2B5RA

1b lactamase / b lactamase inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVYNSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding Hot Spots in the TEM1-BLIP Interface in Light of its Modular Architecture.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase TEM
total genus 92
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2b5rA00
4E6XA 4MBKA 4DXBA 3W4PA 5FAPA 1SCWA 4GNUA 4N92A 4IVKA 1ONGA 4S2LA 1LLBA 1XKZA 5A90A 2Y4AA 1FOFA 5F1FA 1NZUA 5E2EA 5CTNA 2X02A 4KENB 5FATA 5M1AA 3OPRA 4C6YA 3A3FA 1JTGA 2FFFB 3HUNA 5FQMA 2WYXA 3WWXA 1FCMA 3QNCA 1YLJA 1YMXA 5TGFA 4ID4A 3PBOA 2UWXA 1BLCA 2Z2LB 3A3DA 2J8YA 3GVBA 4S2MA 4RX3A 4WEJA 5AQ7A 3RXWA 3FWLA 5HAPA 4YINA 1LL5A 3N4IA 2ZD8A 1GHIA 2QMIA 3WS2A 1PYYA 1NY0A 4GD8A 4GKUA 4RYEA 2XQZA 4MNRA 3HLBA 1MY8A 3FYZA 2XEPA 1BLSA 2Y2JA 3HLFA 5FI6A 5FSRA 5U47A 1CK3A 1RP5A 3ZVTA 2RL3A 4R3BA 2HDUA 3G30A 3OPLA 5A93A 2EX9A 4JKTA 4F94A 3V50A 1OMEA 4JPMA 4GB7A 3SH8A 1H5XA 1K57A 4QY5A 3IT9A 4OPQA 1W79A 3HLWA 3IXBA 5JYPA 4IBRA 4ZAMA 1Q2QA 3LEZA 4ZJ1A 4Q8IA 2IWCA 3HLEA 3ZG9B 1MWTA 5HAQA 4LCMA 3I7JA 1BLHA 1G68A 3GTCA 5KSHA 3PTEA 1LL9A 1FCNA 2OLVA 2HP5A 1GHPA 3BLSA 4JBFA 4WEKA 1K4EA 1KVLA 1YLTA 1W8YA 5FQKA 5GLCA 3UDFA 4BQMA 3M2JA 3UPPA 1K55C 3C5AA 3UDXA 1N9BA 3AGEA 4E3NA 1SKFA 3PBSA 4WZ5C 5F1GA 2Y2PA 4EV4A 2WUQA 2V1ZA 2V20A 1FSWA 2PU2A 1IEMA 3DW0A 1HD8A 3MXSA 1HTZA 1ZG4A 3TOIA 1AXBA 3C7VA 4X68A 1IKIA 2JCHA 3PAGA 3BFGA 1YLYA 2H5SA 2BLSA 3IH9A 4EWFA 2XLNA 1PIOA 2Y2NA 2IWDA 2Y2KA 3SS4A 3S4XA 5FQQA 5G18A 4FD8A 3W4OA 2XD1A 1BUEA 1KDWA 1QMFA 5A91A 3ZCZA 1YLPA 4WBGA 1E4DA 1VM1A 5GLDA 3ZFZA 1K56A 3BFCA 3UNWA 3GRJA 2G2WA 4BL2A 1PZPA 5L2FA 1QMEA 3UE0A 1K25A 3HLDA 3TG9A 1GA9A 5F82A 5EOEA 5E2FA 3BM6A 4OP8A 1WYBA 2XD5A 3UN7A 3VSKA 1KGGA 1H8ZA 2QPNA 4JXVA 4JLFA 4UAAA 4BLMA 4R1GA 5KSCA 3N8SA 4FCFA 4OLGA 4U3TA 5CGWA 4BD1A 4HEFA 4XUZA 1O07A 3PBTA 4P85A 3JYIA 2Y2MA 3MKFA 4WMCD 5CGXA 2R9XA 3E2KA 1KE3A 3V39A 2IWBA 1PWCA 4WELA 1XGJA 2EX8A 4QD4A 1KGFA 5IHVA 3O3VA 2A49A 4X6TA 4DRTA 3SH7A 3ZG8B 4QJGA 3N8LA 2DCFA 3TSGA 3M6HA 4YFMA 4RX2A 4Y0UA 4KG5A 4QU3A 3ZGAB 4KZ4A 4LV0A 5EECA 1L0GA 2ZQ8A 4OQ0A 4GD6A 5FAQA 1GCEA 4B88A 1XX2A 4Y7PA 5DVAA 1K55A 1Q2PA 3EQUA 5DTTA 3ZHHA 2J9PA 4MBFA 1NZOA 5GLBA 3PBNA 5CERA 3G35A 3UE3A 5GHXA 4ZDXA 1YMSA 5GLAA 3W8KA 4E3LA 5E2HA 3IH8A 3NY4A 4U0XA 3ZG0A 1S6RA 1FQGA 3WS4A 4EQIA 4HBTA 3BFFA 1ESIA 4OH0A 5GHZA 3IXGA 3HVFA 3VP0A 2EFXA 3C4PA 3VP2A 1BLPA 4EBNA 3WS0A 1YM1A 1IELA 3G32A 5EVIC 4KZ7A 5CHMA 2WKIA 1RGZA 1JTDA 4X53A 5GHYA 1PI5A 2ZC4B 2XDMA 4WZ4A 3UY6A 3V5MA 1ZG6A 3FZCA 5GL9A 4R23A 4OVDA 1O7EA 4K91A 2Y91A 2VGJA 3S1YA 3UO9A 3GR2A 4JF6A 1PW1A 3RXXA 1YLZA 3UDIA 2Y2HA 1ZC2A 5EVIB 3W4QA 3Q82A 3HUOA 3VFFA 2EX2A 3AGFA 5FA7A 3M2KA 4UHUA 1MXOA 5I94A 4GZBA 1W5DA 2Y2GA 4OPYA 3UPOA 4KQRA 1ES2A 1XPBA 1K56D 2DNSA 4WM9A 4H8RA 4R3JA 4EBLA 4OONA 4IEDA 3ZNTA 2ZQDA 4E3MA 4OP5A 4Y0TA 2Z2MB 4R4RA 1XA1A 4JF5A 1GHMA 3P98A 3GSGA 3OZHA 1ESUA 1TEMA 1DJBA 1VQQA 5EVLA 5FAOA 1BULA 2WK0A 2Y59A 2PU4A 4KZ5A 4JXGA 3IF6A 1NYYA 3NI9A 1SDNA 1ZKJA 2BG1A 4BD0A 4JXSA 3MBZA 5FI2A 4KQOA 2ZQCA 5DF7A 3ZNYA 1FSYA 2HDQA 4OPZA 1H8YA 4P0MA 2P74A 5FI7A 2ZQ9A 2WZXA 4PPRA 2X01A 4OQGA 4KZ6A 5CTMA 5EUAA 3EQVA 1JWZA 2RCXA 3NCKA 3IHBA 2H0TA 2HP9A 2OSUA 2WKEA 2Y2LA 5TR7A 2HPBA 5CXWA 4WYYA 3ZDJA 1ERQA 2G2UA 1SHVA 2Q9NA 1IYPA 4S2NA 4DE3A 3FKWA 5FQIA 1CI9A 1DJAA 2X71A 4LENA 4CJNA 2EXAA 3CMZA 2EX6A 3M6BA 3GV9A 1PWGA 1K4FA 1Y54A 3PBRA 4OOMA 5D3OA 3OCLA 5EVID 3BRMA 4GN2A 4QB8A 1PWDA 3Q7VA 5CEDA 4X69A 4IVIA 3HUMA 4FSFA 3UPNA 4DE2A 2ZMAA 3DTMA 2HP6A 1JVJA 2JC7A 2Q9MA 4OQIA 4DDSA 1ES5A 4M3KA 2PBYA 4X55A 4DXCA 5M19A 4K0XA 3O86A 4KZBA 3BFEA 4HBUA 4PM7A 4B4XA 4N9LA 3CG5A 5EVIA 4FH2A 3ZG7B 3LY3A 1L0DA 3A3IA 3CJMA 2ZC7A 4WZ5A 3Q1FA 4LCLA 3ZVWA 4DKIA 5TFQA 3V3SA 4S2KA 1EWZA 1XP4A 3HLGA 4KZ3A 1ONHA 4EUZA 3IXHA 3O87A 5KMWA 2ZC6B 4R0QA 1BTLA 1IYQA 1FR6A 3NIAA 5AQBA 3P09A 3NDEA 2CC1A 4N9KA 3MFDA 1HZOA 2WKHA 3GQZA 5CECA 5BOHA 1CEGA 1LI9A 1EI5A 1MPLA 4E3IA 4OOLA 2WAFA 4UA9A 3N6IA 4OQHA 1W7FA 3IF5A 3O88A 1DY6A 2XF3A 2WGWA 4DE1A 3IWQA 2XR0A 4EBPA 5HFOA 1DJCA 1C3BA 2H10A 4KQQA 3VOZA 2V2FF 3DWZA 3G31A 1EROA 3G2ZA 1CI8A 3LO7A 4PM6A 3SS3A 1TDLA 4CPKA 3IWOA 3Q7ZA 5AQAA 3RJUA 3IHAA 1YLWA 1MWRA 4RVAA 4XUXA 1L0FA 4LV3A 4LV2A 5HL1A 2WAEA 1E25A 4KG2A 4Y0OA 1E3UA 2XGNA 3A3EA 3BFDA 2HDRA 3FV7A 4KZ8A 4PM8A 4ZJ2A 4C3QA 4U0TA 1FR1A 3OC2A 4MBHA 2ZM2A 5E2GA 4DE0A 2R9WA 3HREA 4R4SA 5HX9A 2J9OA 5EOOA 3C4OA 3G4PA 2ZQ7A 3WS5A 4UA7A 2XK1A 2WZZA 3NDGA 2OV5A 3E2LA 4XXRA 1RGYA 1S0WA 2QZ6A 3BLMA 2FFYA 1XA7A 4OPRA 1XGIA 1E3UD 2ZQAA 4S2IA 4ZJ3A 1BSGA 3VP3A 3A3JA 2I72A 2Y2OA 3MZDA 4S2NC 3BEBA 1J9MA 4PMAA 3BECA 2ZLYA 2XFSA 3OPPA 4X56A 5CEBA 3IXDA 5FDHA 1PZOA 1W8QA 4PM9A 5EE8A 1YQSA 1LI0A 3IQAA 5DF8A 3HBRA 4D2OA 4S2JA 5FQJA 2C5WB 1HVBA 4N1HA 1NYMA 3NBLA 5EPHA 2EXBA 4S2OA 1CEFA 3VMAA 3MXRA 3LY4A 3N7WA 5DF9A 1K38A 1JWVA 3GMWA 3QHYA 1IYSA 1I2WA 4Z9QA 3Q07A 4WMCA 2ZC5B 4KZ9A 2JBFA 5E43A 5AQ9A 3SH9A 1K6SA 4OKPA 4HESA 5CGSA 4B4ZA 2WGVA 1FCOA 1PI4A 4A5RA 3OPHA 1ERMA 1KVMA 4S2PA 4C75A 2B5RA 1K54C 1WYCA 1NXYA 3ITAA 4P87A 1M40A 3OCNA 5F83A 4IBXA 5FASA 5HARA 3C7UA 2HDSA 3MZFA 4FH4A 2Y2QA 4MLLA 3S22A 3AGDA 4OOYA 3VP1A 4NETA 4BL3A 4NK3A 4DDYA 4BENA 4P6BA 3IWIA 1KDSA 1YT4A 5CHUA 4ZBEA 1Z6FA 3PAEA 4UA6A 2XFTA 3G2YA 3WS1A 1M6KA 4QHCA 5DTKA 4DF6A 3PBQA 4KZAA 1KE0A 1MBLA 3ITBA 2WADA 1WE4A 3SOIA 3VOYA 5KZHA 3LCEA 1G6AA 1BZAA 3HL9A 3V3RA 3ISGA 4ZTKA 1GA0A 2XH9A 1KE4A 1BT5A 3Q7VB 4GOGA 3VFHA 3IF6C 1K57C 2E8IA 2H0YA 4JF4A 4KG6A 2Y55A 4LV1A 3VSLA 1PW8A 5FQ9A 3N8RA 3QNBA 3HLCA 2JE5A 1SDEA 1LHYA 2J7VA 3SS5A 1TVFA 2VGKA 1ES3A 1I5QA 2DRWA 1TDGA 4N1XA 2P9VA 3WRTA 1XXMA 1ALQA 1MKIA 2A3UA 3UE1A 3DWKA 4RA7A 2OLUA 5HW3A 2ZC3B 1NRFA 2Y2IA 2ZJ9A 4OLDA 1JWPA 5JYOA 2P9VB 4K0WA 2WGIA 4QY6A 5A92A 3IF6B 2EFUA 5CHJA 1IYOA 2GDNA 3BYDA 3MZEA 5CRFA 4E3KA 3G34A 1N4OA 2C6WB 3B3XA 3NC8A 1L2SA 1U60A 3VP4A 4E3OA 1I2SA 4E6WA 4GDBA 1MWSA 4GDNA 1L0EA 3MKEA 3Q81A 2ZM0A 4L0LA 3WRZA 3FKVA 4BJPA 1NJ4A 1K54A 1K6RA 1ES4A 3D4FA 5J8XA 2ZM8A 4PM5A 2WGWB 4MEZA 5DTSA 1MWUA 4E3JA 3CZDA 4JXWA 4O7DA 5HAIA 3ZG5A 5M18A 1KGEA 1IKGA 1RCJA
chains in the Genus database with same CATH superfamily
