2B5RA

1b lactamase / b lactamase inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVYNSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Binding Hot Spots in the TEM1-BLIP Interface in Light of its Modular Architecture.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 92
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2b5rA00
3WS5A 3LY3A 5GHXA 4EV4A 4MBHA 1KVLA 2C5WB 3MZDA 1N4OA 5EVIC 1TVFA 5GLAA 1GHPA 3VOZA 2OSUA 3ZGAB 3A3FA 4OP8A 3G30A 4C75A 1C3BA 4IVIA 4M3KA 4D2OA 3NDEA 1DJCA 2Y2GA 4WZ5C 2B5RA 4EBLA 1CI8A 2RL3A 2QMIA 3NC8A 1DY6A 1I2SA 4Y7PA 3PAGA 3E2KA 3BLMA 2WGWB 1K4FA 4OP5A 4DXCA 1SDNA 1XGIA 2HDUA 3RXXA 1ONGA 5E2EA 2ZQ9A 3FYZA 5CHJA 3FZCA 4LENA 2ZM8A 3OPPA 5L2FA 1HTZA 3FKWA 1O7EA 4FH2A 4ZJ1A 3NI9A 1PYYA 4BENA 4JF6A 3FKVA 3BFCA 4E3NA 1L2SA 2EFUA 4UHUA 1YLZA 3GR2A 4OQIA 4S2KA 3IH8A 1J9MA 2HDSA 2XD5A 4PM6A 5E2HA 3G32A 1GHIA 3Q81A 1NY0A 2WKEA 4OPQA 3ZG5A 1YMXA 2Z2LB 1JWPA 1FR6A 1NJ4A 3ITAA 3GV9A 3OCLA 3N4IA 4K0XA 1K54C 2E8IA 4ZJ2A 1K56A 5AQ9A 3IF6B 1W8YA 3PBOA 5FSRA 2RCXA 1VQQA 5AQ7A 3RXWA 1EI5A 3PBNA 3HLFA 1MWSA 1DJAA 5HX9A 3UN7A 3BEBA 5FI7A 3WRTA 2ZQDA 4KG2A 4KQOA 4H8RA 5GHYA 1YT4A 4LV0A 3ZG0A 5F82A 2J8YA 3FV7A 3N8LA 2ZC4B 2ZC5B 4GDNA 3Q7ZA 3HREA 4KQRA 4R3JA 4KZ8A 4P85A 3LEZA 3W4PA 1U60A 1ES3A 3SH9A 4DXBA 3HLDA 3HLGA 3FWLA 2WGIA 3O87A 3MFDA 3HUMA 4MBFA 4QD4A 3SS4A 4GNUA 1BTLA 1NXYA 1Q2PA 2Q9NA 2Y2MA 4JXSA 1K6RA 4OOYA 3G2ZA 4X56A 4P6BA 1JTDA 2XR0A 1KGEA 1MWTA 1KDSA 4IBXA 1E4DA 4KZ7A 2G2UA 5GLDA 1PWGA 3MXRA 2OV5A 5EOEA 2VGKA 4PM5A 1K56D 2FFYA 3BLSA 4B4XA 4R4RA 4L0LA 3W4QA 4JKTA 4RVAA 5FQKA 1KVMA 4GOGA 4C6YA 5GLBA 3M6BA 1ONHA 2QZ6A 4KZAA 3VP4A 3BFFA 2Y2LA 4MEZA 2WGWA 3O88A 4EQIA 5DF9A 1ZC2A 3UDFA 3A3JA 5M19A 2ZC6B 4OH0A 4FSFA 2ZC7A 4UA9A 3B3XA 5DVAA 3C5AA 1CK3A 3PBTA 4OLDA 4B88A 2QPNA 2Y2KA 1NRFA 4MLLA 4S2NC 1LL9A 1DJBA 4OPRA 1YLWA 4GZBA 5FATA 4GN2A 4PMAA 2JCHA 4K91A 4FH4A 3HVFA 2WZXA 4WBGA 3SH8A 4DDSA 3V3SA 2XF3A 3PBQA 1JWVA 2J9PA 1BZAA 1G6AA 5E43A 5CHUA 2OLUA 3ZNTA 3N8RA 4JXVA 1L0FA 2V2FF 5FAPA 2ZLYA 4PPRA 3IHAA 3CMZA 2WADA 2ZM0A 4MBKA 3UE1A 4X55A 3JYIA 3BM6A 3HUNA 2XH9A 3ZVWA 3SH7A 2BG1A 3E2LA 4C3QA 3EQUA 4K0WA 4HESA 2WUQA 4NETA 2X71A 3DWKA 4OQ0A 2J7VA 3UNWA 1PWCA 3IQAA 3A3EA 1K57A 4S2PA 2ZQAA 2Q9MA 3MZEA 3IWQA 3VP1A 1ALQA 5U47A 4B4ZA 3VP3A 2ZJ9A 3VSKA 3Q82A 2HP6A 3TG9A 2G2WA 4JLFA 5A91A 4BJPA 4BL3A 4JPMA 5D3OA 1WYCA 4WEKA 4S2IA 1NZUA 4X6TA 4GDBA 4O7DA 4S2MA 2FFFB 2DRWA 1SKFA 2Y59A 5IHVA 3WS1A 4EBNA 4R0QA 3ZDJA 3IXDA 4PM7A 5FQ9A 3IXGA 1IKIA 2XQZA 3VP2A 3VP0A 3QNBA 3ISGA 2R9WA 3BFGA 3IF6C 4ZDXA 3S22A 3SS3A 1PW8A 1IKGA 2EX8A 4OOMA 4OVDA 5A92A 2IWBA 3SS5A 5EVID 3HLWA 1YM1A 3ZVTA 3M2JA 2H5SA 4DE0A 5CGXA 2EX2A 4WYYA 3O86A 2HPBA 3N6IA 4RX2A 1XA7A 2GDNA 4DKIA 4ZTKA 3MBZA 1JWZA 2PU4A 1K25A 1YMSA 3G4PA 1IEMA 1K55C 1IYPA 2WKHA 3LCEA 3OPLA 1ESUA 4QU3A 5AQBA 4N9LA 3V50A 4F94A 2A49A 3G35A 4UAAA 1JTGA 2EXAA 4FCFA 4E3IA 3GVBA 2H0YA 4ZJ3A 4BQMA 3PAEA 4IBRA 1PI4A 3AGDA 5DTKA 5I94A 3HLBA 3UPOA 4E3MA 1KE0A 2Y2PA 3UE0A 4EWFA 2Y2OA 1EROA 1W7FA 1IYSA 2HDQA 4P87A 1MPLA 4OPYA 1BLPA 4UA6A 5CEDA 5FDHA 3BFDA 5GL9A 4E3KA 2HP9A 1TDLA 3HL9A 2UWXA 3N7WA 4KG5A 4BD1A 5HL1A 5FQJA 1N9BA 4GKUA 3LY4A 3Q7VA 5G18A 2C6WB 4Z9QA 4DE3A 4UA7A 1BLSA 4GD6A 1XPBA 1XX2A 1H5XA 4JXGA 1XA1A 2Y55A 5F1FA 4QHCA 3IHBA 4Y0TA 4OKPA 4QY6A 2VGJA 2Y2NA 1RP5A 1PWDA 2X02A 3MXSA 5DTSA 3Q1FA 3UDXA 5CGSA 2WYXA 3UPNA 5KZHA 4CPKA 5CTNA 2CC1A 5E2FA 4E3JA 4HBTA 4S2OA 1FQGA 3VSLA 3WWXA 3TOIA 1NZOA 4LCLA 1ERMA 1AXBA 1PI5A 4E6XA 4BD0A 3DWZA 1ES2A 1BLCA 4XUZA 4IVKA 1E25A 5A90A 3AGFA 3QHYA 2PBYA 3NDGA 1S6RA 1L0DA 1XP4A 4X68A 5EECA 3ZFZA 2XFTA 4KQQA 1ES5A 4U3TA 5DF8A 2J9OA 3BECA 5GHZA 3IXBA 1W8QA 5A93A 2ZQ7A 1PZOA 2P74A 3QNCA 1LHYA 3IWIA 3G34A 5TGFA 3W4OA 3DTMA 5HFOA 1XKZA 1GA0A 1BULA 4YFMA 2V20A 3CZDA 3CG5A 1JVJA 4LV3A 3S4XA 5CEBA 5EVIA 1ERQA 1YQSA 1G68A 1KGFA 1LLBA 1ZKJA 2XFSA 3HLCA 4EBPA 3MZFA 4N1XA 3Q7VB 5FQMA 1VM1A 4WMCD 4QJGA 3GSGA 1NYMA 4U0TA 2WAEA 3OCNA 4WZ5A 4X53A 2H10A 3VFHA 5FASA 5TR7A 1CEGA 2XDMA 4HBUA 3C7UA 1E3UD 4OPZA 4WELA 3VOYA 1O07A 3WS4A 1YLPA 4XUXA 1I2WA 3G31A 2XK1A 4IEDA 4R3BA 2WAFA 1QMEA 4N1HA 4KZBA 4KZ9A 4R1GA 4ZAMA 5KMWA 1LI9A 2H0TA 4JXWA 5EUAA 3WS0A 1LL5A 3BFEA 3ZCZA 3AGEA 1FR1A 1QMFA 2EXBA 2ZQ8A 3TSGA 2WKIA 4N92A 3RJUA 3IXHA 4GD8A 4KENB 2HP5A 3NIAA 4QB8A 3UE3A 2EX6A 3ITBA 1HVBA 3NBLA 5DTTA 2Y2JA 2P9VA 4DE1A 1GA9A 3G2YA 2IWDA 1K54A 3W8KA 2PU2A 2ZM2A 3OC2A 1WE4A 3V3RA 3ZHHA 5JYOA 2BLSA 1K55A 1K57C 2HDRA 3IT9A 5DF7A 5TFQA 4X69A 1GCEA 5CECA 1ES4A 1CI9A 1FOFA 1YLTA 4WM9A 5CRFA 3HLEA 3GQZA 5F1GA 1GHMA 1H8YA 3CJMA 2EFXA 3C4OA 5EVIB 2I72A 2WGVA 2ZQCA 3NCKA 3HBRA 3OPRA 5FI6A 2XGNA 3IH9A 5FI2A 3LO7A 4LCMA 2Y4AA 5FQQA 1SHVA 3BRMA 3P09A 5CTMA 3GRJA 1PIOA 5BOHA 4YINA 3ZNYA 4EUZA 5F83A 1FCMA 2XD1A 3DW0A 3D4FA 4XXRA 3UY6A 2Y91A 4DE2A 1XXMA 1W79A 5EOOA 4OLGA 3MKFA 5CERA 2V1ZA 1MKIA 4LV1A 1L0GA 4RYEA 3Q07A 5CHMA 1RCJA 5CXWA 4MNRA 1MBLA 1SCWA 3OPHA 1CEFA 1EWZA 4ID4A 2A3UA 2Y2QA 5E2GA 2JC7A 3PTEA 4KG6A 2ZD8A 4KZ4A 1BSGA 5EPHA 1L0EA 4OOLA 1FCNA 1ESIA 4WZ4A 1IYOA 1HD8A 4S2JA 1KE4A 3VMAA 1ZG6A 3UPPA 3ZG8B 1K38A 3PBRA 5KSCA 1KGGA 1KDWA 1TEMA 1MWRA 2WK0A 4FD8A 2P9VB 1PZPA 3NY4A 4OONA 4PM8A 3C4PA 4U0XA 3M2KA 3A3DA 3HUOA 5AQAA 4WMCA 4JBFA 3VFFA 4JF5A 2JE5A 3GTCA 1BT5A 1IELA 1MXOA 1OMEA 3PBSA 1K4EA 3BYDA 4ZBEA 3IF5A 3I7JA 4E6WA 5FAOA 5M1AA 1E3UA 1ZG4A 3WRZA 3A3IA 2DNSA 4KZ3A 1MY8A 4S2NA 1YLYA 2Y2IA 1Z6FA 1Q2QA 1PW1A 3O3VA 4OQGA 1I5QA 4NK3A 4QY5A 1BLHA 3OZHA 4S2LA 5CGWA 3GMWA 4BLMA 2XEPA 4OQHA 4DF6A 5HAPA 5KSHA 1MWUA 1SDEA 1HZOA 3IWOA 5HW3A 5FA7A 1NYYA 2Y2HA 3EQVA 4WEJA 5J8XA 2OLVA 4Y0UA 1FSYA 1TDGA 3SOIA 4LV2A 4BL2A 1YLJA 5M18A 5EVLA 1H8ZA 4A5RA 4RX3A 5FAQA 4PM9A 4P0MA 4E3OA 1M40A 2JBFA 4Y0OA 3V39A 5HARA 1K6SA 2ZMAA 3N8SA 1KE3A 1Y54A 3C7VA 4E3LA 2WZZA 5GLCA 4GB7A 4KZ5A 3WS2A 1RGYA 3UO9A 3P98A 2Z2MB 5JYPA 5FQIA 3M6HA 1XGJA 2EX9A 2R9XA 3MKEA 4HEFA 4RA7A 3V5MA 4R23A 4CJNA 4JF4A 1BUEA 1S0WA 4Q8IA 4R4SA 1LI0A 4KZ6A 1RGZA 2XLNA 5EE8A 4DDYA 3ZG9B 1FSWA 4DRTA 1WYBA 1M6KA 5HAQA 2ZC3B 5HAIA 3S1YA 2X01A 2DCFA 1W5DA 3ZG7B 1FCOA 3UDIA 3IF6A 4N9KA 1IYQA 2IWCA
chains in the Genus database with same CATH superfamily
