2H0TA

Crystal structure of the m69v e166a double mutant of shv-1 b-lactamase complexed to clavulanic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMVSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWATELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Broad-spectrum beta-lactamase SHV-1
publication title Effect of the inhibitor-resistant M69V substitution on the structures and populations of trans-enamine beta-lactamase intermediates.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 98
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2h0tA00
1K25A 4JPMA 1K56A 3CJMA 4K0XA 3WS5A 4JXWA 4BD1A 5AQ9A 4KZ3A 4Y7PA 5DVAA 5EVIA 3Q1FA 4Q8IA 1BULA 1K57A 5JYPA 4XUXA 4OKPA 3A3FA 3PBRA 3VP4A 1W79A 3N7WA 2Y2MA 5TFQA 1JVJA 4L0LA 1XP4A 5GHYA 2Q9MA 3ITBA 3BFEA 3SS3A 4JF4A 2WUQA 3IXBA 2WKIA 4EQIA 1GCEA 4P0MA 3VSLA 2A3UA 2V2FF 3UPPA 2B5RA 1TVFA 1WYCA 4BENA 1PI5A 2IWCA 2JE5A 1IKGA 2XR0A 3GTCA 3PBSA 4R3BA 1FQGA 3G30A 2V20A 5GLDA 2JBFA 4ZAMA 4ZBEA 4GD8A 3GVBA 3BECA 3OPHA 3ZVTA 3BM6A 4E3JA 4WEJA 1N9BA 5CHJA 1MKIA 4OLGA 4FD8A 4A5RA 2V1ZA 3UY6A 3WS1A 3UPOA 1NZOA 2Q9NA 4OQ0A 3LO7A 4S2NC 1L0EA 3IT9A 4PM8A 3IHBA 4DE2A 2ZC5B 3ZG8B 1U60A 2Z2MB 3NY4A 4WZ5C 4WMCA 4N9LA 4OH0A 2J8YA 5HAPA 3MZEA 1EWZA 3UPNA 1PYYA 1XX2A 1W8QA 5EVIC 3SH7A 1K57C 1JTDA 3C5AA 2QPNA 5E43A 3Q7VB 3FYZA 3M6HA 1IEMA 2XK1A 4JF6A 1ES2A 4GN2A 2P74A 3C4OA 4MEZA 3HBRA 3OCNA 1ESUA 4ZJ1A 3TOIA 4OPQA 3BFGA 5HL1A 2Y2KA 4KZ6A 1MXOA 4Y0OA 1XA1A 3WS0A 4BD0A 3BLSA 4M3KA 1IYOA 5AQBA 1BLSA 2RL3A 5KZHA 1ESIA 1PWDA 3HREA 4IBXA 5A90A 4S2LA 3PBQA 2H0YA 4CPKA 4NETA 1RGYA 5GLBA 2A49A 1JTGA 3C4PA 3MKFA 4DKIA 5HAQA 1ERQA 3JYIA 3Q7VA 1SDEA 3M2JA 3M6BA 4XUZA 1CI8A 4GNUA 4IVKA 1BZAA 1ERMA 1YLWA 2OSUA 5CXWA 3OZHA 4RA7A 3MZDA 2DCFA 1K6RA 5KMWA 3G35A 3FKWA 1JWZA 3EQVA 4WBGA 1XGIA 5CHMA 3DTMA 1KE3A 4HBUA 1EROA 4DE3A 1PW8A 2E8IA 5E2HA 2DRWA 4OPZA 1H5XA 3BRMA 2Y91A 2Y2JA 4PMAA 4HEFA 3V5MA 3ZNTA 1KGEA 2ZQ8A 1L0DA 3A3DA 3HLWA 1PZPA 1Q2QA 5DF7A 3NDGA 2P9VA 3HUNA 5FSRA 3S22A 2J9PA 4KG5A 1BLCA 1IYQA 1KGGA 5G18A 3HLGA 3IF6B 3E2LA 4Y0TA 1KVMA 4UA6A 2HDRA 1CK3A 3TG9A 4B4XA 4BQMA 1GA0A 3QNBA 3MBZA 5FQJA 5EVLA 4X6TA 4OP5A 4WM9A 3B3XA 4QB8A 1YLYA 4JXVA 4LV1A 5DF8A 5F82A 2CC1A 4IVIA 5FAOA 3UE3A 5FI6A 1E4DA 2ZD8A 4QHCA 4Y0UA 1XXMA 3O87A 1S0WA 3W4OA 3O3VA 4OONA 2WK0A 4KQRA 4B88A 5HX9A 1NYMA 4P6BA 3BEBA 1PW1A 2VGKA 5E2EA 5TGFA 4PM5A 1DJBA 1ALQA 1GA9A 1GHMA 3UE1A 4E6WA 4DDYA 1ES3A 4EV4A 3HUMA 4PPRA 1YLTA 4RYEA 2OLUA 2EFUA 3GQZA 3BFFA 4OLDA 4KG6A 3S1YA 1J9MA 2UWXA 4S2MA 1I2WA 5M1AA 2ZQDA 5FI2A 1QMEA 2XD1A 4MBFA 1XKZA 2ZQ9A 2WAEA 4JF5A 4DDSA 2G2UA 2XLNA 1ES4A 3G31A 1YM1A 5HFOA 1FR6A 3NC8A 1PI4A 4KZBA 4WYYA 4ZJ3A 4DRTA 1LHYA 3AGFA 5EOOA 1FSYA 5KSCA 5FQIA 3FWLA 4R3JA 4GD6A 4JLFA 4PM6A 4O7DA 2WZXA 2ZM0A 2ZJ9A 3UDFA 1K4FA 4WZ4A 1YQSA 2EX2A 3ZGAB 3CG5A 4PM7A 1K54A 4KZ8A 3MFDA 4P87A 1FOFA 4MNRA 2PU4A 5FAPA 1O7EA 3S4XA 1L0FA 2EXBA 2Y2HA 3BYDA 5CEDA 5EECA 2DNSA 2ZMAA 1DJCA 3G32A 1VM1A 3IQAA 1ZG4A 3I7JA 4GZBA 1S6RA 2Y2PA 1KGFA 2XGNA 2EX9A 4LCMA 3G4PA 3IXHA 1C3BA 1VQQA 1W8YA 3FKVA 3MZFA 4P85A 3VP3A 3C7UA 4RVAA 3VP1A 2X02A 4X68A 2Y2IA 1OMEA 3RXXA 3O86A 3IWQA 1BLHA 3HLBA 4WELA 2Y55A 4X53A 3UDIA 2ZM2A 3PTEA 2GDNA 2WKEA 3AGDA 4N1XA 4D2OA 4JXGA 4DXBA 3ITAA 4KZAA 2ZC6B 2HPBA 1W7FA 3MXSA 1IYSA 1K55A 5EPHA 2J9OA 1K56D 2RCXA 3GMWA 4X55A 1KE4A 3SH9A 4CJNA 4GDBA 1K54C 4E3LA 4S2KA 4OOLA 3A3EA 5CGSA 2ZC7A 3HLFA 4E3OA 1YT4A 5EVID 2FFFB 4GKUA 1FCNA 5DTTA 3MXRA 2QMIA 2G2WA 1FSWA 1W5DA 5DF9A 3OPRA 1GHIA 2WADA 5FI7A 4H8RA 1SKFA 2JC7A 4K0WA 5CRFA 2WKHA 3MKEA 4K91A 2BLSA 2OV5A 3G34A 3ZDJA 4KQOA 1KVLA 4BL2A 2HP5A 5GHXA 4DE1A 4OQGA 1MY8A 5CERA 5L2FA 1L0GA 1IELA 1M40A 3C7VA 2XDMA 4OQHA 2FFYA 4LV3A 5AQ7A 1IKIA 2HDUA 3V3SA 3VSKA 2ZQAA 5CGXA 1HVBA 1YMXA 4S2IA 5CTNA 4C75A 4YINA 1KDWA 4MBKA 1YLZA 1WYBA 4N9KA 1SCWA 2J7VA 2Y2NA 3IF5A 2WGVA 3NBLA 3ZNYA 1PWGA 4UAAA 4E3MA 4QU3A 4DF6A 3FZCA 5F1GA 3V3RA 3ZFZA 5EUAA 3LY3A 2HDSA 4EBNA 4C3QA 4GDNA 4JBFA 5CHUA 1K55C 1FCMA 3UE0A 1G6AA 4WMCD 1Y54A 5EVIB 4RX3A 4WEKA 5AQAA 3HUOA 3QHYA 3OPLA 1NZUA 5EOEA 2PU2A 4EBPA 3OPPA 5GLCA 2ZC3B 4HBTA 5A93A 3GRJA 3IH8A 1E25A 3IF6A 3O88A 4R1GA 1E3UD 