4LRZE 4DXBA 4DJ2A 2VLGA 3LIFA 1XKZA 3EEHA 4YNRA 2ACGA 5FATA 2K31A 1JTGA 3HUNA 3WWXA 3NOPC 5TGFA 3CAXA 3KYZA 3FWLA 4YINA 1LL5A 2V1BA 2VX8A 3N4IA 2D02A 2PR6A 2VJWA 1PYYA 4HOIA 1NY0A 3D3OA 2L0WA 1KOUA 2XEPA 2EX9A 4JKTA 4GB7A 1H5XA 4OPQA 2L1MA 1N9LA 3LR3A 3T50A 3EGXC 4ZJ1A 4LCMA 3I7JA 1LL9A 4EW7A 1GSXA 2OLVA 2ZOHA 3BLSA 4L9EA 4JBFA 1YLTA 1KVLA 4BQMA 4I3JA 3M2JA 1K55C 1SKFA 2B18A 2JKGA 5CX7A 4CLCD 2V1ZA 1HD8A 2A24A 4NKPA 3MS6A 4HIAA 1AXBA 2PYPA 4X68A 3PAGA 4ETXA 3BFGA 3FPVA 2BLSA 2XLNA 2LB9A 2Y2NA 3U2AA 2V0UA 5FQQA 4FD8A 3W4OA 1BUEA 1XJ2A 5A91A 3ZCZA 2QJ5A 3ZFZA 5FL3A 4Q0HA 3UNWA 3GRJA 1PZPA 3NHQA 1K25A 3HLDA 4I5SA 1GSWA 3ULFA 3VSKA 3LIAA 1KGGA 4JXVA 4U3TA 2P08A 1O07A 3PBTA 4P85A 2VGLM 2Y2MA 4WMCD 2R9XA 3SZTA 2IWBA 1PWCA 1XGJA 4GS9A 1KGFA 2B02A 4HP4A 1BYWA 3N8LA 4QJGA 2DCFA 4YFMA 3LIEA 2QWSA 3LI9A 3IBJA 4FUWA 5HWTA 4Y7PA 3EQUA 5DTTA 2J9PA 3TJZC 1NZOA 2KX6A 3G35A 3MQOA 3UE3A 1AWIA 3W8KA 1S6RA 2K2NA 2W0NA 1ESIA 2PT7A 1FIKA 3IXGA 3VP2A 1BLPA 3WS0A 1IELA 2YKHA 4KZ7A 5HZHA 4WZ4A 3UY6A 1ZG6A 2J3TC 1O7EA 3D72A 4K91A 2Y91A 2HJEA 3S1YA 3LR0A 2P04A 4JF6A 4BBVA 1PW1A 3KSHA 3W4QA 3Q82A 3HUOA 5I94A 4GZBA 2R78A 1ES2A 1K56D 3T1RA 4OONA 4IEDA 1STZA 2L4RA 3KYQA 1YAXA 3PXPA 2LB5A 2M1CA 3E0YA 5EVLA 3IF6A 4G3KA 2PDRA 3NI9A 1SDNA 2BG1A 3GDIA 3F1OA 4OPZA 2HDQA 5FI7A 4P0MA 2P74A 3CHWP 4PPRA 2BTFP 1DP8A 4KZ6A 4NG2A 3EQVA 3IHBA 2HP9A 4B93A 1DJAA 2X71A 3CUEC 1PWGA 1Y54A 3OCLA 5EVID 4QB8A 5CEDA 3UPNA 3HUMA 4DE2A 3DTMA 4DDSA 5HSQA 2PBYA 3CWFA 3IS2A 5M19A 4II7A 3CG5A 4HH3A 5EVIA 2W1RA 1MC0A 4LCLA 5F68A 3UB5P 3HLGA 4KZ3A 1YPRA 5L07A 1IYQA 1FR6A 5HD5A 3P09A 2CC1A 5BOHA 4OOLA 2WAFA 4UA9A 5IU1A 3IF5A 1DY6A 2XF3A 3IWQA 5HFOA 2H10A 2VGLS 4KQQA 4XT2A 3DWZA 3LO7A 4KUOA 3O5YA 4HP9A 3RJUA 4RVAA 5HL1A 4HQAA 1NRJA 4ZJ2A 3FV7A 4PM8A 2HZ5A 2FH5A 2BASA 2ZM2A 5E2GA 4DE0A 1T1AA 5EOOA 3C4OA 3G4PA 2YKFA 2ZQ7A 4UA7A 3LFVA 4WUJA 2QZ6A 3BLMA 2FFYA 1XA7A 3CUEA 4MN6A 1E3UD 4OPRA 4S2IA 4ZJ3A 3LGOA 1BSGA 1OT6A 2Y2OA 1N9OA 2AVXA 2XFSA 1TS0A 4X56A 3V67A 1OJ5A 3IXDA 3C8CA 3DBAA 5EM0A 4PM9A 2P7JA 2JKRM 4D2OA 3OOVA 3IX3A 3T4TA 4YOFA 3LY4A 1P9WA 1XJ3A 3P7NA 3QHYA 5F69A 1IYSA 1DRMA 1MZUA 4HESA 5DFYA 3OPHA 1ERMA 1NXYA 2ZMFA 4IBXA 5FASA 1S4SA 3MZFA 4JGQA 2UV0E 4BL3A 4UA6A 1M6KA 3H7WA 3PBQA 1ZTUA 1KE0A 1XFNA 4KZAA 2VK3A 1TF1A 3LCEA 3HL9A 3V3RA 3ISGA 1KE4A 3Q7VB 4GOGA 2OOLA 4LV1A 1PW8A 3LEQA 2VGKA 1S1ZA 2OWHA 4O8GA 3PR6A 1UGUA 2W3GA 1MKIA 3UE1A 4Y3IA 1OTEA 5EVEA 4GS9B 3DAVA 4RA7A 5MC7A 2Y2IA 2ZJ9A 4OLDA 5FEFA 1L3LA 2P9VB 5A92A 5CHJA 1IYOA 2GDNA 3F1NA 3UE6A 1YSPA 2C6WB 4E3OA 2VV7A 3VP4A 3BQAA 5K5BA 1L0EA 3MKEA 4BWIA 4L0LA 3WRZA 3C38A 5KIZA 5J8XA 2WGWB 5FEGA 4O7DA 4HJ3A 4C6YA 3E2KA 5FQ9A 4E6XA 1SCWA 1ONGA 3ZQ5A 2Z6CA 1PRQA 1NZUA 3IBRA 5CTNA 4KENB 2FFFB 3H82B 4KQDA 1ACFA 4ID4A 2NUPC 4S2MA 5HAPA 4R70A 3WS2A 2XQZA 3HLBA 3HLFA 5IT5A 5U47A 3KO6A 3SH8A 3IT9A 4IBRA 2EWVA 3LEZA 2PHYA 2IWCA 2KOIA 3T4QA 1MWTA 1BLHA 3GTCA 3UMEA 2CMNA 2VV8A 4WEKA 3T1XA 5TBMA 3UPPA 3C5AA 3UDXA 1N9BA 4E3NA 5G4YA 4WZ5C 4PKYG 5F1GA 5HDDA 2Y2PA 5C5KA 4EV4A 2WUQA 2PU2A 3DW0A 1S67L 2VZWA 3TOIA 3C7VA 2JCHA 2H5SA 1T1CA 1PIOA 2Y2KA 3K3DA 4HY8A 1KDWA 4R38A 5GLDA 1K56A 4E04A 2PR5A 5L2FA 3UE0A 4DN0A 1GA9A 2VEAA 3MMHA 3BM6A 4R6LA 3QP4A 2XD5A 1FILA 3NJAA 1H8ZA 4UAAA 1DP6A 4WL9A 5KSCA 3N8SA 4FCFA 4OLGA 5CGWA 4BD1A 4DMZA 3EEAA 5HL6A 3TSGA 4RX2A 4KG5A 2JN7A 4QU3A 3ZGAB 4KZ4A 4LV0A 2ZQ8A 4OQ0A 4GD6A 4B88A 1XX2A 3ZHHA 3PBNA 5CERA 2IA2A 3C30A 4ZDXA 3LICA 4E3LA 5E2HA 3IH8A 3NY4A 4U0XA 3ZG0A 3WS4A 4EQIA 3CPTA 4OH0A 3VP0A 3C4PA 3MJQA 2D01A 3G32A 1CF0A 4JGOA 4X53A 1W63M 1PI5A 2ZC4B 3FPWA 4R23A 5A8BA 2VGJA 3GR2A 5J7EA 3UDIA 5EVIB 3AGFA 5FA7A 3PYPA 1MXOA 4Y15A 1G5UA 4IHQA 3A0VA 5AVEA 4EETB 4H6JB 4WM9A 2QHKA 4H8RA 3TW8A 4E3MA 2ZQDA 1PNEA 4Z1WA 3GSGA 2Q0OA 2WK0A 2Y59A 2PU4A 4KZ5A 5FDSA 4MMNA 3F1NB 2GX5A 1ZKJA 5FI2A 4KQOA 1FSYA 2WZXA 4OQGA 5CTMA 1JWZA 2H0TA 2OSUA 2O99A 2HPBA 4WYYA 3ZDJA 2PAVP 1T19A 1IYPA 4S2NA 4Y13A 1CI9A 4B9OA 3CMZA 2EX6A 3M6BA 1K4FA 3PBRA 4X69A 3R4KA 2ZMAA 3DTIA 2HP6A 4MN5A 4OQIA 2H28A 3O86A 4HBUA 4PM7A 3T4SA 4B4XA 4N9LA 2Y79A 3ZG7B 3S7OA 3BJNA 2ZC7A 3Q1FA 4Q0IA 2WKQA 3V3SA 1XP4A 3OLOA 2JKTM 3LIDA 2ZBBA 5KMWA 1BTLA 5AQBA 3IX4A 4E3IA 1MPLA 3QP8A 4P6ZS 4NXBA 2WGWA 4DE1A 2HF6A 4EBPA 3K2NA 3VOZA 3SS3A 1EROA 3G2ZA 1TDLA 3Q7ZA 1TD5A 3IHAA 1MWRA 4LV3A 4QPRA 5HWVA 4KG2A 2XGNA 3A3EA 3BFDA 4KZ8A 4U0TA 1FR1A 4MBHA 2O0YA 3W2ZA 3QP6A 5HX9A 3HREA 2HJ9C 3R7WB 2V8CA 2WZZA 1K0KA 3E2LA 4EQ1A 2W3EA 1XGIA 3EOIA 3VP3A 3A3JA 4S2NC 4PMAA 3BECA 2ZLYA 1LT0A 3P01A 3C2WA 5CEBA 4ZRRA 1PZOA 1W8QA 4BBTA 1XFQA 5DF8A 2XSSA 3EWKA 4H6JA 1P9RA 1HVBA 3ZYTA 4S2OA 3KSIA 3MXRA 3N7WA 4G3VA 5EFWA 1JWVA 4WF0A 3LUQA 4GLQA 3UB8A 3Q07A 5HD3A 4WMCA 4KZ9A 5AQ9A 4GHIB 2HV1A 4GCZA 2B95A 2WGVA 1PI4A 4A5RA 4S2PA 4GW9A 1K54C 1WYCA 1LSWA 1M40A 4P87A 1WA9A 3C7UA 4FH4A 2Y2QA 4MLLA 3VP1A 4NK3A 4BENA 3L7HA 3IWIA 4ZBEA 1Z6FA 5DTKA 1MBLA 3ITBA 4JGRA 2WADA 3NOUC 3SOIA 3VOYA 1VETB 1G6AA 4NXEA 2PD7A 3IF6C 3QP2A 4JF4A 4KG6A 3HLCA 2J7VA 1LHYA 5F5YA 3SS5A 5HWWA 2DRWA 1TDGA 3RFBA 4N1XA 2P9VA 2XRNA 3WRTA 1ALQA 2A3UA 4KUKA 4M4XA 5HW3A 1NRFA 2ZC3B 4K0WA 4QY6A 5CRFA 2GNXA 1H3QA 3F1PB 4E3KA 2KLIA 3NC8A 3B33A 4LPZA 4E6WA 2ZM0A 1N9NA 4EERA 1K54A 5EM1A 4E3JA 1MWUA 3LIBA 5HAIA 3ZG5A 5J3WA 1IKGA 4I3IA 5FAPA 4GNUA 4N92A 4S2LA 5A90A 2Y4AA 5DJTA 5E2EA 2X02A 3F1PA 5M1AA 3A3FA 4Q0JA 3DTEA 2M7UA 2WYXA 1YMXA 5AQ7A 1BLCA 2UWXA 2Z2LB 2J8YA 3RXWA 3H7WB 3UB7A 4RYEA 4MNRA 4UQIS 5FI6A 1VHMA 1BLSA 5FSRA 2RL3A 4R3BA 3G30A 3OPLA 1XJ6A 3V50A 4F94A 1OMEA 4JPMA 4LGWA 1K57A 1ZHHB 5DJUA 1W79A 3IXBA 4HH2A 1X0OA 4ZAMA 1Y28A 1Q2QA 4Q8IA 3ZG9B 5HAQA 3KYEA 1V9YA 5KSHA 1ODVA 5FQKA 5GLCA 1W8YA 5HDCA 1S66L 3AGEA 3JPUA 2V20A 3MXSA 1HTZA 2J3TD 1ZG4A 1OTDA 3H9WA 1IKIA 1YLYA 3IH9A 3SS4A 3E4PA 3QP1A 3S4XA 4LLOB 1QMFA 1YLPA 4WBGA 1E4DA 2V9AA 3BFCA 2OAP1 2XA7M 3FG8A 4BL2A 1QMEA 3TG9A 4AFIA 2G7UA 3VV4A 5E2FA 3SW1A 2V1AA 1WYBA 4WN5A 5L10A 1TS8A 2QPNA 4BLMA 4LRXC 4XUZA 4DJ3A 3MKFA 3V39A 4WELA 4XT2B 1Y4OA 4QD4A 2A49A 1P97A 3M6HA 4Y0UA 2V8FA 1Z09A 5EECA 5FAQA 1GCEA 1K55A 5I5LA 4MBFA 5GLBA 5GHXA 5GLAA 1FQGA 4HBTA 2ZOIA 5GHZA 2EFXA 2QJ7A 4EBNA 3BY9A 5EVIC 1S1YA 5CHMA 2WKIA 1RGZA 1JTDA 3HJKA 4UEYA 3V5MA 4OVDA 1A0KA 3ICYA 3RXXA 4ETZA 3VFFA 3A0RA 4UHUA 4EESA 3MFXA 4OPYA 3UPOA 4HI4A 2DNSA 1F2KA 3IX8A 4Y0TA 2Z2MB 4LRYC 4R4RA 1XA1A 4JF5A 3P98A 4BMWA 1ESUA 1TEMA 1VQQA 5FAOA 2VV6A 4JXGA 2GZAA 3RH8B 3PHYA 4JXSA 5DF7A 3ZNYA 1H8YA 2X01A 4EUVA 2RCXA 3NECA 2WKEA 1VEUA 5TR7A 3BY8A 4LFUA 1MKMA 3UB9A 2G2UA 4YWZA 4L9FA 2Q9NA 4DE3A 3QP5A 3FKWA 5FQIA 4LENA 4CJNA 5D3OA 4FTXA 4Y5FA 4FSFA 1VETA 2JC7A 2Q9MA 2INWA 4M3KA 4X55A 4DXCA 3MQQA 3BFEA 3VE4A 4IJGA 1L0DA 3A3IA 4WZ5A 5TFQA 1S4RA 1ONHA 4ME4A 4EUZA 4JGPA 3LR5A 3MFDA 3GQZA 1CEGA 1LI9A 1EI5A 4I38A 4GHIA 2WKRA 2WKPA 3MF0A 1C3BA 1D06A 3G31A 4CPKA 4PM6A 1CI8A 3IWOA 4HNBA 5AQAA 3RTYA 1L0FA 2Y8HA 1E25A 4Y0OA 2PD8A 2DMWA 2R9WA 3LI8A 4ESPA 2OV5A 3NDGA 1RGYA 1S0WA 1CQAA 2I72A 3MZDA 3BEBA 1J9MA 3OPPA 4I39A 2QKPA 5EE8A 1YQSA 3R7WA 1LI0A 3IQAA 4S2JA 4PKYA 5FQJA 1SKOB 2JKFA 4N1HA 1NYMA 2EXBA 1CEFA 3JVUA 3HJIA 1K38A 3CPTB 4X1MA 1I2WA 4Z9QA 3CI6A 2ZC5B 2JBFA 5IS1A 1K6SA 5CGSA 2ZL1B 5HPFA 2A2LA 4C75A 4P6ZM 3CITA 3ITAA 3OCNA 2OAQ1 4CQHA 2HDSA 3S22A 4NETA 4DDYA 4P6BA 3GECA 2QYBA 1KDSA 1YT4A 2PBDP 3PAEA 3WS1A 2XFTA 3G2YA 4IUHA 4DF6A 3T12B 5KZHA 3KX0X 2PRFA 1BZAA 2XROA 2O9BA 1OPXA 1BT5A 3VFHA 1G6OA 2H0YA 1HLUP 3QNBA 2JE5A 3DTKA 1SDEA 1ES3A 1I5QA 