4PM7A

Crystal structure of ctx-m-14 s70g:s237a in complex with cefotaxime at 1.29 angstroms resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
b'QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGAGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-14
publication title Molecular Basis for the Catalytic Specificity of the CTX-M Extended-Spectrum beta-Lactamases.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Hydrolase/antibiotic
total genus 96
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4pm7A00
4DRTA 2V1ZA 3M2JA 1XA7A 2WZZA 4BD1A 4GZBA 3N8SA 4R23A 4ZJ2A 4WEJA 2ZMAA 4OPZA 3C4PA 3Q7VA 5I94A 3IF6A 4BL3A 3TG9A 3TSGA 1KE4A 3UO9A 3WWXA 4E3LA 2PU2A 1ES2A 3ZVTA 3LY3A 2ZC3B 3MKEA 1VQQA 4E3JA 4DDSA 4QJGA 2I72A 4X56A 4NETA 5GLAA 4DE1A 2EFXA 2Y2MA 4KQOA 2WYXA 1IYOA 1XGIA 1PIOA 3OCNA 2JC7A 4RX3A 3WS0A 4BJPA 1DJCA 2WKIA 2IWDA 4S2NC 1FQGA 1MPLA 3GV9A 1NRFA 4OLDA 3UN7A 1K6RA 2IWBA 5DVAA 5FQ9A 2VGKA 4XUXA 3ZHHA 2EFUA 4E3IA 2EX8A 2XF3A 2RL3A 4R4RA 4KZ4A 4N1XA 2QMIA 4WMCA 3N4IA 3N8LA 2WAEA 3ZNTA 3W4OA 1FCMA 5AQ9A 1RP5A 5CEBA 3HLDA 3W4QA 3SH9A 3HUOA 3BLMA 2ZQ7A 4OVDA 4MLLA 4A5RA 4KZ7A 1IELA 4PM8A 1BLCA 5HW3A 4L0LA 4R4SA 4JXSA 1KGEA 1JTGA 2Y2HA 3E2LA 3PAGA 3N8RA 4GDNA 3UE1A 2XK1A 5AQAA 4WM9A 2H0TA 3BM6A 3A3JA 3JYIA 1K6SA 4GNUA 5FQJA 4EQIA 4GDBA 2WKHA 3G30A 1GA9A 4DF6A 3AGEA 3HLCA 1TDGA 4BQMA 1L0DA 2OV5A 3FV7A 2HDSA 3NDEA 4LV0A 2XDMA 1SKFA 4E3OA 4GKUA 1ONHA 2H10A 3UDFA 5EVIB 4XUZA 5FAOA 1TVFA 2Y2PA 4KZBA 3A3IA 1FCOA 5D3OA 4LENA 2CC1A 1TEMA 2ZM2A 3NDGA 1YLJA 4JKTA 5JYOA 2R9XA 2C6WB 1KGFA 3C7VA 3DWKA 4B4ZA 3W4PA 4Q8IA 1LHYA 3GSGA 1KVMA 2ZLYA 1L0FA 1RCJA 3AGFA 4RYEA 5DF7A 3O87A 3OPPA 5TGFA 4E3KA 1O07A 3G4PA 4OOMA 3DW0A 4N9KA 1LI0A 1BTLA 1YMSA 2DRWA 5CGXA 4HBTA 2ZC7A 1HTZA 4N9LA 3VSLA 4N92A 1CI9A 1IYQA 5M19A 2B5RA 2VGJA 4C3QA 3C7UA 3VP3A 1CK3A 4JF5A 2DNSA 3IH9A 1EROA 3ZCZA 4HESA 2XH9A 5FI2A 4P85A 1K57C 1CEFA 3W8KA 1NZOA 3V5MA 3VP2A 4NK3A 5FASA 4ZAMA 4UA9A 1W8QA 1SHVA 3MZDA 3FWLA 4K91A 5BOHA 3NI9A 3M2KA 5J8XA 4PPRA 4QD4A 1WYCA 5DTKA 5EOOA 3SH7A 1I5QA 4KQQA 1E3UD 1L2SA 3ZNYA 1ES4A 3BFCA 1JWPA 1PWCA 3IHAA 4P0MA 1MBLA 2WUQA 5CHMA 1NXYA 2OSUA 4IVIA 3ITAA 4WYYA 4GD8A 5L2FA 5FQKA 2Y2GA 1KE0A 4KG5A 5GLCA 4F94A 3VFHA 2XQZA 3NCKA 1I2SA 3G34A 2H0YA 3SS5A 1MY8A 2C5WB 2HDRA 5AQ7A 3GVBA 4WZ5A 5CHJA 1FOFA 2QPNA 3VOYA 3UPOA 3IXBA 3LY4A 4GN2A 1E4DA 3NBLA 4OQGA 4U0TA 3RXXA 1YLPA 3DTMA 5KMWA 1YLWA 3O3VA 4JBFA 4C6YA 1W5DA 1KE3A 4PM9A 5EVLA 3HBRA 5FA7A 1YT4A 3V50A 4WEKA 1MKIA 1PW1A 1K56D 1J9MA 2OLUA 4ZJ3A 4BD0A 2HP9A 4X68A 3UY6A 3GR2A 1YLYA 5A92A 1K55C 1TDLA 5F1GA 2WK0A 4MNRA 4E3NA 4FH4A 4WZ4A 1G6AA 5CTMA 2HP6A 4M3KA 4OQHA 1GCEA 3A3FA 4OPYA 1QMFA 3G2YA 3Q7VB 5GHZA 5GHXA 2BLSA 5DTTA 3IF6B 2H5SA 4OOLA 4ID4A 3LEZA 2X01A 1PWGA 4EWFA 1ONGA 3UE0A 5CGSA 2Z2MB 5FAQA 1DY6A 2RCXA 3DWZA 4RVAA 4U0XA 4OP8A 3MXRA 2EX6A 3UPNA 2P9VA 3EQUA 3LO7A 5CEDA 3ZG7B 1JWZA 3HUNA 4JPMA 4S2KA 3ISGA 3GQZA 1DJAA 5FQQA 3G2ZA 2EX9A 2Y2NA 1ZKJA 3CJMA 2XFTA 4OONA 3NIAA 3OPHA 2XD5A 3IWIA 2EXBA 3FKVA 4DXBA 3HVFA 3FZCA 2PBYA 2Y2OA 1K54A 1K38A 3O86A 4UA6A 1XP4A 5FSRA 3BLSA 1HZOA 1N9BA 3WS4A 1LL9A 3ZGAB 1XA1A 4MBHA 1FSWA 5F83A 2WAFA 1LI9A 1NYYA 4S2IA 4EBPA 4EBNA 3MFDA 1M6KA 3HLBA 2EX2A 2E8IA 4X53A 4S2PA 2G2UA 3IT9A 5A90A 4LV2A 1PYYA 1ERMA 1XGJA 4OLGA 3IH8A 3QHYA 3CG5A 1KGGA 3G35A 3SS4A 1ESIA 4JXVA 1IKGA 3SH8A 3VOZA 1QMEA 1RGZA 2WZXA 4PM7A 1S6RA 5E2EA 1Q2PA 3IF6C 4WMCD 5A93A 1W8YA 2XFSA 1DJBA 2WADA 2GDNA 1BLHA 1SCWA 5E2GA 3CZDA 3N7WA 2Y55A 3NY4A 4X69A 1JVJA 4QY5A 4Y0UA 3V3SA 4BENA 1Z6FA 4PM5A 3ZG0A 2XLNA 4IBXA 5EVID 4UHUA 3PAEA 4MBFA 2Y2IA 5FDHA 4E6XA 3HLWA 1AXBA 5G18A 2J9PA 1FR6A 2Z2LB 1M40A 2Y2LA 1E3UA 1MWTA 4KENB 3A3EA 4JLFA 4DE0A 3WRTA 1HD8A 1C3BA 2JE5A 3IWOA 1IYPA 3FKWA 3ZG9B 1MXOA 1W79A 3IXGA 5CECA 4R3JA 2Q9MA 4DE3A 1KDWA 3HLGA 4FCFA 2Y2KA 5CHUA 3HREA 3O88A 3P09A 5EVIC 4P87A 3UDXA 1ERQA 5GL9A 2A49A 3OPRA 3ZG5A 5E2FA 3VMAA 4ZBEA 3GTCA 3QNBA 4Y0OA 5HL1A 1Q2QA 4S2NA 3CMZA 5KSHA 5HAIA 2XD1A 1PI4A 2WGWA 4O7DA 2QZ6A 1ZC2A 4FH2A 5EUAA 5GLBA 4ZJ1A 3MKFA 3V3RA 4S2JA 3VFFA 1BLPA 1K56A 1L0GA 4KQRA 5CERA 4WBGA 4GD6A 3OPLA 5EOEA 4S2OA 3G32A 1H5XA 1O7EA 3ZVWA 3IHBA 1LL5A 5HARA 2ZQ9A 5DTSA 4CJNA 3M6HA 5FAPA 4KZ9A 3BECA 5FI7A 4KZAA 3VSKA 3BFDA 2V20A 3PBQA 1YM1A 4B88A 2A3UA 2ZQ8A 2BG1A 2XR0A 1SDEA 4QB8A 4S2MA 4BLMA 4DXCA 1PZPA 4JXGA 4JF6A 1PI5A 2HPBA 1NY0A 1K4FA 3C5AA 5FQIA 2Y2JA 3HL9A 2ZM8A 1GHPA 2XEPA 5M1AA 3M6BA 2J7VA 4LCMA 1LLBA 2WGVA 3PBSA 3OC2A 3EQVA 5F82A 3VP0A 4BL2A 4EUZA 4U3TA 4OPQA 3HLFA 2FFYA 1ZG4A 5DF9A 2HP5A 3S1YA 4OH0A 4Z9QA 1FSYA 1H8YA 5CTNA 3IXHA 4K0XA 2UWXA 1JTDA 4JXWA 1GA0A 3RXWA 5EECA 4E3MA 3AGDA 1K4EA 3Q07A 3TOIA 2R9WA 2DCFA 2Q9NA 1ES5A 2ZQAA 3FYZA 1CI8A 3GMWA 4OQ0A 4QY6A 3S22A 1NZUA 1XXMA 3BRMA 4R0QA 3Q82A 4WELA 4KZ3A 2IWCA 1BUEA 1FCNA 4HBUA 4JF4A 4FSFA 2P9VB 5JYPA 1K25A 3QNCA 1S0WA 3PBTA 1W7FA 2ZC5B 4IVKA 1CEGA 2JCHA 1YMXA 4E6WA 4CPKA 2HDQA 3ITBA 2J8YA 4RX2A 3BYDA 1VM1A 4LV1A 1ESUA 1K57A 3OZHA 4WZ5C 4Y0TA 4IBRA 4OPRA 5HAQA 2EXAA 1YQSA 4ZDXA 4EV4A 1IYSA 3G31A 1BULA 4IEDA 5HFOA 2X71A 5A91A 1L0EA 5CRFA 4MBKA 5U47A 1YLTA 3UDIA 2P74A 3PBNA 1Y54A 3V39A 4QHCA 5EVIA 2WKEA 3IXDA 4YINA 3SOIA 1XPBA 3IWQA 1XX2A 1KVLA 3PTEA 4PMAA 2PU4A 3Q7ZA 4PM6A 1BT5A 3ZG8B 3IF5A 4DKIA 5M18A 1PZOA 1HVBA 2WGIA 1IKIA 1GHMA 4X55A 4X6TA 3A3DA 5FI6A 1JWVA 5TR7A 4C75A 5KSCA 4GOGA 5TFQA 3SS3A 3WS2A 2G2WA 1U60A 1EWZA 4DDYA 1BZAA 1MWUA 4GB7A 5EE8A 2V2FF 3IQAA 3ZFZA 1GHIA 4D2OA 1WE4A 4LV3A 4EBLA 4RA7A 4K0WA 2ZQDA 1EI5A 1I2WA 3BFFA 3VP1A 2FFFB 5E2HA 3WS1A 2OLVA 2XGNA 3D4FA 4QU3A 1KDSA 4KG6A 5AQBA 4OOYA 4H8RA 3OCLA 3C4OA 4OP5A 1IEMA 4R1GA 4ZTKA 4UAAA 1K55A 4KZ6A 4R3BA 1K54C 3GRJA 3NC8A 5EPHA 2ZQCA 2ZJ9A 5KZHA 2ZD8A 3BFEA 2J9OA 4Y7PA 1PW8A 5CGWA 3Q1FA 1MWSA 1H8ZA 3S4XA 3E2KA 4KZ5A 4HEFA 1ALQA 1FR1A 2Y91A 2ZM0A 5HAPA 3Q81A 2Y59A 4N1HA 1RGYA 2X02A 3WRZA 3ZDJA 1N4OA 4LCLA 1PWDA 1WYBA 3UPPA 1NJ4A 4P6BA 3PBOA 4FD8A 2HDUA 4YFMA 3MXSA 3B3XA 5HX9A 1XKZA 5IHVA 3UE3A 4B4XA 3P98A 4MEZA 5GLDA 1ZG6A 5GHYA 3PBRA 3HUMA 4KG2A 4S2LA 4XXRA 2WGWB 4DE2A 4OKPA 1YLZA 1G68A 1ES3A 2Y4AA 2ZC6B 3VP4A 1OMEA 4OQIA 4UA7A 1E25A 3UNWA 3WS5A 3LCEA 3MBZA 2ZC4B 4KZ8A 3BEBA 5FATA 5DF8A 1BLSA 3HLEA 5CXWA 2JBFA 1NYMA 2Y2QA 3MZFA 5E43A 3MZEA 3I7JA 1SDNA 3BFGA 3RJUA 3N6IA 1MWRA 5F1FA 1BSGA 5FQMA
chains in the Genus database with same CATH superfamily
