2MJ6A

Solution structure of the extracellular sensor domain of drak histidine kinase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
b'GSETRTISSTAQERVDLEAVRLASIVDSRLIGTGSVDEDFLREQIRDARYAVIRIPGQPVVEVGTKPTGDVLQGRATGEEGETVLVEEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative two-component system histidine kinase
publication title Mechanism of the pH-Induced Conformational Change in the Sensor Domain of the DraK Histidine Kinase via the E83, E105, and E107 Residues
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transferase
total genus 21
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2013-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18092 DraK_HK_N DraK Histidine Kinase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.250 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2mj6A00
2MJ6A
chains in the Genus database with same CATH superfamily
4ID4A 1T18A 4BBVA 1DP8A 3LIAA 1MC0A 5DF9A 3NDGA 3PR6A 5HFOA 4DKIA 3D72A 2ZMFA 1KGEA 3OLOA 3IX8A 3VFHA 1CK3A 1RP5A 4C6YA 5E43A 3H9WA 3PBTA 1W63M 3LR4A 1QMFA 1K56D 4ARZB 5GHZA 3HJIA 2G2WA 1Y54A 4UQIM 4YNRA 3H7WB 2PAVP 2QHKA 5CEBA 3CLOA 4MN5A 5GLDA 2VGKA 2PBYA 3ZG0A 3ZHHA 4FD8A 3HVFA 3MKFA 1E3UD 3S4XA 2EX9A 4GNUA 1NRJA 1BYWA 3FPVA 3T1RA 3KSHA 4JBFA 4CLCC 2P74A 2BLSA 3MSHA 3NULA 1M6KA 1AXBA 2KDKA 4FTXA 4BMWA 4S2PA 4HP9A 3OPHA 5J8XA 1HD8A 1ZHHB 1VB6A 3UE3A 4IEDA 3ZG9B 4FSFA 2O99A 1MWTA 2XD1A 3Q1FA 4S2OA 4JF4A 3PBSA 4OQ0A 2ZD8A 4OQIA 3BY9A 3GVBA 2Y2IA 2PD7A 2FH5A 4JXGA 5FQ9A 3BECA 5F68A 5HWTA 3CG5A 3LIEA 3T4LA 3BEBA 5FQJA 2WKHA 1BLCA 1VHMA 1ZG6A 1RGYA 3ZYTA 3QP2A 4B88A 4EEUA 5D3OA 5FA7A 2ZQDA 4PPRA 2EWWA 4WUJA 1ERQA 3M2JA 3IQAA 4AFIA 5TBMA 2QZ6A 3MXQA 1DRMA 4R3BA 2LB9A 1LT0A 3IF6B 3RXXA 5HDCA 1OTIA 1GSWA 1D7EA 5HAQA 1YLTA 4N1HA 4PMAA 3CUEC 2XQZA 3NIAA 5F69A 4HEFA 4GHIA 1TS6A 5FI7A 4KQOA 3UE6A 2Q9NA 4QY5A 1BLHA 4EV4A 1S0WA 3IH9A 2WGWA 5HX9A 4CLCE 1KVLA 3ZFZA 2PU4A 2XRNA 4X25A 1J9MA 5F82A 1PRQA 3D9YA 3WRZA 4YFMA 4KG2A 5KSHA 1ESIA 3F1PA 2DCFA 3GECA 1FQGA 3DTEA 5EVEA 5FDHA 3IXHA 5M19A 4UA7A 2Y2OA 4WELA 4Y0UA 1MZUA 3W4QA 3GV9A 3H82A 3MR0A 4F3LB 2I72A 1SDNA 1JWVA 2H0YA 3FC7A 3TJZC 2Y2GA 1FSYA 1F9IA 3KSFA 3HL9A 2PRFA 2E8JA 5HAPA 4HH3A 2ZQCA 3VP1A 4MNRA 4ME4A 1XA7A 1SDEA 2ZM2A 2WKQA 3OPPA 2QPNA 4KQRA 1PWDA 4P6BA 2GNXA 3NY4A 3DW0A 2HDRA 5L07A 3LFVA 1JTGA 4E3MA 1S66L 2V0UA 3Q7ZA 3V3SA 3RTYA 5J7EA 1GHMA 4ZTKA 3NCKA 4X55A 5CEDA 3SH8A 3DWKA 2DMWA 4WLAA 3OBFA 3DAVA 1XJ2A 2OAQ1 3SS4A 4GW9A 2Y79A 3V39A 1YKDA 3MZDA 1BLSA 5AJGA 4C75A 3HCYA 3ZG7B 3UPOA 3LY3A 5HW3A 1F5MA 1KOUA 2X02A 4QHCA 3F1OA 3B42A 4WMCA 1N9LA 3P7NA 5CTMA 2ZC6B 3CITA 1YM1A 2P9VA 3BY8A 3IS2A 1L0GA 2X71A 4K0WA 2EX6A 2IWBA 2ZQ8A 2HP5A 4QB8A 4Y13A 3B33A 2RL3A 5A8BA 3A3DA 3S7OA 1K25A 2L0WA 2Z6CA 3A0SA 4EEPA 3ZNTA 3L7HA 2J7VA 4JKTA 2I9VA 1MY8A 2B95A 3D3OA 3GDIA 3ZG8B 1TEMA 4G3VA 4OP8A 3G4PA 3BLMA 4Q0JA 5TFQA 3TSGA 5DKKA 4ETXA 2HJ9C 2VLGA 1IYSA 3KYEA 4BL3A 3FKWA 4S2LA 4BL2A 2C6WB 2J3TC 2G2UA 3SZTA 2IWCA 2ZQ7A 3KYQA 3VE4A 4QPRA 2WKPA 3LCEA 3PHYA 4WBGA 1ALQA 1Z6FA 1S6RA 2OWJA 4D2OA 1S4RA 2Y2LA 5EM1A 1TS8A 1YSQA 1ONHA 4GZBA 4OQGA 2ZMAA 3R7WB 2KX6A 3PXPA 1W63Q 1XFQA 2XEPA 4B4XA 2HF6A 3T4QA 4LRZE 3RJUA 3ZVTA 1A0KA 4Z1WA 3FV7A 1XPBA 3LEZA 3G30A 4HJ4A 1Y4OA 4LV3A 3BFGA 4NXEA 3MZFA 2JKGA 3UE0A 4WF0A 2PT7A 5CX7A 4EBPA 4Y0TA 3HLGA 3Q7VA 1BUEA 3GR2A 5FQKA 4GCZA 2HP9A 3E4OA 2INWA 2JKRI 2JHEA 2M7UA 5IS1A 5HL6A 3LI8A 3HLFA 4S2KA 2PD8A 4PM6A 1F98A 4IUHA 1SCWA 5EVIA 1TF1A 5HDDA 3N8RA 4BWIA 2XK1A 3O5YA 4MCWA 2R9WA 4Y5FA 1NZOA 4E3NA 1K56A 3B3XA 5EV0A 4O7DA 4PM8A 1P9WA 1QMEA 4DMZA 1BULA 1ES4A 3JVVA 1LSWA 4WEJA 3LR3A 3NOPC 4I3IA 2EWVA 3PBNA 1ES5A 1JTDA 3PAGA 3VMAA 3A3FA 3M6HA 1DJAA 1LLBA 1ONGA 2NUTC 3G31A 1PI4A 4LCMA 3QP5A 2IA2A 3T4KA 5HPFA 2YKFA 2PBDP 3IBJA 4FH4A 1JNUA 4IUKA 5M18A 2Y59A 3FKVA 2JKRM 2Y2NA 4DXBA 4E3OA 2M7VA 3MKEA 2WKIA 4QWOA 4B4ZA 3VOYA 2UV0E 1KDWA 4RX3A 5AQ7A 1ACFA 1FSWA 2WZXA 3LUQA 5KSCA 4QD4A 3FPWA 2CMNA 1BLPA 3IXGA 3QP8A 2PHYA 3NJAA 4LPZA 4BLMA 2WZZA 3IBRA 3OC2A 3N8SA 3Q81A 1CQAA 2Y55A 1CEFA 4MBKA 1PI5A 2HZ5A 2R9XA 2VV7A 4GD6A 5C5KA 5JYPA 2JCHA 4NK3A 2W1TA 2E8IA 2ZJ9A 3TG9A 4FCFA 4PM5A 4HBUA 4EW7A 5CHJA 1BTLA 5U47A 3QP1A 1ES2A 1LI9A 3PTEA 2D02A 4GN2A 1L2SA 3V5MA 2ZC3B 1P9RA 5IHVA 4LV1A 3UB6A 3PBRA 2V9AA 1TS0A 4GS9A 3CAXA 5CGSA 4RA7A 4I5SA 3RXWA 1K55C 4A5RA 4OP5A 4ZJ1A 5F5YA 2GX5A 4S2IA 1CI8A 2JC7A 4EUZA 3N7WA 1YAXA 5G18A 1KE3A 3V3RA 1EI5A 4HY8A 