3VOLA 4CLCA 2JHEA 2WGIA 2EFUA 3MZEA 3G34A 1U60A 1I2SA 1MWSA 4D60A 3L9KA 4X1LA 1K6RA 4MDZA 5DTSA 3MR0A 1RCJA 4MBKA 4K08A 3W4PA 4IVKA 1GSVA 2OWJA 1LLBA 2J3WA 3U4LP 1FOFA 5F1FA 5AVFA 4ARZB 3BQ8A 3OPRA 1LL8A 5FQMA 3HCYA 3BW6A 2O9CA 4RQ9A 1FCMA 5LBRA 3QNCA 1J3WA 1YLJA 3PBOA 3A3DA 3GVBA 4RX3A 4IUKA 4WEJA 2ZD8A 1GHIA 3MSHA 2QMIA 5F6AA 2GJ3A 3S7PA 3TE8A 3BWLA 4GD8A 4GKUA 4X25A 1MY8A 3FYZA 2Y2JA 3ZVTA 1CK3A 1RP5A 2HDUA 5A93A 2M7VA 4QY5A 1P0ZA 3FC7A 3HLWA 5JYPA 3HLEA 3T4KA 1SZVA 1G68A 3E4QA 3PTEA 2JKRI 1FCNA 2VKSA 1NLYA 2HP5A 1GHPA 1H8MA 4GJ4A 1K4EA 3UDFA 1YSQA 3PBSA 1V9ZA 1XJ4A 1G28A 1FSWA 1IEMA 2MJ6A 1W63Q 4F3LA 3KSGA 3G6OA 4EWFA 2IWDA 2A24B 5G18A 5G4ZA 2XD1A 3T1QB 1VM1A 2G2WA 4NXFA 5F82A 5EOEA 3OBFA 4OP8A 4CLCB 3UN7A 2W3FA 3S7QA 4JLFA 4R1GA 4HEFA 3JYIA 5CGXA 5DKKA 4EEPA 1KE3A 1IFQA 2EX8A 5IHVA 3O3VA 4X6TA 4DRTA 3SH7A 3ZG8B 4CLCE 1L0GA 2FZ0A 5DVAA 4DKIA 1Q2PA 3A0SA 1YMSA 3S7NA 1LSXA 3BFFA 3HVFA 1YM1A 2HGVA 5GHYA 1UWPX 4EU0A 2XDMA 3B42A 1F9IA 3FZCA 4FOFA 5GL9A 5DKLA 3UO9A 1YLZA 2Y2HA 1ZC2A 4ARZA 2EX2A 3M2KA 2I9VA 1W5DA 2Y2GA 4KQRA 1XPBA 1OTAA 2W3HA 3EGDC 4R3JA 4EBLA 1NLZA 3ZNTA 4OP5A 2XA7S 4F3LB 3T4LA 3E4OA 1GHMA 5EV0A 3CLOA 2W27A 3OZHA 1DJBA 4MN7A 3TRCA 1BULA 1T1BA 1NYYA 4QWOA 4O01A 4BD0A 3MBZA 2ZQCA 4Y2FA 2ZQ9A 5EUAA 3NCKA 2Y2LA 5CXWA 1UWNX 1ERQA 1SHVA 1CJFA 2EXAA 3GV9A 5AJGA 4OOMA 3BRMA 4GN2A 1PWDA 3Q7VA 4IVIA 1JVJA 5TJJA 5L09A 1ES5A 2J80A 4K0XA 4KZBA 1JNUA 4FH2A 3LY3A 2W3DA 3CJMA 3NULA 4I3AA 3ZVWA 5HDSA 4UQIM 4S2KA 3T1SA 1EWZA 2ZMVA 3IXHA 3O87A 2ZC6B 1OTBA 3NIAA 4R0QA 3NDEA 4G3WA 1OT9A 1TS6A 4MCWA 4N9KA 1HZOA 2WKHA 4Y17A 5CECA 3N6IA 4OQHA 1W7FA 2VA0A 3O88A 2ZL1A 4WLAA 2XR0A 1DJCA 3F1OB 2V2FF 1EW0A 1LSVA 1YLWA 4XUXA 4LV2A 2WAEA 4O0PA 1E3UA 2HDRA 4C3QA 3UMDA 3OC2A 1YKDA 3MXQA 4R4SA 4R3AA 2J9OA 2W1TB 4PHTA 3WS5A 1D1JA 1OJGA 2XK1A 4XXRA 3MQ0A 2ZQAA 2E8JA 3JVVA 5TBMB 1SKOA 5J4EA 3LYXA 1PFLA 5FDHA 2C5WB 2EA9A 2V0WA 3NBLA 5EPHA 4PAUA 2K7SA 2O9AA 3VMAA 3VE3A 5DF9A 3GMWA 4BBUA 5E43A 4NEED 3SH9A 4OKPA 4B4ZA 3D9YA 2KDKA 1FCOA 1KVMA 2NUTC 3E98A 2B5RA 2PYRA 3T4OA 5F83A 5L8MA 2JKTI 5HARA 1DP9A 1OTIA 3AGDA 4OOYA 4EXOA 3H82A 1F98A 1NWZA 5CHUA 3B47A 5DFXA 4QHCA 1F5MA 1WE4A 4CLCC 4ZTKA 1GA0A 2XH9A 1K57C 2E8IA 2Y55A 4HJ6A 3VSLA 3N8RA 1IOUA 4HJ4A 1TVFA 3IS2B 4L9GA 4EEUA 1VEUB 2Z6DA 1XXMA 3DWKA 1VB6A 2OLUA 5JYOA 1JWPA 1H0MA 3IF6B 5HPIA 1TS7A 3BYDA 1N4OA 3B3XA 1T18A 1L2SA 3UB6A 3NOTC 4GDBA 4GDNA 2EWWA 3LR4A 3K3CA 3Q81A 4BJPA 3FKVA 3T4JA 1NJ4A 4NXGA 2W1TA 1ES4A 3D4FA 2ZM8A 4PM5A 4MEZA 3KSFA 3CZDA 4HHDA 4JXWA 1D7EA 5M18A 1KGEA 3HBRA
chains in the Genus database with same CATH topology
4E6XA 4MBKA 4DXBA 3W4PA 5FAPA 1SCWA 4GNUA 4N92A 4IVKA 1ONGA 4S2LA 1LLBA 1XKZA 5A90A 2Y4AA 1FOFA 5F1FA 1NZUA 5E2EA 5CTNA 2X02A 4KENB 5FATA 5M1AA 3OPRA 4C6YA 3A3FA 1JTGA 2FFFB 3HUNA 5FQMA 2WYXA 3WWXA 1FCMA 3QNCA 1YLJA 1YMXA 5TGFA 4ID4A 3PBOA 2UWXA 1BLCA 2Z2LB 3A3DA 2J8YA 3GVBA 4S2MA 4RX3A 4WEJA 5AQ7A 3RXWA 3FWLA 5HAPA 4YINA 1LL5A 3N4IA 2ZD8A 1GHIA 2QMIA 3WS2A 1PYYA 1NY0A 4GD8A 4GKUA 4RYEA 2XQZA 4MNRA 3HLBA 1MY8A 3FYZA 2XEPA 1BLSA 2Y2JA 3HLFA 5FI6A 5FSRA 5U47A 1CK3A 1RP5A 3ZVTA 2RL3A 4R3BA 2HDUA 3G30A 3OPLA 5A93A 2EX9A 4JKTA 4F94A 3V50A 1OMEA 4JPMA 4GB7A 3SH8A 1H5XA 1K57A 4QY5A 3IT9A 4OPQA 1W79A 3HLWA 3IXBA 5JYPA 4IBRA 4ZAMA 1Q2QA 3LEZA 4ZJ1A 4Q8IA 2IWCA 3HLEA 3ZG9B 1MWTA 5HAQA 4LCMA 3I7JA 1BLHA 1G68A 3GTCA 5KSHA 3PTEA 1LL9A 1FCNA 2OLVA 2HP5A 1GHPA 3BLSA 4JBFA 4WEKA 1K4EA 1KVLA 1YLTA 1W8YA 5FQKA 5GLCA 3UDFA 4BQMA 3M2JA 3UPPA 1K55C 3C5AA 3UDXA 1N9BA 3AGEA 4E3NA 1SKFA 3PBSA 4WZ5C 5F1GA 2Y2PA 4EV4A 2WUQA 2V1ZA 2V20A 1FSWA 2PU2A 1IEMA 3DW0A 1HD8A 3MXSA 1HTZA 1ZG4A 3TOIA 1AXBA 3C7VA 4X68A 1IKIA 2JCHA 3PAGA 3BFGA 1YLYA 2H5SA 2BLSA 3IH9A 4EWFA 2XLNA 1PIOA 2Y2NA 2IWDA 2Y2KA 3SS4A 3S4XA 5FQQA 5G18A 4FD8A 3W4OA 2XD1A 1BUEA 1KDWA 1QMFA 5A91A 3ZCZA 1YLPA 4WBGA 1E4DA 1VM1A 5GLDA 3ZFZA 1K56A 3BFCA 3UNWA 3GRJA 2G2WA 4BL2A 1PZPA 5L2FA 1QMEA 3UE0A 1K25A 3HLDA 3TG9A 1GA9A 5F82A 5EOEA 5E2FA 3BM6A 4OP8A 1WYBA 2XD5A 3UN7A 3VSKA 1KGGA 1H8ZA 2QPNA 4JXVA 4JLFA 4UAAA 4BLMA 4R1GA 5KSCA 3N8SA 4FCFA 4OLGA 4U3TA 5CGWA 4BD1A 4HEFA 4XUZA 1O07A 3PBTA 4P85A 3JYIA 2Y2MA 3MKFA 4WMCD 5CGXA 2R9XA 3E2KA 1KE3A 3V39A 2IWBA 1PWCA 4WELA 1XGJA 2EX8A 4QD4A 1KGFA 5IHVA 3O3VA 2A49A 4X6TA 4DRTA 3SH7A 3ZG8B 4QJGA 3N8LA 2DCFA 3TSGA 3M6HA 4YFMA 4RX2A 4Y0UA 4KG5A 4QU3A 3ZGAB 4KZ4A 4LV0A 5EECA 1L0GA 2ZQ8A 4OQ0A 4GD6A 5FAQA 1GCEA 4B88A 1XX2A 4Y7PA 5DVAA 1K55A 1Q2PA 3EQUA 5DTTA 3ZHHA 2J9PA 4MBFA 1NZOA 5GLBA 3PBNA 5CERA 3G35A 3UE3A 5GHXA 4ZDXA 1YMSA 5GLAA 3W8KA 4E3LA 5E2HA 3IH8A 3NY4A 4U0XA 3ZG0A 1S6RA 1FQGA 3WS4A 4EQIA 4HBTA 3BFFA 1ESIA 4OH0A 5GHZA 3IXGA 3HVFA 3VP0A 2EFXA 3C4PA 3VP2A 1BLPA 4EBNA 3WS0A 1YM1A 1IELA 3G32A 5EVIC 4KZ7A 5CHMA 2WKIA 1RGZA 1JTDA 4X53A 5GHYA 1PI5A 2ZC4B 2XDMA 4WZ4A 3UY6A 3V5MA 1ZG6A 3FZCA 5GL9A 4R23A 4OVDA 1O7EA 4K91A 2Y91A 2VGJA 3S1YA 3UO9A 3GR2A 4JF6A 1PW1A 3RXXA 1YLZA 3UDIA 2Y2HA 1ZC2A 5EVIB 3W4QA 3Q82A 3HUOA 3VFFA 2EX2A 3AGFA 5FA7A 3M2KA 4UHUA 1MXOA 5I94A 4GZBA 1W5DA 2Y2GA 4OPYA 3UPOA 4KQRA 1ES2A 1XPBA 1K56D 2DNSA 4WM9A 4H8RA 4R3JA 4EBLA 4OONA 4IEDA 3ZNTA 2ZQDA 4E3MA 4OP5A 4Y0TA 2Z2MB 4R4RA 1XA1A 4JF5A 1GHMA 3P98A 3GSGA 3OZHA 1ESUA 1TEMA 1DJBA 1VQQA 5EVLA 5FAOA 1BULA 2WK0A 2Y59A 2PU4A 4KZ5A 4JXGA 3IF6A 1NYYA 3NI9A 1SDNA 1ZKJA 2BG1A 4BD0A 4JXSA 3MBZA 5FI2A 4KQOA 2ZQCA 5DF7A 3ZNYA 1FSYA 2HDQA 4OPZA 1H8YA 4P0MA 2P74A 5FI7A 2ZQ9A 2WZXA 4PPRA 2X01A 4OQGA 4KZ6A 5CTMA 5EUAA 3EQVA 1JWZA 2RCXA 3NCKA 3IHBA 2H0TA 2HP9A 2OSUA 2WKEA 2Y2LA 5TR7A 2HPBA 5CXWA 4WYYA 3ZDJA 1ERQA 2G2UA 1SHVA 2Q9NA 1IYPA 4S2NA 4DE3A 3FKWA 5FQIA 1CI9A 1DJAA 2X71A 4LENA 4CJNA 2EXAA 3CMZA 2EX6A 3M6BA 3GV9A 1PWGA 1K4FA 1Y54A 3PBRA 4OOMA 5D3OA 3OCLA 5EVID 3BRMA 4GN2A 4QB8A 1PWDA 3Q7VA 5CEDA 4X69A 4IVIA 3HUMA 4FSFA 3UPNA 4DE2A 2ZMAA 3DTMA 2HP6A 1JVJA 2JC7A 2Q9MA 4OQIA 4DDSA 1ES5A 4M3KA 2PBYA 4X55A 4DXCA 5M19A 4K0XA 3O86A 4KZBA 3BFEA 4HBUA 4PM7A 4B4XA 4N9LA 3CG5A 5EVIA 4FH2A 3ZG7B 3LY3A 1L0DA 3A3IA 3CJMA 2ZC7A 4WZ5A 3Q1FA 4LCLA 3ZVWA 4DKIA 5TFQA 3V3SA 4S2KA 1EWZA 1XP4A 3HLGA 4KZ3A 1ONHA 4EUZA 3IXHA 3O87A 5KMWA 2ZC6B 4R0QA 1BTLA 1IYQA 1FR6A 3NIAA 5AQBA 3P09A 3NDEA 2CC1A 4N9KA 3MFDA 1HZOA 2WKHA 3GQZA 5CECA 5BOHA 1CEGA 1LI9A 1EI5A 1MPLA 4E3IA 4OOLA 2WAFA 4UA9A 3N6IA 4OQHA 1W7FA 3IF5A 3O88A 1DY6A 2XF3A 2WGWA 4DE1A 3IWQA 2XR0A 4EBPA 5HFOA 1DJCA 1C3BA 2H10A 4KQQA 3VOZA 2V2FF 3DWZA 3G31A 1EROA 3G2ZA 1CI8A 3LO7A 4PM6A 3SS3A 1TDLA 4CPKA 3IWOA 3Q7ZA 5AQAA 3RJUA 3IHAA 1YLWA 1MWRA 4RVAA 4XUXA 1L0FA 4LV3A 4LV2A 5HL1A 2WAEA 1E25A 4KG2A 4Y0OA 1E3UA 2XGNA 3A3EA 3BFDA 2HDRA 3FV7A 4KZ8A 4PM8A 4ZJ2A 4C3QA 4U0TA 1FR1A 3OC2A 4MBHA 2ZM2A 5E2GA 4DE0A 2R9WA 3HREA 4R4SA 5HX9A 2J9OA 5EOOA 3C4OA 3G4PA 2ZQ7A 3WS5A 4UA7A 2XK1A 2WZZA 3NDGA 2OV5A 3E2LA 4XXRA 1RGYA 1S0WA 2QZ6A 3BLMA 2FFYA 