3WS5A 3CAXA 1KVLA 3A3FA 4EU0A 4QPRA 1S1YA 3NJAA 4WZ5C 4EBLA 1A0KA 1DY6A 3PAGA 2H28A 4GLQA 4DJ2A 3ZYTA 3FC7A 3S7OA 2ZQ9A 3FZCA 2ZM8A 1S4SA 5FEFA 4EESA 4BENA 3VOLA 2W1TA 4E3NA 3S7PA 3A0VA 3E98A 5IS1A 1T1BA 4OQIA 3ZQ5A 2HDSA 4PM6A 2WKEA 4EXOA 1JWPA 4HJ3A 4K0XA 3N4IA 4ZJ2A 2CMNA 2M7VA 1NRJA 3IF6B 3PBOA 5FSRA 2RCXA 4PAUA 1DJAA 5HX9A 3BEBA 2INWA 3T4JA 5GHYA 1YT4A 3ZG0A 5F82A 2ZC5B 4MCWA 1N9NA 4P85A 1F9IA 3W4PA 3DTKA 3FWLA 5HDCA 4MBFA 4Y2FA 4I3IA 5K5BA 2Q9NA 3G2ZA 1JTDA 3D9YA 2O9CA 3KSHA 1CJFA 3UB7A 1W63Q 2OV5A 2VGKA 2FFYA 4CLCB 3TE8A 3BLSA 4L0LA 4RVAA 2QZ6A 3SW1A 3V67A 2Y8HA 3UDFA 4FSFA 2ZC7A 5DVAA 3FPVA 5TBMB 4OLDA 2QPNA 3RH8B 2VKSA 4DDSA 3EWKA 4UEYA 1G6AA 2OLUA 3N8RA 4HI4A 2ZL1A 4PPRA 2Q0OA 3IHAA 4Y17A 2WADA 2L4RA 1P97A 3JYIA 2GNXA 2IA2A 2R78A 3E2LA 1S67L 3BWLA 2DMWA 4OQ0A 2J7VA 3UNWA 3F1PA 3MQQA 5U47A 4B4ZA 3VSKA 2G2WA 4BJPA 4GW9A 2FFFB 3EGDC 4GS9B 5FQ9A 4HP9A 4LGWA 1IKIA 3BFGA 4ZDXA 3S22A 1GSVA 4I3AA 4LRXC 1IKGA 2K7SA 4OVDA 1KOUA 5F5YA 3HLWA 2XA7S 3UMDA 2ZOHA 4RX2A 2GDNA 4ZTKA 1JWZA 2ACGA 1K55C 1H8MA 5AQBA 4UAAA 5DJUA 1JTGA 4YWZA 1X0OA 2H0YA 4ZJ3A 4BQMA 3PAEA 4E3MA 1KE0A 2Y2PA 2PD7A 1ZHHB 2Y2OA 3K2NA 3LFVA 1BLPA 5CEDA 5FDHA 1UWPX 4UQIM 4Z9QA 5HZHA 4HH3A 1BLSA 4JXGA 4EEPA 2GX5A 4QHCA 4Y0TA 3MXSA 5DTSA 1PWDA 5CGSA 3NECA 4S2OA 2JN7A 1TD5A 3T4TA 3W2ZA 3DWZA 1BLCA 4XUZA 1GSWA 3EEAA 1TS6A 3B47A 4X68A 1ES5A 2J9OA 3BECA 4G3WA 2NUPC 2OAP1 2UV0E 1LHYA 3W4OA 1JNUA 3DTMA 5HFOA 1TS7A 2J3WA 1BULA 3CZDA 5EVIA 3JVUA 1KGFA 1LLBA 2XFSA 4WMCD 1STZA 4QJGA 4X53A 1VB6A 2H10A 5FASA 4GCZA 5TR7A 3MF0A 4OPZA 3WS4A 2ZBBA 3T12B 1I2WA 5J3WA 5KMWA 2L1MA 3ZCZA 1XJ2A 2V8CA 3IXHA 3JVVA 2XROA 2WKPA 4HOIA 5JYOA 1K55A 2PT7A 2HDRA 3IT9A 1GCEA 3CPTA 1FOFA 4WM9A 3CJMA 3C4OA 2ZQCA 3OPRA 3IH9A 1SHVA 3LI8A 5CTMA 4NG2A 2Z6DA 1PIOA 1FCMA 4B9OA 3D4FA 4XXRA 3H7WA 3UY6A 4DE2A 1WA9A 1OTDA 3MKFA 4YNRA 2KOIA 1MC0A 2K2NA 3A0RA 1N9OA 1EWZA 3OOVA 5E2GA 1OPXA 4KG6A 3PTEA 4KZ4A 2VZWA 1L0EA 1TS8A 1KE4A 1NLYA 5LBRA 3PBRA 3LYXA 5KSCA 1KGGA 1KDWA 4FD8A 1VEUA 2P9VB 3NY4A 1XFNA 4U0XA 5AQAA 3VFFA 4JF5A 2V8FA 1MXOA 4LPZA 3PBSA 1K4EA 1EW0A 4PKYA 4FUWA 5M1AA 4LLOB 2DNSA 4Y15A 4S2NA 1MY8A 2XA7M 4H6JB 1YLYA 2Y2IA 3O3VA 2O9BA 4NK3A 3OZHA 2XEPA 4OQHA 1SDEA 1HZOA 1MKMA 3SOIA 1S1ZA 4BL2A 4RX3A 1H0MA 5FAQA 4PM9A 4FOFA 3MFXA 4DN0A 1M40A 2JBFA 5AJGA 4Y0OA 1KE3A 2B02A 1FILA 5GLCA 3KSGA 5HPFA 1RGYA 3E4OA 3P98A 5FQIA 3M6HA 1XGJA 2PYPA 4JGRA 4CJNA 2JKRM 5IT5A 4R4SA 3PYPA 1LI0A 2HGVA 4DDYA 3SZTA 3ZG9B 1FSWA 1OTBA 5HAQA 2MJ6A 3S1YA 3T4QA 4I5SA 3QP2A 3ZG7B 3F1NB 3IF6A 3LY3A 5GHXA 4EV4A 4MBHA 1N4OA 1GHPA 3VOZA 3ZGAB 3G30A 3HCYA 4IVIA 4M3KA 2Y2GA 2B5RA 3NC8A 1G28A 1G5UA 3BLMA 4OP5A 1VETB 2HDUA 2A2LA 5L2FA 3VE4A 3FKWA 4PHTA 3FKVA 2EFUA 4UHUA 1YLZA 4S2KA 3IH8A 3LR0A 4WUJA 1K0KA 4CLCA 1ODVA 2O99A 1NY0A 1P0ZA 1YMXA 2Z2LB 1VQQA 5AQ7A 3UMEA 3B42A 3HLFA 2PDRA 5FI7A 5TBMA 2ZQDA 4KG2A 4H8RA 5EVEA 4R3JA 3E4QA 1U60A 3SH9A 4DXBA 3HLDA 2VV8A 2WGIA 3O87A 3MFDA 4GNUA 1BTLA 4JXSA 1K6RA 4II7A 4X56A 1KGEA 2EA9A 1MWTA 4R6LA 1KDSA 2YKHA 2LB5A 3K3DA 1E4DA 5G4ZA 5GLDA 3T1XA 1OTAA 5HL6A 4B4XA 3M6BA 1ONHA 3BFFA 2WGWA 3T1SA 4EQIA 4IHQA 3DTIA 3UB8A 4GS9A 2Z6CA 4OH0A 1GSXA 2A24B 3PBTA 4B88A 5IU1A 1DJBA 1YLWA 4GZBA 4PMAA 3KX0X 2WZXA 3CUEC 3T50A 2J9PA 2P04A 1BZAA 3C38A 2QYBA 4JXVA 5L8MA 1YSPA 4X55A 3BM6A 3HUNA 2XH9A 1D1JA 3L9KA 3SH7A 3EQUA 3C30A 3IQAA 5HDSA 3QP8A 3VP1A 4Q0HA 1P9WA 2ZJ9A 4IUHA 3Q82A 4Q0JA 4XT2A 1LSXA 5A91A 4JPMA 5D3OA 1SKOB 3P7NA 4UQIS 4WEKA 1NZUA 4X6TA 4S2MA 2DRWA 1SKFA 2Y59A 3KYQA 3ZDJA 3IXDA 2BASA 3VP2A 2YKFA 3QNBA 5EM0A 1PW8A 3KYEA 4OOMA 2IWBA 3SS5A 3TJZC 1YM1A 2D01A 4O01A 3ZVTA 3G6OA 1LT0A 2H5SA 5CGXA 3N6IA 3OBFA 2KLIA 3MBZA 3G4PA 3OPLA 1IYPA 4O8GA 4F94A 5J7EA 2A49A 3G35A 1OTEA 1XFQA 4FCFA 4E3IA 3GVBA 4IBRA 1PI4A 3AGDA 3HLBA 3MS6A 3UE0A 4JGOA 4P87A 4OPYA 4JGQA 1S4RA 5GL9A 4E3KA 1TDLA 3HL9A 4ETXA 2UWXA 4BD1A 5HSQA 3E4PA 4GKUA 1V9ZA 4UA7A 4GD6A 1XX2A 1H5XA 1XA1A 3IHBA 2X02A 2WYXA 3UPNA 4HJ4A 4E3JA 3VSLA 5HDDA 3TOIA 3LI9A 1NZOA 1ERMA 1AXBA 5A90A 2W3GA 2XSSA 4BWIA 3CUEA 1PNEA 3ZFZA 3T4LA 2XFTA 5DF8A 3IXBA 1PZOA 2VV7A 2VA0A 3G34A 5C5KA 1XKZA 1BYWA 1GA0A 1D7EA 2VLGA 4LV3A 2L0WA 1YQSA 1G68A 1XJ6A 3MZFA 4N1XA 3EGXC 2M1CA 3Q7VB 5FQMA 4CQHA 4BBVA 2W0NA 4WZ5A 3MR0A 1CEGA 2XDMA 1E3UD 4WELA 1O07A 2VGLS 5DKLA 3BQAA 3G31A 4DMZA 2QKPA 5HWVA 4N1HA 1LL8A 4HNBA 4KZ9A 1LI9A 4JXWA 4NXGA 3BFEA 3S7NA 4N92A 3RJUA 4GD8A 3MXQA 3ITBA 1HVBA 2W3FA 1DP9A 3NBLA 2EWVA 2P9VA 2IWDA 5L10A 1HLUP 3LR3A 5HWWA 2PU2A 3OC2A 3T4SA 2BLSA 1K57C 3B33A 1CI9A 4YOFA 1GHMA 2EFXA 2EWWA 4I3JA 3FPWA 3LO7A 1CF0A 1T19A 3PR6A 4EEUA 2FZ0A 3LIAA 3LGOA 1XXMA 4OLGA 2V1ZA 4RYEA 1YKDA 3Q07A 1RCJA 1MBLA 1SCWA 4ESPA 4ID4A 5DFYA 4OOLA 1FCNA 1ESIA 4WZ4A 1HD8A 3VMAA 3UPPA 3ZG8B 2VK3A 3BY8A 1MWRA 2WK0A 1ACFA 4OONA 2LB9A 3A3DA 4WMCA 2JKTM 5EM1A 4X1MA 3LR5A 3WRZA 4B93A 3F1NA 4I38A 4KZ3A 3LIEA 4KUKA 5CX7A 1I5QA 5CGWA 3DTEA 3GMWA 4DF6A 4Y3IA 4O0PA 3IWOA 4ME4A 2Y2HA 4LRZE 3EEHA 4A5RA 3CWFA 5HPIA 1VETA 3V39A 3N8SA 3H82B 5F69A 3UO9A 2Z2MB 5JYPA 2EX9A 3MKEA 4HEFA 4RA7A 4WF0A 4JF4A 1BUEA 2J80A 1RGZA 5EE8A 2K31A 1M6KA 2ZC3B 1OT9A 2PR5A 2DCFA 1W5DA 1FCOA 3UDIA 2M7UA 1IFQA 2ZLYA 1IYQA 1OJ5A 5I5LA 2C5WB 3MZDA 5GLAA 4F3LB 4C75A 4D2OA 3NDEA 1Z09A 1CI8A 2RL3A 3HJIA 2W3HA 3E2KA 1K4FA 1SDNA 2FH5A 1DP6A 5CHJA 2JKRI 3OPPA 1HTZA 3KO6A 3NI9A 3JPUA 2QJ7A 5DFXA 1TF1A 4EQ1A 1L2SA 3UB9A 2P7JA 1PRQA 3DAVA 3G32A 3Q81A 3IS2A 2I9VA 2HJEA 1W63M 4Q0IA 1FR6A 3ITAA 3GV9A 1K54C 2VGLM 1L3LA 2A24A 4KQOA 4K08A 4LV0A 3FG8A 3Q7ZA 3HREA 4KZ8A 1DRMA 3QP6A 3RFBA 1ES3A 3R4KA 2ZMVA 3SS4A 1NXYA 2Y2MA 3MSHA 3D72A 4PKYG 2XR0A 2G2UA 1T1AA 1Y28A 5J4EA 1DP8A 4R4RA 3W4QA 4HIAA 5FDSA 3MQ0A 5FQKA 1KVMA 4GOGA 4C6YA 5GLBA 3VP4A 4KZAA 4MEZA 4QWOA 1SKOA 2O0YA 3CHWP 3UB6A 5M19A 3CLOA 3QP4A 4NXBA 3C5AA 1CK3A 1UGUA 2P08A 1NRFA 4MLLA 1LL9A 4OPRA 4X25A 5FATA 2ZOIA 4FH4A 3HVFA 4NXFA 4MMNA 5E43A 5CHUA 3EOIA 3LIBA 5FAPA 1IOUA 2ZM0A 3UE1A 5HD3A 4K0WA 4NETA 3DWKA 2JHEA 1PWCA 3LEQA 2Q9MA 4ARZB 1N9LA 3VP3A 4BL3A 4Z1WA 1WYCA 4S2IA 4O7DA 4EERA 3WS1A 4EBNA 3BY9A 4R0QA 2XQZA 2R9WA 2EX8A 3HJKA 5A92A 3UB5P 3M2JA 2EX2A 4WYYA 3O86A 3F1OB 4NEED 4DKIA 1YMSA 1IEMA 2WKHA 3V50A 4N9LA 1G6OA 3TRCA 5DTKA 5AVFA 3UPOA 4EWFA 1UWNX 1FIKA 2V0WA 1W7FA 1IYSA 2W3EA 3BFDA 2HP9A 3N7WA 1N9BA 3LY4A 3Q7VA 4HHDA 5F6AA 3QP5A 1F98A 2Y55A 4OKPA 2PBDP 2Y2NA 1RP5A 4I39A 3Q1FA 5KZHA 5E2FA 4HBTA 1PI5A 2HZ5A 3LR4A 4BD0A 1E25A 5DKKA 3BW6A 4EW7A 1S6RA 3TW8A 1L0DA 5EECA 5KIZA 5F68A 2GJ3A 5GHZA 1W8QA 2JKFA 2O9AA 2ZQ7A 2P74A 3MJQA 4YFMA 2V20A 4MN7A 5CEBA 1ERQA 3BJNA 1ZKJA 4EBPA 1VM1A 3IX3A 3GSGA 1NYMA 2WAEA 3NOPC 5EV0A 3K3CA 4HBUA 4L9EA 3VOYA 2PR6A 1YAXA 1YLPA 4XUXA 3C2WA 2XK1A 1OJGA 4IEDA 4P6ZS 4R3BA 4R1GA 2XRNA 5EUAA 5FEGA 2EXBA 4WLAA 4KENB 5DTTA 4DE1A 1GA9A 3W8KA 5DF7A 5TFQA 5CECA 5F1GA 1YLTA 5CRFA 4ZRRA 3HLEA 3GQZA 1H8YA 2WGVA 3NCKA 3HBRA 5FI6A 5FI2A 2XGNA 3MQOA 4WL9A 4LCMA 5FQQA 3BRMA 4BMWA 1S66L 3GRJA 5MC7A 1XJ4A 5BOHA 3DW0A 3MMHA 2Y91A 2OWHA 1W79A 4LV1A 1L0GA 5CHMA 4MNRA 4HY8A 4CLCE 4EUVA 2JC7A 5EPHA 1BSGA 3H82A 1IYOA 4S2JA 4R38A 2KDKA 1K38A 3R7WB 1TEMA 1PZPA 4PM8A 3HUOA 3PHYA 4JBFA 3GTCA 2BTFP 1IELA 4KUOA 4ZBEA 2PRFA 3IF5A 4E6WA 1E3UA 3A3IA 4HP4A 3CITA 4ETZA 3IBRA 4OQGA 1BLHA 4L9GA 4LFUA 5KSHA 4F3LA 5FA7A 3NHQA 4WEJA 4Y5FA 2OLVA 4MDZA 4E3LA 5HARA 1Y54A 4GB7A 2JKTI 2R9XA 3V5MA 4X1LA 3ICYA 4KZ6A 3IX8A 1Y4OA 2XLNA 1WYBA 5HAIA 2B18A 2X01A 1YSQA 4N9KA 3QP1A 4MN5A 2AVXA 5EVIC 1TVFA 2OSUA 4OP8A 1ZTUA 1C3BA 