2H0TA

Crystal structure of the m69v e166a double mutant of shv-1 b-lactamase complexed to clavulanic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMVSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWATELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Broad-spectrum beta-lactamase SHV-1
publication title Effect of the inhibitor-resistant M69V substitution on the structures and populations of trans-enamine beta-lactamase intermediates.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 98
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2h0tA00
2GDNA 3C7VA 3Q07A 2E8IA 4S2MA 5A92A 4FCFA 1E3UA 1LI9A 3MKEA 1FQGA 3HLEA 3IQAA 3UO9A 4WM9A 3I7JA 4IBXA 3ZG0A 5CRFA 4BL2A 2ZM2A 3DWKA 1DY6A 3Q7VA 4R4RA 1TEMA 3BFCA 4ZAMA 1LHYA 5GHXA 5GLBA 1L0EA 1O07A 2WK0A 3N6IA 4KZ6A 1NXYA 3IWQA 3W4QA 5CGSA 5DF9A 4MLLA 3ZG7B 2B5RA 5E2GA 4ZJ1A 3MBZA 3MKFA 3UE0A 4DDSA 1IYSA 3TOIA 5HX9A 4BJPA 4P0MA 2JCHA 2ZQ9A 2WGVA 5CHUA 3VOYA 1M40A 2QMIA 1IKGA 5AQ7A 4GOGA 3P09A 2OLUA 4LV0A 1KGGA 2V2FF 3UPPA 1XXMA 1DJAA 4KQQA 4EWFA 4FH4A 4XXRA 4MNRA 1SCWA 3WRZA 3S22A 3HUNA 4S2NA 5EE8A 1JVJA 1H8ZA 3LO7A 3JYIA 1BT5A 1KE0A 4WMCD 1K55A 4X53A 1W8QA 4LV3A 4N9LA 5KSCA 1Q2PA 1W8YA 2ZC3B 5FATA 1BZAA 1K25A 2VGJA 5FDHA 4LENA 5EVIA 3CMZA 1SHVA 3M2KA 4Y7PA 1GA0A 3VP0A 1W7FA 1K57A 2ZD8A 1YLTA 1MPLA 1AXBA 2XFSA 1L0FA 3CG5A 4RA7A 3NI9A 2XD1A 5FSRA 4EBNA 4E3LA 3G32A 1MWRA 2JE5A 3SS5A 1PZOA 3W8KA 3HVFA 4JXGA 1G6AA 2P9VA 4OPYA 4DXCA 3MFDA 2Y2KA 5FQQA 1ES4A 4OQIA 4NETA 4BLMA 2J9OA 4R3BA 4S2LA 1ONHA 3GR2A 4DRTA 1LL9A 1NYYA 3HLBA 3IHAA 3IT9A 1ONGA 4N1HA 5DVAA 4BENA 1XGJA 3IF5A 3G4PA 1ZC2A 2PU4A 5CGXA 4C6YA 1YMXA 4K0XA 2Y2NA 5M19A 5EUAA 3W4PA 2XFTA 3IXBA 3PBQA 3A3EA 5TR7A 1N9BA 4ZJ2A 3WS1A 2ZMAA 1C3BA 5FASA 2ZQAA 3WS5A 4O7DA 4JKTA 1EROA 5F83A 1NYMA 5KSHA 3C4PA 3PAGA 2HP5A 5AQBA 4E6WA 3OPPA 1NZOA 1Q2QA 5CERA 5FAPA 1PIOA 1XA1A 2WGWB 3EQUA 2Y2PA 3VMAA 2Y2JA 4MEZA 1MXOA 1I2SA 2XR0A 4ZBEA 5F1FA 4WYYA 1Z6FA 2WKIA 1WYCA 2H10A 4HBUA 2A49A 3HL9A 1CI8A 1ESUA 3OC2A 4E3MA 4OOLA 3N8SA 3M6HA 3E2KA 4OPQA 5GL9A 1IKIA 2WUQA 4DE0A 5EOOA 1ZG6A 3LEZA 4P87A 4X68A 5J8XA 3LCEA 3W4OA 2QZ6A 4LCMA 5AQ9A 3SH9A 1ERMA 1BSGA 3FKWA 1CEGA 1L0DA 1ZKJA 3NBLA 4QY5A 4U0XA 1ES2A 2OLVA 3E2LA 4QJGA 4EBLA 3OZHA 4GNUA 1PI5A 1GHIA 4OPZA 3IF6C 1SDNA 1DJCA 5DF8A 4RX3A 2XH9A 1GA9A 2ZQ8A 3VFHA 1PYYA 1IEMA 3O88A 3NIAA 2H0TA 4KQOA 4PM8A 4S2NC 5HFOA 4PMAA 5FAOA 5CEDA 4OLDA 4YINA 1RCJA 3ISGA 2OV5A 1K55C 3ZNTA 2Y2GA 4R4SA 3PBSA 5GLAA 3VOZA 1YLPA 1KGFA 3V5MA 3AGEA 1FSYA 1NRFA 2G2WA 3HLDA 2X01A 1FCMA 2XGNA 5EVIC 1CK3A 5FA7A 4JXWA 2FFYA 1KE4A 1BLPA 2WADA 1K57C 4R23A 1K6SA 5E2EA 2Q9NA 2ZM0A 4GKUA 3SH8A 3Q82A 4PM5A 1ALQA 1S6RA 3IWIA 3VP4A 1YMSA 1NZUA 2PU2A 4CJNA 4OQHA 1Y54A 3V3RA 4C3QA 2EFUA 3BEBA 5M1AA 3QNCA 4JF4A 2G2UA 5HARA 3RXWA 3Q1FA 1MWUA 4OONA 5A93A 2J7VA 3FYZA 2IWDA 1ES5A 3ZG8B 4C75A 1L0GA 3ZVWA 2EXBA 3GTCA 4OQGA 2ZC4B 2XD5A 1ESIA 4OKPA 1KVLA 3C7UA 5EOEA 3TG9A 3LY3A 3RXXA 1YLWA 1CI9A 1PW1A 1PI4A 3N8RA 4KG5A 1M6KA 4PPRA 4HESA 5CECA 3VP1A 1E4DA 2WGIA 3BFDA 3BRMA 3FWLA 1JWPA 4GB7A 4OQ0A 1W79A 5E2HA 3VSLA 4GD6A 4B88A 2QPNA 2Y91A 4UA7A 5DTSA 3ZG9B 1RGZA 5TFQA 4LV2A 3ZHHA 2Y2MA 3AGFA 2HPBA 4N1XA 3MZEA 1XGIA 3G35A 4OVDA 3S1YA 2JC7A 3PTEA 4BD1A 3VP3A 4ZDXA 3OCNA 3UPOA 3SS3A 4KZ8A 4BL3A 4XUZA 1N4OA 1MWSA 4JBFA 2A3UA 3OPLA 3BFEA 1FCNA 3GRJA 4IEDA 5E2FA 3N4IA 1BULA 3LY4A 4CPKA 3PAEA 1GCEA 3PBTA 5KZHA 2I72A 2EX9A 1KVMA 3HREA 2WKHA 2XF3A 4PM6A 2R9XA 1U60A 3VFFA 5EECA 3PBRA 4S2PA 1RGYA 2WAFA 1E3UD 3FKVA 2RCXA 3MZFA 5D3OA 2Y2QA 4S2OA 3BLMA 5A91A 4QB8A 1QMFA 1L2SA 2HP9A 4N9KA 1K56A 2XDMA 4K0WA 2J9PA 2ZC6B 3GSGA 5CHMA 3N7WA 3QHYA 4DDYA 2Z2MB 1K4EA 1XA7A 4DE2A 3C5AA 1RP5A 4U3TA 1IYOA 4DKIA 2WZXA 3M6BA 4B4XA 5GHYA 5BOHA 4KZ5A 4QHCA 5GLDA 4E3KA 4KZ4A 1H5XA 3MZDA 3ZG5A 1ES3A 3ITAA 2Q9MA 4FSFA 5IHVA 3UDXA 5TGFA 4A5RA 3MXRA 2Y55A 4OOMA 3UN7A 3NDEA 3UDIA 4Y0OA 3Q7VB 3NC8A 1HTZA 2DCFA 3CZDA 2HDSA 3FV7A 4KZAA 4X69A 2ZLYA 1K54A 4ZTKA 5FQKA 4BQMA 2Y59A 2DNSA 3NY4A 3HLWA 4PM9A 1H8YA 3O87A 3TSGA 1XP4A 3IH8A 3M2JA 4E6XA 5DTKA 1GHPA 3Q81A 2ZC5B 3FZCA 4QD4A 4S2JA 5AQAA 1ERQA 4DE1A 3G34A 4Y0TA 5EVID 5M18A 4RYEA 3D4FA 1NY0A 4P85A 5U47A 1BTLA 4X56A 1YT4A 2P74A 3DTMA 4GN2A 4WMCA 3UE1A 5G18A 2WZZA 2ZM8A 4IVKA 3UNWA 3HLCA 4U0TA 4DF6A 1HVBA 3A3JA 3IF6B 1LL5A 4E3IA 1YQSA 3HLGA 5E43A 1W5DA 2EX6A 2ZC7A 2ZJ9A 1PW8A 3BECA 3HBRA 5HW3A 3AGDA 3NCKA 3OPRA 3PBOA 3ZNYA 4N92A 2DRWA 3UDFA 4KZ3A 4JXSA 4MBHA 5FQMA 3EQVA 2WKEA 4S2IA 1S0WA 4JPMA 3B3XA 1OMEA 5EVIB 1BLHA 3IWOA 3QNBA 1TVFA 1YLYA 4WZ4A 3CJMA 5JYOA 2WGWA 5A90A 4LCLA 4E3JA 2ZQDA 3RJUA 3A3FA 3V39A 5HL1A 1E25A 1KDSA 3O86A 3WS4A 1KDWA 4H8RA 1FR1A 2J8YA 3O3VA 4GDBA 2EFXA 4MBKA 2P9VB 2H0YA 1JTDA 2WYXA 1SDEA 1VM1A 1KE3A 1XPBA 4JF6A 5FI6A 3IXDA 1YM1A 2EXAA 2R9WA 4OP8A 2XQZA 3A3IA 3WWXA 3WRTA 5FQ9A 3BFGA 1YLJA 4UHUA 4OPRA 3SS4A 3GVBA 4RX2A 1IYQA 1PWCA 2Z2LB 3P98A 3Q7ZA 5KMWA 3HLFA 4WEJA 5F82A 1FCOA 1FOFA 2V20A 2HDRA 3VSKA 2H5SA 1IELA 5CXWA 1G68A 4X6TA 3GV9A 5CTNA 4E3OA 2X02A 2V1ZA 4KENB 1BLSA 3G30A 1MY8A 3BYDA 1PWDA 1K54C 5FI2A 1LLBA 4QY6A 4OH0A 4WZ5A 5L2FA 4GD8A 3IHBA 1JWVA 3IF6A 3V3SA 4P6BA 1QMEA 2OSUA 5CTMA 1XX2A 2VGKA 1PWGA 2HDUA 1JTGA 3IH9A 4JLFA 5FQJA 1TDLA 4YFMA 2Y2IA 2RL3A 4HEFA 3ZFZA 5CHJA 1EI5A 1JWZA 3S4XA 5CEBA 2ZQCA 1DJBA 3BM6A 4GDNA 5FQIA 2IWCA 4UA9A 4R3JA 4PM7A 1HD8A 1EWZA 3UY6A 1XKZA 2Y2LA 4OLGA 5JYPA 1I5QA 3N8LA 4WBGA 1ZG4A 4KZ7A 4JXVA 3GQZA 5GHZA 3UE3A 4Z9QA 2XEPA 4EUZA 4RVAA 1WE4A 3ZVTA 2ZQ7A 2XK1A 4ID4A 4KZ9A 1K4FA 1TDGA 5DF7A 4M3KA 1MKIA 1I2WA 4HBTA 4R0QA 2IWBA 3BLSA 2HDQA 3V50A 4EV4A 3ITBA 3BFFA 2Y2HA 4IVIA 1J9MA 4QU3A 3MXSA 3SH7A 3NDGA 4X55A 1LI0A 1O7EA 3VP2A 3DW0A 1KGEA 4OP5A 1MBLA 2Y2OA 4E3NA 2C6WB 1FSWA 5HAIA 3ZGAB 1IYPA 2BLSA 4KG2A 2CC1A 5GLCA 3HUOA 3C4OA 5EVLA 4NK3A 4ZJ3A 4FD8A 5FI7A 1NJ4A 1WYBA 3PBNA 3G31A 4DE3A 4JF5A 2UWXA 1PZPA 3UPNA 1FR6A 3IXHA 5DTTA 5FAQA 4R1GA 1GHMA 4GZBA 4OOYA 1K6RA 2XLNA 3IXGA 4Y0UA 2FFFB 4LV1A 4MBFA 3OPHA 3HUMA 4L0LA 5CGWA 5EPHA 4UAAA 4BD0A 2PBYA 2Y4AA 1BLCA 1HZOA 3OCLA 3G2ZA 1CEFA 4KG6A 4EBPA 5F1GA 1BUEA 4KZBA 4WELA 3WS2A 2WAEA 4IBRA 2C5WB 1VQQA 4F94A 3WS0A 4S2KA 4FH2A 4K91A 4Q8IA 4DXBA 3ZCZA 4KQRA 4D2OA 3G2YA 4WZ5C 5HAQA 2BG1A 2X71A 2JBFA 1K38A 5I94A 1SKFA 2EX2A 4UA6A 4EQIA 2HP6A 3SOIA 3A3DA 2EX8A 1MWTA 4B4ZA 3DWZA 1K56D 4XUXA 5HAPA 4WEKA 3ZDJA 3GMWA 1YLZA
chains in the Genus database with same CATH superfamily