2JKTM 5L10A 3G2ZA 4CPKA 5DKLA 4KQDA 2O9CA 5EVID 1GHIA 4PM9A 1K57A 4JXSA 1CJFA 2V8CA 5DJUA 2VA0A 1IEMA 4X6TA 1YMXA 3W8KA 4K91A 1DY6A 1K6RA 4E3KA 3CUEA 1V9YA 5F83A 4DE0A 3LYXA 1K6SA 3UPNA 2VGLS 3JYIA 5DF7A 3KX0X 1IYOA 4X69A 2H28A 4DXCA 1ZKJA 2M1CA 1EW0A 4GKUA 3WS5A 3IX3A 4NXFA 3U2AA 1NYMA 3IHBA 4DDSA 1K0KA 1XJ4A 4HI4A 4JF5A 1S4SA 3UDIA 1OJGA 5FQIA 4DDYA 1VETA 5HD3A 3CPTA 3EGXC 5TBMB 2VZWA 2P04A 5JYOA 3C7VA 1P97A 3ICYA 4EERA 3MMHA 2A2LA 1ES3A 3CZDA 1H8ZA 2Y2PA 1H8MA 4OOLA 4PHTA 4OKPA 4LFUA 2ZQ9A 1XJ6A 4ARZA 1XA1A 1W8QA 3FWLA 2EXAA 3Q82A 2WYXA 1X0OA 1YLJA 1PZPA 4GHIB 1GA0A 3BFEA 1IFQA 3E2LA 5DTKA 5L2FA 1GHPA 3IF5A 3K2NA 1MWSA 1PZOA 4K08A 4U0XA 4OQHA 5DVAA 1H5XA 3PBOA 1K54C 3P01A 2Y2HA 4FOFA 5A92A 4BBUA 4S2NC 3W4PA 3F1PB 3MQQA 3WS2A 4M4XA 5HWVA 4XT2A 3GSGA 2V20A 1LHYA 2V0WA 1VEUA 2XFSA 2W3HA 4OOMA 4XUXA 3H82B 1SKOA 3UY6A 1MPLA 1WYBA 3ISGA 3KSIA 5GLCA 5TGFA 3BQAA 1PW8A 3HLEA 3IH8A 1J3WA 3MS6A 4P85A 4BBTA 1STZA 4MN6A 3UDXA 3ZCZA 1L0FA 2ZQAA 3PYPA 4MEZA 1CI9A 3MJQA 4N9LA 2B02A 4UQIS 2GJ3A 3T4TA 1F2KA 1N9BA 1EWZA 5CHUA 2WKEA 4P87A 3IT9A 4HHDA 4WZ4A 4EXOA 2FZ0A 3HLDA 3K3DA 4EQIA 1FR1A 3F1NA 5E2HA 1KGGA 4RVAA 3O88A 1XGJA 3VOZA 5FATA 5EOOA 1VQQA 2EA9A 1LL9A 3U4LP 2ZLYA 2A49A 2EXBA 1G28A 4R4SA 3ZNYA 2Y91A 1K4FA 4LLOB 1TVFA 1TDGA 1YLZA 1XXMA 4XUZA 5KMWA 3R4KA 3QP6A 3CHWP 2PDRA 3LICA 2L1MA 5A91A 1IYQA 1FR6A 3OZHA 4Z9QA 4YWZA 3NI9A 1FILA 2ZC7A 3F1OB 3MQOA 3G2YA 4LENA 2OV5A 4JF6A 3A3EA 1K38A 4I38A 2P9VB 3UB9A 3IS2B 2RCXA 3C38A 4HJ6A 1Y28A 2QKPA 4KG6A 1SHVA 1XX2A 1HLUP 2JN7A 1N9NA 1XJ3A 2WGIA 3P98A 2P08A 3LEQA 4HBTA 3NECA 2W27A 3UE1A 4L0LA 1U60A 3NOTC 1WYCA 1S1ZA 4R3JA 4DN0A 2OWHA 5HD5A 1RGZA 1W5DA 4HIAA 4KQQA 4DJ2A 1GSXA 3C7UA 1G6AA 3IWQA 5FL3A 3W4OA 3A0VA 4GB7A 3IF6C 3G6OA 2VEAA 4NXGA 3CJMA 3IWIA 3WS4A 4KZ8A 5HSQA 2ZOHA 3JVUA 3M2KA 5HAIA 1GCEA 3E4QA 4ZJ3A 5GL9A 5CERA 2ACGA 3T50A 2XH9A 5DFYA 2DNSA 5A93A 1KGFA 1OTAA 3DWZA 1G6OA 3T12B 3NHQA 1GSVA 4GDNA 3TE8A 3SS3A 3MFXA 4IVIA 4JGRA 2W1RA 1E4DA 3LIBA 2JKFA 1L3LA 1YPRA 2P7JA 4Y2FA 2Q9MA 4XXRA 3Q7VB 1NYYA 2Z2MB 2VJWA 3EGDC 4HQAA 4EU0A 1LSVA 1YQSA 3C5AA 3ITAA 2XA7M 5HDSA 1EROA 4JXVA 1JVJA 5EVIB 1XGIA 4H8RA 3ZQ5A 3G32A 3V50A 3QNBA 1MWUA 3BLSA 5DTSA 5GLBA 3GQZA 4LRXC 2Y2QA 2W3EA 3C30A 3K3CA 4KZ7A 3GTCA 2J3TD 4R70A 4M3KA 1DJBA 4Y0OA 3N6IA 3VP2A 4E3JA 2WK0A 2XF3A 4IBRA 1FCMA 1FCNA 2HPBA 3W2ZA 4N9KA 3ZVWA 2A24A 3SW1A 2KOIA 4KZAA 4HOIA 1AWIA 1OPXA 3WWXA 4JGPA 4KG5A 5EECA 1JWZA 4GLQA 4N92A 5AVFA 3T1SA 1MXOA 1BSGA 5F1FA 1Q2QA 1IELA 4R0QA 3IHAA 2ZOIA 4BENA 2V1ZA 4RX2A 3VP4A 5HPIA 3S1YA 1O07A 4MLLA 4EETB 3QHYA 5DFXA 4X56A 4R1GA 4DJ3A 2VKSA 4P6ZM 1BZAA 5HARA 4U3TA 5FQQA 2FFYA 4UA9A 3C2WA 4FH2A 4CJNA 2J9PA 1TS7A 2W1TB 3MBZA 3MXSA 2EFUA 4JPMA 2PR6A 5FI6A 3T4OA 1JWPA 3GRJA 2ZMVA 4NXBA 2K7SA 2LB5A 1MBLA 3QP4A 3BM6A 4O01A 2B5RA 1MWRA 3I7JA 1ZC2A 2ZL1A 2W0NA 3IXBA 4CLCA 4X53A 4DF6A 1H0MA 4D60A 5HZHA 1NJ4A 3VP0A 1P0ZA 4GS9B 2FFFB 1W79A 1YLYA 2JKTI 4LCLA 4JLFA 5I94A 5FASA 4GOGA 2D01A 4ZRRA 4H6JA 2XA7S 3MZEA 4KZBA 5BOHA 4S2MA 1N4OA 3FYZA 5G4YA 1S1YA 4KUOA 4PKYA 2QMIA 3C4PA 3BWLA 4OH0A 1LL5A 5M1AA 4QY6A 3QNCA 2XLNA 5L09A 4G3KA 3TW8A 4NEED 4EUVA 5GLAA 2PYRA 4PM7A 4E6WA 2OSUA 4JGOA 3NOUC 1YLPA 5EVIC 3PAEA 3WS0A 4N1XA 1NLZA 4ZJ2A 3HLBA 5AQBA 3CI6A 3CMZA 4UA6A 1ERMA 3S7NA 1LL8A 2PU2A 1K54A 3VFFA 1YT4A 2QJ5A 5CXWA 4S2NA 4OONA 3VP3A 4I3AA 4B93A 3VSKA 2Z2LB 5TR7A 1CF0A 2EX8A 1BT5A 3V67A 1VETB 3E4PA 3CPTB 1NWZA 1PNEA 2XDMA 5FQMA 3DTMA 1KVMA 3UNWA 4DRTA 3OCNA 1OJ5A 4WZ5C 2Y2MA 3BJNA 1PYYA 5EE8A 1WA9A 4R6LA 2O0YA 4P6ZS 3WRTA 3LGOA 4F94A 5AQAA 1NRFA 1DP9A 1NZUA 3NDEA 4HNBA 1M40A 2IWDA 2O9BA 4LV2A 4IVKA 3G35A 4RYEA 3BFCA 2BTFP 3MF0A 2OOLA 3JPUA 4MDZA 1YSPA 1PIOA 2VV8A 5GHXA 2V1BA 2C5WB 5E2GA 1FIKA 4R38A 3LIDA 1T1AA 2A3UA 5EPHA 2QJ7A 4XT2B 2XGNA 2BG1A 3A0RA 4CLCD 5EUAA 2OLUA 1XFNA 1C3BA 5FAPA 4HH2A 4QJGA 3H7WA 4OOYA 1VEUB 1LI0A 1SKFA 3E2KA 4IJGA 4RQ9A 3S7PA 1TDLA 4KZ6A 1SKOB 3LR0A 1YMSA 3C8CA 4KZ5A 2XD5A 3MFDA 4LGWA 5E2EA 4BD1A 4DE2A 2WGWB 4ZDXA 3HLCA 5J3WA 3EEAA 2J9OA 4UEYA 2AVXA 3BQ8A 2W3DA 4QU3A 4Q0IA 5CGWA 3N4IA 4U0TA 1H3QA 2VV6A 2ZC5B 4S2JA 2WGVA 1GA9A 3HUOA 2WKRA 1K57C 4NETA 3F1NB 2HGVA 1KE4A 3HLWA 3ZDJA 3AGDA 5EFWA 4BJPA 4I39A 1W7FA 4Y15A 1T1BA 5MC7A 2H10A 4LV0A 4MN7A 4WYYA 3UMDA 4E04A 1G5UA 5CTNA 3C4OA 2CC1A 1O7EA 3S7QA 2Y2KA 2J80A 4JXWA 3FZCA 4O0PA 3HUMA 4WM9A 2J8YA 1L0DA 3E0YA 3A3IA 3IF6A 5A90A 4EESA 2Q0OA 3BYDA 5K5BA 3BFDA 3VOLA 1OTEA 4PKYG 