2MJ6A

Solution structure of the extracellular sensor domain of drak histidine kinase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
GSETRTISSTAQERVDLEAVRLASIVDSRLIGTGSVDEDFLREQIRDARYAVIRIPGQPVVEVGTKPTGDVLQGRATGEEGETVLVEEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative two-component system histidine kinase
publication title Mechanism of the pH-Induced Conformational Change in the Sensor Domain of the DraK Histidine Kinase via the E83, E105, and E107 Residues
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 21
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2013-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18092 DraK_HK_N DraK Histidine Kinase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.250 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2mj6A00
2MJ6A
chains in the Genus database with same CATH superfamily
5J4EA 3LR0A 1IYQA 2B5RA 3K2NA 4DRTA 2INWA 4KZ9A 1XGJA 4S2KA 2J7VA 5FAOA 4OONA 3MF0A 1D1JA 4YWZA 3VSKA 2V0UA 3BQAA 3C4PA 5F6AA 1ES3A 4R1GA 3NDEA 1ALQA 5JYOA 4OP8A 2Q0OA 2XEPA 2HP6A 4KQDA 1KDWA 2PYRA 2ZMVA 1M40A 1NLYA 2W3EA 2Y2JA 4ZJ2A 1FR1A 1VETB 3CLOA 1EROA 1G6AA 1PI5A 4R3BA 4JXVA 3ZVWA 3MS6A 3BY9A 3LIDA 1ERQA 4WLAA 4ARZB 2JKRM 4GDBA 4M4XA 3W4PA 5GHXA 1K4FA 1P97A 4GHIA 1Z6FA 2UV0E 2ZQDA 4BBUA 3E4PA 4KZ8A 4WBGA 5CGXA 2ZQ8A 4OPYA 4OQGA 4Z1WA 5HDCA 5GLBA 2XGNA 2QJ7A 4DMZA 4IHQA 1V9YA 3ULFA 4KZ5A 3S7NA 1VETA 1RGZA 4ZJ3A 3R7WB 4B93A 1SKOB 4OOMA 1U60A 3U4LP 4D60A 3G2YA 5M19A 3UPNA 4NKPA 4BQMA 4KZ7A 4OKPA 4GN2A 3GVBA 4P87A 1MWRA 3HLEA 2JBFA 5JYPA 4ETXA 2KX6A 2PR6A 3EQUA 1FSYA 2PAVP 5KZHA 1S0WA 3V5MA 3P09A 1H5XA 2O99A 3D4FA 1OT9A 4BWIA 5HL6A 4N9LA 1DP9A 4QPRA 5EE8A 3IX4A 3AGEA 1PZPA 2W1RA 2H10A 3R7WA 1G5UA 3QNCA 4GKUA 3PBTA 3CZDA 3Q7VB 2V2FF 5TBMB 5EOOA 4PKYG 4HH3A 1K4EA 3A3EA 3T4LA 2WADA 2YKFA 1A0KA 2PU4A 4AFIA 2M7UA 3MFXA 5F5YA 3W4QA 3VOZA 1MC0A 4EETB 5FDSA 5E2EA 3G34A 2PRFA 3EOIA 1DP8A 2WKEA 2PD7A 3PTEA 2ZD8A 5AJGA 4WZ5C 4LRYC 2Y2GA 4X55A 1TS8A 5FA7A 2Y79A 3FV7A 2XA7M 2ZQ7A 2E8JA 3KO6A 4IUKA 4OQIA 1WA9A 1YLZA 5E2HA 4WM9A 3A0SA 2HDSA 4YOFA 4NG2A 5TBMA 5AQ9A 5E2FA 2V8FA 2Y2QA 3MQQA 1W79A 1L0DA 4WUJA 3G32A 4BJPA 4GS9B 1TS0A 3T50A 3SH7A 4U0XA 4HBUA 3UE3A 1LL9A 3CPTB 3CJMA 4XXRA 5TFQA 5FEFA 1ZTUA 3DW0A 5L07A 2VGLS 1XA7A 3HJIA 4MN6A 4UQIM 4FH2A 2K7SA 4S2PA 2OSUA 3K3CA 2HDQA 1PNEA 1K0KA 2ZC3B 5FQMA 5A93A 4E3OA 4JXSA 4K0XA 5FSRA 2DNSA 1NRJA 3V3RA 3EGDC 4E6XA 1FCMA 3LY4A 3O86A 4GD8A 2ZM8A 1DJAA 1TS7A 3PXPA 1FCNA 1YSPA 1K54A 4GS9A 2OAQ1 4DXCA 1WE4A 3EEHA 5DVAA 1NY0A 2OWJA 5DKKA 2WGIA 1O7EA 2G2WA 4K0WA 4UAAA 1UGUA 2ZLYA 1H8YA 1XJ6A 1UWNX 3HCYA 3LYXA 1L0GA 3UMEA 2ZC7A 1ZG4A 3DTEA 5HWTA 5I94A 2I9VA 2HPBA 4WMCA 4U3TA 3JPUA 3ZQ5A 3SS5A 1I2WA 2J8YA 2OAP1 1IOUA 4FSFA 3HJKA 1GSXA 3MZFA 3B47A 3BEBA 1T1AA 3NOUC 5M18A 2HF6A 3VP4A 1M6KA 1HZOA 4KZBA 3NC8A 4EQIA 2IA2A 3LIAA 4JGOA 1W63M 2Y2MA 2BG1A 2O9BA 3WWXA 4KZ6A 1LLBA 5KSCA 2Z6CA 3NJAA 3N8LA 1K56D 4CLCE 4EWFA 3BFGA 3FPWA 1SKFA 1NZUA 5DF7A 2GZAA 4ME4A 1KGGA 1FOFA 1PWDA 4GZBA 5BOHA 5EV0A 1H3QA 3SH9A 3PR6A 2DCFA 3LFVA 1IKGA 1NYMA 5DTTA 2VK3A 1CEFA 4Y0TA 1LT0A 1K54C 1K55C 2GNXA 2H0TA 2ZM2A 1ES4A 4R4SA 5GLDA 2PDRA 2ZJ9A 3C7VA 3E0YA 3LICA 1KVLA 2X71A 2NUPC 2XK1A 4Q0HA 2JE5A 2Y2IA 1X0OA 1XX2A 4DE1A 2QJ5A 3H7WA 1O07A 1WYBA 4MBKA 1YLPA 2EA9A 3QNBA 1JWZA 5CHJA 2G7UA 5KIZA 2Y91A 5CEBA 2EFXA 2C6WB 1E3UD 5F1FA 1G28A 3IF6B 2ZM0A 3IBJA 2H0YA 2UWXA 2VV7A 3MJQA 3OCLA 4LRZE 3LIEA 3WRTA 1MBLA 1YM1A 4EQ1A 1DJBA 4CJNA 3S4XA 4JPMA 2BTFP 3DTIA 4DE2A 5CX7A 2OWHA 3LI8A 5EVID 3HBRA 3SOIA 3DWKA 4X25A 4WF0A 1DP6A 3PBNA 4DE0A 2ZMAA 1YT4A 1PW1A 4GJ4A 1K57A 1P0ZA 3CWFA 4X68A 3KX0X 4RQ9A 4LLOB 1GHMA 1BTLA 1XA1A 2HJ9C 1PW8A 4E04A 1YAXA 3IF6A 1RCJA 3IX3A 3MZEA 5EM0A 4KUOA 5FQKA 3GECA 5EUAA 3UN7A 5I5LA 4I3IA 4HOIA 4UA9A 1CI8A 1YKDA 4HP9A 2XR0A 2ZQ9A 4OOLA 3P01A 5DTSA 2RL3A 1KVMA 2XLNA 2O9CA 4LFUA 1BYWA 4LV2A 3E98A 1XJ3A 1LHYA 1L0EA 3IHAA 3M6BA 3LIFA 4JKTA 3N4IA 3D9YA 4II7A 2VLGA 3T4QA 4N1HA 5HPFA 2A3UA 3F1NB 4LCLA 2W3HA 4I38A 3BJNA 1GHPA 3T4OA 2OLVA 2ZOIA 2Q9NA 2QYBA 3IHBA 2WAFA 3DBAA 4EEPA 4HH2A 3DWZA 1G68A 2XQZA 1PWCA 5IHVA 3IT9A 5DTKA 3UPOA 1K57C 3GMWA 4Y3IA 2A2LA 4GNUA 3LR4A 3EWKA 2FZ0A 4CLCD 2B02A 5FEGA 1F5MA 3C30A 3QP1A 1LSVA 1XXMA 3T1SA 2VEAA 1TEMA 3C4OA 1J9MA 3M2KA 2O0YA 3L7HA 3OCNA 1NZOA 4I5SA 4JXWA 5HSQA 3B33A 1H8MA 4LV1A 1L3LA 4JBFA 4EERA 2P7JA 4E3MA 1TF1A 4EBLA 4Y13A 4O0PA 3OPRA 4BL2A 3F1PB 1KDSA 