4PM7A

Crystal structure of ctx-m-14 s70g:s237a in complex with cefotaxime at 1.29 angstroms resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGAGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis for the Catalytic Specificity of the CTX-M Extended-Spectrum beta-Lactamases.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Hydrolase/antibiotic
molecule keywords Beta-lactamase CTX-M-14
total genus 96
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4pm7A00
3PTEA 5A90A 1FQGA 2PU2A 4PM6A 1ES5A 1ONHA 5DTTA 4KZBA 4EWFA 2WKHA 3SS4A 1QMEA 5DTSA 1YLJA 5KMWA 3Q7VB 4WYYA 5EOEA 1ALQA 4EUZA 3AGDA 2FFFB 3VOYA 4S2LA 1LL9A 4OLGA 5FSRA 4EBNA 1GA9A 2HPBA 4N92A 3BECA 1ESUA 3GVBA 2JE5A 1GHMA 2Y2OA 1ZKJA 3HUOA 3RXXA 3IH8A 1CK3A 4GKUA 3ITAA 4JBFA 4M3KA 3ZCZA 3HVFA 3SH9A 3ISGA 3E2LA 1DY6A 2HDSA 4WM9A 3A3EA 3MKFA 1YLTA 2ZJ9A 4R0QA 5E2EA 4BJPA 4GD6A 2GDNA 5BOHA 5E2HA 2CC1A 4HEFA 3B3XA 4OPRA 5EVIA 1E3UD 2G2WA 1PI4A 4JXVA 3TOIA 3M6BA 3LY4A 4EBLA 1WYBA 4R23A 2JBFA 1MWUA 3QNCA 5DF8A 1SHVA 1PWCA 2EFUA 2QZ6A 4OPYA 5AQBA 3MKEA 1XKZA 2ZQAA 4DDYA 4U3TA 1NZOA 1MPLA 4RX3A 3SOIA 4WZ5C 4X68A 3VFHA 2J9PA 4N9LA 1ES4A 1K25A 3VMAA 4ZTKA 4PMAA 1K55A 1I2SA 2BLSA 4A5RA 5FATA 3NY4A 1MKIA 3EQUA 3VOZA 4OONA 2HDRA 4OQHA 1IKGA 4E3MA 4CJNA 2ZC5B 4R3JA 2Y2LA 4MBKA 5FI7A 3SS5A 3FV7A 3IQAA 3M2JA 5KZHA 1W79A 1WYCA 4KZ4A 5FQQA 2ZM8A 4LV0A 4KG6A 1Y54A 2EX9A 3Q81A 2OLUA 1ESIA 4DE2A 3UPNA 2XQZA 1BLHA 5KSHA 1RGYA 3IXDA 2V1ZA 1YM1A 4RYEA 3W8KA 5A91A 4OKPA 3OCNA 4GN2A 4UAAA 3CG5A 2ZC7A 4FSFA 4WELA 2OSUA 4GDBA 5M18A 2HP9A 3S22A 5F83A 4IBRA 1NYYA 1TDGA 3MFDA 1LLBA 3D4FA 1JTDA 1GHIA 3PBNA 1LI9A 3WRZA 5EPHA 1ZC2A 3VP0A 4KZAA 1LL5A 4R4SA 4NK3A 2J9OA 1BLPA 2VGKA 1JVJA 4GD8A 2Y2GA 5A93A 2E8IA 1PIOA 1VQQA 1JWZA 1PI5A 5DF9A 1MWSA 1DJBA 2WKEA 4ID4A 5IHVA 4OP5A 1Q2PA 1J9MA 4JF5A 4K0WA 1CI8A 1HVBA 1OMEA 2XEPA 3C4OA 3LEZA 4MEZA 4Y0UA 3ZG0A 1KE4A 2WGVA 2X71A 3Q7VA 3WS0A 5FAOA 2H0YA 5GHXA 4C3QA 1YMXA 5CEBA 1FSYA 1IELA 1NXYA 5CXWA 3MZDA 4QJGA 1XX2A 3ZVWA 2Y2QA 3N6IA 2ZLYA 3VP4A 4E3IA 4B4XA 1KE0A 3TG9A 4X6TA 1NRFA 3I7JA 4ZJ2A 1PWDA 3N8RA 2X02A 4B4ZA 2C5WB 1KDSA 1PYYA 4GB7A 1GHPA 4LV3A 5CTMA 3PBTA 2WGIA 1M6KA 1YT4A 3P98A 5EVID 5HFOA 2BG1A 3UDFA 2Q9NA 3UPPA 4OQIA 3VSKA 1S0WA 3IWOA 4EBPA 3IF6A 1CEFA 5CGSA 2ZQ7A 5E43A 4OPZA 2UWXA 3VP3A 5HAPA 5KSCA 1L0EA 3UE0A 3P09A 1IYPA 1NYMA 4U0TA 3V50A 4JXWA 3ZFZA 2X01A 5HARA 2PU4A 5CGXA 4FH2A 3G31A 3HBRA 1BSGA 1KGGA 4S2NC 1BTLA 5EOOA 4N1XA 3GRJA 4JF6A 2ZQ9A 3QHYA 4XUZA 3ZDJA 4BQMA 1JWVA 1E3UA 3CJMA 3NC8A 1XPBA 5TGFA 4KG2A 3BEBA 4XXRA 1EI5A 2Y2MA 3PBSA 3G2ZA 1TDLA 3ZG8B 4DRTA 1M40A 3IWQA 4N9KA 4FH4A 3DWKA 3ITBA 3NBLA 1EWZA 3HLEA 1TEMA 1ZG6A 3HLWA 3OCLA 1W5DA 2EFXA 2ZMAA 5U47A 4S2NA 3W4PA 2J7VA 3BFEA 4OOLA 2Y55A 4LV2A 4ZBEA 4E3LA 3VFFA 4KQRA 4S2MA 3WWXA 1S6RA 2HP6A 5CRFA 3G2YA 2WYXA 5FQMA 3PBQA 1BT5A 3FKWA 1XA1A 4IVKA 5FASA 1FCMA 1YLPA 3G34A 2WUQA 1NJ4A 3UDIA 1W7FA 3IF5A 4KG5A 5JYPA 5HAIA 4LCLA 1K55C 1VM1A 1G6AA 2JCHA 2HP5A 3A3IA 3LY3A 5FAQA 1GCEA 2QMIA 4WEJA 3OC2A 4PM5A 4DKIA 1BZAA 2EX2A 3UO9A 4HESA 2A49A 3IF6B 3MZFA 4PM8A 4WZ5A 5M1AA 3HREA 3O3VA 2ZQ8A 4LCMA 5FQJA 3SH7A 2A3UA 3ZG5A 2HDUA 4QY6A 4GDNA 3WRTA 4DXCA 4P6BA 2QPNA 4YINA 4WEKA 2Y59A 1W8QA 3OPLA 2RCXA 2XK1A 3NIAA 3MXRA 5GLBA 5AQ7A 1LHYA 4B88A 5FDHA 5GHYA 4QD4A 4S2JA 1MWTA 4OPQA 3M6HA 2Z2LB 4FCFA 1I5QA 2Y2IA 4CPKA 1L0FA 5A92A 3W4QA 2HDQA 1BUEA 1K38A 3GQZA 1K4FA 2OV5A 1K54C 3ZNTA 4E6WA 4WMCD 4DE3A 1H5XA 1RGZA 3Q1FA 4X69A 4JXSA 3ZHHA 4JF4A 2XLNA 4JPMA 1WE4A 3G32A 3UNWA 3HLDA 2XD1A 2IWDA 4P87A 4E3JA 3E2KA 3HUNA 4UA6A 4E3NA 3BRMA 4OOMA 1EROA 4ZJ1A 1BULA 4Z9QA 2P9VA 3ZVTA 4S2IA 4KZ7A 3HLCA 3IT9A 4N1HA 1HD8A 2H0TA 5FQ9A 5CHJA 3FZCA 3NI9A 5FQKA 5FI2A 1YLYA 3A3FA 3IXGA 3G4PA 2EXBA 5AQ9A 4C6YA 1K57C 4KZ6A 1L0DA 4YFMA 2WAEA 4UHUA 2V2FF 3GV9A 5HL1A 4FD8A 3O86A 3O87A 2I72A 4JLFA 4F94A 1ERQA 1XXMA 4OQGA 3IXHA 4JXGA 2IWBA 4K0XA 3HLGA 4NETA 5TFQA 3UDXA 4K91A 3UE1A 1KE3A 2XFSA 5HW3A 4X55A 1RCJA 2P9VB 4BL3A 5CECA 1BLCA 4MNRA 1KGEA 4IVIA 3DTMA 4S2OA 3SS3A 4DXBA 1SDEA 1XGIA 1IYSA 1H8YA 2XF3A 4OP8A 1C3BA 4EQIA 3WS4A 1G68A 1SKFA 4E3KA 3V5MA 1ONGA 3IF6C 4R1GA 4KQOA 5EVLA 2WZZA 3TSGA 3BFDA 3WS5A 1IKIA 5F82A 1ZG4A 4UA9A 5CERA 1ES2A 3WS1A 3UN7A 4PPRA 3NCKA 3FWLA 4GOGA 5HX9A 5GLDA 4GZBA 3MZEA 1IYQA 4H8RA 5GLCA 3JYIA 3HLFA 4DE1A 1DJCA 1YLZA 4BL2A 3IH9A 1QMFA 2ZC3B 4PM9A 1K6SA 5EUAA 5DTKA 3BFFA 4Y0TA 3V3RA 1NZUA 1HZOA 3BFGA 3Q07A 3HLBA 1O07A 3HL9A 3DW0A 2JC7A 4DF6A 3CZDA 3HUMA 1FR6A 2B5RA 2WK0A 4OQ0A 2XH9A 4QY5A 4RX2A 4D2OA 5EVIB 5GHZA 1JTGA 4BLMA 1Z6FA 5I94A 2XGNA 3O88A 3UY6A 4BD1A 3OPHA 4S2KA 1DJAA 1FOFA 4ZDXA 1CI9A 3MBZA 2ZC6B 3NDGA 4GNUA 1HTZA 1U60A 1SCWA 2Y2HA 1KVMA 3FKVA 2ZM0A 3M2KA 5CGWA 4WZ4A 5GLAA 2OLVA 3W4OA 2Y4AA 4DE0A 1IEMA 2C6WB 2Y2JA 4ZAMA 3VSLA 3NDEA 4HBTA 2DNSA 5FA7A 1E25A 1AXBA 3V3SA 1I2WA 1K54A 1XP4A 3UE3A 3GR2A 1SDNA 3PBRA 3LCEA 5FI6A 3C7UA 3ZG9B 3WS2A 1KDWA 5CHMA 2R9XA 5FAPA 2ZQDA 1K56A 5F1FA 4QHCA 4MBHA 1N9BA 4KENB 4Q8IA 4XUXA 1ES3A 3OPPA 1KVLA 2XDMA 2Y2PA 3IXBA 1FCOA 5CHUA 4R4RA 2PBYA 5DF7A 2EX6A 4O7DA 1W8YA 3EQVA 4KZ5A 2ZM2A 3PAEA 1GA0A 1FCNA 5EVIC 4U0XA 5FQIA 2VGJA 2ZQCA 2Z2MB 4Y0OA 3C7VA 5EE8A 1FSWA 3RXWA 1TVFA 4ZJ3A 5D3OA 4OVDA 3CMZA 4WMCA 4QB8A 5F1GA 3GMWA 4LV1A 5L2FA 5E2FA 5CTNA 2G2UA 3C4PA 4MLLA 1N4OA 3VP2A 2EX8A 3OPRA 4C75A 1O7EA 3FYZA 1RP5A 4KZ9A 3N8LA 2Y2NA 5TR7A 3UPOA 2WGWA 4P0MA 1XA7A 3N8SA 4X56A 4BD0A 1LI0A 2WZXA 2DRWA 4QU3A 5EECA 2XD5A 5E2GA 3S1YA 1PWGA 3N7WA 1KGFA 1IYOA 2R9WA 5GL9A 5HAQA 1ERMA 3G35A 4E6XA 4S2PA 2Y91A 3BYDA 4EV4A 1PW1A 1CEGA 2DCFA 3AGFA 1PZPA 1PW8A 2FFYA 1NY0A 4IEDA 5J8XA 3LO7A 1FR1A 3GTCA 1K57A 2V20A 4HBUA 4DDSA 4P85A 5M19A 3A3DA 3IWIA 3SH8A 2WADA 2WAFA 3VP1A 3AGEA 5DVAA 2RL3A 2ZC4B 3IHAA 1K56D 2P74A 2WGWB 4RVAA 2Q9MA 4MBFA 3V39A 5AQAA 3PBOA 4PM7A 5CEDA 3MXSA 4KQQA 5JYOA 1PZOA 3DWZA 3Q7ZA 4X53A 4LENA 3ZGAB 4BENA 1H8ZA 4OLDA 1K4EA 2XFTA 1E4DA 5G18A 1MY8A 3A3JA 3ZNYA 1K6RA 4E3OA 2ZD8A 1YLWA 4IBXA 4R3BA 4RA7A 4Y7PA 3IHBA 1Q2QA 3BLSA 2J8YA 3QNBA 3G30A 2H10A 3OZHA 4JKTA 1BLSA 2H5SA 4WBGA 3S4XA 2WKIA 2XR0A 4OOYA 3BLMA 2Y2KA 1L2SA 3PAGA 1MWRA 1YMSA 1JWPA 2IWCA 4KZ8A 3ZG7B 4L0LA 3C5AA 3BM6A 1MXOA 1XGJA 2EXAA 3Q82A 4KZ3A 1L0GA 1YQSA 3GSGA 3N4IA 3RJUA 1MBLA 4UA7A 3BFCA 4OH0A
chains in the Genus database with same CATH superfamily
