  1MXO A;  3UPN A;  3LEZ A;  2XFT A;  5IU1 A;  5FQI A;  4Y5F A;  2PYR A;  2PR5 A;  3GTC A;  1IKG A;  1H8Z A;  4IUK A;  2HGV A;  1F2K A;  3VMA A;  3N4I A;  3ZG0 A;  2I72 A;  2OSU A;  5G18 A;  2HJE A;  1K6R A;  2W3H A;  1YLW A;  3CIT A;  3ZGA B;  4I3I A;  1LT0 A;  4PPR A;  4Y0O A;  1T19 A;  1ZKJ A;  4OLG A;  1LSV A;  3N6I A;  4JF6 A;  2PU4 A;  1WE4 A;  3O3V A;  4LGW A;  4LEN A;  3CJM A;  3SH9 A;  5HPI A;  4K0X A;  1SKO B;  4PAU A;  4GN2 A;  4NXG A;  3S7P A;  3DWK A;  4Z9Q A;  4WMC A;  2Q9M A;  3BFC A;  5A93 A;  2G7U A;  2JN7 A;  4K91 A;  3CHW P;  2Y2H A;  4KZ8 A;  3GSG A;  1K56 A;  4EUZ A;  4DN0 A;  3CUE A;  4ZBE A;  1S0W A;  2VKS A;  2J80 A;  3W4O A;  5KIZ A;  4MN6 A;  3IF5 A;  4IVK A;  4MN5 A;  3G2Y A;  2NUP C;  1OTI A;  2QZ6 A;  3HCY A;  1K0K A;  5GLC A;  4D2O A;  3S4X A;  3KO6 A;  4XUZ A;  1O07 A;  1MKI A;  5EVI A;  1E3U A;  2EXA A;  5CGS A;  3RH8 B;  4JF4 A;  3KSF A;  3HUO A;  3RTY A;  1OJ5 A;  5F1F A;  3GV9 A;  1UGU A;  5HFO A;  3AGE A;  2K2N A;  1LLB A;  4EBN A;  1RGZ A;  3E2L A;  1WYC A;  2I9V A;  1S1Y A;  4LCM A;  4HH3 A;  3V5M A;  1N9O A;  2EFU A;  1IKI A;  1N9N A;  1LL9 A;  2WYX A;  5EE8 A;  3ZNT A;  2PHY A;  3A0S A;  4M4X A;  3IWI A;  3T4L A;  5CHM A;  4EUV A;  5A92 A;  3F1P B;  1DJC A;  2ZMV A;  3QHY A;  1LL8 A;  1RGY A;  3R7W B;  4R1G A;  1S67 L;  3A0V A;  4YWZ A;  4N1H A;  1LSX A;  3BY9 A;  4Y3I A;  4Y13 A;  3NDG A;  5HDS A;  4KZ7 A;  1Z6F A;  1OTA A;  3LFV A;  2ZC7 A;  2E8J A;  3M6H A;  2PU2 A;  5FQM A;  4UEY A;  4P85 A;  4ZRR A;  4WM9 A;  4BBV A;  3UB5 P;  3NUL A;  5GLD A;  1YKD A;  3V39 A;  5DF7 A;  3CPT B;  3JYI A;  3CAX A;  4OQI A;  4MCW A;  5TJJ A;  4PM9 A;  5L10 A;  2ZQA A;  2ZMF A;  4EWF A;  3N8S A;  4S2J A;  5HZH A;  3A3E A;  3VSK A;  1A0K A;  5I5L A;  5I94 A;  4L9F A;  4WZ4 A;  5GHX A;  2VGL M;  4HJ4 A;  2GNX A;  4LRY C;  1FIL A;  3C2W A;  1GCE A;  2H10 A;  2WKI A;  4O0P A;  2Y91 A;  2UWX A;  1SKO A;  3UE3 A;  4QPR A;  1T18 A;  4Q8I A;  2VZW A;  2V1A A;  4P6B A;  5TFQ A;  1NY0 A;  5FQQ A;  5FI6 A;  2OLV A;  1GSV A;  4HBT A;  2J9O A;  4X68 A;  2Z2L B;  2O9B A;  4HBU A;  3NHQ A;  3BM6 A;  4P87 A;  5FAP A;  4HI4 A;  4EET