5F1GA 1IYPA 1I5QA 1NLYA 4IHQA 3HREA 4L9FA 3VV4A 3EOIA 2XFTA 3NC8A 3RH8B 4E6XA 3DTKA 3O3VA 3AGFA 4EBLA 2V1AA 3SS5A 3EQUA 1PWCA 3EEHA 4KENB 4WL9A 4FUWA 3HUNA 5CECA 4X1MA 1ZTUA 4YINA 4C3QA 5EOEA 2OAP1 2PYPA 3IWOA 3GMWA 4O8GA 3ULFA 1ODVA 5FAQA 2WAEA 1DP6A 4X68A 2WAFA 3D4FA 4EWFA 3T1QB 5CGXA 5F6AA 2W3GA 5EVLA 1ZG4A 2H0TA 3AGEA 4F3LA 4KZ4A 1WE4A 2B18A 4MBHA 4Y3IA 3ITBA 2XSSA 2HDUA 1KE0A 1T19A 5HL1A 3OPRA 4JGQA 4OPQA 4OLGA 2JE5A 3TRCA 3B47A 4WN5A 2WUQA 5L8MA 2V8FA 1MKIA 4ETZA 3LI9A 4KZ9A 1E25A 5FEFA 2KLIA 5E2FA 5TJJA 2G7UA 3UMEA 1NXYA 4HJ3A 2OLVA 5IT5A 2QWSA 4HP4A 5DTTA 4OVDA 5FDSA 1D06A 1HVBA 3M6BA 3T4SA 2BASA 2ZM8A 1DJCA 4DE3A 1XKZA 4R23A 4NKPA 4X1LA 3G34A 2R78A 5LBRA 3DBAA 4IBXA 2EX2A 2ZC4B 3OOVA 1SZVA 2VX8A 4EQ1A 3Q07A 3BRMA 3UN7A 4Q0HA 3NBLA 3UB7A 3ZG5A 3E98A 3T4JA 3KO6A 5EM0A 2HV1A 2L4RA 2A24B 3P09A 1UWPX 3KYZA 2WADA 3MQ0A 1V9ZA 1W8YA 4Y7PA 3S22A 3OPLA 1OTDA 2QYBA 3BW6A 1HTZA 4BQMA 5FI2A 3O86A 4PAUA 3OCLA 1OTBA 5FEGA 1IOUA 3O87A 4MMNA 1PW1A 1IKIA 4GJ4A 2Y2JA 2HDQA 3TOIA 4GD8A 1T1CA 4OPZA 3WS1A 4L9EA 4OLDA 4BD0A 4KZ3A 2V2FF 5I5LA 2VK3A 5FSRA 3UO9A 3ZGAB 3FG8A 2HP6A 2K31A 5J4EA 4E3LA 5KZHA 3IX4A 4KUKA 3LY4A 2EFXA 2MJ6A 4WEKA 2XR0A 1I2SA 1HZOA 1MKMA 1ESUA 1CEGA 1K55A 2UWXA 3R7WA 3RFBA 1Z09A 3IXDA 2ZL1B 4ZAMA 4G3WA 3BFFA 4II7A 2Y8HA 3EWKA 4L9GA 1RCJA 4CLCB 4DE1A 1H8YA 5GHYA 5HWWA 4WMCD 3SOIA 3A3JA 4I3JA 4E3IA 4GDBA 4MBFA 1E3UA 3SH7A 3N8LA 4H6JB 5CHMA 2VGLM 3LIFA 5IU1A 3UB5P 5G4ZA 5FAOA 4R3AA 2X01A 3HJKA 2HDSA 4WZ5A 3LO7A 1KDSA 2Y4AA 2K2NA 1I2WA 2VGJA 4B9OA 1FOFA 2YKHA 2ZBBA 1OT6A 2HJEA 4P0MA 3PBQA 3SH9A 2PR5A 1LSXA 1VM1A 4NG2A 5DJTA 1NY0A 3MXRA 4UAAA 2JBFA 2J3WA 1L0EA 4LRYC 5AQ9A 3HBRA 3L9KA 3VE3A 1PWGA 3VSLA 2Z6DA 4EBNA 4OPRA 2XROA 1K4EA 4ESPA 2GDNA 1D1JA 3LR5A 2NUPC 4K0XA 3KSGA 1IKGA 4HESA 3UPPA 1XP4A 4UHUA 2DRWA 4Y17A 3UDFA 1FCOA 1Q2PA 3CWFA 1N9OA 2W3FA 5AVEA 1YLWA 1G68A 5CRFA 4CQHA 4Q8IA 4YOFA 4OPYA 1UGUA 2O9AA 3UB8A 5DF8A 3DTIA 1PFLA 4R4RA 3T1XA 1OMEA 2ZM0A 1OT9A 4ZBEA 5KIZA 1S67L 1TD5A 2GZAA 2H5SA 3EQVA 1UWNX
chains in the Genus database with same CATH topology
4BWIA 1S1ZA 2HGVA 1T18A 4BBVA 1DP8A 4DN0A 2OWHA 3LIAA 3O5YA 1MC0A 5DF9A 4MCWA 5HD5A 3PR6A 4Y5FA 5EFWA 4BJPA 4HIAA 3D72A 4I39A 2ZMFA 4DJ2A 3OLOA 1GSXA 1P9WA 1T1BA 5MC7A 4DMZA 4MN7A 3JVVA 5FL3A 1LSWA 4WEJA 3LR3A 3NOPC 3A0VA 3G6OA 3UMDA 2VEAA 4E04A 4I3IA 2EWVA 3H9WA 1W63M 3PBNA 3PBTA 4NXGA 3LR4A 3S7QA 2J80A 5HSQA 2ZOHA 3JVUA 4ARZB 3HJIA 4O0PA 4UQIM 2NUTC 3E4QA 4YNRA 3H7WB 2QHKA 3CLOA 4MN5A 3T50A 2IA2A 3E0YA 5DFYA 3T4KA 5HPFA 2YKFA 3IBJA 1JNUA 4EESA 4IUKA 1OTAA 2JKRM 5K5BA 1G6OA 3NHQA 1GSVA 1NRJA 3VOLA 1BYWA 3TE8A 1OTEA 3FPVA 4PKYG 3KSHA 3MFXA 2M7VA 4JGRA 2W1RA 4CLCC 3LIBA 3LUQA 2P7JA 2KDKA 1NLYA 3FPWA 4Y2FA 4IHQA 2CMNA 4BMWA 4HP9A 4L9FA 3VV4A 3EOIA 1ZHHB 1VB6A 3RH8B 2VJWA 3UE3A 3EGDC 2PHYA 4HQAA 4EU0A 4FSFA 2O99A 3NJAA 1LSVA 4LPZA 2XA7M 3PBSA 5HDSA 2V1AA 3IBRA 3OC2A 3BY9A 2PD7A 3ZQ5A 3EQUA 3EEHA 4WL9A 2FH5A 2VV7A 5F68A 5C5KA 1ZTUA 5HWTA 4LRXC 3LIEA 2W3EA 2W1TA 3C30A 2OAP1 3K3CA 3T4LA 2PYPA 2J3TD 4R70A 1VHMA 4O8GA 3ULFA 1ODVA 3ZYTA 1DP6A 4EEUA 4EW7A 5F6AA 2W3GA 4F3LA 2D02A 3W2ZA 2EWWA 1P9RA 4WUJA 2A24A 4AFIA 3SW1A 2KOIA 3UB6A 5TBMA 2B18A 3MXQA 3PBRA 4HOIA 2V9AA 1TS0A 4Y3IA 1DRMA 4GS9A 2XSSA 1OPXA 3CAXA 1T19A 2LB9A 1LT0A 4JGPA 4I5SA 4JGQA 4GLQA 2GX5A 5F5YA 5HDCA 5AVFA 1OTIA 3TRCA 1GSWA 1YAXA 1D7EA 3B47A 4WN5A 4HY8A 2JKTM 2ZOIA 5DKLA 4KQDA 5L8MA 3CUEC 2O9CA 4ETZA 5HPIA 3LI9A 5F69A 2KLIA 4GHIA 4EETB 1TS6A 5TJJA 2G7UA 5DJUA 3UMEA 5DFXA 2VA0A 4KQOA 3UE6A 4DJ3A 2VKSA 4HJ3A 4P6ZM 5IT5A 2QWSA 4HP4A 3CUEA 4CLCE 1D06A 1V9YA 3T4SA 2BASA 2XRNA 4NKPA 3LYXA 2R78A 2VGLS 5LBRA 5KSHA 3C2WA 3DBAA 3F1PA 3KX0X 3GECA 1TS7A 2H28A 3OOVA 2W1TB 2M1CA 2PR6A 3T4OA 2VX8A 4EQ1A 1EW0A 2ZMVA 4NXFA 3U2AA 4NXBA 2K7SA 2LB5A 4WELA 1MZUA 1XJ4A 4Q0HA 3H82A 3UB7A 4O01A 3E98A 3MR0A 4HI4A 3T4JA 3KO6A 4F3LB 2HV1A 1S4SA 1OJGA 3FC7A 2L4RA 2W0NA 5HD3A 2A24B 3TJZC 3EGXC 1UWPX 4CLCA 3KYZA 5TBMB 2VZWA 3MQ0A 2P04A 1V9ZA 5HZHA 1P0ZA 4GS9B 1F9IA 2JKTI 1P97A 3KSFA 3ICYA 4EERA 3MMHA 2A2LA 1OTDA 4HH3A 2D01A 2QYBA 1H8MA 4OOLA 4ZRRA 4H6JA 4ME4A 2XA7S 3BW6A 2WKQA 4PHTA 1XJ6A 5G4YA 4ARZA 2GNXA 1S1YA 4KUOA 4PAUA 3OCLA 1OTBA 1IOUA 4PKYA 4MMNA 1X0OA 3BWLA 4GJ4A 3LFVA 4GHIB 1IFQA 1S66L 2V0UA 1T1CA 4G3KA 3TW8A 3RTYA 5J7EA 4L9EA 3K2NA 4NEED 4K08A 4EUVA 5I5LA 2PYRA 3PBOA 3FG8A 4JGOA 3P01A 3NOUC 4FOFA 2DMWA 2K31A 5J4EA 4WLAA 3OBFA 4BBUA 1XJ2A 2OAQ1 3F1PB 1NLZA 4GW9A 