3PTEA 5A90A 4WLAA 1ONHA 5DTTA 4DMZA 2W3DA 4ZRRA 1NLZA 1YLJA 5KMWA 3Q7VB 4WYYA 1ALQA 4OLGA 2HPBA 4N92A 3GVBA 1GHMA 1SKOB 2YKFA 3IH8A 3ITAA 3ZCZA 3SH9A 2ZJ9A 2GDNA 3MQOA 1AWIA 1MC0A 4OPRA 1NRJA 4GJ4A 5EVIA 1G6OA 2W1RA 4R23A 5DF8A 3QNCA 1PWCA 2QZ6A 1XKZA 3DTIA 4DDYA 4MCWA 2XA7M 2L1MA 1MPLA 3SOIA 4WZ5C 3VFHA 1K25A 4PMAA 3C38A 1MKIA 3EQUA 4OONA 3UB6A 4E3MA 5FI7A 3HJKA 2ZM8A 1Y54A 4DE2A 5HWTA 1BLHA 3C8CA 5KSHA 2V1ZA 5DJTA 4HY8A 4UAAA 4X1LA 3UE6A 5M18A 4HIAA 4IBRA 1CF0A 3W2ZA 1OTAA 1GHIA 3QP6A 1LI9A 4LRZE 4CLCA 3VP0A 4KZAA 4B93A 1BLPA 4XT2B 4RQ9A 1JVJA 1VQQA 2GZAA 1P0ZA 1PI5A 4HP9A 1HVBA 1T1AA 1OMEA 2XEPA 3C4OA 3EWKA 4C3QA 5CEBA 3D9YA 2LB9A 2O9AA 5CXWA 3K3CA 1XX2A 2ZMVA 3G6OA 1PWDA 1PYYA 5CTMA 4LV3A 5EVID 3P98A 3R7WB 2BG1A 2W1TA 2PYRA 5TBMA 1S0WA 4L9FA 4EBPA 3T4JA 3IF6A 4OPZA 3CHWP 5KSCA 2M7UA 4HJ4A 3ZFZA 1A0KA 2VV6A 4M4XA 3HBRA 4S2NC 4HI4A 5L10A 5EOOA 5HDDA 5HDCA 3U4LP 3QP1A 4XXRA 1M40A 3ITBA 3HLEA 3HLWA 3NJAA 1MKMA 2J7VA 4OOLA 4LV2A 3VFFA 3WWXA 1S6RA 5FQMA 4G3KA 3G34A 1XFQA 2V1BA 5MC7A 4I3AA 3C30A 4QWOA 4LPZA 4LCLA 1K55C 3UB8A 1G6AA 3LY3A 2KLIA 3OC2A 1BZAA 3UO9A 3IF6B 5EM1A 5M1AA 2A3UA 3S7OA 3KYZA 4DN0A 4PKYG 4QD4A 4S2JA 4OPQA 5EM0A 3KYEA 1I5QA 3FC7A 2WKRA 4E6WA 3Q1FA 3ZHHA 4JXSA 1VETB 3HLDA 3HUNA 4WUJA 4Q0IA 4GS9A 3EEAA 5DJUA 5FQ9A 1YLYA 3IXGA 2EXBA 4C6YA 4KZ6A 1L0DA 4YFMA 3C2WA 2J3WA 5HL1A 4BWIA 2I72A 3F1PA 2JKGA 4F94A 4YWZA 1OT9A 2IWBA 4NETA 5TFQA 4K91A 3UE1A 2JHEA 1NLYA 3MJQA 4BL3A 4YNRA 4IVIA 4LGWA 4DXBA 1SDEA 4EERA 3WS4A 2WKPA 3V5MA 3TSGA 4KQOA 4Z1WA 4F3LB 3WS1A 3FWLA 5GLDA 4GZBA 5GLCA 3IBJA 3JYIA 1N9NA 2ZC3B 4I39A 1GSWA 3LIEA 4Y0TA 3V3RA 1O07A 2W1TB 4DF6A 2WK0A 4QY5A 5EVIB 5GHZA 4BLMA 1Z6FA 5CX7A 3O88A 1DJAA 1FOFA 5J3WA 3VV4A 1CI9A 2I9VA 3NDGA 1SCWA 1KVMA 5CGWA 1IEMA 3VSLA 3IX8A 5FA7A 3LUQA 1K54A 1XP4A 3PBRA 3OLOA 5CHMA 5FAPA 1K56A 5F1FA 3IX3A 3IXBA 5DF7A 2EX6A 1W8YA 4KZ5A 3PAEA 2O99A 3KSIA 3LFVA 5IU1A 3RTYA 2PRFA 2VEAA 2ZQCA 3RXWA 2P7JA 1KOUA 4WMCA 4FOFA 1F5MA 2D02A 3UPOA 2WGWA 2PHYA 1XA7A 3N8SA 4X56A 1LI0A 2WZXA 2DRWA 3ZYTA 2AVXA 1PWGA 5GL9A 3G35A 4S2PA 2Y91A 5EVEA 2DCFA 3NULA 1PZPA 1PW8A 1PRQA 3GTCA 1K57A 4HBUA 3E4OA 3IS2B 2WAFA 3B42A 3VP1A 3CUEC 2RL3A 3H82B 4B9OA 4KQQA 1YSPA 4LENA 2XFTA 3BW6A 1IOUA 3ZNYA 4HHDA 2ZD8A 4IBXA 4R3BA 2JKRI 3IHBA 3BLSA 5FEGA 3S4XA 2WKIA 1YMSA 3ZG7B 3C5AA 2GNXA 1XGJA 1L0GA 1YQSA 3GSGA 4EUVA 2OAP1 3RJUA 1XJ2A 1H3QA 3T12B 2PU2A 4NKPA 4EWFA 2WKHA 3LI9A 2PYPA 3T1RA 3VOYA 5L07A 4NXEA 3MR0A 2JE5A 5F5YA 3HUOA 3B47A 3JVUA 3RXXA 1CK3A 4WN5A 3ISGA 5IT5A 3E2LA 4WM9A 3MKFA 1YLTA 4BJPA 1XJ6A 4ETXA 4JXVA 3M6BA 3LY4A 1WYBA 2JBFA 1MWUA 1SHVA 2M1CA 4DJ3A 3T4KA 5AQBA 4FUWA 2ZQAA 3ULFA 1XFNA 1GSXA 4K08A 2Z6DA 1D1JA 2VGLS 3RH8B 3VMAA 4ZTKA 1K55A 3SW1A 2BLSA 3VOZA 4OQHA 4CLCC 3MQ0A 1ZTUA 4IUHA 2P04A 4ARZA 1LSWA 2OLUA 2XQZA 1RGYA 3IXDA 1YM1A 3W8KA 3K2NA 3CG5A 2ZC7A 4FSFA 4HH2A 4KQDA 3DTEA 3DTKA 1JTDA 3WRZA 1ZC2A 4R70A 4I3JA 4MMNA 4NK3A 2J9OA 1PIOA 5L09A 3O5YA 1MWSA 1DJBA 2WKEA 3VE3A 3H7WB 4K0WA 1CI8A 3ZG0A 2HJEA 4MEZA 5FAOA 1FSYA 1S1YA 3ZVWA 2Y2QA 1KE0A 2VK3A 1NRFA 3I7JA 2L0WA 3N8RA 2C5WB 1KDSA 1GHPA 2WGIA 1YT4A 5CGSA 3DBAA 5E43A 3EEHA 1L0EA 1S67L 3NOPC 4JXWA 1G28A 5HARA 4L9GA 4FH2A 1UGUA 2MJ6A 3TJZC 1ODVA 2ACGA 4LRYC 2NUTC 4XUZA 3IX4A 1E3UA 3CJMA 1XPBA 1EI5A 4DRTA 4N9KA 3R7WA 1YSQA 3NBLA 3BWLA 2HF6A 1Z09A 1TEMA 1CQAA 4HP4A 2EFXA 4S2NA 1LL8A 3H82A 3PBQA 2VGLM 1XA1A 1NJ4A 3IF5A 4KG5A 2W3HA 4HOIA 4E04A 4IJGA 1VM1A 2HP5A 1GCEA 2W3GA 4LFUA 2EX2A 4PM8A 2A49A 4Y5FA 1YKDA 4WZ5A 3HREA 4LCMA 3ZG5A 3WRTA 4GLQA 4P6BA 4DXCA 2QPNA 3OPLA 2RCXA 3NIAA 2Q0OA 3R4KA 5KIZA 2A24A 3TE8A 5FDSA 3W4QA 1K38A 1BUEA 4HJ6A 2D01A 1N9LA 2B95A 1RGZA 4X69A 4JPMA 3G32A 3UNWA 2IWDA 3E4QA 4P87A 5G4ZA 5L8MA 1BULA 3ZVTA 4KZ7A 1Y4OA 1HD8A 2H0TA 3NI9A 5FI2A 3G4PA 5AQ9A 2Z6CA 5G4YA 4UHUA 5TJJA 5A8BA 3GV9A 4FD8A 3L9KA 4Q0JA 4OQGA 4JXGA 4K0XA 3HLGA 1H8MA 5HW3A 4X55A 2IA2A 1BLCA 4MNRA 1YAXA 1XGIA 1H8YA 4OP8A 4JGPA 2VV8A 1SKFA 1ONGA 2VZWA 1X0OA 3WS5A 3BFDA 1IKIA 5CERA 4UA9A 2V1AA 3A0VA 2HV1A 2INWA 5HX9A 4GS9B 3MZEA 1IYQA 4DE1A 1VEUB 1YLZA 1QMFA 1W63M 4BBUA 2ZOIA 1K6SA 2VKSA 3CPTA 5DTKA 1HZOA 3BFGA 3Q07A 3HLBA 2DMWA 3HJIA 3CZDA 1S4SA 4BD1A 1WA9A 4ZDXA 4NXBA 4H6JA 1U60A 2Y2HA 4GHIB 1FIKA 5GLAA 2OLVA 2Y4AA 4II7A 4ZAMA 2VJWA 1AXBA 3V3SA 1I2WA 3RFBA 3UE3A 3GR2A 1K0KA 4R3AA 3A0RA 3WS2A 2BASA 2R9XA 2J3TC 4QHCA 4MBHA 2L4RA 4KENB 2ZOHA 1KVLA 1FCOA 4ME4A 4O7DA 3EQVA 5EVIC 3JVVA 5FQIA 2VGJA 4JGOA 1VHMA 4Y0OA 1TVFA 5HSQA 5D3OA 3CMZA 3GMWA 5L2FA 3F1NB 4MLLA 1N4OA 4KZ9A 2A24B 2K2NA 1DP8A 1T18A 5EECA 5HAQA 4CQHA 5F68A 1JNUA 3AGFA 1NY0A 3LO7A 1FR1A 2V20A 4DJ2A 3F1OA 3SH8A 2XRNA 3AGEA 1N9OA 1LSXA 2OOLA 1K56D 2P74A 2ZC4B 4RVAA 4MBFA 4EETB 1PZOA 4UQIS 4BENA 1H8ZA 5HPIA 1E4DA 3A3JA 4E3OA 4RA7A 3LR3A 2J8YA 1BYWA 2H10A 2WKQA 4JKTA 4WBGA 2H5SA 3P01A 1ACFA 3PAGA 1MWRA 2PDRA 2GJ3A 4L0LA 3OOVA 2EXAA 2JKTM 4UA7A 4OH0A 3KSFA 1FQGA 4KZBA 3SS4A 1QMEA 3T4QA 4EUZA 3AGDA 2FFFB 1LL9A 4EBNA 1GA9A 1OTEA 3LGOA 1ESUA 2W3FA 1ZKJA 4GKUA 4QPRA 4M3KA 3LR5A 3ZQ5A 3T1XA 1DY6A 3A3EA 2CC1A 4I5SA 1E3UD 2OWJA 2G2WA 2GX5A 1PI4A 2HGVA 4G3VA 1J3WA 2O0YA 3U2AA 2KX6A 4EBLA 2PR5A 4NXFA 2EFUA 4OPYA 4EEUA 3FPVA 1D06A 4JGQA 1ES4A 5DFYA 1EW0A 3VOLA 4A5RA 5FATA 3NY4A 2V0WA 2HDRA 1IKGA 4CJNA 2ZC5B 4R3JA 3SS5A 2ZBBA 3FV7A 4Y2FA 1W79A 4KZ4A 4LV0A 1D7EA 2EX9A 3Q81A 3E0YA 3LIAA 4RYEA 5A91A 4GN2A 5HWWA 2OSUA 4GDBA 5F83A 1NYYA 3MF0A 1TDGA 1T1BA 1LLBA 3D4FA 3UMDA 3PBNA 2VLGA 5F69A 3LYXA 2VGKA 4GD8A 2E8IA 3BQAA 1JWZA 5DF9A 4IUKA 4JF5A 5HPFA 4Y0UA 1KE4A 3BY9A 2X71A 4CLCD 2JKRM 2NUPC 1YMXA 1IELA 1NXYA 3MZDA 4QJGA 4ARZB 2KOIA 5HD3A 3CPTB 2VA0A 3N6IA 1SZVA 3V67A 4BBVA 4ZJ2A 2X02A 3GECA 4Y3IA 5HL6A 4GB7A 1M6KA 3D72A 3VSKA 1VETA 3VP3A 5HAPA 3UE0A 3P09A 1IYPA 1NYMA 3KO6A 3F1NA 2PU4A 3G31A 2EWWA 1BSGA 1BTLA 4N1XA 3GRJA 2ZQ9A 3QHYA 3ZDJA 5F6AA 4BQMA 5TGFA 4KG2A 3G2ZA 1TDLA 3ZG8B 1OJGA 3CLOA 4D60A 1EWZA 3T1SA 3OCLA 3L7HA 3BFEA 2Y55A 2K7SA 3BY8A 2WYXA 4IVKA 1BT5A 3FKWA 2Y79A 5FASA 4CLCB 3UDIA 1W7FA 4EW7A 4KUKA 2JCHA 2J80A 4WF0A 4PM5A 4DKIA 4HESA 3MZFA 3O3VA 2ZQ8A 5FQJA 1OTIA 4EQ1A 1P9WA 4H6JB 4GDNA 5DKLA 1L3LA 4WEKA 2Y59A 1W8QA 3CUEA 2XK1A 3BQ8A 3MXRA 3IS2A 5HD5A 5GLBA 1LT0A 5AQ7A 1LHYA 3PHYA 4B88A 2JN7A 5GHYA 2Y2IA 5A92A 2OV5A 3GQZA 2QWSA 3ZNTA 1HLUP 3H9WA 4DE3A 2XLNA 1WE4A 1TF1A 2W27A 2XD1A 1P9RA 3E2KA 4UA6A 3BRMA 1EROA 4WL9A 4ZJ1A 2P9VA 3IT9A 3FZCA 5HDSA 2KDKA 1K57C 3DAVA 3O86A 3O87A 4JLFA 1ERQA 3VE4A 1XXMA 3IXHA 5EV0A 1KE3A 5K5BA 1RCJA 5CECA 3T50A 3SS3A 4Y13A 1S66L 2XF3A 3KYQA 1IYSA 1G68A 1S4RA 4R1GA 1STZA 2WZZA 1ZG4A 5TBMB 2QYBA 3UN7A 4PPRA 3TRCA 3NCKA 4EESA 4GOGA 3T1QB 1XJ3A 4H8RA 3HLFA 1DJCA 4EU0A 4PM9A 2XA7S 1NZUA 1XJ4A 4MN6A 3HL9A 1H0MA 1LSVA 3UB9A 3DW0A 3S7QA 1FR6A 5EFWA 3PXPA 3B33A 1JTGA 2QJ5A 2XGNA 3MSHA 3OPHA 2EA9A 1PFLA 3MBZA 2PAVP 1HTZA 1FILA 3FKVA 2ZM0A 3M2KA 3FPWA 4DE0A 2C6WB 2Y2JA 3NDEA 4HBTA 1E25A 3CITA 2UV0E 2OWHA 1SDNA 5FI6A 3LCEA 3C7UA 4GCZA 3LIDA 2ZQDA 3TW8A 1N9BA 4Q8IA 4XUXA 1ES3A 3OPPA 4HH3A 2ZM2A 4G3WA 1GA0A 3EGXC 4U0XA 2Z2MB 1FSWA 4L9EA 4ZJ3A 5FL3A 5J4EA 4LV1A 5E2FA 2G2UA 3OPRA 4C75A 3T4OA 2PR6A 2VV7A 1RP5A 1V9ZA 2EWVA 5AVFA 5IS1A 5TR7A 3IBRA 4QU3A 4O0PA 2XD5A 3S1YA 3N7WA 1KGFA 1IYOA 2R9WA 4HJ3A 1ERMA 4E6XA 4EV4A 2PT7A 1PW1A 1CEGA 2E8JA 2FZ0A 2P08A 2FFYA 3LEQA 4IEDA 2H28A 4X1MA 4ESPA 5M19A 3A3DA 1P97A 3E98A 2WADA 5DVAA 3IHAA 