2B5RA

1b lactamase / b lactamase inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVYNSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Binding Hot Spots in the TEM1-BLIP Interface in Light of its Modular Architecture.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 92
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2b5rA00
5EVIC 1ERQA 5M1AA 4FD8A 5HAQA 4JXWA 4OVDA 1LL5A 1ESUA 4X55A 1XXMA 3IQAA 3VMAA 1O07A 2Y2JA 4GOGA 5D3OA 3VOZA 1ZKJA 3HLWA 3IWOA 3Q82A 3I7JA 3HREA 3M2JA 4KQQA 3SH8A 4LCMA 2Y2IA 3O88A 4BL3A 1XA1A 1MXOA 4S2IA 5CEDA 5DTSA 1E4DA 3C7VA 3BFCA 2WKIA 1YLTA 3GSGA 5GLDA 2IWCA 4CJNA 5FQMA 2Y55A 4K91A 5FASA 3UPPA 1XP4A 4DRTA 4LV3A 5DTTA 4JLFA 3BEBA 3RJUA 1TEMA 5FQIA 1PW8A 3OZHA 3IXBA 3JYIA 2JE5A 1PZPA 3CMZA 4X68A 5HL1A 4NETA 1L2SA 4HBUA 4JXGA 5IHVA 2EX2A 2WAEA 3O3VA 1NYMA 4IBRA 3ZGAB 4B4XA 3O86A 5BOHA 1NXYA 4F94A 1ES3A 4UA7A 3LEZA 1K6SA 2HDQA 3W8KA 1PIOA 2XEPA 1KDSA 1TVFA 1FOFA 4JF5A 4ZDXA 3PBOA 5FI2A 1HD8A 4HEFA 1PWGA 1CK3A 3IH9A 4EBLA 3PBTA 3EQVA 2G2UA 4PPRA 1U60A 4DE0A 4N92A 3ZG8B 2P9VB 2V20A 2EFUA 1XKZA 5EVID 1W8QA 4EV4A 1EROA 5TR7A 1L0FA 4WYYA 1LHYA 1XX2A 3G2YA 4U0TA 3UPNA 5J8XA 5EVLA 4KZ8A 1JTDA 4WEKA 1HVBA 3N8RA 1IKGA 1MWRA 4RA7A 2WADA 5HFOA 2E8IA 4EBNA 3EQUA 3UNWA 1BUEA 3M6BA 2X02A 2ZD8A 5CTMA 4KZ4A 2PU4A 4FH4A 1MPLA 2Z2LB 5U47A 1W7FA 4QB8A 1K38A 3QHYA 3UE3A 5E2EA 1IYQA 5KZHA 3WS2A 3IF6A 4OLGA 2WZZA 3G30A 4EUZA 1L0EA 3IF6C 1BSGA 5GLBA 1LLBA 4P85A 4RX2A 3HVFA 2ZMAA 3DTMA 3LO7A 2IWBA 5L2FA 4UA6A 5F1GA 1KGEA 4MNRA 4IVKA 3N4IA 1Z6FA 3HBRA 2DCFA 4U3TA 2RCXA 2P74A 1E3UD 4C75A 4E3NA 4OPZA 1KE4A 1NRFA 1HTZA 2XD1A 3OPRA 3VP0A 1KE3A 2V1ZA 2JC7A 3TSGA 3WS5A 1ONHA 5HX9A 5E2FA 4BJPA 3Q7VA 4WBGA 5F82A 1YMSA 2Q9NA 1M40A 2JBFA 5HAPA 1IELA 2H0TA 2PU2A 3C5AA 3PBSA 3UY6A 4RVAA 4X56A 3NDEA 4H8RA 3O87A 4S2KA 1ONGA 1NYYA 2ZQAA 2X01A 4EBPA 4ZJ2A 3V3RA 5HAIA 2FFFB 3WRZA 2BG1A 1K56D 1J9MA 2OSUA 3N7WA 1GA9A 5JYOA 5KSCA 3SH9A 1BULA 5EVIA 4R0QA 1PW1A 1CI9A 5CGXA 2H10A 3UDFA 4OH0A 5F1FA 5JYPA 2R9XA 1CEFA 2B5RA 3NDGA 2G2WA 4UHUA 3S1YA 4KZ6A 5EOEA 5FATA 5CGSA 4OQHA 4XUXA 4WELA 2HP5A 4GZBA 1HZOA 1M6KA 4JPMA 1EWZA 3BLSA 5EPHA 2ZLYA 2ZC6B 1H8ZA 5A92A 3SS3A 2FFYA 4MEZA 1FCOA 2HDRA 4HBTA 3VP4A 1Q2QA 2WAFA 1YLWA 3BFEA 1K4EA 4GB7A 4Y7PA 4ZJ1A 3PBNA 4ID4A 2CC1A 3BLMA 5CGWA 5DF7A 3ZNYA 3Q7ZA 1GHIA 4OPYA 4GDBA 3MBZA 4B4ZA 1JWZA 3WS0A 5FQJA 5FQQA 4HESA 1ESIA 1CI8A 2DNSA 1PWDA 1FCMA 2ZC7A 2BLSA 4KZ7A 4E3MA 4GD8A 5FAOA 4OPRA 4DXBA 4QU3A 3RXWA 3W4QA 2Y4AA 1MKIA 1NY0A 3PTEA 4JF4A 3ITAA 3CJMA 1YQSA 3PAEA 4JF6A 1DJAA 1E3UA 3LCEA 1BT5A 5AQBA 2WYXA 4X69A 4CPKA 1CEGA 2ZQ8A 3NY4A 4LENA 5G18A 4UA9A 2WK0A 1S6RA 4S2NC 2WKEA 5CRFA 1ES2A 4LV2A 4Y0OA 1IYSA 2XGNA 5CHUA 1XGIA 4QD4A 4WM9A 4XUZA 5CTNA 4S2OA 5FI7A 3ZDJA 1WYCA 4A5RA 3MKEA 3IXDA 5DF8A 1W5DA 4IVIA 5GLCA 1YLYA 4PMAA 1O7EA 3G34A 3SOIA 3NBLA 5GHXA 4KQRA 1Q2PA 1QMFA 1FSWA 3S22A 5FA7A 4S2JA 5FDHA 3VP3A 1MWSA 1Y54A 1EI5A 5EECA 3ISGA 3SH7A 1K56A 2XQZA 3IHAA 1E25A 1DJCA 4PM7A 3E2KA 4JXVA 4KZBA 1IYOA 4XXRA 4UAAA 2WGIA 2XF3A 1JTGA 4QY6A 3V3SA 3WRTA 3IT9A 3A3FA 3S4XA 4OP5A 2EX6A 1GCEA 3LY4A 4Y0TA 1XA7A 5GHYA 3BECA 4KENB 5A90A 1PYYA 4S2MA 3D4FA 1YMXA 1BLPA 1BLSA 2OLVA 3QNCA 2ZQ9A 4GDNA 2Y2OA 3TOIA 1IKIA 4WZ4A 3ZVWA 3Q1FA 3VFHA 1ERMA 5DTKA 5DF9A 3HLBA 1FR1A 2XFSA 2XDMA 3V5MA 4BQMA 1IEMA 2A49A 3ZFZA 3GQZA 2Y2MA 1ZG4A 3DW0A 3BFGA 3OCNA 4OOYA 1ZC2A 5FI6A 3ZG7B 2WGVA 3C4PA 2WGWA 3N8SA 3GTCA 1K6RA 3IHBA 3IF6B 4WMCD 1WE4A 5TGFA 3VP2A 5AQAA 2ZC5B 3UN7A 3NIAA 3FKWA 1IYPA 3UDIA 4DF6A 4OP8A 3IWIA 3M6HA 3B3XA 4K0WA 1AXBA 2DRWA 3PAGA 5GHZA 4KQOA 4Y0UA 1DY6A 1BLCA 2HP9A 1KVLA 3FYZA 4FSFA 1GHMA 1OMEA 3DWKA 3BFDA 4PM9A 1G68A 4KG5A 3A3DA 4MBKA 4PM5A 5E2GA 2ZJ9A 3GV9A 4D2OA 4LV1A 4OOMA 5A91A 1N4OA 4R4SA 4BL2A 3NC8A 4QJGA 1ES4A 4RYEA 3ZHHA 1BLHA 3Q81A 4R23A 4DDSA 1K55A 2EX9A 5E2HA 3SS4A 1FCNA 2JCHA 5FAQA 1K54C 1TDGA 3C4OA 1BZAA 1K55C 4P0MA 4E3KA 4ZBEA 3P98A 4P87A 4FCFA 1RP5A 1RGZA 2C5WB 3Q07A 5CHMA 4Q8IA 3UE0A 2Y2KA 5CERA 3QNBA 1TDLA 2Y2QA 2WZXA 1KGGA 1YT4A 1YLPA 1WYBA 1QMEA 2QMIA 4RX3A 1KE0A 2QZ6A 4ZAMA 4BLMA 3GVBA 5EE8A 5EVIB 1FSYA 3HLGA 3ITBA 2EX8A 1BTLA 3M2KA 1XPBA 1H5XA 2H0YA 4ZJ3A 2XH9A 3N8LA 2PBYA 5KSHA 1NZOA 1K57C 1LI9A 4OQ0A 3VP1A 3HLEA 3G2ZA 1JVJA 3BM6A 4E3JA 3IH8A 3NI9A 3SS5A 4GD6A 4DE1A 4S2LA 2ZQCA 1MY8A 2R9WA 3G35A 1YLZA 1VM1A 5CXWA 3MZEA 2VGKA 4BENA 1ALQA 1VQQA 3AGFA 4MBFA 2IWDA 3UE1A 3AGEA 4WMCA 3ZG0A 2UWXA 5AQ9A 3RXXA 3UDXA 3C7UA 1ZG6A 3IXHA 1S0WA 4M3KA 2OV5A 4N9LA 2J8YA 4N1HA 2Y2NA 1SKFA 2XLNA 3P09A 2ZQ7A 2Q9MA 1YM1A 4KG2A 2ZC3B 5EOOA 4S2NA 5HW3A 4QY5A 4R3BA 4JKTA 2Y2PA 3TG9A 3FKVA 2GDNA 3WS4A 4R1GA 1RGYA 3FWLA 4PM8A 4P6BA 4E3IA 4YINA 2X71A 1NZUA 3FV7A 5KMWA 1L0DA 2EXBA 3MXSA 4OOLA 4NK3A 2HPBA 3UO9A 4BD0A 4IEDA 3ZNTA 3ZG5A 3LY3A 2EFXA 3IF5A 2J9OA 3BYDA 3ZCZA 2QPNA 5HARA 4O7DA 3HLCA 3ZG9B 4OLDA 4OQIA 3HUOA 4C6YA 4E6WA 5A93A 4LCLA 5CEBA 3MFDA 3A3EA 2H5SA 2Y91A 5M19A 3CZDA 1W8YA 2XK1A 3WWXA 1K4FA 2Y2GA 4MBHA 3CG5A 1GHPA 3FZCA 5M18A 2HP6A 2P9VA 3N6IA 3HLDA 2Y59A 2Z2MB 1I5QA 4EWFA 3W4PA 1C3BA 2XFTA 5F83A 2HDSA 3A3JA 5FAPA 3AGDA 4OONA 3GRJA 4B88A 5E43A 1PI5A 1RCJA 1XGJA 4GKUA 4C3QA 4E3OA 4E6XA 2XD5A 3BFFA 3E2LA 3V50A 3MKFA 3G31A 1NJ4A 3GR2A 3MZDA 4PM6A 4DDYA 5FSRA 4N1XA 4OKPA 2XR0A 1DJBA 2J9PA 4KZ5A 2V2FF 1SHVA 5TFQA 3OPLA 4X53A 3IWQA 3VSLA 4OQGA 2OLUA 2WGWB 4WZ5A 4X6TA 5I94A 1SDEA 4R3JA 4E3LA 5GLAA 4WZ5C 3OCLA 4BD1A 1SDNA 2C6WB 3G32A 3PBRA 5EUAA 4DE3A 1L0GA 1FQGA 3ZVTA 1SCWA 4KZAA 4DE2A 4LV0A 2WUQA 1JWPA 4K0XA 1I2SA 1H8YA 2VGJA 2I72A 4QHCA 1MWUA 3OPHA 4KG6A 1LI0A 2HDUA 3IXGA 3PBQA 3Q7VB 1K54A 4DKIA 3HUNA 4KZ9A 3MXRA 4OPQA 4S2PA 4U0XA 5FQ9A 4EQIA 3OC2A 4JXSA 2Y2LA 3MZFA 5DVAA 4Z9QA 3V39A 4IBXA 3VFFA 2J7VA 2A3UA 3UPOA 4GNUA 5CHJA 4N9KA 4ZTKA 3W4OA 2ZM0A 1N9BA 4FH2A 5CECA 4GN2A 1JWVA 2WKHA 3OPPA 1MWTA 1PWCA 1W79A 5AQ7A 2ZC4B 2ZM8A 3NCKA 3VOYA 1PI4A 2ZM2A 3G4PA 4DXCA 4MLLA 4YFMA 4JBFA 1KDWA 1I2WA 3A3IA 1FR6A 3GMWA 4KZ3A 1K57A 4L0LA 1LL9A 5GL9A 1GA0A 1G6AA 3BRMA 1YLJA 2EXAA 4R4RA 2RL3A 1K25A 4WEJA 3VSKA 3WS1A 1ES5A 3HL9A 2ZQDA 2Y2HA 3DWZA 1KVMA 1MBLA 5FQKA 3HLFA 1PZOA 1KGFA 3HUMA
chains in the Genus database with same CATH superfamily