1MZUA 1DJCA 4GHIB 2PAVP 2QMIA 2Y79A 2B95A 1I2SA 4Y7PA 2WGWB 4DXCA 3RXXA 1XGIA 3RTYA 1ONGA 5E2EA 3FYZA 3OLOA 4LENA 3O5YA 4FH2A 1O7EA 4H6JA 4ZJ1A 1PYYA 4JF6A 3BFCA 4KQDA 3GR2A 3KSFA 1J9MA 2XD5A 2J3TC 5E2HA 4HJ6A 1V9YA 1GHIA 3NULA 4HH2A 4OPQA 3BQ8A 3ZG5A 2VX8A 1NJ4A 3OCLA 2E8IA 1K56A 5AQ9A 1W8YA 3RXWA 1EI5A 4P6ZM 3PBNA 1MWSA 3UN7A 3WRTA 2PYRA 5L09A 2VJWA 2J8YA 3FV7A 3N8LA 2ZC4B 4GDNA 4KQRA 4XT2B 3LEZA 4WN5A 3HLGA 3HUMA 4QD4A 3T4KA 1Q2PA 4OOYA 4P6BA 4IJGA 2W1TB 3S7QA 4DJ3A 2W3DA 4IBXA 4KZ7A 4ARZA 1PWGA 3MXRA 4PM5A 5EOEA 4HQAA 1K56D 4NKPA 5HWTA 4JKTA 2Y2LA 3O88A 5DF9A 1ZC2A 2PHYA 3A3JA 4RQ9A 2ZC6B 4UA9A 3B3XA 2Y2KA 1LSVA 4S2NC 1F2KA 4GN2A 2JCHA 4K91A 4D60A 4WBGA 3SH8A 3V3SA 2XF3A 3PBQA 1JWVA 3ZNTA 3F1OA 1L0FA 2V2FF 3CMZA 4MBKA 4M4XA 3ZVWA 2BG1A 4C3QA 2V0UA 4HESA 2WUQA 2X71A 3IX4A 3A3EA 1K57A 3NOUC 4S2PA 1CQAA 2ZQAA 3MZEA 1J3WA 3IWQA 1ALQA 5EFWA 1T18A 5G4YA 2HP6A 3TG9A 4JLFA 3CI6A 3KYZA 4GDBA 5TJJA 5IHVA 2ZMFA 4PM7A 3IXGA 3VP0A 3ISGA 3IF6C 3SS3A 1LSWA 5EVID 4DE0A 4BBUA 2HPBA 2ZL1B 3ULFA 4NXEA 1XA7A 3DBAA 3LCEA 1F5MA 1K25A 2PU4A 3H9WA 4QU3A 3PXPA 3UE6A 1ESUA 5HD5A 4EETB 2EXAA 3F1PB 3GDIA 5I94A 2HF6A 1OTIA 2JKGA 2OWJA 3U2AA 2VV6A 1EROA 1XJ3A 1OT6A 4GJ4A 2HDQA 2J3TD 1MPLA 4CLCC 4UA6A 4KG5A 4R3AA 5HL1A 5FQJA 1NWZA 5G18A 2C6WB 4DE3A 1XPBA 2KX6A 5F1FA 4QY6A 2VGJA 3UDXA 4CPKA 5CTNA 2CC1A 1FQGA 3WWXA 4LCLA 4E04A 2V1BA 4E6XA 1ES2A 4IVKA 3AGFA 3QHYA 3LIDA 2PBYA 3NDGA 1XP4A 4KQQA 4U3TA 5A93A 3A0SA 3QNCA 3IWIA 5TGFA 3LUQA 3E0YA 3S4XA 3CG5A 1JVJA 4BBTA 3P01A 3HLCA 1SZVA 4G3VA 4U0TA 2W27A 3OCNA 3VFHA 3VV4A 1AWIA 3LICA 2HV1A 3C7UA 2V9AA 2GZAA 2WAFA 1QMEA 4KZBA 2WKQA 4ZAMA 2H0TA 3WS0A 1LL5A 2OOLA 3AGEA 1FR1A 1QMFA 2ZQ8A 3TSGA 1P9RA 2WKIA 3T1QB 2HP5A 3NIAA 4QB8A 3UE3A 2EX6A 1VHMA 3R7WA 3C8CA 2WKRA 2Y2JA 1T1CA 1D06A 2NUTC 3G2YA 5FL3A 1K54A 2ZM2A 3ZHHA 1WE4A 5DJTA 3V3RA 4X69A 5AVEA 1ES4A 5EVIB 2I72A 2Y4AA 2PD8A 3P09A 2G7UA 3U4LP 4Y13A 3VE3A 4JGPA 4YINA 3ZNYA 4EUZA 5F83A 5A8BA 2XD1A 2VEAA 4L9FA 5EOOA 5CERA 1YPRA 1MKIA 2D02A 2E8JA 5CXWA 1PFLA 3KSIA 1CEFA 3OPHA 2A3UA 2Y2QA 2ZD8A 1TS0A 1ZG6A 3IBJA 3C4PA 3M2KA 2JE5A 1BT5A 1OMEA 4AFIA 2HJ9C 3CPTB 3BYDA 2V1AA 2OAQ1 3I7JA 3NOTC 5FAOA 1ZG4A 1Z6FA 1Q2QA 1PW1A 4S2LA 4QY5A 4CLCD 4BLMA 5HAPA 1MWUA 3GECA 3D3OA 5HW3A 1NYYA 3EQVA 3H7WB 1H3QA 5J8XA 4Y0UA 1FSYA 1TDGA 3T1RA 4LV2A 1YLJA 4GHIA 5M18A 2QJ5A 5EVLA 4LRYC 1H8ZA 3IS2B 4MN6A 3L7HA 4P0MA 2QHKA 4E3OA 4G3KA 3T4OA 1K6SA 2ZMAA 3C7VA 2WZZA 4KZ5A 3WS2A 4FTXA 4R70A 4R23A 1VEUB 1S0WA 4Q8IA 5L07A 3LIFA 4DRTA 4IUKA 1NLZA 2QWSA 2W1RA 2IWCA
chains in the Genus database with same CATH topology
3WS5A 3LY3A 5GHXA 4EV4A 4MBHA 1KVLA 2C5WB 3MZDA 1N4OA 5EVIC 1TVFA 5GLAA 1GHPA 3VOZA 2OSUA 3ZGAB 3A3FA 4OP8A 3G30A 4C75A 1C3BA 4IVIA 4M3KA 4D2OA 3NDEA 1DJCA 2Y2GA 4WZ5C 2B5RA 4EBLA 1CI8A 2RL3A 2QMIA 3NC8A 1DY6A 1I2SA 4Y7PA 3PAGA 3E2KA 3BLMA 2WGWB 1K4FA 4OP5A 4DXCA 1SDNA 1XGIA 2HDUA 3RXXA 1ONGA 5E2EA 2ZQ9A 3FYZA 5CHJA 3FZCA 4LENA 2ZM8A 3OPPA 5L2FA 1HTZA 3FKWA 1O7EA 4FH2A 4ZJ1A 3NI9A 1PYYA 4BENA 4JF6A 3FKVA 3BFCA 4E3NA 1L2SA 2EFUA 4UHUA 1YLZA 3GR2A 4OQIA 4S2KA 3IH8A 1J9MA 2HDSA 2XD5A 4PM6A 5E2HA 3G32A 1GHIA 3Q81A 1NY0A 2WKEA 4OPQA 3ZG5A 1YMXA 2Z2LB 1JWPA 1FR6A 1NJ4A 3ITAA 3GV9A 3OCLA 3N4IA 4K0XA 1K54C 2E8IA 4ZJ2A 1K56A 5AQ9A 3IF6B 1W8YA 3PBOA 5FSRA 2RCXA 1VQQA 5AQ7A 3RXWA 1EI5A 3PBNA 3HLFA 1MWSA 1DJAA 5HX9A 3UN7A 3BEBA 5FI7A 3WRTA 2ZQDA 4KG2A 4KQOA 4H8RA 5GHYA 1YT4A 4LV0A 3ZG0A 5F82A 2J8YA 3FV7A 3N8LA 2ZC4B 2ZC5B 4GDNA 3Q7ZA 3HREA 4KQRA 4R3JA 4KZ8A 4P85A 3LEZA 3W4PA 1U60A 1ES3A 3SH9A 4DXBA 3HLDA 3HLGA 3FWLA 2WGIA 3O87A 3MFDA 3HUMA 4MBFA 4QD4A 3SS4A 4GNUA 1BTLA 1NXYA 1Q2PA 2Q9NA 2Y2MA 4JXSA 1K6RA 4OOYA 3G2ZA 4X56A 4P6BA 1JTDA 2XR0A 1KGEA 1MWTA 1KDSA 4IBXA 1E4DA 4KZ7A 2G2UA 5GLDA 1PWGA 3MXRA 2OV5A 5EOEA 2VGKA 4PM5A 1K56D 2FFYA 3BLSA 4B4XA 4R4RA 4L0LA 3W4QA 4JKTA 4RVAA 5FQKA 1KVMA 4GOGA 4C6YA 5GLBA 3M6BA 1ONHA 2QZ6A 4KZAA 3VP4A 3BFFA 2Y2LA 4MEZA 2WGWA 3O88A 4EQIA 5DF9A 1ZC2A 3UDFA 3A3JA 5M19A 2ZC6B 4OH0A 4FSFA 2ZC7A 4UA9A 3B3XA 5DVAA 3C5AA 1CK3A 3PBTA 4OLDA 4B88A 2QPNA 2Y2KA 1NRFA 4MLLA 4S2NC 1LL9A 1DJBA 4OPRA 1YLWA 4GZBA 5FATA 4GN2A 4PMAA 2JCHA 4K91A 4FH4A 3HVFA 2WZXA 4WBGA 3SH8A 4DDSA 3V3SA 2XF3A 3PBQA 1JWVA 2J9PA 1BZAA 1G6AA 5E43A 5CHUA 2OLUA 3ZNTA 3N8RA 4JXVA 1L0FA 2V2FF 5FAPA 2ZLYA 4PPRA 3IHAA 3CMZA 2WADA 2ZM0A 4MBKA 3UE1A 4X55A 3JYIA 3BM6A 3HUNA 2XH9A 3ZVWA 3SH7A 2BG1A 3E2LA 4C3QA 3EQUA 4K0WA 4HESA 2WUQA 4NETA 2X71A 3DWKA 4OQ0A 2J7VA 3UNWA 1PWCA 3IQAA 3A3EA 1K57A 4S2PA 2ZQAA 2Q9MA 3MZEA 3IWQA 3VP1A 1ALQA 5U47A 4B4ZA 3VP3A 2ZJ9A 3VSKA 3Q82A 2HP6A 3TG9A 2G2WA 4JLFA 5A91A 4BJPA 4BL3A 4JPMA 5D3OA 1WYCA 4WEKA 4S2IA 1NZUA 4X6TA 4GDBA 4O7DA 4S2MA 2FFFB 2DRWA 1SKFA 2Y59A 5IHVA 3WS1A 4EBNA 4R0QA 3ZDJA 3IXDA 4PM7A 5FQ9A 3IXGA 1IKIA 2XQZA 3VP2A 3VP0A 3QNBA 3ISGA 2R9WA 3BFGA 3IF6C 4ZDXA 3S22A 3SS3A 1PW8A 1IKGA 2EX8A 4OOMA 4OVDA 5A92A 2IWBA 3SS5A 5EVID 3HLWA 1YM1A 3ZVTA 3M2JA 2H5SA 4DE0A 5CGXA 2EX2A 4WYYA 3O86A 2HPBA 3N6IA 4RX2A 1XA7A 2GDNA 4DKIA 4ZTKA 3MBZA 1JWZA 2PU4A 1K25A 1YMSA 3G4PA 1IEMA 1K55C 1IYPA 2WKHA 3LCEA 3OPLA 1ESUA 4QU3A 5AQBA 4N9LA 3V50A 4F94A 2A49A 3G35A 4UAAA 1JTGA 2EXAA 4FCFA 4E3IA 3GVBA 2H0YA 4ZJ3A 4BQMA 3PAEA 4IBRA 1PI4A 3AGDA 5DTKA 5I94A 3HLBA 3UPOA 4E3MA 1KE0A 2Y2PA 3UE0A 4EWFA 2Y2OA 1EROA 1W7FA 1IYSA 2HDQA 4P87A 1MPLA 4OPYA 1BLPA 4UA6A 5CEDA 5FDHA 3BFDA 5GL9A 4E3KA 2HP9A 1TDLA 3HL9A 2UWXA 3N7WA 4KG5A 4BD1A 5HL1A 5FQJA 1N9BA 4GKUA 3LY4A 3Q7VA 5G18A 2C6WB 4Z9QA 4DE3A 4UA7A 1BLSA 4GD6A 1XPBA 1XX2A 1H5XA 4JXGA 1XA1A 2Y55A 5F1FA 4QHCA 3IHBA 4Y0TA 4OKPA 4QY6A 2VGJA 2Y2NA 1RP5A 1PWDA 2X02A 3MXSA 5DTSA 3Q1FA 3UDXA 5CGSA 2WYXA 3UPNA 5KZHA 4CPKA 5CTNA 2CC1A 5E2FA 4E3JA 4HBTA 4S2OA 1FQGA 3VSLA 3WWXA 3TOIA 1NZOA 4LCLA 1ERMA 1AXBA 1PI5A 4E6XA 4BD0A 3DWZA 1ES2A 1BLCA 4XUZA 4IVKA 1E25A 5A90A 3AGFA 3QHYA 2PBYA 3NDGA 1S6RA 1L0DA 1XP4A 4X68A 5EECA 3ZFZA 2XFTA 4KQQA 1ES5A 4U3TA 5DF8A 2J9OA 3BECA 5GHZA 3IXBA 1W8QA 5A93A 2ZQ7A 1PZOA 2P74A 3QNCA 1LHYA 3IWIA 3G34A 5TGFA 3W4OA 3DTMA 5HFOA 1XKZA 1GA0A 1BULA 4YFMA 2V20A 3CZDA 3CG5A 1JVJA 4LV3A 3S4XA 5CEBA 5EVIA 1ERQA 1YQSA 1G68A 1KGFA 1LLBA 1ZKJA 2XFSA 3HLCA 4EBPA 3MZFA 4N1XA 3Q7VB 5FQMA 1VM1A 4WMCD 4QJGA 3GSGA 1NYMA 4U0TA 2WAEA 3OCNA 4WZ5A 4X53A 2H10A 3VFHA 5FASA 5TR7A 1CEGA 2XDMA 4HBUA 3C7UA 1E3UD 4OPZA 4WELA 3VOYA 1O07A 3WS4A 1YLPA 4XUXA 1I2WA 3G31A 2XK1A 4IEDA 4R3BA 2WAFA 1QMEA 4N1HA 4KZBA 4KZ9A 4R1GA 4ZAMA 5KMWA 1LI9A 2H0TA 4JXWA 5EUAA 3WS0A 1LL5A 3BFEA 3ZCZA 3AGEA 1FR1A 1QMFA 2EXBA 2ZQ8A 3TSGA 2WKIA 4N92A 3RJUA 3IXHA 4GD8A 4KENB 2HP5A 3NIAA 4QB8A 3UE3A 2EX6A 3ITBA 1HVBA 3NBLA 5DTTA 2Y2JA 2P9VA 4DE1A 1GA9A 3G2YA 2IWDA 1K54A 3W8KA 2PU2A 2ZM2A 3OC2A 1WE4A 3V3RA 3ZHHA 5JYOA 2BLSA 1K55A 1K57C 2HDRA 3IT9A 5DF7A 5TFQA 4X69A 1GCEA 5CECA 1ES4A 1CI9A 1FOFA 1YLTA 4WM9A 