2QPNA 3UB6A 1E25A 2ZBBA 4Y0OA 4GD6A 3G30A 3WS5A 4HESA 4UA6A 3ZG7B 3I7JA 1ESIA 3LR3A 5G4YA 1IYPA 2R9WA 4B9OA 1VEUB 3S7OA 3GQZA 4R0QA 3ICYA 4X6TA 2VGLM 3ISGA 4BMWA 4MN7A 5AVEA 4IBRA 1OTDA 2XD1A 3HLGA 1YQSA 4OPZA 2P04A 2GDNA 1N9LA 4MBHA 4S2OA 3O87A 3VP0A 3GSGA 1KE3A 1FILA 4DJ2A 1S67L 1GA9A 3F1PA 4FH4A 2P9VB 2JN7A 2P74A 1IYOA 2W3DA 4DJ3A 4UA7A 2JCHA 4ARZA 1ZC2A 4N92A 4JF5A 1NXYA 4S2IA 5CHMA 4X69A 2Y2PA 4CPKA 1JTGA 1PYYA 4PM7A 3FZCA 4GLQA 3SW1A 2ZC5B 2HJEA 3GRJA 1YSQA 5CECA 1CI9A 1SZVA 3P98A 4ZBEA 2VX8A 3VOYA 1HTZA 3CI6A 5HAIA 2M1CA 2XF3A 3B42A 2B18A 4S2NA 4X53A 4PMAA 2AVXA 1SKOA 2LB5A 4IEDA 2P9VA 4ETZA 4EUVA 4WN5A 1KE4A 2J9OA 3UPPA 5FQIA 4JLFA 2K31A 4R6LA 2J3TC 3IF5A 2W3FA 2HDUA 2WZZA 3DAVA 3C5AA 2I72A 3WRZA 4E3JA 4BD0A 1SDEA 1Y4OA 3G6OA 4BENA 4KQOA 4MBFA 3RTYA 4HJ6A 4KZ4A 2J3TD 1K6SA 5FDHA 4RYEA 2WKRA 1XJ4A 5L09A 4BLMA 3FG8A 5A8BA 5CHUA 2C5WB 3V50A 2PU2A 3O5YA 4HIAA 4MCWA 3S1YA 3BFFA 1JNUA 4KG6A 4NXGA 5L8MA 4PM8A 3Q7VA 1CQAA 4HJ4A 2V9AA 3K3DA 3NY4A 2WKPA 3BM6A 4YNRA 4JGRA 3TW8A 1ESUA 3UDFA 1BUEA 5HAPA 2K2NA 3IXDA 5GLAA 3BLSA 4X1LA 3QHYA 4NXBA 1P9WA 4FUWA 4DN0A 5EECA 3U2AA 3PBSA 3MKFA 1QMFA 1XPBA 2W1TB 2FH5A 5HZHA 2JKTI 3LEZA 5DJTA 1XP4A 4HQAA 2XROA 5FI7A 5J8XA 2ZMFA 2V8CA 5GL9A 1IEMA 3VSLA 1IELA 5MC7A 2EX8A 3Q82A 2BASA 1KE0A 3H82B 1F2KA 5TJJA 3SZTA 3PBQA 5TGFA 4P6BA 3SS3A 3CUEA 3JVUA 4DDYA 1CJFA 3RH8B 4BBTA 4Q0JA 1RGYA 4OP5A 4UHUA 1ES5A 3QP5A 5FI2A 4Y17A 3VP2A 2J9PA 2ZL1B 1GSWA 5E43A 4M3KA 3TG9A 2XD5A 5DKLA 5AQBA 3GDIA 3Q81A 4PM6A 3PAGA 1KGEA 3CG5A 2W1TA 3MMHA 3ZHHA 3JVVA 4CQHA 5FI6A 3CPTA 3IWIA 5KSHA 3DTMA 4R3JA 3VE3A 1DJCA 4XT2B 3PHYA 3BFEA 4FD8A 4FOFA 4F3LB 1S66L 4Y15A 2XDMA 5HD3A 2Z6DA 1HLUP 3OPPA 1LSWA 1YPRA 2QKPA 5FL3A 1BULA 5EVIB 1Y28A 3MXQA 4P6ZS 4X1MA 1QMEA 3AGFA 2VKSA 3KYEA 1PIOA 4PHTA 2GJ3A 3TOIA 2HGVA 1E3UA 1W7FA 3LI9A 3ZFZA 2EWWA 2JKTM 3IX8A 4KUKA 3VV4A 4MMNA 1NWZA 3HLDA 1W63Q 2XFSA 3HLBA 2RCXA 2HV1A 3ZVTA 4WELA 5F69A 1ODVA 2R78A 1I2SA 3OBFA 1LSXA 4B88A 1MWTA 3ZGAB 3B3XA 2Y4AA 4MEZA 3PYPA 3QP4A 2IWCA 2ACGA 4JF4A 2DRWA 4DF6A 3NECA 2XH9A 2X01A 3BRMA 3N7WA 1ACFA 1ZKJA 3GR2A 5F68A 5HDSA 3FC7A 1T18A 3IQAA 3MQ0A 3DTKA 2Q9MA 2HZ5A 3F1OB 4LV3A 2LB9A 4K91A 4QJGA 2Z2MB 3E4OA 3ZDJA 1UWPX 3UDXA 3CITA 2QWSA 1W8QA 3GV9A 1JWPA 1FR6A 2Y8HA 4HEFA 2JC7A 3IWQA 5C5KA 5A92A 1SHVA 3NCKA 5CTMA 4WMCD 4ZRRA 2IWBA 4CLCB 4R23A 5U47A 2JKGA 3BW6A 4G3KA 3FWLA 3S7PA 4C6YA 1C3BA 5AVFA 3BFCA 4QHCA 4XUXA 1MWSA 1DY6A 4JF6A 4JGPA 3RXXA 4FTXA 1OT6A 3M2JA 4EXOA 4I39A 1ES2A 3BECA 2VA0A 2FFFB 4PKYA 4QD4A 1LI9A 5L2FA 4JXGA 2PT7A 1BLCA 2HP5A 3UE6A 4IBXA 1FIKA 4F94A 4MDZA 2V0WA 4GW9A 3RFBA 5K5BA 2EFUA 1L0FA 1CF0A 5FAQA 5GLCA 5CXWA 5FQJA 2HDRA 4CLCA 3TJZC 3V39A 2BLSA 2ZC6B 5CGWA 4EESA 3CMZA 4R3AA 4EBNA 3HLWA 3TSGA 3FYZA 3E2LA 3H9WA 1BZAA 4E6WA 2H5SA 3IS2B 5HD5A 5GHYA 3HREA 5DF9A 3VFFA 4LPZA 4NXFA 3C7UA 4RA7A 1ZG6A 1YMXA 5J3WA 2PD8A 4DDSA 1SCWA 4MNRA 2EXAA 4OPRA 1PWGA 4PPRA 3V3SA 1AWIA 1NLZA 5F1GA 3WS0A 5M1AA 4BL3A 3A0RA 3G4PA 4E3KA 3KSHA 1HD8A 4O01A 2EX6A 4EUZA 1DRMA 2L4RA 3MBZA 3G31A 4NEED 4P0MA 3RXWA 2VGKA 3ZG8B 2Y2LA 2YKHA 3WS2A 3UY6A 3KSGA 3A3FA 3ZNYA 3KYZA 3UNWA 2EX9A 3QP2A 3NULA 2Y2OA 1N4OA 4E3LA 4ZTKA 1VHMA 1EWZA 3HUMA 3IF6C 2WK0A 4Y5FA 5FQQA 1FSWA 1XGIA 3F1NA 4KENB 1PI4A 3QP6A 2KOIA 4KG2A 3OPLA 1JTDA 1OTIA 1ZHHB 4GHIB 2J80A 4KQQA 3OZHA 4MN5A 3AGDA 3MFDA 3C38A 3LO7A 2WGWB 1ONHA 2VGJA 3NDGA 5E2GA 2VJWA 1YMSA 2M7VA 4IUHA 1K6RA 1W5DA 3R4KA 3T4JA 4IJGA 5LBRA 2X02A 2Y55A 2JHEA 4LGWA 4U0TA 5DFYA 1MKIA 3MZDA 3ITAA 3HL9A 1E4DA 4O8GA 3E2KA 4Z9QA 1OJGA 3PBOA 4QB8A 3IXGA 4OQ0A 4OQHA 4H6JB 5D3OA 4IVIA 2G2UA 4XUZA 4GDNA 4Y0UA 1YLWA 1RP5A 4O7DA 3UO9A 4Q0IA 4NETA 1Y54A 2EX2A 4YINA 4KZAA 1Z09A 3W8KA 4R70A 1S1YA 2WGWA 1SDNA 4OOYA 1TS6A 4FCFA 4I3AA 5G4ZA 2D01A 4B4XA 3UE1A 3TRCA 1IKIA 2B95A 1V9ZA 3FKVA 3NOPC 1MPLA 1CEGA 3D3OA 2CC1A 3T4TA 4Y7PA 4C3QA 1ERMA 1FQGA 1MWUA 3FPVA 3IWOA 1MZUA 1Q2PA 4Q8IA 2PBYA 1IYSA 4ESPA 3MXSA 3W2ZA 4WZ5A 4NK3A 2WKHA 4QU3A 3VOLA 3V67A 1VEUA 3HUOA 1KGFA 4H8RA 4RX2A 4H6JA 3UE0A 3UB9A 4KZ3A 4E3IA 3RJUA 2OLUA 4DKIA 4B4ZA 5HAQA 2DMWA 2CMNA 2WKQA 4P6ZM 4WEJA 3VE4A 1K25A 3UB8A 3QP8A 4BD1A 1IFQA 1I5QA 3IBRA 3EQVA 3G2ZA 3NHQA 5DF8A 2W3GA 1N9OA 1D7EA 2P08A 3MSHA 4OLGA 5HARA 5J7EA 4LRXC 4OLDA 4HNBA 3GTCA 4D2OA 4OVDA 4L9FA 1GSVA 1MXOA 1TD5A 2WKIA 3ZNTA 4GCZA 4R38A 4IVKA 5EPHA 1XJ2A 3BLMA 4EV4A 4LENA 5FATA 3EEAA 2PR5A 2Y2KA 4WL9A 3NOTC 4ZJ1A 3VP1A 2XFTA 2V1ZA 4WEKA 1GA0A 3L9KA 