3C7VA 4MMNA 1E3UA 1LI9A 4WM9A 4IBXA 5CRFA 2JKFA 3BFCA 3H82B 1PRQA 1L0EA 4P6ZM 4KUOA 2ZMVA 3QP2A 4MLLA 3ZG7B 5DFXA 1OTEA 3UE0A 1ODVA 4DDSA 1DP9A 1IYSA 3TOIA 2WKRA 2W3FA 4MN7A 5DJUA 3C2WA 2OLUA 4EXOA 1KGGA 2V2FF 3UPPA 4KQQA 4EWFA 3R7WA 2V8FA 4MNRA 1SCWA 1TD5A 2FZ0A 5EE8A 3LO7A 1SKOA 3IBJA 1BZAA 2VKSA 1K25A 3OOVA 3T4KA 3CHWP 4LENA 4Y7PA 3VP0A 2VV7A 4R38A 1YLTA 1MPLA 2XFSA 1L0FA 3CG5A 4E3LA 4EBNA 1P9RA 2B95A 3HVFA 5FQQA 1OTIA 4OQIA 3V67A 4BLMA 3NECA 2J9OA 4R3BA 4N1HA 2PT7A 1ONGA 5DVAA 3IF5A 1ACFA 1ZC2A 4K0XA 2ZL1A 4BBVA 3IXBA 5TR7A 3A3EA 4F3LA 1F9IA 2ZQAA 1FILA 4O7DA 5HWTA 2A2LA 5HDDA 2O0YA 5AQBA 5A8BA 5KIZA 1Q2QA 3DTIA 1XA1A 3EQUA 2Y2PA 3VMAA 2PRFA 4MEZA 5F1FA 1Z6FA 3BJNA 1LSVA 3HL9A 1ESUA 4E3MA 4P6ZS 3M6HA 3E2KA 4II7A 4OPQA 5GL9A 2WUQA 4R6LA 5EOOA 5J8XA 4P87A 3LCEA 5AQ9A 4LCMA 3FKWA 3NOTC 2KX6A 4QJGA 2P7JA 4GNUA 1GHIA 2ZOIA 4RX3A 1EW0A 2QKPA 1GA9A 4PMAA 1RCJA 4Y17A 4R4SA 5HSQA 3VOZA 1KGFA 4HNBA 1S4RA 1FSYA 5EVIC 5EV0A 4UEYA 5L07A 1CF0A 3UB7A 4HIAA 5E2EA 1S4SA 5DFYA 2ZM0A 3T12B 3VP4A 1YMSA 4KQDA 1Y54A 3V3RA 3O5YA 4JF4A 3Q1FA 2VV8A 5A93A 3C30A 3FYZA 1TS0A 2IWDA 1ES5A 5IS1A 3ZVWA 3BY8A 3ZQ5A 4EERA 3FC7A 2XD5A 1ESIA 5EOEA 3LY3A 1CI9A 3N8RA 3QP5A 4CLCA 1E4DA 3BFDA 5E2HA 3FWLA 4GD6A 1F2KA 2VA0A 2GX5A 4H6JB 4LV2A 1S66L 1T1AA 3MZEA 3G35A 2JC7A 3VP3A 3OCNA 1G5UA 4ETZA 3UPOA 1TS6A 3BFEA 1FCNA 1BULA 3LY4A 3PAEA 4QPRA 3HREA 2XF3A 3VFFA 4S2PA 1RGYA 1Z09A 2WAFA 3IS2A 3BLMA 5A91A 4O01A 1K56A 2I9VA 2XDMA 2J9PA 5CHMA 3KSHA 4DDYA 4QWOA 3IX4A 1XA7A 3C5AA 4DKIA 3M6BA 4KZ5A 2JN7A 3LIDA 1F98A 1H5XA 3LR4A 3UDXA 5TGFA 3MXRA 4OOMA 2EWVA 4EU0A 3NDEA 3S7OA 3UDIA 4YNRA 4Y0OA 2DCFA 4ZTKA 2V0WA 4BQMA 3E0YA 3S7PA 3NY4A 3O87A 4WL9A 2QJ5A 4S2JA 4Y0TA 4DE1A 1NY0A 5U47A 4G3KA 5G18A 2WZZA 2ZM8A 3U4LP 4EW7A 1MKMA 3A3JA 5AVFA 5E43A 1W5DA 2EX6A 5HW3A 3NCKA 4I3AA 4N92A 1L3LA 3UDFA 4JXSA 4S2IA 4JPMA 3B3XA 2VK3A 4DN0A 1BLHA 4ZRRA 1YSPA 1TVFA 1J3WA 1P9WA 2WGWA 3UE6A 3LIAA 3RJUA 3WS4A 1KDWA 2J8YA 3O3VA 4GDBA 2P9VB 3T4SA 2W3HA 1S1YA 1YM1A 2EXAA 1YLJA 4UHUA 3SS4A 3NOUC 3H7WB 3IX8A 5HWWA 3T1RA 2P08A 1IYQA 1STZA 5F82A 1FOFA 4X6TA 4XT2A 2O9BA 4KENB 3CPTA 1PWDA 4QY6A 3V3SA 3CAXA 3HJKA 5G4ZA 2BASA 1OPXA 2Y2IA 5TBMB 4GDNA 4Y13A 1XKZA 4OLGA 2PDRA 3N8LA 4WBGA 2J3TD 4JXVA 3GQZA 4EUZA 4HHDA 1WE4A 3ZVTA 2ZQ7A 3GECA 3BWLA 1MKIA 4ARZB 2HDQA 3V50A 3H9WA 4EV4A 1GSVA 2Y2HA 4QU3A 1J9MA 3SH7A 1LI0A 1KGEA 4E3NA 2Y2OA 3SZTA 1D06A 4I3IA 4KG2A 2BLSA 3LI9A 5EVLA 4EQ1A 3OBFA 4JF5A 4EETB 5FAQA 4I5SA 4LLOB 3F1PA 4Y0UA 3HUMA 2PBYA 4R70A 2Y4AA 3VE3A 2HJEA 1P97A 4WELA 2C5WB 1VQQA 2ACGA 2QHKA 4DXBA 2A24B 3G2YA 4DJ3A 3UB5P 2JBFA 3MMHA 4KUKA 2PYRA 2PHYA 2EX8A 1MWTA 3DWZA 4XUXA 3ZDJA 3GMWA 2Q0OA 2JKRM 4GCZA 3MKEA 3IQAA 1PNEA 3I7JA 4BL2A 3R4KA 2ZM2A 1DY6A 5FL3A 1F5MA 3N6IA 1NXYA 1XJ2A 2JKTM 1DRMA 5CGSA 4JGPA 5E2GA 4ZJ1A 3MBZA 3QP6A 3W2ZA 4IHQA 4R3AA 2XROA 4BJPA 4P0MA 2PBDP 3NJAA 3OLOA 1M40A 3VV4A 1SZVA 3P09A 2W27A 2WKPA 1XJ6A 2ZBBA 4XXRA 3CWFA 3TRCA 4PAUA 1H8ZA 3JYIA 1KE0A 4WMCD 1W8QA 1UWNX 4LV3A 5KSCA 1W8YA 2ZC3B 2VGJA 4FTXA 5EVIA 1SHVA 1OTBA 5L09A 4NEED 5AJGA 1N9OA 1AXBA 4RA7A 4GS9B 2XD1A 3G32A 1MWRA 2JE5A 4JXGA 3B47A 1ES4A 4Q0IA 1NYYA 4JGOA 3A0SA 4C6YA 1XGJA 3G4PA 5CGXA 1YMXA 1Y28A 5G4YA 3W4PA 2DMWA 1C3BA 1D7EA 5J7EA 3T1SA 3T4JA 3IBRA 1EROA 1NYMA 3P7NA 3PAGA 3LR5A 5CERA 3E4PA 2HV1A 4ZBEA 4WYYA 4LPZA 2A49A 1CI8A 3OC2A 1W63M 4DE0A 4X68A 3SH9A 3E2LA 3OZHA 3LI8A 2XH9A 2ZQ8A 1PYYA 4S2NC 4KQOA 1Y4OA 5FAOA 4OLDA 4YINA 3PHYA 1K55C 1WA9A 3PBSA 1YLPA 5HPFA 4X1MA 1NRFA 2G2WA 2M1CA 3HLDA 2X01A 3UMEA 5FA7A 2VV6A 3FPVA 1K57C 4R23A 1YPRA 3SH8A 3Q82A 1NZUA 5CX7A 1CJFA 5M1AA 2W3DA 3QNCA 3RXWA 4OONA 2H28A 4I38A 2EXBA 3GTCA 4OQGA 4K08A 1KVLA 3TG9A 3RXXA 4PPRA 3MQ0A 2NUTC 3VP1A 4JGRA 1JWPA 1W79A 5DTSA 2K31A 3S7QA 1XGIA 3ICYA 3S1YA 3PTEA 1GSWA 3T1XA 2A3UA 4IEDA 3GRJA 1K0KA 1UGUA 4CPKA 1GCEA 3PBTA 5KZHA 2I72A 1KVMA 2WKHA 1MC0A 3H82A 4PM6A 3CLOA 1E3UD 1S1ZA 5D3OA 4S2OA 3K3DA 2M7UA 1QMFA 2L0WA 3N7WA 1RP5A 4JGQA 4U3TA 1LSWA 5GHYA 5BOHA 1LT0A 3F1NB 1ES3A 5IHVA 3FG8A 4A5RA 3Q7VB 1HTZA 3FV7A 2ZLYA 5J3WA 2Y59A 2Z6CA 2PR5A 4PM9A 2W1RA 3TSGA 3M2JA 1GHPA 3JPUA 3T4LA 1ERQA 3G34A 2O9AA 1P0ZA 2P74A 2W0NA 1HVBA 3IF6B 1V9YA 3PXPA 4E3IA 1YQSA 2PAVP 2ZJ9A 1PW8A 3ZNYA 3EQVA 3QP8A 1S0WA 1YKDA 1XFQA 3F1NA 3NOPC 2V9AA 3CJMA 5JYOA 4LCLA 2ZQDA 3IX3A 1E25A 4H8RA 1FR1A 2EFXA 1XFNA 3PYPA 4MCWA 1AWIA 2BTFP 3F1OB 4Z1WA 1XPBA 5FI6A 4E3KA 3WWXA 2XQZA 3A3IA 3EEHA 4BBTA 5FQ9A 4RX2A 3P98A 1PWCA 3HLFA 3UB6A 3GV9A 5HZHA 3D72A 3LEQA 1MY8A 1LLBA 4OH0A 3IHBA 3IF6A 4P6BA 1QMEA 4JLFA 1PWGA 2HDUA 5L10A 4DMZA 3EWKA 2RL3A 4HEFA 1KOUA 2V0UA 4LRZE 5CHJA 1JWZA 3S4XA 5CEBA 1DJBA 5FQIA 2MJ6A 2JHEA 2L4RA 3UY6A 2Y2LA 1OJ5A 5JYPA 1I5QA 2XK1A 1TDGA 4R0QA 4HBTA 2IWBA 1UWPX 5F69A 3ITBA 4Q0JA 3BFFA 4IVIA 3NDGA 4X55A 1O7EA 1XJ4A 3DW0A 4IUHA 1MBLA 2C6WB 3NULA 1FSWA 4H6JA 3SW1A 4NXGA 4CLCD 1NJ4A 4DE3A 2WKQA 3D9YA 5DTTA 2OWJA 3IXGA 2XLNA 4LV1A 4MBFA 4BD0A 3OCLA 2ZMFA 4KG6A 5F1GA 5LBRA 3DBAA 2EA9A 2WAEA 1VEUB 4FH2A 2PD7A 3ZCZA 4KQRA 4D2OA 2B02A 5I94A 2EX2A 3MS6A 2HP6A 4LGWA 3SOIA 4EEUA 4G3VA 4B4ZA 1K56D 5CGWA 3Q07A 4S2MA 3MJQA 4FCFA 1DP6A 1DP8A 1FQGA 3UMDA 3BQAA 3UO9A 5L8MA 4HP9A 3ZG0A 2V8CA 1N9LA 4R4RA 1TEMA 4ZAMA 5GLBA 3KSFA 5IT5A 1O07A 2WK0A 3IWQA 3W4QA 2B5RA 1FIKA 4HOIA 5DJTA 5HX9A 2WGVA 5CHUA 1IKGA 4NXFA 4IUKA 1NRJA 4LV0A 4HJ6A 5HD5A 3K3CA 4FH4A 3WRZA 3HUNA 4WLAA 1LSXA 4S2NA 2J3WA 4FOFA 3MQOA 4UQIM 3RFBA 4MN6A 1K55A 3ZYTA 4N9LA 1VETB 4G3WA 2HGVA 3LUQA 5FDHA 3CMZA 1ZTUA 3M2KA 4BWIA 1GA0A 1K57A 2ZD8A 1PZOA 2W1TB 1G6AA 2P9VA 2NUPC 2QJ7A 3IHAA 3HLBA 3IT9A 4BENA 3H7WA 5M19A 5EUAA 1OTAA 3WS1A 1N9BA 2ZMAA 4HI4A 4JKTA 5F83A 4L9GA 4E6WA 1PIOA 1NWZA 1WYCA 3KO6A 4Y15A 2Y79A 4HP4A 4OOLA 3N8SA 3A0RA 5TBMA 1IKIA 1ZG6A 3LEZA 3W4OA 2OWHA 1CEGA 1L0DA 3CITA 4QY5A 2OLVA 3B42A 1PI5A 4HH2A 3IF6C 1SDNA 3VFHA 1IEMA 5HFOA 2H0TA 4LFUA 3ISGA 3LIFA 2OV5A 4ARZA 2Y2GA 5GLAA 3V5MA 3AGEA 1FCMA 1CK3A 4Y3IA 4JXWA 4UQIS 2FFYA 1KE4A 1BLPA 2WADA 3LR3A 2Q9NA 4PM5A 1S6RA 3IWIA 4MN5A 5F5YA 3EGXC 4GJ4A 4OQHA 4GHIB 2EFUA 3BEBA 5MC7A 1A0KA 2J7VA 5F68A 1L0GA 2D01A 3B33A 4PHTA 3C7UA 1PW1A 1PI4A 4KG5A 3C8CA 4GB7A 3BRMA 4OQ0A 3VSLA 2A24A 2V1AA 4UA7A 3T4QA 2XA7M 1RGZA 5TFQA 3E98A 2HPBA 4N1XA 3KSIA 4BD1A 2KLIA 4ZDXA 3SS3A 4BBUA 1N4OA 4JBFA 2PYPA 2VEAA 3N4IA 4WN5A 3HCYA 2GZAA 5EM0A 2R9XA 1U60A 3T1QB 3PBRA 2RCXA 2ZOHA 4E04A 2HP9A 4K0WA 5TJJA 2ZC6B 3GSGA 5HWVA 3QHYA 2V1BA 4DE2A 1IYOA 4QHCA 4LRXC 2VX8A 4KZ4A 3ITAA 2Q9MA 3MR0A 2Y55A 3EGDC 4X69A 3CZDA 4KZAA 1MZUA 2O99A 3VOLA 3QP1A 2FH5A 3HLWA 1H8YA 3IH8A 4E6XA 4GS9A 5FEFA 3Q81A 2ZC5B 5AQAA 4ME4A 5EVID 5M18A 4RYEA 4P85A 5FEGA 1H3QA 3P01A 4O8GA 4X56A 4U0TA 4YWZA 3R7WB 2XA7S 1LL5A 1BYWA 2XSSA 3BECA 4PKYA 3HBRA 3OPRA 1SKOB 2DRWA 5FQMA 2PD8A 1G28A 3T4TA 1OMEA 5EVEA 3QNBA 1YLYA 2OAQ1 2K7SA 4WZ4A 5A90A 1X0OA 4GLQA 3A3FA 5HL1A 1KDSA 2M7VA 4MBKA 1JTDA 2WYXA 3L9KA 3MXQA 4RQ9A 1VM1A 1KE3A 4HJ3A 2R9WA 2P04A 3WRTA 3BFGA 2J80A 4OPRA 2HF6A 3KYZA 2ZL1B 3Q7ZA 4I39A 1LL8A 5KMWA 4F3LB 1FCOA 3LYXA 1OT6A 4E3OA 2X02A 4NG2A 1BLSA 2Z6DA 3BYDA 1K54C 5L2FA 3CI6A 5CTMA 1XX2A 2G7UA 5FQJA 3MF0A 1TDLA 4PKYG 3ZFZA 1EI5A 1IFQA 2KOIA 2ZQCA 3BM6A 2IWCA 3QP4A 4UA9A 2VZWA 1HD8A 1EWZA 4WF0A 3MFXA 4HJ4A 4KZ7A 5GHZA 3UE3A 4KZ9A 4Y2FA 5C5KA 4DJ2A 3BLSA 3BW6A 3ZG5A 