5CRFA 3HLEA 3GQZA 5F1GA 1GHMA 1H8YA 3CJMA 2EFXA 3C4OA 5EVIB 2I72A 2WGVA 2ZQCA 3NCKA 3HBRA 3OPRA 5FI6A 2XGNA 3IH9A 5FI2A 3LO7A 4LCMA 2Y4AA 5FQQA 1SHVA 3BRMA 3P09A 5CTMA 3GRJA 1PIOA 5BOHA 4YINA 3ZNYA 4EUZA 5F83A 1FCMA 2XD1A 3DW0A 3D4FA 4XXRA 3UY6A 2Y91A 4DE2A 1XXMA 1W79A 5EOOA 4OLGA 3MKFA 5CERA 2V1ZA 1MKIA 4LV1A 1L0GA 4RYEA 3Q07A 5CHMA 1RCJA 5CXWA 4MNRA 1MBLA 1SCWA 3OPHA 1CEFA 1EWZA 4ID4A 2A3UA 2Y2QA 5E2GA 2JC7A 3PTEA 4KG6A 2ZD8A 4KZ4A 1BSGA 5EPHA 1L0EA 4OOLA 1FCNA 1ESIA 4WZ4A 1IYOA 1HD8A 4S2JA 1KE4A 3VMAA 1ZG6A 3UPPA 3ZG8B 1K38A 3PBRA 5KSCA 1KGGA 1KDWA 1TEMA 1MWRA 2WK0A 4FD8A 2P9VB 1PZPA 3NY4A 4OONA 4PM8A 3C4PA 4U0XA 3M2KA 3A3DA 3HUOA 5AQAA 4WMCA 4JBFA 3VFFA 4JF5A 2JE5A 3GTCA 1BT5A 1IELA 1MXOA 1OMEA 3PBSA 1K4EA 3BYDA 4ZBEA 3IF5A 3I7JA 4E6WA 5FAOA 5M1AA 1E3UA 1ZG4A 3WRZA 3A3IA 2DNSA 4KZ3A 1MY8A 4S2NA 1YLYA 2Y2IA 1Z6FA 1Q2QA 1PW1A 3O3VA 4OQGA 1I5QA 4NK3A 4QY5A 1BLHA 3OZHA 4S2LA 5CGWA 3GMWA 4BLMA 2XEPA 4OQHA 4DF6A 5HAPA 5KSHA 1MWUA 1SDEA 1HZOA 3IWOA 5HW3A 5FA7A 1NYYA 2Y2HA 3EQVA 4WEJA 5J8XA 2OLVA 4Y0UA 1FSYA 1TDGA 3SOIA 4LV2A 4BL2A 1YLJA 5M18A 5EVLA 1H8ZA 4A5RA 4RX3A 5FAQA 4PM9A 4P0MA 4E3OA 1M40A 2JBFA 4Y0OA 3V39A 5HARA 1K6SA 2ZMAA 3N8SA 1KE3A 1Y54A 3C7VA 4E3LA 2WZZA 5GLCA 4GB7A 4KZ5A 3WS2A 1RGYA 3UO9A 3P98A 2Z2MB 5JYPA 5FQIA 3M6HA 1XGJA 2EX9A 2R9XA 3MKEA 4HEFA 4RA7A 3V5MA 4R23A 4CJNA 4JF4A 1BUEA 1S0WA 4Q8IA 4R4SA 1LI0A 4KZ6A 1RGZA 2XLNA 5EE8A 4DDYA 3ZG9B 1FSWA 4DRTA 1WYBA 1M6KA 5HAQA 2ZC3B 5HAIA 3S1YA 2X01A 2DCFA 1W5DA 3ZG7B 1FCOA 3UDIA 3IF6A 4N9KA 1IYQA 2IWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WS5 A;  3LY3 A;  5GHX A;  4EV4 A;  4MBH A;  1KVL A;  2C5W B;  3MZD A;  1N4O A;  5EVI C;  1TVF A;  5GLA A;  1GHP A;  3VOZ A;  2OSU A;  3ZGA B;  3A3F A;  4OP8 A;  3G30 A;  4C75 A;  1C3B A;  4IVI A;  4M3K A;  4D2O A;  3NDE A;  1DJC A;  2Y2G A;  4WZ5 C;  2B5R A;  4EBL A;  1CI8 A;  2RL3 A;  2QMI A;  3NC8 A;  1DY6 A;  1I2S A;  4Y7P A;  3PAG A;  3E2K A;  3BLM A;  2WGW B;  1K4F A;  4OP5 A;  4DXC A;  1SDN A;  1XGI A;  2HDU A;  3RXX A;  1ONG A;  5E2E A;  2ZQ9 A;  3FYZ A;  5CHJ A;  3FZC A;  4LEN A;  2ZM8 A;  3OPP A;  5L2F A;  1HTZ A;  3FKW A;  1O7E A;  4FH2 A;  4ZJ1 A;  3NI9 A;  1PYY A;  4BEN A;  4JF6 A;  3FKV A;  3BFC A;  4E3N A;  1L2S A;  2EFU A;  4UHU A;  1YLZ A;  3GR2 A;  4OQI A;  4S2K A;  3IH8 A;  1J9M A;  2HDS A;  2XD5 A;  4PM6 A;  5E2H A;  3G32 A;  1GHI A;  3Q81 A;  1NY0 A;  2WKE A;  4OPQ A;  3ZG5 A;  1YMX A;  2Z2L B;  1JWP A;  1FR6 A;  1NJ4 A;  3ITA A;  3GV9 A;  3OCL A;  3N4I A;  4K0X A;  1K54 C;  2E8I A;  4ZJ2 A;  1K56 A;  5AQ9 A;  3IF6 B;  1W8Y A;  3PBO A;  5FSR A;  2RCX A;  1VQQ A;  5AQ7 A;  3RXW A;  1EI5 A;  3PBN A;  3HLF A;  1MWS A;  1DJA A;  5HX9 A;  3UN7 A;  3BEB A;  5FI7 A;  3WRT A;  2ZQD A;  4KG2 A;  4KQO A;  4H8R A;  5GHY A;  1YT4 A;  4LV0 A;  3ZG0 A;  5F82 A;  2J8Y A;  3FV7 A;  3N8L A;  2ZC4 B;  2ZC5 B;  4GDN A;  3Q7Z A;  3HRE A;  4KQR A;  4R3J A;  4KZ8 A;  4P85 A;  3LEZ A;  3W4P A;  1U60 A;  1ES3 A;  3SH9 A;  4DXB A;  3HLD A;  3HLG A;  3FWL A;  2WGI A;  3O87 A;  3MFD A;  3HUM A;  4MBF A;  4QD4 A;  3SS4 A;  4GNU A;  1BTL A;  1NXY A;  1Q2P A;  2Q9N A;  2Y2M A;  4JXS A;  1K6R A;  4OOY A;  3G2Z A;  4X56 A;  4P6B A;  1JTD A;  2XR0 A;  1KGE A;  1MWT A;  1KDS A;  4IBX A;  1E4D A;  4KZ7 A;  2G2U A;  5GLD A;  1PWG A;  3MXR A;  2OV5 A;  5EOE A;  2VGK A;  4PM5 A;  1K56 D;  2FFY A;  3BLS A;  4B4X A;  4R4R A;  4L0L A;  3W4Q A;  4JKT A;  4RVA A;  5FQK A;  1KVM A;  4GOG A;  4C6Y A;  5GLB A;  3M6B A;  1ONH A;  2QZ6 A;  4KZA A;  3VP4 A;  3BFF A;  2Y2L A;  4MEZ A;  2WGW A;  3O88 A;  4EQI A;  5DF9 A;  1ZC2 A;  3UDF A;  3A3J A;  5M19 A;  2ZC6 B;  4OH0 A;  4FSF A;  2ZC7 A;  4UA9 A;  3B3X A;  5DVA A;  3C5A A;  1CK3 A;  3PBT A;  4OLD A;  4B88 A;  2QPN A;  2Y2K A;  1NRF A;  4MLL A;  4S2N C;  1LL9 A;  1DJB A;  4OPR A;  1YLW A;  4GZB A;  5FAT A;  4GN2 A;  4PMA A;  2JCH A;  4K91 A;  4FH4 A;  3HVF A;  2WZX A;  4WBG A;  3SH8 A;  4DDS A;  3V3S A;  2XF3 A;  3PBQ A;  1JWV A;  2J9P A;  1BZA A;  1G6A A;  5E43 A;  5CHU A;  2OLU A;  3ZNT A;  3N8R A;  4JXV A;  1L0F A;  2V2F F;  5FAP A;  2ZLY A;  4PPR A;  3IHA A;  3CMZ A;  2WAD A;  2ZM0 A;  4MBK A;  3UE1 A;  4X55 A;  3JYI A;  3BM6 A;  3HUN A;  2XH9 A;  3ZVW A;  3SH7 A;  2BG1 A;  3E2L A;  4C3Q A;  3EQU A;  4K0W A;  4HES A;  2WUQ A;  4NET A;  2X71 A;  3DWK A;  4OQ0 A;  2J7V A;  3UNW A;  1PWC A;  3IQA A;  3A3E A;  1K57 A;  4S2P A;  2ZQA A;  2Q9M A;  3MZE A;  3IWQ A;  3VP1 A;  1ALQ A;  5U47 A;  4B4Z A;  3VP3 A;  2ZJ9 A;  3VSK A;  3Q82 A;  2HP6 A;  3TG9 A;  2G2W A;  4JLF A;  5A91 A;  4BJP A;  4BL3 A;  4JPM A;  5D3O A;  1WYC A;  4WEK A;  4S2I A;  1NZU A;  4X6T A;  4GDB A;  4O7D A;  4S2M A;  2FFF B;  2DRW A;  1SKF A;  2Y59 A;  5IHV A;  3WS1 A;  4EBN A;  4R0Q A;  3ZDJ A;  3IXD A;  4PM7 A;  5FQ9 A;  3IXG A;  1IKI A;  2XQZ A;  3VP2 A;  3VP0 A;  3QNB A;  3ISG A;  2R9W A;  3BFG A;  3IF6 C;  4ZDX A;  3S22 A;  3SS3 A;  1PW8 A;  1IKG A;  2EX8 A;  4OOM A;  4OVD A;  5A92 A;  2IWB A;  3SS5 A;  5EVI D;  3HLW A;  1YM1 A;  3ZVT A;  3M2J A;  2H5S A;  4DE0 A;  5CGX A;  2EX2 A;  4WYY A;  3O86 A;  2HPB A;  3N6I A;  4RX2 A;  1XA7 A;  2GDN A;  4DKI A;  4ZTK A;  3MBZ A;  1JWZ A;  2PU4 A;  1K25 A;  1YMS A;  3G4P A;  1IEM A;  1K55 C;  1IYP A;  2WKH A;  3LCE A;  3OPL A;  1ESU A;  4QU3 A;  5AQB A;  4N9L A;  3V50 A;  4F94 A;  2A49 A;  3G35 A;  4UAA A;  1JTG A;  2EXA A;  4FCF A;  4E3I A;  3GVB A;  2H0Y A;  4ZJ3 A;  4BQM A;  3PAE A;  4IBR A;  1PI4 A;  3AGD A;  5DTK A;  5I94 A;  3HLB A;  3UPO A;  4E3M A;  1KE0 A;  2Y2P A;  3UE0 A;  4EWF A;  2Y2O A;  1ERO A;  1W7F A;  1IYS A;  2HDQ A;  4P87 A;  1MPL A;  4OPY A;  1BLP A;  4UA6 A;  5CED A;  5FDH A;  3BFD A;  5GL9 A;  4E3K A;  2HP9 A;  1TDL A;  3HL9 A;  2UWX A;  3N7W A;  4KG5 A;  4BD1 A;  5HL1 A;  5FQJ A;  1N9B A;  4GKU A;  3LY4 A;  3Q7V A;  5G18 A;  2C6W B;  4Z9Q A;  4DE3 A;  4UA7 A;  1BLS A;  4GD6 A;  1XPB A;  1XX2 A;  1H5X A;  4JXG A;  1XA1 A;  2Y55 A;  5F1F A;  4QHC A;  3IHB A;  4Y0T A;  4OKP A;  4QY6 A;  2VGJ A;  2Y2N A;  1RP5 A;  1PWD A;  2X02 A;  3MXS A;  5DTS A;  3Q1F A;  3UDX A;  5CGS A;  2WYX A;  3UPN A;  5KZH A;  4CPK A;  5CTN A;  2CC1 A;  5E2F A;  4E3J A;  4HBT A;  4S2O A;  1FQG A;  3VSL A;  3WWX A;  3TOI A;  1NZO A;  4LCL A;  1ERM A;  1AXB A;  1PI5 A;  4E6X A;  4BD0 A;  3DWZ A;  1ES2 A;  1BLC A;  4XUZ A;  4IVK A;  1E25 A;  5A90 A;  3AGF A;  3QHY A;  2PBY A;  3NDG A;  1S6R A;  1L0D A;  1XP4 A;  4X68 A;  5EEC A;  3ZFZ A;  2XFT A;  4KQQ A;  1ES5 A;  4U3T A;  5DF8 A;  2J9O A;  3BEC A;  5GHZ A;  3IXB A;  1W8Q A;  5A93 A;  2ZQ7 A;  1PZO A;  2P74 A;  3QNC A;  1LHY A;  3IWI A;  3G34 A;  5TGF A;  3W4O A;  3DTM A;  5HFO A;  1XKZ A;  1GA0 A;  1BUL A;  4YFM A;  2V20 A;  3CZD A;  3CG5 A;  1JVJ A;  4LV3 A;  