3D72A 3KSIA 1N9BA 2E8IA 3LR5A 3JYIA 4QY5A 1BLPA 3MKEA 4HHDA 3N8RA 4NXEA 4S2NC 1PZOA 3IH8A 1AXBA 2Z2LB 3MR0A 4RX3A 5FAPA 1HVBA 5CEDA 4OPQA 5TR7A 1T19A 3MXRA 3NI9A 4EBPA 1TVFA 3CHWP 5F82A 3HUNA 4C75A 2GX5A 3C8CA 1N9NA 3IXHA 4S2LA 4YFMA 5EOEA 1OTEA 1NRFA 5A90A 1GCEA 2PBDP 1KOUA 3BYDA 4K08A 1VM1A 2V1AA 1LL8A 3OC2A 5CRFA 5G18A 4HP4A 5AQ7A 1VQQA 1K56A 1S4SA 5FQ9A 3W4OA 3A0VA 2PHYA 4Y2FA 5A91A 3IH9A 1L2SA 1T1BA 5CTNA 3LUQA 3BFDA 4HY8A 3NBLA 4RVAA 3BWLA 1EW0A 2ZQCA 3C2WA 3ZG5A 5IS1A 1F9IA 5HL1A 3ZG9B 3A3JA 2VZWA 3NIAA 5IT5A 4DE3A 1JVJA 4EU0A 1S4RA 1F98A 3A3DA 3H82A 2QMIA 5HPIA 5CERA 1PFLA 3BY8A 1K55A 1XFQA 5HX9A 3G35A 1PRQA 3LY3A 1JWVA 3O3VA 1OTBA 1NJ4A 2ZL1A 2NUTC 2D02A 1MKMA 2A49A 4QY6A 1YLTA 3HVFA 1T1CA 1S1ZA 1BLHA 1Q2QA 2MJ6A 3OLOA 4PM9A 3PAEA 3CUEC 4XT2A 5DFXA 5F83A 1P9RA 2WYXA 3E4QA 4F3LA 2FFYA 3LIBA 2XSSA 1FCOA 2V1BA 3S22A 5GHZA 3T1RA 3LGOA 5EVIA 1K38A 4GB7A 4ZDXA 3T4KA 1OJ5A 1S6RA 2IWDA 4KQRA 4E3NA 4G3VA 1NYYA 2WGVA 3H7WB 4HBTA 4OH0A 5HWWA 4LCMA 2J3WA 3T1QB 3P7NA 5DJUA 3WS4A 1XKZA 2XA7S 3ZG0A 5AQAA 5L10A 4QWOA 4EW7A 1LL5A 3KSFA 4L9EA 5EVEA 2WAEA 1VB6A 5EFWA 3HLCA 4JGQA 5IU1A 2ZC4B 4I3JA 3UMDA 2Y2HA 4A5RA 4MLLA 2OV5A 4S2JA 2VV8A 1WYCA 3T1XA 5HW3A 5FASA 2V20A 1XFNA 2KLIA 2L0WA 3KYQA 4PM5A 3Q07A 4G3WA 4ZAMA 2EXBA 2VV6A 5HDDA 3HLFA 5EVLA 2PYPA 1TDLA 2QHKA 3LEQA 4UQIS 3ZYTA 3CAXA 2ZQAA 4L0LA 4PAUA 3IXBA 2WUQA 4R4RA 3F1OA 4DXBA 2L1MA 2ZOHA 5CGSA 5EVIC 1TDGA 2HP9A 1BLSA 3SH8A 3OOVA 2Y2NA 3T4SA 1GHIA 1BSGA 2WZXA 3M6HA 1H0MA 1H8ZA 1OMEA 3FKWA 5EM1A 2R9XA 4P85A 4KG5A 4N9KA 2O9AA 3T12B 3EGXC 3Q1FA 2XRNA 1STZA 3TE8A 4GOGA 4LV0A 3UDIA 2EWVA 4WYYA 1OTAA 3PBRA 3UB5P 5KMWA 3ZCZA 1J3WA 1YLJA 5HFOA 3LCEA 4S2MA 1ONGA 4N1XA 2A24B 2KDKA 1LI0A 1EI5A 3N8SA 3S7QA 3UB7A 3VMAA 3N6IA 1CK3A 1W8YA 2Y59A 4WZ4A 3MQOA 4L9GA 2W0NA 4HI4A 3BQ8A 3OPHA 3WS1A 2QZ6A 4BBVA 2JKRI 3A3IA 1YLYA 1G6OA 4X56A 2W27A 3ITBA 1OPXA 3IS2A 3VFHA 2OOLA 1D06A 3VP3A 4UEYA 4ID4A 3O88A 3SS4A 5HWVA 4EEUA 1BT5A 3Q7ZA 1MY8A 2JKFA 2A24A 4CLCC 2H28A 4HJ3A
chains in the Genus database with same CATH topology
5J4EA 2DMWA 2CMNA 2EA9A 2WKQA 3LR0A 4P6ZM 3GDIA 4WEJA 2G7UA 5KIZA 3K2NA 3VE4A 3UB8A 2W1TA 3MMHA 3JVVA 2INWA 4CQHA 1G28A 5KSHA 1IFQA 3IBJA 3VE3A 3IBRA 4XT2B 3PHYA 3EQVA 2VV7A 3MF0A 4YWZA 3MJQA 3OCLA 2V0UA 3BQAA 3NHQA 5F6AA 4FOFA 2W3GA 4F3LB 1N9OA 1S66L 1D7EA 4LRZE 3LIEA 2P08A 5HD3A 2Z6DA 5J7EA 4EQ1A 1LSWA 4LRXC 2QKPA 5FL3A 4HNBA 1Y28A 3MXQA 4P6ZS 4KQDA 5CX7A 2PYRA 2OWHA 3LI8A 2ZMVA 4L9FA 1GSVA 2VKSA 1TD5A 1NLYA 2W3EA 4GCZA 4WF0A 1DP6A 3PBNA 4PHTA 4R38A 1XJ2A 3CLOA 4GJ4A 3EEAA 2GJ3A 1P0ZA 2PR5A 2HGVA 3CWFA 4WL9A 3NOTC 3KX0X 4RQ9A 3BY9A 3LI9A 4LLOB 3LIDA 2HJ9C 2EWWA 2JKTM 4KUKA 3VV4A 4MMNA 4WLAA 1NWZA 4ARZB 1W63Q 1YAXA 4E04A 4WEKA 2JKRM 2HV1A 4WELA 4M4XA 3D72A 5F69A 1ODVA 3KSIA 4KUOA 1P97A 2R78A 3GECA 5I5LA 4GHIA 3LR5A 4BBUA 3OBFA 4HOIA 1LSXA 4I3IA 1YKDA 4HP9A 3E4PA 4OOLA 3P01A 4HHDA 4NXEA 4Z1WA 3PYPA 5HDCA 2QJ7A 2O9CA 3MR0A 1BYWA 4DMZA 4IHQA 3E98A 1XJ3A 1V9YA 3ULFA 3S7NA 1T19A 3LIFA 3R7WB 4B93A 4OOMA 2GX5A 3C8CA 1N9NA 4II7A 5F68A 1OTEA 3FC7A 1T18A 5HDSA 2VLGA 3T4QA 5HPFA 3F1NB 3MQ0A 1KOUA 4K08A 4NKPA 2W3HA 4I38A 2V1AA 1LL8A 3OC2A 3BJNA 3F1OB 2LB9A 4HP4A 3T4OA 3E4OA 2ZOIA 1S4SA 1UWPX 2QYBA 3A0VA 2PHYA 4Y2FA 3DBAA 4EEPA 3CITA 2QWSA 1T1BA 4HH2A 3LUQA 4ETXA 2KX6A 2PR6A 2Y8HA 3EQUA 4HY8A 5C5KA 3BWLA 1EW0A 4ZRRA 3C2WA 4CLCB 2O99A 4Y3IA 1F9IA 2A2LA 3LR4A 5IS1A 1OT9A 2VZWA 3EWKA 2FZ0A 3BW6A 4G3KA 4BWIA 2B02A 4CLCD 5IT5A 3S7PA 1F5MA 5AVFA 5HL6A 4EU0A 1DP9A 4QPRA 1S4RA 3C30A 1LSVA 1F98A 2W1RA 4JGPA 3R7WA 1OT6A 3H82A 2VEAA 5HPIA 4EXOA 3PBTA 4I39A 3BY8A 5TBMB 2O0YA 1XFQA 2VA0A 3OCNA 4I5SA 4PKYG 4PKYA 4HH3A 3T4LA 5HSQA 3B33A 2PT7A 1H8MA 2YKFA 1OTBA 3UE6A 4AFIA 4EERA 4MDZA 2NUTC 3MFXA 2P7JA 2M7UA 2D02A 1TF1A 2V0WA 1MKMA 4GW9A 3RFBA 5K5BA 5F5YA 4O0PA 1MC0A 4EETB 1T1CA 3F1PB 1S1ZA 3UB6A 3EOIA 1DP8A 2MJ6A 3OLOA 4CLCA 2ZBBA 3TJZC 2PD7A 4EESA 5AJGA 4R3AA 4LRYC 3CUEC 4XT2A 3H9WA 1TS8A 2Y79A 2XA7M 5DFXA 3KO6A 1P9RA 4IUKA 3E4QA 3IS2B 3LR3A 3LIBA 5G4YA 5HD5A 4F3LA 1WA9A 5DF9A 2XSSA 2V1BA 3A0SA 4B9OA 4LPZA 4YOFA 5TBMA 4NXFA 3S7OA 3ICYA 5J3WA 2PD8A 2VGLM 3T4KA 4BMWA 4MN7A 1OJ5A 4G3VA 5AVEA 1OTDA 1NLZA 3H7WB 2P04A 5HWWA 3MQQA 1N9LA 2J3WA 3P7NA 5DJUA 4DJ2A 1S67L 2XA7S 4WUJA 3A0RA 3F1PA 3KSHA 2JN7A 4BJPA 4O01A 2W3DA 4GS9B 1TS0A 3T50A 4DJ3A 4EW7A 1DRMA 3UE3A 3KSFA 4ARZA 4L9EA 1ZTUA 2L4RA 2VGLS 1VB6A 3HJIA 4MN6A 5EFWA 4UQIM 4JGQA 4GLQA 2K7SA 