5F83A 3WS4A 4OVDA 1H8YA 5FQQA 1YLJA 4FH4A 1NXYA 5DTSA 5DTKA 5CEBA 1MPLA 4E6XA 2EXAA 1HZOA 4LENA 4S2NA 1MWSA 2H10A 5FATA 2WGIA 1ONGA 3WWXA 4ZJ2A 2JCHA 2ZQCA 5EE8A 5J8XA 3SH8A 1SHVA 4WZ5A 3WS2A 1BT5A 2ZC4B 1CI9A 2XFSA 1ES5A 3PAGA 3TSGA 3NIAA 1PZOA 1FR1A 3N4IA 4OQIA 1LLBA 2Y2QA 3LCEA 5A91A 5IHVA 5JYOA 2IWDA 4NK3A 4IBRA 5E2GA 4X56A 4R4SA 4IEDA 5CECA 3HVFA 2WAFA 1MWRA 2X01A 2OLVA 2PBYA 4PM9A 2XD5A 4BJPA 4OPRA 5GHZA 1JWPA 1O07A 3G2ZA 3ZG5A 2I72A 3HLDA 2ZLYA 4S2PA 1RCJA 4KZ4A 4LV2A 3VP0A 3QNCA 3UNWA 5M19A 3VFFA 1NRFA 4QY5A 4KG2A 3ZVWA 4RX2A 4X69A 5FA7A 5TR7A 3IF6C 1AXBA 3HL9A 3PAEA 1IYPA 2HDQA 2C5WB 4GOGA 5FASA 1XGJA 3N8SA 3LY4A 3ZG0A 2Y2GA 3DWKA 4R4RA 4C6YA 4MBHA 5BOHA 1K6SA 2H5SA 3IXDA 3PBNA 2EX6A 4FH2A 4N92A 4UA9A 3UO9A 2HP9A 2ZM8A 3GV9A 4U0TA 3BLMA 5I94A 1QMFA 2Y2OA 4S2JA 4UHUA 4LV0A 3NDEA 1MBLA 4OP8A 4DE0A 4FCFA 1MWUA 4U0XA 2R9XA 1CEGA 4E3KA 1LL5A 1Q2PA 2HP6A 2QZ6A 3IH9A 4JXSA 3SOIA 3V39A 3VOZA 3IHAA 3VFHA 4KQQA 3ZG7B 1E3UA 4XXRA 4HESA 3GR2A 3UN7A 1YLPA 3NCKA 4R23A 1XA7A 2C6WB 3ISGA 5KSHA 3Q82A 3VP2A 2XQZA 3G2YA 3P98A 2WYXA 2IWBA 4QY6A 4UA7A 5CGWA 5CTMA 3W4QA 2XEPA 4E3NA 4EUZA 4KENB 3PBTA 3E2KA 4N1HA 5D3OA 1ZKJA 4E3IA 4F94A 3DWZA 1N4OA 1L2SA 1BUEA 1JWVA 1TDLA 2H0TA 1RGZA 4QD4A 3RXWA 3N8LA 2Y59A 4JKTA 3GSGA 1I2SA 4GB7A 5GLAA 5GL9A 4KZ5A 1MWTA 1TDGA 4B4ZA 1CEFA 2R9WA 4BL3A 5E2FA 1LL9A 1PIOA 3IWOA 4YFMA 5HAIA 1FCOA 1LI0A 3NI9A 2P9VB 1ZG6A 4LCLA 3HLCA 5HARA 3A3IA 1NJ4A 1SDNA 3VOYA 1GHPA 2EFXA 3AGEA 3FV7A 4KZ7A 4QJGA 3ZHHA 1EI5A 1ONHA 2ZQ7A 4OOMA 1G68A 4S2OA 3Q7ZA 5FQMA 3Q81A 5FQ9A 1KE0A 1M6KA 2WGWB 2XFTA 4OPYA 3HLEA 3RJUA 1Z6FA 4KZ9A 3CZDA 3SS5A 3V50A 1ZC2A 4FSFA 1RP5A 4MLLA 1LI9A 1K4EA 1TEMA 4ID4A 2XF3A 2BG1A 2X71A 2VGJA 1DY6A 1WE4A 3SS4A 1HTZA 3OC2A 4Z9QA 3CMZA 5HW3A 3BFCA 1XPBA 1HD8A 5M18A 3IXGA 4R0QA 3UDXA 5A92A 4DXCA 4U3TA 3N8RA 4ZDXA 3M2KA 3W8KA 3PBOA 4BLMA 1H8ZA 3DW0A 3LEZA 3ZG9B 3IWIA 5FDHA 1KDSA 1BLPA 1NYYA 4EWFA 2Y4AA 5FAQA 2Y2LA 5F1FA 5U47A 3WRZA 2WGWA 1PWCA 3Q07A 3A3JA 3N6IA 3BFDA 3OCLA 2Z2LB 3P09A 1NY0A 2XH9A 3EQUA 3VMAA 1BTLA 4EBLA 3W4PA 2WZZA 3WRTA 4OOYA 2EX8A 1I5QA 1YMSA 1BSGA 3ZCZA 5FQKA 1DJAA 1K38A 4ZTKA 3D4FA
chains in the Genus database with same CATH superfamily
3WS5A 4Y7PA 1K57A 3H7WA 4EETB 5J4EA 3SS3A 2V1AA 4Y3IA 2XR0A 5DF8A 3C38A 2VV7A 2V20A 2W27A 2DMWA 4E3JA 2PYPA 2PR6A 2V9AA 4EUVA 4OLGA 4FD8A 5F5YA 4HIAA 2K31A 2PD8A 2VK3A 1P0ZA 2LB9A 4BMWA 3JVVA 4OH0A 2J8YA 1EWZA 1PYYA 3C8CA 1W8QA 3SH7A 4BBTA 4FTXA 3VE3A 4Z1WA 3F1PA 1ES2A 3C4OA 2B02A 3MMHA 4OPQA 3BFGA 3E4OA 3E4QA 1MXOA 1XA1A 3LR3A 4NEED 3H82B 1IYOA 1ESIA 1BYWA 4S2LA 2A49A 1JTGA 2XRNA 3JYIA 1YLWA 5HWVA 2DCFA 5KMWA 3EQVA 2W1TA 4WBGA 1YSQA 5CHMA 4HBUA 4OPZA 3GDIA 3CAXA 4CLCC 3DTEA 3ZNTA 4L9FA 2ZQ8A 1L0DA 5FSRA 1BLCA 4ZRRA 2VJWA 3KO6A 4R70A 4B4XA 3QNBA 4WF0A 5FQJA 4B9OA 2ZD8A 4QHCA 4Y0UA 2Z6CA 3IX4A 3O87A 1KOUA 3NHQA 3UB5P 1NYMA 3BEBA 1GHMA 3UE1A 4DDYA 1ES3A 2OLUA 4HJ6A 1LT0A 4I38A 1P9RA 3CUEA 4S2MA 1I2WA 5M1AA 4ETXA 4MBFA 3SZTA 2WAEA 4DDSA 1NRJA 3G31A 3B33A 3LFVA 3NC8A 3KX0X 1OT9A 3FWLA 2VKSA 3BY8A 4R6LA 4WZ4A 5G4ZA 4PM7A 1K54A 4L9GA 3MFDA 1FOFA 4MNRA 5AVFA 1VM1A 1Z09A 1VB6A 2EX9A 4EEUA 3E98A 2L1MA 3C7UA 2H28A 2X02A 3RXXA 3O86A 3IWQA 2Y55A 3UDIA 4LRZE 3AGDA 4JXGA 1W7FA 4MDZA 5L10A 4E3LA 3O5YA 2JKTM 3MF0A 5DFXA 4EERA 1FCNA 1SKFA 3MKEA 4BL2A 1NLYA 2HP5A 4DE1A 2WKQA 4JGOA 4EW7A 2QWSA 4OQHA 4P6ZS 4LV3A 2BTFP 2HDUA 1F98A 4N9KA 2J7VA 1T1BA 3IF5A 4QU3A 3V3RA 5EUAA 3DAVA 2OAP1 2Y8HA 5CHUA 2JKRM 3A0SA 5EVIB 5A93A 3O88A 1H8YA 4NXEA 5EM0A 3QP5A 4FH4A 3OOVA 2PYRA 3BQ8A 2O9CA 5J8XA 1SHVA 5G4YA 2AVXA 2XFSA 1ES5A 3TSGA 1PZOA 3RH8B 3LCEA 4II7A 4R4SA 3HVFA 3BW6A 2J3WA 4OPRA 5GHZA 1JWPA 3JPUA 4KZ4A 3VP0A 3QNCA 4R3AA 2JN7A 4RX2A 5FA7A 3IF6C 1AXBA 3ZG0A 3DWKA 5BOHA 5TBMB 3PBNA 4FH2A 3UO9A 3GV9A 2XA7M 3BLMA 1QMFA 4Q0IA 3EEHA 3NDEA 4U0XA 2R9XA 1LL5A 2IA2A 4RQ9A 3ZG7B 4XXRA 2KLIA 3GR2A 5J7EA 1H3QA 5KSHA 3LR5A 4NXGA 2IWBA 3U4LP 2WYXA 5C5KA 4UA7A 4EUZA 4KENB 4N1HA 5TBMA 5A8BA 3PYPA 1L2SA 4QD4A 4JKTA 4WL9A 4XT2B 4O0PA 1CEFA 1NLZA 3IWOA 5HAIA 3NI9A 3HLCA 2GJ3A 5HARA 4JGRA 4GS9B 3ZHHA 2ZQ7A 4OOMA 5FQ9A 1M6KA 2XFTA 4KZ9A 5L07A 4FSFA 1RP5A 4MLLA 4FUWA 1K4EA 3KSHA 