2WGWB 4NEED 2QKPA 4PM7A 3CI6A 5CEDA 3DWZA 3KSHA 1ZHHB 2XROA 4OLDA 1F98A 5G18A 4GW9A 3P7NA 1YLWA 1OPXA 1IFQA 1Q2QA 3QNBA 5DKKA 3S7NA 4OOYA 2Y2KA 1T19A 1JWPA 1MXOA 1W63Q 4BMWA 3N4IA 3FG8A 3S22A 4PM6A 1ES5A 5DTSA 5EOEA 2M7VA 4NXGA 3F1OB 4P6ZS 4S2LA 5FSRA 2A2LA 2CMNA 3BECA 2O9CA 2Y2OA 1UWPX 4JBFA 2Y8HA 2LB5A 3HVFA 2HDSA 1Y28A 4R0QA 5E2EA 4GD6A 5BOHA 5E2HA 4HEFA 3B3XA 1OTDA 2PD8A 2HJ9C 3TOIA 3UB5P 3MMHA 4EXOA 3PR6A 3MKEA 4U3TA 2O9BA 1NZOA 4RX3A 3MXQA 4X68A 2J9PA 3F1PB 4N9LA 1I2SA 5DFXA 3UMEA 2Y2LA 4MBKA 3M2JA 3IQAA 4O01A 5KZHA 2K31A 1WYCA 4AFIA 5FQQA 3BJNA 3LR0A 4ETZA 4KG6A 1ESIA 3UPNA 1F9IA 4PKYA 4OKPA 3OCNA 4UEYA 5LBRA 1F2KA 2B18A 4WELA 2HP9A 4R38A 3MFDA 5EPHA 1LL5A 4R4SA 2Y2GA 5A93A 3OBFA 1TS8A 3NOTC 4ID4A 5IHVA 4OP5A 1Q2PA 1J9MA 3GDIA 2JKFA 3LEZA 3NHQA 2J3TD 2WGVA 3Q7VA 3WS0A 2H0YA 5GHXA 4Y17A 1OJ5A 2ZLYA 3VP4A 4E3IA 3SZTA 4B4XA 3TG9A 3MS6A 4X6TA 4B4ZA 4PHTA 5HFOA 2V8FA 3PBTA 3UDFA 3UPPA 2Q9NA 2QJ7A 4OQIA 3IWOA 1CEFA 2V8CA 2ZQ7A 2UWXA 4U0TA 1TS6A 3V50A 2X01A 5CGXA 2VX8A 1KGGA 3QP8A 4JF6A 5AJGA 1JWVA 2XSSA 3NC8A 4HNBA 3BEBA 2Y2MA 3PBSA 3IWQA 3A0SA 4FH4A 3DWKA 4MN7A 1ZG6A 1DP9A 1W5DA 2ZMAA 5U47A 3HCYA 3W4PA 4ZBEA 4E3LA 5HZHA 4KQRA 4S2MA 2PBDP 2HP6A 4KUOA 5CRFA 3G2YA 4GHIA 1OTBA 1FCMA 1YLPA 1T1CA 2WUQA 5JYPA 3E4PA 3LICA 5HAIA 3A3IA 5FAQA 1UWNX 2QMIA 4WEJA 3MQQA 4HQAA 2OAQ1 1VEUA 4NG2A 3SH7A 2HDUA 4QY6A 4YINA 4BBTA 4Q0HA 5FDHA 1MWTA 3LIBA 3D3OA 3M6HA 2Z2LB 4FCFA 4CPKA 1L0FA 2HDQA 1K4FA 1K54C 4WMCD 1YPRA 2W3EA 1H5XA 4JF4A 4E3JA 4E3NA 3KSGA 4OOMA 3KX0X 4Z9QA 4S2IA 3HLCA 4FTXA 4N1HA 5CHJA 5FQKA 3A3FA 4I38A 1VB6A 2WAEA 4F3LA 2V2FF 2ZMFA 3ICYA 3LIFA 1TS7A 5J7EA 1CJFA 3UDXA 3S7PA 2XFSA 2P9VB 2V9AA 1KGEA 4S2OA 3DTMA 5HWVA 1C3BA 4EQIA 4E3KA 1NWZA 5EVLA 3IF6C 4IHQA 5F82A 1ES2A 2ZL1A 4EEPA 5I5LA 2B02A 4BL2A 3IH9A 5EUAA 3EOIA 3BFFA 2R78A 3NECA 4PAUA 5FEFA 2JC7A 3HUMA 1OT6A 2B5RA 4OQ0A 2XH9A 3H7WA 4RX2A 2QHKA 4D2OA 3T4TA 4YOFA 5I94A 4Y15A 3UY6A 2V0UA 2BTFP 4S2KA 4I3IA 2ZC6B 2PD7A 4GNUA 5AVEA 4CLCE 2JKTI 4WZ4A 3W4OA 3T4SA 2DNSA 4P6ZM 2ZL1B 3ZG9B 3LR4A 3QP4A 1KDWA 1DRMA 1PNEA 1GSVA 3QP5A 1V9YA 2XDMA 2Y2PA 5CHUA 4R4RA 2PBYA 4UQIM 1MZUA 3PYPA 1FCNA 5EE8A 3C7VA 1DP6A 1TD5A 3JPUA 4OVDA 4X25A 4QB8A 4MDZA 5F1GA 3CAXA 5CTNA 3CWFA 3C4PA 3VP2A 2EX8A 1O7EA 3K3DA 3FYZA 3N8LA 2Y2NA 4P0MA 4LLOB 4BD0A 4LRXC 5E2GA 3LI8A 3BYDA 1TS0A 4R6LA 1S1ZA 5J8XA 4DDSA 2G7UA 4P85A 3IWIA 3T4LA 3MFXA 1G5UA 1SKOA 5C5KA 4MN5A 3EGDC 2Q9MA 3V39A 5AQAA 3PBOA 3NOUC 3MXSA 5JYOA 3Q7ZA 4X53A 3ZGAB 3QP2A 1K4EA 1MY8A 1K6RA 4Y7PA 3G30A 3OZHA 1BLSA 2W0NA 4JGRA 3UB7A 2FH5A 2XR0A 3BLMA 1L2SA 2IWCA 4KZ8A 3BM6A 2HZ5A 4KZ3A 3Q82A 4XT2A 4O8GA 2YKHA 1MBLA 3BFCA
chains in the Genus database with same CATH topology
3PTEA 5A90A 1FQGA 2PU2A 4PM6A 1ES5A 1ONHA 5DTTA 4KZBA 4EWFA 2WKHA 3SS4A 1QMEA 5DTSA 1YLJA 5KMWA 3Q7VB 4WYYA 5EOEA 1ALQA 4EUZA 3AGDA 2FFFB 3VOYA 4S2LA 1LL9A 4OLGA 5FSRA 4EBNA 1GA9A 2HPBA 4N92A 3BECA 1ESUA 3GVBA 2JE5A 1GHMA 2Y2OA 1ZKJA 3HUOA 3RXXA 3IH8A 1CK3A 4GKUA 3ITAA 4JBFA 4M3KA 3ZCZA 3HVFA 3SH9A 3ISGA 3E2LA 1DY6A 2HDSA 4WM9A 3A3EA 3MKFA 1YLTA 2ZJ9A 4R0QA 5E2EA 4BJPA 4GD6A 2GDNA 5BOHA 5E2HA 2CC1A 4HEFA 3B3XA 4OPRA 5EVIA 1E3UD 2G2WA 1PI4A 4JXVA 3TOIA 3M6BA 3LY4A 4EBLA 1WYBA 4R23A 2JBFA 1MWUA 3QNCA 5DF8A 1SHVA 1PWCA 2EFUA 2QZ6A 4OPYA 5AQBA 3MKEA 1XKZA 2ZQAA 4DDYA 4U3TA 1NZOA 1MPLA 4RX3A 3SOIA 4WZ5C 4X68A 3VFHA 2J9PA 4N9LA 1ES4A 1K25A 3VMAA 4ZTKA 4PMAA 1K55A 1I2SA 2BLSA 4A5RA 5FATA 3NY4A 1MKIA 3EQUA 3VOZA 4OONA 2HDRA 4OQHA 1IKGA 4E3MA 4CJNA 2ZC5B 4R3JA 2Y2LA 4MBKA 5FI7A 3SS5A 3FV7A 3IQAA 3M2JA 5KZHA 1W79A 1WYCA 4KZ4A 5FQQA 2ZM8A 4LV0A 4KG6A 1Y54A 2EX9A 3Q81A 2OLUA 1ESIA 4DE2A 3UPNA 2XQZA 1BLHA 5KSHA 1RGYA 3IXDA 2V1ZA 1YM1A 4RYEA 3W8KA 5A91A 4OKPA 3OCNA 4GN2A 4UAAA 3CG5A 2ZC7A 4FSFA 4WELA 2OSUA 4GDBA 5M18A 2HP9A 3S22A 5F83A 4IBRA 1NYYA 1TDGA 3MFDA 1LLBA 3D4FA 1JTDA 1GHIA 3PBNA 1LI9A 3WRZA 5EPHA 1ZC2A 3VP0A 4KZAA 1LL5A 4R4SA 4NK3A 2J9OA 1BLPA 2VGKA 1JVJA 4GD8A 2Y2GA 5A93A 2E8IA 1PIOA 1VQQA 1JWZA 1PI5A 5DF9A 1MWSA 1DJBA 2WKEA 4ID4A 5IHVA 4OP5A 1Q2PA 1J9MA 4JF5A 4K0WA 1CI8A 1HVBA 1OMEA 2XEPA 3C4OA 3LEZA 4MEZA 4Y0UA 3ZG0A 1KE4A 2WGVA 2X71A 3Q7VA 3WS0A 5FAOA 2H0YA 5GHXA 4C3QA 1YMXA 5CEBA 1FSYA 1IELA 1NXYA 5CXWA 3MZDA 4QJGA 1XX2A 3ZVWA 2Y2QA 3N6IA 2ZLYA 3VP4A 4E3IA 4B4XA 1KE0A 3TG9A 4X6TA 1NRFA 3I7JA 4ZJ2A 1PWDA 3N8RA 2X02A 4B4ZA 2C5WB 1KDSA 1PYYA 4GB7A 1GHPA 4LV3A 5CTMA 3PBTA 2WGIA 1M6KA 1YT4A 3P98A 5EVID 5HFOA 2BG1A 3UDFA 2Q9NA 3UPPA 4OQIA 3VSKA 1S0WA 3IWOA 4EBPA 3IF6A 1CEFA 5CGSA 2ZQ7A 5E43A 4OPZA 2UWXA 3VP3A 5HAPA 5KSCA 1L0EA 3UE0A 3P09A 1IYPA 1NYMA 4U0TA 3V50A 4JXWA 3ZFZA 2X01A 5HARA 2PU4A 5CGXA 4FH2A 3G31A 3HBRA 1BSGA 1KGGA 4S2NC 1BTLA 5EOOA 4N1XA 3GRJA 4JF6A 2ZQ9A 3QHYA 4XUZA 3ZDJA 4BQMA 1JWVA 1E3UA 3CJMA 3NC8A 1XPBA 5TGFA 4KG2A 3BEBA 4XXRA 1EI5A 2Y2MA 3PBSA 3G2ZA 1TDLA 3ZG8B 4DRTA 1M40A 3IWQA 4N9KA 4FH4A 3DWKA 3ITBA 3NBLA 1EWZA 3HLEA 1TEMA 1ZG6A 3HLWA 3OCLA 1W5DA 2EFXA 2ZMAA 5U47A 4S2NA 3W4PA 2J7VA 3BFEA 4OOLA 2Y55A 4LV2A 4ZBEA 4E3LA 3VFFA 4KQRA 4S2MA 3WWXA 1S6RA 2HP6A 5CRFA 3G2YA 2WYXA 5FQMA 3PBQA 1BT5A 3FKWA 1XA1A 4IVKA 5FASA 1FCMA 1YLPA 3G34A 2WUQA 1NJ4A 3UDIA 1W7FA 3IF5A 4KG5A 5JYPA 5HAIA 4LCLA 1K55C 1VM1A 1G6AA 2JCHA 2HP5A 3A3IA 3LY3A 5FAQA 1GCEA 2QMIA 4WEJA 3OC2A 4PM5A 4DKIA 1BZAA 2EX2A 3UO9A 4HESA 2A49A 3IF6B 3MZFA 4PM8A 4WZ5A 5M1AA 3HREA 3O3VA 2ZQ8A 4LCMA 5FQJA 3SH7A 2A3UA 3ZG5A 2HDUA 4QY6A 4GDNA 3WRTA 4DXCA 4P6BA 2QPNA 4YINA 4WEKA 2Y59A 1W8QA 3OPLA 2RCXA 2XK1A 3NIAA 3MXRA 5GLBA 5AQ7A 1LHYA 4B88A 5FDHA 5GHYA 4QD4A 4S2JA 1MWTA 4OPQA 3M6HA 2Z2LB 4FCFA 1I5QA 2Y2IA 4CPKA 1L0FA 5A92A 3W4QA 2HDQA 1BUEA 1K38A 3GQZA 1K4FA 2OV5A 1K54C 3ZNTA 4E6WA 4WMCD 4DE3A 1H5XA 1RGZA 3Q1FA 4X69A 4JXSA 3ZHHA 4JF4A 2XLNA 4JPMA 1WE4A 3G32A 3UNWA 3HLDA 2XD1A 2IWDA 4P87A 4E3JA 3E2KA 3HUNA 4UA6A 4E3NA 3BRMA 4OOMA 1EROA 4ZJ1A 1BULA 4Z9QA 2P9VA 3ZVTA 4S2IA 4KZ7A 3HLCA 3IT9A 4N1HA 1HD8A 2H0TA 5FQ9A 5CHJA 3FZCA 3NI9A 5FQKA 5FI2A 1YLYA 3A3FA 3IXGA 3G4PA 2EXBA 5AQ9A 4C6YA 1K57C 4KZ6A 1L0DA 4YFMA 2WAEA 4UHUA 2V2FF 3GV9A 5HL1A 4FD8A 3O86A 3O87A 2I72A 4JLFA 4F94A 1ERQA 1XXMA 4OQGA 3IXHA 4JXGA 2IWBA 4K0XA 3HLGA 4NETA 5TFQA 3UDXA 4K91A 3UE1A 1KE3A 2XFSA 5HW3A 4X55A 1RCJA 2P9VB 4BL3A 5CECA 1BLCA 4MNRA 1KGEA 4IVIA 3DTMA 4S2OA 3SS3A 4DXBA 1SDEA 1XGIA 1IYSA 1H8YA 2XF3A 4OP8A 1C3BA 4EQIA 3WS4A 1G68A 1SKFA 4E3KA 3V5MA 1ONGA 3IF6C 4R1GA 4KQOA 5EVLA 2WZZA 3TSGA 3BFDA 3WS5A 1IKIA 5F82A 1ZG4A 4UA9A 5CERA 1ES2A 3WS1A 3UN7A 4PPRA 3NCKA 3FWLA 4GOGA 5HX9A 5GLDA 4GZBA 3MZEA 1IYQA 4H8RA 5GLCA 3JYIA 3HLFA 4DE1A 1DJCA 1YLZA 4BL2A 3IH9A 1QMFA 2ZC3B 4PM9A 1K6SA 5EUAA 5DTKA 3BFFA 4Y0TA 3V3RA 1NZUA 1HZOA 3BFGA 3Q07A 3HLBA 1O07A 3HL9A 3DW0A 2JC7A 4DF6A 3CZDA 3HUMA 1FR6A 2B5RA 2WK0A 4OQ0A 2XH9A 4QY5A 4RX2A 4D2OA 5EVIB 5GHZA 1JTGA 4BLMA 1Z6FA 5I94A 2XGNA 3O88A 3UY6A 4BD1A 