5IU1A 4NEED 3SW1A 4I3JA 3K3CA 3UMDA 2YKHA 2HJEA 1YSQA 2VV8A 3KSGA 2VX8A 1NRJA 3KYZA 1XFNA 2KLIA 3CI6A 2L0WA 3KYQA 2M1CA 3EGDC 3B42A 2B18A 4G3WA 1VHMA 2VV6A 5HDDA 2PYPA 4Y5FA 1TS7A 2LB5A 2QHKA 4UQIS 3PXPA 3ZYTA 3CAXA 4ETZA 4EUVA 1YSPA 4WN5A 4L0LA 4PAUA 4GS9A 3F1NA 2OAQ1 2KOIA 3F1OA 3EEHA 2OWJA 5DKKA 2L1MA 2K31A 2ZOHA 1OTIA 4R6LA 2J3TC 1ZHHB 1UGUA 4GHIB 2W3FA 2J80A 1XJ6A 1UWNX 3HCYA 3LYXA 3OOVA 3UMEA 4MN5A 3T4SA 5HWTA 2I9VA 3C38A 3G6OA 4KQOA 3ZQ5A 2VJWA 3RTYA 4HJ6A 2M7VA 2J3TD 4IUHA 3R4KA 2OAP1 3T4JA 1IOUA 4IJGA 2WKRA 4FSFA 3HJKA 1GSXA 5LBRA 1XJ4A 2JHEA 3FG8A 3B47A 2O9AA 5A8BA 1T1AA 3NOUC 5DFYA 3EGXC 2HF6A 2XRNA 3O5YA 4HIAA 4MCWA 1STZA 3TE8A 1JNUA 4NXGA 2EWVA 5L8MA 4O8GA 2IA2A 1OJGA 1OTAA 3LIAA 3PBOA 3PBRA 4HJ4A 2V9AA 3K3DA 4H6JB 1W63M 4JGOA 2O9BA 2WKPA 4YNRA 2Z6CA 3NJAA 4JGRA 3TW8A 4Q0IA 2K2NA 2A24B 4CLCE 2KDKA 3FPWA 3S7QA 4NXBA 1P9WA 4R70A 3UB7A 2GZAA 1S1YA 4ME4A 4DN0A 3U2AA 3PBSA 1TS6A 4I3AA 5G4ZA 1H3QA 2D01A 3TRCA 3PR6A 3LFVA 2W1TB 3MQOA 2FH5A 1V9ZA 4L9GA 2W0NA 4HI4A 3BQ8A 2JKTI 3NOPC 5HZHA 5DJTA 4HQAA 3D3OA 2XROA 1LT0A 2ZMFA 4BBVA 2JKRI 3T4TA 1G6OA 2GNXA 3FPVA 5MC7A 1MZUA 2W27A 2BASA 1OPXA 2PDRA 3H82B 3IS2A 3W2ZA 5TJJA 2OOLA 3PBQA 3E0YA 3LICA 3CUEA 3JVUA 3VOLA 2NUPC 3V67A 1D06A 3RH8B 4BBTA 4UEYA 4Q0JA 4H6JA 4Q0HA 3UB9A 5HWVA 4EEUA 1X0OA 2QJ5A 3H7WA 2A24A 1GSWA 4CLCC 2H28A 4HJ3A 5DKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJ6 A; 
#chains in the Genus database with same CATH topology
 5J4E A;  3LR0 A;  1IYQ A;  2B5R A;  3K2N A;  4DRT A;  2INW A;  4KZ9 A;  1XGJ A;  4S2K A;  2J7V A;  5FAO A;  4OON A;  3MF0 A;  1D1J A;  4YWZ A;  3VSK A;  2V0U A;  3BQA A;  3C4P A;  5F6A A;  1ES3 A;  4R1G A;  3NDE A;  1ALQ A;  5JYO A;  4OP8 A;  2Q0O A;  2XEP A;  2HP6 A;  4KQD A;  1KDW A;  2PYR A;  2ZMV A;  1M40 A;  1NLY A;  2W3E A;  2Y2J A;  4ZJ2 A;  1FR1 A;  1VET B;  3CLO A;  1ERO A;  1G6A A;  1PI5 A;  4R3B A;  4JXV A;  3ZVW A;  3MS6 A;  3BY9 A;  3LID A;  1ERQ A;  4WLA A;  4ARZ B;  2JKR M;  4GDB A;  4M4X A;  3W4P A;  5GHX A;  1K4F A;  1P97 A;  4GHI A;  1Z6F A;  2UV0 E;  2ZQD A;  4BBU A;  3E4P A;  4KZ8 A;  4WBG A;  5CGX A;  2ZQ8 A;  4OPY A;  4OQG A;  4Z1W A;  5HDC A;  5GLB A;  2XGN A;  2QJ7 A;  4DMZ A;  4IHQ A;  1V9Y A;  3ULF A;  4KZ5 A;  3S7N A;  1VET A;  1RGZ A;  4ZJ3 A;  3R7W B;  4B93 A;  1SKO B;  4OOM A;  1U60 A;  3U4L P;  4D60 A;  3G2Y A;  5M19 A;  3UPN A;  4NKP A;  4BQM A;  4KZ7 A;  4OKP A;  4GN2 A;  3GVB A;  4P87 A;  1MWR A;  3HLE A;  2JBF A;  5JYP A;  4ETX A;  2KX6 A;  2PR6 A;  3EQU A;  1FSY A;  2PAV P;  5KZH A;  1S0W A;  3V5M A;  3P09 A;  1H5X A;  2O99 A;  3D4F A;  1OT9 A;  4BWI A;  5HL6 A;  4N9L A;  1DP9 A;  4QPR A;  5EE8 A;  3IX4 A;  3AGE A;  1PZP A;  2W1R A;  2H10 A;  3R7W A;  1G5U A;  3QNC A;  4GKU A;  3PBT A;  3CZD A;  3Q7V B;  2V2F F;  5TBM B;  5EOO A;  4PKY G;  4HH3 A;  1K4E A;  3A3E A;  3T4L A;  2WAD A;  2YKF A;  1A0K A;  2PU4 A;  4AFI A;  2M7U A;  3MFX A;  5F5Y A;  3W4Q A;  3VOZ A;  1MC0 A;  4EET B;  5FDS A;  5E2E A;  3G34 A;  2PRF A;  3EOI A;  1DP8 A;  2WKE A;  2PD7 A;  3PTE A;  2ZD8 A;  5AJG A;  4WZ5 C;  4LRY C;  2Y2G A;  4X55 A;  1TS8 A;  5FA7 A;  2Y79 A;  3FV7 A;  2XA7 M;  2ZQ7 A;  2E8J A;  3KO6 A;  4IUK A;  4OQI A;  1WA9 A;  1YLZ A;  5E2H A;  4WM9 A;  3A0S A;  2HDS A;  4YOF A;  4NG2 A;  5TBM A;  5AQ9 A;  5E2F A;  2V8F A;  2Y2Q A;  3MQQ A;  1W79 A;  1L0D A;  4WUJ A;  3G32 A;  4BJP A;  4GS9 B;  1TS0 A;  3T50 A;  3SH7 A;  4U0X A;  4HBU A;  3UE3 A;  1LL9 A;  3CPT B;  3CJM A;  4XXR A;  5TFQ A;  5FEF A;  1ZTU A;  3DW0 A;  5L07 A;  2VGL S;  1XA7 A;  3HJI A;  4MN6 A;  4UQI M;  4FH2 A;  2K7S A;  4S2P A;  2OSU A;  3K3C A;  2HDQ A;  1PNE A;  1K0K A;  2ZC3 B;  5FQM A;  5A93 A;  4E3O A;  4JXS A;  4K0X A;  5FSR A;  2DNS A;  1NRJ A;  3V3R A;  3EGD C;  4E6X A;  1FCM A;  3LY4 A;  3O86 A;  4GD8 A;  2ZM8 A;  1DJA A;  1TS7 A;  3PXP A;  1FCN A;  1YSP A;  1K54 A;  4GS9 A;  2OAQ 1;  4DXC A;  1WE4 A;  3EEH A;  5DVA A;  1NY0 A;  2OWJ A;  5DKK A;  2WGI A;  1O7E A;  2G2W A;  4K0W A;  4UAA A;  1UGU A;  2ZLY A;  1H8Y A;  1XJ6 A;  1UWN X;  3HCY A;  3LYX A;  1L0G A;  3UME A;  2ZC7 A;  1ZG4 A;  3DTE A;  5HWT A;  5I94 A;  2I9V A;  2HPB A;  4WMC A;  4U3T A;  3JPU A;  3ZQ5 A;  3SS5 A;  1I2W A;  2J8Y A;  2OAP 1;  1IOU A;  4FSF A;  3HJK A;  1GSX A;  3MZF A;  3B47 A;  3BEB A;  1T1A A;  3NOU C;  5M18 A;  2HF6 A;  3VP4 A;  1M6K A;  1HZO A;  4KZB A;  3NC8 A;  4EQI A;  2IA2 