5EVIC 3QP5A 5HAQA 4X55A 3HJKA 3IQAA 2O9CA 3I7JA 4NXGA 3SH8A 3M2JA 4NXEA 1XA1A 4S2IA 1YLTA 2Y8HA 4CJNA 2QHKA 2Y55A 4I39A 4JLFA 1S4SA 3RJUA 5FQIA 4IUKA 2PYPA 1PZPA 2XRNA 4X68A 3DTKA 4HIAA 4B4XA 1NXYA 4F94A 3LEZA 1K6SA 1PIOA 2V8CA 4ZDXA 3PBOA 1HD8A 4HEFA 1PWGA 3BQAA 2EA9A 3EQVA 3NOTC 3KO6A 4Z1WA 4EV4A 1L0FA 4WYYA 5TBMB 1XX2A 3G2YA 3T50A 3UPNA 5J8XA 3D9YA 2O99A 3N8RA 1P9WA 2WADA 3EQUA 4GJ4A 3M6BA 2ZD8A 2PR6A 4KZ4A 5L8MA 4IHQA 2CMNA 1K38A 5DJTA 1IYQA 3IF6C 4EEUA 1KGEA 1Z6FA 4OPZA 4CLCB 3VP0A 1KE3A 3TSGA 1MZUA 2JN7A 3Q7VA 4WBGA 2PAVP 3UY6A 1YKDA 1OPXA 4S2KA 2ZQAA 2X01A 3WRZA 2BG1A 1BULA 1K0KA 4R0QA 5CGXA 1CI9A 3UDFA 5F1FA 1CEFA 2G2WA 5EV0A 2J3TD 4XUXA 5J7EA 4WELA 1M6KA 4JPMA 1EWZA 4DJ3A 5A92A 3SS3A 5L09A 4HBTA 3KYZA 2V8FA 4M4XA 1ESIA 1PWDA 2Y4AA 1YQSA 1E3UA 4JGRA 2ZQ8A 1VHMA 2WK0A 1S6RA 3DTIA 1ES2A 4LV2A 1LSWA 1XGIA 4XUZA 4WM9A 1W5DA 1DP9A 3G34A 3NBLA 5GHXA 1P9RA 4KQRA 1BYWA 2W1RA 5G4ZA 1MWSA 3FG8A 3SH7A 2XQZA 4PM7A 4JXVA 4HJ3A 3H82A 4QY6A 3IT9A 4D60A 4OP5A 1GCEA 4X1LA 3EEAA 1BLSA 2OLVA 3QNCA 1W63M 3CUEA 4BQMA 2XFSA 1NLYA 2M7VA 3JVUA 3ZG7B 5F6AA 3GTCA 5AQAA 3FKWA 3T4JA 4OP8A 3H7WA 2DRWA 3PAGA 4KQOA 4Y0UA 1DY6A 5J3WA 3FYZA 3BW6A 3KYEA 3GV9A 4QJGA 1ES4A 4RYEA 3U4LP 1BLHA 1GSWA 1TDGA 1V9ZA 4WLAA 4E3KA 4L9GA 5CHMA 2PBDP 4ARZA 1TDLA 1KGGA 1WYBA 4RX3A 2JKRI 4BLMA 4GS9A 1BTLA 4ZJ3A 2H0YA 3N8LA 2PBYA 3VP1A 3G2ZA 1JVJA 4DE1A 5IU1A 1YLZA 1LSXA 4Y3IA 3MZEA 2VGKA 4F3LA 1J3WA 4WF0A 4MBFA 5AQ9A 3RXXA 3UDXA 3IXHA 4M3KA 2J8YA 1SKFA 3LR5A 1XJ6A 2ZC3B 3R7WB 3NULA 3FWLA 4P6BA 2QWSA 2X71A 3VE4A 2EXBA 3MSHA 3MXSA 4CLCD 5HPIA 1OT9A 2HJEA 4NKPA 3ZNTA 3LY3A 2J9OA 3CPTB 2VEAA 5HARA 4OLDA 4OQIA 4C6YA 4E6WA 2K31A 3MFDA 3WWXA 2Y2GA 3N6IA 3HLDA 4G3WA 3H82B 4OONA 3GRJA 4Y15A 4B88A 5A8BA 1PI5A 1RCJA 4C3QA 3K3DA 3E2LA 3V50A 3LIDA 3GR2A 5FSRA 2XR0A 1DJBA 3MFXA 2V2FF 1VB6A 4PKYG 1G6OA 5TFQA 4Y13A 2ZMFA 4LRZE 3R4KA 1X0OA 5GLAA 1SDNA 3G32A 1L0GA 3H7WB 4KZAA 4DE2A 2WUQA 4LRYC 1JWPA 1MWUA 3OPHA 4S2PA 3V39A 1KOUA 2Y2LA 4Z9QA 4Q0JA 3VFFA 4IBXA 3MXQA 1N9OA 2WKRA 3KSGA 4FH2A 5CECA 1JWVA 4I3JA 3VOYA 3C38A 3UMEA 3BY8A 1UWPX 4MLLA 1I2WA 1FR6A 2VA0A 4KZ3A 3O5YA 4Q0IA 4ARZB 4O8GA 4O01A 3HL9A 4BBTA 2Y2HA 1SZVA 3HUMA 1VEUA 4UEYA 5KIZA 1XXMA 3VMAA 4GOGA 1IFQA 5D3OA 1ZKJA 3HLWA 3IWOA 3Q82A 3LI8A 3HREA 4F3LB 2Y2IA 3BFCA 4MCWA 3T4TA 2J3WA 1XP4A 4LV3A 1ZTUA 3OZHA 3JYIA 3CMZA 4NG2A 5HL1A 3LIFA 4HBUA 3MJQA 3O3VA 2HF6A 5BOHA 3PXPA 1ES3A 4UA7A 5I5LA 2HDQA 2PR5A 1S66L 1OTDA 2XEPA 3S7QA 3BQ8A 5FI2A 1JNUA 4EBLA 4EEPA 4PPRA 1U60A 4CQHA 4N92A 3B33A 3TJZC 2EFUA 1W8QA 5TR7A 2ZMVA 1JTDA 5FEFA 1HVBA 1CJFA 5HFOA 4EBNA 1BUEA 2X02A 2O0YA 2XA7S 4PKYA 3KX0X 1MPLA 2J3TC 5U47A 1W7FA 3UE3A 3WS2A 3IF6A 3KSFA 1Y4OA 1L0EA 5GLBA 1LLBA 4RX2A 2IWBA 5HD3A 4IVKA 3HBRA 1E3UD 1F9IA 4C75A 1KE4A 1HTZA 2XD1A 5TJJA 2JC7A 2B95A 5F68A 4NXBA 5E2FA 4BJPA 4G3VA 5HZHA 5F82A 2W1TA 2Q9NA 1M40A 1IELA 3RTYA 2WKPA 3F1NA 4G3KA 2NUPC 3L7HA 5HWWA 3GDIA 4X56A 1DP8A 2KDKA 3NDEA 3PHYA 5L10A 1NYYA 3VOLA 3V3RA 5HAIA 1GA9A 2H10A 2R9XA 3NDGA 4HH2A 2GNXA 3QP2A 5EOEA 3BJNA 4OQHA 3S7PA 1VEUB 2ZLYA 2ZC6B 4KUOA 3E4QA 4Q0HA 2FFYA 3MF0A 4MEZA 1Q2QA 3BFEA 3NOUC 3PBNA 2ACGA 3MBZA 1JWZA 3WS0A 5FQQA 4HESA 5AJGA 4KZ7A 2ZC7A 2A2LA 4GD8A 5EM1A 5FAOA 4QU3A 1STZA 3ITAA 1H3QA 1DJAA 3LCEA 4FOFA 2V0WA 2WYXA 4X69A 3NY4A 4PHTA 2ZOHA 5G18A 4UA9A 4S2NC 4QWOA 4Y0OA 1IYSA 4QD4A 3KYQA 5FI7A 4S2OA 4HH3A 4IVIA 3A0SA 4PMAA 3SOIA 1Q2PA 3P01A 5FDHA 1NWZA 1Y54A 1EI5A 1K56A 1S67L 3IHAA 2JKRM 3L9KA 5DFXA 1DJCA 3RFBA 2FH5A 4KZBA 1IYOA 1JTGA 1FIKA 3WRTA 3S4XA 2EX6A 1CF0A 1XA7A 1PYYA 2D02A 4S2MA 4XT2A 3IX4A 2W3EA 1UGUA 2ZQ9A 4GDNA 5DKLA 3IX3A 3ZVWA 3VFHA 1ERMA 5DF9A 3F1OA 4LPZA 2XDMA 1T18A 4MMNA 2A49A 3ZFZA 2W3FA 2Y2MA 3GQZA 1ZG4A 3BFGA 5FI6A 3N8SA 4O0PA 3ICYA 3IF6B 2W3GA 3UN7A 4EXOA 3M6HA 4K0WA 5HWVA 2P7JA 1D06A 1KVLA 4UQIS 3LIAA 2JKFA 4WL9A 2OAP1 5IT5A 1G68A 4KG5A 3A3DA 1VETA 4D2OA 5A91A 1NLZA 4R4SA 3NC8A 1V9YA 1F98A 2AVXA 2VV7A 4CLCC 3SS4A 2JCHA 1K54C 3F1NB 4HJ4A 4P0MA 3P98A 4P87A 1RP5A 2E8JA 2C5WB 1XFNA 4Q8IA 3UE0A 3MR0A 3QNBA 1F5MA 2QZ6A 3GVBA 5EE8A 3ITBA 2EX8A 3M2KA 1H5XA 4LFUA 3FPVA 3ZQ5A 4OQ0A 3BM6A 2ZQCA 3IBJA 2QJ7A 5CXWA 1VQQA 2V1BA 2BASA 2Y79A 4R38A 4WMCA 3ZG0A 2YKFA 1S0WA 4ETZA 2O9BA 3UB8A 3P09A 2LB9A 2Q9MA 2ZQ7A 1YM1A 5EOOA 5HW3A 4IUHA 4WUJA 2Y2PA 3T1QB 2GDNA 2OOLA 4PM8A 3MQQA 4E3IA 4YINA 3A0RA 5KMWA 2BTFP 4OOLA 4IEDA 1G5UA 3IF5A 3BYDA 3UE6A 2R78A 2QPNA 4O7DA 3LEQA 4LLOB 4LCLA 5M19A 2H5SA 2I9VA 4HQAA 4MBHA 2P9VA 2Y59A 4BWIA 5F83A 2Z6CA 2HJ9C 3AGDA 1PNEA 4E3OA 1ODVA 4XT2B 2EWWA 1FILA 1OTEA 3MKFA 3G31A 1NJ4A 1AWIA 3EWKA 4OKPA 3F1OB 4KZ5A 3OPLA 5F69A 2K2NA 4B93A 2QKPA 5L07A 4BD1A 4DE3A 1FQGA 3E4OA 2G7UA 1SCWA 5FEGA 4LV0A 4K0XA 1I2SA 2VGJA 2I72A 1LI0A 3Q7VB 1VETB 4KZ9A 4OPQA 4EQIA 5DVAA 2A3UA 5EFWA 3UPOA 1H8MA 4ZTKA 2Q0OA 3OPPA 1MWTA 5AQ7A 1W79A 1PI4A 2ZM2A 3NOPC 3S7OA 4JBFA 3A3IA 2L1MA 3GMWA 1K57A 4L0LA 1LL9A 2KX6A 1G6AA 3BRMA 3SZTA 2EXAA 3WS1A 2A24A 1ES5A 2ZQDA 1T1AA 1MBLA 3CHWP 3HLFA 1AXBA 1PZOA 4IJGA 4FD8A 4JXWA 1LL5A 2Y2JA 2D01A 1OTAA 4KQQA 3O88A 4BL3A 5GLDA 1E4DA 2WKIA 3GSGA 1NRJA 2IWCA 5FQMA 3ULFA 4K91A 2ZOIA 3UPPA 4DRTA 5DTTA 2PT7A 3BEBA 4YWZA 2DMWA 2JE5A 3VE3A 4NETA 2W3HA 2EX2A 4IBRA 3ZGAB 3F1PA 3CAXA 1ACFA 5J4EA 2PHYA 1KDSA 3A0VA 1FOFA 4JF5A 1CK3A 3PBTA 2PYRA 3ZG8B 2P9VB 1YSQA 2VZWA 1XKZA 3T12B 1EROA 4QPRA 1LHYA 4U0TA 5EVLA 1F2KA 4WEKA 2VGLM 1IKGA 4RA7A 2E8IA 4FH4A 4HJ6A 2W27A 2Z2LB 3RH8B 1N9LA 3P7NA 4I38A 3QHYA 3T4KA 4BBUA 5KZHA 3DBAA 2WZZA 4EUZA 4P85A 3K2NA 3DTMA 5F1GA 3N4IA 2HGVA 2RCXA 1HLUP 1NRFA 3OPRA 4H6JA 2V1ZA 5DKKA 3WS5A 5HX9A 1YMSA 3K3CA 2O9AA 3C5AA 4RVAA 3GECA 3IBRA 3UMDA 1ONGA 4EBPA 4GS9B 2FFFB 4EUVA 4L9FA 1K56D 1J9MA 3N7WA 5KSCA 5EVIA 5JYPA 2A24B 2B5RA 1OJGA 5G4YA 3U2AA 1T1BA 4UHUA 3S1YA 5HPFA 4KZ6A 4R6LA 2HP5A 4GZBA 1HZOA 5EPHA 3BLSA 1FCOA 2HDRA 4Y7PA 5FDSA 5DF7A 5DJUA 1GHIA 4GDBA 2JHEA 1CI8A 4DXBA 3RXWA 3PTEA 2FZ0A 4JF4A 4JF6A 5LBRA 2KLIA 1BT5A 5AQBA 1CEGA 1ZHHB 3B47A 4LENA 3F1PB 4Y17A 2XGNA 3ZDJA 3IX8A 5CTNA 1WYCA 4A5RA 3MKEA 1PFLA 1YAXA 3IXDA 5GLCA 1QMFA 1FSWA 3S22A 4BMWA 5EECA 3ISGA 4R70A 4HOIA 4UAAA 2WGIA 3V3SA 4R3AA 2PD7A 3FPWA 5GHYA 3BECA 4KENB 3E0YA 1OJ5A 3D4FA 2V0UA 2Y2OA 1IKIA 2QYBA 5K5BA 3LR4A 5DTKA 3HLBA 3DW0A 3OCNA 4I3AA 4OOYA 2WGVA 3G6OA 3IHBA 4WMCD 3VP2A 2ZC5B 1IYPA 3UDIA 4DF6A 1MC0A 3QP4A 1BLCA 3VV4A 3SW1A 1T1CA 1EW0A 1GHMA 5AVFA 3DWKA 4PM9A 4MBKA 5E2GA 1OTBA 4LV1A 1N4OA 2VK3A 2QJ5A 4CLCA 4FUWA 4DMZA 4KQDA 5MC7A 3Q81A 4DDSA 2EX9A 1FCNA 3C4OA 1BZAA 4EU0A 1K55C 1RGZA 2K7SA 3Q07A 2Y2KA 5CERA 1YLPA 1KE0A 4JGQA 4ZAMA 5EVIB 1FSYA 1XPBA 4GLQA 2XH9A 5KSHA 3HLEA 3H9WA 2VV8A 3NI9A 4I5SA 4S2LA 1LSVA 3E4PA 3UE1A 2UWXA 1ZG6A 3HJIA 4N9LA 4N1HA 4EETB 2XLNA 2M7UA 4R3BA 1YPRA 4R1GA 2IA2A 4HNBA 3FV7A 4NK3A 4P6ZS 3UO9A 4BD0A 4EW7A 3DTEA 3LIEA 4UQIM 3ZG5A 2EFXA 3LYXA 1OT6A 3ZG9B 3HUOA 5CEBA 3C30A 2Y91A 2XK1A 1K4FA 2VKSA 1GHPA 3FZCA 2HP6A 2W3DA 3W4PA 1GSXA 2XFTA 3A3JA 2B18A 4I3IA 3C8CA 1MKMA 1XGJA 4GKUA 4E6XA 1SKOA 2VX8A 3MZDA 4PM6A 4N1XA 2J9PA 5EM0A 2ZBBA 4Y2FA 4ETXA 3VSLA 3T4QA 4X6TA 4R3JA 4WZ5C 2VV6A 3OCLA 3KSIA 5CX7A 3PBRA 5EUAA 2GZAA 3ZVTA 4ESPA 5AVEA 4HY8A 1W63Q 4KG6A 2HDUA 3IXGA 3PBQA 3UB6A 4DKIA 3HUNA 5FQ9A 3MXRA 2GJ3A 4U0XA 2W1TB 4MN5A 3OC2A 3MZFA 4MDZA 3UB9A 1OTIA 4GNUA 4N9KA 2ZM0A 4GN2A 3OBFA 2WKHA 1PWCA 2GX5A 3G4PA 4YFMA 3QP1A 2W0NA 1S1YA 1GA0A 3QP6A 4GW9A 1D1JA 1YLJA 2RL3A 4WEJA 3TE8A 3VSKA 3ZYTA 3DWZA 5FQKA 4OOMA 1ERQA 2HZ5A 4MN6A 3D72A 4OVDA 1ESUA 