4DRTA 3M2JA 1XA7A 4GZBA 4R23A 4ZJ2A 4WEJA 3C4PA 3EOIA 1MKMA 2PR5A 3TG9A 1XJ4A 3WWXA 4E3LA 1N9OA 4DDSA 2I72A 4DE1A 4HJ6A 1IYOA 2WKQA 3OCNA 3WS0A 4BJPA 5AJGA 1MPLA 2W3GA 4WLAA 4D60A 4OLDA 1K6RA 5FQ9A 2VGKA 4R4RA 2W1TA 3H7WB 4DJ3A 3W4OA 3VV4A 3W4QA 3SH9A 3HUOA 4KZ7A 4L0LA 4R4SA 3N8RA 2HJ9C 2H0TA 3MF0A 3A3JA 4DMZA 4GNUA 5FQJA 4DF6A 4Y2FA 1L0DA 2HDSA 1MC0A 3H82B 4LV0A 2XDMA 1SKFA 4E3OA 1MZUA 2H10A 5EVIB 4XUZA 4KZBA 3VE3A 1TEMA 5EV0A 5G4ZA 5JYOA 2C6WB 3C7VA 4B4ZA 1S66L 3GSGA 1KVMA 1S67L 5DF7A 4RYEA 3OPPA 4NXGA 1LI0A 1PRQA 5IS1A 2PYPA 3VSLA 2B5RA 3SW1A 4JF5A 1NZOA 2A2LA 4UA9A 2GNXA 4PPRA 3LFVA 4QD4A 3HCYA 1L2SA 3ZNYA 2QWSA 1T19A 3S7PA 2WUQA 2OSUA 5FQKA 2HV1A 4KG5A 3VFHA 4EUVA 5K5BA 2OAP1 2H0YA 3PYPA 1SZVA 3MS6A 1E4DA 3DTMA 3O3VA 4JBFA 1W5DA 3ZQ5A 1KE3A 4PM9A 4R70A 3NJAA 3V50A 4CLCE 1TS6A 2O9CA 1NRJA 2YKHA 3GR2A 1K55C 3UB7A 5EM1A 2FZ0A 4WZ4A 1G6AA 3IS2A 4OQHA 5DTTA 1G28A 1PWGA 3T4TA 5CGSA 5FAQA 3DWZA 2EX6A 2P9VA 1JWZA 4JPMA 3ISGA 1DP9A 3G2ZA 1ZKJA 3CJMA 2V8CA 5IT5A 3BW6A 3FKVA 2LB5A 4CLCA 1K54A 3BLSA 1HZOA 4HH2A 1N9BA 1XA1A 3SZTA 3CAXA 1LI9A 3KSHA 2P04A 2EX2A 4GHIB 5A90A 4LV2A 1PYYA 1ERMA 5DFYA 4OLGA 4BMWA 3G35A 3SS4A 5FEGA 4HHDA 1Q2PA 1H0MA 1BLHA 5E2GA 5A8BA 3CZDA 3N7WA 3NY4A 1JVJA 3V3SA 1OPXA 2Z6DA 3PAEA 2Y2IA 3T12B 2Y2LA 1E3UA 1MWTA 3A3EA 3BQ8A 3ZG9B 3QP5A 4X1MA 4BBVA 3HLGA 2Y2KA 4DN0A 5EVIC 4P87A 1VEUB 1DRMA 1F2KA 4NEED 4Z1WA 5AVFA 5E2FA 3UMEA 3CMZA 1PI4A 4O7DA 5GLBA 5EUAA 3VFFA 4GD6A 5EOEA 4S2OA 3G32A 1O7EA 1LL5A 1VHMA 2ZQ9A 1S1YA 3W2ZA 1HLUP 1YM1A 4B88A 4YWZA 2XR0A 1D7EA 4S2MA 4BLMA 3NHQA 4HJ4A 3T50A 4JXGA 3C5AA 3HL9A 2Y8HA 1OT9A 1FILA 3TW8A 4IUKA 3RFBA 4G3VA 1KOUA 3S7QA 1ZG4A 3LIBA 1H8MA 1OT6A 1FSYA 1P9RA 4JXWA 1GA0A 3T4KA 1YKDA 3TOIA 4I5SA 3GMWA 1XXMA 3U2AA 3CUEC 3Q82A 1BSGA 4KZ3A 4I3AA 4HBUA 4JF4A 2W1RA 1S0WA 2ZC5B 4E6WA 2HDQA 5J4EA 4LV1A 1VM1A 3OZHA 4Y0TA 2WKRA 2EXAA 3BJNA 2JKTI 1YQSA 4KUOA 4O01A 4EV4A 1OJGA 3E4PA 2Y79A 5HFOA 2X71A 4G3WA 2L4RA 3UDIA 2P74A 4MMNA 3IWQA 2E8JA 3LIEA 4Q0JA 1XX2A 2XSSA 1BT5A 5M18A 1OTIA 5FI6A 1HVBA 4X55A 1GHMA 4X6TA 2INWA 1JWVA 4C75A 5TFQA 3SS3A 3WS2A 2G2WA 1U60A 4JGPA 5EE8A 1GSWA 4NXFA 4D2OA 4P6ZM 4EBLA 4RA7A 3F1PA 2V1BA 1I2WA 3BFFA 2FFFB 2XGNA 4OOYA 2DMWA 1V9YA 4XT2A 2ZQCA 3BFEA 2J9OA 4L9EA 3Q1FA 1FR1A 2KLIA 2ZM0A 5HAPA 4N1HA 1RGYA 3ZDJA 3T1RA 3PBOA 3K3DA 3DTKA 5HWWA 4MEZA 4MN5A 5GHYA 3HUMA 4XXRA 1OMEA 1E25A 3UNWA 2W3DA 2ZC4B 3HLEA 2JBFA 1NYMA 2Y2QA 3QP6A 1SDNA 3BFGA 2O9BA 5F1FA 3CHWP 3E98A 5FQMA 2WZZA 3QP2A 2VGLM 3T1SA 3LR4A 5I94A 3IF6A 4E04A 1N9LA 2PU2A 3F1NA 3ZVTA 3LY3A 2ZC3B 4E3JA 3LGOA 2Y2MA 4KQOA 2JC7A 1DJCA 4S2NC 1NRFA 3UN7A 3KX0X 3CPTA 3ZHHA 2EFUA 4N1XA 4Y3IA 5CEBA 2V1AA 5EVEA 2ZQ7A 4OVDA 1JTGA 2Y2HA 3UE1A 2XK1A 5AQAA 1K6SA 4EQIA 1WA9A 4GDBA 2WKHA 3AGEA 3HLCA 1TDGA 3F1OA 2ZL1B 4NXBA 3UDFA 3LYXA 5FAOA 1TVFA 2Y2PA 3A3IA 2ZM2A 3NDGA 4JKTA 5CX7A 3RH8B 3LR3A 5AVEA 4NKPA 4Q8IA 3AGFA 3O87A 4E3KA 1O07A 4L9GA 4PKYA 4GS9A 1BTLA 2DRWA 5CGXA 1Y4OA 4HBTA 4N92A 3R7WB 1CJFA 2IA2A 4C3QA 3C7UA 5F69A 1EROA 2XH9A 5FI2A 1K57C 3W8KA 3V5MA 3VP2A 3NECA 3U4LP 4ZAMA 4EEUA 1E3UD 2XA7M 1UWNX 4AFIA 5GLCA 2Y2GA 4M4XA 5FDSA 3SS5A 5AQ7A 1FOFA 3VOYA 3LY4A 3NBLA 3E4OA 3P7NA 1EW0A 4KQDA 4RQ9A 4DJ2A 1DP8A 2OLUA 4BD0A 3UY6A 1ACFA 4K08A 4JGRA 4H6JA 5HDDA 5CTMA 1F98A 4OPYA 3MQ0A 3Q7VB 5GHXA 1T1CA 4FOFA 4ID4A 3MQQA 2O0YA 4MN7A 3UE0A 1DY6A 2PYRA 3EQUA 3HUNA 2XROA 1DJAA 2EX9A 2W3FA 2EA9A 3NIAA 3G6OA 2XD5A 3KSIA 3OBFA 4DXBA 3FZCA 2PBYA 4UA6A 3WS4A 3ZGAB 2VZWA 1NYYA 1M6KA 4X53A 2Z6CA 2G2UA 3IT9A 4L9FA 1XGJA 4HQAA 1OTEA 1KGGA 1ESIA 4JXVA 1IKGA 3VOZA 4UQIS 4PM7A 5E2EA 3FPVA 2XFSA 2O9AA 2V8FA 2GDNA 3A0SA 4BENA 4LRZE 2XLNA 3KO6A 1AXBA 5G18A 2Z2LB 1VB6A 1GSVA 4ARZA 4JLFA 3WRTA 1HD8A 1ZHHB 1MXOA 3E4QA 3IXGA 1KDWA 4FCFA 1S4SA 3O88A 3UDXA 1ERQA 2A49A 3CWFA 3VMAA 4ZBEA 5DFXA 1F5MA 5KSHA 2XD1A 3MKFA 3V3RA 1JNUA 5F5YA 5DTSA 5FAPA 4KZ9A 3VSKA 4KZAA 3S7NA 3BFDA 3PBQA 1ODVA 2ZQ8A 2BG1A 3QP4A 3NOPC 1SDEA 4DXCA 1PZPA 4HP4A 1PI5A 2HPBA 1NY0A 2W27A 2XEPA 5M1AA 3OC2A 3EQVA 4BL2A 1YAXA 5DF9A 3S1YA 4Z9QA 1H8YA 4K0XA 2M1CA 3A0RA 4E3MA 3AGDA 2A24B 2PD8A 4O8GA 1ES5A 4OQ0A 1DP6A 3H7WA 2GZAA 4IUHA 4R0QA 5I5LA 5JYPA 1K25A 1W7FA 4HY8A 4I3JA 4IVKA 2JCHA 2J8YA 1ESUA 5HAQA 1GSXA 3G31A 4GJ4A 4IEDA 5A91A 2B02A 5U47A 3LICA 3PBNA 1Y54A 3MQOA 5EVIA 3LIFA 5EM0A 3SOIA 4PMAA 1KVLA 3PTEA 2GJ3A 3IF5A 4DKIA 2WGIA 3A3DA 1EWZA 4DDYA 4EESA 4IHQA 1VETB 3IQAA 3ZFZA 1GHIA 5HPFA 1YSPA 1EI5A 2VK3A 3D4FA 3MJQA 2JN7A 4OP5A 1P0ZA 3LIDA 4UEYA 4UAAA 5EFWA 4CLCC 1K54C 5EPHA 3QP8A 4Y7PA 1PW8A 3UB6A 5TJJA 3L9KA 4HEFA 2B18A 2J3TD 4GLQA 1ALQA 3Q81A 2Y59A 2VLGA 3WRZA 3EGXC 4LCLA 3P01A 3E0YA 1WYBA 1NJ4A 2JKRM 2HDUA 2WKPA 3B3XA 2KDKA 4HNBA 3UE3A 4YOFA 3P98A 4B4XA 2G7UA 1XJ6A 2K2NA 4KG2A 2WGWB 2Y4AA 1G68A 1ES3A 3VP4A 1SKOB 3LI8A 2LB9A 3DTEA 1W63Q 1TF1A 1G5UA 3MZFA 3MZEA 2W3EA 1MWRA 5LBRA 2V1ZA 3N8SA 2P7JA 4KUKA 4F3LB 2ZMAA 1OTAA 3MFXA 1KE4A 3MKEA 1VQQA 1NLZA 2HZ5A 3IX3A 4QJGA 4X56A 4NETA 5GLAA 2WYXA 2EWVA 1XGIA 4Y13A 2WKIA 2IWDA 1FQGA 2PD7A 3GV9A 3K2NA 2IWBA 1TD5A 2EX8A 3C38A 2RL3A 2QMIA 1T1AA 3N4IA 3N8LA 1XJ3A 5AQ9A 1RP5A 3HLDA 3BLMA 4MLLA 3LEQA 4PM8A 1BLCA 3NOUC 4GHIA 5HW3A 4JXSA 4GDNA 4WM9A 3BM6A 4PKYG 3G30A 1GA9A 4BBTA 2ZOHA 3FV7A 4Y17A 4GKUA 3IX4A 5FEFA 5D3OA 2CC1A 3IX8A 4EU0A 3HJKA 4LRYC 1KGFA 3W4PA 1OTBA 1A0KA 2ZLYA 1L0FA 1RCJA 4GW9A 3BWLA 2OWHA 3G4PA 4OOMA 1YMSA 1K0KA 1W63M 2QHKA 2D02A 1HTZA 2ZC7A 4N9LA 2ZOIA 1IYQA 3DTIA 1NLYA 2B95A 2DNSA 3IH9A 2CMNA 4HESA 2NUPC 4P85A 1CEFA 4GS9B 1VEUA 5FASA 1SHVA 5HWVA 3NI9A 3M2KA 2V0WA 2PT7A 5TBMB 5DTKA 4R3AA 4KQQA 3T1QB 2BTFP 2PR6A 5CHMA 1NXYA 4IVIA 4X1LA 4WYYA 4GD8A 5L2FA 4EXOA 2XQZA 3NCKA 3G34A 3HJIA 2P08A 4MN6A 2HDRA 5L8MA 3GVBA 4WZ5A 4MCWA 3UPOA 3IXBA 4QPRA 3EWKA 4U0TA 4OQGA 4HI4A 3RXXA 1YLWA 5FA7A 4ME4A 1YT4A 4WEKA 4FTXA 3D72A 1J9MA 4ZJ3A 2ZMVA 2HP9A 4X68A 1YLYA 1TDLA 5F1GA 5G4YA 2WK0A 4WF0A 4E3NA 4FH4A 4M3KA 1GCEA 2OAQ1 1QMFA 2BLSA 3B42A 2X01A 1P97A 4EWFA 1ONGA 4U0XA 2RCXA 3CI6A 4OP8A 4PAUA 3EEHA 4IJGA 1PNEA 1ZTUA 4S2KA 5FQQA 2L0WA 2Y2NA 2XFTA 2ZMFA 3IWIA 2Y2OA 1K38A 1XP4A 2W1TB 3KSFA 1LL9A 2R78A 4LPZA 4Y15A 4MBHA 4S2IA 4EBNA 3MFDA 1LT0A 1Z09A 3HLBA 2E8IA 5L09A 1N9NA 3MMHA 3SH8A 3FG8A 4LFUA 4Y5FA 2ZBBA 4Q0HA 3IF6C 4WMCD 5A93A 1DJBA 2WADA 5IU1A 4X69A 4Y0UA 1Z6FA 3ICYA 1CQAA 3NOTC 5EVID 1J3WA 4UHUA 4MBFA 4E6XA 3HLWA 3RTYA 1FR6A 1M40A 2XRNA 4KENB 3PR6A 1C3BA 2JE5A 1D06A 1IYPA 3IWOA 2VEAA 2I9VA 1PFLA 4I3IA 3OPRA 3ZG5A 3JPUA 3GTCA 2JKRI 5HAIA 4FH2A 1BYWA 4S2JA 2VV6A 1K56A 1L0GA 3UB8A 5CERA 4WBGA 3CLOA 4LGWA 3T4OA 3C30A 5DKKA 2V20A 2JKFA 2A3UA 3T4SA 4QB8A 2FH5A 3S7OA 2PRFA 4JF6A 1T1BA 5FQIA 2Y2JA 3PHYA 2J7VA 4LRXC 4EETB 4LCMA 2O99A 3PBSA 3VP0A 4EUZA 3HLFA 2UWXA 5HL6A 1JTDA 1XFQA 3RXWA 3IS2B 1K4EA 2PBDP 3H9WA 3BY9A 1LSXA 2Q9NA 4ETZA 4HJ3A 3S22A 4QY6A 1NZUA 3OLOA 3NULA 1BUEA 1FCNA 2P9VB 3JVUA 4CPKA 3ITBA 3GECA 5HZHA 3TE8A 4OPRA 4ZDXA 1IYSA 4MDZA 4CLCB 1BULA 2NUTC 1IOUA 2ZL1A 3C2WA 5CRFA 2M7VA 4WUJA 3V39A 4R38A 2JKTM 2WKEA 3IXDA 3B33A 3LR5A 4YINA 1XPBA 3C8CA 2PU4A 4PM6A 3ZG8B 2VA0A 1PZOA 1IKIA 4GOGA 5J7EA 1BZAA 1MWUA 1WE4A 4K0WA 5C5KA 3R7WA 2ZQDA 1STZA 2HF6A 4ZRRA 3WS1A 1KDSA 5AQBA 4H8RA 3OCLA 4ZTKA 5J3WA 5HSQA 1K55A 2V9AA 4R3BA 3NC8A 2ZJ9A 1AWIA 1MWSA 3S4XA 3E2KA 4KZ5A 2M7UA 1L3LA 2Y91A 4G3KA 4JGQA 1PWDA 4FD8A 3MSHA 1XKZA 3PBRA 