2XF3A 2VGJA 5TJJA 1HTZA 3OC2A 1UGUA 2EWWA 5HW3A 3BFCA 2EWVA 3IXGA 4R0QA 3M2KA 1P9WA 3V67A 1H8ZA 3DW0A 3LEZA 3ZG9B 5FDHA 1KDSA 4Y17A 2Y2LA 5F1FA 3WRZA 1PWCA 1OJ5A 3N6IA 3K3CA 5EM1A 2VGLS 3LIEA 3C2WA 2LB5A 1K56A 1DRMA 4JXWA 4BD1A 4KZ3A 3T12B 3A3FA 1VEUB 3VP4A 1TF1A 4L0LA 1XP4A 4JGQA 4JF4A 4GCZA 3IXBA 4EQIA 1GCEA 2A3UA 3RFBA 3MFXA 4DJ2A 3GTCA 1IKGA 5HL6A 5GLDA 3PBSA 1FQGA 4ZBEA 4ZAMA 4GD8A 3ZVTA 3BM6A 5CHJA 2M7UA 1NZOA 2Q9NA 4OQ0A 4S2NC 3EGXC 3IT9A 3UMDA 2ZC5B 1S67L 1U60A 1ZTUA 2Z2MB 5HAPA 3MZEA 4I3AA 2ZBBA 3UPNA 1XX2A 3MQQA 1K57C 1JTDA 3C5AA 2QPNA 1T1AA 3FYZA 1IEMA 3M6HA 2QHKA 3QP8A 3HBRA 3OCNA 1ESUA 4ZJ1A 3TOIA 4ETZA 4KZ6A 3OBFA 3WS0A 3BLSA 5J3WA 2RL3A 3BJNA 3HREA 5A90A 3PBQA 1J3WA 1XFQA 1RGYA 3C4PA 3MKFA 5HAQA 5HPFA 3M2JA 1CI8A 4GNUA 5CXWA 1BZAA 3MZDA 3G35A 1JWZA 2YKFA 5E2HA 3LGOA 4PMAA 1KGEA 3TW8A 4IUKA 2P9VA 3HCYA 1IYQA 3QP6A 1V9YA 3MQOA 4Y0TA 1KVMA 4ARZA 2HDRA 3TG9A 4O8GA 1ACFA 4BQMA 1GA0A 4OP5A 4WM9A 4QB8A 5L8MA 3EWKA 2CC1A 5FI6A 1E4DA 3A0RA 3VE4A 3W4OA 4OONA 1DP8A 2WK0A 2FH5A 4B88A 4P6BA 1PW1A 2VGKA 5TGFA 5HSQA 4GLQA 4KG6A 3QP1A 1J9MA 1K0KA 4O01A 5FI2A 3KYZA 4JF5A 2O99A 2XLNA 2UV0E 5HFOA 4YWZA 1PI4A 4B93A 4WYYA 3AGFA 1FSYA 2JKFA 1JNUA 4GD6A 3T4SA 4PM6A 4O7DA 2WZXA 2ZM0A 4NXBA 2ZJ9A 3NULA 3UB8A 1K4FA 1YQSA 4ESPA 1OTIA 2PU4A 1UWPX 2EXBA 3ICYA 3PXPA 2ZMAA 3NOUC 3G32A 3IQAA 1HLUP 1ZG4A 3I7JA 1KGFA 3PHYA 3G4PA 1XJ4A 1C3BA 1VQQA 4P85A 4CLCE 3VP3A 4X1MA 4RVAA 3VP1A 1OMEA 3LUQA 1XJ3A 3D9YA 2WKEA 4D2OA 4KZAA 2HPBA 3LIFA 1K55A 2J9OA 1K56D 2RCXA 3GMWA 1KE4A 4GDBA 1K54C 2QJ5A 5HZHA 3MXRA 2QMIA 2G2WA 1FSWA 5DF9A 1GHIA 2WKRA 3H82A 4H8RA 2JC7A 2OV5A 1N9OA 3G34A 3EEAA 3UMEA 5GHXA 1MY8A 5CERA 1L0GA 1IELA 2XDMA 2FFYA 1MKMA 1IKIA 3V3SA 3T4TA 2ZQAA 1HVBA 4S2IA 3TRCA 4YINA 2W3GA 3IBJA 5DJUA 2WGVA 2JKTI 1OTDA 1SKOB 2CMNA 2HDSA 4EBNA 4JBFA 2VEAA 1FCMA 1G6AA 1Y54A 2V0UA 4WEKA 3QHYA 4EBPA 2PU2A 3TE8A 3GRJA 1TD5A 4Y15A 1NXYA 5DTSA 5DTKA 3RTYA 4D60A 1FIKA 1MPLA 4UQIM 2EXAA 1HZOA 2H10A 5IS1A 4NKPA 2JCHA 4X25A 3WS2A 1BT5A 2ZC4B 1CI9A 2P04A 3PAGA 1GSXA 4G3VA 2JKRI 4IBRA 4IEDA 2WAFA 5EV0A 4HI4A 1MWRA 2OLVA 2PBYA 2O0YA 3HLDA 2W3EA 4LV2A 1X0OA 3VFFA 4CLCB 2Q0OA 3QP2A 3HL9A 1P97A 4X1LA 2ZMFA 4HNBA 2C5WB 4GOGA 1S1YA 1XGJA 3LY4A 4EQ1A 2Y2GA 4R4RA 2E8JA 1K6SA 1OPXA 2H5SA 4N92A 1MC0A 2ZM8A 2Y2OA 4HP9A 1MBLA 1DP9A 1MWUA 1CEGA 1ZHHB 2ZMVA 3E0YA 3VFHA 3T50A 4CLCA 1E3UA 1WA9A 3UN7A 4Q0HA 3L7HA 3T1QB 3Q82A 3VP2A 2XQZA 3G2YA 5HDDA 5CGWA 3W4QA 1S66L 3PBTA 3E2KA 5D3OA 3RXWA 4HHDA 3GSGA 1FILA 1G28A 4UEYA 4KZ5A 1TDGA 4B4ZA 3DBAA 1PIOA 1FCOA 1ZG6A 2L4RA 3A3IA 1NJ4A 1SDNA 3LYXA 1ONHA 2B18A 1G68A 2ZOHA 3Q7ZA 3MJQA 5FQMA 3Q81A 1MZUA 4PAUA 1DY6A 1WE4A 4PHTA 2K7SA 2HF6A 2OOLA 3N8RA 1SZVA 4EU0A 3JVUA 4BLMA 3IWIA 1BLPA 4EWFA 2Y4AA 2HV1A 5FAQA 3LIBA 3H9WA 5EFWA 2OWHA 3OCLA 3P09A 2XH9A 1BTLA 3WRTA 4OOYA 1YMSA 5FQKA 1K25A 4JPMA 4K0XA 3UE6A 5DVAA 5EVIA 3LR0A 5JYPA 4OKPA 4DN0A 1W79A 4KUKA 5GHYA 2Q9MA 3HJIA 4WLAA 4P0MA 5FEFA 3VSLA 2V2FF 3UPPA 2B5RA 1WYCA 1S1ZA 3G30A 2JBFA 2XA7S 3GVBA 3BECA 3OPHA 4WEJA 1N9BA 1IOUA 3ULFA 2PD7A 3GECA 1L0EA 2W3HA 4PM8A 3DTKA 3CWFA 4DE2A 3ZG8B 3NY4A 4WZ5C 4WMCA 1NWZA 4MN6A 4JF6A 4MEZA 3MR0A 1EW0A 2Y2KA 3S7QA 5F69A 3UB6A 1PWDA 4IBXA 2H0YA 4HY8A 4CPKA 1ODVA 5GLBA 5DJTA 1ERQA 1W63M 4XUZA 2OSUA 4RA7A 3FKWA 4LRYC 2OAQ1 4DE3A 1EROA 1PW8A 1H5XA 4QWOA 4FOFA 3T1XA 3LIAA 3BRMA 1VHMA 3K3DA 4HEFA 5AVEA 4XT2A 3NOTC 4F3LB 3A3DA 5DF7A 3NDGA 3ZQ5A 3FPVA 2J9PA 4EESA 4KG5A 2EA9A 4GS9A 1KGGA 1LSXA 3HLGA 3IF6B 3E2LA 4UA6A 1G6OA 3MBZA 3B3XA 4LV1A 5F82A 4IVIA 5FAOA 2J3TD 4F3LA 4Y5FA 1XXMA 4M4XA 3T4LA 2GNXA 1S0WA 4Y2FA 3O3VA 1CQAA 4LPZA 5HX9A 3QP4A 2KDKA 5HWWA 3CPTB 3T4OA 4EV4A 4PPRA 4HJ3A 4OLDA 2UWXA 2HJEA 5I5LA 5LBRA 1QMEA 1XKZA 2ZQ9A 1FR6A 3K2NA 3D3OA 2JHEA 4KZBA 4ZJ3A 4DRTA 4MN5A 3U2AA 4R3JA 4I3JA 3UB7A 4JLFA 1YAXA 1VEUA 1F2KA 2EX2A 3ZGAB 3CG5A 2W0NA 5DFYA 4KZ8A 2QKPA 5FAPA 2V1BA 1O7EA 3FPWA 3S4XA 1L0FA 2W3DA 3BYDA 5CEDA 2DNSA 1DJCA 1H0MA 4GZBA 4K08A 1S6RA 1XJ6A 2XGNA 3C30A 3MZFA 3FKVA 2P7JA 3F1OB 2ZOIA 1BLHA 4WELA 2ZM2A 2GDNA 3T4JA 4DXBA 4G3KA 4WUJA 2ZC6B 4DMZA 3CI6A 4X55A 4HH2A 4OOLA 3A3EA 5CGSA 2PDRA 4E3OA 1YT4A 5EVID 5DTTA 1W5DA 3OPRA 