2JKTM 1O07A 3VOZA 3NHQA 4LCMA 1MXOA 5CEDA 5DTSA 3EEHA 3C7VA 5FASA 4LRXC 2V1AA 1TEMA 1PW8A 3NJAA 3IXBA 4EESA 1P0ZA 1L2SA 4JXGA 3R7WA 5IHVA 3LICA 2WAEA 1NYMA 1GSVA 2H28A 2UV0E 3O86A 2KOIA 4AFIA 3PR6A 1LT0A 1TS8A 4HI4A 3W8KA 1DP6A 3UB5P 1TVFA 3LR0A 4FTXA 3CPTA 1WA9A 4GHIA 5HDCA 3IH9A 1TF1A 4K08A 2OWHA 1TS7A 2G2UA 2PDRA 4DE0A 3FC7A 2V20A 5EVID 1IOUA 3LFVA 2JKGA 4KZ8A 1MWRA 3UNWA 2LB5A 1SKOB 5CTMA 2PU4A 1S4RA 4QB8A 3EOIA 5E2EA 5C5KA 4OLGA 3G30A 1P97A 1BSGA 2MJ6A 3HVFA 1N9NA 2ZMAA 3T4OA 3LO7A 5L2FA 4UA6A 4MNRA 4U3TA 2DCFA 2P74A 4E3NA 5HSQA 1Z09A 2OAQ1 1S1ZA 2YKHA 1ONHA 3T1RA 3D3OA 2XSSA 2JBFA 5HAPA 2H0TA 2PU2A 3PBSA 4H8RA 3O87A 4ZJ2A 4KUKA 2P08A 1H0MA 2OSUA 5JYOA 3SH9A 1PW1A 4OH0A 3BWLA 1UWNX 5FATA 5CGSA 4B9OA 3T1SA 1H8ZA 3VP4A 2WAFA 1YLWA 4ZJ1A 1K4EA 4GB7A 4ME4A 4ID4A 2CC1A 2HV1A 3BLMA 5CGWA 3ZNYA 3Q7ZA 4OPYA 1D7EA 3NECA 4B4ZA 3MS6A 5FQJA 2DNSA 1A0KA 1FCMA 4E3MA 2BLSA 4OPRA 3W4QA 1MKIA 1NY0A 2EWVA 3CJMA 3PAEA 4YOFA 5F5YA 4CPKA 4Y5FA 3UB7A 2WKEA 5CRFA 1XJ4A 4II7A 5CHUA 3LUQA 3T1XA 5DF8A 1YLYA 1O7EA 3CITA 1CQAA 5FA7A 4GHIB 4S2JA 3VP3A 3LR3A 2PRFA 1E25A 3E2KA 4XXRA 1Y28A 2XF3A 2J80A 3A3FA 2OWJA 3LY4A 4NEED 4Y0TA 5A90A 1YMXA 1BLPA 2JKTI 3EGXC 3TOIA 3TW8A 4JGOA 4WZ4A 2B02A 3Q1FA 5HWTA 1FR1A 3V5MA 1IEMA 4RQ9A 3MMHA 4HHDA 2NUTC 3CUEC 1ZC2A 3C4PA 2WGWA 2Z6DA 1K6RA 2ZL1A 1WE4A 5TGFA 4LGWA 5HDDA 3NIAA 2VJWA 3IWIA 3T4LA 4X25A 3TRCA 5M1AA 3B3XA 5GHZA 2HP9A 4YNRA 1TD5A 4FSFA 1OMEA 3BFDA 4PM5A 2VLGA 2ZJ9A 1XFQA 3IS2A 4BL2A 3LIBA 3ZHHA 5HDSA 4R23A 1K55A 5E2HA 1PRQA 3JVVA 5FAQA 4ZBEA 4FCFA 4L9EA 2Y2QA 2WZXA 1YT4A 2L4RA 2QMIA 1QMEA 1YSPA 3HLGA 4GCZA 3CI6A 3T4SA 1NZOA 1K57C 3QP8A 1LI9A 2VGLS 1T19A 4E3JA 3IH8A 5FL3A 3SS5A 2L0WA 4GD6A 1MY8A 2R9WA 3G35A 1VM1A 1XJ2A 4BENA 1ALQA 3AGFA 2IWDA 2XA7M 4MN7A 3CLOA 4ZRRA 3AGEA 3C7UA 4HP9A 2OV5A 3C2WA 3KSHA 2Y2NA 3CWFA 4KG2A 4S2NA 4QY5A 4JKTA 3TG9A 3FKVA 3WS4A 1RGYA 1NZUA 3EGDC 1TS0A 1L0DA 2HPBA 3ZCZA 3LGOA 3BY9A 3HLCA 2M1CA 4HP4A 5A93A 2XROA 3A3EA 3CZDA 1W8YA 5DFYA 3B42A 4X1MA 3CG5A 3MQ0A 5M18A 1DRMA 3W2ZA 4PAUA 4EWFA 2Z2MB 1I5QA 3JPUA 1C3BA 5HL6A 2V9AA 5TBMA 2HDSA 5FAPA 4EERA 1XJ3A 2P04A 5E43A 2XD5A 4DJ2A 3BFFA 4E04A 3PYPA 3LI9A 2INWA 4DDYA 4JGPA 3E98A 1SHVA 4X53A 3IWQA 4CLCE 4OQGA 2OLUA 2WGWB 4NXFA 4WN5A 4WZ5A 5I94A 2ZL1B 1SDEA 4E3LA 4DN0A 2C6WB 3OLOA 1H8YA 4H6JB 4QHCA 1K54A 5HD5A 4JXSA 1LL8A 4EQ1A 3IS2B 2J7VA 3MQOA 5CHJA 3W4OA 3DAVA 1N9BA 3HCYA 4P6ZM 2ZC4B 2ZM8A 3NCKA 5IS1A 4DXCA 1KDWA 3V67A 2WKQA 5GL9A 5EVEA 4R4RA 1K25A 2PD8A 4BBVA 3S7NA 1KVMA 3OOVA 1G28A 1L3LA 1TS6A 1KGFA
chains in the Genus database with same CATH topology
5EVIC 1ERQA 5M1AA 4FD8A 5HAQA 4JXWA 4OVDA 1LL5A 1ESUA 4X55A 1XXMA 3IQAA 3VMAA 1O07A 2Y2JA 4GOGA 5D3OA 3VOZA 1ZKJA 3HLWA 3IWOA 3Q82A 3I7JA 3HREA 3M2JA 4KQQA 3SH8A 4LCMA 2Y2IA 3O88A 4BL3A 1XA1A 1MXOA 4S2IA 5CEDA 5DTSA 1E4DA 3C7VA 3BFCA 2WKIA 1YLTA 3GSGA 5GLDA 2IWCA 4CJNA 5FQMA 2Y55A 4K91A 5FASA 3UPPA 1XP4A 4DRTA 4LV3A 5DTTA 4JLFA 3BEBA 3RJUA 1TEMA 5FQIA 1PW8A 3OZHA 3IXBA 3JYIA 2JE5A 1PZPA 3CMZA 4X68A 5HL1A 4NETA 1L2SA 4HBUA 4JXGA 5IHVA 2EX2A 2WAEA 3O3VA 1NYMA 4IBRA 3ZGAB 4B4XA 3O86A 5BOHA 1NXYA 4F94A 1ES3A 4UA7A 3LEZA 1K6SA 2HDQA 3W8KA 1PIOA 2XEPA 1KDSA 1TVFA 1FOFA 4JF5A 4ZDXA 3PBOA 5FI2A 1HD8A 4HEFA 1PWGA 1CK3A 3IH9A 4EBLA 3PBTA 3EQVA 2G2UA 4PPRA 1U60A 4DE0A 4N92A 3ZG8B 2P9VB 2V20A 2EFUA 1XKZA 5EVID 1W8QA 4EV4A 1EROA 5TR7A 1L0FA 4WYYA 1LHYA 1XX2A 3G2YA 4U0TA 3UPNA 5J8XA 5EVLA 4KZ8A 1JTDA 4WEKA 1HVBA 3N8RA 1IKGA 1MWRA 4RA7A 2WADA 5HFOA 2E8IA 4EBNA 3EQUA 3UNWA 1BUEA 3M6BA 2X02A 2ZD8A 5CTMA 4KZ4A 2PU4A 4FH4A 1MPLA 2Z2LB 5U47A 1W7FA 4QB8A 1K38A 3QHYA 3UE3A 5E2EA 1IYQA 5KZHA 3WS2A 3IF6A 4OLGA 2WZZA 3G30A 4EUZA 1L0EA 3IF6C 1BSGA 5GLBA 1LLBA 4P85A 4RX2A 3HVFA 2ZMAA 3DTMA 3LO7A 2IWBA 5L2FA 4UA6A 5F1GA 1KGEA 4MNRA 4IVKA 3N4IA 1Z6FA 3HBRA 2DCFA 4U3TA 2RCXA 2P74A 1E3UD 4C75A 4E3NA 4OPZA 1KE4A 1NRFA 1HTZA 2XD1A 3OPRA 3VP0A 1KE3A 2V1ZA 2JC7A 3TSGA 3WS5A 1ONHA 5HX9A 5E2FA 4BJPA 3Q7VA 4WBGA 5F82A 1YMSA 2Q9NA 1M40A 2JBFA 5HAPA 1IELA 2H0TA 2PU2A 3C5AA 3PBSA 3UY6A 4RVAA 4X56A 3NDEA 4H8RA 3O87A 4S2KA 1ONGA 1NYYA 2ZQAA 2X01A 4EBPA 4ZJ2A 3V3RA 5HAIA 2FFFB 3WRZA 2BG1A 1K56D 1J9MA 2OSUA 3N7WA 1GA9A 5JYOA 5KSCA 3SH9A 1BULA 5EVIA 4R0QA 1PW1A 1CI9A 5CGXA 2H10A 3UDFA 4OH0A 5F1FA 5JYPA 2R9XA 1CEFA 2B5RA 3NDGA 2G2WA 4UHUA 3S1YA 4KZ6A 5EOEA 5FATA 5CGSA 4OQHA 4XUXA 4WELA 2HP5A 4GZBA 1HZOA 1M6KA 4JPMA 1EWZA 3BLSA 5EPHA 2ZLYA 2ZC6B 1H8ZA 5A92A 3SS3A 2FFYA 4MEZA 1FCOA 2HDRA 4HBTA 3VP4A 1Q2QA 2WAFA 1YLWA 3BFEA 1K4EA 4GB7A 4Y7PA 4ZJ1A 3PBNA 4ID4A 2CC1A 3BLMA 5CGWA 5DF7A 3ZNYA 3Q7ZA 1GHIA 4OPYA 4GDBA 3MBZA 4B4ZA 1JWZA 3WS0A 5FQJA 5FQQA 4HESA 1ESIA 1CI8A 2DNSA 1PWDA 1FCMA 2ZC7A 2BLSA 4KZ7A 4E3MA 4GD8A 5FAOA 4OPRA 4DXBA 4QU3A 3RXWA 3W4QA 2Y4AA 1MKIA 1NY0A 3PTEA 4JF4A 3ITAA 3CJMA 1YQSA 3PAEA 4JF6A 1DJAA 1E3UA 3LCEA 1BT5A 5AQBA 2WYXA 4X69A 4CPKA 1CEGA 2ZQ8A 3NY4A 4LENA 5G18A 4UA9A 2WK0A 1S6RA 4S2NC 2WKEA 5CRFA 1ES2A 4LV2A 4Y0OA 1IYSA 2XGNA 5CHUA 1XGIA 4QD4A 4WM9A 4XUZA 5CTNA 4S2OA 5FI7A 3ZDJA 1WYCA 4A5RA 3MKEA 3IXDA 5DF8A 1W5DA 4IVIA 5GLCA 1YLYA 4PMAA 1O7EA 3G34A 3SOIA 3NBLA 5GHXA 4KQRA 1Q2PA 1QMFA 1FSWA 3S22A 5FA7A 4S2JA 5FDHA 3VP3A 1MWSA 1Y54A 1EI5A 5EECA 3ISGA 3SH7A 1K56A 2XQZA 3IHAA 1E25A 1DJCA 4PM7A 3E2KA 4JXVA 4KZBA 1IYOA 4XXRA 4UAAA 2WGIA 2XF3A 1JTGA 4QY6A 3V3SA 3WRTA 3IT9A 3A3FA 3S4XA 4OP5A 2EX6A 1GCEA 3LY4A 4Y0TA 1XA7A 5GHYA 3BECA 4KENB 5A90A 1PYYA 4S2MA 3D4FA 1YMXA 1BLPA 1BLSA 2OLVA 3QNCA 2ZQ9A 4GDNA 2Y2OA 3TOIA 1IKIA 4WZ4A 3ZVWA 3Q1FA 3VFHA 1ERMA 5DTKA 5DF9A 3HLBA 1FR1A 2XFSA 2XDMA 3V5MA 4BQMA 1IEMA 2A49A 3ZFZA 3GQZA 2Y2MA 1ZG4A 3DW0A 3BFGA 3OCNA 4OOYA 1ZC2A 5FI6A 3ZG7B 2WGVA 3C4PA 2WGWA 3N8SA 3GTCA 1K6RA 3IHBA 3IF6B 4WMCD 1WE4A 5TGFA 3VP2A 5AQAA 2ZC5B 3UN7A 3NIAA 3FKWA 1IYPA 3UDIA 4DF6A 4OP8A 3IWIA 3M6HA 3B3XA 4K0WA 1AXBA 2DRWA 3PAGA 5GHZA 4KQOA 4Y0UA 1DY6A 1BLCA 2HP9A 1KVLA 3FYZA 4FSFA 1GHMA 1OMEA 3DWKA 3BFDA 4PM9A 1G68A 4KG5A 3A3DA 4MBKA 4PM5A 5E2GA 2ZJ9A 3GV9A 4D2OA 4LV1A 4OOMA 5A91A 1N4OA 4R4SA 4BL2A 3NC8A 4QJGA 1ES4A 4RYEA 3ZHHA 1BLHA 3Q81A 4R23A 4DDSA 1K55A 2EX9A 5E2HA 3SS4A 1FCNA 2JCHA 5FAQA 1K54C 1TDGA 3C4OA 1BZAA 1K55C 4P0MA 4E3KA 4ZBEA 3P98A 4P87A 4FCFA 1RP5A 1RGZA 2C5WB 3Q07A 5CHMA 4Q8IA 3UE0A 2Y2KA 5CERA 3QNBA 1TDLA 2Y2QA 2WZXA 1KGGA 1YT4A 1YLPA 1WYBA 1QMEA 2QMIA 4RX3A 1KE0A 2QZ6A 4ZAMA 4BLMA 3GVBA 5EE8A 5EVIB 1FSYA 3HLGA 3ITBA 2EX8A 1BTLA 3M2KA 1XPBA 1H5XA 2H0YA 4ZJ3A 2XH9A 3N8LA 2PBYA 5KSHA 1NZOA 1K57C 1LI9A 4OQ0A 3VP1A 3HLEA 3G2ZA 1JVJA 3BM6A 4E3JA 3IH8A 3NI9A 3SS5A 4GD6A 4DE1A 4S2LA 2ZQCA 1MY8A 2R9WA 3G35A 1YLZA 1VM1A 5CXWA 3MZEA 2VGKA 4BENA 1ALQA 1VQQA 3AGFA 4MBFA 2IWDA 3UE1A 3AGEA 4WMCA 3ZG0A 2UWXA 5AQ9A 3RXXA 3UDXA 3C7UA 1ZG6A 3IXHA 1S0WA 4M3KA 2OV5A 4N9LA 2J8YA 4N1HA 2Y2NA 1SKFA 2XLNA 3P09A 2ZQ7A 2Q9MA 1YM1A 