4S2LA 4DE2A 4OKPA 1P9WA 5HDSA 1TS7A 1YLZA 1X0OA 2ZC6B 4UA7A 3WS5A 3LCEA 4KZ8A 1BLSA 1TS8A 5CXWA 2JKGA 3I7JA 2ACGA 2H28A 3MR0A 4BD1A 2MJ6A 4FUWA 2K7SA 3A0VA 3ULFA 4OPZA 5L07A 3Q7VA 3BY8A 4BL3A 3TSGA 3T4QA 3UO9A 3LUQA 1ES2A 2EFXA 1V9ZA 1PIOA 2W0NA 4UQIM 4RX3A 4R6LA 3T4LA 5DKLA 3R4KA 4JGOA 3O5YA 3KYZA 3TRCA 5DVAA 2VV7A 2PHYA 4XUXA 1NWZA 4E3IA 2XF3A 4KZ4A 4WMCA 2HJEA 1LSVA 2WAEA 4WN5A 3ZNTA 1FCMA 2J3WA 3K3CA 4A5RA 3H82A 4YNRA 1IELA 1KGEA 2W3HA 3E2LA 3PAGA 3LR0A 3JYIA 1UWPX 4BQMA 3MXQA 2OV5A 3TJZC 3NDEA 4NG2A 2VX8A 1ONHA 4EQ1A 4HOIA 1FCOA 4LENA 1YLJA 2EWWA 2R9XA 5KIZA 3DWKA 1LHYA 5A92A 3T1XA 1D1JA 2YKFA 5TGFA 3DW0A 4N9KA 3FC7A 1CI9A 5M19A 3F1PB 2VGJA 3VP3A 4ESPA 1CK3A 3EEAA 3ZCZA 2QJ7A 3UB5P 4NK3A 1W8QA 3MZDA 3FWLA 4XT2B 4K91A 5BOHA 5J8XA 1WYCA 5EOOA 2QYBA 3SH7A 1YSQA 1I5QA 5F6AA 1ES4A 3BFCA 4X25A 1JWPA 1PWCA 3IHAA 4P0MA 1MBLA 2BASA 2JHEA 4P6ZS 3ITAA 3CUEA 1KE0A 4F94A 1I2SA 1MY8A 2C5WB 5HPIA 5CHJA 2QPNA 4GN2A 1YLPA 5KMWA 4B9OA 4C6YA 3T4JA 5EVLA 3HBRA 1MKIA 1PW1A 1K56D 1F9IA 3PXPA 4MNRA 2HP6A 4BWIA 2A24A 3A3FA 3KSGA 3G2YA 5GHZA 3IF6B 2H5SA 4OOLA 3LEZA 4I38A 3F1NB 1UGUA 2Z2MB 4RVAA 2OOLA 3UPNA 3MXRA 4ETXA 3LO7A 5CEDA 3ZG7B 1TS0A 2J80A 3GQZA 3DBAA 4OONA 3OPHA 2EXBA 3CPTB 3HVFA 3O86A 3LI9A 3KYQA 4EEPA 5FSRA 2VGLS 1FSWA 5F83A 2WAFA 4EBPA 3D3OA 4S2PA 3IH8A 5HD3A 3QHYA 3CG5A 5F68A 1QMEA 1RGZA 2WZXA 2VKSA 3F1OB 1S6RA 1CF0A 1Y28A 1H3QA 4BBUA 1W8YA 1VETA 4HP9A 3L7HA 1SCWA 4LLOB 2Y55A 1OTDA 4QY5A 2HGVA 4PM5A 3ZG0A 4IBXA 5FDHA 2J9PA 4DE0A 2KOIA 2OWJA 1XFNA 3ZYTA 3FKWA 1W79A 5CECA 4QWOA 2VV8A 4R3JA 2Q9MA 4DE3A 4WL9A 3JVVA 5CHUA 1YPRA 3IBJA 3HREA 3UE6A 1OJ5A 3P09A 3CITA 2K31A 5GL9A 3DAVA 2L1MA 3OOVA 3QNBA 4Y0OA 5HL1A 1Q2QA 4S2NA 2WGWA 2QZ6A 1ZC2A 2UV0E 4ZJ1A 4II7A 1BLPA 1SKOA 3OPLA 1H5XA 3ZVWA 3IHBA 5HARA 3FPWA 4CJNA 2VJWA 3V67A 3M6HA 3BECA 3KYEA 5FI7A 3EGDC 5HD5A 4F3LA 3BQAA 1G6OA 1K4FA 3UB9A 1S4RA 2ZM8A 1GHPA 2Q0OA 1T18A 3M6BA 3LIAA 1LLBA 2WGVA 5F82A 4U3TA 4OPQA 2FFYA 2XA7S 2HP5A 4OH0A 4H6JB 5CTNA 3IXHA 2QKPA 2KX6A 5EECA 5L10A 3Q07A 2R9WA 2DCFA 2ZQAA 3FYZA 1CI8A 2GX5A 5MC7A 3BRMA 4PHTA 1IFQA 1LSWA 4WELA 2IWCA 2D01A 4FSFA 5HDCA 3QNCA 3PBTA 1CEGA 1YMXA 5DJUA 4RX2A 3BYDA 1K57A 4WZ5C 4IBRA 1L0EA 4MBKA 4EW7A 1YLTA 1S1ZA 4QHCA 3QP1A 4HH3A 3Q7ZA 2PDRA 4I39A 3VOLA 5TR7A 5KSCA 2V0UA 4CLCD 4GB7A 2V2FF 3VE4A 4GCZA 3UMDA 4LV3A 3VP1A 5E2HA 4Q0IA 2OLVA 3D9YA 4QU3A 4KG6A 3C4OA 4R1GA 1IEMA 4ARZB 3B47A 4KZ6A 3GRJA 5HWTA 4B93A 5KZHA 2ZD8A 5TBMA 5CGWA 1H8ZA 5DJTA 5FL3A 3IBRA 2X02A 1N4OA 4NXEA 3UPPA 4P6BA 4O0PA 4YFMA 3MXSA 5HX9A 5IHVA 2QJ5A 2PAVP 4HIAA 5GLDA 1ZG6A 1XJ2A 4OQIA 2J3TC 3MBZA 4EERA 1LL8A 5FATA 3BEBA 4CQHA 5DF8A 1FIKA 3GDIA 2AVXA 5E43A 3RJUA 3N6IA 4KQRA
chains in the Genus database with same CATH topology
4DRTA 2V1ZA 3M2JA 1XA7A 2WZZA 4BD1A 4GZBA 3N8SA 4R23A 4ZJ2A 4WEJA 2ZMAA 4OPZA 3C4PA 3Q7VA 5I94A 3IF6A 4BL3A 3TG9A 3TSGA 1KE4A 3UO9A 3WWXA 4E3LA 2PU2A 1ES2A 3ZVTA 3LY3A 2ZC3B 3MKEA 1VQQA 4E3JA 4DDSA 4QJGA 2I72A 4X56A 4NETA 5GLAA 4DE1A 2EFXA 2Y2MA 4KQOA 2WYXA 1IYOA 1XGIA 1PIOA 3OCNA 2JC7A 4RX3A 3WS0A 4BJPA 1DJCA 2WKIA 2IWDA 4S2NC 1FQGA 1MPLA 3GV9A 1NRFA 4OLDA 3UN7A 1K6RA 2IWBA 5DVAA 5FQ9A 2VGKA 4XUXA 3ZHHA 2EFUA 4E3IA 2EX8A 2XF3A 2RL3A 4R4RA 4KZ4A 4N1XA 2QMIA 4WMCA 3N4IA 3N8LA 2WAEA 3ZNTA 3W4OA 1FCMA 5AQ9A 1RP5A 5CEBA 3HLDA 3W4QA 3SH9A 3HUOA 3BLMA 2ZQ7A 4OVDA 4MLLA 4A5RA 4KZ7A 1IELA 4PM8A 1BLCA 5HW3A 4L0LA 4R4SA 4JXSA 1KGEA 1JTGA 2Y2HA 3E2LA 3PAGA 3N8RA 4GDNA 3UE1A 2XK1A 5AQAA 4WM9A 2H0TA 3BM6A 3A3JA 3JYIA 1K6SA 4GNUA 5FQJA 4EQIA 4GDBA 2WKHA 3G30A 1GA9A 4DF6A 3AGEA 3HLCA 1TDGA 4BQMA 1L0DA 2OV5A 3FV7A 2HDSA 3NDEA 4LV0A 2XDMA 1SKFA 4E3OA 4GKUA 1ONHA 2H10A 3UDFA 5EVIB 4XUZA 5FAOA 1TVFA 2Y2PA 4KZBA 3A3IA 1FCOA 5D3OA 4LENA 2CC1A 1TEMA 2ZM2A 3NDGA 1YLJA 4JKTA 5JYOA 2R9XA 2C6WB 1KGFA 3C7VA 3DWKA 4B4ZA 3W4PA 4Q8IA 1LHYA 3GSGA 1KVMA 2ZLYA 1L0FA 1RCJA 3AGFA 4RYEA 5DF7A 3O87A 3OPPA 5TGFA 4E3KA 1O07A 3G4PA 4OOMA 3DW0A 4N9KA 1LI0A 1BTLA 1YMSA 2DRWA 5CGXA 4HBTA 2ZC7A 1HTZA 4N9LA 3VSLA 4N92A 1CI9A 1IYQA 5M19A 2B5RA 2VGJA 4C3QA 3C7UA 3VP3A 1CK3A 4JF5A 2DNSA 3IH9A 1EROA 3ZCZA 4HESA 2XH9A 5FI2A 4P85A 1K57C 1CEFA 3W8KA 1NZOA 3V5MA 3VP2A 4NK3A 5FASA 4ZAMA 4UA9A 1W8QA 1SHVA 3MZDA 3FWLA 4K91A 5BOHA 3NI9A 3M2KA 5J8XA 4PPRA 4QD4A 1WYCA 5DTKA 5EOOA 3SH7A 1I5QA 4KQQA 1E3UD 1L2SA 3ZNYA 1ES4A 3BFCA 1JWPA 1PWCA 3IHAA 4P0MA 1MBLA 2WUQA 5CHMA 1NXYA 2OSUA 4IVIA 3ITAA 4WYYA 4GD8A 5L2FA 5FQKA 2Y2GA 1KE0A 4KG5A 5GLCA 4F94A 3VFHA 2XQZA 3NCKA 1I2SA 3G34A 2H0YA 3SS5A 1MY8A 2C5WB 2HDRA 5AQ7A 3GVBA 4WZ5A 5CHJA 1FOFA 2QPNA 3VOYA 3UPOA 3IXBA 3LY4A 4GN2A 1E4DA 3NBLA 4OQGA 4U0TA 3RXXA 1YLPA 3DTMA 5KMWA 1YLWA 3O3VA 4JBFA 4C6YA 1W5DA 1KE3A 4PM9A 5EVLA 3HBRA 5FA7A 1YT4A 3V50A 4WEKA 1MKIA 1PW1A 1K56D 1J9MA 2OLUA 4ZJ3A 4BD0A 2HP9A 4X68A 3UY6A 3GR2A 1YLYA 5A92A 1K55C 1TDLA 5F1GA 2WK0A 4MNRA 4E3NA 4FH4A 4WZ4A 1G6AA 5CTMA 2HP6A 4M3KA 4OQHA 1GCEA 3A3FA 4OPYA 1QMFA 3G2YA 3Q7VB 5GHZA 5GHXA 2BLSA 5DTTA 3IF6B 2H5SA 4OOLA 4ID4A 3LEZA 2X01A 1PWGA 4EWFA 1ONGA 3UE0A 5CGSA 2Z2MB 5FAQA 1DY6A 2RCXA 3DWZA 4RVAA 4U0XA 4OP8A 3MXRA 2EX6A 3UPNA 2P9VA 3EQUA 3LO7A 5CEDA 3ZG7B 1JWZA 3HUNA 4JPMA 4S2KA 3ISGA 3GQZA 1DJAA 5FQQA 3G2ZA 2EX9A 2Y2NA 1ZKJA 3CJMA 2XFTA 4OONA 3NIAA 3OPHA 2XD5A 3IWIA 2EXBA 3FKVA 4DXBA 3HVFA 3FZCA 2PBYA 2Y2OA 1K54A 1K38A 3O86A 4UA6A 1XP4A 5FSRA 3BLSA 1HZOA 1N9BA 3WS4A 1LL9A 3ZGAB 1XA1A 4MBHA 1FSWA 5F83A 2WAFA 1LI9A 1NYYA 4S2IA 4EBPA 4EBNA 3MFDA 1M6KA 3HLBA 2EX2A 2E8IA 4X53A 4S2PA 2G2UA 3IT9A 5A90A 4LV2A 1PYYA 1ERMA 1XGJA 4OLGA 3IH8A 3QHYA 3CG5A 1KGGA 3G35A 3SS4A 1ESIA 4JXVA 1IKGA 3SH8A 3VOZA 1QMEA 1RGZA 2WZXA 4PM7A 1S6RA 5E2EA 1Q2PA 3IF6C 4WMCD 5A93A 1W8YA 2XFSA 1DJBA 2WADA 2GDNA 1BLHA 1SCWA 5E2GA 3CZDA 3N7WA 2Y55A 3NY4A 4X69A 1JVJA 4QY5A 4Y0UA 3V3SA 4BENA 1Z6FA 4PM5A 3ZG0A 2XLNA 4IBXA 5EVID 4UHUA 3PAEA 4MBFA 2Y2IA 5FDHA 4E6XA 3HLWA 1AXBA 5G18A 2J9PA 1FR6A 2Z2LB 1M40A 2Y2LA 1E3UA 1MWTA 4KENB 3A3EA 4JLFA 4DE0A 3WRTA 1HD8A 1C3BA 2JE5A 3IWOA 1IYPA 3FKWA 3ZG9B 1MXOA 1W79A 3IXGA 5CECA 4R3JA 2Q9MA 4DE3A 1KDWA 3HLGA 4FCFA 2Y2KA 5CHUA 3HREA 3O88A 3P09A 5EVIC 4P87A 3UDXA 1ERQA 5GL9A 2A49A 3OPRA 3ZG5A 5E2FA 3VMAA 4ZBEA 3GTCA 3QNBA 4Y0OA 5HL1A 1Q2QA 4S2NA 3CMZA 5KSHA 5HAIA 2XD1A 1PI4A 2WGWA 4O7DA 2QZ6A 1ZC2A 4FH2A 5EUAA 5GLBA 4ZJ1A 3MKFA 3V3RA 4S2JA 3VFFA 1BLPA 1K56A 1L0GA 4KQRA 5CERA 4WBGA 4GD6A 3OPLA 5EOEA 4S2OA 3G32A 1H5XA 1O7EA 3ZVWA 3IHBA 1LL5A 5HARA 2ZQ9A 5DTSA 4CJNA 3M6HA 5FAPA 4KZ9A 3BECA 5FI7A 4KZAA 3VSKA 3BFDA 2V20A 3PBQA 1YM1A 4B88A 2A3UA 2ZQ8A 2BG1A 2XR0A 1SDEA 4QB8A 4S2MA 4BLMA 4DXCA 1PZPA 4JXGA 4JF6A 1PI5A 2HPBA 1NY0A 1K4FA 3C5AA 5FQIA 2Y2JA 3HL9A 2ZM8A 1GHPA 2XEPA 5M1AA 3M6BA 2J7VA 4LCMA 1LLBA 2WGVA 3PBSA 3OC2A 3EQVA 5F82A 3VP0A 4BL2A 4EUZA 4U3TA 4OPQA 3HLFA 2FFYA 1ZG4A 5DF9A 2HP5A 3S1YA 4OH0A 4Z9QA 1FSYA 1H8YA 5CTNA 3IXHA 4K0XA 2UWXA 