3S4X A;  5CEB A;  5EVI A;  1ERQ A;  1YQS A;  1G68 A;  1KGF A;  1LLB A;  1ZKJ A;  2XFS A;  3HLC A;  4EBP A;  3MZF A;  4N1X A;  3Q7V B;  5FQM A;  1VM1 A;  4WMC D;  4QJG A;  3GSG A;  1NYM A;  4U0T A;  2WAE A;  3OCN A;  4WZ5 A;  4X53 A;  2H10 A;  3VFH A;  5FAS A;  5TR7 A;  1CEG A;  2XDM A;  4HBU A;  3C7U A;  1E3U D;  4OPZ A;  4WEL A;  3VOY A;  1O07 A;  3WS4 A;  1YLP A;  4XUX A;  1I2W A;  3G31 A;  2XK1 A;  4IED A;  4R3B A;  2WAF A;  1QME A;  4N1H A;  4KZB A;  4KZ9 A;  4R1G A;  4ZAM A;  5KMW A;  1LI9 A;  2H0T A;  4JXW A;  5EUA A;  3WS0 A;  1LL5 A;  3BFE A;  3ZCZ A;  3AGE A;  1FR1 A;  1QMF A;  2EXB A;  2ZQ8 A;  3TSG A;  2WKI A;  4N92 A;  3RJU A;  3IXH A;  4GD8 A;  4KEN B;  2HP5 A;  3NIA A;  4QB8 A;  3UE3 A;  2EX6 A;  3ITB A;  1HVB A;  3NBL A;  5DTT A;  2Y2J A;  2P9V A;  4DE1 A;  1GA9 A;  3G2Y A;  2IWD A;  1K54 A;  3W8K A;  2PU2 A;  2ZM2 A;  3OC2 A;  1WE4 A;  3V3R A;  3ZHH A;  5JYO A;  2BLS A;  1K55 A;  1K57 C;  2HDR A;  3IT9 A;  5DF7 A;  5TFQ A;  4X69 A;  1GCE A;  5CEC A;  1ES4 A;  1CI9 A;  1FOF A;  1YLT A;  4WM9 A;  5CRF A;  3HLE A;  3GQZ A;  5F1G A;  1GHM A;  1H8Y A;  3CJM A;  2EFX A;  3C4O A;  5EVI B;  2I72 A;  2WGV A;  2ZQC A;  3NCK A;  3HBR A;  3OPR A;  5FI6 A;  2XGN A;  3IH9 A;  5FI2 A;  3LO7 A;  4LCM A;  2Y4A A;  5FQQ A;  1SHV A;  3BRM A;  3P09 A;  5CTM A;  3GRJ A;  1PIO A;  5BOH A;  4YIN A;  3ZNY A;  4EUZ A;  5F83 A;  1FCM A;  2XD1 A;  3DW0 A;  3D4F A;  4XXR A;  3UY6 A;  2Y91 A;  4DE2 A;  1XXM A;  1W79 A;  5EOO A;  4OLG A;  3MKF A;  5CER A;  2V1Z A;  1MKI A;  4LV1 A;  1L0G A;  4RYE A;  3Q07 A;  5CHM A;  1RCJ A;  5CXW A;  4MNR A;  1MBL A;  1SCW A;  3OPH A;  1CEF A;  1EWZ A;  4ID4 A;  2A3U A;  2Y2Q A;  5E2G A;  2JC7 A;  3PTE A;  4KG6 A;  2ZD8 A;  4KZ4 A;  1BSG A;  5EPH A;  1L0E A;  4OOL A;  1FCN A;  1ESI A;  4WZ4 A;  1IYO A;  1HD8 A;  4S2J A;  1KE4 A;  3VMA A;  1ZG6 A;  3UPP A;  3ZG8 B;  1K38 A;  3PBR A;  5KSC A;  1KGG A;  1KDW A;  1TEM A;  1MWR A;  2WK0 A;  4FD8 A;  2P9V B;  1PZP A;  3NY4 A;  4OON A;  4PM8 A;  3C4P A;  4U0X A;  3M2K A;  3A3D A;  3HUO A;  5AQA A;  4WMC A;  4JBF A;  3VFF A;  4JF5 A;  2JE5 A;  3GTC A;  1BT5 A;  1IEL A;  1MXO A;  1OME A;  3PBS A;  1K4E A;  3BYD A;  4ZBE A;  3IF5 A;  3I7J A;  4E6W A;  5FAO A;  5M1A A;  1E3U A;  1ZG4 A;  3WRZ A;  3A3I A;  2DNS A;  4KZ3 A;  1MY8 A;  4S2N A;  1YLY A;  2Y2I A;  1Z6F A;  1Q2Q A;  1PW1 A;  3O3V A;  4OQG A;  1I5Q A;  4NK3 A;  4QY5 A;  1BLH A;  3OZH A;  4S2L A;  5CGW A;  3GMW A;  4BLM A;  2XEP A;  4OQH A;  4DF6 A;  5HAP A;  5KSH A;  1MWU A;  1SDE A;  1HZO A;  3IWO A;  5HW3 A;  5FA7 A;  1NYY A;  2Y2H A;  3EQV A;  4WEJ A;  5J8X A;  2OLV A;  4Y0U A;  1FSY A;  1TDG A;  3SOI A;  4LV2 A;  4BL2 A;  1YLJ A;  5M18 A;  5EVL A;  1H8Z A;  4A5R A;  4RX3 A;  5FAQ A;  4PM9 A;  4P0M A;  4E3O A;  1M40 A;  2JBF A;  4Y0O A;  3V39 A;  5HAR A;  1K6S A;  2ZMA A;  3N8S A;  1KE3 A;  1Y54 A;  3C7V A;  4E3L A;  2WZZ A;  5GLC A;  4GB7 A;  4KZ5 A;  3WS2 A;  1RGY A;  3UO9 A;  3P98 A;  2Z2M B;  5JYP A;  5FQI A;  3M6H A;  1XGJ A;  2EX9 A;  2R9X A;  3MKE A;  4HEF A;  4RA7 A;  3V5M A;  4R23 A;  4CJN A;  4JF4 A;  1BUE A;  1S0W A;  4Q8I A;  4R4S A;  1LI0 A;  4KZ6 A;  1RGZ A;  2XLN A;  5EE8 A;  4DDY A;  3ZG9 B;  1FSW A;  4DRT A;  1WYB A;  1M6K A;  5HAQ A;  2ZC3 B;  5HAI A;  3S1Y A;  2X01 A;  2DCF A;  1W5D A;  3ZG7 B;  1FCO A;  3UDI A;  3IF6 A;  4N9K A;  1IYQ A;  2IWC A; 
#chains in the Genus database with same CATH topology
 3WS5 A;  3CAX A;  1KVL A;  3A3F A;  4EU0 A;  4QPR A;  1S1Y A;  3NJA A;  4WZ5 C;  4EBL A;  1A0K A;  1DY6 A;  3PAG A;  2H28 A;  4GLQ A;  4DJ2 A;  3ZYT A;  3FC7 A;  3S7O A;  2ZQ9 A;  3FZC A;  2ZM8 A;  1S4S A;  5FEF A;  4EES A;  4BEN A;  3VOL A;  2W1T A;  4E3N A;  3S7P A;  3A0V A;  3E98 A;  5IS1 A;  1T1B A;  4OQI A;  3ZQ5 A;  2HDS A;  4PM6 A;  2WKE A;  4EXO A;  1JWP A;  4HJ3 A;  4K0X A;  3N4I A;  4ZJ2 A;  2CMN A;  2M7V A;  1NRJ A;  3IF6 B;  3PBO A;  5FSR A;  2RCX A;  4PAU A;  1DJA A;  5HX9 A;  3BEB A;  2INW A;  3T4J A;  5GHY A;  1YT4 A;  3ZG0 A;  5F82 A;  2ZC5 B;  4MCW A;  1N9N A;  4P85 A;  1F9I A;  3W4P A;  3DTK A;  3FWL A;  5HDC A;  4MBF A;  4Y2F A;  4I3I A;  5K5B A;  2Q9N A;  3G2Z A;  1JTD A;  3D9Y A;  2O9C A;  3KSH A;  1CJF A;  3UB7 A;  1W63 Q;  2OV5 A;  2VGK A;  2FFY A;  4CLC B;  3TE8 A;  3BLS A;  4L0L A;  4RVA A;  2QZ6 A;  3SW1 A;  3V67 A;  2Y8H A;  3UDF A;  4FSF A;  2ZC7 A;  5DVA A;  3FPV A;  5TBM B;  4OLD A;  2QPN A;  3RH8 B;  2VKS A;  4DDS A;  3EWK A;  4UEY A;  1G6A A;  2OLU A;  3N8R A;  4HI4 A;  2ZL1 A;  4PPR A;  2Q0O A;  3IHA A;  4Y17 A;  2WAD A;  2L4R A;  1P97 A;  3JYI A;  2GNX A;  2IA2 A;  2R78 A;  3E2L A;  1S67 L;  3BWL A;  2DMW A;  4OQ0 A;  2J7V A;  3UNW A;  3F1P A;  3MQQ A;  5U47 A;  4B4Z A;  3VSK A;  2G2W A;  4BJP A;  4GW9 A;  2FFF B;  3EGD C;  4GS9 B;  5FQ9 A;  4HP9 A;  4LGW A;  1IKI A;  3BFG A;  4ZDX A;  3S22 A;  1GSV A;  4I3A A;  4LRX C;  1IKG A;  2K7S A;  4OVD A;  1KOU A;  5F5Y A;  3HLW A;  2XA7 S;  3UMD A;  2ZOH A;  4RX2 A;  2GDN A;  4ZTK A;  1JWZ A;  2ACG A;  1K55 C;  1H8M A;  5AQB A;  4UAA A;  5DJU A;  1JTG A;  4YWZ A;  1X0O A;  2H0Y A;  4ZJ3 A;  4BQM A;  3PAE A;  4E3M A;  1KE0 A;  2Y2P A;  2PD7 A;  1ZHH B;  2Y2O A;  3K2N A;  3LFV A;  1BLP A;  5CED A;  5FDH A;  1UWP X;  4UQI M;  4Z9Q A;  5HZH A;  4HH3 A;  1BLS A;  4JXG A;  4EEP A;  2GX5 A;  4QHC A;  4Y0T A;  3MXS A;  5DTS A;  1PWD A;  5CGS A;  3NEC A;  4S2O A;  2JN7 A;  1TD5 A;  3T4T A;  3W2Z A;  3DWZ A;  1BLC A;  4XUZ A;  1GSW A;  3EEA A;  1TS6 A;  3B47 A;  4X68 A;  1ES5 A;  2J9O A;  3BEC A;  4G3W A;  2NUP C;  2OAP 1;  2UV0 E;  1LHY A;  3W4O A;  1JNU A;  3DTM A;  5HFO A;  1TS7 A;  2J3W A;  1BUL A;  3CZD A;  5EVI A;  3JVU A;  1KGF A;  1LLB A;  2XFS A;  4WMC D;  1STZ A;  4QJG A;  4X53 A;  1VB6 A;  2H10 A;  5FAS A;  4GCZ A;  5TR7 A;  3MF0 A;  4OPZ A;  3WS4 A;  2ZBB A;  3T12 B;  1I2W A;  5J3W A;  5KMW A;  2L1M A;  3ZCZ A;  1XJ2 A;  2V8C A;  3IXH A;  3JVV A;  2XRO A;  2WKP A;  4HOI A;  5JYO A;  1K55 A;  2PT7 A;  2HDR A;  3IT9 A;  1GCE A;  3CPT A;  1FOF A;  4WM9 A;  3CJM A;  3C4O A;  2ZQC A;  3OPR A;  3IH9 A;  1SHV A;  3LI8 A;  5CTM A;  4NG2 A;  2Z6D A;  1PIO A;  1FCM A;  4B9O A;  3D4F A;  4XXR A;  3H7W A;  3UY6 A;  4DE2 A;  1WA9 A;  1OTD A;  3MKF A;  4YNR A;  2KOI A;  1MC0 A;  2K2N A;  3A0R A;  1N9O A;  1EWZ A;  3OOV A;  5E2G A;  1OPX A;  4KG6 A;  3PTE A;  4KZ4 A;  2VZW A;  1L0E A;  1TS8 A;  1KE4 A;  1NLY A;  5LBR A;  3PBR A;  3LYX A;  5KSC A;  1KGG A;  1KDW A;  4FD8 A;  1VEU A;  2P9V B;  3NY4 A;  1XFN A;  4U0X A;  5AQA A;  3VFF A;  4JF5 A;  2V8F A;  1MXO A;  4LPZ A;  3PBS A;  1K4E A;  1EW0 A;  4PKY A;  4FUW A;  5M1A A;  4LLO B;  2DNS A;  4Y15 A;  4S2N A;  1MY8 A;  2XA7 M;  4H6J B;  1YLY A;  2Y2I A;  3O3V A;  2O9B A;  4NK3 A;  3OZH A;  