4KG2A 2ZC3B 5EOOA 4S2NA 5HW3A 4QY5A 4R3BA 4JKTA 2Y2PA 3TG9A 3FKVA 2GDNA 3WS4A 4R1GA 1RGYA 3FWLA 4PM8A 4P6BA 4E3IA 4YINA 2X71A 1NZUA 3FV7A 5KMWA 1L0DA 2EXBA 3MXSA 4OOLA 4NK3A 2HPBA 3UO9A 4BD0A 4IEDA 3ZNTA 3ZG5A 3LY3A 2EFXA 3IF5A 2J9OA 3BYDA 3ZCZA 2QPNA 5HARA 4O7DA 3HLCA 3ZG9B 4OLDA 4OQIA 3HUOA 4C6YA 4E6WA 5A93A 4LCLA 5CEBA 3MFDA 3A3EA 2H5SA 2Y91A 5M19A 3CZDA 1W8YA 2XK1A 3WWXA 1K4FA 2Y2GA 4MBHA 3CG5A 1GHPA 3FZCA 5M18A 2HP6A 2P9VA 3N6IA 3HLDA 2Y59A 2Z2MB 1I5QA 4EWFA 3W4PA 1C3BA 2XFTA 5F83A 2HDSA 3A3JA 5FAPA 3AGDA 4OONA 3GRJA 4B88A 5E43A 1PI5A 1RCJA 1XGJA 4GKUA 4C3QA 4E3OA 4E6XA 2XD5A 3BFFA 3E2LA 3V50A 3MKFA 3G31A 1NJ4A 3GR2A 3MZDA 4PM6A 4DDYA 5FSRA 4N1XA 4OKPA 2XR0A 1DJBA 2J9PA 4KZ5A 2V2FF 1SHVA 5TFQA 3OPLA 4X53A 3IWQA 3VSLA 4OQGA 2OLUA 2WGWB 4WZ5A 4X6TA 5I94A 1SDEA 4R3JA 4E3LA 5GLAA 4WZ5C 3OCLA 4BD1A 1SDNA 2C6WB 3G32A 3PBRA 5EUAA 4DE3A 1L0GA 1FQGA 3ZVTA 1SCWA 4KZAA 4DE2A 4LV0A 2WUQA 1JWPA 4K0XA 1I2SA 1H8YA 2VGJA 2I72A 4QHCA 1MWUA 3OPHA 4KG6A 1LI0A 2HDUA 3IXGA 3PBQA 3Q7VB 1K54A 4DKIA 3HUNA 4KZ9A 3MXRA 4OPQA 4S2PA 4U0XA 5FQ9A 4EQIA 3OC2A 4JXSA 2Y2LA 3MZFA 5DVAA 4Z9QA 3V39A 4IBXA 3VFFA 2J7VA 2A3UA 3UPOA 4GNUA 5CHJA 4N9KA 4ZTKA 3W4OA 2ZM0A 1N9BA 4FH2A 5CECA 4GN2A 1JWVA 2WKHA 3OPPA 1MWTA 1PWCA 1W79A 5AQ7A 2ZC4B 2ZM8A 3NCKA 3VOYA 1PI4A 2ZM2A 3G4PA 4DXCA 4MLLA 4YFMA 4JBFA 1KDWA 1I2WA 3A3IA 1FR6A 3GMWA 4KZ3A 1K57A 4L0LA 1LL9A 5GL9A 1GA0A 1G6AA 3BRMA 1YLJA 2EXAA 4R4RA 2RL3A 1K25A 4WEJA 3VSKA 3WS1A 1ES5A 3HL9A 2ZQDA 2Y2HA 3DWZA 1KVMA 1MBLA 5FQKA 3HLFA 1PZOA 1KGFA 3HUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EVI C;  1ERQ A;  5M1A A;  4FD8 A;  5HAQ A;  4JXW A;  4OVD A;  1LL5 A;  1ESU A;  4X55 A;  1XXM A;  3IQA A;  3VMA A;  1O07 A;  2Y2J A;  4GOG A;  5D3O A;  3VOZ A;  1ZKJ A;  3HLW A;  3IWO A;  3Q82 A;  3I7J A;  3HRE A;  3M2J A;  4KQQ A;  3SH8 A;  4LCM A;  2Y2I A;  3O88 A;  4BL3 A;  1XA1 A;  1MXO A;  4S2I A;  5CED A;  5DTS A;  1E4D A;  3C7V A;  3BFC A;  2WKI A;  1YLT A;  3GSG A;  5GLD A;  2IWC A;  4CJN A;  5FQM A;  2Y55 A;  4K91 A;  5FAS A;  3UPP A;  1XP4 A;  4DRT A;  4LV3 A;  5DTT A;  4JLF A;  3BEB A;  3RJU A;  1TEM A;  5FQI A;  1PW8 A;  3OZH A;  3IXB A;  3JYI A;  2JE5 A;  1PZP A;  3CMZ A;  4X68 A;  5HL1 A;  4NET A;  1L2S A;  4HBU A;  4JXG A;  5IHV A;  2EX2 A;  2WAE A;  3O3V A;  1NYM A;  4IBR A;  3ZGA B;  4B4X A;  3O86 A;  5BOH A;  1NXY A;  4F94 A;  1ES3 A;  4UA7 A;  3LEZ A;  1K6S A;  2HDQ A;  3W8K A;  1PIO A;  2XEP A;  1KDS A;  1TVF A;  1FOF A;  4JF5 A;  4ZDX A;  3PBO A;  5FI2 A;  1HD8 A;  4HEF A;  1PWG A;  1CK3 A;  3IH9 A;  4EBL A;  3PBT A;  3EQV A;  2G2U A;  4PPR A;  1U60 A;  4DE0 A;  4N92 A;  3ZG8 B;  2P9V B;  2V20 A;  2EFU A;  1XKZ A;  5EVI D;  1W8Q A;  4EV4 A;  1ERO A;  5TR7 A;  1L0F A;  4WYY A;  1LHY A;  1XX2 A;  3G2Y A;  4U0T A;  3UPN A;  5J8X A;  5EVL A;  4KZ8 A;  1JTD A;  4WEK A;  1HVB A;  3N8R A;  1IKG A;  1MWR A;  4RA7 A;  2WAD A;  5HFO A;  2E8I A;  4EBN A;  3EQU A;  3UNW A;  1BUE A;  3M6B A;  2X02 A;  2ZD8 A;  5CTM A;  4KZ4 A;  2PU4 A;  4FH4 A;  1MPL A;  2Z2L B;  5U47 A;  1W7F A;  4QB8 A;  1K38 A;  3QHY A;  3UE3 A;  5E2E A;  1IYQ A;  5KZH A;  3WS2 A;  3IF6 A;  4OLG A;  2WZZ A;  3G30 A;  4EUZ A;  1L0E A;  3IF6 C;  1BSG A;  5GLB A;  1LLB A;  4P85 A;  4RX2 A;  3HVF A;  2ZMA A;  3DTM A;  3LO7 A;  2IWB A;  5L2F A;  4UA6 A;  5F1G A;  1KGE A;  4MNR A;  4IVK A;  3N4I A;  1Z6F A;  3HBR A;  2DCF A;  4U3T A;  2RCX A;  2P74 A;  1E3U D;  4C75 A;  4E3N A;  4OPZ A;  1KE4 A;  1NRF A;  1HTZ A;  2XD1 A;  3OPR A;  3VP0 A;  1KE3 A;  2V1Z A;  2JC7 A;  3TSG A;  3WS5 A;  1ONH A;  5HX9 A;  5E2F A;  4BJP A;  3Q7V A;  4WBG A;  5F82 A;  1YMS A;  2Q9N A;  1M40 A;  2JBF A;  5HAP A;  1IEL A;  2H0T A;  2PU2 A;  3C5A A;  3PBS A;  3UY6 A;  4RVA A;  4X56 A;  3NDE A;  4H8R A;  3O87 A;  4S2K A;  1ONG A;  1NYY A;  2ZQA A;  2X01 A;  4EBP A;  4ZJ2 A;  3V3R A;  5HAI A;  2FFF B;  3WRZ A;  2BG1 A;  1K56 D;  1J9M A;  2OSU A;  3N7W A;  1GA9 A;  5JYO A;  5KSC A;  3SH9 A;  1BUL A;  5EVI A;  4R0Q A;  1PW1 A;  1CI9 A;  5CGX A;  2H10 A;  3UDF A;  4OH0 A;  5F1F A;  5JYP A;  2R9X A;  1CEF A;  2B5R A;  3NDG A;  2G2W A;  4UHU A;  3S1Y A;  4KZ6 A;  5EOE A;  5FAT A;  5CGS A;  4OQH A;  4XUX A;  4WEL A;  2HP5 A;  4GZB A;  1HZO A;  1M6K A;  4JPM A;  1EWZ A;  3BLS A;  5EPH A;  2ZLY A;  2ZC6 B;  1H8Z A;  5A92 A;  3SS3 A;  2FFY A;  4MEZ A;  1FCO A;  2HDR A;  4HBT A;  3VP4 A;  1Q2Q A;  2WAF A;  1YLW A;  3BFE A;  1K4E A;  4GB7 A;  4Y7P A;  4ZJ1 A;  3PBN A;  4ID4 A;  2CC1 A;  3BLM A;  5CGW A;  5DF7 A;  3ZNY A;  3Q7Z A;  1GHI A;  4OPY A;  4GDB A;  3MBZ A;  4B4Z A;  1JWZ A;  3WS0 A;  5FQJ A;  5FQQ A;  4HES A;  1ESI A;  1CI8 A;  2DNS A;  1PWD A;  1FCM A;  2ZC7 A;  2BLS A;  4KZ7 A;  4E3M A;  4GD8 A;  5FAO A;  4OPR A;  4DXB A;  4QU3 A;  3RXW A;  3W4Q A;  2Y4A A;  1MKI A;  1NY0 A;  3PTE A;  4JF4 A;  3ITA A;  3CJM A;  1YQS A;  3PAE A;  4JF6 A;  1DJA A;  1E3U A;  3LCE A;  1BT5 A;  5AQB A;  2WYX A;  4X69 A;  4CPK A;  1CEG A;  2ZQ8 A;  3NY4 A;  4LEN A;  5G18 A;  4UA9 A;  2WK0 A;  1S6R A;  4S2N C;  2WKE A;  5CRF A;  1ES2 A;  4LV2 A;  4Y0O A;  1IYS A;  2XGN A;  5CHU A;  1XGI A;  4QD4 A;  4WM9 A;  4XUZ A;  5CTN A;  4S2O A;  5FI7 A;  3ZDJ A;  1WYC A;  4A5R A;  3MKE A;  3IXD A;  5DF8 A;  1W5D A;  4IVI A;  5GLC A;  1YLY A;  4PMA A;  1O7E A;  3G34 A;  3SOI A;  3NBL A;  5GHX A;  4KQR A;  1Q2P A;  1QMF A;  1FSW A;  3S22 A;  5FA7 A;  4S2J A;  5FDH A;  3VP3 A;  1MWS A;  1Y54 A;  1EI5 A;  5EEC A;  3ISG A;  3SH7 A;  1K56 A;  2XQZ A;  3IHA A;  1E25 A;  1DJC A;  4PM7 A;  3E2K A;  4JXV A;  4KZB A;  1IYO A;  4XXR A;  4UAA A;  2WGI A;  2XF3 A;  1JTG A;  4QY6 A;  3V3S A;  3WRT A;  3IT9 A;  3A3F A;  3S4X A;  4OP5 A;  2EX6 A;  1GCE A;  3LY4 A;  4Y0T A;  1XA7 A;  5GHY A;  3BEC A;  4KEN B;  5A90 A;  1PYY A;  4S2M A;  3D4F A;  1YMX A;  1BLP A;  1BLS A;  2OLV A;  3QNC A;  2ZQ9 A;  4GDN A;  2Y2O A;  3TOI A;  1IKI A;  4WZ4 A;  3ZVW A;  3Q1F A;  3VFH A;  1ERM A;  5DTK A;  5DF9 A;  3HLB A;  1FR1 A;  2XFS A;  2XDM A;  3V5M A;  4BQM A;  1IEM A;  2A49 A;  3ZFZ A;  3GQZ A;  2Y2M A;  1ZG4 A;  3DW0 A;  3BFG A;  3OCN A;  4OOY A;  1ZC2 A;  5FI6 A;  3ZG7 B;  2WGV A;  3C4P A;  2WGW A;  3N8S A;  3GTC A;  1K6R A;  3IHB A;  3IF6 B;  4WMC D;  1WE4 A;  5TGF A;  3VP2 A;  5AQA A;  2ZC5 B;  3UN7 A;  3NIA A;  3FKW A;  1IYP A;  3UDI A;  4DF6 A;  4OP8 A;  3IWI A;  3M6H A;  3B3X A;  4K0W A;  1AXB A;  2DRW A;  3PAG A;  5GHZ A;  4KQO A;  4Y0U A;  1DY6 A;  1BLC A;  2HP9 A;  1KVL A;  3FYZ A;  4FSF A;  1GHM A;  1OME A;  3DWK A;  3BFD A;  4PM9 A;  1G68 A;  4KG5 A;  3A3D A;  4MBK A;  4PM5 A;  5E2G A;  2ZJ9 A;  3GV9 A;  4D2O A;  4LV1 A;  4OOM A;  5A91 A;  1N4O A;  4R4S A;  4BL2 A;  3NC8 A;  4QJG A;  1ES4 A;  4RYE A;  3ZHH A;  1BLH A;  3Q81 A;  4R23 A;  4DDS A;  