4OP5A 5HAIA 4EUVA 1IYPA 4YOFA 2CC1A 3U2AA 3HUOA 3PBNA 3G31A 3UPNA 4FUWA 4R1GA 4GZBA 4OOYA 1K6RA 3LIBA 3JVVA 4NKPA 5EPHA 2JKGA 4UAAA 1BLCA 1CEFA 3WS2A 3LFVA 5K5BA 2K2NA 4CLCB 1D1JA 1OJGA 4WZ5C 4EEPA 2X71A 1K38A 4UA6A 4EQIA 1HLUP 3A3DA 2L1MA 5HAPA 4WEKA 1YLZA 2GDNA 5A92A 2E8IA 3HLEA 4M4XA 3DWKA 3Q7VA 5DKLA 1LHYA 1YAXA 5GHXA 4KZ6A 1TF1A 5DF9A 3IS2B 5HDSA 3MKFA 2E8JA 5I5LA 1N9NA 2JCHA 2ZQ9A 4CQHA 4ESPA 3VOYA 2QMIA 5AQ7A 4GOGA 3RTYA 1XXMA 2OOLA 1VB6A 1DJAA 3S22A 1JVJA 4D60A 1BT5A 3CUEC 4X53A 3EOIA 3UB8A 1Q2PA 5FATA 2IA2A 1W7FA 4HY8A 5FSRA 3NI9A 3HJIA 1TS8A 3SS5A 3W8KA 4OPYA 4HQAA 4DXCA 3MFDA 2Y2KA 3UB9A 3F1OA 4NETA 3GDIA 4S2LA 1ONHA 1T18A 1OT9A 3GR2A 4DRTA 1LL9A 2PU4A 1T1CA 3TW8A 2Y2NA 3LIEA 2B18A 2XFTA 3PBQA 5FASA 4ZJ2A 2VGLM 3WS5A 4X1LA 5KSHA 3C4PA 2HP5A 3KSGA 4CLCE 3DTEA 3OPPA 1NZOA 5FAPA 2WGWB 1T19A 2Y2JA 4MDZA 1MXOA 1I2SA 2XR0A 4L9FA 3PR6A 2WKIA 2H10A 3D3OA 3KYQA 4HBUA 5EM1A 3ULFA 5J4EA 5HPIA 2QZ6A 1T1BA 1ERMA 4IJGA 1BSGA 1ZKJA 3NBLA 4U0XA 1ES2A 2YKHA 4EBLA 4OPZA 1DJCA 5DF8A 4X25A 3JVUA 4PM8A 3O88A 3NIAA 2VJWA 3FPWA 5CEDA 4XT2B 3ZNTA 3VE4A 3CPTB 2XGNA 1TS7A 4Q0HA 2YKFA 1K6SA 4GKUA 1ALQA 2PU2A 4CJNA 4C3QA 2HJ9C 2G2UA 5HARA 3T50A 1MWUA 1PFLA 2GJ3A 3ZG8B 4C75A 1NLYA 5IU1A 3BY9A 4B93A 2ZC4B 3A0VA 4OKPA 1YLWA 1M6KA 2LB9A 4HESA 5CECA 1VEUA 2WGIA 3T4OA 4B88A 3K2NA 2QPNA 2VLGA 2Y91A 3ZG9B 2VGLS 3ZHHA 1W63Q 2Y2MA 3AGFA 5AVEA 4OVDA 4BL3A 4KZ8A 5HDCA 4XUZA 1MWSA 3F1PB 3OPLA 5E2FA 2JKRI 2EX9A 5EECA 4NXEA 2EWWA 3FKVA 3MZFA 3LR0A 2XRNA 2Y2QA 2JKTI 4QB8A 1L2SA 4N9KA 2OAP1 3KX0X 3E4OA 2Z2MB 1K4EA 2WZXA 4B4XA 2R78A 1G6OA 5GLDA 2PR6A 3MZDA 4FSFA 1GSXA 4I3JA 3UN7A 3L7HA 4NXBA 4LRYC 2GNXA 4B9OA 3NC8A 3BQ8A 2HDSA 1VETA 3RH8B 1K54A 5FQKA 3MSHA 1S67L 2DNSA 1XP4A 4CLCC 5DTKA 4EESA 4QD4A 2UV0E 3FZCA 2W1TA 3D4FA 1BTLA 4Y5FA 1YT4A 3NHQA 3DTMA 4GN2A 4WMCA 5F6AA 3UE1A 2HZ5A 4IVKA 3UNWA 3HLCA 4DF6A 3G6OA 3HLGA 2ZC7A 3AGDA 3PBOA 4KZ3A 2Y8HA 1IOUA 4MBHA 2WKEA 3C38A 5EVIB 3IWOA 2KDKA 4E3JA 3V39A 3O86A 5DKKA 5EFWA 2H0YA 1SDEA 2W3EA 2INWA 4JF6A 3IXDA 4OP8A 3GVBA 2W3GA 2Z2LB 4ETXA 4WEJA 2O9CA 2QYBA 2CMNA 2V20A 2HDRA 3VSKA 3DTKA 2H5SA 1IELA 5CXWA 1G68A 5CTNA 3DAVA 4GW9A 1ZHHB 2V1ZA 4HH3A 3G30A 4AFIA 5FI2A 4WZ5A 4GD8A 1JWVA 2OSUA 4O0PA 2VGKA 1JTGA 3IH9A 4YFMA 4GHIA 5HL6A 4R3JA 4PM7A 1H8MA 1ZG4A 4Z9QA 2XEPA 4RVAA 3E4QA 4ID4A 1K4FA 3TJZC 5DF7A 5HD3A 1YSQA 4M3KA 1I2WA 2J3TC 3LICA 3EEAA 3S7NA 3LGOA 1XJ3A 3MXSA 3VP2A 4L9EA 1V9ZA 3ZGAB 5GLCA 3C4OA 4ZJ3A 4NK3A 4FD8A 5FI7A 1WYBA 2UWXA 1PZPA 1FR6A 3IXHA 1GHMA 2D02A 3KYEA 3CUEA 2FFFB 3OPHA 4L0LA 1NLZA 1HZOA 2QWSA 3G2ZA 4EBPA 1BUEA 2LB5A 4KZBA 4BMWA 4IBRA 1H0MA 1VHMA 4F94A 3WS0A 4S2KA 4K91A 4Q8IA 2AVXA 5HAQA 3MQQA 2BG1A 4WUJA 5FDSA 1OTDA 1SKFA 1JNUA 3TE8A 1CQAA
chains in the Genus database with same CATH topology
2GDNA 3C7VA 3Q07A 2E8IA 4S2MA 5A92A 4FCFA 1E3UA 1LI9A 3MKEA 1FQGA 3HLEA 3IQAA 3UO9A 4WM9A 3I7JA 4IBXA 3ZG0A 5CRFA 4BL2A 2ZM2A 3DWKA 1DY6A 3Q7VA 4R4RA 1TEMA 3BFCA 4ZAMA 1LHYA 5GHXA 5GLBA 1L0EA 1O07A 2WK0A 3N6IA 4KZ6A 1NXYA 3IWQA 3W4QA 5CGSA 5DF9A 4MLLA 3ZG7B 2B5RA 5E2GA 4ZJ1A 3MBZA 3MKFA 3UE0A 4DDSA 1IYSA 3TOIA 5HX9A 4BJPA 4P0MA 2JCHA 2ZQ9A 2WGVA 5CHUA 3VOYA 1M40A 2QMIA 1IKGA 5AQ7A 4GOGA 3P09A 2OLUA 4LV0A 1KGGA 2V2FF 3UPPA 1XXMA 1DJAA 4KQQA 4EWFA 4FH4A 4XXRA 4MNRA 1SCWA 3WRZA 3S22A 3HUNA 4S2NA 5EE8A 1JVJA 1H8ZA 3LO7A 3JYIA 1BT5A 1KE0A 4WMCD 1K55A 4X53A 1W8QA 4LV3A 4N9LA 5KSCA 1Q2PA 1W8YA 2ZC3B 5FATA 1BZAA 1K25A 2VGJA 5FDHA 4LENA 5EVIA 3CMZA 1SHVA 3M2KA 4Y7PA 1GA0A 3VP0A 1W7FA 1K57A 2ZD8A 1YLTA 1MPLA 1AXBA 2XFSA 1L0FA 3CG5A 4RA7A 3NI9A 2XD1A 5FSRA 4EBNA 4E3LA 3G32A 1MWRA 2JE5A 3SS5A 1PZOA 3W8KA 3HVFA 4JXGA 1G6AA 2P9VA 4OPYA 4DXCA 3MFDA 2Y2KA 5FQQA 1ES4A 4OQIA 4NETA 4BLMA 2J9OA 4R3BA 4S2LA 1ONHA 3GR2A 4DRTA 1LL9A 1NYYA 3HLBA 3IHAA 3IT9A 1ONGA 4N1HA 5DVAA 4BENA 1XGJA 3IF5A 3G4PA 1ZC2A 2PU4A 5CGXA 4C6YA 1YMXA 4K0XA 2Y2NA 5M19A 5EUAA 3W4PA 2XFTA 3IXBA 3PBQA 3A3EA 5TR7A 1N9BA 4ZJ2A 3WS1A 2ZMAA 1C3BA 5FASA 2ZQAA 3WS5A 4O7DA 4JKTA 1EROA 5F83A 1NYMA 5KSHA 3C4PA 3PAGA 2HP5A 5AQBA 4E6WA 3OPPA 1NZOA 1Q2QA 5CERA 5FAPA 1PIOA 1XA1A 2WGWB 3EQUA 2Y2PA 3VMAA 2Y2JA 4MEZA 1MXOA 1I2SA 2XR0A 4ZBEA 5F1FA 4WYYA 1Z6FA 2WKIA 1WYCA 2H10A 4HBUA 2A49A 3HL9A 1CI8A 1ESUA 3OC2A 4E3MA 4OOLA 3N8SA 3M6HA 3E2KA 4OPQA 5GL9A 1IKIA 2WUQA 4DE0A 5EOOA 1ZG6A 3LEZA 4P87A 4X68A 5J8XA 3LCEA 3W4OA 2QZ6A 4LCMA 5AQ9A 3SH9A 1ERMA 1BSGA 3FKWA 1CEGA 1L0DA 1ZKJA 3NBLA 4QY5A 4U0XA 1ES2A 2OLVA 3E2LA 4QJGA 4EBLA 3OZHA 4GNUA 1PI5A 1GHIA 4OPZA 3IF6C 1SDNA 1DJCA 5DF8A 4RX3A 2XH9A 1GA9A 2ZQ8A 3VFHA 1PYYA 1IEMA 3O88A 3NIAA 2H0TA 4KQOA 4PM8A 4S2NC 5HFOA 4PMAA 5FAOA 5CEDA 4OLDA 4YINA 1RCJA 3ISGA 2OV5A 1K55C 3ZNTA 2Y2GA 4R4SA 3PBSA 5GLAA 3VOZA 1YLPA 1KGFA 3V5MA 3AGEA 1FSYA 1NRFA 2G2WA 3HLDA 2X01A 1FCMA 2XGNA 5EVIC 1CK3A 5FA7A 4JXWA 2FFYA 1KE4A 1BLPA 2WADA 1K57C 4R23A 1K6SA 5E2EA 2Q9NA 2ZM0A 4GKUA 3SH8A 3Q82A 4PM5A 1ALQA 1S6RA 3IWIA 3VP4A 1YMSA 1NZUA 2PU2A 4CJNA 4OQHA 1Y54A 3V3RA 4C3QA 2EFUA 3BEBA 5M1AA 3QNCA 4JF4A 2G2UA 5HARA 3RXWA 3Q1FA 1MWUA 4OONA 5A93A 2J7VA 3FYZA 2IWDA 1ES5A 3ZG8B 4C75A 1L0GA 3ZVWA 2EXBA 3GTCA 4OQGA 2ZC4B 2XD5A 1ESIA 4OKPA 1KVLA 3C7UA 5EOEA 3TG9A 3LY3A 3RXXA 1YLWA 1CI9A 1PW1A 1PI4A 3N8RA 4KG5A 1M6KA 4PPRA 4HESA 5CECA 3VP1A 1E4DA 2WGIA 3BFDA 3BRMA 3FWLA 1JWPA 4GB7A 4OQ0A 1W79A 5E2HA 3VSLA 4GD6A 4B88A 2QPNA 2Y91A 4UA7A 5DTSA 3ZG9B 1RGZA 5TFQA 4LV2A 3ZHHA 2Y2MA 3AGFA 2HPBA 4N1XA 3MZEA 1XGIA 3G35A 4OVDA 3S1YA 2JC7A 3PTEA 4BD1A 3VP3A 4ZDXA 3OCNA 3UPOA 3SS3A 4KZ8A 4BL3A 4XUZA 1N4OA 1MWSA 4JBFA 2A3UA 3OPLA 3BFEA 1FCNA 3GRJA 4IEDA 5E2FA 3N4IA 1BULA 3LY4A 4CPKA 3PAEA 1GCEA 3PBTA 5KZHA 2I72A 2EX9A 1KVMA 3HREA 2WKHA 2XF3A 4PM6A 2R9XA 1U60A 3VFFA 5EECA 3PBRA 4S2PA 1RGYA 2WAFA 1E3UD 3FKVA 2RCXA 3MZFA 5D3OA 2Y2QA 4S2OA 3BLMA 5A91A 4QB8A 1QMFA 1L2SA 2HP9A 4N9KA 1K56A 2XDMA 4K0WA 2J9PA 2ZC6B 3GSGA 5CHMA 3N7WA 3QHYA 4DDYA 2Z2MB 1K4EA 1XA7A 4DE2A 3C5AA 1RP5A 4U3TA 1IYOA 4DKIA 2WZXA 3M6BA 4B4XA 5GHYA 5BOHA 4KZ5A 4QHCA 5GLDA 4E3KA 4KZ4A 1H5XA 3MZDA 3ZG5A 1ES3A 3ITAA 2Q9MA 4FSFA 5IHVA 3UDXA 5TGFA 4A5RA 3MXRA 2Y55A 4OOMA 3UN7A 3NDEA 3UDIA 4Y0OA 3Q7VB 3NC8A 1HTZA 2DCFA 3CZDA 2HDSA 3FV7A 4KZAA 4X69A 2ZLYA 1K54A 4ZTKA 5FQKA 4BQMA 2Y59A 2DNSA 3NY4A 3HLWA 4PM9A 1H8YA 3O87A 3TSGA 1XP4A 3IH8A 3M2JA 4E6XA 5DTKA 1GHPA 3Q81A 2ZC5B 3FZCA 4QD4A 4S2JA 5AQAA 1ERQA 4DE1A 3G34A 4Y0TA 5EVID 5M18A 4RYEA 3D4FA 1NY0A 4P85A 5U47A 1BTLA 4X56A 1YT4A 2P74A 3DTMA 4GN2A 4WMCA 3UE1A 5G18A 2WZZA 2ZM8A 4IVKA 3UNWA 3HLCA 4U0TA 4DF6A 1HVBA 3A3JA 3IF6B 1LL5A 4E3IA 1YQSA 3HLGA 5E43A 1W5DA 2EX6A 2ZC7A 2ZJ9A 1PW8A 3BECA 3HBRA 5HW3A 3AGDA 3NCKA 3OPRA 3PBOA 3ZNYA 4N92A 2DRWA 3UDFA 4KZ3A 4JXSA 4MBHA 5FQMA 3EQVA 2WKEA 4S2IA 1S0WA 4JPMA 3B3XA 1OMEA 5EVIB 1BLHA 3IWOA 3QNBA 1TVFA 1YLYA 4WZ4A 3CJMA 5JYOA 2WGWA 5A90A 4LCLA 4E3JA 2ZQDA 3RJUA 3A3FA 3V39A 5HL1A 1E25A 