1XA7A 4OPRA 1XGIA 1E3UD 2ZQAA 4S2IA 4ZJ3A 1BSGA 3VP3A 3A3JA 2I72A 2Y2OA 3MZDA 4S2NC 3BEBA 1J9MA 4PMAA 3BECA 2ZLYA 2XFSA 3OPPA 4X56A 5CEBA 3IXDA 5FDHA 1PZOA 1W8QA 4PM9A 5EE8A 1YQSA 1LI0A 3IQAA 5DF8A 3HBRA 4D2OA 4S2JA 5FQJA 2C5WB 1HVBA 4N1HA 1NYMA 3NBLA 5EPHA 2EXBA 4S2OA 1CEFA 3VMAA 3MXRA 3LY4A 3N7WA 5DF9A 1K38A 1JWVA 3GMWA 3QHYA 1IYSA 1I2WA 4Z9QA 3Q07A 4WMCA 2ZC5B 4KZ9A 2JBFA 5E43A 5AQ9A 3SH9A 1K6SA 4OKPA 4HESA 5CGSA 4B4ZA 2WGVA 1FCOA 1PI4A 4A5RA 3OPHA 1ERMA 1KVMA 4S2PA 4C75A 2B5RA 1K54C 1WYCA 1NXYA 3ITAA 4P87A 1M40A 3OCNA 5F83A 4IBXA 5FASA 5HARA 3C7UA 2HDSA 3MZFA 4FH4A 2Y2QA 4MLLA 3S22A 3AGDA 4OOYA 3VP1A 4NETA 4BL3A 4NK3A 4DDYA 4BENA 4P6BA 3IWIA 1KDSA 1YT4A 5CHUA 4ZBEA 1Z6FA 3PAEA 4UA6A 2XFTA 3G2YA 3WS1A 1M6KA 4QHCA 5DTKA 4DF6A 3PBQA 4KZAA 1KE0A 1MBLA 3ITBA 2WADA 1WE4A 3SOIA 3VOYA 5KZHA 3LCEA 1G6AA 1BZAA 3HL9A 3V3RA 3ISGA 4ZTKA 1GA0A 2XH9A 1KE4A 1BT5A 3Q7VB 4GOGA 3VFHA 3IF6C 1K57C 2E8IA 2H0YA 4JF4A 4KG6A 2Y55A 4LV1A 3VSLA 1PW8A 5FQ9A 3N8RA 3QNBA 3HLCA 2JE5A 1SDEA 1LHYA 2J7VA 3SS5A 1TVFA 2VGKA 1ES3A 1I5QA 2DRWA 1TDGA 4N1XA 2P9VA 3WRTA 1XXMA 1ALQA 1MKIA 2A3UA 3UE1A 3DWKA 4RA7A 2OLUA 5HW3A 2ZC3B 1NRFA 2Y2IA 2ZJ9A 4OLDA 1JWPA 5JYOA 2P9VB 4K0WA 2WGIA 4QY6A 5A92A 3IF6B 2EFUA 5CHJA 1IYOA 2GDNA 3BYDA 3MZEA 5CRFA 4E3KA 3G34A 1N4OA 2C6WB 3B3XA 3NC8A 1L2SA 1U60A 3VP4A 4E3OA 1I2SA 4E6WA 4GDBA 1MWSA 4GDNA 1L0EA 3MKEA 3Q81A 2ZM0A 4L0LA 3WRZA 3FKVA 4BJPA 1NJ4A 1K54A 1K6RA 1ES4A 3D4FA 5J8XA 2ZM8A 4PM5A 2WGWB 4MEZA 5DTSA 1MWUA 4E3JA 3CZDA 4JXWA 4O7DA 5HAIA 3ZG5A 5M18A 1KGEA 1IKGA 1RCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E6X A;  4MBK A;  4DXB A;  3W4P A;  5FAP A;  1SCW A;  4GNU A;  4N92 A;  4IVK A;  1ONG A;  4S2L A;  1LLB A;  1XKZ A;  5A90 A;  2Y4A A;  1FOF A;  5F1F A;  1NZU A;  5E2E A;  5CTN A;  2X02 A;  4KEN B;  5FAT A;  5M1A A;  3OPR A;  4C6Y A;  3A3F A;  1JTG A;  2FFF B;  3HUN A;  5FQM A;  2WYX A;  3WWX A;  1FCM A;  3QNC A;  1YLJ A;  1YMX A;  5TGF A;  4ID4 A;  3PBO A;  2UWX A;  1BLC A;  2Z2L B;  3A3D A;  2J8Y A;  3GVB A;  4S2M A;  4RX3 A;  4WEJ A;  5AQ7 A;  3RXW A;  3FWL A;  5HAP A;  4YIN A;  1LL5 A;  3N4I A;  2ZD8 A;  1GHI A;  2QMI A;  3WS2 A;  1PYY A;  1NY0 A;  4GD8 A;  4GKU A;  4RYE A;  2XQZ A;  4MNR A;  3HLB A;  1MY8 A;  3FYZ A;  2XEP A;  1BLS A;  2Y2J A;  3HLF A;  5FI6 A;  5FSR A;  5U47 A;  1CK3 A;  1RP5 A;  3ZVT A;  2RL3 A;  4R3B A;  2HDU A;  3G30 A;  3OPL A;  5A93 A;  2EX9 A;  4JKT A;  4F94 A;  3V50 A;  1OME A;  4JPM A;  4GB7 A;  3SH8 A;  1H5X A;  1K57 A;  4QY5 A;  3IT9 A;  4OPQ A;  1W79 A;  3HLW A;  3IXB A;  5JYP A;  4IBR A;  4ZAM A;  1Q2Q A;  3LEZ A;  4ZJ1 A;  4Q8I A;  2IWC A;  3HLE A;  3ZG9 B;  1MWT A;  5HAQ A;  4LCM A;  3I7J A;  1BLH A;  1G68 A;  3GTC A;  5KSH A;  3PTE A;  1LL9 A;  1FCN A;  2OLV A;  2HP5 A;  1GHP A;  3BLS A;  4JBF A;  4WEK A;  1K4E A;  1KVL A;  1YLT A;  1W8Y A;  5FQK A;  5GLC A;  3UDF A;  4BQM A;  3M2J A;  3UPP A;  1K55 C;  3C5A A;  3UDX A;  1N9B A;  3AGE A;  4E3N A;  1SKF A;  3PBS A;  4WZ5 C;  5F1G A;  2Y2P A;  4EV4 A;  2WUQ A;  2V1Z A;  2V20 A;  1FSW A;  2PU2 A;  1IEM A;  3DW0 A;  1HD8 A;  3MXS A;  1HTZ A;  1ZG4 A;  3TOI A;  1AXB A;  3C7V A;  4X68 A;  1IKI A;  2JCH A;  3PAG A;  3BFG A;  1YLY A;  2H5S A;  2BLS A;  3IH9 A;  4EWF A;  2XLN A;  1PIO A;  2Y2N A;  2IWD A;  2Y2K A;  3SS4 A;  3S4X A;  5FQQ A;  5G18 A;  4FD8 A;  3W4O A;  2XD1 A;  1BUE A;  1KDW A;  1QMF A;  5A91 A;  3ZCZ A;  1YLP A;  4WBG A;  1E4D A;  1VM1 A;  5GLD A;  3ZFZ A;  1K56 A;  3BFC A;  3UNW A;  3GRJ A;  2G2W A;  4BL2 A;  1PZP A;  5L2F A;  1QME A;  3UE0 A;  1K25 A;  3HLD A;  3TG9 A;  1GA9 A;  5F82 A;  5EOE A;  5E2F A;  3BM6 A;  4OP8 A;  1WYB A;  2XD5 A;  3UN7 A;  3VSK A;  1KGG A;  1H8Z A;  2QPN A;  4JXV A;  4JLF A;  4UAA A;  4BLM A;  4R1G A;  5KSC A;  3N8S A;  4FCF A;  4OLG A;  4U3T A;  5CGW A;  4BD1 A;  4HEF A;  4XUZ A;  1O07 A;  3PBT A;  4P85 A;  3JYI A;  2Y2M A;  3MKF A;  4WMC D;  5CGX A;  2R9X A;  3E2K A;  1KE3 A;  3V39 A;  2IWB A;  1PWC A;  4WEL A;  1XGJ A;  2EX8 A;  4QD4 A;  1KGF A;  5IHV A;  3O3V A;  2A49 A;  4X6T A;  4DRT A;  3SH7 A;  3ZG8 B;  4QJG A;  3N8L A;  2DCF A;  3TSG A;  3M6H A;  4YFM A;  4RX2 A;  4Y0U A;  4KG5 A;  4QU3 A;  3ZGA B;  4KZ4 A;  4LV0 A;  5EEC A;  1L0G A;  2ZQ8 A;  4OQ0 A;  4GD6 A;  5FAQ A;  1GCE A;  4B88 A;  1XX2 A;  4Y7P A;  5DVA A;  1K55 A;  1Q2P A;  3EQU A;  5DTT A;  3ZHH A;  2J9P A;  4MBF A;  1NZO A;  5GLB A;  3PBN A;  5CER A;  3G35 A;  3UE3 A;  5GHX A;  4ZDX A;  1YMS A;  5GLA A;  3W8K A;  4E3L A;  5E2H A;  3IH8 A;  3NY4 A;  4U0X A;  3ZG0 A;  1S6R A;  1FQG A;  3WS4 A;  4EQI A;  4HBT A;  3BFF A;  1ESI A;  4OH0 A;  5GHZ A;  3IXG A;  3HVF A;  3VP0 A;  2EFX A;  3C4P A;  3VP2 A;  1BLP A;  4EBN A;  3WS0 A;  1YM1 A;  1IEL A;  3G32 A;  5EVI C;  4KZ7 A;  5CHM A;  2WKI A;  1RGZ A;  1JTD A;  4X53 A;  5GHY A;  1PI5 A;  2ZC4 B;  2XDM A;  4WZ4 A;  3UY6 A;  3V5M A;  1ZG6 A;  3FZC A;  5GL9 A;  4R23 A;  4OVD A;  1O7E A;  4K91 A;  2Y91 A;  2VGJ A;  3S1Y A;  3UO9 A;  3GR2 A;  4JF6 A;  1PW1 A;  3RXX A;  1YLZ A;  3UDI A;  2Y2H A;  1ZC2 A;  5EVI B;  3W4Q A;  3Q82 A;  3HUO A;  3VFF A;  2EX2 A;  3AGF A;  5FA7 A;  3M2K A;  4UHU A;  1MXO A;  5I94 A;  4GZB A;  1W5D A;  2Y2G A;  4OPY A;  3UPO A;  4KQR A;  1ES2 A;  1XPB A;  1K56 D;  2DNS A;  4WM9 A;  4H8R A;  4R3J A;  4EBL A;  4OON A;  4IED A;  3ZNT A;  2ZQD A;  4E3M A;  4OP5 A;  4Y0T A;  2Z2M B;  4R4R A;  1XA1 A;  4JF5 A;  1GHM A;  3P98 A;  3GSG A;  3OZH A;  1ESU A;  1TEM A;  1DJB A;  1VQQ A;  5EVL A;  5FAO A;  1BUL A;  2WK0 A;  2Y59 A;  2PU4 A;  4KZ5 A;  4JXG A;  3IF6 A;  1NYY A;  3NI9 A;  1SDN A;  1ZKJ A;  2BG1 A;  4BD0 A;  4JXS A;  3MBZ A;  5FI2 A;  4KQO A;  2ZQC A;  5DF7 A;  3ZNY A;  1FSY A;  2HDQ A;  4OPZ A;  1H8Y A;  4P0M A;  2P74 A;  5FI7 A;  2ZQ9 A;  2WZX A;  4PPR A;  2X01 A;  4OQG A;  4KZ6 A;  5CTM A;  5EUA A;  3EQV A;  1JWZ A;  2RCX A;  3NCK A;  3IHB A;  2H0T A;  2HP9 A;  2OSU A;  2WKE A;  2Y2L A;  5TR7 A;  2HPB A;  5CXW A;  4WYY A;  3ZDJ A;  1ERQ A;  2G2U A;  1SHV A;  2Q9N A;  1IYP A;  4S2N A;  4DE3 A;  3FKW A;  5FQI A;  1CI9 A;  1DJA A;  2X71 A;  4LEN A;  4CJN A;  2EXA A;  3CMZ A;  2EX6 A;  3M6B A;  3GV9 A;  1PWG A;  1K4F A;  1Y54 A;  3PBR A;  4OOM A;  5D3O A;  3OCL A;  5EVI D;  3BRM A;  4GN2 A;  4QB8 A;  1PWD A;  3Q7V A;  5CED A;  4X69 A;  4IVI A;  3HUM A;  4FSF A;  3UPN A;  4DE2 A;  2ZMA A;  3DTM A;  2HP6 A;  1JVJ A;  2JC7 A;  2Q9M A;  4OQI A;  4DDS A;  1ES5 A;  4M3K A;  2PBY A;  4X55 A;  4DXC A;  5M19 A;  4K0X A;  3O86 A;  4KZB A;  3BFE A;  4HBU A;  4PM7 A;  4B4X A;  4N9L A;  3CG5 A;  5EVI A;  4FH2 A;  3ZG7 B;  3LY3 A;  1L0D A;  3A3I A;  3CJM A;  2ZC7 A;  4WZ5 A;  3Q1F A;  4LCL A;  3ZVW A;  4DKI A;  5TFQ A;  3V3S A;  4S2K A;  1EWZ A;  1XP4 A;  3HLG A;  4KZ3 A;  1ONH A;  4EUZ A;  