A;  3LIA A;  4JGO A;  1W63 M;  2Y2M A;  2BG1 A;  2O9B A;  3WWX A;  4KZ6 A;  1LLB A;  5KSC A;  2Z6C A;  3NJA A;  3N8L A;  1K56 D;  4CLC E;  4EWF A;  3BFG A;  3FPW A;  1SKF A;  1NZU A;  5DF7 A;  2GZA A;  4ME4 A;  1KGG A;  1FOF A;  1PWD A;  4GZB A;  5BOH A;  5EV0 A;  1H3Q A;  3SH9 A;  3PR6 A;  2DCF A;  3LFV A;  1IKG A;  1NYM A;  5DTT A;  2VK3 A;  1CEF A;  4Y0T A;  1LT0 A;  1K54 C;  1K55 C;  2GNX A;  2H0T A;  2ZM2 A;  1ES4 A;  4R4S A;  5GLD A;  2PDR A;  2ZJ9 A;  3C7V A;  3E0Y A;  3LIC A;  1KVL A;  2X71 A;  2NUP C;  2XK1 A;  4Q0H A;  2JE5 A;  2Y2I A;  1X0O A;  1XX2 A;  4DE1 A;  2QJ5 A;  3H7W A;  1O07 A;  1WYB A;  4MBK A;  1YLP A;  2EA9 A;  3QNB A;  1JWZ A;  5CHJ A;  2G7U A;  5KIZ A;  2Y91 A;  5CEB A;  2EFX A;  2C6W B;  1E3U D;  5F1F A;  1G28 A;  3IF6 B;  2ZM0 A;  3IBJ A;  2H0Y A;  2UWX A;  2VV7 A;  3MJQ A;  3OCL A;  4LRZ E;  3LIE A;  3WRT A;  1MBL A;  1YM1 A;  4EQ1 A;  1DJB A;  4CJN A;  3S4X A;  4JPM A;  2BTF P;  3DTI A;  4DE2 A;  5CX7 A;  2OWH A;  3LI8 A;  5EVI D;  3HBR A;  3SOI A;  3DWK A;  4X25 A;  4WF0 A;  1DP6 A;  3PBN A;  4DE0 A;  2ZMA A;  1YT4 A;  1PW1 A;  4GJ4 A;  1K57 A;  1P0Z A;  3CWF A;  4X68 A;  3KX0 X;  4RQ9 A;  4LLO B;  1GHM A;  1BTL A;  1XA1 A;  2HJ9 C;  1PW8 A;  4E04 A;  1YAX A;  3IF6 A;  1RCJ A;  3IX3 A;  3MZE A;  5EM0 A;  4KUO A;  5FQK A;  3GEC A;  5EUA A;  3UN7 A;  5I5L A;  4I3I A;  4HOI A;  4UA9 A;  1CI8 A;  1YKD A;  4HP9 A;  2XR0 A;  2ZQ9 A;  4OOL A;  3P01 A;  5DTS A;  2RL3 A;  1KVM A;  2XLN A;  2O9C A;  4LFU A;  1BYW A;  4LV2 A;  3E98 A;  1XJ3 A;  1LHY A;  1L0E A;  3IHA A;  3M6B A;  3LIF A;  4JKT A;  3N4I A;  3D9Y A;  4II7 A;  2VLG A;  3T4Q A;  4N1H A;  5HPF A;  2A3U A;  3F1N B;  4LCL A;  2W3H A;  4I38 A;  3BJN A;  1GHP A;  3T4O A;  2OLV A;  2ZOI A;  2Q9N A;  2QYB A;  3IHB A;  2WAF A;  3DBA A;  4EEP A;  4HH2 A;  3DWZ A;  1G68 A;  2XQZ A;  1PWC A;  5IHV A;  3IT9 A;  5DTK A;  3UPO A;  1K57 C;  3GMW A;  4Y3I A;  2A2L A;  4GNU A;  3LR4 A;  3EWK A;  2FZ0 A;  4CLC D;  2B02 A;  5FEG A;  1F5M A;  3C30 A;  3QP1 A;  1LSV A;  1XXM A;  3T1S A;  2VEA A;  1TEM A;  3C4O A;  1J9M A;  3M2K A;  2O0Y A;  3L7H A;  3OCN A;  1NZO A;  4I5S A;  4JXW A;  5HSQ A;  3B33 A;  1H8M A;  4LV1 A;  1L3L A;  4JBF A;  4EER A;  2P7J A;  4E3M A;  1TF1 A;  4EBL A;  4Y13 A;  4O0P A;  3OPR A;  4BL2 A;  3F1P B;  1KDS A;  2QPN A;  3UB6 A;  1E25 A;  2ZBB A;  4Y0O A;  4GD6 A;  3G30 A;  3WS5 A;  4HES A;  4UA6 A;  3ZG7 B;  3I7J A;  1ESI A;  3LR3 A;  5G4Y A;  1IYP A;  2R9W A;  4B9O A;  1VEU B;  3S7O A;  3GQZ A;  4R0Q A;  3ICY A;  4X6T A;  2VGL M;  3ISG A;  4BMW A;  4MN7 A;  5AVE A;  4IBR A;  1OTD A;  2XD1 A;  3HLG A;  1YQS A;  4OPZ A;  2P04 A;  2GDN A;  1N9L A;  4MBH A;  4S2O A;  3O87 A;  3VP0 A;  3GSG A;  1KE3 A;  1FIL A;  4DJ2 A;  1S67 L;  1GA9 A;  3F1P A;  4FH4 A;  2P9V B;  2JN7 A;  2P74 A;  1IYO A;  2W3D A;  4DJ3 A;  4UA7 A;  2JCH A;  4ARZ A;  1ZC2 A;  4N92 A;  4JF5 A;  1NXY A;  4S2I A;  5CHM A;  4X69 A;  2Y2P A;  4CPK A;  1JTG A;  1PYY A;  4PM7 A;  3FZC A;  4GLQ A;  3SW1 A;  2ZC5 B;  2HJE A;  3GRJ A;  1YSQ A;  5CEC A;  1CI9 A;  1SZV A;  3P98 A;  4ZBE A;  2VX8 A;  3VOY A;  1HTZ A;  3CI6 A;  5HAI A;  2M1C A;  2XF3 A;  3B42 A;  2B18 A;  4S2N A;  4X53 A;  4PMA A;  2AVX A;  1SKO A;  2LB5 A;  4IED A;  2P9V A;  4ETZ A;  4EUV A;  4WN5 A;  1KE4 A;  2J9O A;  3UPP A;  5FQI A;  4JLF A;  2K31 A;  4R6L A;  2J3T C;  3IF5 A;  2W3F A;  2HDU A;  2WZZ A;  3DAV A;  3C5A A;  2I72 A;  3WRZ A;  4E3J A;  4BD0 A;  1SDE A;  1Y4O A;  3G6O A;  4BEN A;  4KQO A;  4MBF A;  3RTY A;  4HJ6 A;  4KZ4 A;  2J3T D;  1K6S A;  5FDH A;  4RYE A;  2WKR A;  1XJ4 A;  5L09 A;  4BLM A;  3FG8 A;  5A8B A;  5CHU A;  2C5W B;  3V50 A;  2PU2 A;  3O5Y A;  4HIA A;  4MCW A;  3S1Y A;  3BFF A;  1JNU A;  4KG6 A;  4NXG A;  5L8M A;  4PM8 A;  3Q7V A;  1CQA A;  4HJ4 A;  2V9A A;  3K3D A;  3NY4 A;  2WKP A;  3BM6 A;  4YNR A;  4JGR A;  3TW8 A;  1ESU A;  3UDF A;  1BUE A;  5HAP A;  2K2N A;  3IXD A;  5GLA A;  3BLS A;  4X1L A;  3QHY A;  4NXB A;  1P9W A;  4FUW A;  4DN0 A;  5EEC A;  3U2A A;  3PBS A;  3MKF A;  1QMF A;  1XPB A;  2W1T B;  2FH5 A;  5HZH A;  2JKT I;  3LEZ A;  5DJT A;  1XP4 A;  4HQA A;  2XRO A;  5FI7 A;  5J8X A;  2ZMF A;  2V8C A;  5GL9 A;  1IEM A;  3VSL A;  1IEL A;  5MC7 A;  2EX8 A;  3Q82 A;  2BAS A;  1KE0 A;  3H82 B;  1F2K A;  5TJJ A;  3SZT A;  3PBQ A;  5TGF A;  4P6B A;  3SS3 A;  3CUE A;  3JVU A;  4DDY A;  1CJF A;  3RH8 B;  4BBT A;  