1KDSA 3O86A 3WS4A 1KDWA 4H8RA 1FR1A 2J8YA 3O3VA 4GDBA 2EFXA 4MBKA 2P9VB 2H0YA 1JTDA 2WYXA 1SDEA 1VM1A 1KE3A 1XPBA 4JF6A 5FI6A 3IXDA 1YM1A 2EXAA 2R9WA 4OP8A 2XQZA 3A3IA 3WWXA 3WRTA 5FQ9A 3BFGA 1YLJA 4UHUA 4OPRA 3SS4A 3GVBA 4RX2A 1IYQA 1PWCA 2Z2LB 3P98A 3Q7ZA 5KMWA 3HLFA 4WEJA 5F82A 1FCOA 1FOFA 2V20A 2HDRA 3VSKA 2H5SA 1IELA 5CXWA 1G68A 4X6TA 3GV9A 5CTNA 4E3OA 2X02A 2V1ZA 4KENB 1BLSA 3G30A 1MY8A 3BYDA 1PWDA 1K54C 5FI2A 1LLBA 4QY6A 4OH0A 4WZ5A 5L2FA 4GD8A 3IHBA 1JWVA 3IF6A 3V3SA 4P6BA 1QMEA 2OSUA 5CTMA 1XX2A 2VGKA 1PWGA 2HDUA 1JTGA 3IH9A 4JLFA 5FQJA 1TDLA 4YFMA 2Y2IA 2RL3A 4HEFA 3ZFZA 5CHJA 1EI5A 1JWZA 3S4XA 5CEBA 2ZQCA 1DJBA 3BM6A 4GDNA 5FQIA 2IWCA 4UA9A 4R3JA 4PM7A 1HD8A 1EWZA 3UY6A 1XKZA 2Y2LA 4OLGA 5JYPA 1I5QA 3N8LA 4WBGA 1ZG4A 4KZ7A 4JXVA 3GQZA 5GHZA 3UE3A 4Z9QA 2XEPA 4EUZA 4RVAA 1WE4A 3ZVTA 2ZQ7A 2XK1A 4ID4A 4KZ9A 1K4FA 1TDGA 5DF7A 4M3KA 1MKIA 1I2WA 4HBTA 4R0QA 2IWBA 3BLSA 2HDQA 3V50A 4EV4A 3ITBA 3BFFA 2Y2HA 4IVIA 1J9MA 4QU3A 3MXSA 3SH7A 3NDGA 4X55A 1LI0A 1O7EA 3VP2A 3DW0A 1KGEA 4OP5A 1MBLA 2Y2OA 4E3NA 2C6WB 1FSWA 5HAIA 3ZGAB 1IYPA 2BLSA 4KG2A 2CC1A 5GLCA 3HUOA 3C4OA 5EVLA 4NK3A 4ZJ3A 4FD8A 5FI7A 1NJ4A 1WYBA 3PBNA 3G31A 4DE3A 4JF5A 2UWXA 1PZPA 3UPNA 1FR6A 3IXHA 5DTTA 5FAQA 4R1GA 1GHMA 4GZBA 4OOYA 1K6RA 2XLNA 3IXGA 4Y0UA 2FFFB 4LV1A 4MBFA 3OPHA 3HUMA 4L0LA 5CGWA 5EPHA 4UAAA 4BD0A 2PBYA 2Y4AA 1BLCA 1HZOA 3OCLA 3G2ZA 1CEFA 4KG6A 4EBPA 5F1GA 1BUEA 4KZBA 4WELA 3WS2A 2WAEA 4IBRA 2C5WB 1VQQA 4F94A 3WS0A 4S2KA 4FH2A 4K91A 4Q8IA 4DXBA 3ZCZA 4KQRA 4D2OA 3G2YA 4WZ5C 5HAQA 2BG1A 2X71A 2JBFA 1K38A 5I94A 1SKFA 2EX2A 4UA6A 4EQIA 2HP6A 3SOIA 3A3DA 2EX8A 1MWTA 4B4ZA 3DWZA 1K56D 4XUXA 5HAPA 4WEKA 3ZDJA 3GMWA 1YLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GDN A;  3C7V A;  3Q07 A;  2E8I A;  4S2M A;  5A92 A;  4FCF A;  1E3U A;  1LI9 A;  3MKE A;  1FQG A;  3HLE A;  3IQA A;  3UO9 A;  4WM9 A;  3I7J A;  4IBX A;  3ZG0 A;  5CRF A;  4BL2 A;  2ZM2 A;  3DWK A;  1DY6 A;  3Q7V A;  4R4R A;  1TEM A;  3BFC A;  4ZAM A;  1LHY A;  5GHX A;  5GLB A;  1L0E A;  1O07 A;  2WK0 A;  3N6I A;  4KZ6 A;  1NXY A;  3IWQ A;  3W4Q A;  5CGS A;  5DF9 A;  4MLL A;  3ZG7 B;  2B5R A;  5E2G A;  4ZJ1 A;  3MBZ A;  3MKF A;  3UE0 A;  4DDS A;  1IYS A;  3TOI A;  5HX9 A;  4BJP A;  4P0M A;  2JCH A;  2ZQ9 A;  2WGV A;  5CHU A;  3VOY A;  1M40 A;  2QMI A;  1IKG A;  5AQ7 A;  4GOG A;  3P09 A;  2OLU A;  4LV0 A;  1KGG A;  2V2F F;  3UPP A;  1XXM A;  1DJA A;  4KQQ A;  4EWF A;  4FH4 A;  4XXR A;  4MNR A;  1SCW A;  3WRZ A;  3S22 A;  3HUN A;  4S2N A;  5EE8 A;  1JVJ A;  1H8Z A;  3LO7 A;  3JYI A;  1BT5 A;  1KE0 A;  4WMC D;  1K55 A;  4X53 A;  1W8Q A;  4LV3 A;  4N9L A;  5KSC A;  1Q2P A;  1W8Y A;  2ZC3 B;  5FAT A;  1BZA A;  1K25 A;  2VGJ A;  5FDH A;  4LEN A;  5EVI A;  3CMZ A;  1SHV A;  3M2K A;  4Y7P A;  1GA0 A;  3VP0 A;  1W7F A;  1K57 A;  2ZD8 A;  1YLT A;  1MPL A;  1AXB A;  2XFS A;  1L0F A;  3CG5 A;  4RA7 A;  3NI9 A;  2XD1 A;  5FSR A;  4EBN A;  4E3L A;  3G32 A;  1MWR A;  2JE5 A;  3SS5 A;  1PZO A;  3W8K A;  3HVF A;  4JXG A;  1G6A A;  2P9V A;  4OPY A;  4DXC A;  3MFD A;  2Y2K A;  5FQQ A;  1ES4 A;  4OQI A;  4NET A;  4BLM A;  2J9O A;  4R3B A;  4S2L A;  1ONH A;  3GR2 A;  4DRT A;  1LL9 A;  1NYY A;  3HLB A;  3IHA A;  3IT9 A;  1ONG A;  4N1H A;  5DVA A;  4BEN A;  1XGJ A;  3IF5 A;  3G4P A;  1ZC2 A;  2PU4 A;  5CGX A;  4C6Y A;  1YMX A;  4K0X A;  2Y2N A;  5M19 A;  5EUA A;  3W4P A;  2XFT A;  3IXB A;  3PBQ A;  3A3E A;  5TR7 A;  1N9B A;  4ZJ2 A;  3WS1 A;  2ZMA A;  1C3B A;  5FAS A;  2ZQA A;  3WS5 A;  4O7D A;  4JKT A;  1ERO A;  5F83 A;  1NYM A;  5KSH A;  3C4P A;  3PAG A;  2HP5 A;  5AQB A;  4E6W A;  3OPP A;  1NZO A;  1Q2Q A;  5CER A;  5FAP A;  1PIO A;  1XA1 A;  2WGW B;  3EQU A;  2Y2P A;  3VMA A;  2Y2J A;  4MEZ A;  1MXO A;  1I2S A;  2XR0 A;  4ZBE A;  5F1F A;  4WYY A;  1Z6F A;  2WKI A;  1WYC A;  2H10 A;  4HBU A;  2A49 A;  3HL9 A;  1CI8 A;  1ESU A;  3OC2 A;  4E3M A;  4OOL A;  3N8S A;  3M6H A;  3E2K A;  4OPQ A;  5GL9 A;  1IKI A;  2WUQ A;  4DE0 A;  5EOO A;  1ZG6 A;  3LEZ A;  4P87 A;  4X68 A;  5J8X A;  3LCE A;  3W4O A;  2QZ6 A;  4LCM A;  5AQ9 A;  3SH9 A;  1ERM A;  1BSG A;  3FKW A;  1CEG A;  1L0D A;  1ZKJ A;  3NBL A;  4QY5 A;  4U0X A;  1ES2 A;  2OLV A;  3E2L A;  4QJG A;  4EBL A;  3OZH A;  4GNU A;  1PI5 A;  1GHI A;  4OPZ A;  3IF6 C;  1SDN A;  1DJC A;  5DF8 A;  4RX3 A;  2XH9 A;  1GA9 A;  2ZQ8 A;  3VFH A;  1PYY A;  1IEM A;  3O88 A;  3NIA A;  2H0T A;  4KQO A;  4PM8 A;  4S2N C;  5HFO A;  4PMA A;  5FAO A;  5CED A;  4OLD A;  4YIN A;  1RCJ A;  3ISG A;  2OV5 A;  1K55 C;  3ZNT A;  2Y2G A;  4R4S A;  3PBS A;  5GLA A;  3VOZ A;  1YLP A;  1KGF A;  3V5M A;  3AGE A;  1FSY A;  1NRF A;  2G2W A;  3HLD A;  2X01 A;  1FCM A;  2XGN A;  5EVI C;  1CK3 A;  5FA7 A;  4JXW A;  2FFY A;  1KE4 A;  1BLP A;  2WAD A;  1K57 C;  4R23 A;  1K6S A;  5E2E A;  2Q9N A;  2ZM0 A;  4GKU A;  3SH8 A;  3Q82 A;  4PM5 A;  1ALQ A;  1S6R A;  3IWI A;  3VP4 A;  1YMS A;  1NZU A;  2PU2 A;  4CJN A;  4OQH A;  1Y54 A;  3V3R A;  4C3Q A;  2EFU A;  3BEB A;  5M1A A;  3QNC A;  4JF4 A;  2G2U A;  5HAR A;  3RXW A;  3Q1F A;  1MWU A;  4OON A;  5A93 A;  2J7V A;  3FYZ A;  2IWD A;  1ES5 A;  3ZG8 B;  4C75 A;  1L0G A;  3ZVW A;  2EXB A;  3GTC A;  4OQG A;  2ZC4 B;  2XD5 A;  1ESI A;  4OKP A;  1KVL A;  3C7U A;  5EOE A;  3TG9 A;  3LY3 A;  3RXX A;  1YLW A;  1CI9 A;  1PW1 A;  1PI4 A;  3N8R A;  4KG5 A;  1M6K A;  4PPR A;  4HES A;  5CEC A;  3VP1 A;  1E4D A;  2WGI A;  3BFD A;  3BRM A;  3FWL A;  1JWP A;  4GB7 A;  4OQ0 A;  1W79 A;  5E2H A;  3VSL A;  4GD6 A;  4B88 A;  2QPN A;  2Y91 A;  4UA7 A;  5DTS A;  3ZG9 B;  1RGZ A;  5TFQ A;  4LV2 A;  3ZHH A;  2Y2M A;  3AGF A;  2HPB A;  4N1X A;  3MZE A;  1XGI A;  3G35 A;  4OVD A;  3S1Y A;  2JC7 A;  3PTE A;  4BD1 A;  3VP3 A;  4ZDX A;  3OCN A;  3UPO A;  3SS3 A;  4KZ8 A;  4BL3 A;  4XUZ A;  1N4O A;  1MWS A;  4JBF A;  2A3U A;  3OPL A;  3BFE A;  1FCN A;  3GRJ A;  4IED A;  5E2F A;  3N4I A;  1BUL A;  3LY4 A;  4CPK A;  3PAE A;  1GCE A;  3PBT A;  5KZH A;  2I72 A;  2EX9 A;  1KVM A;  3HRE A;  2WKH A;  2XF3 A;  4PM6 A;  2R9X A;  1U60 A;  3VFF A;  5EEC A;  3PBR A;  4S2P A;  1RGY A;  2WAF A;  1E3U D;  3FKV A;  2RCX A;  3MZF A;  5D3O A;  2Y2Q A;  4S2O A;  3BLM A;  5A91 A;  4QB8 A;  1QMF A;  1L2S A;  2HP9 A;  4N9K A;  1K56 A;  2XDM A;  4K0W A;  2J9P A;  2ZC6 B;  3GSG A;  5CHM A;  3N7W A;  3QHY A;  4DDY A;  2Z2M B;  1K4E A;  1XA7 A;  4DE2 A;  3C5A A;  1RP5 A;  4U3T A;  1IYO A;  4DKI A;  2WZX A;  3M6B A;  4B4X A;  5GHY A;  5BOH A;  4KZ5 A;  4QHC A;  5GLD A;  4E3K A;  4KZ4 A;  1H5X A;  3MZD A;  3ZG5 A;  1ES3 A;  3ITA A;  2Q9M A;  4FSF A;  5IHV A;  3UDX A;  5TGF A;  4A5R A;  3MXR A;  2Y55 A;  4OOM A;  3UN7 A;  3NDE A;  3UDI A;  4Y0O A;  3Q7V B;  3NC8 A;  1HTZ A;  2DCF A;  3CZD A;  2HDS A;  3FV7 A;  4KZA A;  4X69 A;  2ZLY A;  1K54 A;  4ZTK A;  5FQK