3IXH A;  3O87 A;  5KMW A;  2ZC6 B;  4R0Q A;  1BTL A;  1IYQ A;  1FR6 A;  3NIA A;  5AQB A;  3P09 A;  3NDE A;  2CC1 A;  4N9K A;  3MFD A;  1HZO A;  2WKH A;  3GQZ A;  5CEC A;  5BOH A;  1CEG A;  1LI9 A;  1EI5 A;  1MPL A;  4E3I A;  4OOL A;  2WAF A;  4UA9 A;  3N6I A;  4OQH A;  1W7F A;  3IF5 A;  3O88 A;  1DY6 A;  2XF3 A;  2WGW A;  4DE1 A;  3IWQ A;  2XR0 A;  4EBP A;  5HFO A;  1DJC A;  1C3B A;  2H10 A;  4KQQ A;  3VOZ A;  2V2F F;  3DWZ A;  3G31 A;  1ERO A;  3G2Z A;  1CI8 A;  3LO7 A;  4PM6 A;  3SS3 A;  1TDL A;  4CPK A;  3IWO A;  3Q7Z A;  5AQA A;  3RJU A;  3IHA A;  1YLW A;  1MWR A;  4RVA A;  4XUX A;  1L0F A;  4LV3 A;  4LV2 A;  5HL1 A;  2WAE A;  1E25 A;  4KG2 A;  4Y0O A;  1E3U A;  2XGN A;  3A3E A;  3BFD A;  2HDR A;  3FV7 A;  4KZ8 A;  4PM8 A;  4ZJ2 A;  4C3Q A;  4U0T A;  1FR1 A;  3OC2 A;  4MBH A;  2ZM2 A;  5E2G A;  4DE0 A;  2R9W A;  3HRE A;  4R4S A;  5HX9 A;  2J9O A;  5EOO A;  3C4O A;  3G4P A;  2ZQ7 A;  3WS5 A;  4UA7 A;  2XK1 A;  2WZZ A;  3NDG A;  2OV5 A;  3E2L A;  4XXR A;  1RGY A;  1S0W A;  2QZ6 A;  3BLM A;  2FFY A;  1XA7 A;  4OPR A;  1XGI A;  1E3U D;  2ZQA A;  4S2I A;  4ZJ3 A;  1BSG A;  3VP3 A;  3A3J A;  2I72 A;  2Y2O A;  3MZD A;  4S2N C;  3BEB A;  1J9M A;  4PMA A;  3BEC A;  2ZLY A;  2XFS A;  3OPP A;  4X56 A;  5CEB A;  3IXD A;  5FDH A;  1PZO A;  1W8Q A;  4PM9 A;  5EE8 A;  1YQS A;  1LI0 A;  3IQA A;  5DF8 A;  3HBR A;  4D2O A;  4S2J A;  5FQJ A;  2C5W B;  1HVB A;  4N1H A;  1NYM A;  3NBL A;  5EPH A;  2EXB A;  4S2O A;  1CEF A;  3VMA A;  3MXR A;  3LY4 A;  3N7W A;  5DF9 A;  1K38 A;  1JWV A;  3GMW A;  3QHY A;  1IYS A;  1I2W A;  4Z9Q A;  3Q07 A;  4WMC A;  2ZC5 B;  4KZ9 A;  2JBF A;  5E43 A;  5AQ9 A;  3SH9 A;  1K6S A;  4OKP A;  4HES A;  5CGS A;  4B4Z A;  2WGV A;  1FCO A;  1PI4 A;  4A5R A;  3OPH A;  1ERM A;  1KVM A;  4S2P A;  4C75 A;  2B5R A;  1K54 C;  1WYC A;  1NXY A;  3ITA A;  4P87 A;  1M40 A;  3OCN A;  5F83 A;  4IBX A;  5FAS A;  5HAR A;  3C7U A;  2HDS A;  3MZF A;  4FH4 A;  2Y2Q A;  4MLL A;  3S22 A;  3AGD A;  4OOY A;  3VP1 A;  4NET A;  4BL3 A;  4NK3 A;  4DDY A;  4BEN A;  4P6B A;  3IWI A;  1KDS A;  1YT4 A;  5CHU A;  4ZBE A;  1Z6F A;  3PAE A;  4UA6 A;  2XFT A;  3G2Y A;  3WS1 A;  1M6K A;  4QHC A;  5DTK A;  4DF6 A;  3PBQ A;  4KZA A;  1KE0 A;  1MBL A;  3ITB A;  2WAD A;  1WE4 A;  3SOI A;  3VOY A;  5KZH A;  3LCE A;  1G6A A;  1BZA A;  3HL9 A;  3V3R A;  3ISG A;  4ZTK A;  1GA0 A;  2XH9 A;  1KE4 A;  1BT5 A;  3Q7V B;  4GOG A;  3VFH A;  3IF6 C;  1K57 C;  2E8I A;  2H0Y A;  4JF4 A;  4KG6 A;  2Y55 A;  4LV1 A;  3VSL A;  1PW8 A;  5FQ9 A;  3N8R A;  3QNB A;  3HLC A;  2JE5 A;  1SDE A;  1LHY A;  2J7V A;  3SS5 A;  1TVF A;  2VGK A;  1ES3 A;  1I5Q A;  2DRW A;  1TDG A;  4N1X A;  2P9V A;  3WRT A;  1XXM A;  1ALQ A;  1MKI A;  2A3U A;  3UE1 A;  3DWK A;  4RA7 A;  2OLU A;  5HW3 A;  2ZC3 B;  1NRF A;  2Y2I A;  2ZJ9 A;  4OLD A;  1JWP A;  5JYO A;  2P9V B;  4K0W A;  2WGI A;  4QY6 A;  5A92 A;  3IF6 B;  2EFU A;  5CHJ A;  1IYO A;  2GDN A;  3BYD A;  3MZE A;  5CRF A;  4E3K A;  3G34 A;  1N4O A;  2C6W B;  3B3X A;  3NC8 A;  1L2S A;  1U60 A;  3VP4 A;  4E3O A;  1I2S A;  4E6W A;  4GDB A;  1MWS A;  4GDN A;  1L0E A;  3MKE A;  3Q81 A;  2ZM0 A;  4L0L A;  3WRZ A;  3FKV A;  4BJP A;  1NJ4 A;  1K54 A;  1K6R A;  1ES4 A;  3D4F A;  5J8X A;  2ZM8 A;  4PM5 A;  2WGW B;  4MEZ A;  5DTS A;  1MWU A;  4E3J A;  3CZD A;  4JXW A;  4O7D A;  5HAI A;  3ZG5 A;  5M18 A;  1KGE A;  1IKG A;  1RCJ A; 
#chains in the Genus database with same CATH topology
 4LRZ E;  4DXB A;  4DJ2 A;  2VLG A;  3LIF A;  1XKZ A;  3EEH A;  4YNR A;  2ACG A;  5FAT A;  2K31 A;  1JTG A;  3HUN A;  3WWX A;  3NOP C;  5TGF A;  3CAX A;  3KYZ A;  3FWL A;  4YIN A;  1LL5 A;  2V1B A;  2VX8 A;  3N4I A;  2D02 A;  2PR6 A;  2VJW A;  1PYY A;  4HOI A;  1NY0 A;  3D3O A;  2L0W A;  1KOU A;  2XEP A;  2EX9 A;  4JKT A;  4GB7 A;  1H5X A;  4OPQ A;  2L1M A;  1N9L A;  3LR3 A;  3T50 A;  3EGX C;  4ZJ1 A;  4LCM A;  3I7J A;  1LL9 A;  4EW7 A;  1GSX A;  2OLV A;  2ZOH A;  3BLS A;  4L9E A;  4JBF A;  1YLT A;  1KVL A;  4BQM A;  4I3J A;  3M2J A;  1K55 C;  1SKF A;  2B18 A;  2JKG A;  5CX7 A;  4CLC D;  2V1Z A;  1HD8 A;  2A24 A;  4NKP A;  3MS6 A;  4HIA A;  1AXB A;  2PYP A;  4X68 A;  3PAG A;  4ETX A;  3BFG A;  3FPV A;  2BLS A;  2XLN A;  2LB9 A;  2Y2N A;  3U2A A;  2V0U A;  5FQQ A;  4FD8 A;  3W4O A;  1BUE A;  1XJ2 A;  5A91 A;  3ZCZ A;  2QJ5 A;  3ZFZ A;  5FL3 A;  4Q0H A;  3UNW A;  3GRJ A;  1PZP A;  3NHQ A;  1K25 A;  3HLD A;  4I5S A;  1GSW A;  3ULF A;  3VSK A;  3LIA A;  1KGG A;  4JXV A;  4U3T A;  2P08 A;  1O07 A;  3PBT A;  4P85 A;  2VGL M;  2Y2M A;  4WMC D;  2R9X A;  3SZT A;  2IWB A;  1PWC A;  1XGJ A;  4GS9 A;  1KGF A;  2B02 A;  4HP4 A;  1BYW A;  3N8L A;  4QJG A;  2DCF A;  4YFM A;  3LIE A;  2QWS A;  3LI9 A;  3IBJ A;  4FUW A;  5HWT A;  4Y7P A;  3EQU A;  5DTT A;  2J9P A;  3TJZ C;  1NZO A;  2KX6 A;  3G35 A;  3MQO A;  3UE3 A;  1AWI A;  3W8K A;  1S6R A;  2K2N A;  2W0N A;  1ESI A;  2PT7 A;  1FIK A;  3IXG A;  3VP2 A;  1BLP A;  3WS0 A;  1IEL A;  2YKH A;  4KZ7 A;  5HZH A;  4WZ4 A;  3UY6 A;  1ZG6 A;  2J3T C;  1O7E A;  3D72 A;  4K91 A;  2Y91 A;  2HJE A;  3S1Y A;  3LR0 A;  2P04 A;  4JF6 A;  4BBV A;  1PW1 A;  3KSH A;  3W4Q A;  3Q82 A;  3HUO A;  5I94 A;  4GZB A;  2R78 A;  1ES2 A;  1K56 D;  3T1R A;  4OON A;  4IED A;  1STZ A;  2L4R A;  3KYQ A;  1YAX A;  3PXP A;  2LB5 A;  2M1C A;  3E0Y A;  5EVL A;  3IF6 A;  4G3K A;  2PDR A;  3NI9 A;  1SDN A;  2BG1 A;  3GDI A;  3F1O A;  4OPZ A;  2HDQ A;  5FI7 A;  4P0M A;  2P74 A;  3CHW P;  4PPR A;  2BTF P;  1DP8 A;  4KZ6 A;  4NG2 A;  3EQV A;  3IHB A;  2HP9 A;  4B93 A;  1DJA A;  2X71 A;  3CUE C;  1PWG A;  1Y54 A;  3OCL A;  5EVI D;  4QB8 A;  5CED A;  3UPN A;  3HUM A;  4DE2 A;  3DTM A;  4DDS A;  5HSQ A;  2PBY A;  3CWF A;  3IS2 A;  5M19 A;  4II7 A;  3CG5 A;  4HH3 A;  5EVI A;  2W1R A;  1MC0 A;  4LCL A;  5F68 A;  3UB5 P;  3HLG A;  4KZ3 A;  1YPR A;  5L07 A;  1IYQ A;  1FR6 A;  5HD5 A;  3P09 A;  2CC1 A;  5BOH A;  4OOL A;  2WAF A;  4UA9 A;  5IU1 A;  3IF5 A;  1DY6 A;  2XF3 A;  3IWQ A;  5HFO A;  2H10 A;  2VGL S;  4KQQ A;  4XT2 A;  3DWZ A;  3LO7 A;  4KUO A;  3O5Y A;  4HP9 A;  3RJU A;  4RVA A;  5HL1 A;  4HQA A;  1NRJ A;  4ZJ2 A;  3FV7 A;  4PM8 A;  2HZ5 A;  2FH5 A;  2BAS A;  2ZM2 A;  5E2G A;  4DE0 A;  1T1A A;  5EOO A;  3C4O A;  3G4P A;  2YKF A;  2ZQ7 A;  4UA7 A;  3LFV A;  4WUJ A;  2QZ6 A;  3BLM A;  2FFY A;  1XA7 A;  3CUE A;  4MN6 A;  1E3U D;  4OPR A;  4S2I A;  4ZJ3 A;  3LGO A;  1BSG A;  1OT6 A;  2Y2O A;  1N9O A;  2AVX A;  2XFS A;  1TS0 A;  4X56 A;  3V67 A;  1OJ5 A;  3IXD A;  3C8C A;  3DBA A;  5EM0 A;  4PM9 A;  2P7J A;  2JKR M;  4D2O A;  3OOV A;  3IX3 A;  3T4T A;  4YOF A;  3LY4 A;  1P9W A;  1XJ3 A;  3P7N A;  3QHY A;  5F69 A;  1IYS A;  1DRM A;  1MZU A;  4HES A;  5DFY A;  3OPH A;  1ERM A;  1NXY A;  2ZMF A;  4IBX A;  5FAS