2WADA 3F1OA 5CRFA 5MC7A 4K91A 2BLSA 3ZDJA 1KVLA 3KYEA 1LL8A 5DKKA 5HPIA 2D01A 1F9IA 3VSKA 4L9EA 5FDSA 3CHWP 4C75A 3L9KA 4MBKA 1WYBA 1SCWA 2Y2NA 3NBLA 1PWGA 4UAAA 3S7PA 4DF6A 2VLGA 2VA0A 2W1RA 3LY3A 4GDNA 3NOPC 4MN7A 1K55C 3UE0A 4WMCD 2VV6A 4RX3A 2O9AA 5AQAA 1NZUA 5EOEA 1A0KA 3OPPA 2ZC3B 4HBTA 5F83A 1H8MA 5FQQA 1UWNX 2OWJA 2PR5A 4S2NA 1YPRA 4LRXC 1MWSA 4Q0JA 2WGIA 4CQHA 4ZJ2A 2ZQCA 5EE8A 2QYBA 4MCWA 1D06A 3LIDA 4QPRA 2L0WA 1FR1A 4OQIA 1LLBA 4NK3A 2PAVP 1OTAA 4HOIA 3G2ZA 3ZG5A 2HGVA 2I72A 2ZLYA 5M19A 4QY5A 3ZVWA 4X69A 3F1PB 1IYPA 2HDQA 5L09A 5FASA 4LFUA 4C6YA 4MBHA 3W2ZA 3A0VA 3G6OA 3CUEC 4U0TA 5I94A 4S2JA 4LV0A 2PBDP 4FCFA 4E3KA 1Q2PA 3V39A 3IH9A 3SOIA 4JXSA 2M1CA 5HDCA 5DKLA 1YLPA 4R23A 1XA7A 2C6WB 3BQAA 3P98A 2W1TB 4HH3A 5CTMA 2XEPA 4NXFA 5CX7A 1ZKJA 4F94A 3KSIA 3DWZA 1N4OA 5HD3A 1BUEA 1JWVA 2H0TA 2Y59A 2Z6DA 1MWTA 4BL3A 1OT6A 3VOYA 2J3TC 4QJGA 4I5SA 3D72A 3P01A 2W3FA 3RJUA 3SS5A 3V50A 1TS7A 1TEMA 4ID4A 2BG1A 1XJ2A 3CMZA 4G3WA 4KUOA 1XPBA 5A92A 4ZDXA 1N9LA 1TS6A 2QJ7A 4AFIA 3PBOA 4UQIS 2HJ9C 2K2NA 1PNEA 5U47A 4EEPA 3E4PA 3F1NB 2G7UA 2Z2LB 1TS0A 3EQUA 3W4PA 1LSWA 1SKOA 3ZCZA 1BSGA 1K38A 5F68A 4ZTKA 3WS1A 2INWA 3CJMA 5AQ9A 1LSVA 1V9ZA 3Q1FA 4Q8IA 1BULA 4XUXA 3PBRA 3N7WA 2V0WA 2Y2MA 5TFQA 1JVJA 3F1NA 3ITBA 3BFEA 3T4QA 2WUQA 2WKIA 5FL3A 2J80A 2P08A 1TVFA 4BENA 2GX5A 1PI5A 2IWCA 2JE5A 1GSWA 4R3BA 2PT7A 1MKIA 3IS2B 4A5RA 2V1ZA 3UY6A 3UPOA 3LO7A 1S4RA 3IHBA 5IT5A 3UB9A 4N9LA 4EXOA 5EVIC 5E43A 3Q7VB 2XK1A 4GN2A 2PHYA 2P74A 3IS2A 5HL1A 1L3LA 4Y0OA 3T1RA 2I9VA 3IBRA 4BD0A 4M3KA 5AQBA 1BLSA 5KZHA 3P7NA 4NETA 1G5UA 1IFQA 4H6JB 4DKIA 3Q7VA 3T4KA 1SDEA 2KOIA 3M6BA 4IVKA 1ERMA 3OZHA 1K6RA 1XGIA 1N9NA 3DTMA 1KE3A 3LI9A 2E8IA 2DRWA 4E04A 3PR6A 2Y91A 2Y2JA 3V5MA 3KSFA 4ME4A 1OJGA 3HLWA 2MJ6A 1PZPA 1Q2QA 4H6JA 4GHIB 3BWLA 3HUNA 1PRQA 3S22A 5G18A 2NUPC 1CK3A 1GSVA 1YSPA 3FG8A 4X6TA 4P6ZM 2A24B 1YLYA 4JXVA 3UE3A 4BWIA 5HDSA 1T1CA 1TS8A 4GHIA 4KQRA 4BBVA 5E2EA 4PM5A 1DJBA 1ALQA 1GA9A 4E6WA 4HJ4A 4WN5A 5HD5A 1OTBA 4NG2A 3HUMA 1YLTA 4RYEA 3IX8A 3GQZA 2EFUA 5K5BA 3BFFA 3S1YA 1W63Q 2A24A 2ZQDA 2WKPA 2XD1A 3VV4A 2G2UA 1ES4A 1YM1A 3MSHA 1AWIA 1LHYA 5EOOA 2Y79A 5KSCA 5FQIA 3R7WB 1F5MA 3UDFA 3CITA 3KSGA 3KYQA 1T19A 2A2LA 4P87A 4R38A 1CF0A 2Y2HA 2B95A 2FZ0A 4IUHA 5EECA 4DJ3A 3R7WA 2Y2PA 4LCMA 2XSSA 3IXHA 3B47A 1W8YA 3T1SA 2M7VA 1S4SA 4HQAA 4X68A 2Y2IA 3HLBA 4X53A 3PTEA 4N1XA 3ITAA 3MXSA 1IYSA 3EOIA 5EPHA 2VZWA 4CJNA 3SH9A 4S2KA 2ZC7A 3HLFA 2FFFB 4GKUA 5EVLA 3MXQA 5FI7A 4K0WA 4YOFA 2WKHA 2PRFA 4KQOA 2XROA 4OQGA 2ZL1B 5L2FA 1YKDA 3LR4A 1M40A 3C7VA 3B42A 3S7OA 5FEGA 5AQ7A 3IX3A 5CGXA 1YMXA 5CTNA 1KDWA 1YLZA 4HP4A 3ZNYA 4E3MA 4BBUA 3FZCA 4GW9A 5F1GA 3ZFZA 4IHQA 1Y28A 4C3QA 1D1JA 2ZL1A 1OTEA 3HUOA 3OPLA 5GLCA 3IH8A 1E25A 3IF6A 4R1GA 4CLCD 1E3UD 3WS4A 4OVDA 1YLJA 5CEBA 4E6XA 3LICA 4LENA 5FATA 1ONGA 3VOLA 3WWXA 3SH8A 4WZ5A 3MQ0A 1D7EA 4PKYG 3NIAA 5F6AA 3N4IA 2D02A 3LEQA 4PKYA 2Y2QA 5A91A 5JYOA 5IHVA 2IWDA 1VETB 5E2GA 4X56A 2ACGA 5CECA 2VGLM 3CPTA 5KIZA 2X01A 4PM9A 2XD5A 4BJPA 1O07A 3S7NA 4S2PA 4LGWA 1RCJA 3R4KA 3UNWA 1NRFA 4KG2A 5TR7A 3PAEA 4KQDA 1STZA 5AJGA 3N8SA 1VETA 2GZAA 3NJAA 3IXDA 4UA9A 2EX6A 2HP9A 4UHUA 4OP8A 4DE0A 2HP6A 2QZ6A 3VOZA 5HWTA 3IHAA 5EVEA 4KQQA 4I3IA 4HESA 3HJKA 2O9BA 2BASA 3NCKA 3ISGA 2KX6A 3CLOA 4QY6A 4E3NA 4E3IA 3BY9A 1TDLA 1RGZA 1XFNA 2VV8A 3N8LA 1I2SA 4GB7A 5GLAA 5GL9A 3NECA 4Y13A 2VX8A 2R9WA 5E2FA 1LL9A 3DTIA 4GJ4A 4YFMA 1LI0A 2V8FA 3MS6A 2P9VB 4YNRA 4LCLA 2NUTC 4LLOB 1GHPA 2EFXA 3AGEA 3FV7A 4KZ7A 3LI8A 4MMNA 1EI5A 4S2OA 1Y4OA 1KE0A 2JKGA 4ARZB 2V8CA 3FC7A 2WGWB 4OPYA 3HLEA 1Z6FA 2YKHA 1T18A 3SW1A 3CZDA 1CJFA 1ZC2A 1LI9A 2X71A 3SS4A 4Z9QA 1HD8A 3EGDC 5M18A 3UDXA 4DXCA 4U3TA 3ZYTA 3OLOA 3W8KA 2HZ5A 1NYYA 1PFLA 3H7WB 4I39A 4JGPA 2WGWA 3Q07A 2R78A 3A3JA 4IJGA 1DP6A 3BFDA 3VMAA 1NY0A 4EBLA 2WZZA 2EX8A 1I5QA 3TJZC 1DJAA 3D4FA 5IU1A
chains in the Genus database with same CATH topology