B;  3S7Q A;  2P7J A;  4QD4 A;  1L0E A;  4LV0 A;  4OON A;  1DP9 A;  2GJ3 A;  4KQR A;  5EOO A;  5HDC A;  5JYO A;  4MMN A;  1NXY A;  1KVL A;  3WRZ A;  4JGR A;  4OPQ A;  1VQQ A;  4FSF A;  4KZB A;  1D06 A;  1GHI A;  3NBL A;  4FCF A;  1W7F A;  1MY8 A;  3B33 A;  3P01 A;  4DXC A;  3KSG A;  1HD8 A;  3G31 A;  3SS5 A;  3LY3 A;  3PXP A;  1TF1 A;  2ZL1 B;  4R6L A;  3DTK A;  4MBK A;  3UO9 A;  2A24 A;  1PW8 A;  3IXH A;  3QNB A;  4GS9 B;  1ZTU A;  4UA7 A;  2C5W B;  2DRW A;  4GB7 A;  2XLN A;  1BUL A;  1ZHH B;  2Y2I A;  3SS4 A;  5CTN A;  3A3D A;  3F1P A;  1K4F A;  3RJU A;  1MC0 A;  5CX7 A;  1XXM A;  1NWZ A;  2PR6 A;  1YPR A;  3BFD A;  2KLI A;  3IS2 B;  5HDD A;  3G35 A;  5EUA A;  1BLC A;  3GEC A;  2V1Z A;  4EEP A;  4ZDX A;  3KSH A;  2JKR I;  2K7S A;  3ITA A;  2XDM A;  4BEN A;  1G28 A;  3LYX A;  3W4Q A;  2X02 A;  4P6Z S;  5FDS A;  5FAT A;  1AXB A;  3CPT A;  2JBF A;  2WKR A;  4EXO A;  1XJ6 A;  2ZLY A;  1NLY A;  3D9Y A;  2Q9N A;  3GDI A;  2XGN A;  3LIA A;  3C8C A;  2A3U A;  3PBR A;  1K6S A;  4XT2 A;  1ZG4 A;  5CRF A;  3MKF A;  2VEA A;  2EFX A;  2XRN A;  3VE3 A;  2ZBB A;  2P08 A;  1CJF A;  4HOI A;  5CER A;  2HV1 A;  1E25 A;  4NXE A;  3Q7V B;  2HP9 A;  2IA2 A;  2L0W A;  1X0O A;  1KVM A;  1P9R A;  2M1C A;  4EER A;  2PBY A;  5F69 A;  3ZFZ A;  1EW0 A;  3MKE A;  4WN5 A;  4NK3 A;  2ZQC A;  5D3O A;  5GL9 A;  2O9C A;  2OV5 A;  3H9W A;  5M18 A;  2ZOI A;  4JXG A;  4DE2 A;  3A3F A;  4GD6 A;  1ERQ A;  2Y8H A;  4Y2F A;  1N9L A;  4KG6 A;  3JVU A;  1DJA A;  1Q2P A;  2ZC6 B;  5E43 A;  3U4L P;  3HLB A;  4PM6 A;  2INW A;  4B9O A;  1G68 A;  3NC8 A;  4IJG A;  3MSH A;  2BTF P;  4DMZ A;  1U60 A;  1KE4 A;  2ZQ8 A;  4UAA A;  3HVF A;  1XP4 A;  3BRM A;  4WEL A;  3UE6 A;  2PYP A;  3HJI A;  3HLG A;  5AQA A;  5HWW A;  2B95 A;  1Y54 A;  3V3R A;  5DVA A;  3V67 A;  4NXB A;  4FUW A;  2WGI A;  1ZC2 A;  3WS5 A;  5EEC A;  4BLM A;  3DAV A;  1VB6 A;  1L3L A;  3K3C A;  3K2N A;  4NG2 A;  2Y2G A;  2Z6C A;  4WEJ A;  1YLT A;  3MZD A;  1W63 Q;  3BQ8 A;  1LL5 A;  1J3W A;  1H8M A;  3IS2 A;  3LR4 A;  4RX2 A;  4DJ3 A;  4JXV A;  4KZA A;  3MQQ A;  1TS7 A;  2GX5 A;  4MLL A;  4OH0 A;  3UPO A;  3P09 A;  3E2K A;  