3OPHA 4S2KA 1DJAA 1FOFA 4ZDXA 1CI9A 3MBZA 2ZC6B 3NDGA 4GNUA 1HTZA 1U60A 1SCWA 2Y2HA 1KVMA 3FKVA 2ZM0A 3M2KA 5CGWA 4WZ4A 5GLAA 2OLVA 3W4OA 2Y4AA 4DE0A 1IEMA 2C6WB 2Y2JA 4ZAMA 3VSLA 3NDEA 4HBTA 2DNSA 5FA7A 1E25A 1AXBA 3V3SA 1I2WA 1K54A 1XP4A 3UE3A 3GR2A 1SDNA 3PBRA 3LCEA 5FI6A 3C7UA 3ZG9B 3WS2A 1KDWA 5CHMA 2R9XA 5FAPA 2ZQDA 1K56A 5F1FA 4QHCA 4MBHA 1N9BA 4KENB 4Q8IA 4XUXA 1ES3A 3OPPA 1KVLA 2XDMA 2Y2PA 3IXBA 1FCOA 5CHUA 4R4RA 2PBYA 5DF7A 2EX6A 4O7DA 1W8YA 3EQVA 4KZ5A 2ZM2A 3PAEA 1GA0A 1FCNA 5EVIC 4U0XA 5FQIA 2VGJA 2ZQCA 2Z2MB 4Y0OA 3C7VA 5EE8A 1FSWA 3RXWA 1TVFA 4ZJ3A 5D3OA 4OVDA 3CMZA 4WMCA 4QB8A 5F1GA 3GMWA 4LV1A 5L2FA 5E2FA 5CTNA 2G2UA 3C4PA 4MLLA 1N4OA 3VP2A 2EX8A 3OPRA 4C75A 1O7EA 3FYZA 1RP5A 4KZ9A 3N8LA 2Y2NA 5TR7A 3UPOA 2WGWA 4P0MA 1XA7A 3N8SA 4X56A 4BD0A 1LI0A 2WZXA 2DRWA 4QU3A 5EECA 2XD5A 5E2GA 3S1YA 1PWGA 3N7WA 1KGFA 1IYOA 2R9WA 5GL9A 5HAQA 1ERMA 3G35A 4E6XA 4S2PA 2Y91A 3BYDA 4EV4A 1PW1A 1CEGA 2DCFA 3AGFA 1PZPA 1PW8A 2FFYA 1NY0A 4IEDA 5J8XA 3LO7A 1FR1A 3GTCA 1K57A 2V20A 4HBUA 4DDSA 4P85A 5M19A 3A3DA 3IWIA 3SH8A 2WADA 2WAFA 3VP1A 3AGEA 5DVAA 2RL3A 2ZC4B 3IHAA 1K56D 2P74A 2WGWB 4RVAA 2Q9MA 4MBFA 3V39A 5AQAA 3PBOA 4PM7A 5CEDA 3MXSA 4KQQA 5JYOA 1PZOA 3DWZA 3Q7ZA 4X53A 4LENA 3ZGAB 4BENA 1H8ZA 4OLDA 1K4EA 2XFTA 1E4DA 5G18A 1MY8A 3A3JA 3ZNYA 1K6RA 4E3OA 2ZD8A 1YLWA 4IBXA 4R3BA 4RA7A 4Y7PA 3IHBA 1Q2QA 3BLSA 2J8YA 3QNBA 3G30A 2H10A 3OZHA 4JKTA 1BLSA 2H5SA 4WBGA 3S4XA 2WKIA 2XR0A 4OOYA 3BLMA 2Y2KA 1L2SA 3PAGA 1MWRA 1YMSA 1JWPA 2IWCA 4KZ8A 3ZG7B 4L0LA 3C5AA 3BM6A 1MXOA 1XGJA 2EXAA 3Q82A 4KZ3A 1L0GA 1YQSA 3GSGA 3N4IA 3RJUA 1MBLA 4UA7A 3BFCA 4OH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PTE A;  5A90 A;  1FQG A;  2PU2 A;  4PM6 A;  1ES5 A;  1ONH A;  5DTT A;  4KZB A;  4EWF A;  2WKH A;  3SS4 A;  1QME A;  5DTS A;  1YLJ A;  5KMW A;  3Q7V B;  4WYY A;  5EOE A;  1ALQ A;  4EUZ A;  3AGD A;  2FFF B;  3VOY A;  4S2L A;  1LL9 A;  4OLG A;  5FSR A;  4EBN A;  1GA9 A;  2HPB A;  4N92 A;  3BEC A;  1ESU A;  3GVB A;  2JE5 A;  1GHM A;  2Y2O A;  1ZKJ A;  3HUO A;  3RXX A;  3IH8 A;  1CK3 A;  4GKU A;  3ITA A;  4JBF A;  4M3K A;  3ZCZ A;  3HVF A;  3SH9 A;  3ISG A;  3E2L A;  1DY6 A;  2HDS A;  4WM9 A;  3A3E A;  3MKF A;  1YLT A;  2ZJ9 A;  4R0Q A;  5E2E A;  4BJP A;  4GD6 A;  2GDN A;  5BOH A;  5E2H A;  2CC1 A;  4HEF A;  3B3X A;  4OPR A;  5EVI A;  1E3U D;  2G2W A;  1PI4 A;  4JXV A;  3TOI A;  3M6B A;  3LY4 A;  4EBL A;  1WYB A;  4R23 A;  2JBF A;  1MWU A;  3QNC A;  5DF8 A;  1SHV A;  1PWC A;  2EFU A;  2QZ6 A;  4OPY A;  5AQB A;  3MKE A;  1XKZ A;  2ZQA A;  4DDY A;  4U3T A;  1NZO A;  1MPL A;  4RX3 A;  3SOI A;  4WZ5 C;  4X68 A;  3VFH A;  2J9P A;  4N9L A;  1ES4 A;  1K25 A;  3VMA A;  4ZTK A;  4PMA A;  1K55 A;  1I2S A;  2BLS A;  4A5R A;  5FAT A;  3NY4 A;  1MKI A;  3EQU A;  3VOZ A;  4OON A;  2HDR A;  4OQH A;  1IKG A;  4E3M A;  4CJN A;  2ZC5 B;  4R3J A;  2Y2L A;  4MBK A;  5FI7 A;  3SS5 A;  3FV7 A;  3IQA A;  3M2J A;  5KZH A;  1W79 A;  1WYC A;  4KZ4 A;  5FQQ A;  2ZM8 A;  4LV0 A;  4KG6 A;  1Y54 A;  2EX9 A;  3Q81 A;  2OLU A;  1ESI A;  4DE2 A;  3UPN A;  2XQZ A;  1BLH A;  5KSH A;  1RGY A;  3IXD A;  2V1Z A;  1YM1 A;  4RYE A;  3W8K A;  5A91 A;  4OKP A;  3OCN A;  4GN2 A;  4UAA A;  3CG5 A;  2ZC7 A;  4FSF A;  4WEL A;  2OSU A;  4GDB A;  5M18 A;  2HP9 A;  3S22 A;  5F83 A;  4IBR A;  1NYY A;  1TDG A;  3MFD A;  1LLB A;  3D4F A;  1JTD A;  1GHI A;  3PBN A;  1LI9 A;  3WRZ A;  5EPH A;  1ZC2 A;  3VP0 A;  4KZA A;  1LL5 A;  4R4S A;  4NK3 A;  2J9O A;  1BLP A;  2VGK A;  1JVJ A;  4GD8 A;  2Y2G A;  5A93 A;  2E8I A;  1PIO A;  1VQQ A;  1JWZ A;  1PI5 A;  5DF9 A;  1MWS A;  1DJB A;  2WKE A;  4ID4 A;  5IHV A;  4OP5 A;  1Q2P A;  1J9M A;  4JF5 A;  4K0W A;  1CI8 A;  1HVB A;  1OME A;  2XEP A;  3C4O A;  3LEZ A;  4MEZ A;  4Y0U A;  3ZG0 A;  1KE4 A;  2WGV A;  2X71 A;  3Q7V A;  3WS0 A;  5FAO A;  2H0Y A;  5GHX A;  4C3Q A;  1YMX A;  5CEB A;  1FSY A;  1IEL A;  1NXY A;  5CXW A;  3MZD A;  4QJG A;  1XX2 A;  3ZVW A;  2Y2Q A;  3N6I A;  2ZLY A;  3VP4 A;  4E3I A;  4B4X A;  1KE0 A;  3TG9 A;  4X6T A;  1NRF A;  3I7J A;  4ZJ2 A;  1PWD A;  3N8R A;  2X02 A;  4B4Z A;  2C5W B;  1KDS A;  1PYY A;  4GB7 A;  1GHP A;  4LV3 A;  5CTM A;  3PBT A;  2WGI A;  1M6K A;  1YT4 A;  3P98 A;  5EVI D;  5HFO A;  2BG1 A;  3UDF A;  2Q9N A;  3UPP A;  4OQI A;  3VSK A;  1S0W A;  3IWO A;  4EBP A;  3IF6 A;  1CEF A;  5CGS A;  2ZQ7 A;  5E43 A;  4OPZ A;  2UWX A;  3VP3 A;  5HAP A;  5KSC A;  1L0E A;  3UE0 A;  3P09 A;  1IYP A;  1NYM A;  4U0T A;  3V50 A;  4JXW A;  3ZFZ A;  2X01 A;  5HAR A;  2PU4 A;  5CGX A;  4FH2 A;  3G31 A;  3HBR A;  1BSG A;  1KGG A;  4S2N C;  1BTL A;  5EOO A;  4N1X A;  3GRJ A;  4JF6 A;  2ZQ9 A;  3QHY A;  4XUZ A;  3ZDJ A;  4BQM A;  1JWV A;  1E3U A;  3CJM A;  3NC8 A;  1XPB A;  5TGF A;  4KG2 A;  3BEB A;  4XXR A;  1EI5 A;  2Y2M A;  3PBS A;  3G2Z A;  1TDL A;  3ZG8 B;  4DRT A;  1M40 A;  3IWQ A;  4N9K A;  4FH4 A;  3DWK A;  3ITB A;  3NBL A;  1EWZ A;  3HLE A;  1TEM A;  1ZG6 A;  3HLW A;  3OCL A;  1W5D A;  2EFX A;  2ZMA A;  5U47 A;  4S2N A;  3W4P A;  2J7V A;  3BFE A;  4OOL A;  2Y55 A;  4LV2 A;  4ZBE A;  4E3L A;  3VFF A;  4KQR A;  4S2M A;  3WWX A;  1S6R A;  2HP6 A;  5CRF A;  3G2Y A;  2WYX A;  5FQM A;  3PBQ A;  1BT5 A;  3FKW A;  1XA1 A;  4IVK A;  5FAS A;  1FCM A;  1YLP A;  3G34 A;  2WUQ A;  1NJ4 A;  3UDI A;  1W7F A;  3IF5 A;  4KG5 A;  5JYP A;  5HAI A;  4LCL A;  1K55 C;  1VM1 A;  1G6A A;  2JCH A;  2HP5 A;  3A3I A;  3LY3 A;  5FAQ A;  1GCE A;  2QMI A;  4WEJ A;  3OC2 A;  4PM5 A;  4DKI A;  1BZA A;  2EX2 A;  3UO9 A;  4HES A;  2A49 A;  3IF6 B;  3MZF A;  4PM8 A;  4WZ5 A;  5M1A A;  3HRE A;  3O3V A;  2ZQ8 A;  4LCM A;  5FQJ A;  3SH7 A;  2A3U A;  3ZG5 A;  2HDU A;  4QY6 A;  4GDN A;  3WRT A;  4DXC A;  4P6B A;  2QPN A;  4YIN A;  4WEK A;  2Y59 A;  1W8Q A;  3OPL A;  2RCX A;  2XK1 A;  3NIA A;  3MXR A;  5GLB A;  5AQ7 A;  1LHY A;  4B88 A;  5FDH A;  5GHY A;  4QD4 A;  4S2J A;  1MWT A;  4OPQ A;  3M6H A;  2Z2L B;  4FCF A;  1I5Q A;  2Y2I A;  4CPK A;  1L0F A;  5A92 A;  3W4Q A;  2HDQ A;  1BUE A;  1K38 A;  3GQZ A;  1K4F A;  2OV5 A;  1K54 C;  3ZNT A;  4E6W A;  4WMC D;  4DE3 A;  1H5X A;  1RGZ A;  3Q1F A;  4X69 A;  4JXS A;  3ZHH A;  4JF4 A;  2XLN A;  4JPM A;  1WE4 A;  3G32 A;  3UNW A;  3HLD A;  2XD1 A;  2IWD A;  4P87 A;  4E3J A;  3E2K A;  3HUN A;  4UA6 A;  4E3N A;  3BRM A;  4OOM A;  1ERO A;  4ZJ1 A;  1BUL A;  4Z9Q A;  2P9V A;  3ZVT A;  4S2I A;  4KZ7 A;  3HLC A;  3IT9 A;  4N1H A;  1HD8 A;  2H0T A;  5FQ9 A;  5CHJ A;  3FZC A;  3NI9 A;  5FQK A;  5FI2 A;  1YLY A;  3A3F A;  3IXG A;  3G4P A;  2EXB A;  5AQ9 A;  4C6Y A;  1K57 C;  4KZ6 A;  1L0D A;  4YFM A;  2WAE A;  4UHU A;  2V2F F;  3GV9 A;  5HL1 A;  4FD8 A;  3O86 A;  3O87 A;  2I72 A;  4JLF A;  4F94 A;  1ERQ A;  1XXM A;  4OQG A;  3IXH A;  4JXG A;  2IWB A;  4K0X A;  3HLG A;  4NET