1K25A 4JPMA 1K56A 3CJMA 4K0XA 3WS5A 4JXWA 4BD1A 5AQ9A 4KZ3A 4Y7PA 5DVAA 5EVIA 3Q1FA 4Q8IA 1BULA 1K57A 5JYPA 4XUXA 4OKPA 3A3FA 3PBRA 3VP4A 1W79A 3N7WA 2Y2MA 5TFQA 1JVJA 4L0LA 1XP4A 5GHYA 2Q9MA 3ITBA 3BFEA 3SS3A 4JF4A 2WUQA 3IXBA 2WKIA 4EQIA 1GCEA 4P0MA 3VSLA 2A3UA 2V2FF 3UPPA 2B5RA 1TVFA 1WYCA 4BENA 1PI5A 2IWCA 2JE5A 1IKGA 2XR0A 3GTCA 3PBSA 4R3BA 1FQGA 3G30A 2V20A 5GLDA 2JBFA 4ZAMA 4ZBEA 4GD8A 3GVBA 3BECA 3OPHA 3ZVTA 3BM6A 4E3JA 4WEJA 1N9BA 5CHJA 1MKIA 4OLGA 4FD8A 4A5RA 2V1ZA 3UY6A 3WS1A 3UPOA 1NZOA 2Q9NA 4OQ0A 3LO7A 4S2NC 1L0EA 3IT9A 4PM8A 3IHBA 4DE2A 2ZC5B 3ZG8B 1U60A 2Z2MB 3NY4A 4WZ5C 4WMCA 4N9LA 4OH0A 2J8YA 5HAPA 3MZEA 1EWZA 3UPNA 1PYYA 1XX2A 1W8QA 5EVIC 3SH7A 1K57C 1JTDA 3C5AA 2QPNA 5E43A 3Q7VB 3FYZA 3M6HA 1IEMA 2XK1A 4JF6A 1ES2A 4GN2A 2P74A 3C4OA 4MEZA 3HBRA 3OCNA 1ESUA 4ZJ1A 3TOIA 4OPQA 3BFGA 5HL1A 2Y2KA 4KZ6A 1MXOA 4Y0OA 1XA1A 3WS0A 4BD0A 3BLSA 4M3KA 1IYOA 5AQBA 1BLSA 2RL3A 5KZHA 1ESIA 1PWDA 3HREA 4IBXA 5A90A 4S2LA 3PBQA 2H0YA 4CPKA 4NETA 1RGYA 5GLBA 2A49A 1JTGA 3C4PA 3MKFA 4DKIA 5HAQA 1ERQA 3JYIA 3Q7VA 1SDEA 3M2JA 3M6BA 4XUZA 1CI8A 4GNUA 4IVKA 1BZAA 1ERMA 1YLWA 2OSUA 5CXWA 3OZHA 4RA7A 3MZDA 2DCFA 1K6RA 5KMWA 3G35A 3FKWA 1JWZA 3EQVA 4WBGA 1XGIA 5CHMA 3DTMA 1KE3A 4HBUA 1EROA 4DE3A 1PW8A 2E8IA 5E2HA 2DRWA 4OPZA 1H5XA 3BRMA 2Y91A 2Y2JA 4PMAA 4HEFA 3V5MA 3ZNTA 1KGEA 2ZQ8A 1L0DA 3A3DA 3HLWA 1PZPA 1Q2QA 5DF7A 3NDGA 2P9VA 3HUNA 5FSRA 3S22A 2J9PA 4KG5A 1BLCA 1IYQA 1KGGA 5G18A 3HLGA 3IF6B 3E2LA 4Y0TA 1KVMA 4UA6A 2HDRA 1CK3A 3TG9A 4B4XA 4BQMA 1GA0A 3QNBA 3MBZA 5FQJA 5EVLA 4X6TA 4OP5A 4WM9A 3B3XA 4QB8A 1YLYA 4JXVA 4LV1A 5DF8A 5F82A 2CC1A 4IVIA 5FAOA 3UE3A 5FI6A 1E4DA 2ZD8A 4QHCA 4Y0UA 1XXMA 3O87A 1S0WA 3W4OA 3O3VA 4OONA 2WK0A 4KQRA 4B88A 5HX9A 1NYMA 4P6BA 3BEBA 1PW1A 2VGKA 5E2EA 5TGFA 4PM5A 1DJBA 1ALQA 1GA9A 1GHMA 3UE1A 4E6WA 4DDYA 1ES3A 4EV4A 3HUMA 4PPRA 1YLTA 4RYEA 2OLUA 2EFUA 3GQZA 3BFFA 4OLDA 4KG6A 3S1YA 1J9MA 2UWXA 4S2MA 1I2WA 5M1AA 2ZQDA 5FI2A 1QMEA 2XD1A 4MBFA 1XKZA 2ZQ9A 2WAEA 4JF5A 4DDSA 2G2UA 2XLNA 1ES4A 3G31A 1YM1A 5HFOA 1FR6A 3NC8A 1PI4A 4KZBA 4WYYA 4ZJ3A 4DRTA 1LHYA 3AGFA 5EOOA 1FSYA 5KSCA 5FQIA 3FWLA 4R3JA 4GD6A 4JLFA 4PM6A 4O7DA 2WZXA 2ZM0A 2ZJ9A 3UDFA 1K4FA 4WZ4A 1YQSA 2EX2A 3ZGAB 3CG5A 4PM7A 1K54A 4KZ8A 3MFDA 4P87A 1FOFA 4MNRA 2PU4A 5FAPA 1O7EA 3S4XA 1L0FA 2EXBA 2Y2HA 3BYDA 5CEDA 5EECA 2DNSA 2ZMAA 1DJCA 3G32A 1VM1A 3IQAA 1ZG4A 3I7JA 4GZBA 1S6RA 2Y2PA 1KGFA 2XGNA 2EX9A 4LCMA 3G4PA 3IXHA 1C3BA 1VQQA 1W8YA 3FKVA 3MZFA 4P85A 3VP3A 3C7UA 4RVAA 3VP1A 2X02A 4X68A 2Y2IA 1OMEA 3RXXA 3O86A 3IWQA 1BLHA 3HLBA 4WELA 2Y55A 4X53A 3UDIA 2ZM2A 3PTEA 2GDNA 2WKEA 3AGDA 4N1XA 4D2OA 4JXGA 4DXBA 3ITAA 4KZAA 2ZC6B 2HPBA 1W7FA 3MXSA 1IYSA 1K55A 5EPHA 2J9OA 1K56D 2RCXA 3GMWA 4X55A 1KE4A 3SH9A 4CJNA 4GDBA 1K54C 4E3LA 4S2KA 4OOLA 3A3EA 5CGSA 2ZC7A 3HLFA 4E3OA 1YT4A 5EVID 2FFFB 4GKUA 1FCNA 5DTTA 3MXRA 2QMIA 2G2WA 1FSWA 1W5DA 5DF9A 3OPRA 1GHIA 2WADA 5FI7A 4H8RA 1SKFA 2JC7A 4K0WA 5CRFA 2WKHA 3MKEA 4K91A 2BLSA 2OV5A 3G34A 3ZDJA 4KQOA 1KVLA 4BL2A 2HP5A 5GHXA 4DE1A 4OQGA 1MY8A 5CERA 5L2FA 1L0GA 1IELA 1M40A 3C7VA 2XDMA 4OQHA 2FFYA 4LV3A 5AQ7A 1IKIA 2HDUA 3V3SA 3VSKA 2ZQAA 5CGXA 1HVBA 1YMXA 4S2IA 5CTNA 4C75A 4YINA 1KDWA 4MBKA 1YLZA 1WYBA 4N9KA 1SCWA 2J7VA 2Y2NA 3IF5A 2WGVA 3NBLA 3ZNYA 1PWGA 4UAAA 4E3MA 4QU3A 4DF6A 3FZCA 5F1GA 3V3RA 3ZFZA 5EUAA 3LY3A 2HDSA 4EBNA 4C3QA 4GDNA 4JBFA 5CHUA 1K55C 1FCMA 3UE0A 1G6AA 4WMCD 1Y54A 5EVIB 4RX3A 4WEKA 5AQAA 3HUOA 3QHYA 3OPLA 1NZUA 5EOEA 2PU2A 4EBPA 3OPPA 5GLCA 2ZC3B 4HBTA 5A93A 3GRJA 3IH8A 1E25A 3IF6A 3O88A 4R1GA 1E3UD 5F83A 3WS4A 4OVDA 1H8YA 5FQQA 1YLJA 4FH4A 1NXYA 5DTSA 5DTKA 5CEBA 1MPLA 4E6XA 2EXAA 1HZOA 4LENA 4S2NA 1MWSA 2H10A 5FATA 2WGIA 1ONGA 3WWXA 4ZJ2A 2JCHA 2ZQCA 5EE8A 5J8XA 3SH8A 1SHVA 4WZ5A 3WS2A 1BT5A 2ZC4B 1CI9A 2XFSA 1ES5A 3PAGA 3TSGA 3NIAA 1PZOA 1FR1A 3N4IA 4OQIA 1LLBA 2Y2QA 3LCEA 5A91A 5IHVA 5JYOA 2IWDA 4NK3A 4IBRA 5E2GA 4X56A 4R4SA 4IEDA 5CECA 3HVFA 2WAFA 1MWRA 2X01A 2OLVA 2PBYA 4PM9A 2XD5A 4BJPA 4OPRA 5GHZA 1JWPA 1O07A 3G2ZA 3ZG5A 2I72A 3HLDA 2ZLYA 4S2PA 1RCJA 4KZ4A 4LV2A 3VP0A 3QNCA 3UNWA 5M19A 3VFFA 1NRFA 4QY5A 4KG2A 3ZVWA 4RX2A 4X69A 5FA7A 5TR7A 3IF6C 1AXBA 3HL9A 3PAEA 1IYPA 2HDQA 2C5WB 4GOGA 5FASA 1XGJA 3N8SA 3LY4A 3ZG0A 2Y2GA 3DWKA 4R4RA 4C6YA 4MBHA 5BOHA 1K6SA 2H5SA 3IXDA 3PBNA 2EX6A 4FH2A 4N92A 4UA9A 3UO9A 2HP9A 2ZM8A 3GV9A 4U0TA 3BLMA 5I94A 1QMFA 2Y2OA 4S2JA 4UHUA 4LV0A 3NDEA 1MBLA 4OP8A 