2C6W B;  2ZMA A;  1YSP A;  4XUX A;  2WZZ A;  1BSG A;  3N8R A;  1PYY A;  3S1Y A;  2WKQ A;  5EV0 A;  1YQS A;  5CTM A;  3LIB A;  3T1S A;  4R3B A;  2P9V B;  3KYE A;  1H0M A;  2O9A A;  1BTL A;  1BUE A;  3BYD A;  1NZU A;  2L4R A;  5HWV A;  2A49 A;  3E4O A;  1FSW A;  4OOL A;  3E98 A;  2PT7 A;  4HIA A;  3RXW A;  3MFX A;  3VP1 A;  3NOP C;  3BJN A;  2OAQ 1;  4MBH A;  3Q7V A;  1ALQ A;  3MBZ A;  3MS6 A;  2QJ5 A;  4GHI B;  2HDR A;  4ME4 A;  3T4Q A;  1YMX A;  1FCO A;  3VSL A;  5IT5 A;  4BL2 A;  1IYS A;  4JXW A;  4DF6 A;  4GKU A;  2JKG A;  4N92 A;  1K57 C;  3LY4 A;  2GDN A;  3O86 A;  2R78 A;  4X1L A;  3ZG5 A;  1NYM A;  5AQB A;  2PD8 A;  3WRT A;  4NEE D;  4X53 A;  3UN7 A;  5AQ9 A;  1H5X A;  1XJ4 A;  4LLO B;  3VE4 A;  3AGF A;  2HPB A;  4D60 A;  2EX8 A;  4MDZ A;  4WL9 A;  4G3V A;  1PW1 A;  3T1R A;  4JGO A;  3OPL A;  1KGF A;  1TS0 A;  1P9W A;  5FEF A;  4ETZ A;  1FQG A;  3HLD A;  1XFN A;  5FA7 A;  3L7H A;  5FAS A;  3CMZ A;  3T4T A;  4LRX C;  3NIA A;  1UWP X;  2XA7 S;  3MMH A;  3UDX A;  2JE5 A;  4R4S A;  4QWO A;  3LI8 A;  5CEC A;  4BBT A;  2V2F F;  4Q0I A;  1F5M A;  3DTM A;  1S4R A;  4S2M A;  3MF0 A;  1KDW A;  4G3K A;  4HHD A;  4LCL A;  2DMW A;  1H3Q A;  5IS1 A;  1CI9 A;  3TG9 A;  4ZJ3 A;  3ZG9 B;  4HP9 A;  1NZO A;  3UE0 A;  1BZA A;  3IX3 A;  5AQ7 A;  3WS4 A;  3BW6 A;  3PAG A;  5FAQ A;  1PWD A;  3L9K A;  3QP1 A;  2Q0O A;  5IHV A;  2ZM2 A;  3FC7 A;  3EQU A;  3M2K A;  2JCH A;  1IYQ A;  4EES A;  3D3O A;  5U47 A;  3C30 A;  3DTI A;  1GHP A;  4WLA A;  4G3W A;  1WA9 A;  1K55 C;  5F1G A;  1O7E A;  1K57 A;  4YFM A;  1JWZ A;  2FH5 A;  1F98 A;  2XD1 A;  4UHU A;  4BWI A;  3A3J A;  4OQH A;  3PBO A;  2A24 B;  1ODV A;  3UB8 A;  3LR5 A;  3M6B A;  2KDK A;  1OPX A;  4E6X A;  1ONH A;  1XPB A;  2P9V A;  2DCF A;  3MZE A;  1S66 L;  1MBL A;  5A90 A;  1T1A A;  2Y2L A;  4R0Q A;  1OT9 A;  5HL6 A;  3ZG7 B;  1XX2 A;  2J3T D;  1CK3 A;  1YLY A;  5J4E A;  2ACG A;  2JKR M;  3T50 A;  3CG5 A;  3T1X A;  4EEU A;  4OPR A;  2AVX A;  1MZU A;  4HP4 A;  2G2U A;  4GHI A;  1W8Y A;  4H8R A;  3KYZ A;  4KZ5 A;  4O8G A;  3DW0 A;  5E2G A;  2WAE A;  4N1X A;  3UPP A;  5LBR A;  4GCZ A;  3C4P A;  4B93 A;  3IQA A;  