A;  5TFQ A;  3UDX A;  4K91 A;  3UE1 A;  1KE3 A;  2XFS A;  5HW3 A;  4X55 A;  1RCJ A;  2P9V B;  4BL3 A;  5CEC A;  1BLC A;  4MNR A;  1KGE A;  4IVI A;  3DTM A;  4S2O A;  3SS3 A;  4DXB A;  1SDE A;  1XGI A;  1IYS A;  1H8Y A;  2XF3 A;  4OP8 A;  1C3B A;  4EQI A;  3WS4 A;  1G68 A;  1SKF A;  4E3K A;  3V5M A;  1ONG A;  3IF6 C;  4R1G A;  4KQO A;  5EVL A;  2WZZ A;  3TSG A;  3BFD A;  3WS5 A;  1IKI A;  5F82 A;  1ZG4 A;  4UA9 A;  5CER A;  1ES2 A;  3WS1 A;  3UN7 A;  4PPR A;  3NCK A;  3FWL A;  4GOG A;  5HX9 A;  5GLD A;  4GZB A;  3MZE A;  1IYQ A;  4H8R A;  5GLC A;  3JYI A;  3HLF A;  4DE1 A;  1DJC A;  1YLZ A;  4BL2 A;  3IH9 A;  1QMF A;  2ZC3 B;  4PM9 A;  1K6S A;  5EUA A;  5DTK A;  3BFF A;  4Y0T A;  3V3R A;  1NZU A;  1HZO A;  3BFG A;  3Q07 A;  3HLB A;  1O07 A;  3HL9 A;  3DW0 A;  2JC7 A;  4DF6 A;  3CZD A;  3HUM A;  1FR6 A;  2B5R A;  2WK0 A;  4OQ0 A;  2XH9 A;  4QY5 A;  4RX2 A;  4D2O A;  5EVI B;  5GHZ A;  1JTG A;  4BLM A;  1Z6F A;  5I94 A;  2XGN A;  3O88 A;  3UY6 A;  4BD1 A;  3OPH A;  4S2K A;  1DJA A;  1FOF A;  4ZDX A;  1CI9 A;  3MBZ A;  2ZC6 B;  3NDG A;  4GNU A;  1HTZ A;  1U60 A;  1SCW A;  2Y2H A;  1KVM A;  3FKV A;  2ZM0 A;  3M2K A;  5CGW A;  4WZ4 A;  5GLA A;  2OLV A;  3W4O A;  2Y4A A;  4DE0 A;  1IEM A;  2C6W B;  2Y2J A;  4ZAM A;  3VSL A;  3NDE A;  4HBT A;  2DNS A;  5FA7 A;  1E25 A;  1AXB A;  3V3S A;  1I2W A;  1K54 A;  1XP4 A;  3UE3 A;  3GR2 A;  1SDN A;  3PBR A;  3LCE A;  5FI6 A;  3C7U A;  3ZG9 B;  3WS2 A;  1KDW A;  5CHM A;  2R9X A;  5FAP A;  2ZQD A;  1K56 A;  5F1F A;  4QHC A;  4MBH A;  1N9B A;  4KEN B;  4Q8I A;  4XUX A;  1ES3 A;  3OPP A;  1KVL A;  2XDM A;  2Y2P A;  3IXB A;  1FCO A;  5CHU A;  4R4R A;  2PBY A;  5DF7 A;  2EX6 A;  4O7D A;  1W8Y A;  3EQV A;  4KZ5 A;  2ZM2 A;  3PAE A;  1GA0 A;  1FCN A;  5EVI C;  4U0X A;  5FQI A;  2VGJ A;  2ZQC A;  2Z2M B;  4Y0O A;  3C7V A;  5EE8 A;  1FSW A;  3RXW A;  1TVF A;  4ZJ3 A;  5D3O A;  4OVD A;  3CMZ A;  4WMC A;  4QB8 A;  5F1G A;  3GMW A;  4LV1 A;  5L2F A;  5E2F A;  5CTN A;  2G2U A;  3C4P A;  4MLL A;  1N4O A;  3VP2 A;  2EX8 A;  3OPR A;  4C75 A;  1O7E A;  3FYZ A;  1RP5 A;  4KZ9 A;  3N8L A;  2Y2N A;  5TR7 A;  3UPO A;  2WGW A;  4P0M A;  1XA7 A;  3N8S A;  4X56 A;  4BD0 A;  1LI0 A;  2WZX A;  2DRW A;  4QU3 A;  5EEC A;  2XD5 A;  5E2G A;  3S1Y A;  1PWG A;  3N7W A;  1KGF A;  1IYO A;  2R9W A;  5GL9 A;  5HAQ A;  1ERM A;  3G35 A;  4E6X A;  4S2P A;  2Y91 A;  3BYD A;  4EV4 A;  1PW1 A;  1CEG A;  2DCF A;  3AGF A;  1PZP A;  1PW8 A;  2FFY A;  1NY0 A;  4IED A;  5J8X A;  3LO7 A;  1FR1 A;  3GTC A;  1K57 A;  2V20 A;  4HBU A;  4DDS A;  4P85 A;  5M19 A;  3A3D A;  3IWI A;  3SH8 A;  2WAD A;  2WAF A;  3VP1 A;  3AGE A;  5DVA A;  2RL3 A;  2ZC4 B;  3IHA A;  1K56 D;  2P74 A;  2WGW B;  4RVA A;  2Q9M A;  4MBF A;  3V39 A;  5AQA A;  3PBO A;  4PM7 A;  5CED A;  3MXS A;  4KQQ A;  5JYO A;  1PZO A;  3DWZ A;  3Q7Z A;  4X53 A;  4LEN A;  3ZGA B;  4BEN A;  1H8Z A;  4OLD A;  1K4E A;  2XFT A;  1E4D A;  5G18 A;  1MY8 A;  3A3J A;  3ZNY A;  1K6R A;  4E3O A;  2ZD8 A;  1YLW A;  4IBX A;  4R3B A;  4RA7 A;  4Y7P A;  3IHB A;  1Q2Q A;  3BLS A;  2J8Y A;  3QNB A;  3G30 A;  2H10 A;  3OZH A;  4JKT A;  1BLS A;  2H5S A;  4WBG A;  3S4X A;  2WKI A;  2XR0 A;  4OOY A;  3BLM A;  2Y2K A;  1L2S A;  3PAG A;  1MWR A;  1YMS A;  1JWP A;  2IWC A;  4KZ8 A;  3ZG7 B;  4L0L A;  3C5A A;  3BM6 A;  1MXO A;  1XGJ A;  2EXA A;  3Q82 A;  4KZ3 A;  1L0G A;  1YQS A;  3GSG A;  3N4I A;  3RJU A;  1MBL A;  4UA7 A;  3BFC A;  4OH0 A; 
#chains in the Genus database with same CATH topology
 3PTE A;  5A90 A;  4WLA A;  1ONH A;  5DTT A;  4DMZ A;  2W3D A;  4ZRR A;  1NLZ A;  1YLJ A;  5KMW A;  3Q7V B;  4WYY A;  1ALQ A;  4OLG A;  2HPB A;  4N92 A;  3GVB A;  1GHM A;  1SKO B;  2YKF A;  3IH8 A;  3ITA A;  3ZCZ A;  3SH9 A;  2ZJ9 A;  2GDN A;  3MQO A;  1AWI A;  1MC0 A;  4OPR A;  1NRJ A;  4GJ4 A;  5EVI A;  1G6O A;  2W1R A;  4R23 A;  5DF8 A;  3QNC A;  1PWC A;  2QZ6 A;  1XKZ A;  3DTI A;  4DDY A;  4MCW A;  2XA7 M;  2L1M A;  1MPL A;  3SOI A;  4WZ5 C;  3VFH A;  1K25 A;  4PMA A;  3C38 A;  1MKI A;  3EQU A;  4OON A;  3UB6 A;  4E3M A;  5FI7 A;  3HJK A;  2ZM8 A;  1Y54 A;  4DE2 A;  5HWT A;  1BLH A;  3C8C A;  5KSH A;  2V1Z A;  5DJT A;  4HY8 A;  4UAA A;  4X1L A;  3UE6 A;  5M18 A;  4HIA A;  4IBR A;  1CF0 A;  3W2Z A;  1OTA A;  1GHI A;  3QP6 A;  1LI9 A;  4LRZ E;  4CLC A;  3VP0 A;  4KZA A;  4B93 A;  1BLP A;  4XT2 B;  4RQ9 A;  1JVJ A;  1VQQ A;  2GZA A;  1P0Z A;  1PI5 A;  4HP9 A;  1HVB A;  1T1A A;  1OME A;  2XEP A;  3C4O A;  3EWK A;  4C3Q A;  5CEB A;  3D9Y A;  2LB9 A;  2O9A A;  5CXW A;  3K3C A;  1XX2 A;  2ZMV A;  3G6O A;  1PWD A;  1PYY A;  5CTM A;  4LV3 A;  5EVI D;  3P98 A;  3R7W B;  2BG1 A;  2W1T A;  2PYR A;  5TBM A;  1S0W A;  4L9F A;  4EBP A;  3T4J A;  3IF6 A;  4OPZ A;  3CHW P;  5KSC A;  2M7U A;  4HJ4 A;  3ZFZ A;  1A0K A;  2VV6 A;  4M4X A;  3HBR A;  4S2N C;  4HI4 A;  5L10 A;  5EOO A;  5HDD A;  5HDC A;  3U4L P;  3QP1 A;  4XXR A;  1M40 A;  3ITB A;  3HLE A;  3HLW A;  3NJA A;  1MKM A;  2J7V A;  4OOL A;  4LV2 A;  3VFF A;  3WWX A;  1S6R A;  5FQM A;  4G3K A;  3G34 A;  1XFQ A;  2V1B A;  5MC7 A;  4I3A A;  3C30 A;  4QWO A;  4LPZ A;  4LCL A;  1K55 C;  3UB8 A;  1G6A A;  3LY3 A;  2KLI A;  3OC2 A;  1BZA A;  3UO9 A;  3IF6 B;  5EM1 A;  5M1A A;  2A3U A;  3S7O A;  3KYZ A;  4DN0 A;  4PKY G;  4QD4 A;  4S2J A;  4OPQ A;  5EM0 A;  3KYE A;  1I5Q A;  3FC7 A;  2WKR A;  4E6W A;  3Q1F A;  3ZHH A;  4JXS A;  1VET B;  3HLD A;  3HUN A;  4WUJ A;  4Q0I A;  4GS9 A;  3EEA A;  5DJU A;  5FQ9 A;  1YLY A;  3IXG A;  2EXB A;  4C6Y A;  4KZ6 A;  1L0D A;  4YFM A;  3C2W A;  2J3W A;  5HL1 A;  4BWI A;  2I72 A;  3F1P A;  2JKG A;  4F94 A;  4YWZ A;  1OT9 A;  2IWB A;  4NET A;  5TFQ A;  4K91 A;  3UE1 A;  2JHE A;  1NLY A;  3MJQ A;  4BL3 A;  4YNR A;  4IVI A;  4LGW A;  4DXB A;  1SDE A;  4EER A;  3WS4 A;  2WKP A;  3V5M A;  3TSG A;  4KQO A;  4Z1W A;  4F3L B;  3WS1 A;  3FWL A;  5GLD A;  4GZB A;  5GLC A;  3IBJ A;  3JYI A;  1N9N A;  2ZC3 B;  4I39 A;  1GSW A;  3LIE A;  4Y0T A;  3V3R A;  1O07 A;  2W1T B;  4DF6 A;  2WK0 A;  4QY5 A;  5EVI B;  5GHZ A;  4BLM A;  1Z6F A;  5CX7 A;  3O88 A;  1DJA A;  1FOF A;  5J3W A;  3VV4 A;  1CI9 A;  2I9V A;  3NDG A;  1SCW A;  1KVM A;  5CGW A;  1IEM A;  3VSL A;  3IX8 A;  5FA7 A;  3LUQ A;  1K54 A;  1XP4 A;  3PBR A;  3OLO A;  5CHM A;  5FAP A;  1K56 A;  5F1F A;  3IX3 A;  3IXB A;  5DF7 A;  2EX6 A;  1W8Y A;  4KZ5 A;  3PAE A;  2O99 A;  3KSI A;  3LFV A;  5IU1 A;  3RTY A;  2PRF A;  2VEA A;  2ZQC A;  3RXW A;  2P7J A;  1KOU A;  4WMC A;  4FOF A;  1F5M A;  2D02 A;  3UPO A;  2WGW A;  2PHY A;  1XA7 A;  3N8S A;  4X56 A;  1LI0 A;  2WZX A;  2DRW A;  3ZYT A;  2AVX A;  1PWG A;  5GL9 A;  3G35 A;  4S2P A;  2Y91 A;  5EVE A;  2DCF A;  3NUL A;  1PZP A;  1PW8 A;  1PRQ A;  3GTC A;  1K57 A;  4HBU A;  3E4O A;  3IS2 B;  2WAF A;  3B42 