A;  4BQM A;  2Y59 A;  2DNS A;  3NY4 A;  3HLW A;  4PM9 A;  1H8Y A;  3O87 A;  3TSG A;  1XP4 A;  3IH8 A;  3M2J A;  4E6X A;  5DTK A;  1GHP A;  3Q81 A;  2ZC5 B;  3FZC A;  4QD4 A;  4S2J A;  5AQA A;  1ERQ A;  4DE1 A;  3G34 A;  4Y0T A;  5EVI D;  5M18 A;  4RYE A;  3D4F A;  1NY0 A;  4P85 A;  5U47 A;  1BTL A;  4X56 A;  1YT4 A;  2P74 A;  3DTM A;  4GN2 A;  4WMC A;  3UE1 A;  5G18 A;  2WZZ A;  2ZM8 A;  4IVK A;  3UNW A;  3HLC A;  4U0T A;  4DF6 A;  1HVB A;  3A3J A;  3IF6 B;  1LL5 A;  4E3I A;  1YQS A;  3HLG A;  5E43 A;  1W5D A;  2EX6 A;  2ZC7 A;  2ZJ9 A;  1PW8 A;  3BEC A;  3HBR A;  5HW3 A;  3AGD A;  3NCK A;  3OPR A;  3PBO A;  3ZNY A;  4N92 A;  2DRW A;  3UDF A;  4KZ3 A;  4JXS A;  4MBH A;  5FQM A;  3EQV A;  2WKE A;  4S2I A;  1S0W A;  4JPM A;  3B3X A;  1OME A;  5EVI B;  1BLH A;  3IWO A;  3QNB A;  1TVF A;  1YLY A;  4WZ4 A;  3CJM A;  5JYO A;  2WGW A;  5A90 A;  4LCL A;  4E3J A;  2ZQD A;  3RJU A;  3A3F A;  3V39 A;  5HL1 A;  1E25 A;  1KDS A;  3O86 A;  3WS4 A;  1KDW A;  4H8R A;  1FR1 A;  2J8Y A;  3O3V A;  4GDB A;  2EFX A;  4MBK A;  2P9V B;  2H0Y A;  1JTD A;  2WYX A;  1SDE A;  1VM1 A;  1KE3 A;  1XPB A;  4JF6 A;  5FI6 A;  3IXD A;  1YM1 A;  2EXA A;  2R9W A;  4OP8 A;  2XQZ A;  3A3I A;  3WWX A;  3WRT A;  5FQ9 A;  3BFG A;  1YLJ A;  4UHU A;  4OPR A;  3SS4 A;  3GVB A;  4RX2 A;  1IYQ A;  1PWC A;  2Z2L B;  3P98 A;  3Q7Z A;  5KMW A;  3HLF A;  4WEJ A;  5F82 A;  1FCO A;  1FOF A;  2V20 A;  2HDR A;  3VSK A;  2H5S A;  1IEL A;  5CXW A;  1G68 A;  4X6T A;  3GV9 A;  5CTN A;  4E3O A;  2X02 A;  2V1Z A;  4KEN B;  1BLS A;  3G30 A;  1MY8 A;  3BYD A;  1PWD A;  1K54 C;  5FI2 A;  1LLB A;  4QY6 A;  4OH0 A;  4WZ5 A;  5L2F A;  4GD8 A;  3IHB A;  1JWV A;  3IF6 A;  3V3S A;  4P6B A;  1QME A;  2OSU A;  5CTM A;  1XX2 A;  2VGK A;  1PWG A;  2HDU A;  1JTG A;  3IH9 A;  4JLF A;  5FQJ A;  1TDL A;  4YFM A;  2Y2I A;  2RL3 A;  4HEF A;  3ZFZ A;  5CHJ A;  1EI5 A;  1JWZ A;  3S4X A;  5CEB A;  2ZQC A;  1DJB A;  3BM6 A;  4GDN A;  5FQI A;  2IWC A;  4UA9 A;  4R3J A;  4PM7 A;  1HD8 A;  1EWZ A;  3UY6 A;  1XKZ A;  2Y2L A;  4OLG A;  5JYP A;  1I5Q A;  3N8L A;  4WBG A;  1ZG4 A;  4KZ7 A;  4JXV A;  3GQZ A;  5GHZ A;  3UE3 A;  4Z9Q A;  2XEP A;  4EUZ A;  4RVA A;  1WE4 A;  3ZVT A;  2ZQ7 A;  2XK1 A;  4ID4 A;  4KZ9 A;  1K4F A;  1TDG A;  5DF7 A;  4M3K A;  1MKI A;  1I2W A;  4HBT A;  4R0Q A;  2IWB A;  3BLS A;  2HDQ A;  3V50 A;  4EV4 A;  3ITB A;  3BFF A;  2Y2H A;  4IVI A;  1J9M A;  4QU3 A;  3MXS A;  3SH7 A;  3NDG A;  4X55 A;  1LI0 A;  1O7E A;  3VP2 A;  3DW0 A;  1KGE A;  4OP5 A;  1MBL A;  2Y2O A;  4E3N A;  2C6W B;  1FSW A;  5HAI A;  3ZGA B;  1IYP A;  2BLS A;  4KG2 A;  2CC1 A;  5GLC A;  3HUO A;  3C4O A;  5EVL A;  4NK3 A;  4ZJ3 A;  4FD8 A;  5FI7 A;  1NJ4 A;  1WYB A;  3PBN A;  3G31 A;  4DE3 A;  4JF5 A;  2UWX A;  1PZP A;  3UPN A;  1FR6 A;  3IXH A;  5DTT A;  5FAQ A;  4R1G A;  1GHM A;  4GZB A;  4OOY A;  1K6R A;  2XLN A;  3IXG A;  4Y0U A;  2FFF B;  4LV1 A;  4MBF A;  3OPH A;  3HUM A;  4L0L A;  5CGW A;  5EPH A;  4UAA A;  4BD0 A;  2PBY A;  2Y4A A;  1BLC A;  1HZO A;  3OCL A;  3G2Z A;  1CEF A;  4KG6 A;  4EBP A;  5F1G A;  1BUE A;  4KZB A;  4WEL A;  3WS2 A;  2WAE A;  4IBR A;  2C5W B;  1VQQ A;  4F94 A;  3WS0 A;  4S2K A;  4FH2 A;  4K91 A;  4Q8I A;  4DXB A;  3ZCZ A;  4KQR A;  4D2O A;  3G2Y A;  4WZ5 C;  5HAQ A;  2BG1 A;  2X71 A;  2JBF A;  1K38 A;  5I94 A;  1SKF A;  2EX2 A;  4UA6 A;  4EQI A;  2HP6 A;  3SOI A;  3A3D A;  2EX8 A;  1MWT A;  4B4Z A;  3DWZ A;  1K56 D;  4XUX A;  5HAP A;  4WEK A;  3ZDJ A;  3GMW A;  1YLZ A; 
#chains in the Genus database with same CATH topology
 3C7V A;  4MMN A;  1E3U A;  1LI9 A;  4WM9 A;  4IBX A;  5CRF A;  2JKF A;  3BFC A;  3H82 B;  1PRQ A;  1L0E A;  4P6Z M;  4KUO A;  2ZMV A;  3QP2 A;  4MLL A;  3ZG7 B;  5DFX A;  1OTE A;  3UE0 A;  1ODV A;  4DDS A;  1DP9 A;  1IYS A;  3TOI A;  2WKR A;  2W3F A;  4MN7 A;  5DJU A;  3C2W A;  2OLU A;  4EXO A;  1KGG A;  2V2F F;  3UPP A;  4KQQ A;  4EWF A;  3R7W A;  2V8F A;  4MNR A;  1SCW A;  1TD5 A;  2FZ0 A;  5EE8 A;  3LO7 A;  1SKO A;  3IBJ A;  1BZA A;  2VKS A;  1K25 A;  3OOV A;  3T4K A;  3CHW P;  4LEN A;  4Y7P A;  3VP0 A;  2VV7 A;  4R38 A;  1YLT A;  1MPL A;  2XFS A;  1L0F A;  3CG5 A;  4E3L A;  4EBN A;  1P9R A;  2B95 A;  3HVF A;  5FQQ A;  1OTI A;  4OQI A;  3V67 A;  4BLM A;  3NEC A;  2J9O A;  4R3B A;  4N1H A;  2PT7 A;  1ONG A;  5DVA A;  3IF5 A;  1ACF A;  1ZC2 A;  4K0X A;  2ZL1 A;  4BBV A;  3IXB A;  5TR7 A;  3A3E A;  4F3L A;  1F9I A;  2ZQA A;  1FIL A;  4O7D A;  5HWT A;  2A2L A;  5HDD A;  2O0Y A;  5AQB A;  5A8B A;  5KIZ A;  1Q2Q A;  3DTI A;  1XA1 A;  3EQU A;  2Y2P A;  3VMA A;  2PRF A;  4MEZ A;  5F1F A;  1Z6F A;  3BJN A;  1LSV A;  3HL9 A;  1ESU A;  4E3M A;  4P6Z S;  3M6H A;  3E2K A;  4II7 A;  4OPQ A;  5GL9 A;  2WUQ A;  4R6L A;  5EOO A;  5J8X A;  4P87 A;  3LCE A;  5AQ9 A;  4LCM A;  3FKW A;  3NOT C;  2KX6 A;  4QJG A;  2P7J A;  4GNU A;  1GHI A;  2ZOI A;  4RX3 A;  1EW0 A;  2QKP A;  1GA9 A;  4PMA A;  1RCJ A;  4Y17 A;  4R4S A;  5HSQ A;  3VOZ A;  1KGF A;  4HNB A;  1S4R A;  1FSY A;  5EVI C;  5EV0 A;  4UEY A;  5L07 A;  1CF0 A;  3UB7 A;  4HIA A;  5E2E A;  1S4S A;  5DFY A;  2ZM0 A;  3T12 B;  3VP4 A;  1YMS A;  4KQD A;  1Y54 A;  3V3R A;  3O5Y A;  4JF4 A;  3Q1F A;  2VV8 A;  5A93 A;  3C30 A;  3FYZ A;  1TS0 A;  2IWD A;  1ES5 A;  5IS1 A;  3ZVW A;  3BY8 A;  3ZQ5 A;  4EER A;  3FC7 A;  2XD5 A;  1ESI A;  5EOE A;  3LY3 A;  1CI9 A;  3N8R A;  3QP5 A;  4CLC A;  1E4D A;  3BFD A;  5E2H A;  3FWL A;  4GD6 A;  1F2K A;  2VA0 A;  2GX5 A;  4H6J B;  4LV2 A;  1S66 L;  1T1A A;  3MZE A;  3G35 A;  2JC7 A;  3VP3 A;  3OCN A;  1G5U A;  4ETZ A;  3UPO A;  1TS6 A;  3BFE A;  1FCN A;  1BUL A;  3LY4 A;  3PAE A;  4QPR A;  3HRE A;  2XF3 A;  3VFF A;  4S2P A;  1RGY A;  1Z09 A;  2WAF A;  3IS2 A;  3BLM A;  5A91 A;  4O01 A;  1K56 A;  2I9V A;  2XDM A;  2J9P A;  5CHM A;  3KSH A;  4DDY A;  4QWO A;  3IX4 A;  1XA7 A;  3C5A A;  4DKI A;  3M6B A;  4KZ5 A;  2JN7 A;  3LID A;  1F98 A;  1H5X A;  3LR4 A;  3UDX A;  5TGF A;  3MXR A;  4OOM A;  2EWV A;  4EU0 A;  3NDE A;  3S7O A;  3UDI A;  4YNR A;  4Y0O A;  2DCF A;  4ZTK A;  2V0W A;  4BQM A;  3E0Y A;  3S7P A;  3NY4 A;  3O87 A;  4WL9 A;  2QJ5 A;  4S2J A;  4Y0T A;  4DE1 A;  1NY0 A;  5U47 A;  4G3K A;  5G18 A;  2WZZ A;  2ZM8 A;  3U4L P;  4EW7 A;  1MKM A;  3A3J A;  5AVF A;  5E43 A;  1W5D A;  2EX6 A;  5HW3 A;  3NCK A;  4I3A A;  4N92 A;  1L3L A;  3UDF A;  4JXS A;  4S2I A;  4JPM A;  3B3X A;  2VK3 A;  4DN0 A;  1BLH A;  4ZRR A;  1YSP A;  1TVF A;  1J3W A;  1P9W A;  2WGW A;  3UE6 A;  3LIA A;  3RJU A;  3WS4 A;  1KDW A;  2J8Y A;  3O3V A;  4GDB A;  2P9V B;  3T4S A;  2W3H A;  1S1Y A;  1YM1 A;  2EXA A;  1YLJ A;  4UHU A;  3SS4 A;  3NOU C;  3H7W B;  3IX8 A;  5HWW A;  3T1R A;  2P08 A;  1IYQ A;  1STZ A;  5F82 A;  1FOF A;  4X6T A;  4XT2 A;  2O9B A;  4KEN B;  3CPT A;  1PWD A;  4QY6 