4BL3 A;  1RP5 A;  5E2E A;  1YMS A;  2W3E A;  2W3D A;  2O0Y A;  1SHV A;  4KG5 A;  1OME A;  4NXF A;  3EEH A;  3ZYT A;  3W2Z A;  5EM1 A;  1JWP A;  4XT2 B;  1ZG6 A;  1NRF A;  4KG2 A;  1JTD A;  5AVF A;  1DJB A;  3BFG A;  4F94 A;  4Z1W A;  1PIO A;  4OP5 A;  4HEF A;  3OPH A;  3FPW A;  3NEC A;  4QJG A;  3H7W B;  3CI6 A;  2L1M A;  3I7J A;  1Y28 A;  1K55 A;  3FPV A;  4X6T A;  2IWC A;  1QMF A;  2HDU A;  2QYB A;  1XJ3 A;  3G2Z A;  1W63 M;  2EA9 A;  3BEC A;  3LEQ A;  4QY5 A;  4CJN A;  2WKE A;  3O88 A;  4KUK A;  3C4O A;  1Z09 A;  4E3L A;  2RCX A;  4H6J B;  2B02 A;  4GNU A;  4PM5 A;  1LSW A;  4QU3 A;  3HBR A;  4S2P A;  4ETX A;  3VOY A;  1KE3 A;  3RXX A;  4II7 A;  1YAX A;  1GHM A;  2PD7 A;  3TE8 A;  1KGE A;  1TDL A;  3HRE A;  5CED A;  1SDE A;  5DKL A;  1UWN X;  1BLP A;  5HX9 A;  1YM1 A;  1XFQ A;  1FOF A;  4FH4 A;  2VGJ A;  5F82 A;  2BAS A;  1D1J A;  3SOI A;  4DDY A;  3UME A;  4U3T A;  3LIC A;  1W5D A;  3KYQ A;  3HLW A;  4L9E A;  4X55 A;  3V3S A;  2V20 A;  2Z2M B;  4BBU A;  2V0U A;  1M40 A;  1MWS A;  3IWQ A;  3G6O A;  1SZV A;  3HLE A;  1F9I A;  3IHA A;  1KGG A;  2XD5 A;  1LHY A;  2FFF B;  4OQ0 A;  3VP2 A;  1PI5 A;  3PHY A;  4YNR A;  3KSI A;  2VGL S;  2LB9 A;  3S7N A;  1E4D A;  3ZHH A;  4C6Y A;  1I2W A;  2V0W A;  3QP2 A;  4CLC A;  4WUJ A;  4ZTK A;  1XA1 A;  2EX9 A;  2Y2K A;  1W8Q A;  3TOI A;  5GLA A;  1STZ A;  1K4E A;  3ZDJ A;  5J7E A;  3ZNY A;  4YIN A;  3HLC A;  2X71 A;  2OWH A;  4GJ4 A;  2O99 A;  1H8Y A;  2W3F A;  3LCE A;  1JWV A;  2JKT M;  1VHM A;  4IBX A;  2VGK A;  4PKY A;  4UQI M;  3N8L A;  2YKF A;  2EX6 A;  3IXD A;  4FH2 A;  4UA6 A;  3F1N A;  3HL9 A;  3OC2 A;  1ONG A;  2D01 A;  4U0T A;  3HUN A;  3W8K A;  1PI4 A;  2W1T B;  2H28 A;  3MXS A;  5FQK A;  3BWL A;  4B4X A;  3LO7 A;  4X25 A;  3H7W A;  1YSQ A;  1I5Q A;  4IVI A;  4DJ2 A;  4CLC D;  1FCM A;  4E3O A;  2ZM0 A;  4EBL A;  4S2K A;  3Q07 A;  3HUM A;  5EVL A;  1N4O A;  2Y79 A;  5DFX A;  1XKZ A;  4Q0J A;  3D72 A;  2ZC4 B;  3QP5 A;  3IHB A;  1ES2 A;  4E3J A;  3GRJ A;  4RQ9 A;  4I3A A;  1DY6 A;  4WF0 A;  4FTX A;  1G5U A;  2V8F A;  3T4O A;  4L0L A;  4H6J A;  4IBR A;  3UB6 A;  4FOF A;  3ZG8 B;  4I5S A;  3ZVT A;  2OOL A;  4KZ6 A; 