1JTDA 4JXWA 1GA0A 3RXWA 5EECA 4E3MA 3AGDA 1K4EA 3Q07A 3TOIA 2R9WA 2DCFA 2Q9NA 1ES5A 2ZQAA 3FYZA 1CI8A 3GMWA 4OQ0A 4QY6A 3S22A 1NZUA 1XXMA 3BRMA 4R0QA 3Q82A 4WELA 4KZ3A 2IWCA 1BUEA 1FCNA 4HBUA 4JF4A 4FSFA 2P9VB 5JYPA 1K25A 3QNCA 1S0WA 3PBTA 1W7FA 2ZC5B 4IVKA 1CEGA 2JCHA 1YMXA 4E6WA 4CPKA 2HDQA 3ITBA 2J8YA 4RX2A 3BYDA 1VM1A 4LV1A 1ESUA 1K57A 3OZHA 4WZ5C 4Y0TA 4IBRA 4OPRA 5HAQA 2EXAA 1YQSA 4ZDXA 4EV4A 1IYSA 3G31A 1BULA 4IEDA 5HFOA 2X71A 5A91A 1L0EA 5CRFA 4MBKA 5U47A 1YLTA 3UDIA 2P74A 3PBNA 1Y54A 3V39A 4QHCA 5EVIA 2WKEA 3IXDA 4YINA 3SOIA 1XPBA 3IWQA 1XX2A 1KVLA 3PTEA 4PMAA 2PU4A 3Q7ZA 4PM6A 1BT5A 3ZG8B 3IF5A 4DKIA 5M18A 1PZOA 1HVBA 2WGIA 1IKIA 1GHMA 4X55A 4X6TA 3A3DA 5FI6A 1JWVA 5TR7A 4C75A 5KSCA 4GOGA 5TFQA 3SS3A 3WS2A 2G2WA 1U60A 1EWZA 4DDYA 1BZAA 1MWUA 4GB7A 5EE8A 2V2FF 3IQAA 3ZFZA 1GHIA 4D2OA 1WE4A 4LV3A 4EBLA 4RA7A 4K0WA 2ZQDA 1EI5A 1I2WA 3BFFA 3VP1A 2FFFB 5E2HA 3WS1A 2OLVA 2XGNA 3D4FA 4QU3A 1KDSA 4KG6A 5AQBA 4OOYA 4H8RA 3OCLA 3C4OA 4OP5A 1IEMA 4R1GA 4ZTKA 4UAAA 1K55A 4KZ6A 4R3BA 1K54C 3GRJA 3NC8A 5EPHA 2ZQCA 2ZJ9A 5KZHA 2ZD8A 3BFEA 2J9OA 4Y7PA 1PW8A 5CGWA 3Q1FA 1MWSA 1H8ZA 3S4XA 3E2KA 4KZ5A 4HEFA 1ALQA 1FR1A 2Y91A 2ZM0A 5HAPA 3Q81A 2Y59A 4N1HA 1RGYA 2X02A 3WRZA 3ZDJA 1N4OA 4LCLA 1PWDA 1WYBA 3UPPA 1NJ4A 4P6BA 3PBOA 4FD8A 2HDUA 4YFMA 3MXSA 3B3XA 5HX9A 1XKZA 5IHVA 3UE3A 4B4XA 3P98A 4MEZA 5GLDA 1ZG6A 5GHYA 3PBRA 3HUMA 4KG2A 4S2LA 4XXRA 2WGWB 4DE2A 4OKPA 1YLZA 1G68A 1ES3A 2Y4AA 2ZC6B 3VP4A 1OMEA 4OQIA 4UA7A 1E25A 3UNWA 3WS5A 3LCEA 3MBZA 2ZC4B 4KZ8A 3BEBA 5FATA 5DF8A 1BLSA 3HLEA 5CXWA 2JBFA 1NYMA 2Y2QA 3MZFA 5E43A 3MZEA 3I7JA 1SDNA 3BFGA 3RJUA 3N6IA 1MWRA 5F1FA 1BSGA 5FQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRT A;  2V1Z A;  3M2J A;  1XA7 A;  2WZZ A;  4BD1 A;  4GZB A;  3N8S A;  4R23 A;  4ZJ2 A;  4WEJ A;  2ZMA A;  4OPZ A;  3C4P A;  3Q7V A;  5I94 A;  3IF6 A;  4BL3 A;  3TG9 A;  3TSG A;  1KE4 A;  3UO9 A;  3WWX A;  4E3L A;  2PU2 A;  1ES2 A;  3ZVT A;  3LY3 A;  2ZC3 B;  3MKE A;  1VQQ A;  4E3J A;  4DDS A;  4QJG A;  2I72 A;  4X56 A;  4NET A;  5GLA A;  4DE1 A;  2EFX A;  2Y2M A;  4KQO A;  2WYX A;  1IYO A;  1XGI A;  1PIO A;  3OCN A;  2JC7 A;  4RX3 A;  3WS0 A;  4BJP A;  1DJC A;  2WKI A;  2IWD A;  4S2N C;  1FQG A;  1MPL A;  3GV9 A;  1NRF A;  4OLD A;  3UN7 A;  1K6R A;  2IWB A;  5DVA A;  5FQ9 A;  2VGK A;  4XUX A;  3ZHH A;  2EFU A;  4E3I A;  2EX8 A;  2XF3 A;  2RL3 A;  4R4R A;  4KZ4 A;  4N1X A;  2QMI A;  4WMC A;  3N4I A;  3N8L A;  2WAE A;  3ZNT A;  3W4O A;  1FCM A;  5AQ9 A;  1RP5 A;  5CEB A;  3HLD A;  3W4Q A;  3SH9 A;  3HUO A;  3BLM A;  2ZQ7 A;  4OVD A;  4MLL A;  4A5R A;  4KZ7 A;  1IEL A;  4PM8 A;  1BLC A;  5HW3 A;  4L0L A;  4R4S A;  4JXS A;  1KGE A;  1JTG A;  2Y2H A;  3E2L A;  3PAG A;  3N8R A;  4GDN A;  3UE1 A;  2XK1 A;  5AQA A;  4WM9 A;  2H0T A;  3BM6 A;  3A3J A;  3JYI A;  1K6S A;  4GNU A;  5FQJ A;  4EQI A;  4GDB A;  2WKH A;  3G30 A;  1GA9 A;  4DF6 A;  3AGE A;  3HLC A;  1TDG A;  4BQM A;  1L0D A;  2OV5 A;  3FV7 A;  2HDS A;  3NDE A;  4LV0 A;  2XDM A;  1SKF A;  4E3O A;  4GKU A;  1ONH A;  2H10 A;  3UDF A;  5EVI B;  4XUZ A;  5FAO A;  1TVF A;  2Y2P A;  4KZB A;  3A3I A;  1FCO A;  5D3O A;  4LEN A;  2CC1 A;  1TEM A;  2ZM2 A;  3NDG A;  1YLJ A;  4JKT A;  5JYO A;  2R9X A;  2C6W B;  1KGF A;  3C7V A;  3DWK A;  4B4Z A;  3W4P A;  4Q8I A;  1LHY A;  3GSG A;  1KVM A;  2ZLY A;  1L0F A;  1RCJ A;  3AGF A;  4RYE A;  5DF7 A;  3O87 A;  3OPP A;  5TGF A;  4E3K A;  1O07 A;  3G4P A;  4OOM A;  3DW0 A;  4N9K A;  1LI0 A;  1BTL A;  1YMS A;  2DRW A;  5CGX A;  4HBT A;  2ZC7 A;  1HTZ A;  4N9L A;  3VSL A;  4N92 A;  1CI9 A;  1IYQ A;  5M19 A;  2B5R A;  2VGJ A;  4C3Q A;  3C7U A;  3VP3 A;  1CK3 A;  4JF5 A;  2DNS A;  3IH9 A;  1ERO A;  3ZCZ A;  4HES A;  2XH9 A;  5FI2 A;  4P85 A;  1K57 C;  1CEF A;  3W8K A;  1NZO A;  3V5M A;  3VP2 A;  4NK3 A;  5FAS A;  4ZAM A;  4UA9 A;  1W8Q A;  1SHV A;  3MZD A;  3FWL A;  4K91 A;  5BOH A;  3NI9 A;  3M2K A;  5J8X A;  4PPR A;  4QD4 A;  1WYC A;  5DTK A;  5EOO A;  3SH7 A;  1I5Q A;  4KQQ A;  1E3U D;  1L2S A;  3ZNY A;  1ES4 A;  3BFC A;  1JWP A;  1PWC A;  3IHA A;  4P0M A;  1MBL A;  2WUQ A;  5CHM A;  1NXY A;  2OSU A;  4IVI A;  3ITA A;  4WYY A;  4GD8 A;  5L2F A;  5FQK A;  2Y2G A;  1KE0 A;  4KG5 A;  5GLC A;  4F94 A;  3VFH A;  2XQZ A;  3NCK A;  1I2S A;  3G34 A;  2H0Y A;  3SS5 A;  1MY8 A;  2C5W B;  2HDR A;  5AQ7 A;  3GVB A;  4WZ5 A;  5CHJ A;  1FOF A;  2QPN A;  3VOY A;  3UPO A;  3IXB A;  3LY4 A;  4GN2 A;  1E4D A;  3NBL A;  4OQG A;  4U0T A;  3RXX A;  1YLP A;  3DTM A;  5KMW A;  1YLW A;  3O3V A;  4JBF A;  4C6Y A;  1W5D A;  1KE3 A;  4PM9 A;  5EVL A;  3HBR A;  5FA7 A;  1YT4 A;  3V50 A;  4WEK A;  1MKI A;  1PW1 A;  1K56 D;  1J9M A;  2OLU A;  4ZJ3 A;  4BD0 A;  2HP9 A;  4X68 A;  3UY6 A;  3GR2 A;  1YLY A;  5A92 A;  1K55 C;  1TDL A;  5F1G A;  2WK0 A;  4MNR A;  4E3N A;  4FH4 A;  4WZ4 A;  1G6A A;  5CTM A;  2HP6 A;  4M3K A;  4OQH A;  1GCE A;  3A3F A;  4OPY A;  1QMF A;  3G2Y A;  3Q7V B;  5GHZ A;  5GHX A;  2BLS A;  5DTT A;  3IF6 B;  2H5S A;  4OOL A;  4ID4 A;  3LEZ A;  2X01 A;  1PWG A;  4EWF A;  1ONG A;  3UE0 A;  5CGS A;  2Z2M B;  5FAQ A;  1DY6 A;  2RCX A;  3DWZ A;  4RVA A;  4U0X A;  4OP8 A;  3MXR A;  2EX6 A;  3UPN A;  2P9V A;  3EQU A;  3LO7 A;  5CED A;  3ZG7 B;  1JWZ A;  3HUN A;  4JPM A;  4S2K A;  3ISG A;  3GQZ A;  1DJA A;  5FQQ A;  3G2Z A;  2EX9 A;  2Y2N A;  1ZKJ A;  3CJM A;  2XFT A;  4OON A;  3NIA A;  3OPH A;  2XD5 A;  3IWI A;  2EXB A;  3FKV A;  4DXB A;  3HVF A;  3FZC A;  2PBY A;  2Y2O A;  1K54 A;  1K38 A;  3O86 A;  4UA6 A;  1XP4 A;  5FSR A;  3BLS A;  1HZO A;  1N9B A;  3WS4 A;  1LL9 A;  3ZGA B;  1XA1 A;  4MBH A;  1FSW A;  5F83 A;  2WAF A;  1LI9 A;  1NYY A;  4S2I A;  4EBP A;  4EBN A;  3MFD A;  1M6K A;  3HLB A;  2EX2 A;  2E8I A;  4X53 A;  4S2P A;  2G2U A;  3IT9 A;  5A90 A;  4LV2 A;  1PYY A;  1ERM A;  1XGJ A;  4OLG A;  3IH8 A;  3QHY A;  3CG5 A;  1KGG A;  3G35 A;  3SS4 A;  1ESI A;  4JXV A;  1IKG A;  3SH8 A;  3VOZ A;  1QME A;  1RGZ A;  2WZX A;  4PM7 A;  1S6R A;  5E2E A;  1Q2P A;  3IF6 C;  4WMC D;  5A93 A;  1W8Y A;  2XFS A;  1DJB A;  2WAD A;  2GDN A;  1BLH A;  1SCW A;  5E2G A;  3CZD A;  3N7W A;  2Y55 A;  3NY4 A;  4X69 A;  1JVJ A;  4QY5 A;  4Y0U A;  3V3S A;  4BEN A;  1Z6F A;  4PM5 A;  3ZG0 A;  2XLN A;  4IBX A;  5EVI D;  4UHU A;  3PAE A;  4MBF A;  2Y2I A;  5FDH A;  4E6X A;  3HLW A;  1AXB A;  5G18 A;  2J9P A;  1FR6 A;  2Z2L B;  1M40 A;  2Y2L A;  1E3U A;  1MWT A;  4KEN B;  3A3E A;  4JLF A;  4DE0 A;  3WRT A;  1HD8 A;  1C3B A;  2JE5 A;  3IWO A;  1IYP A;  3FKW A;  3ZG9 B;  1MXO A;  1W79 A;  3IXG A;  5CEC A;  4R3J A;  2Q9M A;  4DE3 A;  1KDW A;  3HLG A;  4FCF A;  2Y2K A;  5CHU A;  3HRE A;  3O88 A;  3P09 A;  5EVI C;  4P87 A;  3UDX A;  1ERQ A;  5GL9 A;  2A49 A;  3OPR A;  3ZG5 A;  5E2F A;  3VMA A;  4ZBE A;  3GTC A;  3QNB A;  