A;  3V3S A;  3CAX A;  3HJK A;  5G4Z A;  2BAS A;  1OPX A;  2Y2I A;  5TBM B;  4GDN A;  4Y13 A;  1XKZ A;  4OLG A;  2PDR A;  3N8L A;  4WBG A;  2J3T D;  4JXV A;  3GQZ A;  4EUZ A;  4HHD A;  1WE4 A;  3ZVT A;  2ZQ7 A;  3GEC A;  3BWL A;  1MKI A;  4ARZ B;  2HDQ A;  3V50 A;  3H9W A;  4EV4 A;  1GSV A;  2Y2H A;  4QU3 A;  1J9M A;  3SH7 A;  1LI0 A;  1KGE A;  4E3N A;  2Y2O A;  3SZT A;  1D06 A;  4I3I A;  4KG2 A;  2BLS A;  3LI9 A;  5EVL A;  4EQ1 A;  3OBF A;  4JF5 A;  4EET B;  5FAQ A;  4I5S A;  4LLO B;  3F1P A;  4Y0U A;  3HUM A;  2PBY A;  4R70 A;  2Y4A A;  3VE3 A;  2HJE A;  1P97 A;  4WEL A;  2C5W B;  1VQQ A;  2ACG A;  2QHK A;  4DXB A;  2A24 B;  3G2Y A;  4DJ3 A;  3UB5 P;  2JBF A;  3MMH A;  4KUK A;  2PYR A;  2PHY A;  2EX8 A;  1MWT A;  3DWZ A;  4XUX A;  3ZDJ A;  3GMW A;  2Q0O A;  2JKR M;  4GCZ A;  3MKE A;  3IQA A;  1PNE A;  3I7J A;  4BL2 A;  3R4K A;  2ZM2 A;  1DY6 A;  5FL3 A;  1F5M A;  3N6I A;  1NXY A;  1XJ2 A;  2JKT M;  1DRM A;  5CGS A;  4JGP A;  5E2G A;  4ZJ1 A;  3MBZ A;  3QP6 A;  3W2Z A;  4IHQ A;  4R3A A;  2XRO A;  4BJP A;  4P0M A;  2PBD P;  3NJA A;  3OLO A;  1M40 A;  3VV4 A;  1SZV A;  3P09 A;  2W27 A;  2WKP A;  1XJ6 A;  2ZBB A;  4XXR A;  3CWF A;  3TRC A;  4PAU A;  1H8Z A;  3JYI A;  1KE0 A;  4WMC D;  1W8Q A;  1UWN X;  4LV3 A;  5KSC A;  1W8Y A;  2ZC3 B;  2VGJ A;  4FTX A;  5EVI A;  1SHV A;  1OTB A;  5L09 A;  4NEE D;  5AJG A;  1N9O A;  1AXB A;  4RA7 A;  4GS9 B;  2XD1 A;  3G32 A;  1MWR A;  2JE5 A;  4JXG A;  3B47 A;  1ES4 A;  4Q0I A;  1NYY A;  4JGO A;  3A0S A;  4C6Y A;  1XGJ A;  3G4P A;  5CGX A;  1YMX A;  1Y28 A;  5G4Y A;  3W4P A;  2DMW A;  1C3B A;  1D7E A;  5J7E A;  3T1S A;  3T4J A;  3IBR A;  1ERO A;  1NYM A;  3P7N A;  3PAG A;  3LR5 A;  5CER A;  3E4P A;  2HV1 A;  4ZBE A;  4WYY A;  4LPZ A;  2A49 A;  1CI8 A;  3OC2 A;  1W63 M;  4DE0 A;  4X68 A;  3SH9 A;  3E2L A;  3OZH A;  3LI8 A;  2XH9 A;  2ZQ8 A;  1PYY A;  4S2N C;  4KQO A;  1Y4O A;  5FAO A;  4OLD A;  4YIN A;  3PHY A;  1K55 C;  1WA9 A;  3PBS A;  1YLP A;  5HPF A;  4X1M A;  1NRF A;  2G2W A;  2M1C A;  3HLD A;  2X01 A;  3UME A;  5FA7 A;  2VV6 A;  3FPV A;  1K57 C;  4R23 A;  1YPR A;  3SH8 A;  3Q82 A;  1NZU A;  5CX7 A;  1CJF A;  5M1A A;  2W3D A;  3QNC A;  3RXW A;  4OON A;  2H28 A;  4I38 A;  2EXB A;  3GTC A;  4OQG A;  4K08 A;  1KVL A;  3TG9 A;  3RXX A;  4PPR A;  3MQ0 A;  2NUT C;  3VP1 A;  4JGR A;  1JWP A;  1W79 A;  5DTS A;  2K31 A;  3S7Q A;  1XGI A;  3ICY A;  3S1Y A;  3PTE A;  1GSW A;  3T1X A;  2A3U A;  4IED A;  3GRJ A;  1K0K A;  1UGU A;  4CPK A;  1GCE A;  3PBT A;  5KZH A;  2I72 A;  1KVM A;  2WKH A;  1MC0 A;  3H82 A;  4PM6 A;  3CLO A;  1E3U D;  1S1Z A;  5D3O A;  4S2O A;  3K3D A;  2M7U A;  1QMF A;  2L0W A;  3N7W A;  1RP5 A;  4JGQ A;  4U3T A;  1LSW A;  5GHY A;  5BOH A;  1LT0 A;  3F1N B;  1ES3 A;  5IHV A;  3FG8 A;  4A5R A;  3Q7V B;  1HTZ A;  3FV7 A;  2ZLY A;  5J3W A;  2Y59 A;  2Z6C A;  2PR5 A;  4PM9 A;  2W1R A;  3TSG A;  3M2J A;  1GHP A;  3JPU A;  3T4L A;  1ERQ A;  3G34 A;  2O9A A;  1P0Z A;  2P74 A;  2W0N A;  1HVB A;  3IF6 B;  1V9Y A;  3PXP A;  4E3I A;  1YQS A;  2PAV P;  2ZJ9 A;  1PW8 A;  3ZNY A;  3EQV A;  3QP8 A;  1S0W A;  1YKD A;  1XFQ A;  3F1N A;  3NOP C;  2V9A A;  3CJM A;  5JYO A;  4LCL A;  2ZQD A;  3IX3 A;  1E25 A;  4H8R A;  1FR1 A;  2EFX A;  1XFN A;  3PYP A;  4MCW A;  1AWI A;  2BTF P;  3F1O B;  4Z1W A;  1XPB A;  5FI6 A;  4E3K A;  3WWX A;  2XQZ A;  3A3I A;  3EEH A;  4BBT A;  5FQ9 A;  4RX2 A;  3P98 A;  1PWC A;  3HLF A;  3UB6 A;  3GV9 A;  5HZH A;  3D72 A;  3LEQ A;  1MY8 A;  1LLB A;  4OH0 A;  3IHB A;  3IF6 A;  4P6B A;  1QME A;  4JLF A;  1PWG A;  2HDU A;  5L10 A;  4DMZ A;  3EWK A;  2RL3 A;  4HEF A;  1KOU A;  2V0U A;  4LRZ E;  5CHJ A;  1JWZ A;  3S4X A;  5CEB A;  1DJB A;  5FQI A;  2MJ6 A;  2JHE A;  2L4R A;  3UY6 A;  2Y2L A;  1OJ5 A;  5JYP A;  1I5Q A;  2XK1 A;  1TDG A;  4R0Q A;  4HBT A;  2IWB A;  1UWP X;  5F69 A;  3ITB A;  4Q0J A;  3BFF A;  4IVI A;  3NDG A;  4X55 A;  1O7E A;  1XJ4 A;  3DW0 A;  4IUH A;  1MBL A;  2C6W B;  3NUL A;  1FSW A;  4H6J A;  3SW1 A;  4NXG A;  4CLC D;  1NJ4 A;  4DE3 A;  2WKQ A;  3D9Y A;  5DTT A;  2OWJ A;  3IXG A;  2XLN A;  4LV1 A;  4MBF A;  4BD0 A;  3OCL A;  2ZMF A;  4KG6 A;  5F1G A;  5LBR A;  3DBA A;  2EA9 A;  2WAE A;  1VEU B;  4FH2 A;  2PD7 A;  3ZCZ A;  4KQR A;  4D2O A;  2B02 A;  5I94 A;  2EX2 A;  3MS6 A;  2HP6 A;  4LGW A;  3SOI A;  4EEU A;  4G3V A;  4B4Z A;  1K56 D;  5CGW A;  3Q07 A;  4S2M A;  3MJQ A;  4FCF A;  1DP6 A;  1DP8 A;  1FQG A;  3UMD A;  3BQA A;  3UO9 A;  5L8M A;  4HP9 A;  3ZG0 A;  2V8C A;  1N9L A;  4R4R A;  1TEM A;  4ZAM A;  5GLB A;  3KSF A;  5IT5 A;  1O07 A;  2WK0 A;  3IWQ A;  3W4Q A;  2B5R A;  1FIK A;  4HOI A;  5DJT A;  5HX9 A;  2WGV A;  5CHU A;  1IKG A;  4NXF A;  4IUK A;  1NRJ A;  4LV0 A;  4HJ6 A;  5HD5 A;  3K3C A;  4FH4 A;  3WRZ A;  3HUN A;  4WLA A;  1LSX A;  4S2N A;  2J3W A;  4FOF A;  3MQO A;  4UQI M;  3RFB A;  4MN6 A;  1K55 A;  3ZYT A;  4N9L A;  1VET B;  4G3W A;  2HGV A;  3LUQ A;  5FDH A;  3CMZ A;  1ZTU A;  3M2K A;  4BWI A;  1GA0 A;  1K57 A;  2ZD8 A;  1PZO A;  2W1T B;  1G6A A;  2P9V A;  2NUP C;  2QJ7 A;  3IHA A;  3HLB A;  3IT9 A;  4BEN A;  3H7W A;  5M19 A;  5EUA A;  1OTA A;  3WS1 A;  1N9B A;  2ZMA A;  4HI4 A;  4JKT A;  5F83 A;  4L9G A;  4E6W A;  1PIO A;  1NWZ A;  1WYC A;  3KO6 A;  4Y15 A;  2Y79 A;  4HP4 A;  4OOL A;  3N8S A;  3A0R A;  5TBM A;  1IKI A;  1ZG6 A;  3LEZ A;  3W4O A;  2OWH A;  1CEG A;  1L0D A;  3CIT A;  4QY5 A;  2OLV A;  3B42 A;  1PI5 A;  4HH2 A;  3IF6 C;  1SDN A;  3VFH A;  1IEM A;  5HFO A;  2H0T A;  4LFU A;  3ISG A;  3LIF A;  2OV5 A;  4ARZ A;  2Y2G A;  5GLA A;  3V5M A;  3AGE A;  1FCM A;  1CK3 A;  4Y3I A;  4JXW A;  4UQI S;  2FFY A;  1KE4 A;  1BLP A;  2WAD A;  3LR3 A;  2Q9N A;  4PM5 A;  1S6R A;  3IWI A;  4MN5 A;  5F5Y A;  3EGX C;  4GJ4 A;  4OQH A;  4GHI B;  2EFU A;  3BEB A;  5MC7 A;  1A0K A;  2J7V A;  5F68 A;  1L0G A;  2D01 A;  3B33 A;  4PHT A;  3C7U A;  1PW1 A;  1PI4 A;  4KG5 A;  3C8C A;  4GB7 A;  3BRM A;  4OQ0 A;  3VSL A;  2A24 A;  2V1A A;  4UA7 A;  3T4Q A;  2XA7 M;  1RGZ A;  5TFQ A;  3E98 A;  2HPB A;  4N1X A;  3KSI A;  4BD1 A;  2KLI A;  4ZDX A;  3SS3 A;  4BBU A;  1N4O A;  4JBF A;  2PYP A;  2VEA A;  3N4I A;  4WN5 A;  3HCY A;  2GZA A;  5EM0 A;  2R9X A;  1U60 A;  3T1Q B;  3PBR A;  2RCX A;  2ZOH A;  4E04 A;  2HP9 A;  4K0W A;  5TJJ A;  2ZC6 B;  3GSG A;  5HWV A;  3QHY A;  2V1B A;  4DE2 A;  1IYO A;  4QHC A;  4LRX C;  2VX8 A;  4KZ4 A;  3ITA A;  2Q9M A;  3MR0 A;  2Y55 A;  3EGD C;  4X69 A;  3CZD A;  4KZA A;  1MZU A;  2O99 A;  3VOL A;  3QP1 A;  2FH5 A;  3HLW A;  1H8Y A;  3IH8 A;  4E6X A;  4GS9 A;  5FEF A;  3Q81 A;  2ZC5 B;  5AQA A;  4ME4 A;  5EVI D;  5M18 A;  4RYE A;  4P85 A;  5FEG A;  1H3Q A;  3P01 A;  4O8G A;  4X56 A;  4U0T A;  4YWZ A;  3R7W B;  2XA7 S;  1LL5 A;  1BYW A;  2XSS A;  3BEC A;  4PKY A;  3HBR A;  3OPR A;  