1K55 A;  2EX9 A;  5E2H A;  3SS4 A;  1FCN A;  2JCH A;  5FAQ A;  1K54 C;  1TDG A;  3C4O A;  1BZA A;  1K55 C;  4P0M A;  4E3K A;  4ZBE A;  3P98 A;  4P87 A;  4FCF A;  1RP5 A;  1RGZ A;  2C5W B;  3Q07 A;  5CHM A;  4Q8I A;  3UE0 A;  2Y2K A;  5CER A;  3QNB A;  1TDL A;  2Y2Q A;  2WZX A;  1KGG A;  1YT4 A;  1YLP A;  1WYB A;  1QME A;  2QMI A;  4RX3 A;  1KE0 A;  2QZ6 A;  4ZAM A;  4BLM A;  3GVB A;  5EE8 A;  5EVI B;  1FSY A;  3HLG A;  3ITB A;  2EX8 A;  1BTL A;  3M2K A;  1XPB A;  1H5X A;  2H0Y A;  4ZJ3 A;  2XH9 A;  3N8L A;  2PBY A;  5KSH A;  1NZO A;  1K57 C;  1LI9 A;  4OQ0 A;  3VP1 A;  3HLE A;  3G2Z A;  1JVJ A;  3BM6 A;  4E3J A;  3IH8 A;  3NI9 A;  3SS5 A;  4GD6 A;  4DE1 A;  4S2L A;  2ZQC A;  1MY8 A;  2R9W A;  3G35 A;  1YLZ A;  1VM1 A;  5CXW A;  3MZE A;  2VGK A;  4BEN A;  1ALQ A;  1VQQ A;  3AGF A;  4MBF A;  2IWD A;  3UE1 A;  3AGE A;  4WMC A;  3ZG0 A;  2UWX A;  5AQ9 A;  3RXX A;  3UDX A;  3C7U A;  1ZG6 A;  3IXH A;  1S0W A;  4M3K A;  2OV5 A;  4N9L A;  2J8Y A;  4N1H A;  2Y2N A;  1SKF A;  2XLN A;  3P09 A;  2ZQ7 A;  2Q9M A;  1YM1 A;  4KG2 A;  2ZC3 B;  5EOO A;  4S2N A;  5HW3 A;  4QY5 A;  4R3B A;  4JKT A;  2Y2P A;  3TG9 A;  3FKV A;  2GDN A;  3WS4 A;  4R1G A;  1RGY A;  3FWL A;  4PM8 A;  4P6B A;  4E3I A;  4YIN A;  2X71 A;  1NZU A;  3FV7 A;  5KMW A;  1L0D A;  2EXB A;  3MXS A;  4OOL A;  4NK3 A;  2HPB A;  3UO9 A;  4BD0 A;  4IED A;  3ZNT A;  3ZG5 A;  3LY3 A;  2EFX A;  3IF5 A;  2J9O A;  3BYD A;  3ZCZ A;  2QPN A;  5HAR A;  4O7D A;  3HLC A;  3ZG9 B;  4OLD A;  4OQI A;  3HUO A;  4C6Y A;  4E6W A;  5A93 A;  4LCL A;  5CEB A;  3MFD A;  3A3E A;  2H5S A;  2Y91 A;  5M19 A;  3CZD A;  1W8Y A;  2XK1 A;  3WWX A;  1K4F A;  2Y2G A;  4MBH A;  3CG5 A;  1GHP A;  3FZC A;  5M18 A;  2HP6 A;  2P9V A;  3N6I A;  3HLD A;  2Y59 A;  2Z2M B;  1I5Q A;  4EWF A;  3W4P A;  1C3B A;  2XFT A;  5F83 A;  2HDS A;  3A3J A;  5FAP A;  3AGD A;  4OON A;  3GRJ A;  4B88 A;  5E43 A;  1PI5 A;  1RCJ A;  1XGJ A;  4GKU A;  4C3Q A;  4E3O A;  4E6X A;  2XD5 A;  3BFF A;  3E2L A;  3V50 A;  3MKF A;  3G31 A;  1NJ4 A;  3GR2 A;  3MZD A;  4PM6 A;  4DDY A;  5FSR A;  4N1X A;  4OKP A;  2XR0 A;  1DJB A;  2J9P A;  4KZ5 A;  2V2F F;  1SHV A;  5TFQ A;  3OPL A;  4X53 A;  3IWQ A;  3VSL A;  4OQG A;  2OLU A;  2WGW B;  4WZ5 A;  4X6T A;  5I94 A;  1SDE A;  4R3J A;  4E3L A;  5GLA A;  4WZ5 C;  3OCL A;  4BD1 A;  1SDN A;  2C6W B;  3G32 A;  3PBR A;  5EUA A;  4DE3 A;  1L0G A;  1FQG A;  3ZVT A;  1SCW A;  4KZA A;  4DE2 A;  4LV0 A;  2WUQ A;  1JWP A;  4K0X A;  1I2S A;  1H8Y A;  2VGJ A;  2I72 A;  4QHC A;  1MWU A;  3OPH A;  4KG6 A;  1LI0 A;  2HDU A;  3IXG A;  3PBQ A;  3Q7V B;  1K54 A;  4DKI A;  3HUN A;  4KZ9 A;  3MXR A;  4OPQ A;  4S2P A;  4U0X A;  5FQ9 A;  4EQI A;  3OC2 A;  4JXS A;  2Y2L A;  3MZF A;  5DVA A;  4Z9Q A;  3V39 A;  4IBX A;  3VFF A;  2J7V A;  2A3U A;  3UPO A;  4GNU A;  5CHJ A;  4N9K A;  4ZTK A;  3W4O A;  2ZM0 A;  1N9B A;  4FH2 A;  5CEC A;  4GN2 A;  1JWV A;  2WKH A;  3OPP A;  1MWT A;  1PWC A;  1W79 A;  5AQ7 A;  2ZC4 B;  2ZM8 A;  3NCK A;  3VOY A;  1PI4 A;  2ZM2 A;  3G4P A;  4DXC A;  4MLL A;  4YFM A;  4JBF A;  1KDW A;  1I2W A;  3A3I A;  1FR6 A;  3GMW A;  4KZ3 A;  1K57 A;  4L0L A;  1LL9 A;  5GL9 A;  1GA0 A;  1G6A A;  3BRM A;  1YLJ A;  2EXA A;  4R4R A;  2RL3 A;  1K25 A;  4WEJ A;  3VSK A;  3WS1 A;  1ES5 A;  3HL9 A;  2ZQD A;  2Y2H A;  3DWZ A;  1KVM A;  1MBL A;  5FQK A;  3HLF A;  1PZO A;  1KGF A;  3HUM A; 
#chains in the Genus database with same CATH topology
 5EVI C;  3QP5 A;  5HAQ A;  4X55 A;  3HJK A;  3IQA A;  2O9C A;  3I7J A;  4NXG A;  3SH8 A;  3M2J A;  4NXE A;  1XA1 A;  4S2I A;  1YLT A;  2Y8H A;  4CJN A;  2QHK A;  2Y55 A;  4I39 A;  4JLF A;  1S4S A;  3RJU A;  5FQI A;  4IUK A;  2PYP A;  1PZP A;  2XRN A;  4X68 A;  3DTK A;  4HIA A;  4B4X A;  1NXY A;  4F94 A;  3LEZ A;  1K6S A;  1PIO A;  2V8C A;  4ZDX A;  3PBO A;  1HD8 A;  4HEF A;  1PWG A;  3BQA A;  2EA9 A;  3EQV A;  3NOT C;  3KO6 A;  4Z1W A;  4EV4 A;  1L0F A;  4WYY A;  5TBM B;  1XX2 A;  3G2Y A;  3T50 A;  3UPN A;  5J8X A;  3D9Y A;  2O99 A;  3N8R A;  1P9W A;  2WAD A;  3EQU A;  4GJ4 A;  3M6B A;  2ZD8 A;  2PR6 A;  4KZ4 A;  5L8M A;  4IHQ A;  2CMN A;  1K38 A;  5DJT A;  1IYQ A;  3IF6 C;  4EEU A;  1KGE A;  1Z6F A;  4OPZ A;  4CLC B;  3VP0 A;  1KE3 A;  3TSG A;  1MZU A;  2JN7 A;  3Q7V A;  4WBG A;  2PAV P;  3UY6 A;  1YKD A;  1OPX A;  4S2K A;  2ZQA A;  2X01 A;  3WRZ A;  2BG1 A;  1BUL A;  1K0K A;  4R0Q A;  5CGX A;  1CI9 A;  3UDF A;  5F1F A;  1CEF A;  2G2W A;  5EV0 A;  2J3T D;  4XUX A;  5J7E A;  4WEL A;  1M6K A;  4JPM A;  1EWZ A;  4DJ3 A;  5A92 A;  3SS3 A;  5L09 A;  4HBT A;  3KYZ A;  2V8F A;  4M4X A;  1ESI A;  1PWD A;  2Y4A A;  1YQS A;  1E3U A;  4JGR A;  2ZQ8 A;  1VHM A;  2WK0 A;  1S6R A;  3DTI A;  1ES2 A;  4LV2 A;  1LSW A;  1XGI A;  4XUZ A;  4WM9 A;  1W5D A;  1DP9 A;  3G34 A;  3NBL A;  5GHX A;  1P9R A;  4KQR A;  1BYW A;  2W1R A;  5G4Z A;  1MWS A;  3FG8 A;  3SH7 A;  2XQZ A;  4PM7 A;  4JXV A;  4HJ3 A;  3H82 A;  4QY6 A;  3IT9 A;  4D60 A;  4OP5 A;  1GCE A;  4X1L A;  3EEA A;  1BLS A;  2OLV A;  3QNC A;  1W63 M;  3CUE A;  4BQM A;  2XFS A;  1NLY A;  2M7V A;  3JVU A;  3ZG7 B;  5F6A A;  3GTC A;  5AQA A;  3FKW A;  3T4J A;  4OP8 A;  3H7W A;  2DRW A;  3PAG A;  4KQO A;  4Y0U A;  1DY6 A;  5J3W A;  3FYZ A;  3BW6 A;  3KYE A;  3GV9 A;  4QJG A;  1ES4 A;  4RYE A;  3U4L P;  1BLH A;  1GSW A;  1TDG A;  1V9Z A;  4WLA A;  4E3K A;  4L9G A;  5CHM A;  2PBD P;  4ARZ A;  1TDL A;  1KGG A;  1WYB A;  4RX3 A;  2JKR I;  4BLM A;  4GS9 A;  1BTL A;  4ZJ3 A;  2H0Y A;  3N8L A;  2PBY A;  3VP1 A;  3G2Z A;  1JVJ A;  4DE1 A;  5IU1 A;  1YLZ A;  1LSX A;  4Y3I A;  3MZE A;  2VGK A;  4F3L A;  1J3W A;  4WF0 A;  4MBF A;  5AQ9 A;  3RXX A;  3UDX A;  3IXH A;  4M3K A;  2J8Y A;  1SKF A;  3LR5 A;  1XJ6 A;  2ZC3 B;  3R7W B;  3NUL A;  3FWL A;  4P6B A;  2QWS A;  2X71 A;  3VE4 A;  2EXB A;  3MSH A;  3MXS A;  4CLC D;  5HPI A;  1OT9 A;  2HJE A;  4NKP A;  3ZNT A;  3LY3 A;  2J9O A;  3CPT B;  2VEA A;  5HAR A;  4OLD A;  4OQI A;  4C6Y A;  4E6W A;  2K31 A;  3MFD A;  3WWX A;  2Y2G A;  3N6I A;  3HLD A;  4G3W A;  3H82 B;  4OON A;  3GRJ A;  4Y15 A;  4B88 A;  5A8B A;  1PI5 A;  1RCJ A;  4C3Q A;  3K3D A;  3E2L A;  3V50 A;  3LID A;  3GR2 A;  5FSR A;  2XR0 A;  1DJB A;  3MFX A;  2V2F F;  1VB6 A;  4PKY G;  1G6O A;  5TFQ A;  4Y13 A;  2ZMF A;  4LRZ E;  3R4K A;  1X0O A;  5GLA A;  1SDN A;  3G32 A;  1L0G A;  3H7W B;  4KZA A;  4DE2 A;  2WUQ A;  4LRY C;  1JWP A;  1MWU A;  3OPH A;  4S2P A;  3V39 A;  1KOU A;  2Y2L A;  4Z9Q A;  4Q0J A;  3VFF A;  4IBX A;  3MXQ A;  1N9O A;  2WKR A;  3KSG A;  4FH2 A;  5CEC A;  1JWV A;  4I3J A;  3VOY A;  3C38 A;  3UME A;  3BY8 A;  1UWP X;  4MLL A;  1I2W A;  1FR6 A;  2VA0 A;  4KZ3 A;  3O5Y A;  4Q0I A;  4ARZ B;  4O8G A;  4O01 A;  3HL9 A;  4BBT A;  2Y2H A;  1SZV A;  3HUM A;  1VEU A;  