4Y0O A;  5HL1 A;  1Q2Q A;  4S2N A;  3CMZ A;  5KSH A;  5HAI A;  2XD1 A;  1PI4 A;  2WGW A;  4O7D A;  2QZ6 A;  1ZC2 A;  4FH2 A;  5EUA A;  5GLB A;  4ZJ1 A;  3MKF A;  3V3R A;  4S2J A;  3VFF A;  1BLP A;  1K56 A;  1L0G A;  4KQR A;  5CER A;  4WBG A;  4GD6 A;  3OPL A;  5EOE A;  4S2O A;  3G32 A;  1H5X A;  1O7E A;  3ZVW A;  3IHB A;  1LL5 A;  5HAR A;  2ZQ9 A;  5DTS A;  4CJN A;  3M6H A;  5FAP A;  4KZ9 A;  3BEC A;  5FI7 A;  4KZA A;  3VSK A;  3BFD A;  2V20 A;  3PBQ A;  1YM1 A;  4B88 A;  2A3U A;  2ZQ8 A;  2BG1 A;  2XR0 A;  1SDE A;  4QB8 A;  4S2M A;  4BLM A;  4DXC A;  1PZP A;  4JXG A;  4JF6 A;  1PI5 A;  2HPB A;  1NY0 A;  1K4F A;  3C5A A;  5FQI A;  2Y2J A;  3HL9 A;  2ZM8 A;  1GHP A;  2XEP A;  5M1A A;  3M6B A;  2J7V A;  4LCM A;  1LLB A;  2WGV A;  3PBS A;  3OC2 A;  3EQV A;  5F82 A;  3VP0 A;  4BL2 A;  4EUZ A;  4U3T A;  4OPQ A;  3HLF A;  2FFY A;  1ZG4 A;  5DF9 A;  2HP5 A;  3S1Y A;  4OH0 A;  4Z9Q A;  1FSY A;  1H8Y A;  5CTN A;  3IXH A;  4K0X A;  2UWX A;  1JTD A;  4JXW A;  1GA0 A;  3RXW A;  5EEC A;  4E3M A;  3AGD A;  1K4E A;  3Q07 A;  3TOI A;  2R9W A;  2DCF A;  2Q9N A;  1ES5 A;  2ZQA A;  3FYZ A;  1CI8 A;  3GMW A;  4OQ0 A;  4QY6 A;  3S22 A;  1NZU A;  1XXM A;  3BRM A;  4R0Q A;  3Q82 A;  4WEL A;  4KZ3 A;  2IWC A;  1BUE A;  1FCN A;  4HBU A;  4JF4 A;  4FSF A;  2P9V B;  5JYP A;  1K25 A;  3QNC A;  1S0W A;  3PBT A;  1W7F A;  2ZC5 B;  4IVK A;  1CEG A;  2JCH A;  1YMX A;  4E6W A;  4CPK A;  2HDQ A;  3ITB A;  2J8Y A;  4RX2 A;  3BYD A;  1VM1 A;  4LV1 A;  1ESU A;  1K57 A;  3OZH A;  4WZ5 C;  4Y0T A;  4IBR A;  4OPR A;  5HAQ A;  2EXA A;  1YQS A;  4ZDX A;  4EV4 A;  1IYS A;  3G31 A;  1BUL A;  4IED A;  5HFO A;  2X71 A;  5A91 A;  1L0E A;  5CRF A;  4MBK A;  5U47 A;  1YLT A;  3UDI A;  2P74 A;  3PBN A;  1Y54 A;  3V39 A;  4QHC A;  5EVI A;  2WKE A;  3IXD A;  4YIN A;  3SOI A;  1XPB A;  3IWQ A;  1XX2 A;  1KVL A;  3PTE A;  4PMA A;  2PU4 A;  3Q7Z A;  4PM6 A;  1BT5 A;  3ZG8 B;  3IF5 A;  4DKI A;  5M18 A;  1PZO A;  1HVB A;  2WGI A;  1IKI A;  1GHM A;  4X55 A;  4X6T A;  3A3D A;  5FI6 A;  1JWV A;  5TR7 A;  4C75 A;  5KSC A;  4GOG A;  5TFQ A;  3SS3 A;  3WS2 A;  2G2W A;  1U60 A;  1EWZ A;  4DDY A;  1BZA A;  1MWU A;  4GB7 A;  5EE8 A;  2V2F F;  3IQA A;  3ZFZ A;  1GHI A;  4D2O A;  1WE4 A;  4LV3 A;  4EBL A;  4RA7 A;  4K0W A;  2ZQD A;  1EI5 A;  1I2W A;  3BFF A;  3VP1 A;  2FFF B;  5E2H A;  3WS1 A;  2OLV A;  2XGN A;  3D4F A;  4QU3 A;  1KDS A;  4KG6 A;  5AQB A;  4OOY A;  4H8R A;  3OCL A;  3C4O A;  4OP5 A;  1IEM A;  4R1G A;  4ZTK A;  4UAA A;  1K55 A;  4KZ6 A;  4R3B A;  1K54 C;  3GRJ A;  3NC8 A;  5EPH A;  2ZQC A;  2ZJ9 A;  5KZH A;  2ZD8 A;  3BFE A;  2J9O A;  4Y7P A;  1PW8 A;  5CGW A;  3Q1F A;  1MWS A;  1H8Z A;  3S4X A;  3E2K A;  4KZ5 A;  4HEF A;  1ALQ A;  1FR1 A;  2Y91 A;  2ZM0 A;  5HAP A;  3Q81 A;  2Y59 A;  4N1H A;  1RGY A;  2X02 A;  3WRZ A;  3ZDJ A;  1N4O A;  4LCL A;  1PWD A;  1WYB A;  3UPP A;  1NJ4 A;  4P6B A;  3PBO A;  4FD8 A;  2HDU A;  4YFM A;  3MXS A;  3B3X A;  5HX9 A;  1XKZ A;  5IHV A;  3UE3 A;  4B4X A;  3P98 A;  4MEZ A;  5GLD A;  1ZG6 A;  5GHY A;  3PBR A;  3HUM A;  4KG2 A;  4S2L A;  4XXR A;  2WGW B;  4DE2 A;  4OKP A;  1YLZ A;  1G68 A;  1ES3 A;  2Y4A A;  2ZC6 B;  3VP4 A;  1OME A;  4OQI A;  4UA7 A;  1E25 A;  3UNW A;  3WS5 A;  3LCE A;  3MBZ A;  2ZC4 B;  4KZ8 A;  3BEB A;  5FAT A;  5DF8 A;  1BLS A;  3HLE A;  5CXW A;  2JBF A;  1NYM A;  2Y2Q A;  3MZF A;  5E43 A;  3MZE A;  3I7J A;  1SDN A;  3BFG A;  3RJU A;  3N6I A;  1MWR A;  5F1F A;  1BSG A;  5FQM A; 
#chains in the Genus database with same CATH topology
 4DRT A;  3M2J A;  1XA7 A;  4GZB A;  4R23 A;  4ZJ2 A;  4WEJ A;  3C4P A;  3EOI A;  1MKM A;  2PR5 A;  3TG9 A;  1XJ4 A;  3WWX A;  4E3L A;  1N9O A;  4DDS A;  2I72 A;  4DE1 A;  4HJ6 A;  1IYO A;  2WKQ A;  3OCN A;  3WS0 A;  4BJP A;  5AJG A;  1MPL A;  2W3G A;  4WLA A;  4D60 A;  4OLD A;  1K6R A;  5FQ9 A;  2VGK A;  4R4R A;  2W1T A;  3H7W B;  4DJ3 A;  3W4O A;  3VV4 A;  3W4Q A;  3SH9 A;  3HUO A;  4KZ7 A;  4L0L A;  4R4S A;  3N8R A;  2HJ9 C;  2H0T A;  3MF0 A;  3A3J A;  4DMZ A;  4GNU A;  5FQJ A;  4DF6 A;  4Y2F A;  1L0D A;  2HDS A;  1MC0 A;  3H82 B;  4LV0 A;  2XDM A;  1SKF A;  4E3O A;  1MZU A;  2H10 A;  5EVI B;  4XUZ A;  4KZB A;  3VE3 A;  1TEM A;  5EV0 A;  5G4Z A;  5JYO A;  2C6W B;  3C7V A;  4B4Z A;  1S66 L;  3GSG A;  1KVM A;  1S67 L;  5DF7 A;  4RYE A;  3OPP A;  4NXG A;  1LI0 A;  1PRQ A;  5IS1 A;  2PYP A;  3VSL A;  2B5R A;  3SW1 A;  4JF5 A;  1NZO A;  2A2L A;  4UA9 A;  2GNX A;  4PPR A;  3LFV A;  4QD4 A;  3HCY A;  1L2S A;  3ZNY A;  2QWS A;  1T19 A;  3S7P A;  2WUQ A;  2OSU A;  5FQK A;  2HV1 A;  4KG5 A;  3VFH A;  4EUV A;  5K5B A;  2OAP 1;  2H0Y A;  3PYP A;  1SZV A;  3MS6 A;  1E4D A;  3DTM A;  3O3V A;  4JBF A;  1W5D A;  3ZQ5 A;  1KE3 A;  4PM9 A;  4R70 A;  3NJA A;  3V50 A;  4CLC E;  1TS6 A;  2O9C A;  1NRJ A;  2YKH A;  3GR2 A;  1K55 C;  3UB7 A;  5EM1 A;  2FZ0 A;  4WZ4 A;  1G6A A;  3IS2 A;  4OQH A;  5DTT A;  1G28 A;  1PWG A;  3T4T A;  5CGS A;  5FAQ A;  3DWZ A;  2EX6 A;  2P9V A;  1JWZ A;  4JPM A;  3ISG A;  1DP9 A;  3G2Z A;  1ZKJ A;  3CJM A;  2V8C A;  5IT5 A;  3BW6 A;  3FKV A;  2LB5 A;  4CLC A;  1K54 A;  3BLS A;  1HZO A;  4HH2 A;  1N9B A;  1XA1 A;  3SZT A;  3CAX A;  1LI9 A;  3KSH A;  2P04 A;  2EX2 A;  4GHI B;  5A90 A;  4LV2 A;  1PYY A;  1ERM A;  5DFY A;  4OLG A;  4BMW A;  3G35 A;  3SS4 A;  5FEG A;  4HHD A;  1Q2P A;  1H0M A;  1BLH A;  5E2G A;  5A8B A;  3CZD A;  3N7W A;  3NY4 A;  1JVJ A;  3V3S A;  1OPX A;  2Z6D A;  3PAE A;  2Y2I A;  3T12 B;  2Y2L A;  1E3U A;  1MWT A;  3A3E A;  3BQ8 A;  3ZG9 B;  3QP5 A;  4X1M A;  4BBV A;  3HLG A;  2Y2K A;  4DN0 A;  5EVI C;  4P87 A;  1VEU B;  1DRM A;  1F2K A;  4NEE D;  4Z1W A;  5AVF A;  5E2F A;  3UME A;  3CMZ A;  1PI4 A;  4O7D A;  5GLB A;  5EUA A;  3VFF A;  4GD6 A;  5EOE A;  4S2O A;  3G32 A;  1O7E A;  1LL5 A;  1VHM A;  2ZQ9 A;  1S1Y A;  3W2Z A;  1HLU P;  1YM1 A;  4B88 A;  4YWZ A;  2XR0 A;  1D7E A;  4S2M A;  4BLM A;  3NHQ A;  4HJ4 A;  3T50 A;  4JXG A;  3C5A A;  3HL9 A;  2Y8H A;  1OT9 A;  1FIL A;  3TW8 A;  4IUK A;  3RFB A;  4G3V A;  1KOU A;  3S7Q A;  1ZG4 A;  3LIB A;  1H8M A;  1OT6 A;  1FSY A;  1P9R A;  4JXW A;  1GA0 A;  3T4K A;  1YKD A;  3TOI A;  4I5S A;  3GMW A;  1XXM A;  3U2A A;  3CUE C;  3Q82 A;  1BSG A;  4KZ3 A;  4I3A A;  4HBU A;  4JF4 A;  2W1R A;  1S0W A;  2ZC5 B;  4E6W A;  2HDQ A;  5J4E A;  4LV1 A;  1VM1 A;  3OZH A;  4Y0T A;  2WKR A;  2EXA A;  3BJN A;  2JKT I;  1YQS A;  4KUO A;  4O01 A;  4EV4 A;  1OJG A;  3E4P A;  2Y79 A;  5HFO A;  2X71 A;  4G3W A;  2L4R A;  3UDI A;  2P74 A;  4MMN A;  3IWQ A;  2E8J A;  3LIE A;  4Q0J A;  1XX2 A;  2XSS A;  1BT5 A;  5M18 A;  1OTI A;  5FI6 A;  1HVB A;  4X55 A;  1GHM A;  4X6T A;  2INW A;  1JWV A;  4C75 A;  5TFQ A;  3SS3 A;  3WS2 A;  2G2W A;  1U60 A;  4JGP A;  5EE8 A;  1GSW A;  4NXF A;  4D2O A;  4P6Z