2XEP A;  4OQH A;  1SDE A;  1HZO A;  1MKM A;  3SOI A;  1S1Z A;  4BL2 A;  4RX3 A;  1H0M A;  5FAQ A;  4PM9 A;  4FOF A;  3MFX A;  4DN0 A;  1M40 A;  2JBF A;  5AJG A;  4Y0O A;  1KE3 A;  2B02 A;  1FIL A;  5GLC A;  3KSG A;  5HPF A;  1RGY A;  3E4O A;  3P98 A;  5FQI A;  3M6H A;  1XGJ A;  2PYP A;  4JGR A;  4CJN A;  2JKR M;  5IT5 A;  4R4S A;  3PYP A;  1LI0 A;  2HGV A;  4DDY A;  3SZT A;  3ZG9 B;  1FSW A;  1OTB A;  5HAQ A;  2MJ6 A;  3S1Y A;  3T4Q A;  4I5S A;  3QP2 A;  3ZG7 B;  3F1N B;  3IF6 A;  3LY3 A;  5GHX A;  4EV4 A;  4MBH A;  1N4O A;  1GHP A;  3VOZ A;  3ZGA B;  3G30 A;  3HCY A;  4IVI A;  4M3K A;  2Y2G A;  2B5R A;  3NC8 A;  1G28 A;  1G5U A;  3BLM A;  4OP5 A;  1VET B;  2HDU A;  2A2L A;  5L2F A;  3VE4 A;  3FKW A;  4PHT A;  3FKV A;  2EFU A;  4UHU A;  1YLZ A;  4S2K A;  3IH8 A;  3LR0 A;  4WUJ A;  1K0K A;  4CLC A;  1ODV A;  2O99 A;  1NY0 A;  1P0Z A;  1YMX A;  2Z2L B;  1VQQ A;  5AQ7 A;  3UME A;  3B42 A;  3HLF A;  2PDR A;  5FI7 A;  5TBM A;  2ZQD A;  4KG2 A;  4H8R A;  5EVE A;  4R3J A;  3E4Q A;  1U60 A;  3SH9 A;  4DXB A;  3HLD A;  2VV8 A;  2WGI A;  3O87 A;  3MFD A;  4GNU A;  1BTL A;  4JXS A;  1K6R A;  4II7 A;  4X56 A;  1KGE A;  2EA9 A;  1MWT A;  4R6L A;  1KDS A;  2YKH A;  2LB5 A;  3K3D A;  1E4D A;  5G4Z A;  5GLD A;  3T1X A;  1OTA A;  5HL6 A;  4B4X A;  3M6B A;  1ONH A;  3BFF A;  2WGW A;  3T1S A;  4EQI A;  4IHQ A;  3DTI A;  3UB8 A;  4GS9 A;  2Z6C A;  4OH0 A;  1GSX A;  2A24 B;  3PBT A;  4B88 A;  5IU1 A;  1DJB A;  1YLW A;  4GZB A;  4PMA A;  3KX0 X;  2WZX A;  3CUE C;  3T50 A;  2J9P A;  2P04 A;  1BZA A;  3C38 A;  2QYB A;  4JXV A;  5L8M A;  1YSP A;  4X55 A;  3BM6 A;  3HUN A;  2XH9 A;  1D1J A;  3L9K A;  3SH7 A;  3EQU A;  3C30 A;  3IQA A;  5HDS A;  3QP8 A;  3VP1 A;  4Q0H A;  1P9W A;  2ZJ9 A;  4IUH A;  3Q82 A;  4Q0J A;  4XT2 A;  1LSX A;  5A91 A;  4JPM A;  5D3O A;  1SKO B;  3P7N A;  4UQI S;  4WEK A;  1NZU A;  4X6T A;  4S2M A;  2DRW A;  1SKF A;  2Y59 A;  3KYQ A;  3ZDJ A;  3IXD A;  2BAS A;  3VP2 A;  2YKF A;  3QNB A;  5EM0 A;  1PW8 A;  3KYE A;  4OOM A;  2IWB A;  3SS5 A;  3TJZ C;  1YM1 A;  2D01 A;  4O01 A;  3ZVT A;  3G6O A;  1LT0 A;  2H5S A;  5CGX A;  3N6I A;  3OBF A;  2KLI A;  3MBZ A;  3G4P A;  3OPL A;  1IYP A;  4O8G A;  4F94 A;  5J7E A;  2A49 A;  3G35 A;  1OTE A;  1XFQ A;  4FCF A;  4E3I A;  3GVB A;  4IBR A;  1PI4 A;  3AGD A;  3HLB A;  3MS6 A;  3UE0 A;  4JGO A;  4P87 A;  4OPY A;  4JGQ A;  1S4R A;  5GL9 A;  4E3K A;  1TDL A;  3HL9 A;  4ETX A;  2UWX A;  4BD1 A;  5HSQ A;  3E4P A;  4GKU A;  1V9Z A;  4UA7 A;  4GD6 A;  1XX2 A;  1H5X A;  1XA1 A;  3IHB A;  2X02 A;  2WYX A;  3UPN A;  4HJ4 A;  4E3J A;  3VSL A;  5HDD A;  3TOI A;  3LI9 A;  1NZO A;  1ERM A;  1AXB A;  5A90 A;  2W3G A;  2XSS A;  4BWI A;  3CUE A;  1PNE A;  3ZFZ A;  3T4L A;  2XFT A;  5DF8 A;  3IXB A;  1PZO A;  2VV7 A;  2VA0 A;  3G34 A;  5C5K A;  1XKZ A;  1BYW A;  1GA0 A;  1D7E A;  2VLG A;  4LV3 A;  2L0W A;  1YQS A;  1G68 A;  1XJ6 A;  3MZF A;  4N1X A;  3EGX C;  2M1C A;  3Q7V B;  5FQM A;  4CQH A;  4BBV A;  2W0N A;  4WZ5 A;  3MR0 A;  1CEG A;  2XDM A;  1E3U D;  4WEL A;  1O07 A;  2VGL S;  5DKL A;  3BQA A;  3G31 A;  4DMZ A;  2QKP A;  5HWV A;  4N1H A;  1LL8 A;  4HNB A;  4KZ9 A;  1LI9 A;  4JXW A;  4NXG A;  3BFE A;  3S7N A;  4N92 A;  3RJU A;  4GD8 A;  3MXQ A;  3ITB A;  1HVB A;  2W3F A;  1DP9 A;  3NBL A;  2EWV A;  2P9V A;  2IWD A;  5L10 A;  1HLU P;  3LR3 A;  5HWW A;  2PU2 A;  3OC2 A;  3T4S A;  2BLS A;  1K57 C;  3B33 A;  1CI9 A;  4YOF A;  1GHM A;  2EFX A;  2EWW A;  4I3J A;  3FPW A;  3LO7 A;  1CF0 A;  1T19 A;  3PR6 A;  4EEU A;  2FZ0 A;  3LIA A;  3LGO A;  1XXM A;  4OLG A;  2V1Z A;  4RYE A;  1YKD A;  3Q07 A;  1RCJ A;  1MBL A;  1SCW A;  4ESP A;  4ID4 A;  5DFY A;  4OOL A;  1FCN A;  1ESI A;  4WZ4 A;  1HD8 A;  3VMA A;  3UPP A;  3ZG8 B;  2VK3 A;  3BY8 A;  1MWR A;  2WK0 A;  1ACF A;  4OON A;  2LB9 A;  3A3D A;  4WMC A;  2JKT M;  5EM1 A;  4X1M A;  3LR5 A;  3WRZ A;  4B93 A;  3F1N A;  4I38 A;  4KZ3 A;  3LIE A;  4KUK A;  5CX7 A;  1I5Q A;  5CGW A;  3DTE A;  3GMW A;  4DF6 A;  4Y3I A;  4O0P A;  3IWO A;  4ME4 A;  2Y2H A;  4LRZ E;  3EEH A;  4A5R A;  3CWF A;  5HPI A;  1VET A;  3V39 A;  3N8S A;  3H82 B;  5F69 A;  3UO9 A;  2Z2M B;  5JYP A;  2EX9 A;  3MKE A;  4HEF A;  4RA7 A;  4WF0 A;  4JF4 A;  1BUE A;  2J80 A;  1RGZ A;  5EE8 A;  2K31 A;  1M6K A;  2ZC3 B;  1OT9 A;  2PR5 A;  2DCF A;  1W5D A;  1FCO A;  3UDI A;  2M7U A;  1IFQ A;  2ZLY A;  1IYQ A;  1OJ5 A;  5I5L A;  2C5W B;  3MZD A;  5GLA A;  4F3L B;  4C75 A;  4D2O A;  3NDE A;  1Z09 A;  1CI8 A;  2RL3 A;  3HJI A;  2W3H A;  3E2K A;  1K4F A;  1SDN A;  2FH5 A;  1DP6 A;  5CHJ A;  2JKR I;  3OPP A;  1HTZ A;  3KO6 A;  3NI9 A;  3JPU A;  2QJ7 A;  5DFX A;  1TF1 A;  4EQ1 A;  1L2S A;  3UB9 A;  2P7J A;  1PRQ A;  3DAV A;  3G32 A;  3Q81 A;  3IS2 A;  2I9V A;  2HJE A;  1W63 M;  4Q0I A;  1FR6 A;  3ITA A;  3GV9 A;  1K54 C;  2VGL M;  1L3L A;  2A24 A;  4KQO A;  4K08 A;  4LV0 A;  3FG8 A;  3Q7Z A;  3HRE A;  4KZ8 A;  1DRM A;  3QP6 A;  3RFB A;  1ES3 A;  3R4K A;  2ZMV A;  3SS4 A;  1NXY A;  2Y2M A;  3MSH A;  3D72 A;  4PKY G;  2XR0 A;  2G2U A;  1T1A A;  1Y28 A;  5J4E A;  1DP8 A;  4R4R A;  3W4Q A;  4HIA A;  5FDS A;  3MQ0 A;  5FQK A;  1KVM A;  4GOG A;  4C6Y A;  5GLB A;  3VP4 A;  4KZA A;  4MEZ A;  4QWO A;  1SKO A;  2O0Y A;  3CHW P;  3UB6 A;  5M19 A;  3CLO A;  3QP4 A;  4NXB A;  3C5A A;  1CK3 A;  1UGU A;  2P08 A;  1NRF A;  4MLL A;  1LL9 A;  4OPR A;  4X25 A;  5FAT A;  2ZOI A;  4FH4 A;  3HVF A;  4NXF A;  4MMN A;  5E43 A;  5CHU A;  3EOI A;  3LIB A;  5FAP A;  1IOU A;  2ZM0 A;  3UE1 A;  5HD3 A;  4K0W A;  4NET A;  3DWK A;  2JHE A;  1PWC A;  3LEQ A;  2Q9M A;  4ARZ B;  1N9L A;  3VP3 A;  4BL3 A;  4Z1W A;  1WYC A;  4S2I A;  4O7D A;  4EER A;  3WS1 A;  4EBN A;  3BY9 A;  4R0Q A;  2XQZ A;  2R9W A;  2EX8 A;  3HJK A;  5A92 A;  3UB5 P;  3M2J A;  2EX2 A;  4WYY A;  3O86 A;  3F1O B;  4NEE D;  4DKI A;  1YMS A;  1IEM A;  2WKH A;  3V50 A;  4N9L A;  1G6O A;  3TRC A;  5DTK A;  5AVF A;  3UPO A;  4EWF A;  1UWN X;  1FIK A;  2V0W A;  1W7F A;  1IYS A;  2W3E A;  3BFD A;  2HP9 A;  3N7W A;  1N9B A;  3LY4 A;  3Q7V A;  4HHD A;  5F6A A;  3QP5 A;  1F98 A;  2Y55 A;  4OKP A;  2PBD P;  2Y2N A;  1RP5 A;  4I39 A;  3Q1F A;  5KZH A;  5E2F A;  4HBT A;  1PI5 A;  2HZ5 A;  3LR4 A;  4BD0 A;  1E25 A;  5DKK A;  3BW6 A;  4EW7 A;  1S6R A;  3TW8 A;  1L0D A;  5EEC A;  5KIZ A;  5F68 A;  2GJ3 A;  5GHZ A;  1W8Q A;  2JKF A;  2O9A A;  2ZQ7 A;  2P74 A;  3MJQ A;  4YFM A;  2V20 A;  4MN7 A;  5CEB A;  1ERQ A;  3BJN A;  1ZKJ A;  4EBP A;  1VM1 A;  3IX3 A;  3GSG A;  1NYM A;  2WAE A;  3NOP C;  5EV0 A;  3K3C A;  4HBU A;  4L9E A;  3VOY A;  2PR6 A;  1YAX A;  1YLP A;  4XUX A;  3C2W A;  2XK1 A;  1OJG A;  4IED A;  4P6Z S;  4R3B A;  4R1G A;  2XRN A;  5EUA A;  5FEG A;  2EXB A;  4WLA A;  4KEN B;  5DTT A;  4DE1 A;  1GA9 A;  3W8K