3LEZA

Crystal structure of a halotolerant bacterial beta-lactamase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
260
structure length
260
Chain Sequence
GSEDLKKLEEEFDVRLGVYAIDTGADKEISYRENERFAYTSTFKPLAVGAVLQTKSDEELEETITYSEEDLVTYSPITEQHVDEGMTLVEIADAAIRYSDNTAGNLLLEAMGGPDELETILRDIGDETIEMDRYETELNEAKPGDIRDTSTAKAMATTLQQYVLEDVLDADRREVLTNMLINNTTGDALIRAGVPDGWTVGDKTGAGGYGTRNDIGIIWPEGDEEPIVIAIMSSRDEEDADYDDKLIEKATEIVLQELRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title An antibiotic-resistance enzyme from a deep-sea bacterium
pubmed doi rcsb
source organism Oceanobacillus iheyensis
total genus 85
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3lezA00
4BD0A 1YQSA 2Y2JA 1PI5A 3FKWA 3HLEA 3QNBA 1ES5A 2H5SA 1K54A 2Y2GA 1LI9A 2Y59A 1JWPA 3BFEA 3G4PA 4Z9QA 3HLCA 4JXGA 2JE5A 3V50A 4S2OA 4CJNA 2HPBA 2WAEA 1GHPA 1NZOA 4NETA 5CEBA 2BLSA 4FCFA 2BG1A 4JPMA 1CEGA 1H8ZA 2ZC7A 4LV0A 3VOYA 2XLNA 4E3JA 3IXGA 3GV9A 3S1YA 3WRZA 1LL5A 3ZG7B 1S6RA 1W79A 3PAEA 3W4QA 4B88A 5CXWA 2IWDA 3RXWA 3VSKA 3V3SA 5A93A 3LO7A 1DJCA 2HDRA 2Y2MA 4EWFA 3FZCA 4OP8A 2HP5A 4PM9A 4U0TA 5EE8A 1MY8A 1PIOA 2JCHA 3SS3A 1K38A 1TEMA 1HZOA 3IXHA 3W4OA 1XPBA 4Y0OA 1K56D 1I5QA 2Q9NA 1CEFA 1FCMA 4ZBEA 3UDXA 2ZM8A 4EBLA 4R3BA 1K57C 5EVIC 1K56A 3HLFA 2IWBA 1N4OA 4B4XA 3IQAA 5FATA 2OSUA 1TDGA 3VOZA 2EXAA 1JWVA 1PW1A 3S4XA 3PBSA 1IYSA 1O7EA 4S2MA 4MEZA 4WMCD 5DVAA 4FD8A 2QZ6A 3AGEA 1SCWA 4GB7A 2ZD8A 1L0DA 3N6IA 1LLBA 3UE0A 5CHUA 3Q07A 4WMCA 4MNRA 3O86A 3ZFZA 1ONHA 3E2KA 5EVIB 3WS5A 5HX9A 1KGEA 1YLPA 3NBLA 3NIAA 4Y7PA 4N9KA 4WM9A 4QB8A 3G2YA 2Y2HA 3DWZA 3GVBA 5F82A 3Q7VA 1K4FA 4HEFA 5CGXA 4DDYA 2H0TA 5FI7A 4DE0A 3HLDA 3HLWA 1ERQA 2PBYA 4Y0UA 3IHBA 5G18A 4X6TA 5CTMA 1EWZA 3N7WA 1XKZA 3FKVA 3SH8A 3NY4A 3HUOA 3MBZA 4H8RA 5GLCA 3BLSA 4B4ZA 4OOYA 3N8LA 2P9VA 1XA1A 2PU4A 2XD1A 1ERMA 2H10A 2Y2QA 4S2LA 1CI8A 1EI5A 5FDHA 1S0WA 4S2IA 4FH4A 4JXWA 3BM6A 3A3DA 2WAFA 5CRFA 2EFUA 3IHAA 5GLBA 3EQVA 4PM8A 2Z2LB 5KSCA 1JVJA 5CHJA 3MZFA 4ZJ3A 4C3QA 3IWOA 3C7UA 4YINA 4BD1A 3WWXA 1KVLA 3MZEA 5M18A 1NJ4A 2ZQ7A 4GDBA 2EX2A 1SDNA 2QPNA 2FFYA 4R23A 4OQIA 1AXBA 5FI6A 5AQ9A 5F1GA 4P0MA 5EOOA 3M2KA 3N8RA 3VFHA 3W8KA 1RCJA 2ZC4B 1H5XA 3AGDA 3DTMA 3SS5A 3M6HA 4OQHA 3ZVTA 2XF3A 1Y54A 4WZ5C 1SDEA 3SOIA 3UPPA 1KGGA 5DF7A 3WS2A 4UA6A 1J9MA 2JC7A 4KZ7A 4X69A 4EBNA 4KQOA 5CHMA 5EVLA 4JF6A 5TR7A 1CI9A 3ZNYA 4N1XA 1L2SA 1GHMA 3VFFA 1QMEA 4KZ6A 2B5RA 3TOIA 1LHYA 1DJAA 1EROA 1FCOA 3MFDA 2WK0A 3ZDJA 1ES3A 3MXSA 5I94A 1FR1A 4OP5A 4R1GA 4Q8IA 1KE0A 3IF6C 4HBTA 4RA7A 1NZUA 1XA7A 2G2UA 3A3IA 1PW8A 3E2LA 3Q81A 4BJPA 1YM1A 4KZ3A 5FAPA 5CEDA 2V2FF 5FQQA 2IWCA 2WZZA 1FSYA 5FQ9A 5CECA 1LI0A 3BFCA 3P09A 2ZM2A 1W7FA 4QD4A 3OPLA 2XK1A 4DE3A 1Q2PA 2CC1A 3PBTA 4ZAMA 1K54C 3UO9A 3ZG0A 2R9XA 4OOLA 2PU2A 3IF6B 1M40A 1ZG4A 3AGFA 5A91A 1BLSA 3N4IA 3IWQA 4KZ5A 2XQZA 2ZM0A 4L0LA 4OOMA 4P6BA 1ESIA 3NDEA 2X01A 3QHYA 2XDMA 4DRTA 2C5WB 2RL3A 3D4FA 4M3KA 5EECA 3C5AA 3P98A 3GSGA 4S2NA 2Y91A 1NXYA 3MXRA 4MLLA 3LEZA 4S2JA 5HAIA 3OCLA 3VSLA 1RGZA 1PI4A 2EFXA 2H0YA 5EVID 1RGYA 3ZVWA 4O7DA 1MPLA 4KZBA 2UWXA 5HAPA 1SHVA 3SS4A 1PWDA 1BT5A 5EVIA 5FQJA 3UNWA 3A3JA 3G2ZA 2HP9A 1G68A 2J9OA 5EPHA 1GHIA 3ISGA 3O87A 4OPQA 1ALQA 2P74A 4WELA 1RP5A 2XD5A 2EXBA 4P87A 1TDLA 1ZC2A 4R3JA 2EX6A 3B3XA 3HVFA 1XP4A 4E3LA 1HVBA 4F94A 4BENA 1IYPA 1ONGA 1MWTA 4X56A 5JYOA 4N92A 4LCMA 3G34A 5FSRA 4QY6A 5GLAA 5L2FA 4GKUA 1TVFA 2ZMAA 4MBKA 4E6XA 5FASA 1W5DA 1WYBA 4KZAA 4R4SA 2EX9A 3ITAA 3ZHHA 3HUMA 3GTCA 3QNCA 5GHYA 2ZC5B 1BZAA 4OKPA 2A3UA 5KMWA 4KG2A 4X68A 1YLJA 4DXCA 1E3UD 1FQGA 3IWIA 4HESA 4LV1A 3CJMA 3PAGA 4OLDA 1VM1A 2Q9MA 2RCXA 4LV3A 3SH7A 5A92A 1E3UA 3G35A 1FR6A 3BECA 2WKHA 4GNUA 4E6WA 5CTNA 4MBFA 5E2GA 1MKIA 3MZDA 5GL9A 3LCEA 4QY5A 3HBRA 3N8SA 5E2FA 2WGWA 4YFMA 4E3OA 1L0FA 5F83A 4E3IA 2ZLYA 1WE4A 3DWKA 3ZCZA 5GHZA 3RXXA 2DRWA 5TFQA 3WS1A 1JTGA 4PM5A 2X71A 3O88A 3BYDA 4RYEA 4DXBA 1WYCA 1OMEA 1IEMA 5BOHA 1HTZA 1W8QA 1Z6FA 3UDFA 1CK3A 2OLVA 3HREA 5AQAA 4DDSA 4RVAA 5FQKA 4D2OA 4JBFA 3IXDA 3NDGA 2P9VB 3G30A 3WS0A 3GQZA 4C6YA 5EOEA 1NRFA 4OVDA 4EUZA 3FV7A 1K55C 3IH8A 1NY0A 2HP6A 4KG5A 4WZ4A 4OQ0A 4X55A 2ZQAA 3UY6A 3WRTA 4U3TA 2ZQ9A 4NK3A 4WBGA 2V1ZA 3UDIA 4MBHA 4BL2A 3A3EA 2WGIA 5FI2A 1K6RA 3OPRA 3SH9A 1MBLA 3GR2A 3Q1FA 3LY3A 2ZC6B 3ITBA 4GDNA 1BULA 4IBXA 1IKIA 3G31A 1KE4A 3TG9A 4EBPA 1Q2QA 4K0XA 4ZJ2A 4GD8A 4A5RA 1BLHA 4X53A 1YLTA 5HFOA 3FYZA 4UA9A 2V20A 2WKEA 3C4PA 1YLWA 3CZDA 4IVIA 2HDSA 3GRJA 3V39A 5HW3A 5D3OA 4XUXA 5TGFA 3Q82A 1NYYA 3MKFA 1MWRA 4IVKA 4OH0A 5F1FA 2ZQCA 2A49A 3ZG9B 5HL1A 2E8IA 4WEKA 5J8XA 1PWCA 4ZTKA 4KG6A 5CGSA 5AQBA 5M1AA 1VQQA 1JWZA 5KSHA 2XR0A 2J8YA 4KQQA 5HAQA 3PBQA 3IT9A 2XFTA 3CMZA 2J7VA 3IH9A 5M19A 1E25A 4IBRA 1ZG6A 4KQRA 4U0XA 3GMWA 2EX8A 4E3MA 3O3VA 1ESUA 1IYQA 1MWUA 1XGIA 2C6WB 4RX2A 3VP3A 5FQIA 4XXRA 4OPRA 1FCNA 2HDQA 1K57A 1PZPA 4QJGA 1L0GA 4S2NC 1QMFA 3TSGA 3VP4A 3PTEA 5JYPA 3OPHA 2Y2OA 4GOGA 2JBFA 5FAOA 4ID4A 4PM7A 2Y55A 4BQMA 3MKEA 4DF6A 5EUAA 3PBOA 2OV5A 4K91A 1U60A 1BLCA 4UA7A 3UE1A 2ZQ8A 3W4PA 2R9WA 1IELA 1BTLA 1BUEA 1C3BA 1GA9A 2I72A 5U47A 1YMXA 1K4EA 2VGKA 3BLMA 4JXVA 1NYMA 5E43A 5E2HA 2OLUA 5DF9A 3DW0A 3BFDA 5DTKA 3BFFA 5IHVA 1YT4A 1GCEA 4KZ4A 3NC8A 5GHXA 1JTDA 1YLZA 5CERA 4GD6A 2FFFB 1MWSA 1KDSA 3LY4A 3M6BA 1XXMA 4JF5A 2Y2KA 2ZJ9A 2DNSA 3VMAA 4IEDA 4E3NA 5E2EA 1FSWA 1YLYA 2WZXA 2J9PA 4JLFA 2WGVA 3OC2A 1HD8A 3HL9A 3BFGA 3ZNTA 1PWGA 3UPOA 1E4DA 1GA0A 2XH9A 2WKIA 2Y2IA 3HLBA 2GDNA 1DJBA 3NI9A 4DE1A 1IYOA 2Y2PA 5DF8A 2G2WA 5FQMA 1BSGA 3NCKA 3VP0A 5AQ7A 5FA7A 3V3RA 3A3FA 1FOFA 1I2SA 4OQGA 1M6KA 3IXBA 4OPYA 1YMSA 1KDWA 4FH2A 5DTTA 4JKTA 4R4RA 1I2WA 4OLGA 4OPZA 2ZC3B 4WYYA 4JF4A 3ZGAB 3V5MA 5CGWA 4LV2A 3JYIA 5KZHA 3Q7VB 4XUZA 3PBNA 1K25A 4JXSA 3UE3A 2Z2MB 3S22A 4Y0TA 3EQUA 1XGJA 4UHUA 4ZJ1A 1LL9A 2XFSA 4UAAA 5A90A 1MXOA 3RJUA 3G32A 2QMIA 4GN2A 3HLGA 4WEJA 4RX3A 2X02A 1G6AA 3OCNA 4N9LA 4PM6A 5DTSA 1KE3A 1ZKJA 4S2KA 2ZQDA 4LCLA 4PPRA 2Y4AA 3Q7ZA 3C4OA 4BLMA 5FAQA 4EQIA 3VP2A 2WYXA 2XGNA 4HBUA 4KENB 1O07A 3I7JA 3UN7A 3HUNA 4P85A 4DE2A 1H8YA 4KZ8A 2DCFA 4DKIA 1PYYA 1N9BA 3C7VA 4K0WA 4R0QA 4FSFA 3PBRA 4WZ5A 4BL3A 5GLDA 2WUQA 2Y2NA 1ES4A 4C75A 1DY6A 4KZ9A 1L0EA 1PZOA 1K55A 3ZG5A 4EV4A 4E3KA 1W8YA 4N1HA 3OZHA 3M2JA 1BLPA 4GZBA 2WGWB 4PMAA 3FWLA 3IF5A 3OPPA 3ZG8B 1K6SA 1KVMA 5HARA 4ZDXA 2VGJA 4S2PA 4QU3A 4QHCA 3UPNA 3WS4A 1IKGA 3IF6A 2XEPA 2HDUA 4LENA 1ES2A 3VP1A 1SKFA 3CG5A 3BEBA 4CPKA 1KGFA 1XX2A 2Y2LA 3BRMA 4OONA 2WADA
chains in the Genus database with same CATH superfamily