2Y79A 1YKDA 4KUKA 3CI6A 3MQQA 4M4XA 2MJ6A 5AJGA 3S7NA 5HWVA 4WEKA 4XT2A 3HCYA 1LL8A 1F5MA 1KOUA 1MKMA 2QJ5A 2V0WA 3F1OA 2W3HA 4OOMA 3B42A 3H82B 4I3AA 4B93A 1N9LA 3P7NA 3R7WA 3RFBA 3KSIA 3CITA 3V67A 4G3WA 3BQAA 3E4PA 3BY8A 3IS2A 1NWZA 4II7A 2Y8HA 3EWKA 4L9GA 4CLCB 4BBTA 3OCNA 1OJ5A 1STZA 4MN6A 3B33A 3BJNA 5HWWA 3PYPA 5A8BA 1WA9A 3MJQA 4I3JA 2O0YA 4R6LA 4P6ZS 3S7OA 4H6JB 2VGLM 2B02A 3LIFA 2L0WA 2Z6CA 3A0SA 4UQIS 5IU1A 5G4ZA 4R3AA 4EEPA 2GJ3A 3T4TA 3HJKA 1DP9A 4HNBA 4HHDA 2I9VA 2O9BA 2K2NA 4B9OA 2YKHA 3GDIA 3D3OA 4EXOA 2ZBBA 1OT6A 2FZ0A 2HJEA 4G3VA 3K3DA 3PBQA 3F1NA 2PR5A 4Q0JA 1LSXA 3MF0A 5DJTA 2OOLA 5DKKA 4ETXA 2HJ9C 2VLGA 4MDZA 1YSPA 2EA9A 2J3WA 2VV8A 2J3TC 4LRYC 2V1BA 1G28A 3VE3A 2Z6DA 4LLOB 3KYQA 4R38A 3VE4A 3LIDA 1T1AA 4QPRA 2XROA 2WKPA 3R4KA 3PHYA 3LR5A 2NUPC 3KSGA 2PDRA 3LICA 2QJ7A 2L1MA 2OWJA 1S4RA 4XT2B 3A0RA 4CLCD 1XFNA 4YWZA 1TS8A 1YSQA 4HH2A 3H7WA 3F1OB 3MQOA 3S7PA 4IJGA 4RQ9A 3CWFA 1N9OA 3LR0A 2W3FA 5AVEA 3R7WB 3C8CA 2KX6A 3PXPA 1W63Q 4I38A 1XFQA 4CQHA 3UB9A 2HF6A 3IS2B 3T4QA 4YOFA 4LRZE 3C38A 4Z1WA 1UGUA 4HJ6A 5J3WA 2O9AA 1Y28A 2QKPA 3EEAA 3UB8A 4HJ4A 4UEYA 4NXEA 3BQ8A 4WF0A 2W3DA 2PT7A 5CX7A 2JN7A 1OT9A 1N9NA 1XJ3A 2P08A 4Q0IA 4GCZA 3E4OA 1H3QA 2INWA 5KIZA 2JKRI 2JHEA 1S67L 2M7UA 5HL6A 5IS1A 3LI8A 1TD5A 2VV6A 2PD8A 1F98A 4IUHA 2GZAA 2W27A 4L0LA 1TF1A 5HDDA 2WKRA 3EQVA 3NOTC 3F1NB 1UWNX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJ6 A; 
#chains in the Genus database with same CATH topology
 4ID4 A;  1T18 A;  4BBV A;  1DP8 A;  3LIA A;  1MC0 A;  5DF9 A;  3NDG A;  3PR6 A;  5HFO A;  4DKI A;  3D72 A;  2ZMF A;  1KGE A;  3OLO A;  3IX8 A;  3VFH A;  1CK3 A;  1RP5 A;  4C6Y A;  5E43 A;  3H9W A;  3PBT A;  1W63 M;  3LR4 A;  1QMF A;  1K56 D;  4ARZ B;  5GHZ A;  3HJI A;  2G2W A;  1Y54 A;  4UQI M;  4YNR A;  3H7W B;  2PAV P;  2QHK A;  5CEB A;  3CLO A;  4MN5 A;  5GLD A;  2VGK A;  2PBY A;  3ZG0 A;  3ZHH A;  4FD8 A;  3HVF A;  3MKF A;  1E3U D;  3S4X A;  2EX9 A;  4GNU A;  1NRJ A;  1BYW A;  3FPV A;  3T1R A;  3KSH A;  4JBF A;  4CLC C;  2P74 A;  2BLS A;  3MSH A;  3NUL A;  1M6K A;  1AXB A;  2KDK A;  4FTX A;  4BMW A;  4S2P A;  4HP9 A;  3OPH A;  5J8X A;  1HD8 A;  1ZHH B;  1VB6 A;  3UE3 A;  4IED A;  3ZG9 B;  4FSF A;  2O99 A;  1MWT A;  2XD1 A;  3Q1F A;  4S2O A;  4JF4 A;  3PBS A;  4OQ0 A;  2ZD8 A;  4OQI A;  3BY9 A;  3GVB A;  2Y2I A;  2PD7 A;  2FH5 A;  4JXG A;  5FQ9 A;  3BEC A;  5F68 A;  5HWT A;  3CG5 A;  3LIE A;  3T4L A;  3BEB A;  5FQJ A;  2WKH A;  1BLC A;  1VHM A;  1ZG6 A;  1RGY A;  3ZYT A;  3QP2 A;  4B88 A;  4EEU A;  5D3O A;  5FA7 A;  2ZQD A;  4PPR A;  2EWW A;  4WUJ A;  1ERQ A;  3M2J A;  3IQA A;  4AFI A;  5TBM A;  2QZ6 A;  3MXQ A;  1DRM A;  4R3B A;  2LB9 A;  1LT0 A;  3IF6 B;  3RXX A;  5HDC A;  1OTI A;  1GSW A;  1D7E A;  5HAQ A;  1YLT A;  4N1H A;  4PMA A;  3CUE C;  2XQZ A;  3NIA A;  5F69 A;  4HEF A;  4GHI A;  1TS6 A;  5FI7 A;  4KQO A;  3UE6 A;  2Q9N A;  4QY5 A;  1BLH A;  4EV4 A;  1S0W A;  3IH9 A;  2WGW A;  5HX9 A;  4CLC E;  1KVL A;  3ZFZ A;  2PU4 A;  2XRN A;  4X25 A;  1J9M A;  5F82 A;  1PRQ A;  3D9Y A;  3WRZ A;  4YFM A;  4KG2 A;  5KSH A;  1ESI A;  3F1P A;  2DCF A;  3GEC A;  1FQG A;  3DTE A;  5EVE A;  5FDH A;  3IXH A;  5M19 A;  4UA7 A;  2Y2O A;  4WEL A;  4Y0U A;  1MZU A;  3W4Q A;  3GV9 A;  3H82 A;  3MR0 A;  4F3L B;  2I72 A;  1SDN A;  1JWV A;  2H0Y A;  3FC7 A;  3TJZ C;  2Y2G A;  1FSY A;  1F9I A;  3KSF A;  3HL9 A;  2PRF A;  2E8J A;  5HAP A;  4HH3 A;  2ZQC A;  3VP1 A;  4MNR A;  4ME4 A;  1XA7 A;  1SDE A;  2ZM2 A;  2WKQ A;  3OPP A;  2QPN A;  4KQR A;  1PWD A;  4P6B A;  2GNX A;  3NY4 A;  3DW0 A;  2HDR A;  5L07 A;  3LFV A;  1JTG A;  4E3M A;  1S66 L;  2V0U A;  3Q7Z A;  3V3S A;  3RTY A;  5J7E A;  1GHM A;  4ZTK A;  3NCK A;  4X55 A;  5CED A;  3SH8 A;  3DWK A;  2DMW A;  4WLA A;  3OBF A;  3DAV A;  1XJ2 A;  2OAQ 1;  3SS4 A;  4GW9 A;  2Y79 A;  3V39 A;  1YKD A;  3MZD A;  1BLS A;  5AJG A;  4C75 A;  3HCY A;  3ZG7 B;  3UPO A;  3LY3 A;  5HW3 A;  1F5M A;  1KOU A;  2X02 A;  4QHC A;  3F1O A;  3B42 A;  4WMC A;  1N9L A;  3P7N A;  5CTM A;  2ZC6 B;  3CIT A;  1YM1 A;  2P9V A;  3BY8 A;  3IS2 A;  1L0G A;  2X71 A;  4K0W A;  2EX6 A;  2IWB A;  2ZQ8 A;  2HP5 A;  4QB8 A;  4Y13 A;  3B33 A;  2RL3 A;  5A8B A;  3A3D A;  3S7O A;  1K25 A;  2L0W A;  2Z6C A;  3A0S A;  4EEP A;  3ZNT A;  3L7H A;  2J7V A;  4JKT A;  2I9V A;  1MY8 A;  2B95 A;  3D3O A;  3GDI A;  3ZG8 B;  1TEM A;  4G3V A;  4OP8 A;  3G4P A;  