4UEY A;  5KIZ A;  1XXM A;  3VMA A;  4GOG A;  1IFQ A;  5D3O A;  1ZKJ A;  3HLW A;  3IWO A;  3Q82 A;  3LI8 A;  3HRE A;  4F3L B;  2Y2I A;  3BFC A;  4MCW A;  3T4T A;  2J3W A;  1XP4 A;  4LV3 A;  1ZTU A;  3OZH A;  3JYI A;  3CMZ A;  4NG2 A;  5HL1 A;  3LIF A;  4HBU A;  3MJQ A;  3O3V A;  2HF6 A;  5BOH A;  3PXP A;  1ES3 A;  4UA7 A;  5I5L A;  2HDQ A;  2PR5 A;  1S66 L;  1OTD A;  2XEP A;  3S7Q A;  3BQ8 A;  5FI2 A;  1JNU A;  4EBL A;  4EEP A;  4PPR A;  1U60 A;  4CQH A;  4N92 A;  3B33 A;  3TJZ C;  2EFU A;  1W8Q A;  5TR7 A;  2ZMV A;  1JTD A;  5FEF A;  1HVB A;  1CJF A;  5HFO A;  4EBN A;  1BUE A;  2X02 A;  2O0Y A;  2XA7 S;  4PKY A;  3KX0 X;  1MPL A;  2J3T C;  5U47 A;  1W7F A;  3UE3 A;  3WS2 A;  3IF6 A;  3KSF A;  1Y4O A;  1L0E A;  5GLB A;  1LLB A;  4RX2 A;  2IWB A;  5HD3 A;  4IVK A;  3HBR A;  1E3U D;  1F9I A;  4C75 A;  1KE4 A;  1HTZ A;  2XD1 A;  5TJJ A;  2JC7 A;  2B95 A;  5F68 A;  4NXB A;  5E2F A;  4BJP A;  4G3V A;  5HZH A;  5F82 A;  2W1T A;  2Q9N A;  1M40 A;  1IEL A;  3RTY A;  2WKP A;  3F1N A;  4G3K A;  2NUP C;  3L7H A;  5HWW A;  3GDI A;  4X56 A;  1DP8 A;  2KDK A;  3NDE A;  3PHY A;  5L10 A;  1NYY A;  3VOL A;  3V3R A;  5HAI A;  1GA9 A;  2H10 A;  2R9X A;  3NDG A;  4HH2 A;  2GNX A;  3QP2 A;  5EOE A;  3BJN A;  4OQH A;  3S7P A;  1VEU B;  2ZLY A;  2ZC6 B;  4KUO A;  3E4Q A;  4Q0H A;  2FFY A;  3MF0 A;  4MEZ A;  1Q2Q A;  3BFE A;  3NOU C;  3PBN A;  2ACG A;  3MBZ A;  1JWZ A;  3WS0 A;  5FQQ A;  4HES A;  5AJG A;  4KZ7 A;  2ZC7 A;  2A2L A;  4GD8 A;  5EM1 A;  5FAO A;  4QU3 A;  1STZ A;  3ITA A;  1H3Q A;  1DJA A;  3LCE A;  4FOF A;  2V0W A;  2WYX A;  4X69 A;  3NY4 A;  4PHT A;  2ZOH A;  5G18 A;  4UA9 A;  4S2N C;  4QWO A;  4Y0O A;  1IYS A;  4QD4 A;  3KYQ A;  5FI7 A;  4S2O A;  4HH3 A;  4IVI A;  3A0S A;  4PMA A;  3SOI A;  1Q2P A;  3P01 A;  5FDH A;  1NWZ A;  1Y54 A;  1EI5 A;  1K56 A;  1S67 L;  3IHA A;  2JKR M;  3L9K A;  5DFX A;  1DJC A;  3RFB A;  2FH5 A;  4KZB A;  1IYO A;  1JTG A;  1FIK A;  3WRT A;  3S4X A;  2EX6 A;  1CF0 A;  1XA7 A;  1PYY A;  2D02 A;  4S2M A;  4XT2 A;  3IX4 A;  2W3E A;  1UGU A;  2ZQ9 A;  4GDN A;  5DKL A;  3IX3 A;  3ZVW A;  3VFH A;  1ERM A;  5DF9 A;  3F1O A;  4LPZ A;  2XDM A;  1T18 A;  4MMN A;  2A49 A;  3ZFZ A;  2W3F A;  2Y2M A;  3GQZ A;  1ZG4 A;  3BFG A;  5FI6 A;  3N8S A;  4O0P A;  3ICY A;  3IF6 B;  2W3G A;  3UN7 A;  4EXO A;  3M6H A;  4K0W A;  5HWV A;  2P7J A;  1D06 A;  1KVL A;  4UQI S;  3LIA A;  2JKF A;  4WL9 A;  2OAP 1;  5IT5 A;  1G68 A;  4KG5 A;  3A3D A;  1VET A;  4D2O A;  5A91 A;  1NLZ A;  4R4S A;  3NC8 A;  1V9Y A;  1F98 A;  2AVX A;  2VV7 A;  4CLC C;  3SS4 A;  2JCH A;  1K54 C;  3F1N B;  4HJ4 A;  4P0M A;  3P98 A;  4P87 A;  1RP5 A;  2E8J A;  2C5W B;  1XFN A;  4Q8I A;  3UE0 A;  3MR0 A;  3QNB A;  1F5M A;  2QZ6 A;  3GVB A;  5EE8 A;  3ITB A;  2EX8 A;  3M2K A;  1H5X A;  4LFU A;  3FPV A;  3ZQ5 A;  4OQ0 A;  3BM6 A;  2ZQC A;  3IBJ A;  2QJ7 A;  5CXW A;  1VQQ A;  2V1B A;  2BAS A;  2Y79 A;  4R38 A;  4WMC A;  3ZG0 A;  2YKF A;  1S0W A;  4ETZ A;  2O9B A;  3UB8 A;  3P09 A;  2LB9 A;  2Q9M A;  2ZQ7 A;  1YM1 A;  5EOO A;  5HW3 A;  4IUH A;  4WUJ A;  2Y2P A;  3T1Q B;  2GDN A;  2OOL A;  4PM8 A;  3MQQ A;  4E3I A;  4YIN A;  3A0R A;  5KMW A;  2BTF P;  4OOL A;  4IED A;  1G5U A;  3IF5 A;  3BYD A;  3UE6 A;  2R78 A;  2QPN A;  4O7D A;  3LEQ A;  4LLO B;  4LCL A;  5M19 A;  2H5S A;  2I9V A;  4HQA A;  4MBH A;  2P9V A;  2Y59 A;  4BWI A;  5F83 A;  2Z6C A;  2HJ9 C;  3AGD A;  1PNE A;  4E3O A;  1ODV A;  4XT2 B;  2EWW A;  1FIL A;  1OTE A;  3MKF A;  3G31 A;  1NJ4 A;  1AWI A;  3EWK A;  4OKP A;  3F1O B;  4KZ5 A;  3OPL A;  5F69 A;  2K2N A;  4B93 A;  2QKP A;  5L07 A;  4BD1 A;  4DE3 A;  1FQG A;  3E4O A;  2G7U A;  1SCW A;  5FEG A;  4LV0 A;  4K0X A;  1I2S A;  2VGJ A;  2I72 A;  1LI0 A;  3Q7V B;  1VET B;  4KZ9 A;  4OPQ A;  4EQI A;  5DVA A;  2A3U A;  5EFW A;  3UPO A;  1H8M A;  4ZTK A;  2Q0O A;  3OPP A;  1MWT A;  5AQ7 A;  1W79 A;  1PI4 A;  2ZM2 A;  3NOP C;  3S7O A;  4JBF A;  3A3I A;  2L1M A;  3GMW A;  1K57 A;  4L0L A;  1LL9 A;  2KX6 A;  1G6A A;  3BRM A;  3SZT A;  2EXA A;  3WS1 A;  2A24 A;  1ES5 A;  2ZQD A;  1T1A A;  1MBL A;  3CHW P;  3HLF A;  1AXB A;  1PZO A;  4IJG A;  4FD8 A;  4JXW A;  1LL5 A;  2Y2J A;  2D01 A;  1OTA A;  4KQQ A;  3O88 A;  4BL3 A;  5GLD A;  1E4D A;  2WKI A;  3GSG A;  1NRJ A;  2IWC A;  5FQM A;  3ULF A;  4K91 A;  2ZOI A;  3UPP A;  4DRT A;  5DTT A;  2PT7 A;  3BEB A;  4YWZ A;  2DMW A;  2JE5 A;  3VE3 A;  4NET A;  2W3H A;  2EX2 A;  4IBR A;  3ZGA B;  3F1P A;  3CAX A;  1ACF A;  5J4E A;  2PHY A;  1KDS A;  3A0V A;  1FOF A;  4JF5 A;  1CK3 A;  3PBT A;  2PYR A;  3ZG8 B;  2P9V B;  1YSQ A;  2VZW A;  1XKZ A;  3T12 B;  1ERO A;  4QPR A;  1LHY A;  4U0T A;  5EVL A;  1F2K A;  4WEK A;  2VGL M;  1IKG A;  4RA7 A;  2E8I A;  4FH4 A;  4HJ6 A;  2W27 A;  2Z2L B;  3RH8 B;  1N9L A;  3P7N A;  4I38 A;  3QHY A;  3T4K A;  4BBU A;  5KZH A;  3DBA A;  2WZZ A;  4EUZ A;  4P85 A;  3K2N A;  3DTM A;  5F1G A;  3N4I A;  2HGV A;  2RCX A;  1HLU P;  1NRF A;  3OPR A;  4H6J A;  2V1Z A;  5DKK A;  3WS5 A;  5HX9 A;  1YMS A;  3K3C A;  2O9A A;  3C5A A;  4RVA A;  3GEC A;  3IBR A;  3UMD A;  1ONG A;  4EBP A;  4GS9 B;  2FFF B;  4EUV A;  4L9F A;  1K56 D;  1J9M A;  3N7W A;  5KSC A;  5EVI A;  5JYP A;  2A24 B;  2B5R A;  1OJG A;  5G4Y A;  3U2A A;  1T1B A;  4UHU A;  3S1Y A;  5HPF A;  4KZ6 A;  4R6L A;  2HP5 A;  4GZB A;  1HZO A;  5EPH A;  3BLS A;  1FCO A;  2HDR A;  4Y7P A;  5FDS A;  5DF7 A;  5DJU A;  1GHI A;  4GDB A;  2JHE A;  1CI8 A;  4DXB A;  3RXW A;  3PTE A;  2FZ0 A;  4JF4 A;  4JF6 A;  5LBR A;  2KLI A;  1BT5 A;  5AQB A;  1CEG A;  1ZHH B;  3B47 A;  4LEN A;  3F1P B;  4Y17 A;  2XGN A;  3ZDJ A;  3IX8 A;  5CTN A;  1WYC A;  4A5R A;  3MKE A;  1PFL A;  1YAX A;  3IXD A;  5GLC A;  1QMF A;  1FSW A;  3S22 A;  4BMW A;  5EEC A;  3ISG A;  4R70 A;  4HOI A;  4UAA A;  2WGI A;  3V3S A;  4R3A A;  2PD7 A;  3FPW A;  5GHY A;  3BEC A;  4KEN B;  3E0Y A;  1OJ5 A;  3D4F A;  2V0U A;  2Y2O A;  1IKI A;  2QYB A;  5K5B A;  3LR4 A;  5DTK A;  3HLB A;  3DW0 A;  3OCN A;  4I3A A;  4OOY A;  2WGV A;  3G6O A;  3IHB A;  4WMC D;  3VP2 A;  2ZC5 B;  1IYP A;  3UDI A;  4DF6 A;  1MC0 A;  3QP4 A;  1BLC A;  3VV4 A;  3SW1 A;  1T1C A;  1EW0 A;  1GHM A;  5AVF A;  3DWK A;  4PM9 A;  4MBK A;  5E2G A;  1OTB A;  4LV1 A;  1N4O A;  2VK3 A;  2QJ5 A;  4CLC A;  4FUW A;  4DMZ A;  4KQD A;  5MC7 A;  3Q81 A;  4DDS A;  2EX9 A;  1FCN A;  3C4O A;  1BZA A;  4EU0 A;  1K55 C;  1RGZ A;  2K7S A;  3Q07 A;  2Y2K A;  5CER A;  1YLP A;  1KE0 A;  4JGQ A;  4ZAM A;  5EVI B;  1FSY A;  1XPB A;  4GLQ A;  2XH9 A;  5KSH A;  3HLE A;  3H9W A;  2VV8 A;  3NI9 A;  4I5S A;  4S2L A;  1LSV A;  3E4P A;  3UE1 A;  2UWX A;  1ZG6 A;  3HJI A;  4N9L A;  4N1H A;  4EET B;  2XLN A;  2M7U A;  4R3B A;  1YPR A;  4R1G A;  2IA2 A;  4HNB A;  3FV7 A;  4NK3 A;  4P6Z S;  3UO9 