4Q0J A;  1RGY A;  4OP5 A;  4UHU A;  1ES5 A;  3QP5 A;  5FI2 A;  4Y17 A;  3VP2 A;  2J9P A;  2ZL1 B;  1GSW A;  5E43 A;  4M3K A;  3TG9 A;  2XD5 A;  5DKL A;  5AQB A;  3GDI A;  3Q81 A;  4PM6 A;  3PAG A;  1KGE A;  3CG5 A;  2W1T A;  3MMH A;  3ZHH A;  3JVV A;  4CQH A;  5FI6 A;  3CPT A;  3IWI A;  5KSH A;  3DTM A;  4R3J A;  3VE3 A;  1DJC A;  4XT2 B;  3PHY A;  3BFE A;  4FD8 A;  4FOF A;  4F3L B;  1S66 L;  4Y15 A;  2XDM A;  5HD3 A;  2Z6D A;  1HLU P;  3OPP A;  1LSW A;  1YPR A;  2QKP A;  5FL3 A;  1BUL A;  5EVI B;  1Y28 A;  3MXQ A;  4P6Z S;  4X1M A;  1QME A;  3AGF A;  2VKS A;  3KYE A;  1PIO A;  4PHT A;  2GJ3 A;  3TOI A;  2HGV A;  1E3U A;  1W7F A;  3LI9 A;  3ZFZ A;  2EWW A;  2JKT M;  3IX8 A;  4KUK A;  3VV4 A;  4MMN A;  1NWZ A;  3HLD A;  1W63 Q;  2XFS A;  3HLB A;  2RCX A;  2HV1 A;  3ZVT A;  4WEL A;  5F69 A;  1ODV A;  2R78 A;  1I2S A;  3OBF A;  1LSX A;  4B88 A;  1MWT A;  3ZGA B;  3B3X A;  2Y4A A;  4MEZ A;  3PYP A;  3QP4 A;  2IWC A;  2ACG A;  4JF4 A;  2DRW A;  4DF6 A;  3NEC A;  2XH9 A;  2X01 A;  3BRM A;  3N7W A;  1ACF A;  1ZKJ A;  3GR2 A;  5F68 A;  5HDS A;  3FC7 A;  1T18 A;  3IQA A;  3MQ0 A;  3DTK A;  2Q9M A;  2HZ5 A;  3F1O B;  4LV3 A;  2LB9 A;  4K91 A;  4QJG A;  2Z2M B;  3E4O A;  3ZDJ A;  1UWP X;  3UDX A;  3CIT A;  2QWS A;  1W8Q A;  3GV9 A;  1JWP A;  1FR6 A;  2Y8H A;  4HEF A;  2JC7 A;  3IWQ A;  5C5K A;  5A92 A;  1SHV A;  3NCK A;  5CTM A;  4WMC D;  4ZRR A;  2IWB A;  4CLC B;  4R23 A;  5U47 A;  2JKG A;  3BW6 A;  4G3K A;  3FWL A;  3S7P A;  4C6Y A;  1C3B A;  5AVF A;  3BFC A;  4QHC A;  4XUX A;  1MWS A;  1DY6 A;  4JF6 A;  4JGP A;  3RXX A;  4FTX A;  1OT6 A;  3M2J A;  4EXO A;  4I39 A;  1ES2 A;  3BEC A;  2VA0 A;  2FFF B;  4PKY A;  4QD4 A;  1LI9 A;  5L2F A;  4JXG A;  2PT7 A;  1BLC A;  2HP5 A;  3UE6 A;  4IBX A;  1FIK A;  4F94 A;  4MDZ A;  2V0W A;  4GW9 A;  3RFB A;  5K5B A;  2EFU A;  1L0F A;  1CF0 A;  5FAQ A;  5GLC A;  5CXW A;  5FQJ A;  2HDR A;  4CLC A;  3TJZ C;  3V39 A;  2BLS A;  2ZC6 B;  5CGW A;  4EES A;  3CMZ A;  4R3A A;  4EBN A;  3HLW A;  3TSG A;  3FYZ A;  3E2L A;  3H9W A;  1BZA A;  4E6W A;  2H5S A;  3IS2 B;  5HD5 A;  5GHY A;  3HRE A;  5DF9 A;  3VFF A;  4LPZ A;  4NXF A;  3C7U A;  4RA7 A;  1ZG6 A;  1YMX A;  5J3W A;  2PD8 A;  4DDS A;  1SCW A;  4MNR A;  2EXA A;  4OPR A;  1PWG A;  4PPR A;  3V3S A;  1AWI A;  1NLZ A;  5F1G A;  3WS0 A;  5M1A A;  4BL3 A;  3A0R A;  3G4P A;  4E3K A;  3KSH A;  1HD8 A;  4O01 A;  2EX6 A;  4EUZ A;  1DRM A;  2L4R A;  3MBZ A;  3G31 A;  4NEE D;  4P0M A;  3RXW A;  2VGK A;  3ZG8 B;  2Y2L A;  2YKH A;  3WS2 A;  3UY6 A;  3KSG A;  3A3F A;  3ZNY A;  3KYZ A;  3UNW A;  2EX9 A;  3QP2 A;  3NUL A;  2Y2O A;  1N4O A;  4E3L A;  4ZTK A;  1VHM A;  1EWZ A;  3HUM A;  3IF6 C;  2WK0 A;  4Y5F A;  5FQQ A;  1FSW A;  1XGI A;  3F1N A;  4KEN B;  1PI4 A;  3QP6 A;  2KOI A;  4KG2 A;  3OPL A;  1JTD A;  1OTI A;  1ZHH B;  4GHI B;  2J80 A;  4KQQ A;  3OZH A;  4MN5 A;  3AGD A;  3MFD A;  3C38 A;  3LO7 A;  2WGW B;  1ONH A;  2VGJ A;  3NDG A;  5E2G A;  2VJW A;  1YMS A;  2M7V A;  4IUH A;  1K6R A;  1W5D A;  3R4K A;  3T4J A;  4IJG A;  5LBR A;  2X02 A;  2Y55 A;  2JHE A;  4LGW A;  4U0T A;  5DFY A;  1MKI A;  3MZD A;  3ITA A;  3HL9 A;  1E4D A;  4O8G A;  3E2K A;  4Z9Q A;  1OJG A;  3PBO A;  4QB8 A;  3IXG A;  4OQ0 A;  4OQH A;  4H6J B;  5D3O A;  4IVI A;  2G2U A;  4XUZ A;  4GDN A;  4Y0U A;  1YLW A;  1RP5 A;  4O7D A;  3UO9 A;  4Q0I A;  4NET A;  1Y54 A;  2EX2 A;  4YIN A;  4KZA A;  1Z09 A;  3W8K A;  4R70 A;  1S1Y A;  2WGW A;  1SDN A;  4OOY A;  1TS6 A;  4FCF A;  4I3A A;  5G4Z A;  2D01 A;  4B4X A;  3UE1 A;  3TRC A;  1IKI A;  2B95 A;  1V9Z A;  3FKV A;  3NOP C;  1MPL A;  1CEG A;  3D3O A;  2CC1 A;  3T4T A;  4Y7P A;  4C3Q A;  1ERM A;  1FQG A;  1MWU A;  3FPV A;  3IWO A;  1MZU A;  1Q2P A;  4Q8I A;  2PBY A;  1IYS A;  4ESP A;  3MXS A;  3W2Z A;  4WZ5 A;  4NK3 A;  2WKH A;  4QU3 A;  3VOL A;  3V67 A;  1VEU A;  3HUO A;  1KGF A;  4H8R A;  4RX2 A;  4H6J A;  3UE0 A;  3UB9 A;  4KZ3 A;  4E3I A;  3RJU A;  2OLU A;  4DKI A;  4B4Z A;  5HAQ A;  2DMW A;  2CMN A;  2WKQ A;  4P6Z M;  4WEJ A;  3VE4 A;  1K25 A;  3UB8 A;  3QP8 A;  4BD1 A;  1IFQ A;  1I5Q A;  3IBR A;  3EQV A;  3G2Z A;  3NHQ A;  5DF8 A;  2W3G A;  1N9O A;  1D7E A;  2P08 A;  3MSH A;  4OLG A;  5HAR A;  5J7E A;  4LRX C;  4OLD A;  4HNB A;  3GTC A;  4D2O A;  4OVD A;  4L9F A;  1GSV A;  1MXO A;  1TD5 A;  2WKI A;  3ZNT A;  4GCZ A;  4R38 A;  4IVK A;  5EPH A;  1XJ2 A;  3BLM A;  4EV4 A;  4LEN