#chains in the Genus database with same CATH homology
 4BL2 A;  1IYS A;  4JXW A;  4RYE A;  4DF6 A;  1ERO A;  4GKU A;  4GD8 A;  1DJC A;  3IT9 A;  3VFH A;  4DRT A;  3QHY A;  4N92 A;  3WS0 A;  1RGY A;  1K57 C;  3LY4 A;  2XFS A;  2GDN A;  3O86 A;  4R1G A;  1YLP A;  1NJ4 A;  1KE0 A;  4N1H A;  5CEB A;  1FCN A;  1YLJ A;  3ZG5 A;  1HTZ A;  1NYM A;  5AQB A;  5M19 A;  3WRT A;  3BLS A;  4JPM A;  2HP6 A;  3NDG A;  1IYO A;  1MWT A;  5F83 A;  4KZ7 A;  1Z6F A;  4JBF A;  5GHY A;  4X53 A;  3UN7 A;  5AQ9 A;  1H5X A;  2WGW A;  2ZC7 A;  3M6H A;  2PU2 A;  3AGF A;  4WEK A;  1K38 A;  2HPB A;  2WUQ A;  5DTT A;  5FQM A;  3BEB A;  2EX8 A;  4P85 A;  3S22 A;  1PW1 A;  4C3Q A;  4EQI A;  3OPL A;  4WM9 A;  1KGF A;  1IEL A;  4OKP A;  3C7U A;  5GLD A;  3EQV A;  2Y2M A;  1HZO A;  3O87 A;  3V39 A;  2P74 A;  1FQG A;  1JTG A;  3HLD A;  3DWZ A;  5DF7 A;  5CGW A;  3G34 A;  2J7V A;  3FV7 A;  2XK1 A;  3JYI A;  4OQI A;  5FA7 A;  1FR6 A;  5FAS A;  5BOH A;  3CMZ A;  4EV4 A;  4PM9 A;  3CZD A;  3NIA A;  5M1A A;  2ZQA A;  4U0X A;  5GLB A;  5HAI A;  5TGF A;  3N8S A;  4EWF A;  4S2J A;  4IED A;  3UNW A;  3UDX A;  2JE5 A;  3PTE A;  4HES A;  4R4S A;  4E3I A;  3SH7 A;  4WBG A;  3VOZ A;  1W79 A;  5CEC A;  2V2F F;  3A3E A;  1PWG A;  3VSK A;  5CHU A;  3G30 A;  3NDE A;  3DTM A;  4S2M A;  5L2F A;  1LI9 A;  5I94 A;  1KDW A;  1YLZ A;  1CI8 A;  4WZ4 A;  5KSC A;  5GHX A;  4LCL A;  4GOG A;  1CI9 A;  1VM1 A;  2XQZ A;  3TG9 A;  5J8X A;  4ZJ3 A;  3ZG9 B;  4Y7P A;  1HVB A;  3GVB A;  3MFD A;  2DNS A;  1GCE A;  2H10 A;  1NZO A;  2WKI A;  1BZA A;  2H5S A;  2Y91 A;  4S2I A;  1L2S A;  2UWX A;  5AQ7 A;  3UE0 A;  3WS4 A;  3UE3 A;  1M6K A;  3VP0 A;  4KZ3 A;  5A91 A;  4E6W A;  1CEG A;  3PAG A;  1MWR A;  4Q8I A;  5FAQ A;  1PWD A;  3IXB A;  2ZD8 A;  5IHV A;  2ZM2 A;  4P6B A;  5TFQ A;  1NY0 A;  5FQQ A;  1C3B A;  2WAF A;  5FI6 A;  2OLV A;  4HBT A;  2J9O A;  4S2O A;  2Z2L B;  4X68 A;  1PZO A;  3EQU A;  3M2K A;  2G2W A;  2JCH A;  4HBU A;  3BM6 A;  1IYQ A;  4P87 A;  2ZC5 B;  4S2N A;  5DTS A;  5FAP A;  4MNR A;  5U47 A;  3IWO A;  1GHP A;  2Y59 A;  4QD4 A;  4E3K A;  1L0E A;  4R4R A;  4Y0T A;  1K55 C;  5F1G