A;  5DF7 A;  5TFQ A;  5CEC A;  5F1G A;  1YLT A;  5CRF A;  4ZRR A;  3HLE A;  3GQZ A;  1H8Y A;  2WGV A;  3NCK A;  3HBR A;  5FI6 A;  5FI2 A;  2XGN A;  3MQO A;  4WL9 A;  4LCM A;  5FQQ A;  3BRM A;  4BMW A;  1S66 L;  3GRJ A;  5MC7 A;  1XJ4 A;  5BOH A;  3DW0 A;  3MMH A;  2Y91 A;  2OWH A;  1W79 A;  4LV1 A;  1L0G A;  5CHM A;  4MNR A;  4HY8 A;  4CLC E;  4EUV A;  2JC7 A;  5EPH A;  1BSG A;  3H82 A;  1IYO A;  4S2J A;  4R38 A;  2KDK A;  1K38 A;  3R7W B;  1TEM A;  1PZP A;  4PM8 A;  3HUO A;  3PHY A;  4JBF A;  3GTC A;  2BTF P;  1IEL A;  4KUO A;  4ZBE A;  2PRF A;  3IF5 A;  4E6W A;  1E3U A;  3A3I A;  4HP4 A;  3CIT A;  4ETZ A;  3IBR A;  4OQG A;  1BLH A;  4L9G A;  4LFU A;  5KSH A;  4F3L A;  5FA7 A;  3NHQ A;  4WEJ A;  4Y5F A;  2OLV A;  4MDZ A;  4E3L A;  5HAR A;  1Y54 A;  4GB7 A;  2JKT I;  2R9X A;  3V5M A;  4X1L A;  3ICY A;  4KZ6 A;  3IX8 A;  1Y4O A;  2XLN A;  1WYB A;  5HAI A;  2B18 A;  2X01 A;  1YSQ A;  4N9K A;  3QP1 A;  4MN5 A;  2AVX A;  5EVI C;  1TVF A;  2OSU A;  4OP8 A;  1ZTU A;  1C3B A;  1MZU A;  1DJC A;  4GHI B;  2PAV P;  2QMI A;  2Y79 A;  2B95 A;  1I2S A;  4Y7P A;  2WGW B;  4DXC A;  3RXX A;  1XGI A;  3RTY A;  1ONG A;  5E2E A;  3FYZ A;  3OLO A;  4LEN A;  3O5Y A;  4FH2 A;  1O7E A;  4H6J A;  4ZJ1 A;  1PYY A;  4JF6 A;  3BFC A;  4KQD A;  3GR2 A;  3KSF A;  1J9M A;  2XD5 A;  2J3T C;  5E2H A;  4HJ6 A;  1V9Y A;  1GHI A;  3NUL A;  4HH2 A;  4OPQ A;  3BQ8 A;  3ZG5 A;  2VX8 A;  1NJ4 A;  3OCL A;  2E8I A;  1K56 A;  5AQ9 A;  1W8Y A;  3RXW A;  1EI5 A;  4P6Z M;  3PBN A;  1MWS A;  3UN7 A;  3WRT A;  2PYR A;  5L09 A;  2VJW A;  2J8Y A;  3FV7 A;  3N8L A;  2ZC4 B;  4GDN A;  4KQR A;  4XT2 B;  3LEZ A;  4WN5 A;  3HLG A;  3HUM A;  4QD4 A;  3T4K A;  1Q2P A;  4OOY A;  4P6B A;  4IJG A;  2W1T B;  3S7Q A;  4DJ3 A;  2W3D A;  4IBX A;  4KZ7 A;  4ARZ A;  1PWG A;  3MXR A;  4PM5 A;  5EOE A;  4HQA A;  1K56 D;  4NKP A;  5HWT A;  4JKT A;  2Y2L A;  3O88 A;  5DF9 A;  1ZC2 A;  2PHY A;  3A3J A;  4RQ9 A;  2ZC6 B;  4UA9 A;  3B3X A;  2Y2K A;  1LSV A;  4S2N C;  1F2K A;  4GN2 A;  2JCH A;  4K91 A;  4D60 A;  4WBG A;  3SH8 A;  3V3S A;  2XF3 A;  3PBQ A;  1JWV A;  3ZNT A;  3F1O A;  1L0F A;  2V2F F;  3CMZ A;  4MBK A;  4M4X A;  3ZVW A;  2BG1 A;  4C3Q A;  2V0U A;  4HES A;  2WUQ A;  2X71 A;  3IX4 A;  3A3E A;  1K57 A;  3NOU C;  4S2P A;  1CQA A;  2ZQA A;  3MZE A;  1J3W A;  3IWQ A;  1ALQ A;  5EFW A;  1T18 A;  5G4Y A;  2HP6 A;  3TG9 A;  4JLF A;  3CI6 A;  3KYZ A;  4GDB A;  5TJJ A;  5IHV A;  2ZMF A;  4PM7 A;  3IXG A;  3VP0 A;  3ISG A;  3IF6 C;  3SS3 A;  1LSW A;  5EVI D;  4DE0 A;  4BBU A;  2HPB A;  2ZL1 B;  3ULF A;  4NXE A;  1XA7 A;  3DBA A;  3LCE A;  1F5M A;  1K25 A;  2PU4 A;  3H9W A;  4QU3 A;  3PXP A;  3UE6 A;  1ESU A;  5HD5 A;  4EET B;  2EXA A;  3F1P B;  3GDI A;  5I94 A;  2HF6 A;  1OTI A;  2JKG A;  2OWJ A;  3U2A A;  2VV6 A;  1ERO A;  1XJ3 A;  1OT6 A;  4GJ4 A;  2HDQ A;  2J3T D;  1MPL A;  4CLC C;  4UA6 A;  4KG5 A;  4R3A A;  5HL1 A;  5FQJ A;  1NWZ A;  5G18 A;  2C6W B;  4DE3 A;  1XPB A;  2KX6 A;  5F1F A;  4QY6 A;  2VGJ A;  3UDX A;  4CPK A;  5CTN A;  2CC1 A;  1FQG A;  3WWX A;  4LCL A;  4E04 A;  2V1B A;  4E6X A;  1ES2 A;  4IVK A;  3AGF A;  3QHY A;  3LID A;  2PBY A;  3NDG A;  1XP4 A;  4KQQ A;  4U3T A;  5A93 A;  3A0S A;  3QNC A;  3IWI A;  5TGF A;  3LUQ A;  3E0Y A;  3S4X A;  3CG5 A;  1JVJ A;  4BBT A;  3P01 A;  3HLC A;  1SZV A;  4G3V A;  4U0T A;  2W27 A;  3OCN A;  3VFH A;  3VV4 A;  1AWI A;  3LIC A;  2HV1 A;  3C7U A;  2V9A A;  2GZA A;  2WAF A;  1QME A;  4KZB A;  2WKQ A;  4ZAM A;  2H0T A;  3WS0 A;  1LL5 A;  2OOL A;  3AGE A;  1FR1 A;  1QMF A;  2ZQ8 A;  3TSG A;  1P9R A;  2WKI A;  3T1Q B;  2HP5 A;  3NIA A;  4QB8 A;  3UE3 A;  2EX6 A;  1VHM A;  3R7W A;  3C8C A;  2WKR A;  2Y2J A;  1T1C A;  1D06 A;  2NUT C;  3G2Y A;  5FL3 A;  1K54 A;  2ZM2 A;  3ZHH A;  1WE4 A;  5DJT A;  3V3R A;  4X69 A;  5AVE A;  1ES4 A;  5EVI B;  2I72 A;  2Y4A A;  2PD8 A;  3P09 A;  2G7U A;  3U4L P;  4Y13 A;  3VE3 A;  4JGP A;  4YIN A;  3ZNY A;  4EUZ A;  5F83 A;  5A8B A;  2XD1 A;  2VEA A;  4L9F A;  5EOO A;  5CER A;  1YPR A;  1MKI A;  2D02 A;  2E8J A;  5CXW A;  1PFL A;  3KSI A;  1CEF A;  3OPH A;  2A3U A;  2Y2Q A;  2ZD8 A;  1TS0 A;  1ZG6 A;  3IBJ A;  3C4P A;  3M2K A;  2JE5 A;  1BT5 A;  1OME A;  4AFI A;  2HJ9 C;  3CPT B;  3BYD A;  2V1A A;  2OAQ 1;  3I7J A;  3NOT C;  5FAO A;  1ZG4 A;  1Z6F A;  1Q2Q A;  1PW1 A;  4S2L A;  4QY5 A;  4CLC D;  4BLM A;  5HAP A;  1MWU A;  3GEC A;  3D3O A;  5HW3 A;  1NYY A;  3EQV A;  3H7W B;  1H3Q A;  5J8X A;  4Y0U A;  1FSY A;  1TDG A;  3T1R A;  4LV2 A;  1YLJ A;  4GHI A;  5M18 A;  2QJ5 A;  5EVL A;  4LRY C;  1H8Z A;  3IS2 B;  4MN6 A;  3L7H A;  4P0M A;  2QHK A;  4E3O A;  4G3K A;  3T4O A;  1K6S A;  2ZMA A;  3C7V A;  2WZZ A;  4KZ5 A;  3WS2 A;  4FTX A;  4R70 A;  4R23 A;  1VEU B;  1S0W A;  4Q8I A;  5L07 A;  3LIF A;  4DRT A;  4IUK A;  1NLZ A;  2QWS A;  2W1R A;  2IWC A; 
#chains in the Genus database with same CATH homology
 3WS5 A;  3LY3 A;  5GHX A;  4EV4 A;  4MBH A;  1KVL A;  2C5W B;  3MZD A;  1N4O A;  5EVI C;  1TVF A;  5GLA A;  1GHP A;  3VOZ A;  2OSU A;  3ZGA B;  3A3F A;  4OP8 A;  3G30 A;  4C75 A;  1C3B A;  4IVI A;  4M3K A;  4D2O A;  3NDE A;  1DJC A;  2Y2G A;  4WZ5 C;  2B5R A;  4EBL A;  1CI8 A;  2RL3 A;  2QMI A;  3NC8 A;  1DY6 A;  1I2S A;  4Y7P A;  3PAG A;  3E2K A;  3BLM A;  2WGW B;  1K4F A;  4OP5 A;  4DXC A;  1SDN A;  1XGI A;  2HDU A;  3RXX A;  1ONG A;  5E2E A;  2ZQ9 A;  3FYZ A;  5CHJ A;  3FZC A;  4LEN A;  2ZM8 A;  3OPP A;  5L2F A;  1HTZ A;  3FKW A;  1O7E A;  4FH2 A;  4ZJ1 A;  3NI9 A;  1PYY A;  4BEN A;  4JF6 A;  3FKV A;  3BFC A;  4E3N A;  1L2S A;  2EFU A;  4UHU A;  1YLZ A;  3GR2 A;  4OQI A;  4S2K A;  3IH8 A;  1J9M A;  2HDS A;  2XD5 A;  4PM6 A;  5E2H A;  3G32 A;  1GHI A;  3Q81 A;  1NY0 A;  2WKE A;  4OPQ A;  3ZG5 A;  1YMX A;  2Z2L B;  1JWP A;  1FR6 A;  1NJ4 A;  3ITA A;  3GV9 A;  3OCL A;  3N4I A;  4K0X A;  1K54 C;  2E8I A;  4ZJ2 A;  1K56 A;  5AQ9 A;  3IF6 B;  1W8Y A;  3PBO A;  5FSR A;  2RCX A;  1VQQ A;  5AQ7 A;  3RXW A;  1EI5 A;  3PBN A;  3HLF A;  1MWS A;  1DJA A;  5HX9 A;  3UN7 A;  3BEB A;  5FI7 A;  3WRT A;  2ZQD A;  4KG2 A;  4KQO A;  4H8R A;  5GHY A;  1YT4 A;  4LV0 A;  3ZG0 A;  5F82 A;  2J8Y A;  3FV7 A;  3N8L A;  2ZC4 B;  2ZC5 B;  4GDN A;  3Q7Z A;  3HRE A;  4KQR A;  4R3J A;  4KZ8 A;  4P85 A;  3LEZ A;  3W4P A;  1U60 A;  1ES3 A;  3SH9 A;  4DXB A;  3HLD A;  3HLG A;  3FWL A;  2WGI A;  3O87 A;  3MFD A;  3HUM A;  4MBF A;  4QD4 A;  3SS4 A;  4GNU A;  1BTL A;  1NXY A;  1Q2P A;  2Q9N A;  2Y2M A;  4JXS A;  1K6R A;  4OOY A;  3G2Z A;  4X56 A;  4P6B A;  1JTD A;  2XR0 A;  1KGE A;  1MWT A;  1KDS A;  4IBX A;  1E4D A;  4KZ7 A;  2G2U A;  5GLD A;  1PWG A;  3MXR A;  2OV5 A;  5EOE A;  2VGK A;  4PM5 A;  1K56 D;  2FFY A;  3BLS A;  4B4X A;  4R4R A;  4L0L A;  3W4Q A;  4JKT A;  4RVA