A;  5FAT A;  3EEA A;  2PR5 A;  2Y2K A;  4WL9 A;  3NOT C;  4ZJ1 A;  3VP1 A;  2XFT A;  2V1Z A;  4WEK A;  1GA0 A;  3L9K A;  3D72 A;  3KSI A;  1N9B A;  2E8I A;  3LR5 A;  3JYI A;  4QY5 A;  1BLP A;  3MKE A;  4HHD A;  3N8R A;  4NXE A;  4S2N C;  1PZO A;  3IH8 A;  1AXB A;  2Z2L B;  3MR0 A;  4RX3 A;  5FAP A;  1HVB A;  5CED A;  4OPQ A;  5TR7 A;  1T19 A;  3MXR A;  3NI9 A;  4EBP A;  1TVF A;  3CHW P;  5F82 A;  3HUN A;  4C75 A;  2GX5 A;  3C8C A;  1N9N A;  3IXH A;  4S2L A;  4YFM A;  5EOE A;  1OTE A;  1NRF A;  5A90 A;  1GCE A;  2PBD P;  1KOU A;  3BYD A;  4K08 A;  1VM1 A;  2V1A A;  1LL8 A;  3OC2 A;  5CRF A;  5G18 A;  4HP4 A;  5AQ7 A;  1VQQ A;  1K56 A;  1S4S A;  5FQ9 A;  3W4O A;  3A0V A;  2PHY A;  4Y2F A;  5A91 A;  3IH9 A;  1L2S A;  1T1B A;  5CTN A;  3LUQ A;  3BFD A;  4HY8 A;  3NBL A;  4RVA A;  3BWL A;  1EW0 A;  2ZQC A;  3C2W A;  3ZG5 A;  5IS1 A;  1F9I A;  5HL1 A;  3ZG9 B;  3A3J A;  2VZW A;  3NIA A;  5IT5 A;  4DE3 A;  1JVJ A;  4EU0 A;  1S4R A;  1F98 A;  3A3D A;  3H82 A;  2QMI A;  5HPI A;  5CER A;  1PFL A;  3BY8 A;  1K55 A;  1XFQ A;  5HX9 A;  3G35 A;  1PRQ A;  3LY3 A;  1JWV A;  3O3V A;  1OTB A;  1NJ4 A;  2ZL1 A;  2NUT C;  2D02 A;  1MKM A;  2A49 A;  4QY6 A;  1YLT A;  3HVF A;  1T1C A;  1S1Z A;  1BLH A;  1Q2Q A;  2MJ6 A;  3OLO A;  4PM9 A;  3PAE A;  3CUE C;  4XT2 A;  5DFX A;  5F83 A;  1P9R A;  2WYX A;  3E4Q A;  4F3L A;  2FFY A;  3LIB A;  2XSS A;  1FCO A;  2V1B A;  3S22 A;  5GHZ A;  3T1R A;  3LGO A;  5EVI A;  1K38 A;  4GB7 A;  4ZDX A;  3T4K A;  1OJ5 A;  1S6R A;  2IWD A;  4KQR A;  4E3N A;  4G3V A;  1NYY A;  2WGV A;  3H7W B;  4HBT A;  4OH0 A;  5HWW A;  4LCM A;  2J3W A;  3T1Q B;  3P7N A;  5DJU A;  3WS4 A;  1XKZ A;  2XA7 S;  3ZG0 A;  5AQA A;  5L10 A;  4QWO A;  4EW7 A;  1LL5 A;  3KSF A;  4L9E A;  5EVE A;  2WAE A;  1VB6 A;  5EFW A;  3HLC A;  4JGQ A;  5IU1 A;  2ZC4 B;  4I3J A;  3UMD A;  2Y2H A;  4A5R A;  4MLL A;  2OV5 A;  4S2J A;  2VV8 A;  1WYC A;  3T1X A;  5HW3 A;  5FAS A;  2V20 A;  1XFN A;  2KLI A;  2L0W A;  3KYQ A;  4PM5 A;  3Q07 A;  4G3W A;  4ZAM A;  2EXB A;  2VV6 A;  5HDD A;  3HLF A;  5EVL A;  2PYP A;  1TDL A;  2QHK A;  3LEQ A;  4UQI S;  3ZYT A;  3CAX A;  2ZQA A;  4L0L A;  4PAU A;  3IXB A;  2WUQ A;  4R4R A;  3F1O A;  4DXB A;  2L1M A;  2ZOH A;  5CGS A;  5EVI C;  1TDG A;  2HP9 A;  1BLS A;  3SH8 A;  3OOV A;  2Y2N A;  3T4S A;  1GHI A;  1BSG A;  2WZX A;  3M6H A;  1H0M A;  1H8Z A;  1OME A;  3FKW A;  5EM1 A;  2R9X A;  4P85 A;  4KG5 A;  4N9K A;  2O9A A;  3T12 B;  3EGX C;  3Q1F A;  2XRN A;  1STZ A;  3TE8 A;  4GOG A;  4LV0 A;  3UDI A;  2EWV A;  4WYY A;  1OTA A;  3PBR A;  3UB5 P;  5KMW A;  3ZCZ A;  1J3W A;  1YLJ A;  5HFO A;  3LCE A;  4S2M A;  1ONG A;  4N1X A;  2A24 B;  2KDK A;  1LI0 A;  1EI5 A;  3N8S A;  3S7Q A;  3UB7 A;  3VMA A;  3N6I A;  1CK3 A;  1W8Y A;  2Y59 A;  4WZ4 A;  3MQO A;  4L9G A;  2W0N A;  4HI4 A;  3BQ8 A;  3OPH A;  3WS1 A;  2QZ6 A;  4BBV A;  2JKR I;  3A3I A;  1YLY A;  1G6O A;  4X56 A;  2W27 A;  3ITB A;  1OPX A;  3IS2 A;  3VFH A;  2OOL A;  1D06 A;  3VP3 A;  4UEY A;  4ID4 A;  3O88 A;  3SS4 A;  5HWV A;  4EEU A;  1BT5 A;  3Q7Z A;  1MY8 A;  2JKF A;  2A24 A;  4CLC C;  2H28 A;  4HJ3 A; 
#chains in the Genus database with same CATH homology
 5J4E A;  2DMW A;  2CMN A;  2EA9 A;  2WKQ A;  3LR0 A;  4P6Z M;  3GDI A;  4WEJ A;  2G7U A;  5KIZ A;  3K2N A;  3VE4 A;  3UB8 A;  2W1T A;  3MMH A;  3JVV A;  2INW A;  4CQH A;  1G28 A;  5KSH A;  1IFQ A;  3IBJ A;  3VE3 A;  3IBR A;  4XT2 B;  3PHY A;  3EQV A;  2VV7 A;  3MF0 A;  4YWZ A;  3MJQ A;  3OCL A;  2V0U A;  3BQA A;  3NHQ A;  5F6A A;  4FOF A;  2W3G A;  4F3L B;  1N9O A;  1S66 L;  1D7E A;  4LRZ E;  3LIE A;  2P08 A;  5HD3 A;  2Z6D A;  5J7E A;  4EQ1 A;  1LSW A;  4LRX C;  2QKP A;  5FL3 A;  4HNB A;  1Y28 A;  3MXQ A;  4P6Z S;  4KQD A;  5CX7 A;  2PYR A;  2OWH A;  3LI8 A;  2ZMV A;  4L9F A;  1GSV A;  2VKS A;  1TD5 A;  1NLY A;  2W3E A;  4GCZ A;  4WF0 A;  1DP6 A;  3PBN A;  4PHT A;  4R38 A;  1XJ2 A;  3CLO A;  4GJ4 A;  3EEA A;  2GJ3 A;  1P0Z A;  2PR5 A;  2HGV A;  3CWF A;  4WL9 A;  3NOT C;  3KX0 X;  4RQ9 A;  3BY9 A;  3LI9 A;  4LLO B;  3LID A;  2HJ9 C;  2EWW A;  2JKT M;  4KUK A;  3VV4 A;  4MMN A;  4WLA A;  1NWZ A;  4ARZ B;  1W63 Q;  1YAX A;  4E04 A;  4WEK A;  2JKR M;  2HV1 A;  4WEL A;  4M4X A;  3D72 A;  5F69 A;  1ODV A;  3KSI A;  4KUO A;  1P97 A;  2R78 A;  3GEC A;  5I5L A;  4GHI A;  3LR5 A;  4BBU A;  3OBF A;  4HOI A;  1LSX A;  4I3I A;  1YKD A;  4HP9 A;  3E4P A;  