A;  1O7E A;  3FYZ A;  1YT4 A;  4LV0 A;  1K57 A;  4OON A;  4YFM A;  1JWZ A;  4BD0 A;  2XD1 A;  4UHU A;  4LV3 A;  3A3J A;  4OQH A;  3PBO A;  4OOM A;  1BLS A;  4KQR A;  5E2F A;  5EOO A;  3SS3 A;  3GQZ A;  3M6B A;  2CC1 A;  3PAE A;  5FSR A;  5JYO A;  1NXY A;  4OOY A;  1KVL A;  5EPH A;  4E6X A;  1ONH A;  3WRZ A;  4OPQ A;  1XPB A;  5FQ9 A;  2P9V A;  1VQQ A;  1SKF A;  2DCF A;  4FSF A;  4KZB A;  4QB8 A;  1GHI A;  3MZE A;  3NBL A;  4FCF A;  3G32 A;  4S2N C;  1NYY A;  1W7F A;  1MBL A;  1MY8 A;  2BLS A;  5A90 A;  4B4Z A;  2Y2L A;  4R0Q A;  5HAR A;  4DXC A;  3ZG7 B;  1HD8 A;  3M2J A;  3G31 A;  3UDI A;  2Y2J A;  3SS5 A;  1XX2 A;  1ESU A;  3LY3 A;  3Q82 A;  1CK3 A;  1YLY A;  3UDF A;  1L0G A;  4C75 A;  4EBP A;  1JVJ A;  1TEM A;  4OP8 A;  4LV2 A;  1K54 C;  4PMA A;  3CG5 A;  4MBK A;  4E3N A;  3UO9 A;  4RVA A;  2J9P A;  4KZ9 A;  3B3X A;  1PW8 A;  4E3M A;  3IXH A;  4KZ6 A;  5CGX A;  3OCL A;  3QNB A;  2J8Y A;  5DF8 A;  2X01 A;  4OPR A;  2G2U A;  4X56 A;  5JYP A;  3D4F A;  4UA7 A;  2HDS A;  2C5W B;  2DRW A;  4GB7 A;  2XLN A;  1BUL A;  1W8Y A;  4H8R A;  2Y2I A;  3SS4 A;  1G6A A;  4KZ5 A;  5CTN A;  4X69 A;  5FI2 A;  3IH9 A;  3A3D A;  3DW0 A;  1K4F A;  3OZH A;  3RJU A;  5HW3 A;  5E2G A;  5E2H A;  3VP4 A;  2WAE A;  4N1X A;  3UPP A;  1ES3 A;  1XXM A;  3PBN A;  3MZF A;  3BFD A;  3IF6 B;  1L0F A;  2R9X A;  3C4P A;  2WK0 A;  3G35 A;  5CHM A;  4KQO A;  2WAD A;  3IQA A;  5EUA A;  4GDB A;  3Q1F A;  4BL3 A;  1BLC A;  1RP5 A;  5E2E A;  2Y2O A;  3BFF A;  1YMS A;  5FQJ A;  3GMW A;  2Y2P A;  3UY6 A;  2V1Z A;  1SHV A;  4KG5 A;  4P0M A;  4A5R A;  1OME A;  4WZ5 C;  4ZJ2 A;  2OLU A;  3IH8 A;  4OPY A;  4R23 A;  5KSH A;  4ZDX A;  3IXG A;  4OLD A;  4CPK A;  1MPL A;  4WYY A;  1JWP A;  3ITA A;  2XDM A;  1ZG6 A;  3PBT A;  1NRF A;  4BEN A;  1S6R A;  4OPZ A;  3W4Q A;  4KG2 A;  1JTD A;  2X02 A;  1DJB A;  3BFG A;  4F94 A;  3FZC A;  1PIO A;  3NCK A;  4GDN A;  4KQQ A;  1IEM A;  1SCW A;  4OP5 A;  2ZQ9 A;  4HEF A;  1MWU A;  2QMI A;  5FAT A;  1AXB A;  5FDH A;  5FI7 A;  3OPH A;  4QJG A;  3A3I A;  2HP5 A;  3I7J A;  2JBF A;  1K55 A;  5EVI B;  4X6T A;  2ZLY A;  2IWC A;  3MXR A;  2Q9N A;  3ZVW A;  