2O9BA 3V67A 2MJ6A 2QJ7A 1K54A 3NULA 3ULFA 4JXGA 5EVEA 4CJNA 2WAEA 2VX8A 2NUPC 1N9OA 1OPXA 5CEBA 4JPMA 2BG1A 4HHDA 4LV0A 3VOYA 3EWKA 5HPFA 4B88A 5A93A 2GNXA 2FZ0A 2Y2MA 2HP5A 1K0KA 1YKDA 3IXHA 3W4OA 4Y0OA 1K56D 5EM0A 2Q9NA 2J3TD 1K56A 2IWBA 1N4OA 4B4XA 5FATA 3MS6A 1TDGA 3OLOA 1JWVA 1XFQA 3LUQA 5DVAA 2QZ6A 3BWLA 3N6IA 3DTEA 3T1QB 5HDSA 3S7OA 3ZFZA 1P0ZA 1F98A 1JNUA 3PXPA 5DFXA 1YLPA 3NBLA 4WM9A 4QB8A 5G4ZA 1W63Q 1T1AA 4DDYA 4JGPA 3R4KA 3R7WB 2ZBBA 5G18A 4X6TA 5CTMA 3N7WA 4HH3A 1F9IA 3SZTA 2B02A 3KYZA 3T1RA 4OOYA 3N8LA 4G3WA 1XA1A 2PU4A 5HSQA 1ERMA 1PFLA 2Y2QA 3KSHA 1CI8A 4FH4A 3BM6A 5CRFA 3T4SA 5KSCA 2QKPA 5CHJA 3MZFA 4ZJ3A 3LGOA 3IWOA 3C7UA 1NJ4A 4GDBA 1AXBA 4UEYA 5AQ9A 5F1GA 3VE4A 3RTYA 3M2KA 3W8KA 2ZC4B 3AGDA 1T19A 3UPPA 4KUOA 5HPIA 4HQAA 2JC7A 2O99A 4EBNA 5CHMA 5EVLA 1L2SA 1GHMA 3UB7A 4BBUA 2WK0A 3ZDJA 1ES3A 3MXSA 2XROA 2VV7A 2XA7S 1XA7A 2G2UA 1PW8A 4BJPA 4KZ3A 5FAPA 2VK3A 2ZM2A 3UB9A 2XK1A 1Q2PA 3PBTA 3MFXA 5HL6A 1TD5A 3H9WA 4NXFA 2I9VA 3IWQA 2ZM0A 4DRTA 2X01A 3QHYA 2XDMA 3EGDC 2M7VA 4X25A 3VSLA 4S2JA 3OCLA 3T1XA 2EFXA 3GECA 2H0YA 4F3LB 3UMEA 4KZBA 2UWXA 3SS4A 4I39A 5AJGA 1PRQA 2J9OA 5DKKA 1GHIA 2VGLS 3O87A 4OPQA 1ALQA 2P74A 2XA7M 4ZRRA 4E3LA 4F94A 5MC7A 2PD8A 2IA2A 3R7WA 1HLUP 5GLAA 4IUHA 3LR0A 4E6XA 3NHQA 1WYBA 1P97A 3HUMA 4YNRA 4OKPA 2A3UA 4KG2A 2EWWA 1E3UD 1LSXA 4OLDA 4LV1A 3OBFA 3PAGA 2Q9MA 3S7NA 3SH7A 5A92A 1E3UA 1FR6A 3BJNA 3LCEA 3HBRA 3N8SA 2CMNA 4YFMA 4E3OA 5AVEA 4EUVA 3ZCZA 5GHZA 3RXXA 3O88A 3BYDA 4DXBA 3S7QA 5BOHA 1W8QA 1Z6FA 3UDFA 5FQKA 4D2OA 3NDGA 2EA9A 3GQZA 4LFUA 4WZ4A 4HOIA 2V1ZA 3A3EA 3IBRA 5FI2A 3OPRA 3F1OA 4RA7A 1BULA 3CI6A 4EBPA 4JGRA 4K0XA 4HP9A 4GD8A 4X53A 1YPRA 4UA9A 2V20A 1VEUA 5K5BA 1YLWA 1J3WA 5D3OA 5J7EA 4RQ9A 3MKFA 1MWRA 1LSVA 3ZG9B 5HL1A 5J8XA 3QP4A 4KG6A 3NECA 5CGSA 5M1AA 2XR0A 3PHYA 2Z6DA 3PBQA 4HIAA 2J7VA 1MC0A 2L4RA 4PKYG 1LL8A 2KX6A 2WKRA 4FOFA 4I3IA 4QJGA 1F2KA 1L0GA 2Y2OA 3LICA 3MQQA 4Y3IA 3ICYA 4WUJA 3W4PA 2K7SA 2I72A 5U47A 1NYMA 1OTAA 3SW1A 5DF9A 5IHVA 1YT4A 3NC8A 5L07A 1JTDA 2FFFB 3TJZC 4IEDA 2WZXA 4JLFA 3OC2A 1HD8A 4Q0IA 1PWGA 1GA0A 1SKOB 2Y2IA 3HLBA 2GDNA 4DE1A 5DF8A 2Y2PA 5FQMA 2G2WA 3UE6A 5FA7A 3A3FA 3IBJA 4FH2A 4JKTA 2V1BA 4OPZA 4H6JB 2ZC3B 3ZGAB 1S1ZA 5EM1A 3V5MA 4II7A 3JYIA 3BY8A 5FEGA 5KZHA 3PBNA 3QP1A 5IS1A 2ACGA 1K25A 4JXSA 3UE3A 4Y0TA 3EQUA 1XGJA 3G32A 3D72A 2Y4AA 3ZYTA 3Q7ZA 3C4OA 3VP2A 4HBUA 4KENB 2BTFP 1VHMA 3UN7A 1H8YA 2OWHA 1N9BA 1S66L 1ES4A 4BMWA 1L0EA 3M2JA 3KSGA 3ZG8B 1K6SA 3D9YA 4LRYC 1PNEA 2VLGA 3NJAA 2GZAA 3IF6A 1P9RA 4EETB 4EQ1A 3EEHA 4CPKA 3E98A 2JHEA 2WADA 2Y2JA 1S67L 1PI5A 5FDSA 2Y2GA 1LI9A 2Y59A 3HLCA 3V50A 2JE5A 4S2OA 1NZOA 4NETA 2BLSA 1H8ZA 1LL5A 3ZG7B 3W4QA 3E4OA 4OP8A 4U0TA 3DBAA 1MY8A 3RH8B 3SS3A 3UB6A 1HZOA 1XPBA 4ZBEA 4R3BA 3IQAA 3VOZA 2EXAA 1IYSA 3FPVA 4FD8A 3T4LA 4GB7A 2ZL1B 2V0UA 5CHUA 3Q07A 4MNRA 3C30A 3WS5A 1KGEA 2JKRM 4N9KA 5TBMA 5F82A 1K4FA 5CGXA 5EV0A 2QHKA 3HLWA 4Y0UA 3FKVA 2HZ5A 3HUOA 1T18A 4H8RA 4AFIA 3BLSA 4HJ3A 1N9LA 2P9VA 2XD1A 5HD5A 3LI8A 4FTXA 1EI5A 3EEAA 1S0WA 3IS2B 4S2IA 3A3DA 2WAFA 3T12B 4GS9B 4PM8A 2VA0A 1P9WA 5HWVA 1IFQA 4QPRA 4C3QA 4BD1A 3WWXA 1KVLA 5IU1A 1XJ6A 3H82B 5FI6A 1G6OA 5EOOA 3N8RA 3VFHA 2W27A 1H5XA 2J80A 3SS5A 3MF0A 5DKLA 1SDEA 1KGGA 2O0YA 1QMEA 3K2NA 2B5RA 2QJ5A 3KSIA 3MFDA 1FR1A 4HBTA 5FL3A 1A0KA 1NZUA 3A3IA 4GCZA 3K3DA 2IWCA 4GJ4A 3BW6A 4CQHA 1W7FA 4GLQA 3CUEC 4QD4A 4DE3A 2R9XA 2HV1A 4KZ5A 2XQZA 4LPZA 4QWOA 1TS8A 2OOLA 2RL3A 3D4FA 2W3GA 3C5AA 3P98A 4S2NA 2Y91A 1V9YA 1RGZA 2GX5A 4XT2B 4O7DA 1MPLA 4HNBA 1PWDA 2H28A 3UNWA 3G2ZA 1OTDA 1RP5A 4P87A 2EXBA 2W3HA 4R3JA 3B3XA 3T4OA 4ARZA 2JKRI 4NEED 1H3QA 4BENA 1IYPA 4X56A 5JYOA 4N92A 4LCMA 5L2FA 1TVFA 2ZMAA 4MBKA 2V8CA 2EX9A 3ITAA 3CPTB 2OWJA 2L1MA 2NUTC 2V8FA 3K3CA 3IS2A 2ZC5B 2GJ3A 4LLOB 4X68A 1YLJA 3CWFA 2ZMVA 2Q0OA 4MDZA 3CJMA 1DP8A 4Y2FA 2RCXA 4LV3A 4GNUA 4O01A 5E2GA 3H82A 5GL9A 4QY5A 5E2FA 2WGWA 5J4EA 5F83A 5TFQA 4RYEA 1HTZA 4IJGA 5CX7A 5AQAA 4DDSA 4YOFA 1UGUA 4B93A 1D1JA 3G30A 5F5YA 4EUZA 4KG5A 2EWVA 2ZQ9A 2WGIA 3KYQA 3SH9A 4O0PA 1FILA 1TS7A 3G31A 1BLHA 5HFOA 2A24B 4PKYA 3F1NB 3ZQ5A 4DJ2A 3TW8A 2WKEA 3C4PA 3CZDA 2V9AA 2HDSA 3GRJA 5HW3A 5HWTA 1N9NA 4JGOA 2ZQCA 2A49A 3CUEA 4WLAA 2QWSA 2LB9A 1VQQA 4EW7A 3IX4A 1JWZA 5DJTA 4U0XA 4E3MA 1ESUA 4L9FA 1XGIA 4RX2A 3VP3A 1QMFA 3TSGA 3T4TA 2JBFA 4BQMA 3PBOA 2O9CA 2M7UA 1C3BA 1GA9A 1K4EA 2D01A 5E43A 5E2HA 2V0WA 4MN7A 3DW0A 3BFDA 5DTKA 3LIAA 3C8CA 4LGWA 1YLZA 4X1MA 1KDSA 1XXMA 2Y2KA 2DNSA 3IX8A 1FSWA 4KQDA 3ZNTA 3BFGA 1E4DA 1IYOA 5AQ7A 4OQGA 3IXBA 1CJFA 1YMSA 3LIEA 5DTTA 2R78A 4OLGA 4JF4A 3UB8A 5CGWA 5J3WA 4LV2A 2Y79A 3QP2A 3C2WA 1FIKA 1T1CA 4ZJ1A 1LL9A 4UAAA 2JKTM 3RJUA 3E4PA 4WEJA 2X02A 4PPRA 4NXBA 2WYXA 4BBVA 1GSXA 3I7JA 3HUNA 2DCFA 1NLZA 3C7VA 3PYPA 4R0QA 1DP9A 3PBRA 2WUQA 2Y2NA 3TRCA 4R70A 3ZG5A 4E3KA 2W3EA 1W8YA 4N1HA 4L9EA 3T4KA 1KVMA 3MMHA 2VGJA 4FUWA 3WS4A 4QHCA 1IKGA 1SKFA 3CG5A 5LBRA 3BEBA 1XX2A 4NKPA 3SOIA 3BRMA 1CQAA 3IX3A 3FKWA 3QNBA 4F3LA 5HWWA 1L3LA 4WN5A 2Y8HA 2HPBA 1GHPA 4FCFA 2ZC7A 2XLNA 4E3JA 3IXGA 3WRZA 1S6RA 2XRNA 1W79A 3PAEA 2IWDA 3RXWA 3LO7A 1DJCA 4EWFA 2PBDP 2JCHA 5EE8A 1K38A 1TEMA 1Z09A 3A0SA 1I5QA 1FCMA 1CEFA 4ETZA 4EBLA 1K57C 5EVIC 2OSUA 4EU0A 3LEQA 3T50A 3S4XA 3PBSA 1O7EA 4WMCD 1VETB 3UE0A 4WMCA 1S4RA 1UWPX 1ONHA 2HJ9C 5EVIB 1H0MA 3NIAA 4Y7PA 5A8BA 3G2YA 2Y2HA 2VV8A 3GVBA 3MQOA 4HEFA 2H0TA 5FI7A 3HLDA 2XSSA 1TS0A 2AVXA 2PBYA 2PDRA 3CAXA 3IHBA 5HDCA 3NY4A 1NWZA 2JKTI 2A2LA 4B4ZA 2VEAA 4R6LA 5FDHA 4JXWA 4NXGA 2EFUA 3IHAA 2Z2LB 4B9OA 1JVJA 4CLCC 3DTKA 1XJ2A 5M18A 2EX2A 1SDNA 2QPNA 2FFYA 4R23A 3MJQA 3A0VA 4CLCB 3ZVTA 1Y54A 4WZ5C 1BYWA 5DF7A 4UA6A 3HCYA 3CLOA 4KQOA 4JF6A 5TR7A 1CI9A 3FG8A 3ZNYA 3MSHA 1S1YA 3MXQA 3VFFA 1LHYA 1DJAA 1EROA 1XJ3A 5I94A 1OTIA 3E2LA 4P6ZS 4Q0JA 2WZZA 5FQQA 5FQ9A 5CECA 1LI0A 3BFCA 1X0OA 2PRFA 2HF6A 3OPLA 3MR0A 4EEPA 1XJ4A 2CC1A 4ZAMA 1K54C 3ZG0A 3L7HA 2PU2A 1M40A 4P6BA 4I5SA 3NDEA 4HJ6A 3GSGA 4MLLA 3EGXC 5HAIA 3LEZA 2B18A 3FC7A 1WA9A 4PHTA 1PI4A 3BQ8A 1OJ5A 1OTEA 4DMZA 3E4QA 5EVID 2ZMFA 5HAPA 4L9GA 3T4JA 1BT5A 5EVIA 4K08A 1SKOA 2HP9A 2W1TB 1G68A 5EPHA 1LSWA 3T4QA 3JVVA 3OOVA 1ZC2A 2EX6A 3DAVA 4P6ZM 2J3TC 4EXOA 2W3DA 5F6AA 4H6JA 3KO6A 3G34A 5FSRA 4QY6A 4GKUA 3HJKA 2P04A 4HI4A 3VV4A 3ZHHA 1DP6A 2VKSA 1BZAA 1EW0A 3LR5A 5KMWA 4WF0A 4DXCA 1G5UA 4HESA 3RFBA 1LT0A 1VM1A 2P7JA 3G35A 3BECA 5L10A 4E6WA 1MKIA 2O9AA 3MZDA 2JKFA 2FH5A 4CLCD 1WE4A 3T1SA 2DRWA 1JTGA 2X71A 3P7NA 1S4SA 1OMEA 4ME4A 4IUKA 1CK3A 4Y17A 3HREA 4RVAA 2INWA 2VV6A 3WS0A 4C6YA 3LI9A 5EOEA 1NRFA 4OVDA 3FV7A 2WKPA 4X55A 4OQ0A 2ZQAA 3WRTA 1K6RA 2VJWA 3B42A 3GR2A 3Q1FA 1IKIA 4KUKA 5F69A 4ZJ2A 2K31A 4A5RA 3QP6A 1YLTA 4IVIA 3B47A 3S7PA 3Q82A 1GSVA 1ODVA 4IVKA 5F1FA 2HGVA 2E8IA 2JKGA 4ZTKA 5KSHA 2XFTA 3CMZA 2W3FA 3LR4A 4IBRA 1ZG6A 2W1TA 2ZL1A 3O3VA 1IYQA 1MWUA 5FQIA 4XXRA 3GDIA 1PZPA 1YSQA 2PYPA 5FAOA 4ID4A 2Y55A 3MKEA 4DF6A 5EUAA 4BBTA 2KOIA 1U60A 1BLCA 1YAXA 2ZQ8A 2R9WA 1IELA 2ZOHA 1BTLA 1BUEA 1YMXA 3BLMA 4I3AA 2L0WA 4HP4A 5CERA 3QP8A 3LY4A 3BY9A 5E2EA 1YLYA 2J9PA 3HL9A 2QYBA 1ZHHB 3UPOA 2XH9A 1DJBA 3NI9A 4GS9A 5AVFA 3F1PB 3V3RA 1NLYA 2PHYA 1I2SA 1KDWA 4ETXA 4ESPA 3HJIA 1H8MA 1AWIA 4WYYA 2KDKA 3Q7VB 4NG2A 