A;  3VP1 A;  3CUE C;  2RL3 A;  3H82 B;  4B9O A;  4KQQ A;  1YSP A;  4LEN A;  2XFT A;  3BW6 A;  1IOU A;  3ZNY A;  4HHD A;  2ZD8 A;  4IBX A;  4R3B A;  2JKR I;  3IHB A;  3BLS A;  5FEG A;  3S4X A;  2WKI A;  1YMS A;  3ZG7 B;  3C5A A;  2GNX A;  1XGJ A;  1L0G A;  1YQS A;  3GSG A;  4EUV A;  2OAP 1;  3RJU A;  1XJ2 A;  1H3Q A;  3T12 B;  2PU2 A;  4NKP A;  4EWF A;  2WKH A;  3LI9 A;  2PYP A;  3T1R A;  3VOY A;  5L07 A;  4NXE A;  3MR0 A;  2JE5 A;  5F5Y A;  3HUO A;  3B47 A;  3JVU A;  3RXX A;  1CK3 A;  4WN5 A;  3ISG A;  5IT5 A;  3E2L A;  4WM9 A;  3MKF A;  1YLT A;  4BJP A;  1XJ6 A;  4ETX A;  4JXV A;  3M6B A;  3LY4 A;  1WYB A;  2JBF A;  1MWU A;  1SHV A;  2M1C A;  4DJ3 A;  3T4K A;  5AQB A;  4FUW A;  2ZQA A;  3ULF A;  1XFN A;  1GSX A;  4K08 A;  2Z6D A;  1D1J A;  2VGL S;  3RH8 B;  3VMA A;  4ZTK A;  1K55 A;  3SW1 A;  2BLS A;  3VOZ A;  4OQH A;  4CLC C;  3MQ0 A;  1ZTU A;  4IUH A;  2P04 A;  4ARZ A;  1LSW A;  2OLU A;  2XQZ A;  1RGY A;  3IXD A;  1YM1 A;  3W8K A;  3K2N A;  3CG5 A;  2ZC7 A;  4FSF A;  4HH2 A;  4KQD A;  3DTE A;  3DTK A;  1JTD A;  3WRZ A;  1ZC2 A;  4R70 A;  4I3J A;  4MMN A;  4NK3 A;  2J9O A;  1PIO A;  5L09 A;  3O5Y A;  1MWS A;  1DJB A;  2WKE A;  3VE3 A;  3H7W B;  4K0W A;  1CI8 A;  3ZG0 A;  2HJE A;  4MEZ A;  5FAO A;  1FSY A;  1S1Y A;  3ZVW A;  2Y2Q A;  1KE0 A;  2VK3 A;  1NRF A;  3I7J A;  2L0W A;  3N8R A;  2C5W B;  1KDS A;  1GHP A;  2WGI A;  1YT4 A;  5CGS A;  3DBA A;  5E43 A;  3EEH A;  1L0E A;  1S67 L;  3NOP C;  4JXW A;  1G28 A;  5HAR A;  4L9G A;  4FH2 A;  1UGU A;  2MJ6 A;  3TJZ C;  1ODV A;  2ACG A;  4LRY C;  2NUT C;  4XUZ A;  3IX4 A;  1E3U A;  3CJM A;  1XPB A;  1EI5 A;  4DRT A;  4N9K A;  3R7W A;  1YSQ A;  3NBL A;  3BWL A;  2HF6 A;  1Z09 A;  1TEM A;  1CQA A;  4HP4 A;  2EFX A;  4S2N A;  1LL8 A;  3H82 A;  3PBQ A;  2VGL M;  1XA1 A;  1NJ4 A;  3IF5 A;  4KG5 A;  2W3H A;  4HOI A;  4E04 A;  4IJG A;  1VM1 A;  2HP5 A;  1GCE A;  2W3G A;  4LFU A;  2EX2 A;  4PM8 A;  2A49 A;  4Y5F A;  1YKD A;  4WZ5 A;  3HRE A;  4LCM A;  3ZG5 A;  3WRT A;  4GLQ A;  4P6B A;  4DXC A;  2QPN A;  3OPL A;  2RCX A;  3NIA A;  2Q0O A;  3R4K A;  5KIZ A;  2A24 A;  3TE8 A;  5FDS A;  3W4Q A;  1K38 A;  1BUE A;  4HJ6 A;  2D01 A;  1N9L A;  2B95 A;  1RGZ A;  4X69 A;  4JPM A;  3G32 A;  3UNW A;  2IWD A;  3E4Q A;  4P87 A;  5G4Z A;  5L8M A;  1BUL A;  3ZVT A;  4KZ7 A;  1Y4O A;  1HD8 A;  2H0T A;  3NI9 A;  5FI2 A;  3G4P A;  5AQ9 A;  2Z6C A;  5G4Y A;  4UHU A;  5TJJ A;  5A8B A;  3GV9 A;  4FD8 A;  3L9K A;  4Q0J A;  4OQG A;  4JXG A;  4K0X A;  3HLG A;  1H8M A;  5HW3 A;  4X55 A;  2IA2 A;  1BLC A;  4MNR A;  1YAX A;  1XGI A;  1H8Y A;  4OP8 A;  4JGP A;  2VV8 A;  1SKF A;  1ONG A;  2VZW A;  1X0O A;  3WS5 A;  3BFD A;  1IKI A;  5CER A;  4UA9 A;  2V1A A;  3A0V A;  2HV1 A;  2INW A;  5HX9 A;  4GS9 B;  3MZE A;  1IYQ A;  4DE1 A;  1VEU B;  1YLZ A;  1QMF A;  1W63 M;  4BBU A;  2ZOI A;  1K6S A;  2VKS A;  3CPT A;  5DTK A;  1HZO A;  3BFG A;  3Q07 A;  3HLB A;  2DMW A;  3HJI A;  3CZD A;  1S4S A;  4BD1 A;  1WA9 A;  4ZDX A;  4NXB A;  4H6J A;  1U60 A;  2Y2H A;  4GHI B;  1FIK A;  5GLA A;  2OLV A;  2Y4A A;  4II7 A;  4ZAM A;  2VJW A;  1AXB A;  3V3S A;  1I2W A;  3RFB A;  3UE3 A;  3GR2 A;  1K0K A;  4R3A A;  3A0R A;  3WS2 A;  2BAS A;  2R9X A;  2J3T C;  4QHC A;  4MBH A;  2L4R A;  4KEN B;  2ZOH A;  1KVL A;  1FCO A;  4ME4 A;  4O7D A;  3EQV A;  5EVI C;  3JVV A;  5FQI A;  2VGJ A;  4JGO A;  1VHM A;  4Y0O A;  1TVF A;  5HSQ A;  5D3O A;  3CMZ A;  3GMW A;  5L2F A;  3F1N B;  4MLL A;  1N4O A;  4KZ9 A;  2A24 B;  2K2N A;  1DP8 A;  1T18 A;  5EEC A;  5HAQ A;  4CQH A;  5F68 A;  1JNU A;  3AGF A;  1NY0 A;  3LO7 A;  1FR1 A;  2V20 A;  4DJ2 A;  3F1O A;  3SH8 A;  2XRN A;  3AGE A;  1N9O A;  1LSX A;  2OOL A;  1K56 D;  2P74 A;  2ZC4 B;  4RVA A;  4MBF A;  4EET B;  1PZO A;  4UQI S;  4BEN A;  1H8Z A;  5HPI A;  1E4D A;  3A3J A;  4E3O A;  4RA7 A;  3LR3 A;  2J8Y A;  1BYW A;  2H10 A;  2WKQ A;  4JKT A;  4WBG A;  2H5S A;  3P01 A;  1ACF A;  3PAG A;  1MWR A;  2PDR A;  2GJ3 A;  4L0L A;  3OOV A;  2EXA A;  2JKT M;  4UA7 A;  4OH0 A;  3KSF A;  1FQG A;  4KZB A;  3SS4 A;  1QME A;  3T4Q A;  4EUZ A;  3AGD A;  2FFF B;  1LL9 A;  4EBN A;  1GA9 A;  1OTE A;  3LGO A;  1ESU A;  2W3F A;  1ZKJ A;  4GKU A;  4QPR A;  4M3K A;  3LR5 A;  3ZQ5 A;  3T1X A;  1DY6 A;  3A3E A;  2CC1 A;  4I5S A;  1E3U D;  2OWJ A;  2G2W A;  2GX5 A;  1PI4 A;  2HGV A;  4G3V A;  1J3W A;  2O0Y A;  3U2A A;  2KX6 A;  4EBL A;  2PR5 A;  4NXF A;  2EFU A;  4OPY A;  4EEU A;  3FPV A;  1D06 A;  4JGQ A;  1ES4 A;  5DFY A;  1EW0 A;  3VOL A;  4A5R A;  5FAT A;  3NY4 A;  2V0W A;  2HDR A;  1IKG A;  4CJN A;  2ZC5 B;  4R3J A;  3SS5 A;  2ZBB A;  3FV7 A;  4Y2F A;  1W79 A;  4KZ4 A;  4LV0 A;  1D7E A;  2EX9 A;  3Q81 A;  3E0Y A;  3LIA A;  4RYE A;  5A91 A;  4GN2 A;  5HWW A;  2OSU A;  4GDB A;  5F83 A;  1NYY A;  3MF0 A;  1TDG A;  1T1B A;  1LLB A;  3D4F A;  3UMD A;  3PBN A;  2VLG A;  5F69 A;  3LYX A;  2VGK A;  4GD8 A;  2E8I A;  3BQA A;  1JWZ A;  5DF9 A;  4IUK A;  4JF5 A;  5HPF A;  4Y0U A;  1KE4 A;  3BY9 A;  2X71 A;  4CLC D;  2JKR M;  2NUP C;  1YMX A;  1IEL A;  1NXY A;  3MZD A;  4QJG A;  4ARZ B;  2KOI A;  5HD3 A;  3CPT B;  2VA0 A;  3N6I A;  1SZV A;  3V67 A;  4BBV A;  4ZJ2 A;  2X02 A;  3GEC A;  4Y3I A;  5HL6 A;  4GB7 A;  1M6K A;  3D72 A;  3VSK A;  1VET A;  3VP3 A;  5HAP A;  3UE0 A;  3P09 A;  1IYP A;  1NYM A;  3KO6 A;  3F1N A;  2PU4 A;  3G31 A;  2EWW A;  1BSG A;  1BTL A;  4N1X A;  3GRJ A;  2ZQ9 A;  3QHY A;  3ZDJ A;  5F6A A;  4BQM A;  5TGF A;  4KG2 A;  3G2Z A;  1TDL A;  3ZG8 B;  1OJG A;  3CLO A;  4D60 A;  1EWZ A;  3T1S A;  3OCL A;  3L7H A;  3BFE A;  2Y55 A;  2K7S A;  3BY8 A;  2WYX A;  4IVK A;  1BT5 A;  3FKW A;  2Y79 A;  5FAS A;  4CLC B;  3UDI A;  1W7F A;  4EW7 A;  4KUK A;  2JCH A;  2J80 A;  4WF0 A;  4PM5 A;  4DKI A;  4HES A;  3MZF A;  3O3V A;  2ZQ8 A;  5FQJ A;  1OTI A;  4EQ1 A;  1P9W A;  4H6J B;  4GDN A;  5DKL A;  1L3L A;  4WEK A;  2Y59 A;  1W8Q A;  3CUE A;  2XK1 A;  3BQ8 A;  3MXR A;  3IS2 A;  5HD5 A;  5GLB A;  1LT0 A;  5AQ7 A;  1LHY A;  3PHY A;  4B88 A;  2JN7 A;  5GHY A;  2Y2I A;  5A92 A;  2OV5 A;  3GQZ A;  2QWS A;  3ZNT A;  1HLU P;  3H9W A;  4DE3 A;  2XLN A;  1WE4 A;  1TF1 A;  2W27 A;  2XD1 A;  1P9R A;  3E2K A;  4UA6 A;  3BRM A;  1ERO A;  4WL9 A;  4ZJ1 A;  2P9V A;  3IT9 A;  3FZC A;  5HDS A;  2KDK A;  1K57 C;  3DAV A;  3O86 A;  3O87 A;  4JLF A;  1ERQ A;  3VE4 A;  1XXM A;  3IXH A;  5EV0 A;  1KE3 A;  5K5B A;  1RCJ A;  5CEC A;  3T50 A;  3SS3 A;  4Y13 A;  1S66 L;  2XF3 A;  3KYQ A;  1IYS A;  1G68 A;  1S4R A;  4R1G A;  1STZ A;  2WZZ A;  1ZG4 A;  5TBM B;  2QYB A;  3UN7 A;  4PPR A;  3TRC A;  3NCK A;  4EES A;  4GOG A;  3T1Q B;  1XJ3 A;  4H8R A;  3HLF A;  1DJC A;  4EU0 A;  4PM9 A;  2XA7 S;  1NZU A;  1XJ4 A;  4MN6 A;  3HL9 A;  1H0M A;  1LSV A;  3UB9 A;  3DW0 A;  3S7Q A;  1FR6 A;  5EFW A;  3PXP