4DE0A 4FCFA 1MWUA 4U0XA 2R9XA 1CEGA 4E3KA 1LL5A 1Q2PA 2HP6A 2QZ6A 3IH9A 4JXSA 3SOIA 3V39A 3VOZA 3IHAA 3VFHA 4KQQA 3ZG7B 1E3UA 4XXRA 4HESA 3GR2A 3UN7A 1YLPA 3NCKA 4R23A 1XA7A 2C6WB 3ISGA 5KSHA 3Q82A 3VP2A 2XQZA 3G2YA 3P98A 2WYXA 2IWBA 4QY6A 4UA7A 5CGWA 5CTMA 3W4QA 2XEPA 4E3NA 4EUZA 4KENB 3PBTA 3E2KA 4N1HA 5D3OA 1ZKJA 4E3IA 4F94A 3DWZA 1N4OA 1L2SA 1BUEA 1JWVA 1TDLA 2H0TA 1RGZA 4QD4A 3RXWA 3N8LA 2Y59A 4JKTA 3GSGA 1I2SA 4GB7A 5GLAA 5GL9A 4KZ5A 1MWTA 1TDGA 4B4ZA 1CEFA 2R9WA 4BL3A 5E2FA 1LL9A 1PIOA 3IWOA 4YFMA 5HAIA 1FCOA 1LI0A 3NI9A 2P9VB 1ZG6A 4LCLA 3HLCA 5HARA 3A3IA 1NJ4A 1SDNA 3VOYA 1GHPA 2EFXA 3AGEA 3FV7A 4KZ7A 4QJGA 3ZHHA 1EI5A 1ONHA 2ZQ7A 4OOMA 1G68A 4S2OA 3Q7ZA 5FQMA 3Q81A 5FQ9A 1KE0A 1M6KA 2WGWB 2XFTA 4OPYA 3HLEA 3RJUA 1Z6FA 4KZ9A 3CZDA 3SS5A 3V50A 1ZC2A 4FSFA 1RP5A 4MLLA 1LI9A 1K4EA 1TEMA 4ID4A 2XF3A 2BG1A 2X71A 2VGJA 1DY6A 1WE4A 3SS4A 1HTZA 3OC2A 4Z9QA 3CMZA 5HW3A 3BFCA 1XPBA 1HD8A 5M18A 3IXGA 4R0QA 3UDXA 5A92A 4DXCA 4U3TA 3N8RA 4ZDXA 3M2KA 3W8KA 3PBOA 4BLMA 1H8ZA 3DW0A 3LEZA 3ZG9B 3IWIA 5FDHA 1KDSA 1BLPA 1NYYA 4EWFA 2Y4AA 5FAQA 2Y2LA 5F1FA 5U47A 3WRZA 2WGWA 1PWCA 3Q07A 3A3JA 3N6IA 3BFDA 3OCLA 2Z2LB 3P09A 1NY0A 2XH9A 3EQUA 3VMAA 1BTLA 4EBLA 3W4PA 2WZZA 3WRTA 4OOYA 2EX8A 1I5QA 1YMSA 1BSGA 3ZCZA 5FQKA 1DJAA 1K38A 4ZTKA 3D4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K25 A;  4JPM A;  1K56 A;  3CJM A;  4K0X A;  3WS5 A;  4JXW A;  4BD1 A;  5AQ9 A;  4KZ3 A;  4Y7P A;  5DVA A;  5EVI A;  3Q1F A;  4Q8I A;  1BUL A;  1K57 A;  5JYP A;  4XUX A;  4OKP A;  3A3F A;  3PBR A;  3VP4 A;  1W79 A;  3N7W A;  2Y2M A;  5TFQ A;  1JVJ A;  4L0L A;  1XP4 A;  5GHY A;  2Q9M A;  3ITB A;  3BFE A;  3SS3 A;  4JF4 A;  2WUQ A;  3IXB A;  2WKI A;  4EQI A;  1GCE A;  4P0M A;  3VSL A;  2A3U A;  2V2F F;  3UPP A;  2B5R A;  1TVF A;  1WYC A;  4BEN A;  1PI5 A;  2IWC A;  2JE5 A;  1IKG A;  2XR0 A;  3GTC A;  3PBS A;  4R3B A;  1FQG A;  3G30 A;  2V20 A;  5GLD A;  2JBF A;  4ZAM A;  4ZBE A;  4GD8 A;  3GVB A;  3BEC A;  3OPH A;  3ZVT A;  3BM6 A;  4E3J A;  4WEJ A;  1N9B A;  5CHJ A;  1MKI A;  4OLG A;  4FD8 A;  4A5R A;  2V1Z A;  3UY6 A;  3WS1 A;  3UPO A;  1NZO A;  2Q9N A;  4OQ0 A;  3LO7 A;  4S2N C;  1L0E A;  3IT9 A;  4PM8 A;  3IHB A;  4DE2 A;  2ZC5 B;  3ZG8 B;  1U60 A;  2Z2M B;  3NY4 A;  4WZ5 C;  4WMC A;  4N9L A;  4OH0 A;  2J8Y A;  5HAP A;  3MZE A;  1EWZ A;  3UPN A;  1PYY A;  1XX2 A;  1W8Q A;  5EVI C;  3SH7 A;  1K57 C;  1JTD A;  3C5A A;  2QPN A;  5E43 A;  3Q7V B;  3FYZ A;  3M6H A;  1IEM A;  2XK1 A;  4JF6 A;  1ES2 A;  4GN2 A;  2P74 A;  3C4O A;  4MEZ A;  3HBR A;  3OCN A;  1ESU A;  4ZJ1 A;  3TOI A;  4OPQ A;  3BFG A;  5HL1 A;  2Y2K A;  4KZ6 A;  1MXO A;  4Y0O A;  1XA1 A;  3WS0 A;  4BD0 A;  3BLS A;  4M3K A;  1IYO A;  5AQB A;  1BLS A;  2RL3 A;  5KZH A;  1ESI A;  1PWD A;  3HRE A;  4IBX A;  5A90 A;  4S2L A;  3PBQ A;  2H0Y A;  4CPK A;  4NET A;  1RGY A;  5GLB A;  2A49 A;  1JTG A;  3C4P A;  3MKF A;  4DKI A;  5HAQ A;  1ERQ A;  3JYI A;  3Q7V A;  1SDE A;  3M2J A;  3M6B A;  4XUZ A;  1CI8 A;  4GNU A;  4IVK A;  1BZA A;  1ERM A;  1YLW A;  2OSU A;  5CXW A;  3OZH A;  4RA7 A;  3MZD A;  2DCF A;  1K6R A;  5KMW A;  3G35 A;  3FKW A;  1JWZ A;  3EQV A;  4WBG A;  1XGI A;  5CHM A;  3DTM A;  1KE3 A;  4HBU A;  1ERO A;  4DE3 A;  1PW8 A;  2E8I A;  5E2H A;  2DRW A;  4OPZ A;  1H5X A;  3BRM A;  2Y91 A;  2Y2J A;  4PMA A;  4HEF A;  3V5M A;  3ZNT A;  1KGE A;  2ZQ8 A;  1L0D A;  3A3D A;  3HLW A;  1PZP A;  1Q2Q A;  5DF7 A;  3NDG A;  2P9V A;  3HUN A;  5FSR A;  3S22 A;  2J9P A;  4KG5 A;  1BLC A;  1IYQ A;  1KGG A;  5G18 A;  3HLG A;  3IF6 B;  3E2L A;  4Y0T A;  1KVM A;  4UA6 A;  2HDR A;  1CK3 A;  3TG9 A;  4B4X A;  4BQM A;  1GA0 A;  3QNB A;  3MBZ A;  5FQJ A;  5EVL A;  4X6T A;  4OP5 A;  4WM9 A;  3B3X A;  4QB8 A;  1YLY A;  4JXV A;  4LV1 A;  5DF8 A;  5F82 A;  2CC1 A;  4IVI A;  5FAO A;  3UE3 A;  5FI6 A;  1E4D A;  2ZD8 A;  4QHC A;  4Y0U A;  1XXM A;  3O87 A;  1S0W A;  3W4O A;  3O3V A;  4OON A;  2WK0 A;  4KQR A;  4B88 A;  5HX9 A;  1NYM A;  4P6B A;  3BEB A;  1PW1 A;  2VGK A;  5E2E A;  5TGF A;  4PM5 A;  1DJB A;  1ALQ A;  1GA9 A;  1GHM A;  3UE1 A;  4E6W A;  4DDY A;  1ES3 A;  4EV4 A;  3HUM A;  4PPR A;  1YLT A;  4RYE A;  2OLU A;  2EFU A;  3GQZ A;  3BFF A;  4OLD A;  4KG6 A;  3S1Y A;  1J9M A;  2UWX A;  4S2M A;  1I2W A;  5M1A A;  2ZQD A;  5FI2 A;  1QME A;  2XD1 A;  4MBF A;  1XKZ A;  2ZQ9 A;  2WAE A;  4JF5 A;  4DDS A;  2G2U A;  2XLN A;  1ES4 A;  3G31 A;  1YM1 A;  5HFO A;  1FR6 A;  3NC8 A;  1PI4 A;  4KZB A;  4WYY A;  4ZJ3 A;  4DRT A;  1LHY A;  3AGF A;  5EOO A;  1FSY A;  5KSC A;  5FQI A;  3FWL A;  4R3J A;  4GD6 A;  4JLF A;  4PM6 A;  4O7D A;  2WZX A;  2ZM0 A;  2ZJ9 A;  3UDF A;  1K4F A;  4WZ4 A;  1YQS A;  2EX2 A;  3ZGA B;  3CG5 A;  4PM7 A;  1K54 A;  4KZ8 A;  3MFD A;  4P87 A;  1FOF A;  4MNR A;  2PU4 A;  5FAP A;  1O7E A;  3S4X A;  1L0F A;  2EXB A;  2Y2H A;  3BYD A;  5CED A;  5EEC A;  2DNS A;  2ZMA A;  1DJC A;  3G32 A;  1VM1 A;  3IQA A;  1ZG4 A;  3I7J A;  4GZB A;  1S6R A;  2Y2P A;  1KGF A;  2XGN A;  2EX9 A;  4LCM A;  3G4P A;  3IXH A;  1C3B A;  1VQQ A;  1W8Y A;  3FKV A;  3MZF A;  4P85 A;  3VP3 A;  3C7U A;  4RVA A;  3VP1 A;  2X02 A;  4X68 A;  2Y2I A;  1OME A;  3RXX A;  3O86 A;  3IWQ A;  1BLH A;  3HLB A;  4WEL A;  2Y55 A;  4X53 A;  3UDI A;  2ZM2 A;  3PTE A;  2GDN A;  2WKE A;  3AGD A;  4N1X A;  4D2O A;  4JXG A;  4DXB A;  3ITA A;  4KZA A;  2ZC6 B;  2HPB A;  1W7F A;  3MXS A;  1IYS A;  1K55 A;  5EPH A;  2J9O A;  1K56 D;  2RCX A;  3GMW A;  4X55 A;  1KE4 A;  3SH9 A;  4CJN A;  4GDB A;  1K54 C;  4E3L A;  4S2K A;  4OOL A;  3A3E A;  5CGS A;  2ZC7 A;  3HLF A;  4E3O A;  1YT4 A;  5EVI D;  2FFF B;  4GKU A;  1FCN A;  5DTT A;  3MXR A;  2QMI A;  2G2W A;  1FSW A;  1W5D A;  5DF9 A;  3OPR A;  1GHI A;  2WAD A;  5FI7 A;  4H8R A;  1SKF A;  2JC7 A;  4K0W A;  5CRF A;  2WKH A;  3MKE A;  4K91 A;  2BLS A;  2OV5 A;  3G34 A;  3ZDJ A;  4KQO A;  1KVL A;  4BL2 A;  2HP5 A;  5GHX A;  4DE1 A;  4OQG A;  1MY8 A;  5CER A;  5L2F A;  1L0G A;  1IEL A;  1M40 A;  3C7V A;  2XDM A;  4OQH A;  2FFY A;  4LV3 A;  5AQ7 A;  1IKI A;  2HDU A;  3V3S A;  3VSK A;  2ZQA A;  5CGX A;  1HVB A;  1YMX A;  4S2I A;  5CTN A;  4C75 A;  4YIN A;  1KDW A;  4MBK A;  1YLZ A;  1WYB A;  4N9K A;  1SCW A;  2J7V A;  2Y2N A;  3IF5 A;  2WGV A;  3NBL A;  3ZNY A;  1PWG A;  4UAA A;  4E3M A;  4QU3 A;  4DF6 A;  3FZC A;  5F1G A;  3V3R A;  3ZFZ A;  5EUA A;  3LY3 A;  2HDS A;  4EBN A;  4C3Q A;  4GDN A;  4JBF A;  5CHU A;  1K55 C;  1FCM A;  3UE0 A;  1G6A A;  4WMC D;  1Y54 A;  5EVI B;  4RX3 A;  4WEK A;  5AQA A;  3HUO A;  3QHY A;  3OPL A;  1NZU A;  5EOE A;  2PU2 A;  4EBP A;  3OPP A;  5GLC A;  2ZC3 B;  4HBT A;  5A93 A;  3GRJ A;  3IH8 A;  1E25 A;  3IF6 A;  3O88 A;  4R1G A;  1E3U D;  5F83 A;  3WS4 A;  4OVD A;  1H8Y A;  5FQQ A;  1YLJ A;  4FH4 A;  1NXY A;  5DTS A;  5DTK A;  5CEB A;  1MPL A;  4E6X A;  2EXA A;  1HZO A;  4LEN A;  4S2N A;  1MWS A;  2H10 A;  5FAT A;  2WGI A;  1ONG A;  3WWX A;  4ZJ2 A;  2JCH A;  2ZQC A;  5EE8 A;  5J8X A;  3SH8 A;  1SHV A;  4WZ5 A;  3WS2 A;  1BT5 A;  2ZC4 B;  1CI9 A;  2XFS A;  1ES5 A;  3PAG A;  3TSG A;  3NIA A;  1PZO A;  1FR1 A;  3N4I A;  4OQI A;  1LLB A;  2Y2Q A;  3LCE A;  5A91 A;  5IHV A;  5JYO A;  2IWD A;  4NK3 A;  4IBR A;  5E2G A;  4X56 A;  4R4S A;  4IED A;  5CEC A;  3HVF A;  2WAF A;  1MWR A;  2X01 A;  2OLV A;  2PBY A;  4PM9 A;  2XD5 A;  4BJP A;  4OPR A;  5GHZ A;  1JWP A;  1O07 A;  3G2Z A;  3ZG5 A;  2I72 A;  3HLD A;  2ZLY A;  4S2P A;  1RCJ A;  4KZ4 A;  4LV2 A;  3VP0 A;  3QNC A;  3UNW A;  5M19 A;  3VFF A;  1NRF A;  4QY5 A;  4KG2 A;  3ZVW A;  4RX2 A;  4X69 A;  5FA7 A;  5TR7 A;  3IF6 C;  1AXB A;  3HL9 A;  3PAE A;  1IYP A;  2HDQ A;  2C5W B;  4GOG A;  5FAS A;  1XGJ A;  3N8S A;  3LY4 A;  3ZG0 A;  2Y2G A;  3DWK A;  4R4R A;  4C6Y A;  4MBH A;  5BOH A;  1K6S A;  2H5S A;  3IXD A;  3PBN A;  2EX6 A;  4FH2 A;  4N92 A;  4UA9 A;  3UO9 A;  2HP9 A;  2ZM8 A;  3GV9 A;  4U0T A;  3BLM A;  5I94 A;  1QMF A;  2Y2O A;  4S2J A;  4UHU A;  4LV0 A;  3NDE A;  1MBL A;  4OP8 A;  4DE0 A;  4FCF A;  1MWU A;  4U0X A;  2R9X A;  1CEG A;  4E3K A;  1LL5 A;  1Q2P A;  2HP6 A;  2QZ6 A;  3IH9 A;  4JXS A;  3SOI A;  3V39 A;  3VOZ A;  3IHA A;  3VFH A;  4KQQ A;  3ZG7 B;  1E3U A;  4XXR A;  4HES A;  3GR2 A;  3UN7 A;  1YLP A;  3NCK A;  4R23 A;  1XA7 A;  2C6W B;  3ISG A;  5KSH A;  3Q82 A;  3VP2 A;  2XQZ A;  3G2Y A;  3P98 A;  