A;  1S4S A;  3MZF A;  4JGQ A;  2UV0 E;  4BL3 A;  4UA6 A;  1M6K A;  3H7W A;  3PBQ A;  1ZTU A;  1KE0 A;  1XFN A;  4KZA A;  2VK3 A;  1TF1 A;  3LCE A;  3HL9 A;  3V3R A;  3ISG A;  1KE4 A;  3Q7V B;  4GOG A;  2OOL A;  4LV1 A;  1PW8 A;  3LEQ A;  2VGK A;  1S1Z A;  2OWH A;  4O8G A;  3PR6 A;  1UGU A;  2W3G A;  1MKI A;  3UE1 A;  4Y3I A;  1OTE A;  5EVE A;  4GS9 B;  3DAV A;  4RA7 A;  5MC7 A;  2Y2I A;  2ZJ9 A;  4OLD A;  5FEF A;  1L3L A;  2P9V B;  5A92 A;  5CHJ A;  1IYO A;  2GDN A;  3F1N A;  3UE6 A;  1YSP A;  2C6W B;  4E3O A;  2VV7 A;  3VP4 A;  3BQA A;  5K5B A;  1L0E A;  3MKE A;  4BWI A;  4L0L A;  3WRZ A;  3C38 A;  5KIZ A;  5J8X A;  2WGW B;  5FEG A;  4O7D A;  4HJ3 A;  4C6Y A;  3E2K A;  5FQ9 A;  4E6X A;  1SCW A;  1ONG A;  3ZQ5 A;  2Z6C A;  1PRQ A;  1NZU A;  3IBR A;  5CTN A;  4KEN B;  2FFF B;  3H82 B;  4KQD A;  1ACF A;  4ID4 A;  2NUP C;  4S2M A;  5HAP A;  4R70 A;  3WS2 A;  2XQZ A;  3HLB A;  3HLF A;  5IT5 A;  5U47 A;  3KO6 A;  3SH8 A;  3IT9 A;  4IBR A;  2EWV A;  3LEZ A;  2PHY A;  2IWC A;  2KOI A;  3T4Q A;  1MWT A;  1BLH A;  3GTC A;  3UME A;  2CMN A;  2VV8 A;  4WEK A;  3T1X A;  5TBM A;  3UPP A;  3C5A A;  3UDX A;  1N9B A;  4E3N A;  5G4Y A;  4WZ5 C;  4PKY G;  5F1G A;  5HDD A;  2Y2P A;  5C5K A;  4EV4 A;  2WUQ A;  2PU2 A;  3DW0 A;  1S67 L;  2VZW A;  3TOI A;  3C7V A;  2JCH A;  2H5S A;  1T1C A;  1PIO A;  2Y2K A;  3K3D A;  4HY8 A;  1KDW A;  4R38 A;  5GLD A;  1K56 A;  4E04 A;  2PR5 A;  5L2F A;  3UE0 A;  4DN0 A;  1GA9 A;  2VEA A;  3MMH A;  3BM6 A;  4R6L A;  3QP4 A;  2XD5 A;  1FIL A;  3NJA A;  1H8Z A;  4UAA A;  1DP6 A;  4WL9 A;  5KSC A;  3N8S A;  4FCF A;  4OLG A;  5CGW A;  4BD1 A;  4DMZ A;  3EEA A;  5HL6 A;  3TSG A;  4RX2 A;  4KG5 A;  2JN7 A;  4QU3 A;  3ZGA B;  4KZ4 A;  4LV0 A;  2ZQ8 A;  4OQ0 A;  4GD6 A;  4B88 A;  1XX2 A;  3ZHH A;  3PBN A;  5CER A;  2IA2 A;  3C30 A;  4ZDX A;  3LIC A;  4E3L A;  5E2H A;  3IH8 A;  3NY4 A;  4U0X A;  3ZG0 A;  3WS4 A;  4EQI A;  3CPT A;  4OH0 A;  3VP0 A;  3C4P A;  3MJQ A;  2D01 A;  3G32 A;  1CF0 A;  4JGO A;  4X53 A;  1W63 M;  1PI5 A;  2ZC4 B;  3FPW A;  4R23 A;  5A8B A;  2VGJ A;  3GR2 A;  5J7E A;  3UDI A;  5EVI B;  3AGF A;  5FA7 A;  3PYP A;  1MXO A;  4Y15 A;  1G5U A;  4IHQ A;  3A0V A;  5AVE A;  4EET B;  4H6J B;  4WM9 A;  2QHK A;  4H8R A;  3TW8 A;  4E3M A;  2ZQD A;  1PNE A;  4Z1W A;  3GSG A;  2Q0O A;  2WK0 A;  2Y59 A;  2PU4 A;  4KZ5 A;  5FDS A;  4MMN A;  3F1N B;  2GX5 A;  1ZKJ A;  5FI2 A;  4KQO A;  1FSY A;  2WZX A;  4OQG A;  5CTM A;  1JWZ A;  2H0T A;  2OSU A;  2O99 A;  2HPB A;  4WYY A;  3ZDJ A;  2PAV P;  1T19 A;  1IYP A;  4S2N A;  4Y13 A;  1CI9 A;  4B9O A;  3CMZ A;  2EX6 A;  3M6B A;  1K4F A;  3PBR A;  4X69 A;  3R4K A;  2ZMA A;  3DTI A;  2HP6 A;  4MN5 A;  4OQI A;  2H28 A;  3O86 A;  4HBU A;  4PM7 A;  3T4S A;  4B4X A;  4N9L A;  2Y79 A;  3ZG7 B;  3S7O A;  3BJN A;  2ZC7 A;  3Q1F A;  4Q0I A;  2WKQ A;  3V3S A;  1XP4 A;  3OLO A;  2JKT M;  3LID A;  2ZBB A;  5KMW A;  1BTL A;  5AQB A;  3IX4 A;  4E3I A;  1MPL A;  3QP8 A;  4P6Z S;  4NXB A;  2WGW A;  4DE1 A;  2HF6 A;  4EBP A;  3K2N A;  3VOZ A;  3SS3 A;  1ERO A;  3G2Z A;  1TDL A;  3Q7Z A;  1TD5 A;  3IHA A;  1MWR A;  4LV3 A;  4QPR A;  5HWV A;  4KG2 A;  2XGN A;  3A3E A;  3BFD A;  4KZ8 A;  4U0T A;  1FR1 A;  4MBH A;  2O0Y A;  3W2Z A;  3QP6 A;  5HX9 A;  3HRE A;  2HJ9 C;  3R7W B;  2V8C A;  2WZZ A;  1K0K A;  3E2L A;  4EQ1 A;  2W3E A;  1XGI A;  3EOI A;  3VP3 A;  3A3J A;  4S2N C;  4PMA A;  3BEC A;  2ZLY A;  1LT0 A;  3P01 A;  3C2W A;  5CEB A;  4ZRR A;  1PZO A;  1W8Q A;  4BBT A;  1XFQ A;  5DF8 A;  2XSS A;  3EWK A;  4H6J A;  1P9R A;  1HVB A;  3ZYT A;  4S2O A;  3KSI A;  3MXR A;  3N7W A;  4G3V A;  5EFW A;  1JWV A;  4WF0 A;  3LUQ A;  4GLQ A;  3UB8 A;  3Q07 A;  5HD3 A;  4WMC A;  4KZ9 A;  5AQ9 A;  4GHI B;  2HV1 A;  4GCZ A;  2B95 A;  2WGV A;  1PI4 A;  4A5R A;  4S2P A;  4GW9 A;  1K54 C;  1WYC A;  1LSW A;  1M40 A;  4P87 A;  1WA9 A;  3C7U A;  4FH4 A;  2Y2Q A;  4MLL A;  3VP1 A;  4NK3 A;  4BEN A;  3L7H A;  3IWI A;  4ZBE A;  1Z6F A;  5DTK A;  1MBL A;  3ITB A;  4JGR A;  2WAD A;  3NOU C;  3SOI A;  3VOY A;  1VET B;  1G6A A;  4NXE A;  2PD7 A;  3IF6 C;  3QP2 A;  4JF4 A;  4KG6 A;  3HLC A;  2J7V A;  1LHY A;  5F5Y A;  3SS5 A;  5HWW A;  2DRW A;  1TDG A;  3RFB A;  4N1X A;  2P9V A;  2XRN A;  3WRT A;  1ALQ A;  2A3U A;  4KUK A;  4M4X A;  5HW3 A;  1NRF A;  2ZC3 B;  4K0W A;  4QY6 A;  5CRF A;  2GNX A;  1H3Q A;  3F1P B;  4E3K A;  2KLI A;  3NC8 A;  3B33 A;  4LPZ A;  4E6W A;  2ZM0 A;  1N9N A;  4EER A;  1K54 A;  5EM1 A;  4E3J A;  1MWU A;  3LIB A;  5HAI A;  3ZG5 A;  5J3W A;  1IKG A;  4I3I A;  5FAP A;  4GNU A;  4N92 A;  4S2L A;  5A90 A;  2Y4A A;  5DJT A;  5E2E A;  2X02 A;  3F1P A;  5M1A A;  3A3F A;  4Q0J A;  3DTE A;  2M7U A;  2WYX A;  1YMX A;  5AQ7 A;  1BLC A;  2UWX A;  2Z2L B;  2J8Y A;  3RXW A;  3H7W B;  3UB7 A;  4RYE A;  4MNR A;  4UQI S;  5FI6 A;  1VHM A;  1BLS A;  5FSR A;  2RL3 A;  4R3B A;  3G30 A;  3OPL A;  1XJ6 A;  3V50 A;  4F94 A;  1OME A;  4JPM A;  4LGW A;  1K57 A;  1ZHH B;  5DJU A;  1W79 A;  3IXB A;  4HH2 A;  1X0O A;  4ZAM A;  1Y28 A;  1Q2Q A;  4Q8I A;  3ZG9 B;  5HAQ A;  3KYE A;  1V9Y A;  5KSH A;  1ODV A;  5FQK A;  5GLC A;  1W8Y A;  5HDC A;  1S66 L;  3AGE A;  3JPU A;  2V20 A;  3MXS A;  1HTZ A;  2J3T D;  1ZG4 A;  1OTD A;  3H9W A;  1IKI A;  1YLY A;  3IH9 A;  3SS4 A;  3E4P A;  3QP1 A;  3S4X A;  4LLO B;  1QMF A;  1YLP A;  4WBG A;  1E4D A;  2V9A A;  3BFC A;  2OAP 1;  2XA7 M;  3FG8 A;  4BL2 A;  1QME A;  3TG9 A;  4AFI A;  2G7U A;  3VV4 A;  5E2F A;  3SW1 A;  2V1A A;  1WYB A;  4WN5 A;  5L10 A;  1TS8 A;  2QPN A;  4BLM A;  4LRX C;  4XUZ A;  4DJ3 A;  3MKF A;  3V39 A;  4WEL A;  4XT2 B;  1Y4O A;  4QD4 A;  2A49 A;  1P97 A;  3M6H A;  4Y0U A;  2V8F A;  1Z09 A;  5EEC A;  5FAQ A;  1GCE A;  1K55 A;  5I5L A;  4MBF A;  5GLB A;  5GHX A;  5GLA A;  1FQG A;  4HBT A;  2ZOI A;  5GHZ A;  2EFX A;  2QJ7 A;  4EBN A;  3BY9 A;  5EVI C;  1S1Y A;  5CHM A;  2WKI A;  1RGZ A;  1JTD A;  3HJK A;  4UEY A;  3V5M A;  4OVD A;  1A0K A;  3ICY A;  3RXX A;  4ETZ A;  3VFF A;  3A0R A;  4UHU A;  4EES A;  3MFX A;  4OPY A;  3UPO A;  4HI4 A;  2DNS A;  1F2K A;  3IX8 A;  4Y0T A;  2Z2M B;  4LRY C;  4R4R A;  1XA1 A;  4JF5 A;  3P98 A;  4BMW A;  1ESU A;  1TEM A;  1VQQ A;  5FAO A;  2VV6 A;  4JXG A;  2GZA A;  3RH8 B;  3PHY A;  4JXS A;  5DF7 A;  3ZNY A;  1H8Y A;  2X01 A;  4EUV A;  2RCX A;  3NEC A;  2WKE A;  1VEU A;  5TR7 A;  3BY8 A;  4LFU A;  1MKM A;  3UB9 A;  2G2U A;  4YWZ A;  4L9F A;  2Q9N A;  4DE3 A;  3QP5 A;  3FKW A;  5FQI A;  4LEN A;  4CJN A;  5D3O A;  4FTX A;  4Y5F A;  4FSF A;  1VET A;  2JC7 A;  2Q9M A;  2INW A;  4M3K A;  4X55 A;  4DXC A;  3MQQ A;  3BFE A;  3VE4 A;  4IJG A;  1L0D A;  3A3I A;  4WZ5 A;  5TFQ A;  1S4R A;  1ONH A;  4ME4 A;  4EUZ A;  4JGP A;  3LR5 A;  3MFD A;  3GQZ A;  1CEG A;  1LI9 A;  1EI5 A;  