4XUZA 4UHUA 5A90A 3NOUC 1MXOA 2QMIA 1G6AA 3DTIA 5DTSA 1KE3A 2ZQDA 4LCLA 2D02A 4DJ3A 4EQIA 2XGNA 1O07A 1OT6A 3JPUA 4KZ8A 4LRZE 4DKIA 4K0WA 1T1BA 4FSFA 5TJJA 5GLDA 1UWNX 2W0NA 4C75A 1DY6A 4KZ9A 1PZOA 4EV4A 4PMAA 1BLPA 2HJEA 3FWLA 3IF5A 3OPPA 5HARA 4ZDXA 4HY8A 1VB6A 1STZA 2DMWA 4QU3A 3UPNA 1SZVA 2HDUA 1ES2A 1KGFA 4BD0A 1YQSA 3HLEA 2E8JA 1ES5A 4MN5A 4XT2A 2H5SA 3BFEA 1JWPA 3G4PA 4Z9QA 3VE3A 3LIBA 3QP5A 3F1OB 1CEGA 5IT5A 3GV9A 3S1YA 3D3OA 5HDDA 1ZTUA 4Y5FA 1VEUB 5CXWA 2P08A 3VSKA 3V3SA 3E0YA 2HDRA 3FZCA 4PM9A 2G7UA 1PIOA 4PAUA 5DJUA 1DRMA 3UDXA 2ZM8A 4G3KA 3CPTA 3HLFA 1PW1A 4S2MA 4MEZA 3AGEA 1SCWA 3JVUA 2ZD8A 1L0DA 1LLBA 1XFNA 3F1PA 3O86A 1W63M 3LYXA 3E2KA 5HX9A 5C5KA 5EFWA 5FEFA 3DWZA 3Q7VA 2WKQA 2YKHA 2UV0E 3FPWA 4DE0A 1ERQA 4M4XA 5HZHA 1EWZA 1XKZA 3SH8A 3MBZA 5GLCA 3B33A 2H10A 4S2LA 4O8GA 3UMDA 5GLBA 3EQVA 2PR5A 2VGLM 4I3JA 4YINA 1TS6A 5F68A 3MZEA 2ZQ7A 2A24A 3F1NA 4OQIA 5HD3A 4P0MA 5L8MA 3LFVA 2J3WA 1Y28A 2PYRA 1RCJA 4R38A 3DTMA 3M6HA 4OQHA 2XF3A 3BQAA 4JGQA 1Y4OA 3WS2A 5L09A 1J9MA 3O5YA 4KZ7A 4X69A 2Z6CA 4N1XA 4G3VA 4LRXC 1TF1A 4KZ6A 3TOIA 1FCOA 4OP5A 4R1GA 4Q8IA 2PT7A 1KE0A 3IF6C 3Q81A 1YM1A 5CEDA 1OTBA 2V2FF 2BASA 1G28A 2LB5A 1FSYA 3P09A 2JN7A 3NOPC 3TE8A 4HH2A 3UO9A 3H7WB 4OOLA 3IF6B 1ZG4A 2ZOIA 3AGFA 5A91A 1BLSA 3N4IA 4L0LA 4OOMA 1ESIA 2C5WB 4M3KA 5EECA 3C38A 1NXYA 2OAQ1 3MXRA 4EERA 3KYEA 3KX0X 1IOUA 4CLCE 4R3AA 1RGYA 3ZVWA 1D06A 1SHVA 5FQJA 3A3JA 5DFYA 3ISGA 4WELA 2XD5A 1TDLA 4MCWA 3HVFA 1XP4A 1HVBA 4E04A 1ONGA 1MWTA 4DN0A 1ACFA 1KOUA 5FASA 1W5DA 4KZAA 4R4SA 4NXEA 3W2ZA 3GTCA 3QNCA 4Q0HA 5GHYA 4GHIB 1MZUA 1FQGA 3IWIA 1F5MA 1GSWA 2WKHA 5CTNA 4MBFA 4D60A 3LR3A 5TBMB 3CHWP 1L0FA 4E3IA 2ZLYA 1MKMA 3DWKA 3WS1A 4GW9A 4PM5A 3LIDA 1WYCA 1IEMA 2K2NA 2OLVA 2PAVP 3CITA 4JBFA 3IXDA 1V9ZA 3LIFA 2P9VB 3NOTC 1K55C 3IH8A 1CF0A 1NY0A 2HP6A 3UY6A 4U3TA 4NK3A 4WBGA 3UDIA 2YKFA 2M1CA 4MBHA 4YWZA 4BL2A 4IBXA 1MBLA 4BWIA 3LY3A 2ZC6B 3ITBA 4GDNA 2B95A 1KE4A 4X1LA 3TG9A 1Q2QA 4I38A 3FYZA 3H7WA 4Z1WA 1OJGA 4MMNA 1NRJA 3G6OA 3V39A 2KLIA 3MQ0A 4XUXA 5TGFA 3U2AA 1NYYA 4OH0A 4WEKA 4Y13A 1PWCA 2VZWA 5AQBA 2PR6A 4EEUA 2J8YA 4KQQA 5HAQA 3IT9A 5G4YA 3IH9A 5M19A 1E25A 1VETA 4KQRA 3GMWA 2EX8A 1D7EA 2C6WB 4OPRA 1FCNA 2HDQA 3PR6A 1K57A 4S2NC 3VP4A 5JYPA 3PTEA 3OPHA 4GOGA 4PM7A 2OV5A 4K91A 4UA7A 3UE1A 3P01A 3U4LP 4JXVA 2VGKA 2OLUA 3BFFA 1GCEA 4KZ4A 5GHXA 1OT9A 3UB5P 4GD6A 4GHIA 1MWSA 4EESA 3M6BA 4JF5A 3VMAA 2ZJ9A 4HJ4A 4E3NA 3KSFA 2WGVA 3VOLA 2PD7A 2WKIA 4MN6A 5I5LA 3VP0A 1BSGA 3NCKA 3EOIA 1FOFA 1M6KA 4OPYA 4R4RA 4ARZB 4UQIS 1I2WA 1YSPA 2Z2MB 3S22A 4CLCA 3L9KA 2XFSA 4GN2A 3HLGA 4RX3A 3OCNA 4N9LA 4PM6A 4Y15A 1ZKJA 4S2KA 2W1RA 5KIZA 4BLMA 5FAQA 4P85A 2OAP1 4DE2A 1PYYA 4BL3A 4WZ5A 3A0RA 1K55A 3OZHA 4GZBA 2WGWB 4IHQA 4WL9A 4UQIM 4S2PA 2V1AA 2XEPA 4LENA 3VP1A 2Y2LA 4OONA
chains in the Genus database with same CATH topology
4BD0A 1YQSA 2Y2JA 1PI5A 3FKWA 3HLEA 3QNBA 1ES5A 2H5SA 1K54A 2Y2GA 1LI9A 2Y59A 1JWPA 3BFEA 3G4PA 4Z9QA 3HLCA 4JXGA 2JE5A 3V50A 4S2OA 4CJNA 2HPBA 2WAEA 1GHPA 1NZOA 4NETA 5CEBA 2BLSA 4FCFA 2BG1A 4JPMA 1CEGA 1H8ZA 2ZC7A 4LV0A 3VOYA 2XLNA 4E3JA 3IXGA 3GV9A 3S1YA 3WRZA 1LL5A 3ZG7B 1S6RA 1W79A 3PAEA 3W4QA 4B88A 5CXWA 2IWDA 3RXWA 3VSKA 3V3SA 5A93A 3LO7A 1DJCA 2HDRA 2Y2MA 4EWFA 3FZCA 4OP8A 2HP5A 4PM9A 4U0TA 5EE8A 1MY8A 1PIOA 2JCHA 3SS3A 1K38A 1TEMA 1HZOA 3IXHA 3W4OA 1XPBA 4Y0OA 1K56D 1I5QA 2Q9NA 1CEFA 1FCMA 4ZBEA 3UDXA 2ZM8A 4EBLA 4R3BA 1K57C 5EVIC 1K56A 3HLFA 2IWBA 1N4OA 4B4XA 3IQAA 5FATA 2OSUA 1TDGA 3VOZA 2EXAA 1JWVA 1PW1A 3S4XA 3PBSA 1IYSA 1O7EA 4S2MA 4MEZA 4WMCD 5DVAA 4FD8A 2QZ6A 3AGEA 1SCWA 4GB7A 2ZD8A 1L0DA 3N6IA 1LLBA 3UE0A 5CHUA 3Q07A 4WMCA 4MNRA 3O86A 3ZFZA 1ONHA 3E2KA 5EVIB 3WS5A 5HX9A 1KGEA 1YLPA 3NBLA 3NIAA 4Y7PA 4N9KA 4WM9A 4QB8A 3G2YA 2Y2HA 3DWZA 3GVBA 5F82A 3Q7VA 1K4FA 4HEFA 5CGXA 4DDYA 2H0TA 5FI7A 4DE0A 3HLDA 3HLWA 1ERQA 2PBYA 4Y0UA 3IHBA 5G18A 4X6TA 5CTMA 1EWZA 3N7WA 1XKZA 3FKVA 3SH8A 3NY4A 3HUOA 3MBZA 4H8RA 5GLCA 3BLSA 4B4ZA 4OOYA 3N8LA 2P9VA 1XA1A 2PU4A 2XD1A 1ERMA 2H10A 2Y2QA 4S2LA 1CI8A 1EI5A 5FDHA 1S0WA 4S2IA 4FH4A 4JXWA 3BM6A 3A3DA 2WAFA 5CRFA 2EFUA 3IHAA 5GLBA 3EQVA 4PM8A 2Z2LB 5KSCA 1JVJA 5CHJA 3MZFA 4ZJ3A 4C3QA 3IWOA 3C7UA 4YINA 4BD1A 3WWXA 1KVLA 3MZEA 5M18A 1NJ4A 2ZQ7A 4GDBA 2EX2A 1SDNA 2QPNA 2FFYA 4R23A 4OQIA 1AXBA 5FI6A 5AQ9A 5F1GA 4P0MA 5EOOA 3M2KA 3N8RA 3VFHA 3W8KA 1RCJA 2ZC4B 1H5XA 3AGDA 3DTMA 3SS5A 3M6HA 4OQHA 3ZVTA 2XF3A 1Y54A 4WZ5C 1SDEA 3SOIA 3UPPA 1KGGA 5DF7A 3WS2A 4UA6A 1J9MA 2JC7A 4KZ7A 4X69A 4EBNA 4KQOA 5CHMA 5EVLA 4JF6A 5TR7A 1CI9A 3ZNYA 4N1XA 1L2SA 1GHMA 3VFFA 1QMEA 4KZ6A 2B5RA 3TOIA 1LHYA 1DJAA 1EROA 1FCOA 3MFDA 2WK0A 3ZDJA 1ES3A 3MXSA 5I94A 1FR1A 4OP5A 4R1GA 4Q8IA 1KE0A 3IF6C 4HBTA 4RA7A 1NZUA 1XA7A 2G2UA 3A3IA 1PW8A 3E2LA 3Q81A 4BJPA 1YM1A 4KZ3A 5FAPA 5CEDA 2V2FF 5FQQA 2IWCA 2WZZA 1FSYA 5FQ9A 5CECA 1LI0A 3BFCA 3P09A 2ZM2A 1W7FA 4QD4A 3OPLA 2XK1A 4DE3A 1Q2PA 2CC1A 3PBTA 4ZAMA 1K54C 3UO9A 3ZG0A 2R9XA 4OOLA 2PU2A 3IF6B 1M40A 1ZG4A 3AGFA 5A91A 1BLSA 3N4IA 3IWQA 4KZ5A 2XQZA 2ZM0A 4L0LA 4OOMA 4P6BA 1ESIA 3NDEA 2X01A 3QHYA 2XDMA 4DRTA 2C5WB 2RL3A 3D4FA 4M3KA 5EECA 3C5AA 3P98A 3GSGA 4S2NA 2Y91A 1NXYA 3MXRA 4MLLA 3LEZA 4S2JA 5HAIA 3OCLA 3VSLA 1RGZA 1PI4A 2EFXA 2H0YA 5EVID 1RGYA 3ZVWA 4O7DA 1MPLA 4KZBA 2UWXA 5HAPA 1SHVA 3SS4A 1PWDA 1BT5A 5EVIA 5FQJA 3UNWA 3A3JA 3G2ZA 2HP9A 1G68A 2J9OA 5EPHA 1GHIA 3ISGA 3O87A 4OPQA 1ALQA 2P74A 4WELA 1RP5A 2XD5A 2EXBA 4P87A 1TDLA 1ZC2A 4R3JA 2EX6A 3B3XA 3HVFA 1XP4A 4E3LA 1HVBA 4F94A 4BENA 1IYPA 1ONGA 1MWTA 4X56A 5JYOA 4N92A 4LCMA 3G34A 5FSRA 4QY6A 5GLAA 5L2FA 4GKUA 1TVFA 2ZMAA 4MBKA 4E6XA 5FASA 1W5DA 1WYBA 4KZAA 4R4SA 2EX9A 3ITAA 3ZHHA 3HUMA 3GTCA 3QNCA 5GHYA 2ZC5B 1BZAA 4OKPA 2A3UA 5KMWA 4KG2A 4X68A 1YLJA 4DXCA 1E3UD 1FQGA 3IWIA 4HESA 4LV1A 3CJMA 3PAGA 4OLDA 1VM1A 2Q9MA 2RCXA 4LV3A 3SH7A 5A92A 1E3UA 3G35A 1FR6A 3BECA 2WKHA 4GNUA 4E6WA 5CTNA 4MBFA 5E2GA 1MKIA 3MZDA 5GL9A 3LCEA 4QY5A 3HBRA 3N8SA 5E2FA 2WGWA 4YFMA 4E3OA 1L0FA 5F83A 4E3IA 2ZLYA 1WE4A 3DWKA 3ZCZA 5GHZA 3RXXA 2DRWA 5TFQA 3WS1A 1JTGA 4PM5A 2X71A 3O88A 3BYDA 4RYEA 4DXBA 1WYCA 1OMEA 1IEMA 5BOHA 1HTZA 1W8QA 1Z6FA 3UDFA 1CK3A 2OLVA 3HREA 5AQAA 4DDSA 4RVAA 5FQKA 4D2OA 4JBFA 3IXDA 3NDGA 2P9VB 3G30A 3WS0A 3GQZA 4C6YA 5EOEA 1NRFA 4OVDA 4EUZA 3FV7A 1K55C 3IH8A 1NY0A 2HP6A 4KG5A 4WZ4A 4OQ0A 4X55A 2ZQAA 3UY6A 3WRTA 4U3TA 2ZQ9A 4NK3A 4WBGA 2V1ZA 3UDIA 4MBHA 4BL2A 3A3EA 2WGIA 5FI2A 1K6RA 3OPRA 3SH9A 1MBLA 3GR2A 3Q1FA 3LY3A 2ZC6B 3ITBA 4GDNA 1BULA 4IBXA 1IKIA 3G31A 1KE4A 3TG9A 4EBPA 1Q2QA 4K0XA 4ZJ2A 4GD8A 4A5RA 1BLHA 4X53A 1YLTA 5HFOA 3FYZA 4UA9A 2V20A 2WKEA 3C4PA 1YLWA 3CZDA 4IVIA 2HDSA 3GRJA 3V39A 5HW3A 5D3OA 4XUXA 5TGFA 3Q82A 1NYYA 3MKFA 1MWRA 4IVKA 4OH0A 5F1FA 2ZQCA 2A49A 3ZG9B 5HL1A 2E8IA 4WEKA 5J8XA 1PWCA 4ZTKA 4KG6A 5CGSA 5AQBA 5M1AA 1VQQA 1JWZA 5KSHA 2XR0A 2J8YA 4KQQA 5HAQA 3PBQA 3IT9A 