M;  4EBL A;  4RA7 A;  3F1P A;  2V1B A;  1I2W A;  3BFF A;  2FFF B;  2XGN A;  4OOY A;  2DMW A;  1V9Y A;  4XT2 A;  2ZQC A;  3BFE A;  2J9O A;  4L9E A;  3Q1F A;  1FR1 A;  2KLI A;  2ZM0 A;  5HAP A;  4N1H A;  1RGY A;  3ZDJ A;  3T1R A;  3PBO A;  3K3D A;  3DTK A;  5HWW A;  4MEZ A;  4MN5 A;  5GHY A;  3HUM A;  4XXR A;  1OME A;  1E25 A;  3UNW A;  2W3D A;  2ZC4 B;  3HLE A;  2JBF A;  1NYM A;  2Y2Q A;  3QP6 A;  1SDN A;  3BFG A;  2O9B A;  5F1F A;  3CHW P;  3E98 A;  5FQM A;  2WZZ A;  3QP2 A;  2VGL M;  3T1S A;  3LR4 A;  5I94 A;  3IF6 A;  4E04 A;  1N9L A;  2PU2 A;  3F1N A;  3ZVT A;  3LY3 A;  2ZC3 B;  4E3J A;  3LGO A;  2Y2M A;  4KQO A;  2JC7 A;  1DJC A;  4S2N C;  1NRF A;  3UN7 A;  3KX0 X;  3CPT A;  3ZHH A;  2EFU A;  4N1X A;  4Y3I A;  5CEB A;  2V1A A;  5EVE A;  2ZQ7 A;  4OVD A;  1JTG A;  2Y2H A;  3UE1 A;  2XK1 A;  5AQA A;  1K6S A;  4EQI A;  1WA9 A;  4GDB A;  2WKH A;  3AGE A;  3HLC A;  1TDG A;  3F1O A;  2ZL1 B;  4NXB A;  3UDF A;  3LYX A;  5FAO A;  1TVF A;  2Y2P A;  3A3I A;  2ZM2 A;  3NDG A;  4JKT A;  5CX7 A;  3RH8 B;  3LR3 A;  5AVE A;  4NKP A;  4Q8I A;  3AGF A;  3O87 A;  4E3K A;  1O07 A;  4L9G A;  4PKY A;  4GS9 A;  1BTL A;  2DRW A;  5CGX A;  1Y4O A;  4HBT A;  4N92 A;  3R7W B;  1CJF A;  2IA2 A;  4C3Q A;  3C7U A;  5F69 A;  1ERO A;  2XH9 A;  5FI2 A;  1K57 C;  3W8K A;  3V5M A;  3VP2 A;  3NEC A;  3U4L P;  4ZAM A;  4EEU A;  1E3U D;  2XA7 M;  1UWN X;  4AFI A;  5GLC A;  2Y2G A;  4M4X A;  5FDS A;  3SS5 A;  5AQ7 A;  1FOF A;  3VOY A;  3LY4 A;  3NBL A;  3E4O A;  3P7N A;  1EW0 A;  4KQD A;  4RQ9 A;  4DJ2 A;  1DP8 A;  2OLU A;  4BD0 A;  3UY6 A;  1ACF A;  4K08 A;  4JGR A;  4H6J A;  5HDD A;  5CTM A;  1F98 A;  4OPY A;  3MQ0 A;  3Q7V B;  5GHX A;  1T1C A;  4FOF A;  4ID4 A;  3MQQ A;  2O0Y A;  4MN7 A;  3UE0 A;  1DY6 A;  2PYR A;  3EQU A;  3HUN A;  2XRO A;  1DJA A;  2EX9 A;  2W3F A;  2EA9 A;  3NIA A;  3G6O A;  2XD5 A;  3KSI A;  3OBF A;  4DXB A;  3FZC A;  2PBY A;  4UA6 A;  3WS4 A;  3ZGA B;  2VZW A;  1NYY A;  1M6K A;  4X53 A;  2Z6C A;  2G2U A;  3IT9 A;  4L9F A;  1XGJ A;  4HQA A;  1OTE A;  1KGG A;  1ESI A;  4JXV A;  1IKG A;  3VOZ A;  4UQI S;  4PM7 A;  5E2E A;  3FPV A;  2XFS A;  2O9A A;  2V8F A;  2GDN A;  3A0S A;  4BEN A;  4LRZ E;  2XLN A;  3KO6 A;  1AXB A;  5G18 A;  2Z2L B;  1VB6 A;  1GSV A;  4ARZ A;  4JLF A;  3WRT A;  1HD8 A;  1ZHH B;  1MXO A;  3E4Q A;  3IXG A;  1KDW A;  4FCF A;  1S4S A;  3O88 A;  3UDX A;  1ERQ A;  2A49 A;  3CWF A;  3VMA A;  4ZBE A;  5DFX A;  1F5M A;  5KSH A;  2XD1 A;  3MKF A;  3V3R A;  1JNU A;  5F5Y A;  5DTS A;  5FAP A;  4KZ9 A;  3VSK A;  4KZA A;  3S7N A;  3BFD A;  3PBQ A;  1ODV A;  2ZQ8 A;  2BG1 A;  3QP4 A;  3NOP C;  1SDE A;  4DXC A;  1PZP A;  4HP4 A;  1PI5 A;  2HPB A;  1NY0 A;  2W27 A;  2XEP A;  5M1A A;  3OC2 A;  3EQV A;  4BL2 A;  1YAX A;  5DF9 A;  3S1Y A;  4Z9Q A;  1H8Y A;  4K0X A;  2M1C A;  3A0R A;  4E3M A;  3AGD A;  2A24 B;  2PD8 A;  4O8G A;  1ES5 A;  4OQ0 A;  1DP6 A;  3H7W A;  2GZA A;  4IUH A;  4R0Q A;  5I5L A;  5JYP A;  1K25 A;  1W7F A;  4HY8 A;  4I3J A;  4IVK A;  2JCH A;  2J8Y A;  1ESU A;  5HAQ A;  1GSX A;  3G31 A;  4GJ4 A;  4IED A;  5A91 A;  2B02 A;  5U47 A;  3LIC A;  3PBN A;  1Y54 A;  3MQO A;  5EVI A;  3LIF A;  5EM0 A;  3SOI A;  4PMA A;  1KVL A;  3PTE A;  2GJ3 A;  3IF5 A;  4DKI A;  2WGI A;  3A3D A;  1EWZ A;  4DDY A;  4EES A;  4IHQ A;  1VET B;  3IQA A;  3ZFZ A;  1GHI A;  5HPF A;  1YSP A;  1EI5 A;  2VK3 A;  3D4F A;  3MJQ A;  2JN7 A;  4OP5 A;  1P0Z A;  3LID A;  4UEY A;  4UAA A;  5EFW A;  4CLC C;  1K54 C;  5EPH A;  3QP8 A;  4Y7P A;  1PW8 A;  3UB6 A;  5TJJ A;  3L9K A;  4HEF A;  2B18 A;  2J3T D;  4GLQ A;  1ALQ A;  3Q81 A;  2Y59 A;  2VLG A;  3WRZ A;  3EGX C;  4LCL A;  3P01 A;  3E0Y A;  1WYB A;  1NJ4 A;  2JKR M;  2HDU A;  2WKP A;  3B3X A;  2KDK A;  4HNB A;  3UE3 A;  4YOF A;  3P98 A;  4B4X A;  2G7U A;  1XJ6 A;  2K2N A;  4KG2 A;  2WGW B;  2Y4A A;  1G68 A;  1ES3 A;  3VP4 A;  1SKO B;  3LI8 A;  2LB9 A;  3DTE A;  1W63 Q;  1TF1 A;  1G5U A;  3MZF A;  3MZE A;  2W3E A;  1MWR A;  5LBR A;  2V1Z A;  3N8S A;  2P7J A;  4KUK A;  4F3L B;  2ZMA A;  1OTA A;  3MFX A;  1KE4 A;  3MKE A;  1VQQ A;  1NLZ A;  2HZ5 A;  3IX3 A;  4QJG A;  4X56 A;  4NET A;  5GLA A;  2WYX A;  2EWV A;  1XGI A;  4Y13 A;  2WKI A;  2IWD A;  1FQG A;  2PD7 A;  3GV9 A;  3K2N A;  2IWB A;  1TD5 A;  2EX8 A;  3C38 A;  2RL3 A;  2QMI A;  1T1A A;  3N4I A;  3N8L A;  1XJ3 A;  5AQ9 A;  1RP5 A;  3HLD A;  3BLM A;  4MLL A;  3LEQ A;  4PM8 A;  1BLC A;  3NOU C;  4GHI A;  5HW3 A;  4JXS A;  4GDN A;  4WM9 A;  3BM6 A;  4PKY G;  3G30 A;  1GA9 A;  4BBT A;  2ZOH A;  3FV7 A;  4Y17 A;  4GKU A;  3IX4 A;  5FEF A;  5D3O A;  2CC1 A;  3IX8 A;  4EU0 A;  3HJK A;  4LRY C;  1KGF A;  3W4P A;  1OTB A;  1A0K A;  2ZLY A;  1L0F A;  1RCJ A;  4GW9 A;  3BWL A;  2OWH A;  3G4P A;  4OOM A;  1YMS A;  1K0K A;  1W63 M;  2QHK A;  2D02 A;  1HTZ A;  2ZC7 A;  4N9L A;  2ZOI A;  1IYQ A;  3DTI A;  1NLY A;  2B95 A;  2DNS A;  3IH9 A;  2CMN A;  4HES A;  2NUP C;  4P85 A;  1CEF A;  4GS9 B;  1VEU A;  5FAS A;  1SHV A;  5HWV A;  3NI9 A;  3M2K A;  2V0W A;  2PT7 A;  5TBM B;  5DTK A;  4R3A A;  4KQQ A;  3T1Q B;  2BTF P;  2PR6 A;  5CHM A;  1NXY A;  4IVI A;  4X1L A;  4WYY A;  4GD8 A;  5L2F A;  4EXO A;  2XQZ A;  3NCK A;  3G34 A;  3HJI A;  2P08 A;  4MN6 A;  2HDR A;  5L8M A;  3GVB A;  4WZ5 A;  4MCW A;  3UPO A;  3IXB A;  4QPR A;  3EWK A;  4U0T A;  4OQG A;  4HI4 A;  3RXX A;  1YLW A;  5FA7 A;  4ME4 A;  1YT4 A;  4WEK A;  4FTX A;  3D72 A;  1J9M A;  4ZJ3 A;  2ZMV A;  2HP9 A;  4X68 A;  1YLY A;  1TDL A;  5F1G A;  5G4Y A;  2WK0 A;  4WF0 A;  4E3N A;  4FH4 A;  4M3K A;  1GCE A;  2OAQ 1;  1QMF A;  2BLS A;  3B42 A;  2X01 A;  1P97 A;  4EWF A;  1ONG A;  4U0X A;  2RCX A;  3CI6 A;  4OP8 A;  4PAU A;  3EEH A;  4IJG A;  1PNE A;  1ZTU A;  4S2K A;  5FQQ A;  2L0W A;  2Y2N A;  2XFT A;  2ZMF A;  3IWI A;  2Y2O A;  1K38 A;  1XP4 A;  2W1T B;  3KSF A;  1LL9 A;  2R78 A;  4LPZ A;  4Y15 A;  4MBH A;  4S2I A;  4EBN A;  3MFD A;  1LT0 A;  1Z09 A;  3HLB A;  2E8I A;  5L09 A;  1N9N A;  3MMH A;  3SH8 A;  3FG8 A;  4LFU A;  4Y5F A;  2ZBB A;  4Q0H A;  3IF6 C;  4WMC D;  5A93 A;  1DJB A;  2WAD A;  5IU1 A;  4X69 A;  4Y0U A;  1Z6F A;  3ICY A;  1CQA A;  3NOT C;  5EVI D;  1J3W A;  4UHU A;  4MBF A;  4E6X A;  3HLW A;  3RTY A;  1FR6 A;  1M40 A;  2XRN A;  4KEN B;  3PR6 A;  1C3B A;  2JE5 A;  1D06 A;  1IYP A;  3IWO A;  2VEA A;  2I9V A;  1PFL A;  4I3I A;  3OPR A;  3ZG5 A;  3JPU A;  3GTC A;  2JKR I;  5HAI A;  4FH2 A;  1BYW A;  4S2J A;  2VV6 A;  1K56 A;  1L0G A;  3UB8 A;  5CER A;  4WBG A;  3CLO A;  4LGW A;  3T4O A;  3C30 A;  5DKK A;  2V20 A;  2JKF A;  2A3U A;  3T4S A;  4QB8 A;  2FH5 A;  3S7O A;  2PRF A;  4JF6 A;  1T1B A;  5FQI A;  2Y2J A;  3PHY A;  2J7V A;  4LRX C;  4EET B;  4LCM A;  2O99 A;  3PBS A;  3VP0 A;  4EUZ A;  3HLF A;  2UWX A;  5HL6 A;  1JTD A;  1XFQ A;  3RXW A;  3IS2 