4I38 A;  4GHI A;  2WKR A;  2WKP A;  3MF0 A;  1C3B A;  1D06 A;  3G31 A;  4CPK A;  4PM6 A;  1CI8 A;  3IWO A;  4HNB A;  5AQA A;  3RTY A;  1L0F A;  2Y8H A;  1E25 A;  4Y0O A;  2PD8 A;  2DMW A;  2R9W A;  3LI8 A;  4ESP A;  2OV5 A;  3NDG A;  1RGY A;  1S0W A;  1CQA A;  2I72 A;  3MZD A;  3BEB A;  1J9M A;  3OPP A;  4I39 A;  2QKP A;  5EE8 A;  1YQS A;  3R7W A;  1LI0 A;  3IQA A;  4S2J A;  4PKY A;  5FQJ A;  1SKO B;  2JKF A;  4N1H A;  1NYM A;  2EXB A;  1CEF A;  3JVU A;  3HJI A;  1K38 A;  3CPT B;  4X1M A;  1I2W A;  4Z9Q A;  3CI6 A;  2ZC5 B;  2JBF A;  5IS1 A;  1K6S A;  5CGS A;  2ZL1 B;  5HPF A;  2A2L A;  4C75 A;  4P6Z M;  3CIT A;  3ITA A;  3OCN A;  2OAQ 1;  4CQH A;  2HDS A;  3S22 A;  4NET A;  4DDY A;  4P6B A;  3GEC A;  2QYB A;  1KDS A;  1YT4 A;  2PBD P;  3PAE A;  3WS1 A;  2XFT A;  3G2Y A;  4IUH A;  4DF6 A;  3T12 B;  5KZH A;  3KX0 X;  2PRF A;  1BZA A;  2XRO A;  2O9B A;  1OPX A;  1BT5 A;  3VFH A;  1G6O A;  2H0Y A;  1HLU P;  3QNB A;  2JE5 A;  3DTK A;  1SDE A;  1ES3 A;  1I5Q A;  3VOL A;  4CLC A;  2JHE A;  2WGI A;  2EFU A;  3MZE A;  3G34 A;  1U60 A;  1I2S A;  1MWS A;  4D60 A;  3L9K A;  4X1L A;  1K6R A;  4MDZ A;  5DTS A;  3MR0 A;  1RCJ A;  4MBK A;  4K08 A;  3W4P A;  4IVK A;  1GSV A;  2OWJ A;  1LLB A;  2J3W A;  3U4L P;  1FOF A;  5F1F A;  5AVF A;  4ARZ B;  3BQ8 A;  3OPR A;  1LL8 A;  5FQM A;  3HCY A;  3BW6 A;  2O9C A;  4RQ9 A;  1FCM A;  5LBR A;  3QNC A;  1J3W A;  1YLJ A;  3PBO A;  3A3D A;  3GVB A;  4RX3 A;  4IUK A;  4WEJ A;  2ZD8 A;  1GHI A;  3MSH A;  2QMI A;  5F6A A;  2GJ3 A;  3S7P A;  3TE8 A;  3BWL A;  4GD8 A;  4GKU A;  4X25 A;  1MY8 A;  3FYZ A;  2Y2J A;  3ZVT A;  1CK3 A;  1RP5 A;  2HDU A;  5A93 A;  2M7V A;  4QY5 A;  1P0Z A;  3FC7 A;  3HLW A;  5JYP A;  3HLE A;  3T4K A;  1SZV A;  1G68 A;  3E4Q A;  3PTE A;  2JKR I;  1FCN A;  2VKS A;  1NLY A;  2HP5 A;  1GHP A;  1H8M A;  4GJ4 A;  1K4E A;  3UDF A;  1YSQ A;  3PBS A;  1V9Z A;  1XJ4 A;  1G28 A;  1FSW A;  1IEM A;  2MJ6 A;  1W63 Q;  4F3L A;  3KSG A;  3G6O A;  4EWF A;  2IWD A;  2A24 B;  5G18 A;  5G4Z A;  2XD1 A;  3T1Q B;  1VM1 A;  2G2W A;  4NXF A;  5F82 A;  5EOE A;  3OBF A;  4OP8 A;  4CLC B;  3UN7 A;  2W3F A;  3S7Q A;  4JLF A;  4R1G A;  4HEF A;  3JYI A;  5CGX A;  5DKK A;  4EEP A;  1KE3 A;  1IFQ A;  2EX8 A;  5IHV A;  3O3V A;  4X6T A;  4DRT A;  3SH7 A;  3ZG8 B;  4CLC E;  1L0G A;  2FZ0 A;  5DVA A;  4DKI A;  1Q2P A;  3A0S A;  1YMS A;  3S7N A;  1LSX A;  3BFF A;  3HVF A;  1YM1 A;  2HGV A;  5GHY A;  1UWP X;  4EU0 A;  2XDM A;  3B42 A;  1F9I A;  3FZC A;  4FOF A;  5GL9 A;  5DKL A;  3UO9 A;  1YLZ A;  2Y2H A;  1ZC2 A;  4ARZ A;  2EX2 A;  3M2K A;  2I9V A;  1W5D A;  2Y2G A;  4KQR A;  1XPB A;  1OTA A;  2W3H A;  3EGD C;  4R3J A;  4EBL A;  1NLZ A;  3ZNT A;  4OP5 A;  2XA7 S;  4F3L B;  3T4L A;  3E4O A;  1GHM A;  5EV0 A;  3CLO A;  2W27 A;  3OZH A;  1DJB A;  4MN7 A;  3TRC A;  1BUL A;  1T1B A;  1NYY A;  4QWO A;  4O01 A;  4BD0 A;  3MBZ A;  2ZQC A;  4Y2F A;  2ZQ9 A;  5EUA A;  3NCK A;  2Y2L A;  5CXW A;  1UWN X;  1ERQ A;  1SHV A;  1CJF A;  2EXA A;  3GV9 A;  5AJG A;  4OOM A;  3BRM A;  4GN2 A;  1PWD A;  3Q7V A;  4IVI A;  1JVJ A;  5TJJ A;  5L09 A;  1ES5 A;  2J80 A;  4K0X A;  4KZB A;  1JNU A;  4FH2 A;  3LY3 A;  2W3D A;  3CJM A;  3NUL A;  4I3A A;  3ZVW A;  5HDS A;  4UQI M;  4S2K A;  3T1S A;  1EWZ A;  2ZMV A;  3IXH A;  3O87 A;  2ZC6 B;  1OTB A;  3NIA A;  4R0Q A;  3NDE A;  4G3W A;  1OT9 A;  1TS6 A;  4MCW A;  4N9K A;  1HZO A;  2WKH A;  4Y17 A;  5CEC A;  3N6I A;  4OQH A;  1W7F A;  2VA0 A;  3O88 A;  2ZL1 A;  4WLA A;  2XR0 A;  1DJC A;  3F1O B;  2V2F F;  1EW0 A;  1LSV A;  1YLW A;  4XUX A;  4LV2 A;  2WAE A;  4O0P A;  1E3U A;  2HDR A;  4C3Q A;  3UMD A;  3OC2 A;  1YKD A;  3MXQ A;  4R4S A;  4R3A A;  2J9O A;  2W1T B;  4PHT A;  3WS5 A;  1D1J A;  1OJG A;  2XK1 A;  4XXR A;  3MQ0 A;  2ZQA A;  2E8J A;  3JVV A;  5TBM B;  1SKO A;  5J4E A;  3LYX A;  1PFL A;  5FDH A;  2C5W B;  2EA9 A;  2V0W A;  3NBL A;  5EPH A;  4PAU A;  2K7S A;  2O9A A;  3VMA A;  3VE3 A;  5DF9 A;  3GMW A;  4BBU A;  5E43 A;  4NEE D;  3SH9 A;  4OKP A;  4B4Z A;  3D9Y A;  2KDK A;  1FCO A;  1KVM A;  2NUT C;  3E98 A;  2B5R A;  2PYR A;  3T4O A;  5F83 A;  5L8M A;  2JKT I;  5HAR A;  1DP9 A;  1OTI A;  3AGD A;  4OOY A;  4EXO A;  3H82 A;  1F98 A;  1NWZ A;  5CHU A;  3B47 A;  5DFX A;  4QHC A;  1F5M A;  1WE4 A;  4CLC C;  4ZTK A;  1GA0 A;  2XH9 A;  1K57 C;  2E8I A;  2Y55 A;  4HJ6 A;  3VSL A;  3N8R A;  1IOU A;  4HJ4 A;  1TVF A;  3IS2 B;  4L9G A;  4EEU A;  1VEU B;  2Z6D A;  1XXM A;  3DWK A;  1VB6 A;  2OLU A;  5JYO A;  1JWP A;  1H0M A;  3IF6 B;  5HPI A;  1TS7 A;  3BYD A;  1N4O A;  3B3X A;  1T18 A;  1L2S A;  3UB6 A;  3NOT C;  4GDB A;  4GDN A;  2EWW A;  3LR4 A;  3K3C A;  3Q81 A;  4BJP A;  3FKV A;  3T4J A;  1NJ4 A;  4NXG A;  2W1T A;  1ES4 A;  3D4F A;  2ZM8 A;  4PM5 A;  4MEZ A;  3KSF A;  3CZD A;  4HHD A;  4JXW A;  1D7E A;  5M18 A;  1KGE A;  3HBR A; 
#chains in the Genus database with same CATH homology
 4E6X A;  4MBK A;  4DXB A;  3W4P A;  5FAP A;  1SCW A;  4GNU A;  4N92 A;  4IVK A;  1ONG A;  4S2L A;  1LLB A;  1XKZ A;  5A90 A;  2Y4A A;  1FOF A;  5F1F A;  1NZU A;  5E2E A;  5CTN A;  2X02 A;  4KEN B;  5FAT A;  5M1A A;  3OPR A;  4C6Y A;  3A3F A;  1JTG A;  2FFF B;  3HUN A;  5FQM A;  2WYX A;  3WWX A;  1FCM A;  3QNC A;  1YLJ A;  1YMX A;  5TGF A;  4ID4 A;  3PBO A;  2UWX A;  1BLC A;  2Z2L B;  3A3D A;  2J8Y A;  3GVB A;  4S2M A;  4RX3 A;  4WEJ A;  5AQ7 A;  3RXW A;  3FWL A;  5HAP A;  4YIN A;  1LL5 A;  3N4I A;  2ZD8 A;  1GHI A;  2QMI A;  3WS2 A;  1PYY A;  1NY0 A;  4GD8 A;  4GKU A;  4RYE A;  2XQZ A;  4MNR A;  3HLB A;  1MY8 A;  3FYZ A;  2XEP A;  1BLS A;  2Y2J A;  3HLF A;  5FI6 A;  5FSR A;  5U47 A;  1CK3 A;  1RP5 A;  3ZVT A;  2RL3 A;  4R3B A;  2HDU A;  3G30 A;  3OPL A;  5A93 A;  2EX9 A;  4JKT A;  4F94 A;  3V50 A;  1OME A;  4JPM A;  4GB7 A;  3SH8 A;  1H5X A;  1K57 A;  4QY5 A;  3IT9 A;  4OPQ A;  1W79 A;  3HLW A;  3IXB A;  5JYP A;  4IBR A;  4ZAM A;  1Q2Q A;  3LEZ A;  4ZJ1 A;  4Q8I A;  2IWC A;  3HLE A;  3ZG9 B;  1MWT A;  5HAQ A;  4LCM A;  3I7J A;  1BLH A;  1G68 A;  3GTC A;  5KSH A;  3PTE A;  1LL9 A;  1FCN A;  2OLV A;  2HP5 A;  1GHP A;  3BLS A;  4JBF A;  4WEK A;  1K4E A;  1KVL A;  1YLT A;  1W8Y A;  5FQK A;  5GLC A;  3UDF A;  4BQM A;  3M2J A;  3UPP A;  1K55 C;  3C5A A;  3UDX A;  1N9B A;  3AGE A;  4E3N A;  1SKF A;  3PBS A;  4WZ5 C;  5F1G A;  2Y2P A;  4EV4 A;  2WUQ A;  2V1Z A;  2V20 A;  1FSW A;  2PU2 A;  1IEM A;  3DW0 A;  1HD8 A;  3MXS A;  1HTZ A;  1ZG4 A;  3TOI A;  1AXB A;  3C7V A;  4X68 A;  1IKI A;  2JCH A;  3PAG A;  3BFG A;  1YLY A;  2H5S A;  2BLS A;  3IH9 A;  4EWF A;  2XLN A;  1PIO A;  2Y2N A;  2IWD A;  2Y2K A;  3SS4 A;  3S4X A;  5FQQ A;  5G18 A;  4FD8 A;  3W4O A;  2XD1 A;  1BUE A;  1KDW A;  1QMF A;  5A91 A;  3ZCZ A;  1YLP A;  4WBG A;  1E4D A;  1VM1 A;  