1SKO B;  2DRW A;  5FQM A;  2PD8 A;  1G28 A;  3T4T A;  1OME A;  5EVE A;  3QNB A;  1YLY A;  2OAQ 1;  2K7S A;  4WZ4 A;  5A90 A;  1X0O A;  4GLQ A;  3A3F A;  5HL1 A;  1KDS A;  2M7V A;  4MBK A;  1JTD A;  2WYX A;  3L9K A;  3MXQ A;  4RQ9 A;  1VM1 A;  1KE3 A;  4HJ3 A;  2R9W A;  2P04 A;  3WRT A;  3BFG A;  2J80 A;  4OPR A;  2HF6 A;  3KYZ A;  2ZL1 B;  3Q7Z A;  4I39 A;  1LL8 A;  5KMW A;  4F3L B;  1FCO A;  3LYX A;  1OT6 A;  4E3O A;  2X02 A;  4NG2 A;  1BLS A;  2Z6D A;  3BYD A;  1K54 C;  5L2F A;  3CI6 A;  5CTM A;  1XX2 A;  2G7U A;  5FQJ A;  3MF0 A;  1TDL A;  4PKY G;  3ZFZ A;  1EI5 A;  1IFQ A;  2KOI A;  2ZQC A;  3BM6 A;  2IWC A;  3QP4 A;  4UA9 A;  2VZW A;  1HD8 A;  1EWZ A;  4WF0 A;  3MFX A;  4HJ4 A;  4KZ7 A;  5GHZ A;  3UE3 A;  4KZ9 A;  4Y2F A;  5C5K A;  4DJ2 A;  3BLS A;  3BW6 A;  3ZG5 A;  4OP5 A;  5HAI A;  4EUV A;  1IYP A;  4YOF A;  2CC1 A;  3U2A A;  3HUO A;  3PBN A;  3G31 A;  3UPN A;  4FUW A;  4R1G A;  4GZB A;  4OOY A;  1K6R A;  3LIB A;  3JVV A;  4NKP A;  5EPH A;  2JKG A;  4UAA A;  1BLC A;  1CEF A;  3WS2 A;  3LFV A;  5K5B A;  2K2N A;  4CLC B;  1D1J A;  1OJG A;  4WZ5 C;  4EEP A;  2X71 A;  1K38 A;  4UA6 A;  4EQI A;  1HLU P;  3A3D A;  2L1M A;  5HAP A;  4WEK A;  1YLZ A;  2GDN A;  5A92 A;  2E8I A;  3HLE A;  4M4X A;  3DWK A;  3Q7V A;  5DKL A;  1LHY A;  1YAX A;  5GHX A;  4KZ6 A;  1TF1 A;  5DF9 A;  3IS2 B;  5HDS A;  3MKF A;  2E8J A;  5I5L A;  1N9N A;  2JCH A;  2ZQ9 A;  4CQH A;  4ESP A;  3VOY A;  2QMI A;  5AQ7 A;  4GOG A;  3RTY A;  1XXM A;  2OOL A;  1VB6 A;  1DJA A;  3S22 A;  1JVJ A;  4D60 A;  1BT5 A;  3CUE C;  4X53 A;  3EOI A;  3UB8 A;  1Q2P A;  5FAT A;  2IA2 A;  1W7F A;  4HY8 A;  5FSR A;  3NI9 A;  3HJI A;  1TS8 A;  3SS5 A;  3W8K A;  4OPY A;  4HQA A;  4DXC A;  3MFD A;  2Y2K A;  3UB9 A;  3F1O A;  4NET A;  3GDI A;  4S2L A;  1ONH A;  1T18 A;  1OT9 A;  3GR2 A;  4DRT A;  1LL9 A;  2PU4 A;  1T1C A;  3TW8 A;  2Y2N A;  3LIE A;  2B18 A;  2XFT A;  3PBQ A;  5FAS A;  4ZJ2 A;  2VGL M;  3WS5 A;  4X1L A;  5KSH A;  3C4P A;  2HP5 A;  3KSG A;  4CLC E;  3DTE A;  3OPP A;  1NZO A;  5FAP A;  2WGW B;  1T19 A;  2Y2J A;  4MDZ A;  1MXO A;  1I2S A;  2XR0 A;  4L9F A;  3PR6 A;  2WKI A;  2H10 A;  3D3O A;  3KYQ A;  4HBU A;  5EM1 A;  3ULF A;  5J4E A;  5HPI A;  2QZ6 A;  1T1B A;  1ERM A;  4IJG A;  1BSG A;  1ZKJ A;  3NBL A;  4U0X A;  1ES2 A;  2YKH A;  4EBL A;  4OPZ A;  1DJC A;  5DF8 A;  4X25 A;  3JVU A;  4PM8 A;  3O88 A;  3NIA A;  2VJW A;  3FPW A;  5CED A;  4XT2 B;  3ZNT A;  3VE4 A;  3CPT B;  2XGN A;  1TS7 A;  4Q0H A;  2YKF A;  1K6S A;  4GKU A;  1ALQ A;  2PU2 A;  4CJN A;  4C3Q A;  2HJ9 C;  2G2U A;  5HAR A;  3T50 A;  1MWU A;  1PFL A;  2GJ3 A;  3ZG8 B;  4C75 A;  1NLY A;  5IU1 A;  3BY9 A;  4B93 A;  2ZC4 B;  3A0V A;  4OKP A;  1YLW A;  1M6K A;  2LB9 A;  4HES A;  5CEC A;  1VEU A;  2WGI A;  3T4O A;  4B88 A;  3K2N A;  2QPN A;  2VLG A;  2Y91 A;  3ZG9 B;  2VGL S;  3ZHH A;  1W63 Q;  2Y2M A;  3AGF A;  5AVE A;  4OVD A;  4BL3 A;  4KZ8 A;  5HDC A;  4XUZ A;  1MWS A;  3F1P B;  3OPL A;  5E2F A;  2JKR I;  2EX9 A;  5EEC A;  4NXE A;  2EWW A;  3FKV A;  3MZF A;  3LR0 A;  2XRN A;  2Y2Q A;  2JKT I;  4QB8 A;  1L2S A;  4N9K A;  2OAP 1;  3KX0 X;  3E4O A;  2Z2M B;  1K4E A;  2WZX A;  4B4X A;  2R78 A;  1G6O A;  5GLD A;  2PR6 A;  3MZD A;  4FSF A;  1GSX A;  4I3J A;  3UN7 A;  3L7H A;  4NXB A;  4LRY C;  2GNX A;  4B9O A;  3NC8 A;  3BQ8 A;  2HDS A;  1VET A;  3RH8 B;  1K54 A;  5FQK A;  3MSH A;  1S67 L;  2DNS A;  1XP4 A;  4CLC C;  5DTK A;  4EES A;  4QD4 A;  2UV0 E;  3FZC A;  2W1T A;  3D4F A;  1BTL A;  4Y5F A;  1YT4 A;  3NHQ A;  3DTM A;  4GN2 A;  4WMC A;  5F6A A;  3UE1 A;  2HZ5 A;  4IVK A;  3UNW A;  3HLC A;  4DF6 A;  3G6O A;  3HLG A;  2ZC7 A;  3AGD A;  3PBO A;  4KZ3 A;  2Y8H A;  1IOU A;  4MBH A;  2WKE A;  3C38 A;  5EVI B;  3IWO A;  2KDK A;  4E3J A;  3V39 A;  3O86 A;  5DKK A;  5EFW A;  2H0Y A;  1SDE A;  2W3E A;  2INW A;  4JF6 A;  3IXD A;  4OP8 A;  3GVB A;  2W3G A;  2Z2L B;  4ETX A;  4WEJ A;  2O9C A;  2QYB A;  2CMN A;  2V20 A;  2HDR A;  3VSK A;  3DTK A;  2H5S A;  1IEL A;  5CXW A;  1G68 A;  5CTN A;  3DAV A;  4GW9 A;  1ZHH B;  2V1Z A;  4HH3 A;  3G30 A;  4AFI A;  5FI2 A;  4WZ5 A;  4GD8 A;  1JWV A;  2OSU A;  4O0P A;  2VGK A;  1JTG A;  3IH9 A;  4YFM A;  4GHI A;  5HL6 A;  4R3J A;  4PM7 A;  1H8M A;  1ZG4 A;  4Z9Q A;  2XEP A;  4RVA A;  3E4Q A;  4ID4 A;  1K4F A;  3TJZ C;  5DF7 A;  5HD3 A;  1YSQ A;  4M3K A;  1I2W A;  2J3T C;  3LIC A;  3EEA A;  3S7N A;  3LGO A;  1XJ3 A;  3MXS A;  3VP2 A;  4L9E A;  1V9Z A;  3ZGA B;  5GLC A;  3C4O A;  4ZJ3 A;  4NK3 A;  4FD8 A;  5FI7 A;  1WYB A;  2UWX A;  1PZP A;  1FR6 A;  3IXH A;  1GHM A;  2D02 A;  3KYE A;  3CUE A;  2FFF B;  3OPH A;  4L0L A;  1NLZ A;  1HZO A;  2QWS A;  3G2Z A;  4EBP A;  1BUE A;  2LB5 A;  4KZB A;  4BMW A;  4IBR A;  1H0M A;  1VHM A;  4F94 A;  3WS0 A;  4S2K A;  4K91 A;  4Q8I A;  2AVX A;  5HAQ A;  3MQQ A;  2BG1 A;  4WUJ A;  5FDS A;  1OTD A;  1SKF A;  1JNU A;  3TE8 A;  1CQA A; 
#chains in the Genus database with same CATH homology
 2GDN A;  3C7V A;  3Q07 A;  2E8I A;  4S2M A;  5A92 A;  4FCF A;  1E3U A;  1LI9 A;  3MKE A;  1FQG A;  3HLE A;  3IQA A;  3UO9 A;  4WM9 A;  3I7J A;  4IBX A;  3ZG0 A;  5CRF A;  4BL2 A;  2ZM2 A;  3DWK A;  1DY6 A;  3Q7V A;  4R4R A;  1TEM A;  3BFC A;  4ZAM A;  1LHY A;  5GHX A;  5GLB A;  1L0E A;  1O07 A;  2WK0 A;  3N6I A;  4KZ6 A;  1NXY A;  3IWQ A;  3W4Q A;  5CGS A;  5DF9 A;  4MLL A;  3ZG7 B;  2B5R A;  5E2G A;  4ZJ1 A;  3MBZ A;  3MKF A;  3UE0 A;  4DDS A;  1IYS A;  3TOI A;  5HX9 A;  4BJP A;  4P0M A;  2JCH A;  2ZQ9 A;  2WGV A;  5CHU A;  3VOY A;  1M40 A;  2QMI A;  1IKG A;  5AQ7 A;  4GOG A;  3P09 A;  2OLU A;  4LV0 A;  1KGG A;  2V2F F;  3UPP A;  1XXM A;  1DJA A;  4KQQ A;  4EWF A;  4FH4 A;  4XXR A;  4MNR A;  1SCW A;  3WRZ A;  3S22 A;  3HUN A;  4S2N A;  5EE8 A;  1JVJ A;  1H8Z A;  3LO7 A;  3JYI A;  1BT5 A;  1KE0 A;  4WMC D;  1K55 A;  4X53 A;  1W8Q A;  4LV3 A;  4N9L A;  5KSC A;  1Q2P A;  1W8Y A;  2ZC3 B;  5FAT A;  1BZA A;  1K25 A;  2VGJ A;  5FDH A;  4LEN A;  5EVI A;  3CMZ A;  1SHV A;  3M2K A;  4Y7P A;  1GA0 A;  3VP0 A;  1W7F A;  1K57 A;  2ZD8 A;  1YLT A;  1MPL A;  1AXB A;  2XFS A;  1L0F A;  3CG5 A;  4RA7 A;  3NI9 A;  2XD1 A;  5FSR A;  4EBN A;  4E3L A;  3G32 A;  1MWR A;  2JE5 A;  3SS5 A;  1PZO A;  3W8K A;  3HVF A;  4JXG A;  1G6A A;  2P9V A;  4OPY A;  4DXC A;  3MFD A;  2Y2K A;  5FQQ A;  1ES4 A;  4OQI A;  4NET A;  4BLM A;  2J9O A;  4R3B A;  4S2L A;  1ONH A;  3GR2 A;  4DRT A;  1LL9 A;  1NYY A;  3HLB A;  3IHA A;  3IT9 A;  1ONG A;  4N1H A;  5DVA A;  4BEN A;  1XGJ A;  3IF5 A;  3G4P A;  1ZC2 A;  2PU4 A;  5CGX A;  4C6Y A;  1YMX A;  4K0X A;  2Y2N A;  5M19 A;  5EUA A;  3W4P A;  2XFT A;  3IXB A;  3PBQ A;  3A3E A;  5TR7 A;  1N9B A;  4ZJ2 A;  3WS1 A;  2ZMA A;  1C3B A;  5FAS A;  2ZQA A;  3WS5 A;  4O7D A;  4JKT A;  1ERO A;  5F83 A;  1NYM A;  