A;  4BD0 A;  4EW7 A;  3DTE A;  3LIE A;  4UQI M;  3ZG5 A;  2EFX A;  3LYX A;  1OT6 A;  3ZG9 B;  3HUO A;  5CEB A;  3C30 A;  2Y91 A;  2XK1 A;  1K4F A;  2VKS A;  1GHP A;  3FZC A;  2HP6 A;  2W3D A;  3W4P A;  1GSX A;  2XFT A;  3A3J A;  2B18 A;  4I3I A;  3C8C A;  1MKM A;  1XGJ A;  4GKU A;  4E6X A;  1SKO A;  2VX8 A;  3MZD A;  4PM6 A;  4N1X A;  2J9P A;  5EM0 A;  2ZBB A;  4Y2F A;  4ETX A;  3VSL A;  3T4Q A;  4X6T A;  4R3J A;  4WZ5 C;  2VV6 A;  3OCL A;  3KSI A;  5CX7 A;  3PBR A;  5EUA A;  2GZA A;  3ZVT A;  4ESP A;  5AVE A;  4HY8 A;  1W63 Q;  4KG6 A;  2HDU A;  3IXG A;  3PBQ A;  3UB6 A;  4DKI A;  3HUN A;  5FQ9 A;  3MXR A;  2GJ3 A;  4U0X A;  2W1T B;  4MN5 A;  3OC2 A;  3MZF A;  4MDZ A;  3UB9 A;  1OTI A;  4GNU A;  4N9K A;  2ZM0 A;  4GN2 A;  3OBF A;  2WKH A;  1PWC A;  2GX5 A;  3G4P A;  4YFM A;  3QP1 A;  2W0N A;  1S1Y A;  1GA0 A;  3QP6 A;  4GW9 A;  1D1J A;  1YLJ A;  2RL3 A;  4WEJ A;  3TE8 A;  3VSK A;  3ZYT A;  3DWZ A;  5FQK A;  4OOM A;  1ERQ A;  2HZ5 A;  4MN6 A;  3D72 A;  4OVD A;  1ESU A;  2JKT M;  1O07 A;  3VOZ A;  3NHQ A;  4LCM A;  1MXO A;  5CED A;  5DTS A;  3EEH A;  3C7V A;  5FAS A;  4LRX C;  2V1A A;  1TEM A;  1PW8 A;  3NJA A;  3IXB A;  4EES A;  1P0Z A;  1L2S A;  4JXG A;  3R7W A;  5IHV A;  3LIC A;  2WAE A;  1NYM A;  1GSV A;  2H28 A;  2UV0 E;  3O86 A;  2KOI A;  4AFI A;  3PR6 A;  1LT0 A;  1TS8 A;  4HI4 A;  3W8K A;  1DP6 A;  3UB5 P;  1TVF A;  3LR0 A;  4FTX A;  3CPT A;  1WA9 A;  4GHI A;  5HDC A;  3IH9 A;  1TF1 A;  4K08 A;  2OWH A;  1TS7 A;  2G2U A;  2PDR A;  4DE0 A;  3FC7 A;  2V20 A;  5EVI D;  1IOU A;  3LFV A;  2JKG A;  4KZ8 A;  1MWR A;  3UNW A;  2LB5 A;  1SKO B;  5CTM A;  2PU4 A;  1S4R A;  4QB8 A;  3EOI A;  5E2E A;  5C5K A;  4OLG A;  3G30 A;  1P97 A;  1BSG A;  2MJ6 A;  3HVF A;  1N9N A;  2ZMA A;  3T4O A;  3LO7 A;  5L2F A;  4UA6 A;  4MNR A;  4U3T A;  2DCF A;  2P74 A;  4E3N A;  5HSQ A;  1Z09 A;  2OAQ 1;  1S1Z A;  2YKH A;  1ONH A;  3T1R A;  3D3O A;  2XSS A;  2JBF A;  5HAP A;  2H0T A;  2PU2 A;  3PBS A;  4H8R A;  3O87 A;  4ZJ2 A;  4KUK A;  2P08 A;  1H0M A;  2OSU A;  5JYO A;  3SH9 A;  1PW1 A;  4OH0 A;  3BWL A;  1UWN X;  5FAT A;  5CGS A;  4B9O A;  3T1S A;  1H8Z A;  3VP4 A;  2WAF A;  1YLW A;  4ZJ1 A;  1K4E A;  4GB7 A;  4ME4 A;  4ID4 A;  2CC1 A;  2HV1 A;  3BLM A;  5CGW A;  3ZNY A;  3Q7Z A;  4OPY A;  1D7E A;  3NEC A;  4B4Z A;  3MS6 A;  5FQJ A;  2DNS A;  1A0K A;  1FCM A;  4E3M A;  2BLS A;  4OPR A;  3W4Q A;  1MKI A;  1NY0 A;  2EWV A;  3CJM A;  3PAE A;  4YOF A;  5F5Y A;  4CPK A;  4Y5F A;  3UB7 A;  2WKE A;  5CRF A;  1XJ4 A;  4II7 A;  5CHU A;  3LUQ A;  3T1X A;  5DF8 A;  1YLY A;  1O7E A;  3CIT A;  1CQA A;  5FA7 A;  4GHI B;  4S2J A;  3VP3 A;  3LR3 A;  2PRF A;  1E25 A;  3E2K A;  4XXR A;  1Y28 A;  2XF3 A;  2J80 A;  3A3F A;  2OWJ A;  3LY4 A;  4NEE D;  4Y0T A;  5A90 A;  1YMX A;  1BLP A;  2JKT I;  3EGX C;  3TOI A;  3TW8 A;  4JGO A;  4WZ4 A;  2B02 A;  3Q1F A;  5HWT A;  1FR1 A;  3V5M A;  1IEM A;  4RQ9 A;  3MMH A;  4HHD A;  2NUT C;  3CUE C;  1ZC2 A;  3C4P A;  2WGW A;  2Z6D A;  1K6R A;  2ZL1 A;  1WE4 A;  5TGF A;  4LGW A;  5HDD A;  3NIA A;  2VJW A;  3IWI A;  3T4L A;  4X25 A;  3TRC A;  5M1A A;  3B3X A;  5GHZ A;  2HP9 A;  4YNR A;  1TD5 A;  4FSF A;  1OME A;  3BFD A;  4PM5 A;  2VLG A;  2ZJ9 A;  1XFQ A;  3IS2 A;  4BL2 A;  3LIB A;  3ZHH A;  5HDS A;  4R23 A;  1K55 A;  5E2H A;  1PRQ A;  3JVV A;  5FAQ A;  4ZBE A;  4FCF A;  4L9E A;  2Y2Q A;  2WZX A;  1YT4 A;  2L4R A;  2QMI A;  1QME A;  1YSP A;  3HLG A;  4GCZ A;  3CI6 A;  3T4S A;  1NZO A;  1K57 C;  3QP8 A;  1LI9 A;  2VGL S;  1T19 A;  4E3J A;  3IH8 A;  5FL3 A;  3SS5 A;  2L0W A;  4GD6 A;  1MY8 A;  2R9W A;  3G35 A;  1VM1 A;  1XJ2 A;  4BEN A;  1ALQ A;  3AGF A;  2IWD A;  2XA7 M;  4MN7 A;  3CLO A;  4ZRR A;  3AGE A;  3C7U A;  4HP9 A;  2OV5 A;  3C2W A;  3KSH A;  2Y2N A;  3CWF A;  4KG2 A;  4S2N A;  4QY5 A;  4JKT A;  3TG9 A;  3FKV A;  3WS4 A;  1RGY A;  1NZU A;  3EGD C;  1TS0 A;  1L0D A;  2HPB A;  3ZCZ A;  3LGO A;  3BY9 A;  3HLC A;  2M1C A;  4HP4 A;  5A93 A;  2XRO A;  3A3E A;  3CZD A;  1W8Y A;  5DFY A;  3B42 A;  4X1M A;  3CG5 A;  3MQ0 A;  5M18 A;  1DRM A;  3W2Z A;  4PAU A;  4EWF A;  2Z2M B;  1I5Q A;  3JPU A;  1C3B A;  5HL6 A;  2V9A A;  5TBM A;  2HDS A;  5FAP A;  4EER A;  1XJ3 A;  2P04 A;  5E43 A;  2XD5 A;  4DJ2 A;  3BFF A;  4E04 A;  3PYP A;  3LI9 A;  2INW A;  4DDY A;  4JGP A;  3E98 A;  1SHV A;  4X53 A;  3IWQ A;  4CLC E;  4OQG A;  2OLU A;  2WGW B;  4NXF A;  4WN5 A;  4WZ5 A;  5I94 A;  2ZL1 B;  1SDE A;  4E3L A;  4DN0 A;  2C6W B;  3OLO A;  1H8Y A;  4H6J B;  4QHC A;  1K54 A;  5HD5 A;  4JXS A;  1LL8 A;  4EQ1 A;  3IS2 B;  2J7V A;  3MQO A;  5CHJ A;  3W4O A;  3DAV A;  1N9B A;  3HCY A;  4P6Z M;  2ZC4 B;  2ZM8 A;  3NCK A;  5IS1 A;  4DXC A;  1KDW A;  3V67 A;  2WKQ A;  5GL9 A;  5EVE A;  4R4R A;  1K25 A;  2PD8 A;  4BBV A;  3S7N A;  1KVM A;  3OOV A;  1G28 A;  1L3L A;  1TS6 A;  1KGF A; 
#chains in the Genus database with same CATH homology
 5EVI C;  1ERQ A;  5M1A A;  4FD8 A;  5HAQ A;  4JXW A;  4OVD A;  1LL5 A;  1ESU A;  4X55 A;  1XXM A;  3IQA A;  3VMA A;  1O07 A;  2Y2J A;  4GOG A;  5D3O A;  3VOZ A;  1ZKJ A;  3HLW A;  3IWO A;  3Q82 A;  3I7J A;  3HRE A;  3M2J A;  4KQQ A;  3SH8 A;  4LCM A;  2Y2I A;  3O88 A;  4BL3 A;  1XA1 A;  1MXO A;  4S2I A;  5CED A;  5DTS A;  1E4D A;  3C7V A;  3BFC A;  2WKI A;  1YLT A;  3GSG A;  5GLD A;  2IWC A;  4CJN A;  5FQM A;  2Y55 A;  4K91 A;  5FAS A;  3UPP A;  1XP4 A;  4DRT A;  4LV3 A;  5DTT A;  4JLF A;  3BEB A;  3RJU A;  1TEM A;  5FQI A;  1PW8 A;  3OZH A;  3IXB A;  3JYI A;  2JE5 A;  1PZP A;  3CMZ A;  4X68 A;  5HL1 A;  4NET A;  1L2S A;  4HBU A;  4JXG A;  5IHV A;  2EX2 A;  2WAE A;  3O3V A;  1NYM A;  4IBR A;  3ZGA B;  4B4X A;  3O86 A;  5BOH A;  1NXY A;  4F94 A;  1ES3 A;  4UA7 A;  3LEZ A;  1K6S A;  2HDQ A;  3W8K A;  1PIO A;  2XEP A;  1KDS A;  1TVF A;  1FOF A;  4JF5 A;  4ZDX A;  3PBO A;  5FI2 A;  1HD8 A;  4HEF A;  1PWG A;  1CK3 A;  3IH9 A;  4EBL A;  3PBT A;  3EQV A;  2G2U A;  4PPR A;  1U60 A;  4DE0 A;  4N92 A;  3ZG8 B;  2P9V B;  2V20 A;  2EFU A;  1XKZ A;  5EVI D;  1W8Q A;  4EV4 A;  1ERO A;  5TR7 A;  1L0F A;  4WYY A;  1LHY A;  1XX2 A;  3G2Y A;  4U0T A;  3UPN A;  5J8X A;  5EVL A;  4KZ8 A;  1JTD A;  4WEK A;  1HVB A;  3N8R A;  1IKG A;  1MWR A;  4RA7 A;  2WAD A;  5HFO A;  2E8I A;  4EBN A;  3EQU A;  3UNW A;  1BUE A;  3M6B A;  2X02 A;  2ZD8 A;  5CTM A;  4KZ4 A;  2PU4 A;  4FH4 A;  1MPL A;  2Z2L B;  5U47 A;  1W7F A;  4QB8 A;  1K38 A;  3QHY A;  3UE3 A;  5E2E A;  1IYQ A;  5KZH A;  3WS2 A;  3IF6 A;  4OLG A;  2WZZ A;  3G30 A;  4EUZ A;  1L0E A;  3IF6 C;  1BSG A;  5GLB A;  1LLB A;  4P85 A;  4RX2 A;  3HVF A;  2ZMA A;  3DTM A;  3LO7 A;  2IWB A;  5L2F A;  4UA6 A;  5F1G A;  1KGE A;  4MNR A;  4IVK A;  3N4I A;  1Z6F A;  3HBR A;  2DCF A;  4U3T A;  2RCX A;  2P74 A;  1E3U D;  4C75 