3BLM A;  4Q0J A;  5TFQ A;  3TSG A;  5DKK A;  4ETX A;  2HJ9 C;  2VLG A;  1IYS A;  3KYE A;  4BL3 A;  3FKW A;  4S2L A;  4BL2 A;  2C6W B;  2J3T C;  2G2U A;  3SZT A;  2IWC A;  2ZQ7 A;  3KYQ A;  3VE4 A;  4QPR A;  2WKP A;  3LCE A;  3PHY A;  4WBG A;  1ALQ A;  1Z6F A;  1S6R A;  2OWJ A;  4D2O A;  1S4R A;  2Y2L A;  5EM1 A;  1TS8 A;  1YSQ A;  1ONH A;  4GZB A;  4OQG A;  2ZMA A;  3R7W B;  2KX6 A;  3PXP A;  1W63 Q;  1XFQ A;  2XEP A;  4B4X A;  2HF6 A;  3T4Q A;  4LRZ E;  3RJU A;  3ZVT A;  1A0K A;  4Z1W A;  3FV7 A;  1XPB A;  3LEZ A;  3G30 A;  4HJ4 A;  1Y4O A;  4LV3 A;  3BFG A;  4NXE A;  3MZF A;  2JKG A;  3UE0 A;  4WF0 A;  2PT7 A;  5CX7 A;  4EBP A;  4Y0T A;  3HLG A;  3Q7V A;  1BUE A;  3GR2 A;  5FQK A;  4GCZ A;  2HP9 A;  3E4O A;  2INW A;  2JKR I;  2JHE A;  2M7U A;  5IS1 A;  5HL6 A;  3LI8 A;  3HLF A;  4S2K A;  2PD8 A;  4PM6 A;  1F98 A;  4IUH A;  1SCW A;  5EVI A;  1TF1 A;  5HDD A;  3N8R A;  4BWI A;  2XK1 A;  3O5Y A;  4MCW A;  2R9W A;  4Y5F A;  1NZO A;  4E3N A;  1K56 A;  3B3X A;  5EV0 A;  4O7D A;  4PM8 A;  1P9W A;  1QME A;  4DMZ A;  1BUL A;  1ES4 A;  3JVV A;  1LSW A;  4WEJ A;  3LR3 A;  3NOP C;  4I3I A;  2EWV A;  3PBN A;  1ES5 A;  1JTD A;  3PAG A;  3VMA A;  3A3F A;  3M6H A;  1DJA A;  1LLB A;  1ONG A;  2NUT C;  3G31 A;  1PI4 A;  4LCM A;  3QP5 A;  2IA2 A;  3T4K A;  5HPF A;  2YKF A;  2PBD P;  3IBJ A;  4FH4 A;  1JNU A;  4IUK A;  5M18 A;  2Y59 A;  3FKV A;  2JKR M;  2Y2N A;  4DXB A;  4E3O A;  2M7V A;  3MKE A;  2WKI A;  4QWO A;  4B4Z A;  3VOY A;  2UV0 E;  1KDW A;  4RX3 A;  5AQ7 A;  1ACF A;  1FSW A;  2WZX A;  3LUQ A;  5KSC A;  4QD4 A;  3FPW A;  2CMN A;  1BLP A;  3IXG A;  3QP8 A;  2PHY A;  3NJA A;  4LPZ A;  4BLM A;  2WZZ A;  3IBR A;  3OC2 A;  3N8S A;  3Q81 A;  1CQA A;  2Y55 A;  1CEF A;  4MBK A;  1PI5 A;  2HZ5 A;  2R9X A;  2VV7 A;  4GD6 A;  5C5K A;  5JYP A;  2JCH A;  4NK3 A;  2W1T A;  2E8I A;  2ZJ9 A;  3TG9 A;  4FCF A;  4PM5 A;  4HBU A;  4EW7 A;  5CHJ A;  1BTL A;  5U47 A;  3QP1 A;  1ES2 A;  1LI9 A;  3PTE A;  2D02 A;  4GN2 A;  1L2S A;  3V5M A;  2ZC3 B;  1P9R A;  5IHV A;  4LV1 A;  3UB6 A;  3PBR A;  2V9A A;  1TS0 A;  4GS9 A;  3CAX A;  5CGS A;  4RA7 A;  4I5S A;  3RXW A;  1K55 C;  4A5R A;  4OP5 A;  4ZJ1 A;  5F5Y A;  2GX5 A;  4S2I A;  1CI8 A;  2JC7 A;  4EUZ A;  3N7W A;  1YAX A;  5G18 A;  1KE3 A;  3V3R A;  1EI5 A;  4HY8 A;  2JKT M;  5L10 A;  3G2Z A;  4CPK A;  5DKL A;  4KQD A;  2O9C A;  5EVI D;  1GHI A;  4PM9 A;  1K57 A;  4JXS A;  1CJF A;  2V8C A;  5DJU A;  2VA0 A;  1IEM A;  4X6T A;  1YMX A;  3W8K A;  4K91 A;  1DY6 A;  1K6R A;  4E3K A;  3CUE A;  1V9Y A;  5F83 A;  4DE0 A;  3LYX A;  1K6S A;  3UPN A;  2VGL S;  3JYI A;  5DF7 A;  3KX0 X;  1IYO A;  4X69 A;  2H28 A;  4DXC A;  1ZKJ A;  2M1C A;  1EW0 A;  4GKU A;  3WS5 A;  3IX3 A;  4NXF A;  3U2A A;  1NYM A;  3IHB A;  4DDS A;  1K0K A;  1XJ4 A;  4HI4 A;  4JF5 A;  1S4S A;  3UDI A;  1OJG A;  5FQI A;  4DDY A;  1VET A;  5HD3 A;  3CPT A;  3EGX C;  5TBM B;  2VZW A;  2P04 A;  5JYO A;  3C7V A;  1P97 A;  3ICY A;  4EER A;  3MMH A;  2A2L A;  1ES3 A;  3CZD A;  1H8Z A;  2Y2P A;  1H8M A;  4OOL A;  4PHT A;  4OKP A;  4LFU A;  2ZQ9 A;  1XJ6 A;  4ARZ A;  1XA1 A;  1W8Q A;  3FWL A;  2EXA A;  3Q82 A;  2WYX A;  1X0O A;  1YLJ A;  1PZP A;  4GHI B;  1GA0 A;  3BFE A;  1IFQ A;  3E2L A;  5DTK A;  5L2F A;  1GHP A;  3IF5 A;  3K2N A;  1MWS A;  1PZO A;  4K08 A;  4U0X A;  4OQH A;  5DVA A;  1H5X A;  3PBO A;  1K54 C;  3P01 A;  2Y2H A;  4FOF A;  5A92 A;  4BBU A;  4S2N C;  3W4P A;  3F1P B;  3MQQ A;  3WS2 A;  4M4X A;  5HWV A;  4XT2 A;  3GSG A;  2V20 A;  1LHY A;  2V0W A;  1VEU A;  2XFS A;  2W3H A;  4OOM A;  4XUX A;  3H82 B;  1SKO A;  3UY6 A;  1MPL A;  1WYB A;  3ISG A;  3KSI A;  5GLC A;  5TGF A;  3BQA A;  1PW8 A;  3HLE A;  3IH8 A;  1J3W A;  3MS6 A;  4P85 A;  4BBT A;  1STZ A;  4MN6 A;  3UDX A;  3ZCZ A;  1L0F A;  2ZQA A;  3PYP A;  4MEZ A;  1CI9 A;  3MJQ A;  4N9L A;  2B02 A;  4UQI S;  2GJ3 A;  3T4T A;  1F2K A;  1N9B A;  1EWZ A;  5CHU A;  2WKE A;  4P87 A;  3IT9 A;  4HHD A;  4WZ4 A;  4EXO A;  2FZ0 A;  3HLD A;  3K3D A;  4EQI A;  1FR1 A;  3F1N A;  5E2H A;  1KGG A;  4RVA A;  3O88 A;  1XGJ A;  3VOZ A;  5FAT A;  5EOO A;  1VQQ A;  2EA9 A;  1LL9 A;  3U4L P;  2ZLY A;  2A49 A;  2EXB A;  1G28 A;  4R4S A;  3ZNY A;  2Y91 A;  1K4F A;  4LLO B;  1TVF A;  1TDG A;  1YLZ A;  1XXM A;  4XUZ A;  5KMW A;  3R4K A;  3QP6 A;  3CHW P;  2PDR A;  3LIC A;  2L1M A;  5A91 A;  1IYQ A;  1FR6 A;  3OZH A;  4Z9Q A;  4YWZ A;  3NI9 A;  