A;  3B33 A;  1JTG A;  2QJ5 A;  2XGN A;  3MSH A;  3OPH A;  2EA9 A;  1PFL A;  3MBZ A;  2PAV P;  1HTZ A;  1FIL A;  3FKV A;  2ZM0 A;  3M2K A;  3FPW A;  4DE0 A;  2C6W B;  2Y2J A;  3NDE A;  4HBT A;  1E25 A;  3CIT A;  2UV0 E;  2OWH A;  1SDN A;  5FI6 A;  3LCE A;  3C7U A;  4GCZ A;  3LID A;  2ZQD A;  3TW8 A;  1N9B A;  4Q8I A;  4XUX A;  1ES3 A;  3OPP A;  4HH3 A;  2ZM2 A;  4G3W A;  1GA0 A;  3EGX C;  4U0X A;  2Z2M B;  1FSW A;  4L9E A;  4ZJ3 A;  5FL3 A;  5J4E A;  4LV1 A;  5E2F A;  2G2U A;  3OPR A;  4C75 A;  3T4O A;  2PR6 A;  2VV7 A;  1RP5 A;  1V9Z A;  2EWV A;  5AVF A;  5IS1 A;  5TR7 A;  3IBR A;  4QU3 A;  4O0P A;  2XD5 A;  3S1Y A;  3N7W A;  1KGF A;  1IYO A;  2R9W A;  4HJ3 A;  1ERM A;  4E6X A;  4EV4 A;  2PT7 A;  1PW1 A;  1CEG A;  2E8J A;  2FZ0 A;  2P08 A;  2FFY A;  3LEQ A;  4IED A;  2H28 A;  4X1M A;  4ESP A;  5M19 A;  3A3D A;  1P97 A;  3E98 A;  2WAD A;  5DVA A;  3IHA A;  2WGW B;  4NEE D;  2QKP A;  4PM7 A;  3CI6 A;  5CED A;  3DWZ A;  3KSH A;  1ZHH B;  2XRO A;  4OLD A;  1F98 A;  5G18 A;  4GW9 A;  3P7N A;  1YLW A;  1OPX A;  1IFQ A;  1Q2Q A;  3QNB A;  5DKK A;  3S7N A;  4OOY A;  2Y2K A;  1T19 A;  1JWP A;  1MXO A;  1W63 Q;  4BMW A;  3N4I A;  3FG8 A;  3S22 A;  4PM6 A;  1ES5 A;  5DTS A;  5EOE A;  2M7V A;  4NXG A;  3F1O B;  4P6Z S;  4S2L A;  5FSR A;  2A2L A;  2CMN A;  3BEC A;  2O9C A;  2Y2O A;  1UWP X;  4JBF A;  2Y8H A;  2LB5 A;  3HVF A;  2HDS A;  1Y28 A;  4R0Q A;  5E2E A;  4GD6 A;  5BOH A;  5E2H A;  4HEF A;  3B3X A;  1OTD A;  2PD8 A;  2HJ9 C;  3TOI A;  3UB5 P;  3MMH A;  4EXO A;  3PR6 A;  3MKE A;  4U3T A;  2O9B A;  1NZO A;  4RX3 A;  3MXQ A;  4X68 A;  2J9P A;  3F1P B;  4N9L A;  1I2S A;  5DFX A;  3UME A;  2Y2L A;  4MBK A;  3M2J A;  3IQA A;  4O01 A;  5KZH A;  2K31 A;  1WYC A;  4AFI A;  5FQQ A;  3BJN A;  3LR0 A;  4ETZ A;  4KG6 A;  1ESI A;  3UPN A;  1F9I A;  4PKY A;  4OKP A;  3OCN A;  4UEY A;  5LBR A;  1F2K A;  2B18 A;  4WEL A;  2HP9 A;  4R38 A;  3MFD A;  5EPH A;  1LL5 A;  4R4S A;  2Y2G A;  5A93 A;  3OBF A;  1TS8 A;  3NOT C;  4ID4 A;  5IHV A;  4OP5 A;  1Q2P A;  1J9M A;  3GDI A;  2JKF A;  3LEZ A;  3NHQ A;  2J3T D;  2WGV A;  3Q7V A;  3WS0 A;  2H0Y A;  5GHX A;  4Y17 A;  1OJ5 A;  2ZLY A;  3VP4 A;  4E3I A;  3SZT A;  4B4X A;  3TG9 A;  3MS6 A;  4X6T A;  4B4Z A;  4PHT A;  5HFO A;  2V8F A;  3PBT A;  3UDF A;  3UPP A;  2Q9N A;  2QJ7 A;  4OQI A;  3IWO A;  1CEF A;  2V8C A;  2ZQ7 A;  2UWX A;  4U0T A;  1TS6 A;  3V50 A;  2X01 A;  5CGX A;  2VX8 A;  1KGG A;  3QP8 A;  4JF6 A;  5AJG A;  1JWV A;  2XSS A;  3NC8 A;  4HNB A;  3BEB A;  2Y2M A;  3PBS A;  3IWQ A;  3A0S A;  4FH4 A;  3DWK A;  4MN7 A;  1ZG6 A;  1DP9 A;  1W5D A;  2ZMA A;  5U47 A;  3HCY A;  3W4P A;  4ZBE A;  4E3L A;  5HZH A;  4KQR A;  4S2M A;  2PBD P;  2HP6 A;  4KUO A;  5CRF A;  3G2Y A;  4GHI A;  1OTB A;  1FCM A;  1YLP A;  1T1C A;  2WUQ A;  5JYP A;  3E4P A;  3LIC A;  5HAI A;  3A3I A;  5FAQ A;  1UWN X;  2QMI A;  4WEJ A;  3MQQ A;  4HQA A;  2OAQ 1;  1VEU A;  4NG2 A;  3SH7 A;  2HDU A;  4QY6 A;  4YIN A;  4BBT A;  4Q0H A;  5FDH A;  1MWT A;  3LIB A;  3D3O A;  3M6H A;  2Z2L B;  4FCF A;  4CPK A;  1L0F A;  2HDQ A;  1K4F A;  1K54 C;  4WMC D;  1YPR A;  2W3E A;  1H5X A;  4JF4 A;  4E3J A;  4E3N A;  3KSG A;  4OOM A;  3KX0 X;  4Z9Q A;  4S2I A;  3HLC A;  4FTX A;  4N1H A;  5CHJ A;  5FQK A;  3A3F A;  4I38 A;  1VB6 A;  2WAE A;  4F3L A;  2V2F F;  2ZMF A;  3ICY A;  3LIF A;  1TS7 A;  5J7E A;  1CJF A;  3UDX A;  3S7P A;  2XFS A;  2P9V B;  2V9A A;  1KGE A;  4S2O A;  3DTM A;  5HWV A;  1C3B A;  4EQI A;  4E3K A;  1NWZ A;  5EVL A;  3IF6 C;  4IHQ A;  5F82 A;  1ES2 A;  2ZL1 A;  4EEP A;  5I5L A;  2B02 A;  4BL2 A;  3IH9 A;  5EUA A;  3EOI A;  3BFF A;  2R78 A;  3NEC A;  4PAU A;  5FEF A;  2JC7 A;  3HUM A;  1OT6 A;  2B5R A;  4OQ0 A;  2XH9 A;  3H7W A;  4RX2 A;  2QHK A;  4D2O A;  3T4T A;  4YOF A;  5I94 A;  4Y15 A;  3UY6 A;  2V0U A;  2BTF P;  4S2K A;  4I3I A;  2ZC6 B;  2PD7 A;  4GNU A;  5AVE A;  4CLC E;  2JKT I;  4WZ4 A;  3W4O A;  3T4S A;  2DNS A;  4P6Z M;  2ZL1 B;  3ZG9 B;  3LR4 A;  3QP4 A;  1KDW A;  1DRM A;  1PNE A;  1GSV A;  3QP5 A;  1V9Y A;  2XDM A;  2Y2P A;  5CHU A;  4R4R A;  2PBY A;  4UQI M;  1MZU A;  3PYP A;  1FCN A;  5EE8 A;  3C7V A;  1DP6 A;  1TD5 A;  3JPU A;  4OVD A;  4X25 A;  4QB8 A;  4MDZ A;  5F1G A;  3CAX A;  5CTN A;  3CWF A;  3C4P A;  3VP2 A;  2EX8 A;  1O7E A;  3K3D A;  3FYZ A;  3N8L A;  2Y2N A;  4P0M A;  4LLO B;  4BD0 A;  4LRX C;  5E2G A;  3LI8 A;  3BYD A;  1TS0 A;  4R6L A;  1S1Z A;  5J8X A;  4DDS A;  2G7U A;  4P85 A;  3IWI A;  3T4L A;  3MFX A;  1G5U A;  1SKO A;  5C5K A;  4MN5 A;  3EGD C;  2Q9M A;  3V39 A;  5AQA A;  3PBO A;  3NOU C;  3MXS A;  5JYO A;  3Q7Z A;  4X53 A;  3ZGA B;  3QP2 A;  1K4E A;  1MY8 A;  1K6R A;  4Y7P A;  3G30 A;  3OZH A;  1BLS A;  2W0N A;  4JGR A;  3UB7 A;  2FH5 A;  2XR0 A;  3BLM A;  1L2S A;  2IWC A;  4KZ8 A;  3BM6 A;  2HZ5 A;  4KZ3 A;  3Q82 A;  4XT2 A;  4O8G A;  2YKH A;  1MBL A;  3BFC A; 
#chains in the Genus database with same CATH homology
 3PTE A;  5A90 A;  1FQG A;  2PU2 A;  4PM6 A;  1ES5 A;  1ONH A;  5DTT A;  4KZB A;  4EWF A;  2WKH A;  3SS4 A;  1QME A;  5DTS A;  1YLJ A;  5KMW A;  3Q7V B;  4WYY A;  5EOE A;  1ALQ A;  4EUZ A;  3AGD A;  2FFF B;  3VOY A;  4S2L A;  1LL9 A;  4OLG A;  5FSR A;  4EBN A;  1GA9 A;  2HPB A;  4N92 A;  3BEC A;  1ESU A;  3GVB A;  2JE5 A;  1GHM A;  2Y2O A;  1ZKJ A;  3HUO A;  3RXX A;  3IH8 A;  1CK3 A;  4GKU A;  3ITA A;  4JBF A;  4M3K A;  3ZCZ A;  3HVF A;  3SH9 A;  3ISG A;  3E2L A;  1DY6 A;  2HDS A;  4WM9 A;  3A3E A;  3MKF A;  1YLT A;  2ZJ9 A;  4R0Q A;  5E2E A;  4BJP A;  4GD6 A;  2GDN A;  5BOH A;  5E2H A;  2CC1 A;  4HEF A;  3B3X A;  4OPR A;  5EVI A;  1E3U D;  2G2W A;  1PI4 A;  4JXV A;  3TOI A;  3M6B A;  3LY4 A;  4EBL A;  1WYB A;  4R23 A;  2JBF A;  1MWU A;  3QNC A;  5DF8 A;  1SHV A;  1PWC A;  2EFU A;  2QZ6 A;  4OPY A;  5AQB A;  3MKE A;  1XKZ A;  2ZQA A;  4DDY A;  4U3T A;  1NZO A;  1MPL A;  4RX3 A;  3SOI A;  4WZ5 C;  4X68 A;  3VFH A;  2J9P A;  4N9L A;  1ES4 A;  1K25 A;  3VMA A;  4ZTK A;  4PMA A;  1K55 A;  1I2S A;  2BLS A;  4A5R A;  5FAT A;  3NY4 A;  1MKI A;  3EQU A;  3VOZ A;  4OON A;  2HDR A;  4OQH A;  1IKG A;  4E3M A;  4CJN A;  2ZC5 B;  4R3J A;  2Y2L A;  4MBK A;  5FI7 A;  3SS5 A;  3FV7 A;  3IQA A;  3M2J A;  5KZH A;  1W79 A;  1WYC A;  4KZ4 A;  5FQQ A;  2ZM8 A;  4LV0 A;  4KG6 A;  1Y54 A;  2EX9 A;  3Q81 A;  2OLU A;  1ESI A;  4DE2 A;  3UPN A;  2XQZ A;  1BLH A;  5KSH A;  1RGY A;  3IXD A;  2V1Z A;  1YM1 A;  4RYE A;  3W8K A;  5A91 A;  4OKP A;  3OCN A;  4GN2 A;  4UAA A;  3CG5 A;  2ZC7 A;  4FSF A;  4WEL A;  2OSU A;  4GDB A;  5M18 A;  2HP9 A;  3S22 A;  5F83 A;  4IBR A;  1NYY A;  1TDG A;  3MFD A;  1LLB A;  3D4F A;  1JTD A;  1GHI A;  3PBN A;  1LI9 A;  3WRZ A;  5EPH A;  1ZC2 A;  3VP0 A;  4KZA A;  1LL5 A;  4R4S A;  4NK3 A;  2J9O A;  1BLP A;  2VGK A;  1JVJ A;  4GD8 A;  2Y2G A;  5A93 A;  2E8I A;  1PIO A;  1VQQ A;  1JWZ A;  1PI5 A;  5DF9 A;  1MWS A;  1DJB A;  2WKE A;  4ID4 A;  5IHV A;  4OP5 A;  1Q2P A;  1J9M A;  4JF5 A;  4K0W A;  1CI8 A;  1HVB A;  1OME A;  2XEP A;  3C4O A;  3LEZ A;  4MEZ A;  4Y0U A;  3ZG0 A;  1KE4 A;  2WGV A;  2X71 A;  3Q7V A;  3WS0 A;  5FAO A;  2H0Y A;  5GHX A;  4C3Q A;  1YMX A;  5CEB A;  1FSY A;  1IEL A;  1NXY A;  5CXW A;  3MZD A;  4QJG A;  1XX2 A;  3ZVW A;  2Y2Q A;  3N6I A;  2ZLY A;  3VP4 A;  4E3I A;  4B4X A;  1KE0 A;  3TG9 A;  4X6T A;  1NRF A;  3I7J A;  4ZJ2 A;  1PWD A;  3N8R A;  2X02 A;  4B4Z A;  2C5W B;  1KDS A;  1PYY A;  4GB7 A;  1GHP A;  4LV3 A;  5CTM A;  3PBT A;  2WGI A;  1M6K A;  1YT4 A;  3P98 A;  5EVI D;  5HFO A;  2BG1 A;  3UDF A;  2Q9N A;  3UPP A;  4OQI A;  3VSK A;  1S0W A;  3IWO A;  4EBP A;  3IF6 A;  1CEF A;  5CGS A;  2ZQ7 A;  5E43 A;  4OPZ A;  2UWX A;  3VP3 A;  5HAP A;  5KSC A;  1L0E A;  3UE0 A;  3P09 A;  1IYP A;  1NYM A;  4U0T A;  3V50 A;  4JXW A;  3ZFZ A;  2X01 A;  5HAR A;  2PU4 A;  5CGX A;  4FH2 A;  3G31 A;  3HBR A;  1BSG A;  1KGG A;  4S2N C;  1BTL A;  5EOO A;  4N1X A;  3GRJ A;  4JF6 A;  2ZQ9 A;  3QHY A;  4XUZ A;  3ZDJ A;  4BQM A;  1JWV A;  1E3U A;  3CJM A;  3NC8 A;  1XPB A;  5TGF A;  4KG2 A;  3BEB A;  4XXR A;  1EI5 A;  2Y2M A;  3PBS A;  3G2Z A;  1TDL A;  3ZG8 B;  4DRT A;  1M40 A;  3IWQ A;  4N9K A;  4FH4 A;  3DWK A;  3ITB A;  3NBL A;  1EWZ A;  3HLE A;  1TEM A;  1ZG6 A;  3HLW A;  3OCL A;  1W5D A;  2EFX A;  2ZMA A;  5U47 A;  4S2N A;  3W4P A;  2J7V A;  3BFE A;  4OOL A;  2Y55 A;  4LV2 A;  4ZBE A;  4E3L A;  3VFF A;  4KQR A;  4S2M A;  3WWX A;  1S6R A;  2HP6 A;  5CRF A;  3G2Y A;  2WYX A;  5FQM A;  3PBQ A;  1BT5 A;  3FKW A;  1XA1 A;  4IVK A;  5FAS A;  1FCM A;  1YLP A;  3G34 A;  2WUQ A;  1NJ4 A;  3UDI A;  1W7F A;  3IF5 A;  4KG5 A;  5JYP A;  5HAI A;  4LCL A;  1K55 C;  1VM1 A;  1G6A A;  2JCH A;  2HP5 A;  3A3I A;  3LY3 A;  5FAQ A;  1GCE A;  2QMI A;  4WEJ A;  3OC2 A;  4PM5 A;  4DKI A;  1BZA A;  2EX2 A;  3UO9 A;  4HES A;  2A49 A;  3IF6 B;  3MZF A;  4PM8 A;  4WZ5 A;  5M1A A;  3HRE A;  3O3V A;  2ZQ8 A;  4LCM A;  5FQJ A;  3SH7 A;  2A3U A;  3ZG5 A;  2HDU A;  4QY6 A;  4GDN A;  3WRT A;  4DXC A;  4P6B A;  2QPN A;  4YIN A;  4WEK A;  2Y59 A;  1W8Q A;  3OPL A;  2RCX A;  2XK1 A;  3NIA A;  3MXR A;  5GLB A;  5AQ7 A;  1LHY A;  4B88 A;  5FDH A;  5GHY A;  4QD4 A;  4S2J A;  1MWT A;  4OPQ A;  3M6H A;  2Z2L B;  4FCF A;  1I5Q A;  2Y2I A;  4CPK A;  1L0F A;  5A92 A;  3W4Q A;  2HDQ A;  1BUE A;  1K38 A;  3GQZ A;  1K4F A;  2OV5 A;  1K54 C;  3ZNT A;  4E6W A;  4WMC D;  4DE3 A;  1H5X A;  1RGZ A;  3Q1F A;  4X69 A;  4JXS A;  3ZHH A;  4JF4 A;  2XLN A;  4JPM A;  1WE4 A;  3G32 A;  3UNW A;  3HLD A;  2XD1 A;  2IWD A;  4P87 A;  4E3J A;  3E2K A;  3HUN A;  4UA6 A;  4E3N A;  3BRM A;  4OOM A;  1ERO A;  4ZJ1 A;  1BUL A;  4Z9Q A;  2P9V A;  3ZVT A;  4S2I A;  4KZ7 A;  3HLC A;  3IT9 A;  4N1H A;  1HD8 A;  2H0T A;  5FQ9 A;  5CHJ A;  3FZC A;  3NI9 A;  5FQK A;  5FI2 A;  1YLY A;  3A3F A;  3IXG A;  3G4P A;  2EXB A;  5AQ9 A;  4C6Y A;  1K57 C;  4KZ6 A;  1L0D A;  4YFM A;  2WAE A;  4UHU A;  2V2F F;  3GV9 A;  5HL1 A;  4FD8 A;  3O86 A;  3O87 A;  2I72 A;  4JLF A;  4F94 A;  1ERQ A;  1XXM A;  4OQG A;  3IXH A;  4JXG A;  2IWB A;  4K0X A;  3HLG A;  4NET A;  5TFQ A;  3UDX A;  4K91 A;  3UE1 A;  1KE3 A;  2XFS A;  5HW3 A;  4X55 A;  1RCJ A;  2P9V B;  4BL3 A;  5CEC A;  1BLC A;  4MNR A;  1KGE A;  4IVI A;  3DTM A;  4S2O A;  3SS3 A;  4DXB A;  1SDE A;  1XGI A;  1IYS A;  1H8Y A;  2XF3 A;  4OP8 A;  1C3B A;  4EQI A;  3WS4 A;  1G68 A;  1SKF A;  4E3K A;  3V5M A;  1ONG A;  3IF6 C;  4R1G A;  4KQO A;  5EVL A;  2WZZ A;  3TSG A;  3BFD A;  3WS5 A;  1IKI A;  5F82 A;  1ZG4 A;  4UA9 A;  5CER A;  1ES2 A;  3WS1 A;  3UN7 A;  4PPR A;  3NCK A;  3FWL A;  4GOG A;  5HX9 A;  5GLD A;  4GZB A;  3MZE A;  1IYQ A;  4H8R A;  5GLC A;  3JYI A;  3HLF A;  4DE1 A;  1DJC A;  1YLZ A;  4BL2 A;  3IH9 A;  1QMF A;  2ZC3 B;  4PM9 A;  1K6S A;  5EUA A;  5DTK A;  3BFF A;  4Y0T A;  3V3R A;  1NZU A;  1HZO A;  3BFG A;  3Q07 A;  3HLB A;  1O07 A;  3HL9 A;  3DW0 A;  2JC7 A;  4DF6 A;  3CZD A;  3HUM A;  1FR6 A;  2B5R A;  2WK0 A;  4OQ0 A;  2XH9 A;  4QY5 A;  4RX2 A;  4D2O A;  5EVI B;  5GHZ A;  1JTG A;  4BLM A;  1Z6F A;  5I94 A;  2XGN A;  3O88 A;  3UY6 A;  4BD1 A;  3OPH A;  4S2K A;  1DJA A;  1FOF A;  4ZDX A;  1CI9 A;  3MBZ A;  2ZC6 B;  3NDG A;  4GNU A;  1HTZ A;  1U60 A;  1SCW A;  2Y2H A;  1KVM A;  3FKV A;  2ZM0 A;  3M2K A;  5CGW A;  4WZ4 A;  5GLA A;  2OLV A;  3W4O A;  2Y4A A;  4DE0 A;  1IEM A;  2C6W B;  2Y2J A;  4ZAM A;  3VSL A;  3NDE A;  4HBT A;  2DNS A;  5FA7 A;  1E25 A;  1AXB A;  3V3S A;  1I2W A;  1K54 A;  1XP4 A;  3UE3 A;  3GR2 A;  1SDN A;  3PBR A;  3LCE A;  5FI6 A;  3C7U A;  3ZG9 B;  3WS2 A;  1KDW A;  5CHM A;  2R9X A;  5FAP A;  2ZQD A;  1K56 A;  5F1F A;  4QHC A;  4MBH A;  1N9B A;  4KEN B;  4Q8I A;  4XUX A;  1ES3 A;  3OPP A;  1KVL A;  2XDM A;  2Y2P A;  3IXB A;  1FCO A;  5CHU A;  4R4R A;  2PBY A;  5DF7 A;  2EX6 A;  4O7D A;  1W8Y A;  3EQV A;  4KZ5 A;  2ZM2 A;  3PAE A;  1GA0 A;  1FCN A;  5EVI C;  4U0X A;  5FQI A;  2VGJ A;  2ZQC A;  2Z2M B;  4Y0O A;  3C7V A;  5EE8 A;  1FSW A;  3RXW A;  1TVF A;  4ZJ3 A;  5D3O A;  4OVD A;  3CMZ A;  4WMC A;  4QB8 A;  5F1G A;  3GMW A;  4LV1 A;  5L2F A;  5E2F A;  5CTN A;  2G2U A;  3C4P A;  4MLL A;  1N4O A;  3VP2 A;  2EX8 A;  3OPR A;  4C75 A;  1O7E A;  3FYZ A;  1RP5 A;  4KZ9 A;  3N8L A;  2Y2N A;  5TR7 A;  3UPO A;  2WGW A;  4P0M A;  1XA7 A;  3N8S A;  4X56 A;  4BD0 A;  1LI0 A;  2WZX A;  2DRW A;  4QU3 A;  5EEC A;  2XD5 A;  5E2G A;  3S1Y A;  1PWG A;  3N7W A;  1KGF A;  1IYO A;  2R9W A;  5GL9 A;  5HAQ A;  1ERM A;  3G35 A;  4E6X A;  4S2P A;  2Y91 A;  3BYD A;  4EV4 A;  1PW1 A;  1CEG A;  2DCF A;  3AGF A;  1PZP A;  1PW8 A;  2FFY A;  1NY0 A;  4IED A;  5J8X A;  3LO7 A;  1FR1 A;  3GTC A;  1K57 A;  2V20 A;  4HBU A;  4DDS A;  4P85 A;  5M19 A;  3A3D A;  3IWI A;  3SH8 A;  2WAD A;  2WAF A;  3VP1 A;  3AGE A;  5DVA A;  2RL3 A;  2ZC4 B;  3IHA A;  1K56 D;  2P74 A;  2WGW B;  4RVA A;  2Q9M A;  4MBF A;  3V39 A;  5AQA A;  3PBO A;  4PM7 A;  5CED A;  3MXS A;  4KQQ A;  5JYO A;  1PZO A;  3DWZ A;  3Q7Z A;  4X53 A;  4LEN A;  3ZGA B;  4BEN A;  1H8Z A;  4OLD A;  1K4E A;  2XFT A;  1E4D A;  5G18 A;  1MY8 A;  3A3J A;  3ZNY A;  1K6R A;  4E3O A;  2ZD8 A;  1YLW A;  4IBX A;  4R3B A;  4RA7 A;  4Y7P A;  3IHB A;  1Q2Q A;  3BLS A;  2J8Y A;  3QNB A;  3G30 A;  2H10 A;  3OZH A;  4JKT A;  1BLS A;  2H5S A;  4WBG A;  3S4X A;  2WKI A;  2XR0 A;  4OOY A;  3BLM A;  2Y2K A;  1L2S A;  3PAG A;  1MWR A;  1YMS A;  1JWP A;  2IWC A;  4KZ8 A;  3ZG7 B;  4L0L A;  3C5A A;  3BM6 A;  1MXO A;  1XGJ A;  2EXA A;  3Q82 A;  4KZ3 A;  1L0G A;  1YQS A;  3GSG A;  3N4I A;  3RJU A;  1MBL A;  4UA7 A;  3BFC A;  4OH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...