A;  4E3N A;  4OPZ A;  1KE4 A;  1NRF A;  1HTZ A;  2XD1 A;  3OPR A;  3VP0 A;  1KE3 A;  2V1Z A;  2JC7 A;  3TSG A;  3WS5 A;  1ONH A;  5HX9 A;  5E2F A;  4BJP A;  3Q7V A;  4WBG A;  5F82 A;  1YMS A;  2Q9N A;  1M40 A;  2JBF A;  5HAP A;  1IEL A;  2H0T A;  2PU2 A;  3C5A A;  3PBS A;  3UY6 A;  4RVA A;  4X56 A;  3NDE A;  4H8R A;  3O87 A;  4S2K A;  1ONG A;  1NYY A;  2ZQA A;  2X01 A;  4EBP A;  4ZJ2 A;  3V3R A;  5HAI A;  2FFF B;  3WRZ A;  2BG1 A;  1K56 D;  1J9M A;  2OSU A;  3N7W A;  1GA9 A;  5JYO A;  5KSC A;  3SH9 A;  1BUL A;  5EVI A;  4R0Q A;  1PW1 A;  1CI9 A;  5CGX A;  2H10 A;  3UDF A;  4OH0 A;  5F1F A;  5JYP A;  2R9X A;  1CEF A;  2B5R A;  3NDG A;  2G2W A;  4UHU A;  3S1Y A;  4KZ6 A;  5EOE A;  5FAT A;  5CGS A;  4OQH A;  4XUX A;  4WEL A;  2HP5 A;  4GZB A;  1HZO A;  1M6K A;  4JPM A;  1EWZ A;  3BLS A;  5EPH A;  2ZLY A;  2ZC6 B;  1H8Z A;  5A92 A;  3SS3 A;  2FFY A;  4MEZ A;  1FCO A;  2HDR A;  4HBT A;  3VP4 A;  1Q2Q A;  2WAF A;  1YLW A;  3BFE A;  1K4E A;  4GB7 A;  4Y7P A;  4ZJ1 A;  3PBN A;  4ID4 A;  2CC1 A;  3BLM A;  5CGW A;  5DF7 A;  3ZNY A;  3Q7Z A;  1GHI A;  4OPY A;  4GDB A;  3MBZ A;  4B4Z A;  1JWZ A;  3WS0 A;  5FQJ A;  5FQQ A;  4HES A;  1ESI A;  1CI8 A;  2DNS A;  1PWD A;  1FCM A;  2ZC7 A;  2BLS A;  4KZ7 A;  4E3M A;  4GD8 A;  5FAO A;  4OPR A;  4DXB A;  4QU3 A;  3RXW A;  3W4Q A;  2Y4A A;  1MKI A;  1NY0 A;  3PTE A;  4JF4 A;  3ITA A;  3CJM A;  1YQS A;  3PAE A;  4JF6 A;  1DJA A;  1E3U A;  3LCE A;  1BT5 A;  5AQB A;  2WYX A;  4X69 A;  4CPK A;  1CEG A;  2ZQ8 A;  3NY4 A;  4LEN A;  5G18 A;  4UA9 A;  2WK0 A;  1S6R A;  4S2N C;  2WKE A;  5CRF A;  1ES2 A;  4LV2 A;  4Y0O A;  1IYS A;  2XGN A;  5CHU A;  1XGI A;  4QD4 A;  4WM9 A;  4XUZ A;  5CTN A;  4S2O A;  5FI7 A;  3ZDJ A;  1WYC A;  4A5R A;  3MKE A;  3IXD A;  5DF8 A;  1W5D A;  4IVI A;  5GLC A;  1YLY A;  4PMA A;  1O7E A;  3G34 A;  3SOI A;  3NBL A;  5GHX A;  4KQR A;  1Q2P A;  1QMF A;  1FSW A;  3S22 A;  5FA7 A;  4S2J A;  5FDH A;  3VP3 A;  1MWS A;  1Y54 A;  1EI5 A;  5EEC A;  3ISG A;  3SH7 A;  1K56 A;  2XQZ A;  3IHA A;  1E25 A;  1DJC A;  4PM7 A;  3E2K A;  4JXV A;  4KZB A;  1IYO A;  4XXR A;  4UAA A;  2WGI A;  2XF3 A;  1JTG A;  4QY6 A;  3V3S A;  3WRT A;  3IT9 A;  3A3F A;  3S4X A;  4OP5 A;  2EX6 A;  1GCE A;  3LY4 A;  4Y0T A;  1XA7 A;  5GHY A;  3BEC A;  4KEN B;  5A90 A;  1PYY A;  4S2M A;  3D4F A;  1YMX A;  1BLP A;  1BLS A;  2OLV A;  3QNC A;  2ZQ9 A;  4GDN A;  2Y2O A;  3TOI A;  1IKI A;  4WZ4 A;  3ZVW A;  3Q1F A;  3VFH A;  1ERM A;  5DTK A;  5DF9 A;  3HLB A;  1FR1 A;  2XFS A;  2XDM A;  3V5M A;  4BQM A;  1IEM A;  2A49 A;  3ZFZ A;  3GQZ A;  2Y2M A;  1ZG4 A;  3DW0 A;  3BFG A;  3OCN A;  4OOY A;  1ZC2 A;  5FI6 A;  3ZG7 B;  2WGV A;  3C4P A;  2WGW A;  3N8S A;  3GTC A;  1K6R A;  3IHB A;  3IF6 B;  4WMC D;  1WE4 A;  5TGF A;  3VP2 A;  5AQA A;  2ZC5 B;  3UN7 A;  3NIA A;  3FKW A;  1IYP A;  3UDI A;  4DF6 A;  4OP8 A;  3IWI A;  3M6H A;  3B3X A;  4K0W A;  1AXB A;  2DRW A;  3PAG A;  5GHZ A;  4KQO A;  4Y0U A;  1DY6 A;  1BLC A;  2HP9 A;  1KVL A;  3FYZ A;  4FSF A;  1GHM A;  1OME A;  3DWK A;  3BFD A;  4PM9 A;  1G68 A;  4KG5 A;  3A3D A;  4MBK A;  4PM5 A;  5E2G A;  2ZJ9 A;  3GV9 A;  4D2O A;  4LV1 A;  4OOM A;  5A91 A;  1N4O A;  4R4S A;  4BL2 A;  3NC8 A;  4QJG A;  1ES4 A;  4RYE A;  3ZHH A;  1BLH A;  3Q81 A;  4R23 A;  4DDS A;  1K55 A;  2EX9 A;  5E2H A;  3SS4 A;  1FCN A;  2JCH A;  5FAQ A;  1K54 C;  1TDG A;  3C4O A;  1BZA A;  1K55 C;  4P0M A;  4E3K A;  4ZBE A;  3P98 A;  4P87 A;  4FCF A;  1RP5 A;  1RGZ A;  2C5W B;  3Q07 A;  5CHM A;  4Q8I A;  3UE0 A;  2Y2K A;  5CER A;  3QNB A;  1TDL A;  2Y2Q A;  2WZX A;  1KGG A;  1YT4 A;  1YLP A;  1WYB A;  1QME A;  2QMI A;  4RX3 A;  1KE0 A;  2QZ6 A;  4ZAM A;  4BLM A;  3GVB A;  5EE8 A;  5EVI B;  1FSY A;  3HLG A;  3ITB A;  2EX8 A;  1BTL A;  3M2K A;  1XPB A;  1H5X A;  2H0Y A;  4ZJ3 A;  2XH9 A;  3N8L A;  2PBY A;  5KSH A;  1NZO A;  1K57 C;  1LI9 A;  4OQ0 A;  3VP1 A;  3HLE A;  3G2Z A;  1JVJ A;  3BM6 A;  4E3J A;  3IH8 A;  3NI9 A;  3SS5 A;  4GD6 A;  4DE1 A;  4S2L A;  2ZQC A;  1MY8 A;  2R9W A;  3G35 A;  1YLZ A;  1VM1 A;  5CXW A;  3MZE A;  2VGK A;  4BEN A;  1ALQ A;  1VQQ A;  3AGF A;  4MBF A;  2IWD A;  3UE1 A;  3AGE A;  4WMC A;  3ZG0 A;  2UWX A;  5AQ9 A;  3RXX A;  3UDX A;  3C7U A;  1ZG6 A;  3IXH A;  1S0W A;  4M3K A;  2OV5 A;  4N9L A;  2J8Y A;  4N1H A;  2Y2N A;  1SKF A;  2XLN A;  3P09 A;  2ZQ7 A;  2Q9M A;  1YM1 A;  4KG2 A;  2ZC3 B;  5EOO A;  4S2N A;  5HW3 A;  4QY5 A;  4R3B A;  4JKT A;  2Y2P A;  3TG9 A;  3FKV A;  2GDN A;  3WS4 A;  4R1G A;  1RGY A;  3FWL A;  4PM8 A;  4P6B A;  4E3I A;  4YIN A;  2X71 A;  1NZU A;  3FV7 A;  5KMW A;  1L0D A;  2EXB A;  3MXS A;  4OOL A;  4NK3 A;  2HPB A;  3UO9 A;  4BD0 A;  4IED A;  3ZNT A;  3ZG5 A;  3LY3 A;  2EFX A;  3IF5 A;  2J9O A;  3BYD A;  3ZCZ A;  2QPN A;  5HAR A;  4O7D A;  3HLC A;  3ZG9 B;  4OLD A;  4OQI A;  3HUO A;  4C6Y A;  4E6W A;  5A93 A;  4LCL A;  5CEB A;  3MFD A;  3A3E A;  2H5S A;  2Y91 A;  5M19 A;  3CZD A;  1W8Y A;  2XK1 A;  3WWX A;  1K4F A;  2Y2G A;  4MBH A;  3CG5 A;  1GHP A;  3FZC A;  5M18 A;  2HP6 A;  2P9V A;  3N6I A;  3HLD A;  2Y59 A;  2Z2M B;  1I5Q A;  4EWF A;  3W4P A;  1C3B A;  2XFT A;  5F83 A;  2HDS A;  3A3J A;  5FAP A;  3AGD A;  4OON A;  3GRJ A;  4B88 A;  5E43 A;  1PI5 A;  1RCJ A;  1XGJ A;  4GKU A;  4C3Q A;  4E3O A;  4E6X A;  2XD5 A;  3BFF A;  3E2L A;  3V50 A;  3MKF A;  3G31 A;  1NJ4 A;  3GR2 A;  3MZD A;  4PM6 A;  4DDY A;  5FSR A;  4N1X A;  4OKP A;  2XR0 A;  1DJB A;  2J9P A;  4KZ5 A;  2V2F F;  1SHV A;  5TFQ A;  3OPL A;  4X53 A;  3IWQ A;  3VSL A;  4OQG A;  2OLU A;  2WGW B;  4WZ5 A;  4X6T A;  5I94 A;  1SDE A;  4R3J A;  4E3L A;  5GLA A;  4WZ5 C;  3OCL A;  4BD1 A;  1SDN A;  2C6W B;  3G32 A;  3PBR A;  5EUA A;  4DE3 A;  1L0G A;  1FQG A;  3ZVT A;  1SCW A;  4KZA A;  4DE2 A;  4LV0 A;  2WUQ A;  1JWP A;  4K0X A;  1I2S A;  1H8Y A;  2VGJ A;  2I72 A;  4QHC A;  1MWU A;  3OPH A;  4KG6 A;  1LI0 A;  2HDU A;  3IXG A;  3PBQ A;  3Q7V B;  1K54 A;  4DKI A;  3HUN A;  4KZ9 A;  3MXR A;  4OPQ A;  4S2P A;  4U0X A;  5FQ9 A;  4EQI A;  3OC2 A;  4JXS A;  2Y2L A;  3MZF A;  5DVA A;  4Z9Q A;  3V39 A;  4IBX A;  3VFF A;  2J7V A;  2A3U A;  3UPO A;  4GNU A;  5CHJ A;  4N9K A;  4ZTK A;  3W4O A;  2ZM0 A;  1N9B A;  4FH2 A;  5CEC A;  4GN2 A;  1JWV A;  2WKH A;  3OPP A;  1MWT A;  1PWC A;  1W79 A;  5AQ7 A;  2ZC4 B;  2ZM8 A;  3NCK A;  3VOY A;  1PI4 A;  2ZM2 A;  3G4P A;  4DXC A;  4MLL A;  4YFM A;  4JBF A;  1KDW A;  1I2W A;  3A3I A;  1FR6 A;  3GMW A;  4KZ3 A;  1K57 A;  4L0L A;  1LL9 A;  5GL9 A;  1GA0 A;  1G6A A;  3BRM A;  1YLJ A;  2EXA A;  4R4R A;  2RL3 A;  1K25 A;  4WEJ A;  3VSK A;  3WS1 A;  1ES5 A;  3HL9 A;  2ZQD A;  2Y2H A;  3DWZ A;  1KVM A;  1MBL A;  5FQK A;  3HLF A;  1PZO A;  1KGF A;  3HUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...