1FIL A;  2ZC7 A;  3F1O B;  3MQO A;  3G2Y A;  4LEN A;  2OV5 A;  4JF6 A;  3A3E A;  1K38 A;  4I38 A;  2P9V B;  3UB9 A;  3IS2 B;  2RCX A;  3C38 A;  4HJ6 A;  1Y28 A;  2QKP A;  4KG6 A;  1SHV A;  1XX2 A;  1HLU P;  2JN7 A;  1N9N A;  1XJ3 A;  2WGI A;  3P98 A;  2P08 A;  3LEQ A;  4HBT A;  3NEC A;  2W27 A;  3UE1 A;  4L0L A;  1U60 A;  3NOT C;  1WYC A;  1S1Z A;  4R3J A;  4DN0 A;  2OWH A;  5HD5 A;  1RGZ A;  1W5D A;  4HIA A;  4KQQ A;  4DJ2 A;  1GSX A;  3C7U A;  1G6A A;  3IWQ A;  5FL3 A;  3W4O A;  3A0V A;  4GB7 A;  3IF6 C;  3G6O A;  2VEA A;  4NXG A;  3CJM A;  3IWI A;  3WS4 A;  4KZ8 A;  5HSQ A;  2ZOH A;  3JVU A;  3M2K A;  5HAI A;  1GCE A;  3E4Q A;  4ZJ3 A;  5GL9 A;  5CER A;  2ACG A;  3T50 A;  2XH9 A;  5DFY A;  2DNS A;  5A93 A;  1KGF A;  1OTA A;  3DWZ A;  1G6O A;  3T12 B;  3NHQ A;  1GSV A;  4GDN A;  3TE8 A;  3SS3 A;  3MFX A;  4IVI A;  4JGR A;  2W1R A;  1E4D A;  3LIB A;  2JKF A;  1L3L A;  1YPR A;  2P7J A;  4Y2F A;  2Q9M A;  4XXR A;  3Q7V B;  1NYY A;  2Z2M B;  2VJW A;  3EGD C;  4HQA A;  4EU0 A;  1LSV A;  1YQS A;  3C5A A;  3ITA A;  2XA7 M;  5HDS A;  1ERO A;  4JXV A;  1JVJ A;  5EVI B;  1XGI A;  4H8R A;  3ZQ5 A;  3G32 A;  3V50 A;  3QNB A;  1MWU A;  3BLS A;  5DTS A;  5GLB A;  3GQZ A;  4LRX C;  2Y2Q A;  2W3E A;  3C30 A;  3K3C A;  4KZ7 A;  3GTC A;  2J3T D;  4R70 A;  4M3K A;  1DJB A;  4Y0O A;  3N6I A;  3VP2 A;  4E3J A;  2WK0 A;  2XF3 A;  4IBR A;  1FCM A;  1FCN A;  2HPB A;  3W2Z A;  4N9K A;  3ZVW A;  2A24 A;  3SW1 A;  2KOI A;  4KZA A;  4HOI A;  1AWI A;  1OPX A;  3WWX A;  4JGP A;  4KG5 A;  5EEC A;  1JWZ A;  4GLQ A;  4N92 A;  5AVF A;  3T1S A;  1MXO A;  1BSG A;  5F1F A;  1Q2Q A;  1IEL A;  4R0Q A;  3IHA A;  2ZOI A;  4BEN A;  2V1Z A;  4RX2 A;  3VP4 A;  5HPI A;  3S1Y A;  1O07 A;  4MLL A;  4EET B;  3QHY A;  5DFX A;  4X56 A;  4R1G A;  4DJ3 A;  2VKS A;  4P6Z M;  1BZA A;  5HAR A;  4U3T A;  5FQQ A;  2FFY A;  4UA9 A;  3C2W A;  4FH2 A;  4CJN A;  2J9P A;  1TS7 A;  2W1T B;  3MBZ A;  3MXS A;  2EFU A;  4JPM A;  2PR6 A;  5FI6 A;  3T4O A;  1JWP A;  3GRJ A;  2ZMV A;  4NXB A;  2K7S A;  2LB5 A;  1MBL A;  3QP4 A;  3BM6 A;  4O01 A;  2B5R A;  1MWR A;  3I7J A;  1ZC2 A;  2ZL1 A;  2W0N A;  3IXB A;  4CLC A;  4X53 A;  4DF6 A;  1H0M A;  4D60 A;  5HZH A;  1NJ4 A;  3VP0 A;  1P0Z A;  4GS9 B;  2FFF B;  1W79 A;  1YLY A;  2JKT I;  4LCL A;  4JLF A;  5I94 A;  5FAS A;  4GOG A;  2D01 A;  4ZRR A;  4H6J A;  2XA7 S;  3MZE A;  4KZB A;  5BOH A;  4S2M A;  1N4O A;  3FYZ A;  5G4Y A;  1S1Y A;  4KUO A;  4PKY A;  2QMI A;  3C4P A;  3BWL A;  4OH0 A;  1LL5 A;  5M1A A;  4QY6 A;  3QNC A;  2XLN A;  5L09 A;  4G3K A;  3TW8 A;  4NEE D;  4EUV A;  5GLA A;  2PYR A;  4PM7 A;  4E6W A;  2OSU A;  4JGO A;  3NOU C;  1YLP A;  5EVI C;  3PAE A;  3WS0 A;  4N1X A;  1NLZ A;  4ZJ2 A;  3HLB A;  5AQB A;  3CI6 A;  3CMZ A;  4UA6 A;  1ERM A;  3S7N A;  1LL8 A;  2PU2 A;  1K54 A;  3VFF A;  1YT4 A;  2QJ5 A;  5CXW A;  4S2N A;  4OON A;  3VP3 A;  4I3A A;  4B93 A;  3VSK A;  2Z2L B;  5TR7 A;  1CF0 A;  2EX8 A;  1BT5 A;  3V67 A;  1VET B;  3E4P A;  3CPT B;  1NWZ A;  1PNE A;  2XDM A;  5FQM A;  3DTM A;  1KVM A;  3UNW A;  4DRT A;  3OCN A;  1OJ5 A;  4WZ5 C;  2Y2M A;  3BJN A;  1PYY A;  5EE8 A;  1WA9 A;  4R6L A;  2O0Y A;  4P6Z S;  3WRT A;  3LGO A;  4F94 A;  5AQA A;  1NRF A;  1DP9 A;  1NZU A;  3NDE A;  4HNB A;  1M40 A;  2IWD A;  2O9B A;  4LV2 A;  4IVK A;  3G35 A;  4RYE A;  3BFC A;  2BTF P;  3MF0 A;  2OOL A;  3JPU A;  4MDZ A;  1YSP A;  1PIO A;  2VV8 A;  5GHX A;  2V1B A;  2C5W B;  5E2G A;  1FIK A;  4R38 A;  3LID A;  1T1A A;  2A3U A;  5EPH A;  2QJ7 A;  4XT2 B;  2XGN A;  2BG1 A;  3A0R A;  4CLC D;  5EUA A;  2OLU A;  1XFN A;  1C3B A;  5FAP A;  4HH2 A;  4QJG A;  3H7W A;  4OOY A;  1VEU B;  1LI0 A;  1SKF A;  3E2K A;  4IJG A;  4RQ9 A;  3S7P A;  1TDL A;  4KZ6 A;  1SKO B;  3LR0 A;  1YMS A;  3C8C A;  4KZ5 A;  2XD5 A;  3MFD A;  4LGW A;  5E2E A;  4BD1 A;  4DE2 A;  2WGW B;  4ZDX A;  3HLC A;  5J3W A;  3EEA A;  2J9O A;  4UEY A;  2AVX A;  3BQ8 A;  2W3D A;  4QU3 A;  4Q0I A;  5CGW A;  3N4I A;  4U0T A;  1H3Q A;  2VV6 A;  2ZC5 B;  4S2J A;  2WGV A;  1GA9 A;  3HUO A;  2WKR A;  1K57 C;  4NET A;  3F1N B;  2HGV A;  1KE4 A;  3HLW A;  3ZDJ A;  3AGD A;  5EFW A;  4BJP A;  4I39 A;  1W7F A;  4Y15 A;  1T1B A;  5MC7 A;  2H10 A;  4LV0 A;  4MN7 A;  4WYY A;  3UMD A;  4E04 A;  1G5U A;  5CTN A;  3C4O A;  2CC1 A;  1O7E A;  3S7Q A;  2Y2K A;  2J80 A;  4JXW A;  3FZC A;  4O0P A;  3HUM A;  4WM9 A;  2J8Y A;  1L0D A;  3E0Y A;  