2XFTA 3CMZA 2J7VA 3IH9A 5M19A 1E25A 4IBRA 1ZG6A 4KQRA 4U0XA 3GMWA 2EX8A 4E3MA 3O3VA 1ESUA 1IYQA 1MWUA 1XGIA 2C6WB 4RX2A 3VP3A 5FQIA 4XXRA 4OPRA 1FCNA 2HDQA 1K57A 1PZPA 4QJGA 1L0GA 4S2NC 1QMFA 3TSGA 3VP4A 3PTEA 5JYPA 3OPHA 2Y2OA 4GOGA 2JBFA 5FAOA 4ID4A 4PM7A 2Y55A 4BQMA 3MKEA 4DF6A 5EUAA 3PBOA 2OV5A 4K91A 1U60A 1BLCA 4UA7A 3UE1A 2ZQ8A 3W4PA 2R9WA 1IELA 1BTLA 1BUEA 1C3BA 1GA9A 2I72A 5U47A 1YMXA 1K4EA 2VGKA 3BLMA 4JXVA 1NYMA 5E43A 5E2HA 2OLUA 5DF9A 3DW0A 3BFDA 5DTKA 3BFFA 5IHVA 1YT4A 1GCEA 4KZ4A 3NC8A 5GHXA 1JTDA 1YLZA 5CERA 4GD6A 2FFFB 1MWSA 1KDSA 3LY4A 3M6BA 1XXMA 4JF5A 2Y2KA 2ZJ9A 2DNSA 3VMAA 4IEDA 4E3NA 5E2EA 1FSWA 1YLYA 2WZXA 2J9PA 4JLFA 2WGVA 3OC2A 1HD8A 3HL9A 3BFGA 3ZNTA 1PWGA 3UPOA 1E4DA 1GA0A 2XH9A 2WKIA 2Y2IA 3HLBA 2GDNA 1DJBA 3NI9A 4DE1A 1IYOA 2Y2PA 5DF8A 2G2WA 5FQMA 1BSGA 3NCKA 3VP0A 5AQ7A 5FA7A 3V3RA 3A3FA 1FOFA 1I2SA 4OQGA 1M6KA 3IXBA 4OPYA 1YMSA 1KDWA 4FH2A 5DTTA 4JKTA 4R4RA 1I2WA 4OLGA 4OPZA 2ZC3B 4WYYA 4JF4A 3ZGAB 3V5MA 5CGWA 4LV2A 3JYIA 5KZHA 3Q7VB 4XUZA 3PBNA 1K25A 4JXSA 3UE3A 2Z2MB 3S22A 4Y0TA 3EQUA 1XGJA 4UHUA 4ZJ1A 1LL9A 2XFSA 4UAAA 5A90A 1MXOA 3RJUA 3G32A 2QMIA 4GN2A 3HLGA 4WEJA 4RX3A 2X02A 1G6AA 3OCNA 4N9LA 4PM6A 5DTSA 1KE3A 1ZKJA 4S2KA 2ZQDA 4LCLA 4PPRA 2Y4AA 3Q7ZA 3C4OA 4BLMA 5FAQA 4EQIA 3VP2A 2WYXA 2XGNA 4HBUA 4KENB 1O07A 3I7JA 3UN7A 3HUNA 4P85A 4DE2A 1H8YA 4KZ8A 2DCFA 4DKIA 1PYYA 1N9BA 3C7VA 4K0WA 4R0QA 4FSFA 3PBRA 4WZ5A 4BL3A 5GLDA 2WUQA 2Y2NA 1ES4A 4C75A 1DY6A 4KZ9A 1L0EA 1PZOA 1K55A 3ZG5A 4EV4A 4E3KA 1W8YA 4N1HA 3OZHA 3M2JA 1BLPA 4GZBA 2WGWB 4PMAA 3FWLA 3IF5A 3OPPA 3ZG8B 1K6SA 1KVMA 5HARA 4ZDXA 2VGJA 4S2PA 4QU3A 4QHCA 3UPNA 3WS4A 1IKGA 3IF6A 2XEPA 2HDUA 4LENA 1ES2A 3VP1A 1SKFA 3CG5A 3BEBA 4CPKA 1KGFA 1XX2A 2Y2LA 3BRMA 4OONA 2WADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BD0 A;  1YQS A;  2Y2J A;  1PI5 A;  3FKW A;  3HLE A;  3QNB A;  1ES5 A;  2H5S A;  1K54 A;  2Y2G A;  1LI9 A;  2Y59 A;  1JWP A;  3BFE A;  3G4P A;  4Z9Q A;  3HLC A;  4JXG A;  2JE5 A;  3V50 A;  4S2O A;  4CJN A;  2HPB A;  2WAE A;  1GHP A;  1NZO A;  4NET A;  5CEB A;  2BLS A;  4FCF A;  2BG1 A;  4JPM A;  1CEG A;  1H8Z A;  2ZC7 A;  4LV0 A;  3VOY A;  2XLN A;  4E3J A;  3IXG A;  3GV9 A;  3S1Y A;  3WRZ A;  1LL5 A;  3ZG7 B;  1S6R A;  1W79 A;  3PAE A;  3W4Q A;  4B88 A;  5CXW A;  2IWD A;  3RXW A;  3VSK A;  3V3S A;  5A93 A;  3LO7 A;  1DJC A;  2HDR A;  2Y2M A;  4EWF A;  3FZC A;  4OP8 A;  2HP5 A;  4PM9 A;  4U0T A;  5EE8 A;  1MY8 A;  1PIO A;  2JCH A;  3SS3 A;  1K38 A;  1TEM A;  1HZO A;  3IXH A;  3W4O A;  1XPB A;  4Y0O A;  1K56 D;  1I5Q A;  2Q9N A;  1CEF A;  1FCM A;  4ZBE A;  3UDX A;  2ZM8 A;  4EBL A;  4R3B A;  1K57 C;  5EVI C;  1K56 A;  3HLF A;  2IWB A;  1N4O A;  4B4X A;  3IQA A;  5FAT A;  2OSU A;  1TDG A;  3VOZ A;  2EXA A;  1JWV A;  1PW1 A;  3S4X A;  3PBS A;  1IYS A;  1O7E A;  4S2M A;  4MEZ A;  4WMC D;  5DVA A;  4FD8 A;  2QZ6 A;  3AGE A;  1SCW A;  4GB7 A;  2ZD8 A;  1L0D A;  3N6I A;  1LLB A;  3UE0 A;  5CHU A;  3Q07 A;  4WMC A;  4MNR A;  3O86 A;  3ZFZ A;  1ONH A;  3E2K A;  5EVI B;  3WS5 A;  5HX9 A;  1KGE A;  1YLP A;  3NBL A;  3NIA A;  4Y7P A;  4N9K A;  4WM9 A;  4QB8 A;  3G2Y A;  2Y2H A;  3DWZ A;  3GVB A;  5F82 A;  3Q7V A;  1K4F A;  4HEF A;  5CGX A;  4DDY A;  2H0T A;  5FI7 A;  4DE0 A;  3HLD A;  3HLW A;  1ERQ A;  2PBY A;  4Y0U A;  3IHB A;  5G18 A;  4X6T A;  5CTM A;  1EWZ A;  3N7W A;  1XKZ A;  3FKV A;  3SH8 A;  3NY4 A;  3HUO A;  3MBZ A;  4H8R A;  5GLC A;  3BLS A;  4B4Z A;  4OOY A;  3N8L A;  2P9V A;  1XA1 A;  2PU4 A;  2XD1 A;  1ERM A;  2H10 A;  2Y2Q A;  4S2L A;  1CI8 A;  1EI5 A;  5FDH A;  1S0W A;  4S2I A;  4FH4 A;  4JXW A;  3BM6 A;  3A3D A;  2WAF A;  5CRF A;  2EFU A;  3IHA A;  5GLB A;  3EQV A;  4PM8 A;  2Z2L B;  5KSC A;  1JVJ A;  5CHJ A;  3MZF A;  4ZJ3 A;  4C3Q A;  3IWO A;  3C7U A;  4YIN A;  4BD1 A;  3WWX A;  1KVL A;  3MZE A;  5M18 A;  1NJ4 A;  2ZQ7 A;  4GDB A;  2EX2 A;  1SDN A;  2QPN A;  2FFY A;  4R23 A;  4OQI A;  1AXB A;  5FI6 A;  5AQ9 A;  5F1G A;  4P0M A;  5EOO A;  3M2K A;  3N8R A;  3VFH A;  3W8K A;  1RCJ A;  2ZC4 B;  1H5X A;  3AGD A;  3DTM A;  3SS5 A;  3M6H A;  4OQH A;  3ZVT A;  2XF3 A;  1Y54 A;  4WZ5 C;  1SDE A;  3SOI A;  3UPP A;  1KGG A;  5DF7 A;  3WS2 A;  4UA6 A;  1J9M A;  2JC7 A;  4KZ7 A;  4X69 A;  4EBN A;  4KQO A;  5CHM A;  5EVL A;  4JF6 A;  5TR7 A;  1CI9 A;  3ZNY A;  4N1X A;  1L2S A;  1GHM A;  3VFF A;  1QME A;  4KZ6 A;  2B5R A;  3TOI A;  1LHY A;  1DJA A;  1ERO A;  1FCO A;  3MFD A;  2WK0 A;  3ZDJ A;  1ES3 A;  3MXS A;  5I94 A;  1FR1 A;  4OP5 A;  4R1G A;  4Q8I A;  1KE0 A;  3IF6 C;  4HBT A;  4RA7 A;  1NZU A;  1XA7 A;  2G2U A;  3A3I A;  1PW8 A;  3E2L A;  3Q81 A;  4BJP A;  1YM1 A;  4KZ3 A;  5FAP A;  5CED A;  2V2F F;  5FQQ A;  2IWC A;  2WZZ A;  1FSY A;  5FQ9 A;  5CEC A;  1LI0 A;  3BFC A;  3P09 A;  2ZM2 A;  1W7F A;  4QD4 A;  3OPL A;  2XK1 A;  4DE3 A;  1Q2P A;  2CC1 A;  3PBT A;  4ZAM A;  1K54 C;  3UO9 A;  3ZG0 A;  2R9X A;  4OOL A;  2PU2 A;  3IF6 B;  1M40 A;  1ZG4 A;  3AGF A;  5A91 A;  1BLS A;  3N4I A;  3IWQ A;  4KZ5 A;  2XQZ A;  2ZM0 A;  4L0L A;  4OOM A;  4P6B A;  1ESI A;  3NDE A;  2X01 A;  3QHY A;  2XDM A;  4DRT A;  2C5W B;  2RL3 A;  3D4F A;  4M3K A;  5EEC A;  3C5A A;  3P98 A;  3GSG A;  4S2N A;  2Y91 A;  1NXY A;  3MXR A;  4MLL A;  3LEZ A;  4S2J A;  5HAI A;  3OCL A;  3VSL A;  1RGZ A;  1PI4 A;  2EFX A;  2H0Y A;  5EVI D;  1RGY A;  3ZVW A;  4O7D A;  1MPL A;  4KZB A;  2UWX A;  5HAP A;  1SHV A;  3SS4 A;  1PWD A;  1BT5 A;  5EVI A;  5FQJ A;  3UNW A;  3A3J A;  3G2Z A;  2HP9 A;  1G68 A;  2J9O A;  5EPH A;  1GHI A;  3ISG A;  3O87 A;  4OPQ A;  1ALQ A;  2P74 A;  4WEL A;  1RP5 A;  2XD5 A;  2EXB A;  4P87 A;  1TDL A;  1ZC2 A;  4R3J A;  2EX6 A;  3B3X A;  3HVF A;  1XP4 A;  4E3L A;  1HVB A;  4F94 A;  4BEN A;  1IYP A;  1ONG A;  1MWT A;  4X56 A;  5JYO A;  4N92 A;  4LCM A;  3G34 A;  5FSR A;  4QY6 A;  5GLA A;  5L2F A;  4GKU A;  1TVF A;  2ZMA A;  4MBK A;  4E6X A;  5FAS A;  1W5D A;  1WYB A;  4KZA A;  4R4S A;  2EX9 A;  3ITA A;  3ZHH A;  3HUM A;  3GTC A;  3QNC A;  5GHY A;  2ZC5 B;  1BZA A;  4OKP A;  2A3U A;  5KMW A;  4KG2 A;  4X68 A;  1YLJ A;  4DXC A;  1E3U D;  1FQG A;  3IWI A;  4HES A;  4LV1 A;  3CJM A;  3PAG A;  4OLD A;  1VM1 A;  2Q9M A;  2RCX A;  4LV3 A;  3SH7 A;  5A92 A;  1E3U A;  3G35 A;  1FR6 A;  3BEC A;  2WKH A;  4GNU A;  4E6W A;  5CTN A;  4MBF A;  5E2G A;  1MKI A;  3MZD A;  5GL9 A;  3LCE A;  4QY5 A;  3HBR A;  3N8S A;  5E2F A;  2WGW A;  4YFM A;  4E3O A;  1L0F A;  5F83 A;  4E3I A;  2ZLY A;  1WE4 A;  3DWK A;  3ZCZ A;  5GHZ A;  3RXX A;  2DRW A;  5TFQ A;  3WS1 A;  1JTG A;  4PM5 A;  2X71 A;  3O88 A;  3BYD A;  4RYE A;  4DXB A;  1WYC A;  1OME A;  1IEM A;  5BOH A;  1HTZ A;  1W8Q A;  1Z6F A;  3UDF A;  1CK3 A;  2OLV A;  3HRE A;  5AQA A;  4DDS A;  4RVA A;  5FQK A;  4D2O A;  4JBF A;  3IXD A;  3NDG A;  2P9V B;  3G30 A;  3WS0 A;  3GQZ A;  