4DE0 A;  3OPR A;  2XF3 A;  4B88 A;  2ZM8 A;  4PM7 A;  2XGN A;  3QNC A;  1QMF A;  2RL3 A;  4MEZ A;  2HDU A;  2A3U A;  3PBR A;  1K6S A;  3G2Z A;  1ZG4 A;  3BEC A;  3GR2 A;  5CRF A;  3MKF A;  4RX3 A;  5CHJ A;  2EFX A;  1WYB A;  4QY5 A;  4FD8 A;  4CJN A;  5HL1 A;  5HAQ A;  1L0D A;  3VFF A;  4DDS A;  5KZH A;  1XGI A;  3P98 A;  1RCJ A;  2XR0 A;  2WKE A;  1LI0 A;  3O88 A;  1EWZ A;  3IF6 C;  2H0Y A;  3C4O A;  5CER A;  2XEP A;  1I2S A;  1QME A;  1E25 A;  5DTK A;  4E3L A;  2RCX A;  3Q7V B;  2ZQD A;  1K25 A;  3BLM A;  2WGV A;  4GNU A;  1K54 A;  2HP9 A;  4PM5 A;  5KMW A;  3W4P A;  2WKH A;  1BLH A;  4QU3 A;  3HBR A;  4S2P A;  3VOY A;  3FKV A;  3N7W A;  1KE3 A;  3FKW A;  3NI9 A;  5CXW A;  1GA9 A;  3RXX A;  3HLF A;  1GHM A;  4BD1 A;  1KGE A;  1TDL A;  3OPP A;  3TSG A;  1KVM A;  3HRE A;  4R3J A;  4BJP A;  1CEF A;  1GA0 A;  5CED A;  1SDE A;  2PBY A;  1BLP A;  5HX9 A;  1ES5 A;  2HDQ A;  1TDG A;  2ZC3 B;  1YM1 A;  2Y55 A;  1KDS A;  4GZB A;  3WS1 A;  3ZFZ A;  1FOF A;  4FH4 A;  3MKE A;  4NK3 A;  2VGJ A;  5F82 A;  3SOI A;  4DDY A;  4KZ4 A;  2ZQC A;  4QHC A;  5D3O A;  4U3T A;  5GL9 A;  1W5D A;  2OV5 A;  4N9L A;  3C7V A;  4OVD A;  1ES4 A;  3NY4 A;  3HLW A;  3AGD A;  4WMC D;  2Y4A A;  2ZJ9 A;  2QPN A;  3G4P A;  1PZP A;  4X55 A;  4Y0U A;  5EVI C;  3V3S A;  5M18 A;  4JXG A;  5FAO A;  1MXO A;  4DE2 A;  2V20 A;  2Z2M B;  2WGW B;  3A3F A;  4GD6 A;  4ZJ1 A;  1ERQ A;  5A92 A;  2EXB A;  4KG6 A;  1M40 A;  1MWS A;  2B5R A;  3IWQ A;  1DJA A;  1BT5 A;  1PWC A;  3LEZ A;  2XFT A;  1K56 D;  3UPN A;  1Q2P A;  2ZC6 B;  3HLE A;  4JKT A;  5E43 A;  3IHA A;  4NET A;  1KGG A;  3HLB A;  2XD5 A;  5FQI A;  4WZ5 A;  4PM6 A;  1J9M A;  1LHY A;  4OQG A;  3GTC A;  1IKG A;  2FFF B;  4OQ0 A;  2R9W A;  2E8I A;  1G68 A;  5DF9 A;  1H8Z A;  3VMA A;  3N4I A;  3NC8 A;  3VP2 A;  1PI5 A;  3ZG0 A;  2I72 A;  2OSU A;  4DE1 A;  4QY6 A;  3ITB A;  5G18 A;  1E4D A;  5EOE A;  1K6R A;  1U60 A;  3ZHH A;  1KE4 A;  4ZAM A;  4C6Y A;  4S2L A;  2ZQ8 A;  3Q7Z A;  4UAA A;  3HVF A;  1YLW A;  1I2W A;  5EVI D;  1XP4 A;  3UE1 A;  1E3U D;  3BRM A;  4ID4 A;  4WEL A;  3WWX A;  3ZGA B;  2JC7 A;  4PPR A;  4ZTK A;  3FWL A;  3HLG A;  