3A3I A;  3IF6 A;  5A90 A;  4EES A;  2Q0O A;  3BYD A;  5K5B A;  3BFD A;  3VOL A;  1OTE A;  4PKY G;  5F1G A;  1IYP A;  1I5Q A;  1NLY A;  4IHQ A;  3HRE A;  4L9F A;  3VV4 A;  3EOI A;  2XFT A;  3NC8 A;  3RH8 B;  4E6X A;  3DTK A;  3O3V A;  3AGF A;  4EBL A;  2V1A A;  3SS5 A;  3EQU A;  1PWC A;  3EEH A;  4KEN B;  4WL9 A;  4FUW A;  3HUN A;  5CEC A;  4X1M A;  1ZTU A;  4YIN A;  4C3Q A;  5EOE A;  2OAP 1;  2PYP A;  3IWO A;  3GMW A;  4O8G A;  3ULF A;  1ODV A;  5FAQ A;  2WAE A;  1DP6 A;  4X68 A;  2WAF A;  3D4F A;  4EWF A;  3T1Q B;  5CGX A;  5F6A A;  2W3G A;  5EVL A;  1ZG4 A;  2H0T A;  3AGE A;  4F3L A;  4KZ4 A;  1WE4 A;  2B18 A;  4MBH A;  4Y3I A;  3ITB A;  2XSS A;  2HDU A;  1KE0 A;  1T19 A;  5HL1 A;  3OPR A;  4JGQ A;  4OPQ A;  4OLG A;  2JE5 A;  3TRC A;  3B47 A;  4WN5 A;  2WUQ A;  5L8M A;  2V8F A;  1MKI A;  4ETZ A;  3LI9 A;  4KZ9 A;  1E25 A;  5FEF A;  2KLI A;  5E2F A;  5TJJ A;  2G7U A;  3UME A;  1NXY A;  4HJ3 A;  2OLV A;  5IT5 A;  2QWS A;  4HP4 A;  5DTT A;  4OVD A;  5FDS A;  1D06 A;  1HVB A;  3M6B A;  3T4S A;  2BAS A;  2ZM8 A;  1DJC A;  4DE3 A;  1XKZ A;  4R23 A;  4NKP A;  4X1L A;  3G34 A;  2R78 A;  5LBR A;  3DBA A;  4IBX A;  2EX2 A;  2ZC4 B;  3OOV A;  1SZV A;  2VX8 A;  4EQ1 A;  3Q07 A;  3BRM A;  3UN7 A;  4Q0H A;  3NBL A;  3UB7 A;  3ZG5 A;  3E98 A;  3T4J A;  3KO6 A;  5EM0 A;  2HV1 A;  2L4R A;  2A24 B;  3P09 A;  1UWP X;  3KYZ A;  2WAD A;  3MQ0 A;  1V9Z A;  1W8Y A;  4Y7P A;  3S22 A;  3OPL A;  1OTD A;  2QYB A;  3BW6 A;  1HTZ A;  4BQM A;  5FI2 A;  3O86 A;  4PAU A;  3OCL A;  1OTB A;  5FEG A;  1IOU A;  3O87 A;  4MMN A;  1PW1 A;  1IKI A;  4GJ4 A;  2Y2J A;  2HDQ A;  3TOI A;  4GD8 A;  1T1C A;  4OPZ A;  3WS1 A;  4L9E A;  4OLD A;  4BD0 A;  4KZ3 A;  2V2F F;  5I5L A;  2VK3 A;  5FSR A;  3UO9 A;  3ZGA B;  3FG8 A;  2HP6 A;  2K31 A;  5J4E A;  4E3L A;  5KZH A;  3IX4 A;  4KUK A;  3LY4 A;  2EFX A;  2MJ6 A;  4WEK A;  2XR0 A;  1I2S A;  1HZO A;  1MKM A;  1ESU A;  1CEG A;  1K55 A;  2UWX A;  3R7W A;  3RFB A;  1Z09 A;  3IXD A;  2ZL1 B;  4ZAM A;  4G3W A;  3BFF A;  4II7 A;  2Y8H A;  3EWK A;  4L9G A;  1RCJ A;  4CLC B;  4DE1 A;  1H8Y A;  5GHY A;  5HWW A;  4WMC D;  3SOI A;  3A3J A;  4I3J A;  4E3I A;  4GDB A;  4MBF A;  1E3U A;  3SH7 A;  3N8L A;  4H6J B;  5CHM A;  2VGL M;  3LIF A;  5IU1 A;  3UB5 P;  5G4Z A;  5FAO A;  4R3A A;  2X01 A;  3HJK A;  2HDS A;  4WZ5 A;  3LO7 A;  1KDS A;  2Y4A A;  2K2N A;  1I2W A;  2VGJ A;  4B9O A;  1FOF A;  2YKH A;  2ZBB A;  1OT6 A;  2HJE A;  4P0M A;  3PBQ A;  3SH9 A;  2PR5 A;  1LSX A;  1VM1 A;  4NG2 A;  5DJT A;  1NY0 A;  3MXR A;  4UAA A;  2JBF A;  2J3W A;  1L0E A;  4LRY C;  5AQ9 A;  3HBR A;  3L9K A;  3VE3 A;  1PWG A;  3VSL A;  2Z6D A;  4EBN A;  4OPR A;  2XRO A;  1K4E A;  4ESP A;  2GDN A;  1D1J A;  3LR5 A;  2NUP C;  4K0X A;  3KSG A;  1IKG A;  4HES A;  3UPP A;  1XP4 A;  4UHU A;  2DRW A;  4Y17 A;  3UDF A;  1FCO A;  1Q2P A;  3CWF A;  1N9O A;  2W3F A;  5AVE A;  1YLW A;  1G68 A;  5CRF A;  4CQH A;  4Q8I A;  4YOF A;  4OPY A;  1UGU A;  2O9A A;  3UB8 A;  5DF8 A;  3DTI A;  1PFL A;  4R4R A;  3T1X A;  1OME A;  2ZM0 A;  1OT9 A;  4ZBE A;  5KIZ A;  1S67 L;  1TD5 A;  2GZA A;  2H5S A;  3EQV A;  1UWN X; 
#chains in the Genus database with same CATH homology
 4BWI A;  1S1Z A;  2HGV A;  1T18 A;  4BBV A;  1DP8 A;  4DN0 A;  2OWH A;  3LIA A;  3O5Y A;  1MC0 A;  5DF9 A;  4MCW A;  5HD5 A;  3PR6 A;  4Y5F A;  5EFW A;  4BJP A;  4HIA A;  3D72 A;  4I39 A;  2ZMF A;  4DJ2 A;  3OLO A;  1GSX A;  1P9W A;  1T1B A;  5MC7 A;  4DMZ A;  4MN7 A;  3JVV A;  5FL3 A;  1LSW A;  4WEJ A;  3LR3 A;  3NOP C;  3A0V A;  3G6O A;  3UMD A;  2VEA A;  4E04 A;  4I3I A;  2EWV A;  3H9W A;  1W63 M;  3PBN A;  3PBT A;  4NXG A;  3LR4 A;  3S7Q A;  2J80 A;  5HSQ A;  2ZOH A;  3JVU A;  4ARZ B;  3HJI A;  4O0P A;  4UQI M;  2NUT C;  3E4Q A;  4YNR A;  3H7W B;  2QHK A;  3CLO A;  4MN5 A;  3T50 A;  2IA2 A;  3E0Y A;  5DFY A;  3T4K A;  5HPF A;  2YKF A;  3IBJ A;  1JNU A;  4EES A;  4IUK A;  1OTA A;  2JKR M;  5K5B A;  1G6O A;  3NHQ A;  1GSV A;  1NRJ A;  3VOL A;  1BYW A;  3TE8 A;  1OTE A;  3FPV A;  4PKY G;  3KSH A;  3MFX A;  2M7V A;  4JGR A;  2W1R A;  4CLC C;  3LIB A;  3LUQ A;  2P7J A;  2KDK A;  1NLY A;  3FPW A;  4Y2F A;  4IHQ A;  2CMN A;  4BMW A;  4HP9 A;  4L9F A;  3VV4 A;  3EOI A;  1ZHH B;  1VB6 A;  3RH8 B;  2VJW A;  3UE3 A;  3EGD C;  2PHY A;  4HQA A;  4EU0 A;  4FSF A;  2O99 A;  3NJA A;  1LSV A;  4LPZ A;  2XA7 M;  3PBS A;  5HDS A;  2V1A A;  3IBR A;  3OC2 A;  