4C6Y A;  5EOE A;  1NRF A;  4OVD A;  4EUZ A;  3FV7 A;  1K55 C;  3IH8 A;  1NY0 A;  2HP6 A;  4KG5 A;  4WZ4 A;  4OQ0 A;  4X55 A;  2ZQA A;  3UY6 A;  3WRT A;  4U3T A;  2ZQ9 A;  4NK3 A;  4WBG A;  2V1Z A;  3UDI A;  4MBH A;  4BL2 A;  3A3E A;  2WGI A;  5FI2 A;  1K6R A;  3OPR A;  3SH9 A;  1MBL A;  3GR2 A;  3Q1F A;  3LY3 A;  2ZC6 B;  3ITB A;  4GDN A;  1BUL A;  4IBX A;  1IKI A;  3G31 A;  1KE4 A;  3TG9 A;  4EBP A;  1Q2Q A;  4K0X A;  4ZJ2 A;  4GD8 A;  4A5R A;  1BLH A;  4X53 A;  1YLT A;  5HFO A;  3FYZ A;  4UA9 A;  2V20 A;  2WKE A;  3C4P A;  1YLW A;  3CZD A;  4IVI A;  2HDS A;  3GRJ A;  3V39 A;  5HW3 A;  5D3O A;  4XUX A;  5TGF A;  3Q82 A;  1NYY A;  3MKF A;  1MWR A;  4IVK A;  4OH0 A;  5F1F A;  2ZQC A;  2A49 A;  3ZG9 B;  5HL1 A;  2E8I A;  4WEK A;  5J8X A;  1PWC A;  4ZTK A;  4KG6 A;  5CGS A;  5AQB A;  5M1A A;  1VQQ A;  1JWZ A;  5KSH A;  2XR0 A;  2J8Y A;  4KQQ A;  5HAQ A;  3PBQ A;  3IT9 A;  2XFT A;  3CMZ A;  2J7V A;  3IH9 A;  5M19 A;  1E25 A;  4IBR A;  1ZG6 A;  4KQR A;  4U0X A;  3GMW A;  2EX8 A;  4E3M A;  3O3V A;  1ESU A;  1IYQ A;  1MWU A;  1XGI A;  2C6W B;  4RX2 A;  3VP3 A;  5FQI A;  4XXR A;  4OPR A;  1FCN A;  2HDQ A;  1K57 A;  1PZP A;  4QJG A;  1L0G A;  4S2N C;  1QMF A;  3TSG A;  3VP4 A;  3PTE A;  5JYP A;  3OPH A;  2Y2O A;  4GOG A;  2JBF A;  5FAO A;  4ID4 A;  4PM7 A;  2Y55 A;  4BQM A;  3MKE A;  4DF6 A;  5EUA A;  3PBO A;  2OV5 A;  4K91 A;  1U60 A;  1BLC A;  4UA7 A;  3UE1 A;  2ZQ8 A;  3W4P A;  2R9W A;  1IEL A;  1BTL A;  1BUE A;  1C3B A;  1GA9 A;  2I72 A;  5U47 A;  1YMX A;  1K4E A;  2VGK A;  3BLM A;  4JXV A;  1NYM A;  5E43 A;  5E2H A;  2OLU A;  5DF9 A;  3DW0 A;  3BFD A;  5DTK A;  3BFF A;  5IHV A;  1YT4 A;  1GCE A;  4KZ4 A;  3NC8 A;  5GHX A;  1JTD A;  1YLZ A;  5CER A;  4GD6 A;  2FFF B;  1MWS A;  1KDS A;  3LY4 A;  3M6B A;  1XXM A;  4JF5 A;  2Y2K A;  2ZJ9 A;  2DNS A;  3VMA A;  4IED A;  4E3N A;  5E2E A;  1FSW A;  1YLY A;  2WZX A;  2J9P A;  4JLF A;  2WGV A;  3OC2 A;  1HD8 A;  3HL9 A;  3BFG A;  3ZNT A;  1PWG A;  3UPO A;  1E4D A;  1GA0 A;  2XH9 A;  2WKI A;  2Y2I A;  3HLB A;  2GDN A;  1DJB A;  3NI9 A;  4DE1 A;  1IYO A;  2Y2P A;  5DF8 A;  2G2W A;  5FQM A;  1BSG A;  3NCK A;  3VP0 A;  5AQ7 A;  5FA7 A;  3V3R A;  3A3F A;  1FOF A;  1I2S A;  4OQG A;  1M6K A;  3IXB A;  4OPY A;  1YMS A;  1KDW A;  4FH2 A;  5DTT A;  4JKT A;  4R4R A;  1I2W A;  4OLG A;  4OPZ A;  2ZC3 B;  4WYY A;  4JF4 A;  3ZGA B;  3V5M A;  5CGW A;  4LV2 A;  3JYI A;  5KZH A;  3Q7V B;  4XUZ A;  3PBN A;  1K25 A;  4JXS A;  3UE3 A;  2Z2M B;  3S22 A;  4Y0T A;  3EQU A;  1XGJ A;  4UHU A;  4ZJ1 A;  1LL9 A;  2XFS A;  4UAA A;  5A90 A;  1MXO A;  3RJU A;  3G32 A;  2QMI A;  4GN2 A;  3HLG A;  4WEJ A;  4RX3 A;  2X02 A;  1G6A A;  3OCN A;  4N9L A;  4PM6 A;  5DTS A;  1KE3 A;  1ZKJ A;  4S2K A;  2ZQD A;  4LCL A;  4PPR A;  2Y4A A;  3Q7Z A;  3C4O A;  4BLM A;  5FAQ A;  4EQI A;  3VP2 A;  2WYX A;  2XGN A;  4HBU A;  4KEN B;  1O07 A;  3I7J A;  3UN7 A;  3HUN A;  4P85 A;  4DE2 A;  1H8Y A;  4KZ8 A;  2DCF A;  4DKI A;  1PYY A;  1N9B A;  3C7V A;  4K0W A;  4R0Q A;  4FSF A;  3PBR A;  4WZ5 A;  4BL3 A;  5GLD A;  2WUQ A;  2Y2N A;  1ES4 A;  4C75 A;  1DY6 A;  4KZ9 A;  1L0E A;  1PZO A;  1K55 A;  3ZG5 A;  4EV4 A;  4E3K A;  1W8Y A;  4N1H A;  3OZH A;  3M2J A;  1BLP A;  4GZB A;  2WGW B;  4PMA A;  3FWL A;  3IF5 A;  3OPP A;  3ZG8 B;  1K6S A;  1KVM A;  5HAR A;  4ZDX A;  2VGJ A;  4S2P A;  4QU3 A;  4QHC A;  3UPN A;  3WS4 A;  1IKG A;  3IF6 A;  2XEP A;  2HDU A;  4LEN A;  1ES2 A;  3VP1 A;  1SKF A;  3CG5 A;  3BEB A;  4CPK A;  1KGF A;  1XX2 A;  2Y2L A;  3BRM A;  4OON A;  2WAD A; 
#chains in the Genus database with same CATH topology
 2O9B A;  3V67 A;  2MJ6 A;  2QJ7 A;  1K54 A;  3NUL A;  3ULF A;  4JXG A;  5EVE A;  4CJN A;  2WAE A;  2VX8 A;  2NUP C;  1N9O A;  1OPX A;  5CEB A;  4JPM A;  2BG1 A;  4HHD A;  4LV0 A;  3VOY A;  3EWK A;  5HPF A;  4B88 A;  5A93 A;  2GNX A;  2FZ0 A;  2Y2M A;  2HP5 A;  1K0K A;  1YKD A;  3IXH A;  3W4O A;  4Y0O A;  1K56 D;  5EM0 A;  2Q9N A;  2J3T D;  1K56 A;  2IWB A;  1N4O A;  4B4X A;  5FAT A;  3MS6 A;  1TDG A;  3OLO A;  1JWV A;  1XFQ A;  3LUQ A;  5DVA A;  2QZ6 A;  3BWL A;  3N6I A;  3DTE A;  3T1Q B;  5HDS A;  3S7O A;  3ZFZ A;  1P0Z A;  1F98 A;  1JNU A;  3PXP A;  5DFX A;  1YLP A;  3NBL A;  4WM9 A;  4QB8 A;  5G4Z A;  1W63 Q;  1T1A A;  4DDY A;  4JGP A;  3R4K A;  3R7W B;  2ZBB A;  5G18 A;  4X6T A;  5CTM A;  3N7W A;  4HH3 A;  1F9I A;  3SZT A;  2B02 A;  3KYZ A;  3T1R A;  4OOY A;  3N8L A;  4G3W A;  1XA1 A;  2PU4 A;  5HSQ A;  1ERM A;  1PFL A;  2Y2Q A;  3KSH A;  1CI8 A;  4FH4 A;  3BM6 A;  5CRF A;  3T4S A;  5KSC A;  2QKP A;  5CHJ A;  3MZF A;  4ZJ3 A;  3LGO A;  3IWO A;  3C7U A;  1NJ4 A;  4GDB A;  1AXB A;  4UEY A;  5AQ9 A;  5F1G A;  3VE4 A;  3RTY A;  3M2K A;  3W8K A;  2ZC4 B;  3AGD A;  1T19 A;  3UPP A;  4KUO A;  5HPI A;  4HQA A;  2JC7 A;  2O99 A;  4EBN A;  5CHM A;  5EVL A;  1L2S A;  1GHM A;  3UB7 A;  4BBU A;  2WK0 A;  3ZDJ A;  1ES3 A;  3MXS A;  2XRO A;  2VV7 A;  2XA7 S;  1XA7 A;  2G2U A;  1PW8 A;  4BJP A;  4KZ3 A;  5FAP A;  2VK3 A;  2ZM2 A;  3UB9 A;  2XK1 A;  1Q2P A;  3PBT A;  3MFX A;  5HL6 A;  1TD5 A;  3H9W A;  4NXF A;  2I9V A;  3IWQ A;  2ZM0 A;  4DRT A;  2X01 A;  3QHY A;  2XDM A;  3EGD C;  2M7V A;  4X25 A;  3VSL A;  4S2J A;  3OCL A;  3T1X A;  2EFX A;  3GEC A;  2H0Y A;  4F3L B;  3UME A;  4KZB A;  2UWX A;  3SS4 A;  4I39 A;  5AJG A;  1PRQ A;  2J9O A;  5DKK A;  1GHI A;  2VGL S;  3O87 A;  4OPQ A;  1ALQ A;  2P74 A;  2XA7 M;  4ZRR A;  4E3L A;  4F94 A;  5MC7 A;  2PD8 A;  2IA2 A;  3R7W A;  1HLU P;  5GLA A;  4IUH A;  3LR0 A;  4E6X A;  3NHQ A;  1WYB A;  1P97 A;  3HUM A;  4YNR A;  4OKP A;  2A3U A;  4KG2 A;  2EWW A;  1E3U D;  1LSX A;  4OLD A;  4LV1 A;  3OBF A;  3PAG A;  2Q9M A;  3S7N A;  3SH7 A;  5A92 A;  1E3U A;  1FR6 A;  3BJN A;  3LCE A;  3HBR A;  3N8S A;  2CMN A;  4YFM A;  4E3O A;  5AVE A;  4EUV A;  3ZCZ A;  5GHZ A;  3RXX A;  3O88 A;  3BYD A;  4DXB A;  3S7Q A;  5BOH A;  1W8Q A;  1Z6F A;  3UDF A;  5FQK A;  4D2O A;  3NDG A;  2EA9 A;  3GQZ A;  4LFU A;  4WZ4 A;  4HOI A;  2V1Z A;  3A3E A;  3IBR A;  5FI2 A;  3OPR A;  3F1O A;  4RA7 A;  1BUL A;  3CI6 A;  4EBP A;  4JGR A;  4K0X A;  4HP9 A;  4GD8 A;  4X53 A;  1YPR A;  4UA9 A;  2V20 A;  1VEU A;  5K5B A;  1YLW A;  1J3W A;  5D3O A;  5J7E A;  4RQ9 A;  3MKF A;  1MWR A;  1LSV A;  3ZG9 B;  5HL1 A;  5J8X A;  3QP4 A;  4KG6 A;  3NEC A;  5CGS A;  5M1A A;  2XR0 A;  3PHY A;  2Z6D A;  3PBQ A;  4HIA A;  2J7V A;  1MC0 A;  2L4R A;  4PKY G;  1LL8 A;  2KX6 A;  2WKR A;  4FOF A;  4I3I A;  4QJG A;  1F2K A;  1L0G A;  2Y2O A;  3LIC A;  3MQQ A;  4Y3I A;  3ICY A;  4WUJ A;  3W4P A;  2K7S A;  2I72 A;  5U47 A;  1NYM A;  1OTA A;  3SW1 A;  5DF9 A;  5IHV A;  1YT4 A;  3NC8 A;  5L07 A;  1JTD A;  2FFF B;  3TJZ C;  4IED A;  2WZX A;  4JLF A;  3OC2 A;  1HD8 A;  4Q0I A;  1PWG A;  1GA0 A;  1SKO B;  2Y2I A;  3HLB