B;  1K4E A;  2PBD P;  3H9W A;  3BY9 A;  1LSX A;  2Q9N A;  4ETZ A;  4HJ3 A;  3S22 A;  4QY6 A;  1NZU A;  3OLO A;  3NUL A;  1BUE A;  1FCN A;  2P9V B;  3JVU A;  4CPK A;  3ITB A;  3GEC A;  5HZH A;  3TE8 A;  4OPR A;  4ZDX A;  1IYS A;  4MDZ A;  4CLC B;  1BUL A;  2NUT C;  1IOU A;  2ZL1 A;  3C2W A;  5CRF A;  2M7V A;  4WUJ A;  3V39 A;  4R38 A;  2JKT M;  2WKE A;  3IXD A;  3B33 A;  3LR5 A;  4YIN A;  1XPB A;  3C8C A;  2PU4 A;  4PM6 A;  3ZG8 B;  2VA0 A;  1PZO A;  1IKI A;  4GOG A;  5J7E A;  1BZA A;  1MWU A;  1WE4 A;  4K0W A;  5C5K A;  3R7W A;  2ZQD A;  1STZ A;  2HF6 A;  4ZRR A;  3WS1 A;  1KDS A;  5AQB A;  4H8R A;  3OCL A;  4ZTK A;  5J3W A;  5HSQ A;  1K55 A;  2V9A A;  4R3B A;  3NC8 A;  2ZJ9 A;  1AWI A;  1MWS A;  3S4X A;  3E2K A;  4KZ5 A;  2M7U A;  1L3L A;  2Y91 A;  4G3K A;  4JGQ A;  1PWD A;  4FD8 A;  3MSH A;  1XKZ A;  3PBR A;  4S2L A;  4DE2 A;  4OKP A;  1P9W A;  5HDS A;  1TS7 A;  1YLZ A;  1X0O A;  2ZC6 B;  4UA7 A;  3WS5 A;  3LCE A;  4KZ8 A;  1BLS A;  1TS8 A;  5CXW A;  2JKG A;  3I7J A;  2ACG A;  2H28 A;  3MR0 A;  4BD1 A;  2MJ6 A;  4FUW A;  2K7S A;  3A0V A;  3ULF A;  4OPZ A;  5L07 A;  3Q7V A;  3BY8 A;  4BL3 A;  3TSG A;  3T4Q A;  3UO9 A;  3LUQ A;  1ES2 A;  2EFX A;  1V9Z A;  1PIO A;  2W0N A;  4UQI M;  4RX3 A;  4R6L A;  3T4L A;  5DKL A;  3R4K A;  4JGO A;  3O5Y A;  3KYZ A;  3TRC A;  5DVA A;  2VV7 A;  2PHY A;  4XUX A;  1NWZ A;  4E3I A;  2XF3 A;  4KZ4 A;  4WMC A;  2HJE A;  1LSV A;  2WAE A;  4WN5 A;  3ZNT A;  1FCM A;  2J3W A;  3K3C A;  4A5R A;  3H82 A;  4YNR A;  1IEL A;  1KGE A;  2W3H A;  3E2L A;  3PAG A;  3LR0 A;  3JYI A;  1UWP X;  4BQM A;  3MXQ A;  2OV5 A;  3TJZ C;  3NDE A;  4NG2 A;  2VX8 A;  1ONH A;  4EQ1 A;  4HOI A;  1FCO A;  4LEN A;  1YLJ A;  2EWW A;  2R9X A;  5KIZ A;  3DWK A;  1LHY A;  5A92 A;  3T1X A;  1D1J A;  2YKF A;  5TGF A;  3DW0 A;  4N9K A;  3FC7 A;  1CI9 A;  5M19 A;  3F1P B;  2VGJ A;  3VP3 A;  4ESP A;  1CK3 A;  3EEA A;  3ZCZ A;  2QJ7 A;  3UB5 P;  4NK3 A;  1W8Q A;  3MZD A;  3FWL A;  4XT2 B;  4K91 A;  5BOH A;  5J8X A;  1WYC A;  5EOO A;  2QYB A;  3SH7 A;  1YSQ A;  1I5Q A;  5F6A A;  1ES4 A;  3BFC A;  4X25 A;  1JWP A;  1PWC A;  3IHA A;  4P0M A;  1MBL A;  2BAS A;  2JHE A;  4P6Z S;  3ITA A;  3CUE A;  1KE0 A;  4F94 A;  1I2S A;  1MY8 A;  2C5W B;  5HPI A;  5CHJ A;  2QPN A;  4GN2 A;  1YLP A;  5KMW A;  4B9O A;  4C6Y A;  3T4J A;  5EVL A;  3HBR A;  1MKI A;  1PW1 A;  1K56 D;  1F9I A;  3PXP A;  4MNR A;  2HP6 A;  4BWI A;  2A24 A;  3A3F A;  3KSG A;  3G2Y A;  5GHZ A;  3IF6 B;  2H5S A;  4OOL A;  3LEZ A;  4I38 A;  3F1N B;  1UGU A;  2Z2M B;  4RVA A;  2OOL A;  3UPN A;  3MXR A;  4ETX A;  3LO7 A;  5CED A;  3ZG7 B;  1TS0 A;  2J80 A;  3GQZ A;  3DBA A;  4OON A;  3OPH A;  2EXB A;  3CPT B;  3HVF A;  3O86 A;  3LI9 A;  3KYQ A;  4EEP A;  5FSR A;  2VGL S;  1FSW A;  5F83 A;  2WAF A;  4EBP A;  3D3O A;  4S2P A;  3IH8 A;  5HD3 A;  3QHY A;  3CG5 A;  5F68 A;  1QME A;  1RGZ A;  2WZX A;  2VKS A;  3F1O B;  1S6R A;  1CF0 A;  1Y28 A;  1H3Q A;  4BBU A;  1W8Y A;  1VET A;  4HP9 A;  3L7H A;  1SCW A;  4LLO B;  2Y55 A;  1OTD A;  4QY5 A;  2HGV A;  4PM5 A;  3ZG0 A;  4IBX A;  5FDH A;  2J9P A;  4DE0 A;  2KOI A;  2OWJ A;  1XFN A;  3ZYT A;  3FKW A;  1W79 A;  5CEC A;  4QWO A;  2VV8 A;  4R3J A;  2Q9M A;  4DE3 A;  4WL9 A;  3JVV A;  5CHU A;  1YPR A;  3IBJ A;  3HRE A;  3UE6 A;  1OJ5 A;  3P09 A;  3CIT A;  2K31 A;  5GL9 A;  3DAV A;  2L1M A;  3OOV A;  3QNB A;  4Y0O A;  5HL1 A;  1Q2Q A;  4S2N A;  2WGW A;  2QZ6 A;  1ZC2 A;  2UV0 E;  4ZJ1 A;  4II7 A;  1BLP A;  1SKO A;  3OPL A;  1H5X A;  3ZVW A;  3IHB A;  5HAR A;  3FPW A;  4CJN A;  2VJW A;  3V67 A;  3M6H A;  3BEC A;  3KYE A;  5FI7 A;  3EGD C;  5HD5 A;  4F3L A;  3BQA A;  1G6O A;  1K4F A;  3UB9 A;  1S4R A;  2ZM8 A;  1GHP A;  2Q0O A;  1T18 A;  3M6B A;  3LIA A;  1LLB A;  2WGV A;  5F82 A;  4U3T A;  4OPQ A;  2FFY A;  2XA7 S;  2HP5 A;  4OH0 A;  4H6J B;  5CTN A;  3IXH A;  2QKP A;  2KX6 A;  5EEC A;  5L10 A;  3Q07 A;  2R9W A;  2DCF A;  2ZQA A;  3FYZ A;  1CI8 A;  2GX5 A;  5MC7 A;  3BRM A;  4PHT A;  1IFQ A;  1LSW A;  4WEL A;  2IWC A;  2D01 A;  4FSF A;  5HDC A;  3QNC A;  3PBT A;  1CEG A;  1YMX A;  5DJU A;  4RX2 A;  3BYD A;  1K57 A;  4WZ5 C;  4IBR A;  1L0E A;  4MBK A;  4EW7 A;  1YLT A;  1S1Z A;  4QHC A;  3QP1 A;  4HH3 A;  3Q7Z A;  2PDR A;  4I39 A;  3VOL A;  5TR7 A;  5KSC A;  2V0U A;  4CLC D;  4GB7 A;  2V2F F;  3VE4 A;  4GCZ A;  3UMD A;  4LV3 A;  3VP1 A;  5E2H A;  4Q0I A;  2OLV A;  3D9Y A;  4QU3 A;  4KG6 A;  3C4O A;  4R1G A;  1IEM A;  4ARZ B;  3B47 A;  4KZ6 A;  3GRJ A;  5HWT A;  4B93 A;  5KZH A;  2ZD8 A;  5TBM A;  5CGW A;  1H8Z A;  5DJT A;  5FL3 A;  3IBR A;  2X02 A;  1N4O A;  4NXE A;  3UPP A;  4P6B A;  4O0P A;  4YFM A;  3MXS A;  5HX9 A;  5IHV A;  2QJ5 A;  2PAV P;  4HIA A;  5GLD A;  1ZG6 A;  1XJ2 A;  4OQI A;  2J3T C;  3MBZ A;  4EER A;  1LL8 A;  5FAT A;  3BEB A;  4CQH A;  5DF8 A;  1FIK A;  3GDI A;  2AVX A;  5E43 A;  3RJU A;  3N6I A;  4KQR A; 
#chains in the Genus database with same CATH homology
 4DRT A;  2V1Z A;  3M2J A;  1XA7 A;  2WZZ A;  4BD1 A;  4GZB A;  3N8S A;  4R23 A;  4ZJ2 A;  4WEJ A;  2ZMA A;  4OPZ A;  3C4P A;  3Q7V A;  5I94 A;  3IF6 A;  4BL3 A;  3TG9 A;  3TSG A;  1KE4 A;  3UO9 A;  3WWX A;  4E3L A;  2PU2 A;  1ES2 A;  3ZVT A;  3LY3 A;  2ZC3 B;  3MKE A;  1VQQ A;  4E3J A;  4DDS A;  4QJG A;  2I72 A;  4X56 A;  4NET A;  5GLA A;  4DE1 A;  2EFX A;  2Y2M A;  4KQO A;  2WYX A;  1IYO A;  1XGI A;  1PIO A;  3OCN A;  2JC7 A;  4RX3 A;  3WS0 A;  4BJP A;  1DJC A;  2WKI A;  2IWD A;  4S2N C;  1FQG A;  1MPL A;  3GV9 A;  1NRF A;  4OLD A;  3UN7 A;  1K6R A;  2IWB A;  5DVA A;  5FQ9 A;  2VGK A;  4XUX A;  3ZHH A;  2EFU A;  4E3I A;  2EX8 A;  2XF3 A;  2RL3 A;  4R4R A;  4KZ4 A;  4N1X A;  2QMI A;  4WMC A;  3N4I A;  3N8L A;  2WAE A;  3ZNT A;  3W4O A;  1FCM A;  5AQ9 A;  1RP5 A;  5CEB A;  3HLD A;  3W4Q A;  3SH9 A;  3HUO A;  3BLM A;  2ZQ7 A;  4OVD A;  4MLL A;  4A5R A;  4KZ7 A;  1IEL A;  4PM8 A;  1BLC A;  5HW3 A;  4L0L A;  4R4S A;  4JXS A;  1KGE A;  1JTG A;  2Y2H A;  3E2L A;  3PAG A;  3N8R A;  4GDN A;  3UE1 A;  2XK1 A;  5AQA A;  4WM9 A;  2H0T A;  3BM6 A;  3A3J A;  3JYI A;  1K6S A;  4GNU A;  5FQJ A;  4EQI A;  4GDB A;  2WKH A;  3G30 A;  1GA9 A;  4DF6 A;  3AGE A;  3HLC A;  1TDG A;  4BQM A;  1L0D A;  2OV5 A;  3FV7 A;  2HDS A;  3NDE A;  4LV0 A;  2XDM A;  1SKF A;  4E3O A;  4GKU A;  1ONH A;  2H10 A;  3UDF A;  5EVI B;  4XUZ A;  5FAO A;  1TVF A;  2Y2P A;  4KZB A;  3A3I A;  1FCO A;  5D3O A;  4LEN A;  2CC1 A;  1TEM A;  2ZM2 A;  3NDG A;  1YLJ A;  4JKT A;  5JYO A;  2R9X A;  2C6W B;  1KGF A;  3C7V A;  3DWK A;  4B4Z A;  3W4P A;  4Q8I A;  1LHY A;  3GSG A;  1KVM A;  2ZLY A;  1L0F A;  1RCJ A;  3AGF A;  4RYE A;  5DF7 A;  3O87 A;  3OPP A;  5TGF A;  4E3K A;  1O07 A;  3G4P A;  4OOM A;  3DW0 A;  4N9K A;  1LI0 A;  1BTL A;  1YMS A;  2DRW A;  5CGX A;  4HBT A;  