5GLD A;  3ZFZ A;  1K56 A;  3BFC A;  3UNW A;  3GRJ A;  2G2W A;  4BL2 A;  1PZP A;  5L2F A;  1QME A;  3UE0 A;  1K25 A;  3HLD A;  3TG9 A;  1GA9 A;  5F82 A;  5EOE A;  5E2F A;  3BM6 A;  4OP8 A;  1WYB A;  2XD5 A;  3UN7 A;  3VSK A;  1KGG A;  1H8Z A;  2QPN A;  4JXV A;  4JLF A;  4UAA A;  4BLM A;  4R1G A;  5KSC A;  3N8S A;  4FCF A;  4OLG A;  4U3T A;  5CGW A;  4BD1 A;  4HEF A;  4XUZ A;  1O07 A;  3PBT A;  4P85 A;  3JYI A;  2Y2M A;  3MKF A;  4WMC D;  5CGX A;  2R9X A;  3E2K A;  1KE3 A;  3V39 A;  2IWB A;  1PWC A;  4WEL A;  1XGJ A;  2EX8 A;  4QD4 A;  1KGF A;  5IHV A;  3O3V A;  2A49 A;  4X6T A;  4DRT A;  3SH7 A;  3ZG8 B;  4QJG A;  3N8L A;  2DCF A;  3TSG A;  3M6H A;  4YFM A;  4RX2 A;  4Y0U A;  4KG5 A;  4QU3 A;  3ZGA B;  4KZ4 A;  4LV0 A;  5EEC A;  1L0G A;  2ZQ8 A;  4OQ0 A;  4GD6 A;  5FAQ A;  1GCE A;  4B88 A;  1XX2 A;  4Y7P A;  5DVA A;  1K55 A;  1Q2P A;  3EQU A;  5DTT A;  3ZHH A;  2J9P A;  4MBF A;  1NZO A;  5GLB A;  3PBN A;  5CER A;  3G35 A;  3UE3 A;  5GHX A;  4ZDX A;  1YMS A;  5GLA A;  3W8K A;  4E3L A;  5E2H A;  3IH8 A;  3NY4 A;  4U0X A;  3ZG0 A;  1S6R A;  1FQG A;  3WS4 A;  4EQI A;  4HBT A;  3BFF A;  1ESI A;  4OH0 A;  5GHZ A;  3IXG A;  3HVF A;  3VP0 A;  2EFX A;  3C4P A;  3VP2 A;  1BLP A;  4EBN A;  3WS0 A;  1YM1 A;  1IEL A;  3G32 A;  5EVI C;  4KZ7 A;  5CHM A;  2WKI A;  1RGZ A;  1JTD A;  4X53 A;  5GHY A;  1PI5 A;  2ZC4 B;  2XDM A;  4WZ4 A;  3UY6 A;  3V5M A;  1ZG6 A;  3FZC A;  5GL9 A;  4R23 A;  4OVD A;  1O7E A;  4K91 A;  2Y91 A;  2VGJ A;  3S1Y A;  3UO9 A;  3GR2 A;  4JF6 A;  1PW1 A;  3RXX A;  1YLZ A;  3UDI A;  2Y2H A;  1ZC2 A;  5EVI B;  3W4Q A;  3Q82 A;  3HUO A;  3VFF A;  2EX2 A;  3AGF A;  5FA7 A;  3M2K A;  4UHU A;  1MXO A;  5I94 A;  4GZB A;  1W5D A;  2Y2G A;  4OPY A;  3UPO A;  4KQR A;  1ES2 A;  1XPB A;  1K56 D;  2DNS A;  4WM9 A;  4H8R A;  4R3J A;  4EBL A;  4OON A;  4IED A;  3ZNT A;  2ZQD A;  4E3M A;  4OP5 A;  4Y0T A;  2Z2M B;  4R4R A;  1XA1 A;  4JF5 A;  1GHM A;  3P98 A;  3GSG A;  3OZH A;  1ESU A;  1TEM A;  1DJB A;  1VQQ A;  5EVL A;  5FAO A;  1BUL A;  2WK0 A;  2Y59 A;  2PU4 A;  4KZ5 A;  4JXG A;  3IF6 A;  1NYY A;  3NI9 A;  1SDN A;  1ZKJ A;  2BG1 A;  4BD0 A;  4JXS A;  3MBZ A;  5FI2 A;  4KQO A;  2ZQC A;  5DF7 A;  3ZNY A;  1FSY A;  2HDQ A;  4OPZ A;  1H8Y A;  4P0M A;  2P74 A;  5FI7 A;  2ZQ9 A;  2WZX A;  4PPR A;  2X01 A;  4OQG A;  4KZ6 A;  5CTM A;  5EUA A;  3EQV A;  1JWZ A;  2RCX A;  3NCK A;  3IHB A;  2H0T A;  2HP9 A;  2OSU A;  2WKE A;  2Y2L A;  5TR7 A;  2HPB A;  5CXW A;  4WYY A;  3ZDJ A;  1ERQ A;  2G2U A;  1SHV A;  2Q9N A;  1IYP A;  4S2N A;  4DE3 A;  3FKW A;  5FQI A;  1CI9 A;  1DJA A;  2X71 A;  4LEN A;  4CJN A;  2EXA A;  3CMZ A;  2EX6 A;  3M6B A;  3GV9 A;  1PWG A;  1K4F A;  1Y54 A;  3PBR A;  4OOM A;  5D3O A;  3OCL A;  5EVI D;  3BRM A;  4GN2 A;  4QB8 A;  1PWD A;  3Q7V A;  5CED A;  4X69 A;  4IVI A;  3HUM A;  4FSF A;  3UPN A;  4DE2 A;  2ZMA A;  3DTM A;  2HP6 A;  1JVJ A;  2JC7 A;  2Q9M A;  4OQI A;  4DDS A;  1ES5 A;  4M3K A;  2PBY A;  4X55 A;  4DXC A;  5M19 A;  4K0X A;  3O86 A;  4KZB A;  3BFE A;  4HBU A;  4PM7 A;  4B4X A;  4N9L A;  3CG5 A;  5EVI A;  4FH2 A;  3ZG7 B;  3LY3 A;  1L0D A;  3A3I A;  3CJM A;  2ZC7 A;  4WZ5 A;  3Q1F A;  4LCL A;  3ZVW A;  4DKI A;  5TFQ A;  3V3S A;  4S2K A;  1EWZ A;  1XP4 A;  3HLG A;  4KZ3 A;  1ONH A;  4EUZ A;  3IXH A;  3O87 A;  5KMW A;  2ZC6 B;  4R0Q A;  1BTL A;  1IYQ A;  1FR6 A;  3NIA A;  5AQB A;  3P09 A;  3NDE A;  2CC1 A;  4N9K A;  3MFD A;  1HZO A;  2WKH A;  3GQZ A;  5CEC A;  5BOH A;  1CEG A;  1LI9 A;  1EI5 A;  1MPL A;  4E3I A;  4OOL A;  2WAF A;  4UA9 A;  3N6I A;  4OQH A;  1W7F A;  3IF5 A;  3O88 A;  1DY6 A;  2XF3 A;  2WGW A;  4DE1 A;  3IWQ A;  2XR0 A;  4EBP A;  5HFO A;  1DJC A;  1C3B A;  2H10 A;  4KQQ A;  3VOZ A;  2V2F F;  3DWZ A;  3G31 A;  1ERO A;  3G2Z A;  1CI8 A;  3LO7 A;  4PM6 A;  3SS3 A;  1TDL A;  4CPK A;  3IWO A;  3Q7Z A;  5AQA A;  3RJU A;  3IHA A;  1YLW A;  1MWR A;  4RVA A;  4XUX A;  1L0F A;  4LV3 A;  4LV2 A;  5HL1 A;  2WAE A;  1E25 A;  4KG2 A;  4Y0O A;  1E3U A;  2XGN A;  3A3E A;  3BFD A;  2HDR A;  3FV7 A;  4KZ8 A;  4PM8 A;  4ZJ2 A;  4C3Q A;  4U0T A;  1FR1 A;  3OC2 A;  4MBH A;  2ZM2 A;  5E2G A;  4DE0 A;  2R9W A;  3HRE A;  4R4S A;  5HX9 A;  2J9O A;  5EOO A;  3C4O A;  3G4P A;  2ZQ7 A;  3WS5 A;  4UA7 A;  2XK1 A;  2WZZ A;  3NDG A;  2OV5 A;  3E2L A;  4XXR A;  1RGY A;  1S0W A;  2QZ6 A;  3BLM A;  2FFY A;  1XA7 A;  4OPR A;  1XGI A;  1E3U D;  2ZQA A;  4S2I A;  4ZJ3 A;  1BSG A;  3VP3 A;  3A3J A;  2I72 A;  2Y2O A;  3MZD A;  4S2N C;  3BEB A;  1J9M A;  4PMA A;  3BEC A;  2ZLY A;  2XFS A;  3OPP A;  4X56 A;  5CEB A;  3IXD A;  5FDH A;  1PZO A;  1W8Q A;  4PM9 A;  5EE8 A;  1YQS A;  1LI0 A;  3IQA A;  5DF8 A;  3HBR A;  4D2O A;  4S2J A;  5FQJ A;  2C5W B;  1HVB A;  4N1H A;  1NYM A;  3NBL A;  5EPH A;  2EXB A;  4S2O A;  1CEF A;  3VMA A;  3MXR A;  3LY4 A;  3N7W A;  5DF9 A;  1K38 A;  1JWV A;  3GMW A;  3QHY A;  1IYS A;  1I2W A;  4Z9Q A;  3Q07 A;  4WMC A;  2ZC5 B;  4KZ9 A;  2JBF A;  5E43 A;  5AQ9 A;  3SH9 A;  1K6S A;  4OKP A;  4HES A;  5CGS A;  4B4Z A;  2WGV A;  1FCO A;  1PI4 A;  4A5R A;  3OPH A;  1ERM A;  1KVM A;  4S2P A;  4C75 A;  2B5R A;  1K54 C;  1WYC A;  1NXY A;  3ITA A;  4P87 A;  1M40 A;  3OCN A;  5F83 A;  4IBX A;  5FAS A;  5HAR A;  3C7U A;  2HDS A;  3MZF A;  4FH4 A;  2Y2Q A;  4MLL A;  3S22 A;  3AGD A;  4OOY A;  3VP1 A;  4NET A;  4BL3 A;  4NK3 A;  4DDY A;  4BEN A;  4P6B A;  3IWI A;  1KDS A;  1YT4 A;  5CHU A;  4ZBE A;  1Z6F A;  3PAE A;  4UA6 A;  2XFT A;  3G2Y A;  3WS1 A;  1M6K A;  4QHC A;  5DTK A;  4DF6 A;  3PBQ A;  4KZA A;  1KE0 A;  1MBL A;  3ITB A;  2WAD A;  1WE4 A;  3SOI A;  3VOY A;  5KZH A;  3LCE A;  1G6A A;  1BZA A;  3HL9 A;  3V3R A;  3ISG A;  4ZTK A;  1GA0 A;  2XH9 A;  1KE4 A;  1BT5 A;  3Q7V B;  4GOG A;  3VFH A;  3IF6 C;  1K57 C;  2E8I A;  2H0Y A;  4JF4 A;  4KG6 A;  2Y55 A;  4LV1 A;  3VSL A;  1PW8 A;  5FQ9 A;  3N8R A;  3QNB A;  3HLC A;  2JE5 A;  1SDE A;  1LHY A;  2J7V A;  3SS5 A;  1TVF A;  2VGK A;  1ES3 A;  1I5Q A;  2DRW A;  1TDG A;  4N1X A;  2P9V A;  3WRT A;  1XXM A;  1ALQ A;  1MKI A;  2A3U A;  3UE1 A;  3DWK A;  4RA7 A;  2OLU A;  5HW3 A;  2ZC3 B;  1NRF A;  2Y2I A;  2ZJ9 A;  4OLD A;  1JWP A;  5JYO A;  2P9V B;  4K0W A;  2WGI A;  4QY6 A;  5A92 A;  3IF6 B;  2EFU A;  5CHJ A;  1IYO A;  2GDN A;  3BYD A;  3MZE A;  5CRF A;  4E3K A;  3G34 A;  1N4O A;  2C6W B;  3B3X A;  3NC8 A;  1L2S A;  1U60 A;  3VP4 A;  4E3O A;  1I2S A;  4E6W A;  4GDB A;  1MWS A;  4GDN A;  1L0E A;  3MKE A;  3Q81 A;  2ZM0 A;  4L0L A;  3WRZ A;  3FKV A;  4BJP A;  1NJ4 A;  1K54 A;  1K6R A;  1ES4 A;  3D4F A;  5J8X A;  2ZM8 A;  4PM5 A;  2WGW B;  4MEZ A;  5DTS A;  1MWU A;  4E3J A;  3CZD A;  4JXW A;  4O7D A;  5HAI A;  3ZG5 A;  5M18 A;  1KGE A;  1IKG A;  1RCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...