5KSH A;  3C4P A;  3PAG A;  2HP5 A;  5AQB A;  4E6W A;  3OPP A;  1NZO A;  1Q2Q A;  5CER A;  5FAP A;  1PIO A;  1XA1 A;  2WGW B;  3EQU A;  2Y2P A;  3VMA A;  2Y2J A;  4MEZ A;  1MXO A;  1I2S A;  2XR0 A;  4ZBE A;  5F1F A;  4WYY A;  1Z6F A;  2WKI A;  1WYC A;  2H10 A;  4HBU A;  2A49 A;  3HL9 A;  1CI8 A;  1ESU A;  3OC2 A;  4E3M A;  4OOL A;  3N8S A;  3M6H A;  3E2K A;  4OPQ A;  5GL9 A;  1IKI A;  2WUQ A;  4DE0 A;  5EOO A;  1ZG6 A;  3LEZ A;  4P87 A;  4X68 A;  5J8X A;  3LCE A;  3W4O A;  2QZ6 A;  4LCM A;  5AQ9 A;  3SH9 A;  1ERM A;  1BSG A;  3FKW A;  1CEG A;  1L0D A;  1ZKJ A;  3NBL A;  4QY5 A;  4U0X A;  1ES2 A;  2OLV A;  3E2L A;  4QJG A;  4EBL A;  3OZH A;  4GNU A;  1PI5 A;  1GHI A;  4OPZ A;  3IF6 C;  1SDN A;  1DJC A;  5DF8 A;  4RX3 A;  2XH9 A;  1GA9 A;  2ZQ8 A;  3VFH A;  1PYY A;  1IEM A;  3O88 A;  3NIA A;  2H0T A;  4KQO A;  4PM8 A;  4S2N C;  5HFO A;  4PMA A;  5FAO A;  5CED A;  4OLD A;  4YIN A;  1RCJ A;  3ISG A;  2OV5 A;  1K55 C;  3ZNT A;  2Y2G A;  4R4S A;  3PBS A;  5GLA A;  3VOZ A;  1YLP A;  1KGF A;  3V5M A;  3AGE A;  1FSY A;  1NRF A;  2G2W A;  3HLD A;  2X01 A;  1FCM A;  2XGN A;  5EVI C;  1CK3 A;  5FA7 A;  4JXW A;  2FFY A;  1KE4 A;  1BLP A;  2WAD A;  1K57 C;  4R23 A;  1K6S A;  5E2E A;  2Q9N A;  2ZM0 A;  4GKU A;  3SH8 A;  3Q82 A;  4PM5 A;  1ALQ A;  1S6R A;  3IWI A;  3VP4 A;  1YMS A;  1NZU A;  2PU2 A;  4CJN A;  4OQH A;  1Y54 A;  3V3R A;  4C3Q A;  2EFU A;  3BEB A;  5M1A A;  3QNC A;  4JF4 A;  2G2U A;  5HAR A;  3RXW A;  3Q1F A;  1MWU A;  4OON A;  5A93 A;  2J7V A;  3FYZ A;  2IWD A;  1ES5 A;  3ZG8 B;  4C75 A;  1L0G A;  3ZVW A;  2EXB A;  3GTC A;  4OQG A;  2ZC4 B;  2XD5 A;  1ESI A;  4OKP A;  1KVL A;  3C7U A;  5EOE A;  3TG9 A;  3LY3 A;  3RXX A;  1YLW A;  1CI9 A;  1PW1 A;  1PI4 A;  3N8R A;  4KG5 A;  1M6K A;  4PPR A;  4HES A;  5CEC A;  3VP1 A;  1E4D A;  2WGI A;  3BFD A;  3BRM A;  3FWL A;  1JWP A;  4GB7 A;  4OQ0 A;  1W79 A;  5E2H A;  3VSL A;  4GD6 A;  4B88 A;  2QPN A;  2Y91 A;  4UA7 A;  5DTS A;  3ZG9 B;  1RGZ A;  5TFQ A;  4LV2 A;  3ZHH A;  2Y2M A;  3AGF A;  2HPB A;  4N1X A;  3MZE A;  1XGI A;  3G35 A;  4OVD A;  3S1Y A;  2JC7 A;  3PTE A;  4BD1 A;  3VP3 A;  4ZDX A;  3OCN A;  3UPO A;  3SS3 A;  4KZ8 A;  4BL3 A;  4XUZ A;  1N4O A;  1MWS A;  4JBF A;  2A3U A;  3OPL A;  3BFE A;  1FCN A;  3GRJ A;  4IED A;  5E2F A;  3N4I A;  1BUL A;  3LY4 A;  4CPK A;  3PAE A;  1GCE A;  3PBT A;  5KZH A;  2I72 A;  2EX9 A;  1KVM A;  3HRE A;  2WKH A;  2XF3 A;  4PM6 A;  2R9X A;  1U60 A;  3VFF A;  5EEC A;  3PBR A;  4S2P A;  1RGY A;  2WAF A;  1E3U D;  3FKV A;  2RCX A;  3MZF A;  5D3O A;  2Y2Q A;  4S2O A;  3BLM A;  5A91 A;  4QB8 A;  1QMF A;  1L2S A;  2HP9 A;  4N9K A;  1K56 A;  2XDM A;  4K0W A;  2J9P A;  2ZC6 B;  3GSG A;  5CHM A;  3N7W A;  3QHY A;  4DDY A;  2Z2M B;  1K4E A;  1XA7 A;  4DE2 A;  3C5A A;  1RP5 A;  4U3T A;  1IYO A;  4DKI A;  2WZX A;  3M6B A;  4B4X A;  5GHY A;  5BOH A;  4KZ5 A;  4QHC A;  5GLD A;  4E3K A;  4KZ4 A;  1H5X A;  3MZD A;  3ZG5 A;  1ES3 A;  3ITA A;  2Q9M A;  4FSF A;  5IHV A;  3UDX A;  5TGF A;  4A5R A;  3MXR A;  2Y55 A;  4OOM A;  3UN7 A;  3NDE A;  3UDI A;  4Y0O A;  3Q7V B;  3NC8 A;  1HTZ A;  2DCF A;  3CZD A;  2HDS A;  3FV7 A;  4KZA A;  4X69 A;  2ZLY A;  1K54 A;  4ZTK A;  5FQK A;  4BQM A;  2Y59 A;  2DNS A;  3NY4 A;  3HLW A;  4PM9 A;  1H8Y A;  3O87 A;  3TSG A;  1XP4 A;  3IH8 A;  3M2J A;  4E6X A;  5DTK A;  1GHP A;  3Q81 A;  2ZC5 B;  3FZC A;  4QD4 A;  4S2J A;  5AQA A;  1ERQ A;  4DE1 A;  3G34 A;  4Y0T A;  5EVI D;  5M18 A;  4RYE A;  3D4F A;  1NY0 A;  4P85 A;  5U47 A;  1BTL A;  4X56 A;  1YT4 A;  2P74 A;  3DTM A;  4GN2 A;  4WMC A;  3UE1 A;  5G18 A;  2WZZ A;  2ZM8 A;  4IVK A;  3UNW A;  3HLC A;  4U0T A;  4DF6 A;  1HVB A;  3A3J A;  3IF6 B;  1LL5 A;  4E3I A;  1YQS A;  3HLG A;  5E43 A;  1W5D A;  2EX6 A;  2ZC7 A;  2ZJ9 A;  1PW8 A;  3BEC A;  3HBR A;  5HW3 A;  3AGD A;  3NCK A;  3OPR A;  3PBO A;  3ZNY A;  4N92 A;  2DRW A;  3UDF A;  4KZ3 A;  4JXS A;  4MBH A;  5FQM A;  3EQV A;  2WKE A;  4S2I A;  1S0W A;  4JPM A;  3B3X A;  1OME A;  5EVI B;  1BLH A;  3IWO A;  3QNB A;  1TVF A;  1YLY A;  4WZ4 A;  3CJM A;  5JYO A;  2WGW A;  5A90 A;  4LCL A;  4E3J A;  2ZQD A;  3RJU A;  3A3F A;  3V39 A;  5HL1 A;  1E25 A;  1KDS A;  3O86 A;  3WS4 A;  1KDW A;  4H8R A;  1FR1 A;  2J8Y A;  3O3V A;  4GDB A;  2EFX A;  4MBK A;  2P9V B;  2H0Y A;  1JTD A;  2WYX A;  1SDE A;  1VM1 A;  1KE3 A;  1XPB A;  4JF6 A;  5FI6 A;  3IXD A;  1YM1 A;  2EXA A;  2R9W A;  4OP8 A;  2XQZ A;  3A3I A;  3WWX A;  3WRT A;  5FQ9 A;  3BFG A;  1YLJ A;  4UHU A;  4OPR A;  3SS4 A;  3GVB A;  4RX2 A;  1IYQ A;  1PWC A;  2Z2L B;  3P98 A;  3Q7Z A;  5KMW A;  3HLF A;  4WEJ A;  5F82 A;  1FCO A;  1FOF A;  2V20 A;  2HDR A;  3VSK A;  2H5S A;  1IEL A;  5CXW A;  1G68 A;  4X6T A;  3GV9 A;  5CTN A;  4E3O A;  2X02 A;  2V1Z A;  4KEN B;  1BLS A;  3G30 A;  1MY8 A;  3BYD A;  1PWD A;  1K54 C;  5FI2 A;  1LLB A;  4QY6 A;  4OH0 A;  4WZ5 A;  5L2F A;  4GD8 A;  3IHB A;  1JWV A;  3IF6 A;  3V3S A;  4P6B A;  1QME A;  2OSU A;  5CTM A;  1XX2 A;  2VGK A;  1PWG A;  2HDU A;  1JTG A;  3IH9 A;  4JLF A;  5FQJ A;  1TDL A;  4YFM A;  2Y2I A;  2RL3 A;  4HEF A;  3ZFZ A;  5CHJ A;  1EI5 A;  1JWZ A;  3S4X A;  5CEB A;  2ZQC A;  1DJB A;  3BM6 A;  4GDN A;  5FQI A;  2IWC A;  4UA9 A;  4R3J A;  4PM7 A;  1HD8 A;  1EWZ A;  3UY6 A;  1XKZ A;  2Y2L A;  4OLG A;  5JYP A;  1I5Q A;  3N8L A;  4WBG A;  1ZG4 A;  4KZ7 A;  4JXV A;  3GQZ A;  5GHZ A;  3UE3 A;  4Z9Q A;  2XEP A;  4EUZ A;  4RVA A;  1WE4 A;  3ZVT A;  2ZQ7 A;  2XK1 A;  4ID4 A;  4KZ9 A;  1K4F A;  1TDG A;  5DF7 A;  4M3K A;  1MKI A;  1I2W A;  4HBT A;  4R0Q A;  2IWB A;  3BLS A;  2HDQ A;  3V50 A;  4EV4 A;  3ITB A;  3BFF A;  2Y2H A;  4IVI A;  1J9M A;  4QU3 A;  3MXS A;  3SH7 A;  3NDG A;  4X55 A;  1LI0 A;  1O7E A;  3VP2 A;  3DW0 A;  1KGE A;  4OP5 A;  1MBL A;  2Y2O A;  4E3N A;  2C6W B;  1FSW A;  5HAI A;  3ZGA B;  1IYP A;  2BLS A;  4KG2 A;  2CC1 A;  5GLC A;  3HUO A;  3C4O A;  5EVL A;  4NK3 A;  4ZJ3 A;  4FD8 A;  5FI7 A;  1NJ4 A;  1WYB A;  3PBN A;  3G31 A;  4DE3 A;  4JF5 A;  2UWX A;  1PZP A;  3UPN A;  1FR6 A;  3IXH A;  5DTT A;  5FAQ A;  4R1G A;  1GHM A;  4GZB A;  4OOY A;  1K6R A;  2XLN A;  3IXG A;  4Y0U A;  2FFF B;  4LV1 A;  4MBF A;  3OPH A;  3HUM A;  4L0L A;  5CGW A;  5EPH A;  4UAA A;  4BD0 A;  2PBY A;  2Y4A A;  1BLC A;  1HZO A;  3OCL A;  3G2Z A;  1CEF A;  4KG6 A;  4EBP A;  5F1G A;  1BUE A;  4KZB A;  4WEL A;  3WS2 A;  2WAE A;  4IBR A;  2C5W B;  1VQQ A;  4F94 A;  3WS0 A;  4S2K A;  4FH2 A;  4K91 A;  4Q8I A;  4DXB A;  3ZCZ A;  4KQR A;  4D2O A;  3G2Y A;  4WZ5 C;  5HAQ A;  2BG1 A;  2X71 A;  2JBF A;  1K38 A;  5I94 A;  1SKF A;  2EX2 A;  4UA6 A;  4EQI A;  2HP6 A;  3SOI A;  3A3D A;  2EX8 A;  1MWT A;  4B4Z A;  3DWZ A;  1K56 D;  4XUX A;  5HAP A;  4WEK A;  3ZDJ A;  3GMW A;  1YLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...