A;  2GDN A;  4DE1 A;  5DF8 A;  2Y2P A;  5FQM A;  2G2W A;  3UE6 A;  5FA7 A;  3A3F A;  3IBJ A;  4FH2 A;  4JKT A;  2V1B A;  4OPZ A;  4H6J B;  2ZC3 B;  3ZGA B;  1S1Z A;  5EM1 A;  3V5M A;  4II7 A;  3JYI A;  3BY8 A;  5FEG A;  5KZH A;  3PBN A;  3QP1 A;  5IS1 A;  2ACG A;  1K25 A;  4JXS A;  3UE3 A;  4Y0T A;  3EQU A;  1XGJ A;  3G32 A;  3D72 A;  2Y4A A;  3ZYT A;  3Q7Z A;  3C4O A;  3VP2 A;  4HBU A;  4KEN B;  2BTF P;  1VHM A;  3UN7 A;  1H8Y A;  2OWH A;  1N9B A;  1S66 L;  1ES4 A;  4BMW A;  1L0E A;  3M2J A;  3KSG A;  3ZG8 B;  1K6S A;  3D9Y A;  4LRY C;  1PNE A;  2VLG A;  3NJA A;  2GZA A;  3IF6 A;  1P9R A;  4EET B;  4EQ1 A;  3EEH A;  4CPK A;  3E98 A;  2JHE A;  2WAD A;  2Y2J A;  1S67 L;  1PI5 A;  5FDS A;  2Y2G A;  1LI9 A;  2Y59 A;  3HLC A;  3V50 A;  2JE5 A;  4S2O A;  1NZO A;  4NET A;  2BLS A;  1H8Z A;  1LL5 A;  3ZG7 B;  3W4Q A;  3E4O A;  4OP8 A;  4U0T A;  3DBA A;  1MY8 A;  3RH8 B;  3SS3 A;  3UB6 A;  1HZO A;  1XPB A;  4ZBE A;  4R3B A;  3IQA A;  3VOZ A;  2EXA A;  1IYS A;  3FPV A;  4FD8 A;  3T4L A;  4GB7 A;  2ZL1 B;  2V0U A;  5CHU A;  3Q07 A;  4MNR A;  3C30 A;  3WS5 A;  1KGE A;  2JKR M;  4N9K A;  5TBM A;  5F82 A;  1K4F A;  5CGX A;  5EV0 A;  2QHK A;  3HLW A;  4Y0U A;  3FKV A;  2HZ5 A;  3HUO A;  1T18 A;  4H8R A;  4AFI A;  3BLS A;  4HJ3 A;  1N9L A;  2P9V A;  2XD1 A;  5HD5 A;  3LI8 A;  4FTX A;  1EI5 A;  3EEA A;  1S0W A;  3IS2 B;  4S2I A;  3A3D A;  2WAF A;  3T12 B;  4GS9 B;  4PM8 A;  2VA0 A;  1P9W A;  5HWV A;  1IFQ A;  4QPR A;  4C3Q A;  4BD1 A;  3WWX A;  1KVL A;  5IU1 A;  1XJ6 A;  3H82 B;  5FI6 A;  1G6O A;  5EOO A;  3N8R A;  3VFH A;  2W27 A;  1H5X A;  2J80 A;  3SS5 A;  3MF0 A;  5DKL A;  1SDE A;  1KGG A;  2O0Y A;  1QME A;  3K2N A;  2B5R A;  2QJ5 A;  3KSI A;  3MFD A;  1FR1 A;  4HBT A;  5FL3 A;  1A0K A;  1NZU A;  3A3I A;  4GCZ A;  3K3D A;  2IWC A;  4GJ4 A;  3BW6 A;  4CQH A;  1W7F A;  4GLQ A;  3CUE C;  4QD4 A;  4DE3 A;  2R9X A;  2HV1 A;  4KZ5 A;  2XQZ A;  4LPZ A;  4QWO A;  1TS8 A;  2OOL A;  2RL3 A;  3D4F A;  2W3G A;  3C5A A;  3P98 A;  4S2N A;  2Y91 A;  1V9Y A;  1RGZ A;  2GX5 A;  4XT2 B;  4O7D A;  1MPL A;  4HNB A;  1PWD A;  2H28 A;  3UNW A;  3G2Z A;  1OTD A;  1RP5 A;  4P87 A;  2EXB A;  2W3H A;  4R3J A;  3B3X A;  3T4O A;  4ARZ A;  2JKR I;  4NEE D;  1H3Q A;  4BEN A;  1IYP A;  4X56 A;  5JYO A;  4N92 A;  4LCM A;  5L2F A;  1TVF A;  2ZMA A;  4MBK A;  2V8C A;  2EX9 A;  3ITA A;  3CPT B;  2OWJ A;  2L1M A;  2NUT C;  2V8F A;  3K3C A;  3IS2 A;  2ZC5 B;  2GJ3 A;  4LLO B;  4X68 A;  1YLJ A;  3CWF A;  2ZMV A;  2Q0O A;  4MDZ A;  3CJM A;  1DP8 A;  4Y2F A;  2RCX A;  4LV3 A;  4GNU A;  4O01 A;  5E2G A;  3H82 A;  5GL9 A;  4QY5 A;  5E2F A;  2WGW A;  5J4E A;  5F83 A;  5TFQ A;  4RYE A;  1HTZ A;  4IJG A;  5CX7 A;  5AQA A;  4DDS A;  4YOF A;  1UGU A;  4B93 A;  1D1J A;  3G30 A;  5F5Y A;  4EUZ A;  4KG5 A;  2EWV A;  2ZQ9 A;  2WGI A;  3KYQ A;  3SH9 A;  4O0P A;  1FIL A;  1TS7 A;  3G31 A;  1BLH A;  5HFO A;  2A24 B;  4PKY A;  3F1N B;  3ZQ5 A;  4DJ2 A;  3TW8 A;  2WKE A;  3C4P A;  3CZD A;  2V9A A;  2HDS A;  3GRJ A;  5HW3 A;  5HWT A;  1N9N A;  4JGO A;  2ZQC A;  2A49 A;  3CUE A;  4WLA A;  2QWS A;  2LB9 A;  1VQQ A;  4EW7 A;  3IX4 A;  1JWZ A;  5DJT A;  4U0X A;  4E3M A;  1ESU A;  4L9F A;  1XGI A;  4RX2 A;  3VP3 A;  1QMF A;  3TSG A;  3T4T A;  2JBF A;  4BQM A;  3PBO A;  2O9C A;  2M7U A;  1C3B A;  1GA9 A;  1K4E A;  2D01 A;  5E43 A;  5E2H A;  2V0W A;  4MN7 A;  3DW0 A;  3BFD A;  5DTK A;  3LIA A;  3C8C A;  4LGW A;  1YLZ A;  4X1M A;  1KDS A;  1XXM A;  2Y2K A;  2DNS A;  3IX8 A;  1FSW A;  4KQD A;  3ZNT A;  3BFG A;  1E4D A;  1IYO A;  5AQ7 A;  4OQG A;  3IXB A;  1CJF A;  1YMS A;  3LIE A;  5DTT A;  2R78 A;  4OLG A;  4JF4 A;  3UB8 A;  5CGW A;  5J3W A;  4LV2 A;  2Y79 A;  3QP2 A;  3C2W A;  1FIK A;  1T1C A;  4ZJ1 A;  1LL9 A;  4UAA A;  2JKT M;  3RJU A;  3E4P A;  4WEJ A;  2X02 A;  4PPR A;  4NXB A;  2WYX A;  4BBV A;  1GSX A;  3I7J A;  3HUN A;  2DCF A;  1NLZ A;  3C7V A;  3PYP A;  4R0Q A;  1DP9 A;  3PBR A;  2WUQ A;  2Y2N A;  3TRC A;  4R70 A;  3ZG5 A;  4E3K A;  2W3E A;  1W8Y A;  4N1H A;  4L9E A;  3T4K A;  1KVM A;  3MMH A;  2VGJ A;  4FUW A;  3WS4 A;  4QHC A;  1IKG A;  1SKF A;  3CG5 A;  5LBR A;  3BEB A;  1XX2 A;  4NKP A;  3SOI A;  3BRM A;  1CQA A;  3IX3 A;  3FKW A;  3QNB A;  4F3L A;  5HWW A;  1L3L A;  4WN5 A;  2Y8H A;  2HPB A;  1GHP A;  4FCF A;  2ZC7 A;  2XLN A;  4E3J A;  3IXG A;  3WRZ A;  1S6R A;  2XRN A;  1W79 A;  3PAE A;  2IWD A;  3RXW A;  3LO7 A;  1DJC A;  4EWF A;  2PBD P;  2JCH A;  5EE8 A;  1K38 A;  1TEM A;  1Z09 A;  3A0S A;  1I5Q A;  1FCM A;  1CEF A;  4ETZ A;  4EBL A;  1K57 C;  5EVI C;  2OSU A;  4EU0 A;  3LEQ A;  3T50 A;  3S4X A;  3PBS A;  1O7E A;  4WMC D;  1VET B;  3UE0 A;  4WMC A;  1S4R A;  1UWP X;  1ONH A;  2HJ9 C;  5EVI B;  1H0M A;  3NIA A;  4Y7P A;  5A8B A;  3G2Y A;  2Y2H A;  2VV8 A;  3GVB A;  3MQO A;  4HEF A;  2H0T A;  5FI7 A;  3HLD A;  2XSS A;  1TS0 A;  2AVX A;  2PBY A;  2PDR A;  3CAX A;  3IHB A;  5HDC A;  3NY4 A;  1NWZ A;  2JKT I;  2A2L A;  4B4Z A;  2VEA A;  4R6L A;  5FDH A;  4JXW A;  4NXG A;  2EFU A;  3IHA A;  2Z2L B;  4B9O A;  1JVJ A;  4CLC C;  3DTK A;  1XJ2 A;  5M18 A;  2EX2 A;  1SDN A;  2QPN A;  2FFY A;  4R23 A;  3MJQ A;  3A0V A;  4CLC B;  3ZVT A;  1Y54 A;  4WZ5 C;  1BYW A;  5DF7 A;  4UA6 A;  3HCY A;  3CLO A;  4KQO A;  4JF6 A;  5TR7 A;  1CI9 A;  3FG8 A;  3ZNY A;  3MSH A;  1S1Y A;  3MXQ A;  3VFF A;  1LHY A;  1DJA A;  1ERO A;  1XJ3 A;  5I94 A;  1OTI A;  3E2L A;  4P6Z S;  4Q0J A;  2WZZ A;  5FQQ A;  5FQ9 A;  5CEC A;  1LI0 A;  3BFC A;  1X0O A;  2PRF A;  2HF6 A;  3OPL A;  3MR0 A;  4EEP A;  1XJ4 A;  2CC1 A;  4ZAM A;  1K54 C;  3ZG0 A;  3L7H A;  2PU2 A;  1M40 A;  4P6B A;  4I5S A;  3NDE A;  4HJ6 A;  3GSG A;  4MLL A;  3EGX C;  5HAI A;  3LEZ A;  2B18 A;  3FC7 A;  1WA9 A;  4PHT A;  1PI4 A;  3BQ8 A;  1OJ5 A;  1OTE A;  4DMZ A;  3E4Q A;  5EVI D;  2ZMF A;  5HAP A;  4L9G A;  3T4J A;  1BT5 A;  5EVI A;  4K08 A;  1SKO A;  2HP9 A;  2W1T B;  1G68 A;  5EPH A;  1LSW A;  3T4Q A;  3JVV A;  3OOV A;  1ZC2 A;  2EX6 A;  3DAV A;  4P6Z M;  2J3T C;  4EXO A;  2W3D A;  5F6A A;  4H6J A;  3KO6 A;  3G34 A;  5FSR A;  4QY6 A;  4GKU A;  3HJK A;  2P04 A;  4HI4 A;  3VV4 A;  3ZHH A;  1DP6 A;  2VKS A;  1BZA A;  1EW0 A;  3LR5 A;  5KMW A;  4WF0 A;  4DXC A;  1G5U A;  4HES A;  3RFB A;  1LT0 A;  1VM1 A;  2P7J A;  3G35 A;  3BEC A;  5L10 A;  4E6W A;  1MKI A;  2O9A A;  3MZD A;  2JKF A;  2FH5 A;  4CLC D;  1WE4 A;  3T1S A;  2DRW A;  1JTG A;  2X71 A;  3P7N A;  1S4S A;  1OME A;  4ME4 A;  4IUK A;  1CK3 A;  4Y17 A;  3HRE A;  4RVA A;  2INW A;  2VV6 A;  3WS0 A;  4C6Y A;  3LI9 A;  5EOE A;  1NRF A;  4OVD A;  3FV7 A;  2WKP A;  4X55 A;  4OQ0 A;  2ZQA A;  3WRT A;  1K6R A;  2VJW A;  3B42 A;  3GR2 A;  3Q1F A;  1IKI A;  4KUK A;  5F69 A;  4ZJ2 A;  2K31 A;  4A5R A;  3QP6 A;  1YLT A;  4IVI A;  3B47 A;  3S7P A;  3Q82 A;  1GSV A;  