2ZC7 A;  1HTZ A;  4N9L A;  3VSL A;  4N92 A;  1CI9 A;  1IYQ A;  5M19 A;  2B5R A;  2VGJ A;  4C3Q A;  3C7U A;  3VP3 A;  1CK3 A;  4JF5 A;  2DNS A;  3IH9 A;  1ERO A;  3ZCZ A;  4HES A;  2XH9 A;  5FI2 A;  4P85 A;  1K57 C;  1CEF A;  3W8K A;  1NZO A;  3V5M A;  3VP2 A;  4NK3 A;  5FAS A;  4ZAM A;  4UA9 A;  1W8Q A;  1SHV A;  3MZD A;  3FWL A;  4K91 A;  5BOH A;  3NI9 A;  3M2K A;  5J8X A;  4PPR A;  4QD4 A;  1WYC A;  5DTK A;  5EOO A;  3SH7 A;  1I5Q A;  4KQQ A;  1E3U D;  1L2S A;  3ZNY A;  1ES4 A;  3BFC A;  1JWP A;  1PWC A;  3IHA A;  4P0M A;  1MBL A;  2WUQ A;  5CHM A;  1NXY A;  2OSU A;  4IVI A;  3ITA A;  4WYY A;  4GD8 A;  5L2F A;  5FQK A;  2Y2G A;  1KE0 A;  4KG5 A;  5GLC A;  4F94 A;  3VFH A;  2XQZ A;  3NCK A;  1I2S A;  3G34 A;  2H0Y A;  3SS5 A;  1MY8 A;  2C5W B;  2HDR A;  5AQ7 A;  3GVB A;  4WZ5 A;  5CHJ A;  1FOF A;  2QPN A;  3VOY A;  3UPO A;  3IXB A;  3LY4 A;  4GN2 A;  1E4D A;  3NBL A;  4OQG A;  4U0T A;  3RXX A;  1YLP A;  3DTM A;  5KMW A;  1YLW A;  3O3V A;  4JBF A;  4C6Y A;  1W5D A;  1KE3 A;  4PM9 A;  5EVL A;  3HBR A;  5FA7 A;  1YT4 A;  3V50 A;  4WEK A;  1MKI A;  1PW1 A;  1K56 D;  1J9M A;  2OLU A;  4ZJ3 A;  4BD0 A;  2HP9 A;  4X68 A;  3UY6 A;  3GR2 A;  1YLY A;  5A92 A;  1K55 C;  1TDL A;  5F1G A;  2WK0 A;  4MNR A;  4E3N A;  4FH4 A;  4WZ4 A;  1G6A A;  5CTM A;  2HP6 A;  4M3K A;  4OQH A;  1GCE A;  3A3F A;  4OPY A;  1QMF A;  3G2Y A;  3Q7V B;  5GHZ A;  5GHX A;  2BLS A;  5DTT A;  3IF6 B;  2H5S A;  4OOL A;  4ID4 A;  3LEZ A;  2X01 A;  1PWG A;  4EWF A;  1ONG A;  3UE0 A;  5CGS A;  2Z2M B;  5FAQ A;  1DY6 A;  2RCX A;  3DWZ A;  4RVA A;  4U0X A;  4OP8 A;  3MXR A;  2EX6 A;  3UPN A;  2P9V A;  3EQU A;  3LO7 A;  5CED A;  3ZG7 B;  1JWZ A;  3HUN A;  4JPM A;  4S2K A;  3ISG A;  3GQZ A;  1DJA A;  5FQQ A;  3G2Z A;  2EX9 A;  2Y2N A;  1ZKJ A;  3CJM A;  2XFT A;  4OON A;  3NIA A;  3OPH A;  2XD5 A;  3IWI A;  2EXB A;  3FKV A;  4DXB A;  3HVF A;  3FZC A;  2PBY A;  2Y2O A;  1K54 A;  1K38 A;  3O86 A;  4UA6 A;  1XP4 A;  5FSR A;  3BLS A;  1HZO A;  1N9B A;  3WS4 A;  1LL9 A;  3ZGA B;  1XA1 A;  4MBH A;  1FSW A;  5F83 A;  2WAF A;  1LI9 A;  1NYY A;  4S2I A;  4EBP A;  4EBN A;  3MFD A;  1M6K A;  3HLB A;  2EX2 A;  2E8I A;  4X53 A;  4S2P A;  2G2U A;  3IT9 A;  5A90 A;  4LV2 A;  1PYY A;  1ERM A;  1XGJ A;  4OLG A;  3IH8 A;  3QHY A;  3CG5 A;  1KGG A;  3G35 A;  3SS4 A;  1ESI A;  4JXV A;  1IKG A;  3SH8 A;  3VOZ A;  1QME A;  1RGZ A;  2WZX A;  4PM7 A;  1S6R A;  5E2E A;  1Q2P A;  3IF6 C;  4WMC D;  5A93 A;  1W8Y A;  2XFS A;  1DJB A;  2WAD A;  2GDN A;  1BLH A;  1SCW A;  5E2G A;  3CZD A;  3N7W A;  2Y55 A;  3NY4 A;  4X69 A;  1JVJ A;  4QY5 A;  4Y0U A;  3V3S A;  4BEN A;  1Z6F A;  4PM5 A;  3ZG0 A;  2XLN A;  4IBX A;  5EVI D;  4UHU A;  3PAE A;  4MBF A;  2Y2I A;  5FDH A;  4E6X A;  3HLW A;  1AXB A;  5G18 A;  2J9P A;  1FR6 A;  2Z2L B;  1M40 A;  2Y2L A;  1E3U A;  1MWT A;  4KEN B;  3A3E A;  4JLF A;  4DE0 A;  3WRT A;  1HD8 A;  1C3B A;  2JE5 A;  3IWO A;  1IYP A;  3FKW A;  3ZG9 B;  1MXO A;  1W79 A;  3IXG A;  5CEC A;  4R3J A;  2Q9M A;  4DE3 A;  1KDW A;  3HLG A;  4FCF A;  2Y2K A;  5CHU A;  3HRE A;  3O88 A;  3P09 A;  5EVI C;  4P87 A;  3UDX A;  1ERQ A;  5GL9 A;  2A49 A;  3OPR A;  3ZG5 A;  5E2F A;  3VMA A;  4ZBE A;  3GTC A;  3QNB A;  4Y0O A;  5HL1 A;  1Q2Q A;  4S2N A;  3CMZ A;  5KSH A;  5HAI A;  2XD1 A;  1PI4 A;  2WGW A;  4O7D A;  2QZ6 A;  1ZC2 A;  4FH2 A;  5EUA A;  5GLB A;  4ZJ1 A;  3MKF A;  3V3R A;  4S2J A;  3VFF A;  1BLP A;  1K56 A;  1L0G A;  4KQR A;  5CER A;  4WBG A;  4GD6 A;  3OPL A;  5EOE A;  4S2O A;  3G32 A;  1H5X A;  1O7E A;  3ZVW A;  3IHB A;  1LL5 A;  5HAR A;  2ZQ9 A;  5DTS A;  4CJN A;  3M6H A;  5FAP A;  4KZ9 A;  3BEC A;  5FI7 A;  4KZA A;  3VSK A;  3BFD A;  2V20 A;  3PBQ A;  1YM1 A;  4B88 A;  2A3U A;  2ZQ8 A;  2BG1 A;  2XR0 A;  1SDE A;  4QB8 A;  4S2M A;  4BLM A;  4DXC A;  1PZP A;  4JXG A;  4JF6 A;  1PI5 A;  2HPB A;  1NY0 A;  1K4F A;  3C5A A;  5FQI A;  2Y2J A;  3HL9 A;  2ZM8 A;  1GHP A;  2XEP A;  5M1A A;  3M6B A;  2J7V A;  4LCM A;  1LLB A;  2WGV A;  3PBS A;  3OC2 A;  3EQV A;  5F82 A;  3VP0 A;  4BL2 A;  4EUZ A;  4U3T A;  4OPQ A;  3HLF A;  2FFY A;  1ZG4 A;  5DF9 A;  2HP5 A;  3S1Y A;  4OH0 A;  4Z9Q A;  1FSY A;  1H8Y A;  5CTN A;  3IXH A;  4K0X A;  2UWX A;  1JTD A;  4JXW A;  1GA0 A;  3RXW A;  5EEC A;  4E3M A;  3AGD A;  1K4E A;  3Q07 A;  3TOI A;  2R9W A;  2DCF A;  2Q9N A;  1ES5 A;  2ZQA A;  3FYZ A;  1CI8 A;  3GMW A;  4OQ0 A;  4QY6 A;  3S22 A;  1NZU A;  1XXM A;  3BRM A;  4R0Q A;  3Q82 A;  4WEL A;  4KZ3 A;  2IWC A;  1BUE A;  1FCN A;  4HBU A;  4JF4 A;  4FSF A;  2P9V B;  5JYP A;  1K25 A;  3QNC A;  1S0W A;  3PBT A;  1W7F A;  2ZC5 B;  4IVK A;  1CEG A;  2JCH A;  1YMX A;  4E6W A;  4CPK A;  2HDQ A;  3ITB A;  2J8Y A;  4RX2 A;  3BYD A;  1VM1 A;  4LV1 A;  1ESU A;  1K57 A;  3OZH A;  4WZ5 C;  4Y0T A;  4IBR A;  4OPR A;  5HAQ A;  2EXA A;  1YQS A;  4ZDX A;  4EV4 A;  1IYS A;  3G31 A;  1BUL A;  4IED A;  5HFO A;  2X71 A;  5A91 A;  1L0E A;  5CRF A;  4MBK A;  5U47 A;  1YLT A;  3UDI A;  2P74 A;  3PBN A;  1Y54 A;  3V39 A;  4QHC A;  5EVI A;  2WKE A;  3IXD A;  4YIN A;  3SOI A;  1XPB A;  3IWQ A;  1XX2 A;  1KVL A;  3PTE A;  4PMA A;  2PU4 A;  3Q7Z A;  4PM6 A;  1BT5 A;  3ZG8 B;  3IF5 A;  4DKI A;  5M18 A;  1PZO A;  1HVB A;  2WGI A;  1IKI A;  1GHM A;  4X55 A;  4X6T A;  3A3D A;  5FI6 A;  1JWV A;  5TR7 A;  4C75 A;  5KSC A;  4GOG A;  5TFQ A;  3SS3 A;  3WS2 A;  2G2W A;  1U60 A;  1EWZ A;  4DDY A;  1BZA A;  1MWU A;  4GB7 A;  5EE8 A;  2V2F F;  3IQA A;  3ZFZ A;  1GHI A;  4D2O A;  1WE4 A;  4LV3 A;  4EBL A;  4RA7 A;  4K0W A;  2ZQD A;  1EI5 A;  1I2W A;  3BFF A;  3VP1 A;  2FFF B;  5E2H A;  3WS1 A;  2OLV A;  2XGN A;  3D4F A;  4QU3 A;  1KDS A;  4KG6 A;  5AQB A;  4OOY A;  4H8R A;  3OCL A;  3C4O A;  4OP5 A;  1IEM A;  4R1G A;  4ZTK A;  4UAA A;  1K55 A;  4KZ6 A;  4R3B A;  1K54 C;  3GRJ A;  3NC8 A;  5EPH A;  2ZQC A;  2ZJ9 A;  5KZH A;  2ZD8 A;  3BFE A;  2J9O A;  4Y7P A;  1PW8 A;  5CGW A;  3Q1F A;  1MWS A;  1H8Z A;  3S4X A;  3E2K A;  4KZ5 A;  4HEF A;  1ALQ A;  1FR1 A;  2Y91 A;  2ZM0 A;  5HAP A;  3Q81 A;  2Y59 A;  4N1H A;  1RGY A;  2X02 A;  3WRZ A;  3ZDJ A;  1N4O A;  4LCL A;  1PWD A;  1WYB A;  3UPP A;  1NJ4 A;  4P6B A;  3PBO A;  4FD8 A;  2HDU A;  4YFM A;  3MXS A;  3B3X A;  5HX9 A;  1XKZ A;  5IHV A;  3UE3 A;  4B4X A;  3P98 A;  4MEZ A;  5GLD A;  1ZG6 A;  5GHY A;  3PBR A;  3HUM A;  4KG2 A;  4S2L A;  4XXR A;  2WGW B;  4DE2 A;  4OKP A;  1YLZ A;  1G68 A;  1ES3 A;  2Y4A A;  2ZC6 B;  3VP4 A;  1OME A;  4OQI A;  4UA7 A;  1E25 A;  3UNW A;  3WS5 A;  3LCE A;  3MBZ A;  2ZC4 B;  4KZ8 A;  3BEB A;  5FAT A;  5DF8 A;  1BLS A;  3HLE A;  5CXW A;  2JBF A;  1NYM A;  2Y2Q A;  3MZF A;  5E43 A;  3MZE A;  3I7J A;  1SDN A;  3BFG A;  3RJU A;  3N6I A;  1MWR A;  5F1F A;  1BSG A;  5FQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...