A;  5FQK A;  1KVM A;  4GOG A;  4C6Y A;  5GLB A;  3M6B A;  1ONH A;  2QZ6 A;  4KZA A;  3VP4 A;  3BFF A;  2Y2L A;  4MEZ A;  2WGW A;  3O88 A;  4EQI A;  5DF9 A;  1ZC2 A;  3UDF A;  3A3J A;  5M19 A;  2ZC6 B;  4OH0 A;  4FSF A;  2ZC7 A;  4UA9 A;  3B3X A;  5DVA A;  3C5A A;  1CK3 A;  3PBT A;  4OLD A;  4B88 A;  2QPN A;  2Y2K A;  1NRF A;  4MLL A;  4S2N C;  1LL9 A;  1DJB A;  4OPR A;  1YLW A;  4GZB A;  5FAT A;  4GN2 A;  4PMA A;  2JCH A;  4K91 A;  4FH4 A;  3HVF A;  2WZX A;  4WBG A;  3SH8 A;  4DDS A;  3V3S A;  2XF3 A;  3PBQ A;  1JWV A;  2J9P A;  1BZA A;  1G6A A;  5E43 A;  5CHU A;  2OLU A;  3ZNT A;  3N8R A;  4JXV A;  1L0F A;  2V2F F;  5FAP A;  2ZLY A;  4PPR A;  3IHA A;  3CMZ A;  2WAD A;  2ZM0 A;  4MBK A;  3UE1 A;  4X55 A;  3JYI A;  3BM6 A;  3HUN A;  2XH9 A;  3ZVW A;  3SH7 A;  2BG1 A;  3E2L A;  4C3Q A;  3EQU A;  4K0W A;  4HES A;  2WUQ A;  4NET A;  2X71 A;  3DWK A;  4OQ0 A;  2J7V A;  3UNW A;  1PWC A;  3IQA A;  3A3E A;  1K57 A;  4S2P A;  2ZQA A;  2Q9M A;  3MZE A;  3IWQ A;  3VP1 A;  1ALQ A;  5U47 A;  4B4Z A;  3VP3 A;  2ZJ9 A;  3VSK A;  3Q82 A;  2HP6 A;  3TG9 A;  2G2W A;  4JLF A;  5A91 A;  4BJP A;  4BL3 A;  4JPM A;  5D3O A;  1WYC A;  4WEK A;  4S2I A;  1NZU A;  4X6T A;  4GDB A;  4O7D A;  4S2M A;  2FFF B;  2DRW A;  1SKF A;  2Y59 A;  5IHV A;  3WS1 A;  4EBN A;  4R0Q A;  3ZDJ A;  3IXD A;  4PM7 A;  5FQ9 A;  3IXG A;  1IKI A;  2XQZ A;  3VP2 A;  3VP0 A;  3QNB A;  3ISG A;  2R9W A;  3BFG A;  3IF6 C;  4ZDX A;  3S22 A;  3SS3 A;  1PW8 A;  1IKG A;  2EX8 A;  4OOM A;  4OVD A;  5A92 A;  2IWB A;  3SS5 A;  5EVI D;  3HLW A;  1YM1 A;  3ZVT A;  3M2J A;  2H5S A;  4DE0 A;  5CGX A;  2EX2 A;  4WYY A;  3O86 A;  2HPB A;  3N6I A;  4RX2 A;  1XA7 A;  2GDN A;  4DKI A;  4ZTK A;  3MBZ A;  1JWZ A;  2PU4 A;  1K25 A;  1YMS A;  3G4P A;  1IEM A;  1K55 C;  1IYP A;  2WKH A;  3LCE A;  3OPL A;  1ESU A;  4QU3 A;  5AQB A;  4N9L A;  3V50 A;  4F94 A;  2A49 A;  3G35 A;  4UAA A;  1JTG A;  2EXA A;  4FCF A;  4E3I A;  3GVB A;  2H0Y A;  4ZJ3 A;  4BQM A;  3PAE A;  4IBR A;  1PI4 A;  3AGD A;  5DTK A;  5I94 A;  3HLB A;  3UPO A;  4E3M A;  1KE0 A;  2Y2P A;  3UE0 A;  4EWF A;  2Y2O A;  1ERO A;  1W7F A;  1IYS A;  2HDQ A;  4P87 A;  1MPL A;  4OPY A;  1BLP A;  4UA6 A;  5CED A;  5FDH A;  3BFD A;  5GL9 A;  4E3K A;  2HP9 A;  1TDL A;  3HL9 A;  2UWX A;  3N7W A;  4KG5 A;  4BD1 A;  5HL1 A;  5FQJ A;  1N9B A;  4GKU A;  3LY4 A;  3Q7V A;  5G18 A;  2C6W B;  4Z9Q A;  4DE3 A;  4UA7 A;  1BLS A;  4GD6 A;  1XPB A;  1XX2 A;  1H5X A;  4JXG A;  1XA1 A;  2Y55 A;  5F1F A;  4QHC A;  3IHB A;  4Y0T A;  4OKP A;  4QY6 A;  2VGJ A;  2Y2N A;  1RP5 A;  1PWD A;  2X02 A;  3MXS A;  5DTS A;  3Q1F A;  3UDX A;  5CGS A;  2WYX A;  3UPN A;  5KZH A;  4CPK A;  5CTN A;  2CC1 A;  5E2F A;  4E3J A;  4HBT A;  4S2O A;  1FQG A;  3VSL A;  3WWX A;  3TOI A;  1NZO A;  4LCL A;  1ERM A;  1AXB A;  1PI5 A;  4E6X A;  4BD0 A;  3DWZ A;  1ES2 A;  1BLC A;  4XUZ A;  4IVK A;  1E25 A;  5A90 A;  3AGF A;  3QHY A;  2PBY A;  3NDG A;  1S6R A;  1L0D A;  1XP4 A;  4X68 A;  5EEC A;  3ZFZ A;  2XFT A;  4KQQ A;  1ES5 A;  4U3T A;  5DF8 A;  2J9O A;  3BEC A;  5GHZ A;  3IXB A;  1W8Q A;  5A93 A;  2ZQ7 A;  1PZO A;  2P74 A;  3QNC A;  1LHY A;  3IWI A;  3G34 A;  5TGF A;  3W4O A;  3DTM A;  5HFO A;  1XKZ A;  1GA0 A;  1BUL A;  4YFM A;  2V20 A;  3CZD A;  3CG5 A;  1JVJ A;  4LV3 A;  3S4X A;  5CEB A;  5EVI A;  1ERQ A;  1YQS A;  1G68 A;  1KGF A;  1LLB A;  1ZKJ A;  2XFS A;  3HLC A;  4EBP A;  3MZF A;  4N1X A;  3Q7V B;  5FQM A;  1VM1 A;  4WMC D;  4QJG A;  3GSG A;  1NYM A;  4U0T A;  2WAE A;  3OCN A;  4WZ5 A;  4X53 A;  2H10 A;  3VFH A;  5FAS A;  5TR7 A;  1CEG A;  2XDM A;  4HBU A;  3C7U A;  1E3U D;  4OPZ A;  4WEL A;  3VOY A;  1O07 A;  3WS4 A;  1YLP A;  4XUX A;  1I2W A;  3G31 A;  2XK1 A;  4IED A;  4R3B A;  2WAF A;  1QME A;  4N1H A;  4KZB A;  4KZ9 A;  4R1G A;  4ZAM A;  5KMW A;  1LI9 A;  2H0T A;  4JXW A;  5EUA A;  3WS0 A;  1LL5 A;  3BFE A;  3ZCZ A;  3AGE A;  1FR1 A;  1QMF A;  2EXB A;  2ZQ8 A;  3TSG A;  2WKI A;  4N92 A;  3RJU A;  3IXH A;  4GD8 A;  4KEN B;  2HP5 A;  3NIA A;  4QB8 A;  3UE3 A;  2EX6 A;  3ITB A;  1HVB A;  3NBL A;  5DTT A;  2Y2J A;  2P9V A;  4DE1 A;  1GA9 A;  3G2Y A;  2IWD A;  1K54 A;  3W8K A;  2PU2 A;  2ZM2 A;  3OC2 A;  1WE4 A;  3V3R A;  3ZHH A;  5JYO A;  2BLS A;  1K55 A;  1K57 C;  2HDR A;  3IT9 A;  5DF7 A;  5TFQ A;  4X69 A;  1GCE A;  5CEC A;  1ES4 A;  1CI9 A;  1FOF A;  1YLT A;  4WM9 A;  5CRF A;  3HLE A;  3GQZ A;  5F1G A;  1GHM A;  1H8Y A;  3CJM A;  2EFX A;  3C4O A;  5EVI B;  2I72 A;  2WGV A;  2ZQC A;  3NCK A;  3HBR A;  3OPR A;  5FI6 A;  2XGN A;  3IH9 A;  5FI2 A;  3LO7 A;  4LCM A;  2Y4A A;  5FQQ A;  1SHV A;  3BRM A;  3P09 A;  5CTM A;  3GRJ A;  1PIO A;  5BOH A;  4YIN A;  3ZNY A;  4EUZ A;  5F83 A;  1FCM A;  2XD1 A;  3DW0 A;  3D4F A;  4XXR A;  3UY6 A;  2Y91 A;  4DE2 A;  1XXM A;  1W79 A;  5EOO A;  4OLG A;  3MKF A;  5CER A;  2V1Z A;  1MKI A;  4LV1 A;  1L0G A;  4RYE A;  3Q07 A;  5CHM A;  1RCJ A;  5CXW A;  4MNR A;  1MBL A;  1SCW A;  3OPH A;  1CEF A;  1EWZ A;  4ID4 A;  2A3U A;  2Y2Q A;  5E2G A;  2JC7 A;  3PTE A;  4KG6 A;  2ZD8 A;  4KZ4 A;  1BSG A;  5EPH A;  1L0E A;  4OOL A;  1FCN A;  1ESI A;  4WZ4 A;  1IYO A;  1HD8 A;  4S2J A;  1KE4 A;  3VMA A;  1ZG6 A;  3UPP A;  3ZG8 B;  1K38 A;  3PBR A;  5KSC A;  1KGG A;  1KDW A;  1TEM A;  1MWR A;  2WK0 A;  4FD8 A;  2P9V B;  1PZP A;  3NY4 A;  4OON A;  4PM8 A;  3C4P A;  4U0X A;  3M2K A;  3A3D A;  3HUO A;  5AQA A;  4WMC A;  4JBF A;  3VFF A;  4JF5 A;  2JE5 A;  3GTC A;  1BT5 A;  1IEL A;  1MXO A;  1OME A;  3PBS A;  1K4E A;  3BYD A;  4ZBE A;  3IF5 A;  3I7J A;  4E6W A;  5FAO A;  5M1A A;  1E3U A;  1ZG4 A;  3WRZ A;  3A3I A;  2DNS A;  4KZ3 A;  1MY8 A;  4S2N A;  1YLY A;  2Y2I A;  1Z6F A;  1Q2Q A;  1PW1 A;  3O3V A;  4OQG A;  1I5Q A;  4NK3 A;  4QY5 A;  1BLH A;  3OZH A;  4S2L A;  5CGW A;  3GMW A;  4BLM A;  2XEP A;  4OQH A;  4DF6 A;  5HAP A;  5KSH A;  1MWU A;  1SDE A;  1HZO A;  3IWO A;  5HW3 A;  5FA7 A;  1NYY A;  2Y2H A;  3EQV A;  4WEJ A;  5J8X A;  2OLV A;  4Y0U A;  1FSY A;  1TDG A;  3SOI A;  4LV2 A;  4BL2 A;  1YLJ A;  5M18 A;  5EVL A;  1H8Z A;  4A5R A;  4RX3 A;  5FAQ A;  4PM9 A;  4P0M A;  4E3O A;  1M40 A;  2JBF A;  4Y0O A;  3V39 A;  5HAR A;  1K6S A;  2ZMA A;  3N8S A;  1KE3 A;  1Y54 A;  3C7V A;  4E3L A;  2WZZ A;  5GLC A;  4GB7 A;  4KZ5 A;  3WS2 A;  1RGY A;  3UO9 A;  3P98 A;  2Z2M B;  5JYP A;  5FQI A;  3M6H A;  1XGJ A;  2EX9 A;  2R9X A;  3MKE A;  4HEF A;  4RA7 A;  3V5M A;  4R23 A;  4CJN A;  4JF4 A;  1BUE A;  1S0W A;  4Q8I A;  4R4S A;  1LI0 A;  4KZ6 A;  1RGZ A;  2XLN A;  5EE8 A;  4DDY A;  3ZG9 B;  1FSW A;  4DRT A;  1WYB A;  1M6K A;  5HAQ A;  2ZC3 B;  5HAI A;  3S1Y A;  2X01 A;  2DCF A;  1W5D A;  3ZG7 B;  1FCO A;  3UDI A;  3IF6 A;  4N9K A;  1IYQ A;  2IWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...