1ODV A;  4IVK A;  5F1F A;  2HGV A;  2E8I A;  2JKG A;  4ZTK A;  5KSH A;  2XFT A;  3CMZ A;  2W3F A;  3LR4 A;  4IBR A;  1ZG6 A;  2W1T A;  2ZL1 A;  3O3V A;  1IYQ A;  1MWU A;  5FQI A;  4XXR A;  3GDI A;  1PZP A;  1YSQ A;  2PYP A;  5FAO A;  4ID4 A;  2Y55 A;  3MKE A;  4DF6 A;  5EUA A;  4BBT A;  2KOI A;  1U60 A;  1BLC A;  1YAX A;  2ZQ8 A;  2R9W A;  1IEL A;  2ZOH A;  1BTL A;  1BUE A;  1YMX A;  3BLM A;  4I3A A;  2L0W A;  4HP4 A;  5CER A;  3QP8 A;  3LY4 A;  3BY9 A;  5E2E A;  1YLY A;  2J9P A;  3HL9 A;  2QYB A;  1ZHH B;  3UPO A;  2XH9 A;  1DJB A;  3NI9 A;  4GS9 A;  5AVF A;  3F1P B;  3V3R A;  1NLY A;  2PHY A;  1I2S A;  1KDW A;  4ETX A;  4ESP A;  3HJI A;  1H8M A;  1AWI A;  4WYY A;  2KDK A;  3Q7V B;  4NG2 A;  4XUZ A;  4UHU A;  5A90 A;  3NOU C;  1MXO A;  2QMI A;  1G6A A;  3DTI A;  5DTS A;  1KE3 A;  2ZQD A;  4LCL A;  2D02 A;  4DJ3 A;  4EQI A;  2XGN A;  1O07 A;  1OT6 A;  3JPU A;  4KZ8 A;  4LRZ E;  4DKI A;  4K0W A;  1T1B A;  4FSF A;  5TJJ A;  5GLD A;  1UWN X;  2W0N A;  4C75 A;  1DY6 A;  4KZ9 A;  1PZO A;  4EV4 A;  4PMA A;  1BLP A;  2HJE A;  3FWL A;  3IF5 A;  3OPP A;  5HAR A;  4ZDX A;  4HY8 A;  1VB6 A;  1STZ A;  2DMW A;  4QU3 A;  3UPN A;  1SZV A;  2HDU A;  1ES2 A;  1KGF A;  4BD0 A;  1YQS A;  3HLE A;  2E8J A;  1ES5 A;  4MN5 A;  4XT2 A;  2H5S A;  3BFE A;  1JWP A;  3G4P A;  4Z9Q A;  3VE3 A;  3LIB A;  3QP5 A;  3F1O B;  1CEG A;  5IT5 A;  3GV9 A;  3S1Y A;  3D3O A;  5HDD A;  1ZTU A;  4Y5F A;  1VEU B;  5CXW A;  2P08 A;  3VSK A;  3V3S A;  3E0Y A;  2HDR A;  3FZC A;  4PM9 A;  2G7U A;  1PIO A;  4PAU A;  5DJU A;  1DRM A;  3UDX A;  2ZM8 A;  4G3K A;  3CPT A;  3HLF A;  1PW1 A;  4S2M A;  4MEZ A;  3AGE A;  1SCW A;  3JVU A;  2ZD8 A;  1L0D A;  1LLB A;  1XFN A;  3F1P A;  3O86 A;  1W63 M;  3LYX A;  3E2K A;  5HX9 A;  5C5K A;  5EFW A;  5FEF A;  3DWZ A;  3Q7V A;  2WKQ A;  2YKH A;  2UV0 E;  3FPW A;  4DE0 A;  1ERQ A;  4M4X A;  5HZH A;  1EWZ A;  1XKZ A;  3SH8 A;  3MBZ A;  5GLC A;  3B33 A;  2H10 A;  4S2L A;  4O8G A;  3UMD A;  5GLB A;  3EQV A;  2PR5 A;  2VGL M;  4I3J A;  4YIN A;  1TS6 A;  5F68 A;  3MZE A;  2ZQ7 A;  2A24 A;  3F1N A;  4OQI A;  5HD3 A;  4P0M A;  5L8M A;  3LFV A;  2J3W A;  1Y28 A;  2PYR A;  1RCJ A;  4R38 A;  3DTM A;  3M6H A;  4OQH A;  2XF3 A;  3BQA A;  4JGQ A;  1Y4O A;  3WS2 A;  5L09 A;  1J9M A;  3O5Y A;  4KZ7 A;  4X69 A;  2Z6C A;  4N1X A;  4G3V A;  4LRX C;  1TF1 A;  4KZ6 A;  3TOI A;  1FCO A;  4OP5 A;  4R1G A;  4Q8I A;  2PT7 A;  1KE0 A;  3IF6 C;  3Q81 A;  1YM1 A;  5CED A;  1OTB A;  2V2F F;  2BAS A;  1G28 A;  2LB5 A;  1FSY A;  3P09 A;  2JN7 A;  3NOP C;  3TE8 A;  4HH2 A;  3UO9 A;  3H7W B;  4OOL A;  3IF6 B;  1ZG4 A;  2ZOI A;  3AGF A;  5A91 A;  1BLS A;  3N4I A;  4L0L A;  4OOM A;  1ESI A;  2C5W B;  4M3K A;  5EEC A;  3C38 A;  1NXY A;  2OAQ 1;  3MXR A;  4EER A;  3KYE A;  3KX0 X;  1IOU A;  4CLC E;  4R3A A;  1RGY A;  3ZVW A;  1D06 A;  1SHV A;  5FQJ A;  3A3J A;  5DFY A;  3ISG A;  4WEL A;  2XD5 A;  1TDL A;  4MCW A;  3HVF A;  1XP4 A;  1HVB A;  4E04 A;  1ONG A;  1MWT A;  4DN0 A;  1ACF A;  1KOU A;  5FAS A;  1W5D A;  4KZA A;  4R4S A;  4NXE A;  3W2Z A;  3GTC A;  3QNC A;  4Q0H A;  5GHY A;  4GHI B;  1MZU A;  1FQG A;  3IWI A;  1F5M A;  1GSW A;  2WKH A;  5CTN A;  4MBF A;  4D60 A;  3LR3 A;  5TBM B;  3CHW P;  1L0F A;  4E3I A;  2ZLY A;  1MKM A;  3DWK A;  3WS1 A;  4GW9 A;  4PM5 A;  3LID A;  1WYC A;  1IEM A;  2K2N A;  2OLV A;  2PAV P;  3CIT A;  4JBF A;  3IXD A;  1V9Z A;  3LIF A;  2P9V B;  3NOT C;  1K55 C;  3IH8 A;  1CF0 A;  1NY0 A;  2HP6 A;  3UY6 A;  4U3T A;  4NK3 A;  4WBG A;  3UDI A;  2YKF A;  2M1C A;  4MBH A;  4YWZ A;  4BL2 A;  4IBX A;  1MBL A;  4BWI A;  3LY3 A;  2ZC6 B;  3ITB A;  4GDN A;  2B95 A;  1KE4 A;  4X1L A;  3TG9 A;  1Q2Q A;  4I38 A;  3FYZ A;  3H7W A;  4Z1W A;  1OJG A;  4MMN A;  1NRJ A;  3G6O A;  3V39 A;  2KLI A;  3MQ0 A;  4XUX A;  5TGF A;  3U2A A;  1NYY A;  4OH0 A;  4WEK A;  4Y13 A;  1PWC A;  2VZW A;  5AQB A;  2PR6 A;  4EEU A;  2J8Y A;  4KQQ A;  5HAQ A;  3IT9 A;  5G4Y A;  3IH9 A;  5M19 A;  1E25 A;  1VET A;  4KQR A;  3GMW A;  2EX8 A;  1D7E A;  2C6W B;  4OPR A;  1FCN A;  2HDQ A;  3PR6 A;  1K57 A;  4S2N C;  3VP4 A;  5JYP A;  3PTE A;  3OPH A;  4GOG A;  4PM7 A;  2OV5 A;  4K91 A;  4UA7 A;  3UE1 A;  3P01 A;  3U4L P;  4JXV A;  2VGK A;  2OLU A;  3BFF A;  1GCE A;  4KZ4 A;  5GHX A;  1OT9 A;  3UB5 P;  4GD6 A;  4GHI A;  1MWS A;  4EES A;  3M6B A;  4JF5 A;  3VMA A;  2ZJ9 A;  4HJ4 A;  4E3N A;  3KSF A;  2WGV A;  3VOL A;  2PD7 A;  2WKI A;  4MN6 A;  5I5L A;  3VP0 A;  1BSG A;  3NCK A;  3EOI A;  1FOF A;  1M6K A;  4OPY A;  4R4R A;  4ARZ B;  4UQI S;  1I2W A;  1YSP A;  2Z2M B;  3S22 A;  4CLC A;  3L9K A;  2XFS A;  4GN2 A;  3HLG A;  4RX3 A;  3OCN A;  4N9L A;  4PM6 A;  4Y15 A;  1ZKJ A;  4S2K A;  2W1R A;  5KIZ A;  4BLM A;  5FAQ A;  4P85 A;  2OAP 1;  4DE2 A;  1PYY A;  4BL3 A;  4WZ5 A;  3A0R A;  1K55 A;  3OZH A;  4GZB A;  2WGW B;  4IHQ A;  4WL9 A;  4UQI M;  4S2P A;  2V1A A;  2XEP A;  4LEN A;  3VP1 A;  2Y2L A;  4OON A; 
#chains in the Genus database with same CATH homology
 4BD0 A;  1YQS A;  2Y2J A;  1PI5 A;  3FKW A;  3HLE A;  3QNB A;  1ES5 A;  2H5S A;  1K54 A;  2Y2G A;  1LI9 A;  2Y59 A;  1JWP A;  3BFE A;  3G4P A;  4Z9Q A;  3HLC A;  4JXG A;  2JE5 A;  3V50 A;  4S2O A;  4CJN A;  2HPB A;  2WAE A;  1GHP A;  1NZO A;  4NET A;  5CEB A;  2BLS A;  4FCF A;  2BG1 A;  4JPM A;  1CEG A;  1H8Z A;  2ZC7 A;  4LV0 A;  3VOY A;  2XLN A;  4E3J A;  3IXG A;  3GV9 A;  3S1Y A;  3WRZ A;  1LL5 A;  3ZG7 B;  1S6R A;  1W79 A;  3PAE A;  3W4Q A;  4B88 A;  5CXW A;  2IWD A;  3RXW A;  3VSK A;  3V3S A;  5A93 A;  3LO7 A;  1DJC A;  2HDR A;  2Y2M A;  4EWF A;  3FZC A;  4OP8 A;  2HP5 A;  4PM9 A;  4U0T A;  5EE8 A;  1MY8 A;  1PIO A;  2JCH A;  3SS3 A;  1K38 A;  1TEM A;  1HZO A;  3IXH A;  3W4O A;  1XPB A;  4Y0O A;  1K56 D;  1I5Q A;  2Q9N A;  1CEF A;  1FCM A;  4ZBE A;  3UDX A;  2ZM8 A;  4EBL A;  4R3B A;  1K57 C;  5EVI C;  1K56 A;  3HLF A;  2IWB A;  1N4O A;  4B4X A;  3IQA A;  5FAT A;  2OSU A;  1TDG A;  3VOZ A;  2EXA A;  1JWV A;  1PW1 A;  3S4X A;  3PBS A;  1IYS A;  1O7E A;  4S2M A;  4MEZ A;  4WMC D;  5DVA A;  4FD8 A;  2QZ6 A;  3AGE A;  1SCW A;  4GB7 A;  2ZD8 A;  1L0D A;  3N6I A;  1LLB A;  3UE0 A;  5CHU A;  3Q07 A;  4WMC A;  4MNR A;  3O86 A;  3ZFZ A;  1ONH A;  3E2K A;  5EVI B;  3WS5 A;  5HX9 A;  1KGE A;  1YLP A;  3NBL A;  3NIA A;  4Y7P A;  4N9K A;  4WM9 A;  4QB8 A;  3G2Y A;  2Y2H A;  3DWZ A;  3GVB A;  5F82 A;  3Q7V A;  1K4F A;  4HEF A;  5CGX A;  4DDY A;  2H0T A;  5FI7 A;  4DE0 A;  3HLD A;  3HLW A;  1ERQ A;  2PBY A;  4Y0U A;  3IHB A;  5G18 A;  4X6T A;  5CTM A;  1EWZ A;  3N7W A;  1XKZ A;  3FKV A;  3SH8 A;  3NY4 A;  3HUO A;  3MBZ A;  4H8R A;  5GLC A;  3BLS A;  4B4Z A;  4OOY A;  3N8L A;  2P9V A;  1XA1 A;  2PU4 A;  2XD1 A;  1ERM A;  2H10 A;  2Y2Q A;  4S2L A;  1CI8 A;  1EI5 A;  5FDH A;  1S0W A;  4S2I A;  4FH4 A;  4JXW A;  