5AQA A;  1XA1 A;  2H0T A;  2EX9 A;  1IYP A;  2Y2K A;  1Y54 A;  4Y0O A;  1W8Q A;  2EX2 A;  5DVA A;  3V3R A;  3TOI A;  4DKI A;  5GHZ A;  2WGI A;  2Y2N A;  1ZC2 A;  4KEN B;  5GLA A;  1ZKJ A;  3WS5 A;  5EEC A;  1K4E A;  4OLG A;  3ZDJ A;  3N6I A;  4JF6 A;  4BLM A;  2PU4 A;  1WE4 A;  1SDN A;  3O3V A;  3ZNY A;  4YIN A;  4LEN A;  3HLC A;  2X71 A;  3Q81 A;  4DE3 A;  2Y2G A;  3CJM A;  4WEJ A;  3SH9 A;  4BQM A;  1YLT A;  1H8Y A;  3LCE A;  3MZD A;  1JWV A;  4K0X A;  1LL5 A;  1ERM A;  2ZQ7 A;  3OCN A;  4GN2 A;  3DWK A;  4Z9Q A;  4IBX A;  3PBQ A;  2VGK A;  3IF6 A;  4RX2 A;  2IWD A;  4WMC A;  2Q9M A;  3BFC A;  5A93 A;  3N8L A;  4JXV A;  4KZA A;  2EX6 A;  3VP3 A;  4K91 A;  2Y2H A;  3IXD A;  2XH9 A;  3BFE A;  4FH2 A;  4MLL A;  4OH0 A;  4UA6 A;  4KZ8 A;  3GSG A;  3UPO A;  1XGJ A;  1K56 A;  3P09 A;  1FSY A;  4EUZ A;  3E2K A;  4M3K A;  3HL9 A;  3OC2 A;  4O7D A;  1S0W A;  2C6W B;  1ONG A;  4ZBE A;  2BG1 A;  2Y2Q A;  2ZMA A;  3W4O A;  4U0T A;  3HUN A;  3W8K A;  1PI4 A;  3SH8 A;  3MXS A;  3IF5 A;  4IVK A;  4XUX A;  5FQK A;  1ESI A;  3G2Y A;  2WZZ A;  1EI5 A;  4JF5 A;  1BSG A;  3N8R A;  2QZ6 A;  1PYY A;  4MBF A;  1Q2Q A;  3S1Y A;  4B4X A;  3LO7 A;  5GLC A;  1YQS A;  5CTM A;  4D2O A;  3S4X A;  4XUZ A;  3V50 A;  1I5Q A;  1MKI A;  1O07 A;  4IVI A;  4K0W A;  5EVI A;  1N9B A;  1E3U A;  2EXA A;  2P9V B;  4R3B A;  5CGS A;  1FCM A;  1FR1 A;  4E3O A;  2ZM0 A;  4JF4 A;  2IWB A;  4EBL A;  2WZX A;  4S2K A;  3HUO A;  1BTL A;  1BUE A;  3BYD A;  3Q07 A;  3C5A A;  5F1F A;  1NZU A;  3GV9 A;  2A49 A;  3HUM A;  4UA9 A;  4DXB A;  5EVL A;  3ZCZ A;  1FSW A;  4RA7 A;  4OOL A;  4XXR A;  1N4O A;  5HFO A;  3AGE A;  4LV1 A;  1XKZ A;  1LLB A;  4EBN A;  2ZC4 B;  3ISG A;  3RXW A;  1RGZ A;  4PM8 A;  3E2L A;  1WYC A;  3VP1 A;  3IHB A;  4LCM A;  3V5M A;  1ES2 A;  4E3J A;  3GRJ A;  2EFU A;  4N9K A;  1IKI A;  1DY6 A;  3WS2 A;  2FFY A;  4MBH A;  3Q7V A;  1ALQ A;  1LL9 A;  2WYX A;  3MBZ A;  4L0L A;  4IBR A;  4JLF A;  5EE8 A;  5TR7 A;  3ZNT A;  1TVF A;  2HDR A;  3ZG8 B;  5HAP A;  1XA7 A;  3PBS A;  4JXS A;  3ZVT A;  3IWI A;  1YMX A;  1FCO A;  3VSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...