4OOL A;  3P01 A;  4HHD A;  4NXE A;  4Z1W A;  3PYP A;  5HDC A;  2QJ7 A;  2O9C A;  3MR0 A;  1BYW A;  4DMZ A;  4IHQ A;  3E98 A;  1XJ3 A;  1V9Y A;  3ULF A;  3S7N A;  1T19 A;  3LIF A;  3R7W B;  4B93 A;  4OOM A;  2GX5 A;  3C8C A;  1N9N A;  4II7 A;  5F68 A;  1OTE A;  3FC7 A;  1T18 A;  5HDS A;  2VLG A;  3T4Q A;  5HPF A;  3F1N B;  3MQ0 A;  1KOU A;  4K08 A;  4NKP A;  2W3H A;  4I38 A;  2V1A A;  1LL8 A;  3OC2 A;  3BJN A;  3F1O B;  2LB9 A;  4HP4 A;  3T4O A;  3E4O A;  2ZOI A;  1S4S A;  1UWP X;  2QYB A;  3A0V A;  2PHY A;  4Y2F A;  3DBA A;  4EEP A;  3CIT A;  2QWS A;  1T1B A;  4HH2 A;  3LUQ A;  4ETX A;  2KX6 A;  2PR6 A;  2Y8H A;  3EQU A;  4HY8 A;  5C5K A;  3BWL A;  1EW0 A;  4ZRR A;  3C2W A;  4CLC B;  2O99 A;  4Y3I A;  1F9I A;  2A2L A;  3LR4 A;  5IS1 A;  1OT9 A;  2VZW A;  3EWK A;  2FZ0 A;  3BW6 A;  4G3K A;  4BWI A;  2B02 A;  4CLC D;  5IT5 A;  3S7P A;  1F5M A;  5AVF A;  5HL6 A;  4EU0 A;  1DP9 A;  4QPR A;  1S4R A;  3C30 A;  1LSV A;  1F98 A;  2W1R A;  4JGP A;  3R7W A;  1OT6 A;  3H82 A;  2VEA A;  5HPI A;  4EXO A;  3PBT A;  4I39 A;  3BY8 A;  5TBM B;  2O0Y A;  1XFQ A;  2VA0 A;  3OCN A;  4I5S A;  4PKY G;  4PKY A;  4HH3 A;  3T4L A;  5HSQ A;  3B33 A;  2PT7 A;  1H8M A;  2YKF A;  1OTB A;  3UE6 A;  4AFI A;  4EER A;  4MDZ A;  2NUT C;  3MFX A;  2P7J A;  2M7U A;  2D02 A;  1TF1 A;  2V0W A;  1MKM A;  4GW9 A;  3RFB A;  5K5B A;  5F5Y A;  4O0P A;  1MC0 A;  4EET B;  1T1C A;  3F1P B;  1S1Z A;  3UB6 A;  3EOI A;  1DP8 A;  2MJ6 A;  3OLO A;  4CLC A;  2ZBB A;  3TJZ C;  2PD7 A;  4EES A;  5AJG A;  4R3A A;  4LRY C;  3CUE C;  4XT2 A;  3H9W A;  1TS8 A;  2Y79 A;  2XA7 M;  5DFX A;  3KO6 A;  1P9R A;  4IUK A;  3E4Q A;  3IS2 B;  3LR3 A;  3LIB A;  5G4Y A;  5HD5 A;  4F3L A;  1WA9 A;  5DF9 A;  2XSS A;  2V1B A;  3A0S A;  4B9O A;  4LPZ A;  4YOF A;  5TBM A;  4NXF A;  3S7O A;  3ICY A;  5J3W A;  2PD8 A;  2VGL M;  3T4K A;  4BMW A;  4MN7 A;  1OJ5 A;  4G3V A;  5AVE A;  1OTD A;  1NLZ A;  3H7W B;  2P04 A;  5HWW A;  3MQQ A;  1N9L A;  2J3W A;  3P7N A;  5DJU A;  4DJ2 A;  1S67 L;  2XA7 S;  4WUJ A;  3A0R A;  3F1P A;  3KSH A;  2JN7 A;  4BJP A;  4O01 A;  2W3D A;  4GS9 B;  1TS0 A;  3T50 A;  4DJ3 A;  4EW7 A;  1DRM A;  3UE3 A;  3KSF A;  4ARZ A;  4L9E A;  1ZTU A;  2L4R A;  2VGL S;  1VB6 A;  3HJI A;  4MN6 A;  5EFW A;  4UQI M;  4JGQ A;  4GLQ A;  2K7S A;  5IU1 A;  4NEE D;  3SW1 A;  4I3J A;  3K3C A;  3UMD A;  2YKH A;  2HJE A;  1YSQ A;  2VV8 A;  3KSG A;  2VX8 A;  1NRJ A;  3KYZ A;  1XFN A;  2KLI A;  3CI6 A;  2L0W A;  3KYQ A;  2M1C A;  3EGD C;  3B42 A;  2B18 A;  4G3W A;  1VHM A;  2VV6 A;  5HDD A;  2PYP A;  4Y5F A;  1TS7 A;  2LB5 A;  2QHK A;  4UQI S;  3PXP A;  3ZYT A;  3CAX A;  4ETZ A;  4EUV A;  1YSP A;  4WN5 A;  4L0L A;  4PAU A;  4GS9 A;  3F1N A;  2OAQ 1;  2KOI A;  3F1O A;  3EEH A;  2OWJ A;  5DKK A;  2L1M A;  2K31 A;  2ZOH A;  1OTI A;  4R6L A;  2J3T C;  1ZHH B;  1UGU A;  4GHI B;  2W3F A;  2J80 A;  1XJ6 A;  1UWN X;  3HCY A;  3LYX A;  3OOV A;  3UME A;  4MN5 A;  3T4S A;  5HWT A;  2I9V A;  3C38 A;  3G6O A;  4KQO A;  3ZQ5 A;  2VJW A;  3RTY A;  4HJ6 A;  2M7V A;  2J3T D;  4IUH A;  3R4K A;  2OAP 1;  3T4J A;  1IOU A;  4IJG A;  2WKR A;  4FSF A;  3HJK A;  1GSX A;  5LBR A;  1XJ4 A;  2JHE A;  3FG8 A;  3B47 A;  2O9A A;  5A8B A;  1T1A A;  3NOU C;  5DFY A;  3EGX C;  2HF6 A;  2XRN A;  3O5Y A;  4HIA A;  4MCW A;  1STZ A;  3TE8 A;  1JNU A;  4NXG A;  2EWV A;  5L8M A;  4O8G A;  2IA2 A;  1OJG A;  1OTA A;  3LIA A;  3PBO A;  3PBR A;  4HJ4 A;  2V9A A;  3K3D A;  4H6J B;  1W63 M;  4JGO A;  2O9B A;  2WKP A;  4YNR A;  2Z6C A;  3NJA A;  4JGR A;  3TW8 A;  4Q0I A;  2K2N A;  2A24 B;  4CLC E;  2KDK A;  3FPW A;  3S7Q A;  4NXB A;  1P9W A;  4R70 A;  3UB7 A;  2GZA A;  1S1Y A;  4ME4 A;  4DN0 A;  3U2A A;  3PBS A;  1TS6 A;  4I3A A;  5G4Z A;  1H3Q A;  2D01 A;  3TRC A;  3PR6 A;  3LFV A;  2W1T B;  3MQO A;  2FH5 A;  1V9Z A;  4L9G A;  2W0N A;  4HI4 A;  3BQ8 A;  2JKT I;  3NOP C;  5HZH A;  5DJT A;  4HQA A;  3D3O A;  2XRO A;  1LT0 A;  2ZMF A;  4BBV A;  2JKR I;  3T4T A;  1G6O A;  2GNX A;  3FPV A;  5MC7 A;  1MZU A;  2W27 A;  2BAS A;  1OPX A;  2PDR A;  3H82 B;  3IS2 A;  3W2Z A;  5TJJ A;  2OOL A;  3PBQ A;  3E0Y A;  3LIC A;  3CUE A;  3JVU A;  3VOL A;  2NUP C;  3V67 A;  1D06 A;  3RH8 B;  4BBT A;  4UEY A;  4Q0J A;  4H6J A;  4Q0H A;  3UB9 A;  5HWV A;  4EEU A;  1X0O A;  2QJ5 A;  3H7W A;  2A24 A;  1GSW A;  4CLC C;  2H28 A;  4HJ3 A;  5DKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...