3BM6 A;  3A3D A;  2WAF A;  5CRF A;  2EFU A;  3IHA A;  5GLB A;  3EQV A;  4PM8 A;  2Z2L B;  5KSC A;  1JVJ A;  5CHJ A;  3MZF A;  4ZJ3 A;  4C3Q A;  3IWO A;  3C7U A;  4YIN A;  4BD1 A;  3WWX A;  1KVL A;  3MZE A;  5M18 A;  1NJ4 A;  2ZQ7 A;  4GDB A;  2EX2 A;  1SDN A;  2QPN A;  2FFY A;  4R23 A;  4OQI A;  1AXB A;  5FI6 A;  5AQ9 A;  5F1G A;  4P0M A;  5EOO A;  3M2K A;  3N8R A;  3VFH A;  3W8K A;  1RCJ A;  2ZC4 B;  1H5X A;  3AGD A;  3DTM A;  3SS5 A;  3M6H A;  4OQH A;  3ZVT A;  2XF3 A;  1Y54 A;  4WZ5 C;  1SDE A;  3SOI A;  3UPP A;  1KGG A;  5DF7 A;  3WS2 A;  4UA6 A;  1J9M A;  2JC7 A;  4KZ7 A;  4X69 A;  4EBN A;  4KQO A;  5CHM A;  5EVL A;  4JF6 A;  5TR7 A;  1CI9 A;  3ZNY A;  4N1X A;  1L2S A;  1GHM A;  3VFF A;  1QME A;  4KZ6 A;  2B5R A;  3TOI A;  1LHY A;  1DJA A;  1ERO A;  1FCO A;  3MFD A;  2WK0 A;  3ZDJ A;  1ES3 A;  3MXS A;  5I94 A;  1FR1 A;  4OP5 A;  4R1G A;  4Q8I A;  1KE0 A;  3IF6 C;  4HBT A;  4RA7 A;  1NZU A;  1XA7 A;  2G2U A;  3A3I A;  1PW8 A;  3E2L A;  3Q81 A;  4BJP A;  1YM1 A;  4KZ3 A;  5FAP A;  5CED A;  2V2F F;  5FQQ A;  2IWC A;  2WZZ A;  1FSY A;  5FQ9 A;  5CEC A;  1LI0 A;  3BFC A;  3P09 A;  2ZM2 A;  1W7F A;  4QD4 A;  3OPL A;  2XK1 A;  4DE3 A;  1Q2P A;  2CC1 A;  3PBT A;  4ZAM A;  1K54 C;  3UO9 A;  3ZG0 A;  2R9X A;  4OOL A;  2PU2 A;  3IF6 B;  1M40 A;  1ZG4 A;  3AGF A;  5A91 A;  1BLS A;  3N4I A;  3IWQ A;  4KZ5 A;  2XQZ A;  2ZM0 A;  4L0L A;  4OOM A;  4P6B A;  1ESI A;  3NDE A;  2X01 A;  3QHY A;  2XDM A;  4DRT A;  2C5W B;  2RL3 A;  3D4F A;  4M3K A;  5EEC A;  3C5A A;  3P98 A;  3GSG A;  4S2N A;  2Y91 A;  1NXY A;  3MXR A;  4MLL A;  3LEZ A;  4S2J A;  5HAI A;  3OCL A;  3VSL A;  1RGZ A;  1PI4 A;  2EFX A;  2H0Y A;  5EVI D;  1RGY A;  3ZVW A;  4O7D A;  1MPL A;  4KZB A;  2UWX A;  5HAP A;  1SHV A;  3SS4 A;  1PWD A;  1BT5 A;  5EVI A;  5FQJ A;  3UNW A;  3A3J A;  3G2Z A;  2HP9 A;  1G68 A;  2J9O A;  5EPH A;  1GHI A;  3ISG A;  3O87 A;  4OPQ A;  1ALQ A;  2P74 A;  4WEL A;  1RP5 A;  2XD5 A;  2EXB A;  4P87 A;  1TDL A;  1ZC2 A;  4R3J A;  2EX6 A;  3B3X A;  3HVF A;  1XP4 A;  4E3L A;  1HVB A;  4F94 A;  4BEN A;  1IYP A;  1ONG A;  1MWT A;  4X56 A;  5JYO A;  4N92 A;  4LCM A;  3G34 A;  5FSR A;  4QY6 A;  5GLA A;  5L2F A;  4GKU A;  1TVF A;  2ZMA A;  4MBK A;  4E6X A;  5FAS A;  1W5D A;  1WYB A;  4KZA A;  4R4S A;  2EX9 A;  3ITA A;  3ZHH A;  3HUM A;  3GTC A;  3QNC A;  5GHY A;  2ZC5 B;  1BZA A;  4OKP A;  2A3U A;  5KMW A;  4KG2 A;  4X68 A;  1YLJ A;  4DXC A;  1E3U D;  1FQG A;  3IWI A;  4HES A;  4LV1 A;  3CJM A;  3PAG A;  4OLD A;  1VM1 A;  2Q9M A;  2RCX A;  4LV3 A;  3SH7 A;  5A92 A;  1E3U A;  3G35 A;  1FR6 A;  3BEC A;  2WKH A;  4GNU A;  4E6W A;  5CTN A;  4MBF A;  5E2G A;  1MKI A;  3MZD A;  5GL9 A;  3LCE A;  4QY5 A;  3HBR A;  3N8S A;  5E2F A;  2WGW A;  4YFM A;  4E3O A;  1L0F A;  5F83 A;  4E3I A;  2ZLY A;  1WE4 A;  3DWK A;  3ZCZ A;  5GHZ A;  3RXX A;  2DRW A;  5TFQ A;  3WS1 A;  1JTG A;  4PM5 A;  2X71 A;  3O88 A;  3BYD A;  4RYE A;  4DXB A;  1WYC A;  1OME A;  1IEM A;  5BOH A;  1HTZ A;  1W8Q A;  1Z6F A;  3UDF A;  1CK3 A;  2OLV A;  3HRE A;  5AQA A;  4DDS A;  4RVA A;  5FQK A;  4D2O A;  4JBF A;  3IXD A;  3NDG A;  2P9V B;  3G30 A;  3WS0 A;  3GQZ A;  4C6Y A;  5EOE A;  1NRF A;  4OVD A;  4EUZ A;  3FV7 A;  1K55 C;  3IH8 A;  1NY0 A;  2HP6 A;  4KG5 A;  4WZ4 A;  4OQ0 A;  4X55 A;  2ZQA A;  3UY6 A;  3WRT A;  4U3T A;  2ZQ9 A;  4NK3 A;  4WBG A;  2V1Z A;  3UDI A;  4MBH A;  4BL2 A;  3A3E A;  2WGI A;  5FI2 A;  1K6R A;  3OPR A;  3SH9 A;  1MBL A;  3GR2 A;  3Q1F A;  3LY3 A;  2ZC6 B;  3ITB A;  4GDN A;  1BUL A;  4IBX A;  1IKI A;  3G31 A;  1KE4 A;  3TG9 A;  4EBP A;  1Q2Q A;  4K0X A;  4ZJ2 A;  4GD8 A;  4A5R A;  1BLH A;  4X53 A;  1YLT A;  5HFO A;  3FYZ A;  4UA9 A;  2V20 A;  2WKE A;  3C4P A;  1YLW A;  3CZD A;  4IVI A;  2HDS A;  3GRJ A;  3V39 A;  5HW3 A;  5D3O A;  4XUX A;  5TGF A;  3Q82 A;  1NYY A;  3MKF A;  1MWR A;  4IVK A;  4OH0 A;  5F1F A;  2ZQC A;  2A49 A;  3ZG9 B;  5HL1 A;  2E8I A;  4WEK A;  5J8X A;  1PWC A;  4ZTK A;  4KG6 A;  5CGS A;  5AQB A;  5M1A A;  1VQQ A;  1JWZ A;  5KSH A;  2XR0 A;  2J8Y A;  4KQQ A;  5HAQ A;  3PBQ A;  3IT9 A;  2XFT A;  3CMZ A;  2J7V A;  3IH9 A;  5M19 A;  1E25 A;  4IBR A;  1ZG6 A;  4KQR A;  4U0X A;  3GMW A;  2EX8 A;  4E3M A;  3O3V A;  1ESU A;  1IYQ A;  1MWU A;  1XGI A;  2C6W B;  4RX2 A;  3VP3 A;  5FQI A;  4XXR A;  4OPR A;  1FCN A;  2HDQ A;  1K57 A;  1PZP A;  4QJG A;  1L0G A;  4S2N C;  1QMF A;  3TSG A;  3VP4 A;  3PTE A;  5JYP A;  3OPH A;  2Y2O A;  4GOG A;  2JBF A;  5FAO A;  4ID4 A;  4PM7 A;  2Y55 A;  4BQM A;  3MKE A;  4DF6 A;  5EUA A;  3PBO A;  2OV5 A;  4K91 A;  1U60 A;  1BLC A;  4UA7 A;  3UE1 A;  2ZQ8 A;  3W4P A;  2R9W A;  1IEL A;  1BTL A;  1BUE A;  1C3B A;  1GA9 A;  2I72 A;  5U47 A;  1YMX A;  1K4E A;  2VGK A;  3BLM A;  4JXV A;  1NYM A;  5E43 A;  5E2H A;  2OLU A;  5DF9 A;  3DW0 A;  3BFD A;  5DTK A;  3BFF A;  5IHV A;  1YT4 A;  1GCE A;  4KZ4 A;  3NC8 A;  5GHX A;  1JTD A;  1YLZ A;  5CER A;  4GD6 A;  2FFF B;  1MWS A;  1KDS A;  3LY4 A;  3M6B A;  1XXM A;  4JF5 A;  2Y2K A;  2ZJ9 A;  2DNS A;  3VMA A;  4IED A;  4E3N A;  5E2E A;  1FSW A;  1YLY A;  2WZX A;  2J9P A;  4JLF A;  2WGV A;  3OC2 A;  1HD8 A;  3HL9 A;  3BFG A;  3ZNT A;  1PWG A;  3UPO A;  1E4D A;  1GA0 A;  2XH9 A;  2WKI A;  2Y2I A;  3HLB A;  2GDN A;  1DJB A;  3NI9 A;  4DE1 A;  1IYO A;  2Y2P A;  5DF8 A;  2G2W A;  5FQM A;  1BSG A;  3NCK A;  3VP0 A;  5AQ7 A;  5FA7 A;  3V3R A;  3A3F A;  1FOF A;  1I2S A;  4OQG A;  1M6K A;  3IXB A;  4OPY A;  1YMS A;  1KDW A;  4FH2 A;  5DTT A;  4JKT A;  4R4R A;  1I2W A;  4OLG A;  4OPZ A;  2ZC3 B;  4WYY A;  4JF4 A;  3ZGA B;  3V5M A;  5CGW A;  4LV2 A;  3JYI A;  5KZH A;  3Q7V B;  4XUZ A;  3PBN A;  1K25 A;  4JXS A;  3UE3 A;  2Z2M B;  3S22 A;  4Y0T A;  3EQU A;  1XGJ A;  4UHU A;  4ZJ1 A;  1LL9 A;  2XFS A;  4UAA A;  5A90 A;  1MXO A;  3RJU A;  3G32 A;  2QMI A;  4GN2 A;  3HLG A;  4WEJ A;  4RX3 A;  2X02 A;  1G6A A;  3OCN A;  4N9L A;  4PM6 A;  5DTS A;  1KE3 A;  1ZKJ A;  4S2K A;  2ZQD A;  4LCL A;  4PPR A;  2Y4A A;  3Q7Z A;  3C4O A;  4BLM A;  5FAQ A;  4EQI A;  3VP2 A;  2WYX A;  2XGN A;  4HBU A;  4KEN B;  1O07 A;  3I7J A;  3UN7 A;  3HUN A;  4P85 A;  4DE2 A;  1H8Y A;  4KZ8 A;  2DCF A;  4DKI A;  1PYY A;  1N9B A;  3C7V A;  4K0W A;  4R0Q A;  4FSF A;  3PBR A;  4WZ5 A;  4BL3 A;  5GLD A;  2WUQ A;  2Y2N A;  1ES4 A;  4C75 A;  1DY6 A;  4KZ9 A;  1L0E A;  1PZO A;  1K55 A;  3ZG5 A;  4EV4 A;  4E3K A;  1W8Y A;  4N1H A;  3OZH A;  3M2J A;  1BLP A;  4GZB A;  2WGW B;  4PMA A;  3FWL A;  3IF5 A;  3OPP A;  3ZG8 B;  1K6S A;  1KVM A;  5HAR A;  4ZDX A;  2VGJ A;  4S2P A;  4QU3 A;  4QHC A;  3UPN A;  3WS4 A;  1IKG A;  3IF6 A;  2XEP A;  2HDU A;  4LEN A;  1ES2 A;  3VP1 A;  1SKF A;  3CG5 A;  3BEB A;  4CPK A;  1KGF A;  1XX2 A;  2Y2L A;  3BRM A;  4OON A;  2WAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...