3BY9 A;  2PD7 A;  3ZQ5 A;  3EQU A;  3EEH A;  4WL9 A;  2FH5 A;  2VV7 A;  5F68 A;  5C5K A;  1ZTU A;  5HWT A;  4LRX C;  3LIE A;  2W3E A;  2W1T A;  3C30 A;  2OAP 1;  3K3C A;  3T4L A;  2PYP A;  2J3T D;  4R70 A;  1VHM A;  4O8G A;  3ULF A;  1ODV A;  3ZYT A;  1DP6 A;  4EEU A;  4EW7 A;  5F6A A;  2W3G A;  4F3L A;  2D02 A;  3W2Z A;  2EWW A;  1P9R A;  4WUJ A;  2A24 A;  4AFI A;  3SW1 A;  2KOI A;  3UB6 A;  5TBM A;  2B18 A;  3MXQ A;  3PBR A;  4HOI A;  2V9A A;  1TS0 A;  4Y3I A;  1DRM A;  4GS9 A;  2XSS A;  1OPX A;  3CAX A;  1T19 A;  2LB9 A;  1LT0 A;  4JGP A;  4I5S A;  4JGQ A;  4GLQ A;  2GX5 A;  5F5Y A;  5HDC A;  5AVF A;  1OTI A;  3TRC A;  1GSW A;  1YAX A;  1D7E A;  3B47 A;  4WN5 A;  4HY8 A;  2JKT M;  2ZOI A;  5DKL A;  4KQD A;  5L8M A;  3CUE C;  2O9C A;  4ETZ A;  5HPI A;  3LI9 A;  5F69 A;  2KLI A;  4GHI A;  4EET B;  1TS6 A;  5TJJ A;  2G7U A;  5DJU A;  3UME A;  5DFX A;  2VA0 A;  4KQO A;  3UE6 A;  4DJ3 A;  2VKS A;  4HJ3 A;  4P6Z M;  5IT5 A;  2QWS A;  4HP4 A;  3CUE A;  4CLC E;  1D06 A;  1V9Y A;  3T4S A;  2BAS A;  2XRN A;  4NKP A;  3LYX A;  2R78 A;  2VGL S;  5LBR A;  5KSH A;  3C2W A;  3DBA A;  3F1P A;  3KX0 X;  3GEC A;  1TS7 A;  2H28 A;  3OOV A;  2W1T B;  2M1C A;  2PR6 A;  3T4O A;  2VX8 A;  4EQ1 A;  1EW0 A;  2ZMV A;  4NXF A;  3U2A A;  4NXB A;  2K7S A;  2LB5 A;  4WEL A;  1MZU A;  1XJ4 A;  4Q0H A;  3H82 A;  3UB7 A;  4O01 A;  3E98 A;  3MR0 A;  4HI4 A;  3T4J A;  3KO6 A;  4F3L B;  2HV1 A;  1S4S A;  1OJG A;  3FC7 A;  2L4R A;  2W0N A;  5HD3 A;  2A24 B;  3TJZ C;  3EGX C;  1UWP X;  4CLC A;  3KYZ A;  5TBM B;  2VZW A;  3MQ0 A;  2P04 A;  1V9Z A;  5HZH A;  1P0Z A;  4GS9 B;  1F9I A;  2JKT I;  1P97 A;  3KSF A;  3ICY A;  4EER A;  3MMH A;  2A2L A;  1OTD A;  4HH3 A;  2D01 A;  2QYB A;  1H8M A;  4OOL A;  4ZRR A;  4H6J A;  4ME4 A;  2XA7 S;  3BW6 A;  2WKQ A;  4PHT A;  1XJ6 A;  5G4Y A;  4ARZ A;  2GNX A;  1S1Y A;  4KUO A;  4PAU A;  3OCL A;  1OTB A;  1IOU A;  4PKY A;  4MMN A;  1X0O A;  3BWL A;  4GJ4 A;  3LFV A;  4GHI B;  1IFQ A;  1S66 L;  2V0U A;  1T1C A;  4G3K A;  3TW8 A;  3RTY A;  5J7E A;  4L9E A;  3K2N A;  4NEE D;  4K08 A;  4EUV A;  5I5L A;  2PYR A;  3PBO A;  3FG8 A;  4JGO A;  3P01 A;  3NOU C;  4FOF A;  2DMW A;  2K31 A;  5J4E A;  4WLA A;  3OBF A;  4BBU A;  1XJ2 A;  2OAQ 1;  3F1P B;  1NLZ A;  4GW9 A;  2Y79 A;  1YKD A;  4KUK A;  3CI6 A;  3MQQ A;  4M4X A;  2MJ6 A;  5AJG A;  3S7N A;  5HWV A;  4WEK A;  4XT2 A;  3HCY A;  1LL8 A;  1F5M A;  1KOU A;  1MKM A;  2QJ5 A;  2V0W A;  3F1O A;  2W3H A;  4OOM A;  3B42 A;  3H82 B;  4I3A A;  4B93 A;  1N9L A;  3P7N A;  3R7W A;  3RFB A;  3KSI A;  3CIT A;  3V67 A;  4G3W A;  3BQA A;  3E4P A;  3BY8 A;  3IS2 A;  1NWZ A;  4II7 A;  2Y8H A;  3EWK A;  4L9G A;  4CLC B;  4BBT A;  3OCN A;  1OJ5 A;  1STZ A;  4MN6 A;  3B33 A;  3BJN A;  5HWW A;  3PYP A;  5A8B A;  1WA9 A;  3MJQ A;  4I3J A;  2O0Y A;  4R6L A;  4P6Z S;  3S7O A;  4H6J B;  2VGL M;  2B02 A;  3LIF A;  2L0W A;  2Z6C A;  3A0S A;  4UQI S;  5IU1 A;  5G4Z A;  4R3A A;  4EEP A;  2GJ3 A;  3T4T A;  3HJK A;  1DP9 A;  4HNB A;  4HHD A;  2I9V A;  2O9B A;  2K2N A;  4B9O A;  2YKH A;  3GDI A;  3D3O A;  4EXO A;  2ZBB A;  1OT6 A;  2FZ0 A;  2HJE A;  4G3V A;  3K3D A;  3PBQ A;  3F1N A;  2PR5 A;  4Q0J A;  1LSX A;  3MF0 A;  5DJT A;  2OOL A;  5DKK A;  4ETX A;  2HJ9 C;  2VLG A;  4MDZ A;  1YSP A;  2EA9 A;  2J3W A;  2VV8 A;  2J3T C;  4LRY C;  2V1B A;  1G28 A;  3VE3 A;  2Z6D A;  4LLO B;  3KYQ A;  4R38 A;  3VE4 A;  3LID A;  1T1A A;  4QPR A;  2XRO A;  2WKP A;  3R4K A;  3PHY A;  3LR5 A;  2NUP C;  3KSG A;  2PDR A;  3LIC A;  2QJ7 A;  2L1M A;  2OWJ A;  1S4R A;  4XT2 B;  3A0R A;  4CLC D;  1XFN A;  4YWZ A;  1TS8 A;  1YSQ A;  4HH2 A;  3H7W A;  3F1O B;  3MQO A;  3S7P A;  4IJG A;  4RQ9 A;  3CWF A;  1N9O A;  3LR0 A;  2W3F A;  5AVE A;  3R7W B;  3C8C A;  2KX6 A;  3PXP A;  1W63 Q;  4I38 A;  1XFQ A;  4CQH A;  3UB9 A;  2HF6 A;  3IS2 B;  3T4Q A;  4YOF A;  4LRZ E;  3C38 A;  4Z1W A;  1UGU A;  4HJ6 A;  5J3W A;  2O9A A;  1Y28 A;  2QKP A;  3EEA A;  3UB8 A;  4HJ4 A;  4UEY A;  4NXE A;  3BQ8 A;  4WF0 A;  2W3D A;  2PT7 A;  5CX7 A;  2JN7 A;  1OT9 A;  1N9N A;  1XJ3 A;  2P08 A;  4Q0I A;  4GCZ A;  3E4O A;  1H3Q A;  2INW A;  5KIZ A;  2JKR I;  2JHE A;  1S67 L;  2M7U A;  5HL6 A;  5IS1 A;  3LI8 A;  1TD5 A;  2VV6 A;  2PD8 A;  1F98 A;  4IUH A;  2GZA A;  2W27 A;  4L0L A;  1TF1 A;  5HDD A;  2WKR A;  3EQV A;  3NOT C;  3F1N B;  1UWN X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...