2WYX A;  2IWB A;  4QY6 A;  4UA7 A;  5CGW A;  5CTM A;  3W4Q A;  2XEP A;  4E3N A;  4EUZ A;  4KEN B;  3PBT A;  3E2K A;  4N1H A;  5D3O A;  1ZKJ A;  4E3I A;  4F94 A;  3DWZ A;  1N4O A;  1L2S A;  1BUE A;  1JWV A;  1TDL A;  2H0T A;  1RGZ A;  4QD4 A;  3RXW A;  3N8L A;  2Y59 A;  4JKT A;  3GSG A;  1I2S A;  4GB7 A;  5GLA A;  5GL9 A;  4KZ5 A;  1MWT A;  1TDG A;  4B4Z A;  1CEF A;  2R9W A;  4BL3 A;  5E2F A;  1LL9 A;  1PIO A;  3IWO A;  4YFM A;  5HAI A;  1FCO A;  1LI0 A;  3NI9 A;  2P9V B;  1ZG6 A;  4LCL A;  3HLC A;  5HAR A;  3A3I A;  1NJ4 A;  1SDN A;  3VOY A;  1GHP A;  2EFX A;  3AGE A;  3FV7 A;  4KZ7 A;  4QJG A;  3ZHH A;  1EI5 A;  1ONH A;  2ZQ7 A;  4OOM A;  1G68 A;  4S2O A;  3Q7Z A;  5FQM A;  3Q81 A;  5FQ9 A;  1KE0 A;  1M6K A;  2WGW B;  2XFT A;  4OPY A;  3HLE A;  3RJU A;  1Z6F A;  4KZ9 A;  3CZD A;  3SS5 A;  3V50 A;  1ZC2 A;  4FSF A;  1RP5 A;  4MLL A;  1LI9 A;  1K4E A;  1TEM A;  4ID4 A;  2XF3 A;  2BG1 A;  2X71 A;  2VGJ A;  1DY6 A;  1WE4 A;  3SS4 A;  1HTZ A;  3OC2 A;  4Z9Q A;  3CMZ A;  5HW3 A;  3BFC A;  1XPB A;  1HD8 A;  5M18 A;  3IXG A;  4R0Q A;  3UDX A;  5A92 A;  4DXC A;  4U3T A;  3N8R A;  4ZDX A;  3M2K A;  3W8K A;  3PBO A;  4BLM A;  1H8Z A;  3DW0 A;  3LEZ A;  3ZG9 B;  3IWI A;  5FDH A;  1KDS A;  1BLP A;  1NYY A;  4EWF A;  2Y4A A;  5FAQ A;  2Y2L A;  5F1F A;  5U47 A;  3WRZ A;  2WGW A;  1PWC A;  3Q07 A;  3A3J A;  3N6I A;  3BFD A;  3OCL A;  2Z2L B;  3P09 A;  1NY0 A;  2XH9 A;  3EQU A;  3VMA A;  1BTL A;  4EBL A;  3W4P A;  2WZZ A;  3WRT A;  4OOY A;  2EX8 A;  1I5Q A;  1YMS A;  1BSG A;  3ZCZ A;  5FQK A;  1DJA A;  1K38 A;  4ZTK A;  3D4F A; 
#chains in the Genus database with same CATH topology
 3WS5 A;  4Y7P A;  1K57 A;  3H7W A;  4EET B;  5J4E A;  3SS3 A;  2V1A A;  4Y3I A;  2XR0 A;  5DF8 A;  3C38 A;  2VV7 A;  2V20 A;  2W27 A;  2DMW A;  4E3J A;  2PYP A;  2PR6 A;  2V9A A;  4EUV A;  4OLG A;  4FD8 A;  5F5Y A;  4HIA A;  2K31 A;  2PD8 A;  2VK3 A;  1P0Z A;  2LB9 A;  4BMW A;  3JVV A;  4OH0 A;  2J8Y A;  1EWZ A;  1PYY A;  3C8C A;  1W8Q A;  3SH7 A;  4BBT A;  4FTX A;  3VE3 A;  4Z1W A;  3F1P A;  1ES2 A;  3C4O A;  2B02 A;  3MMH A;  4OPQ A;  3BFG A;  3E4O A;  3E4Q A;  1MXO A;  1XA1 A;  3LR3 A;  4NEE D;  3H82 B;  1IYO A;  1ESI A;  1BYW A;  4S2L A;  2A49 A;  1JTG A;  2XRN A;  3JYI A;  1YLW A;  5HWV A;  2DCF A;  5KMW A;  3EQV A;  2W1T A;  4WBG A;  1YSQ A;  5CHM A;  4HBU A;  4OPZ A;  3GDI A;  3CAX A;  4CLC C;  3DTE A;  3ZNT A;  4L9F A;  2ZQ8 A;  1L0D A;  5FSR A;  1BLC A;  4ZRR A;  2VJW A;  3KO6 A;  4R70 A;  4B4X A;  3QNB A;  4WF0 A;  5FQJ A;  4B9O A;  2ZD8 A;  4QHC A;  4Y0U A;  2Z6C A;  3IX4 A;  3O87 A;  1KOU A;  3NHQ A;  3UB5 P;  1NYM A;  3BEB A;  1GHM A;  3UE1 A;  4DDY A;  1ES3 A;  2OLU A;  4HJ6 A;  1LT0 A;  4I38 A;  1P9R A;  3CUE A;  4S2M A;  1I2W A;  5M1A A;  4ETX A;  4MBF A;  3SZT A;  2WAE A;  4DDS A;  1NRJ A;  3G31 A;  3B33 A;  3LFV A;  3NC8 A;  3KX0 X;  1OT9 A;  3FWL A;  2VKS A;  3BY8 A;  4R6L A;  4WZ4 A;  5G4Z A;  4PM7 A;  1K54 A;  4L9G A;  3MFD A;  1FOF A;  4MNR A;  5AVF A;  1VM1 A;  1Z09 A;  1VB6 A;  2EX9 A;  4EEU A;  3E98 A;  2L1M A;  3C7U A;  2H28 A;  2X02 A;  3RXX A;  3O86 A;  3IWQ A;  2Y55 A;  3UDI A;  4LRZ E;  3AGD A;  4JXG A;  1W7F A;  4MDZ A;  5L10 A;  4E3L A;  3O5Y A;  2JKT M;  3MF0 A;  5DFX A;  4EER A;  1FCN A;  1SKF A;  3MKE A;  4BL2 A;  1NLY A;  2HP5 A;  4DE1 A;  2WKQ A;  4JGO A;  4EW7 A;  2QWS A;  4OQH A;  4P6Z S;  4LV3 A;  2BTF P;  2HDU A;  1F98 A;  4N9K A;  2J7V A;  1T1B A;  3IF5 A;  4QU3 A;  3V3R A;  5EUA A;  3DAV A;  2OAP 1;  2Y8H A;  5CHU A;  2JKR M;  3A0S A;  5EVI B;  5A93 A;  3O88 A;  1H8Y A;  4NXE A;  5EM0 A;  3QP5 A;  4FH4 A;  3OOV A;  2PYR A;  3BQ8 A;  2O9C A;  5J8X A;  1SHV A;  5G4Y A;  2AVX A;  2XFS A;  1ES5 A;  3TSG A;  1PZO A;  3RH8 B;  3LCE A;  4II7 A;  4R4S A;  3HVF A;  3BW6 A;  2J3W A;  4OPR A;  5GHZ A;  1JWP A;  3JPU A;  4KZ4 A;  3VP0 A;  3QNC A;  4R3A A;  2JN7 A;  4RX2 A;  5FA7 A;  3IF6 C;  1AXB A;  3ZG0 A;  3DWK A;  5BOH A;  5TBM B;  3PBN A;  4FH2 A;  3UO9 A;  3GV9 A;  2XA7 M;  3BLM A;  1QMF A;  4Q0I A;  3EEH A;  3NDE A;  4U0X A;  2R9X A;  1LL5 A;  2IA2 A;  4RQ9 A;  3ZG7 B;  4XXR A;  2KLI A;  3GR2 A;  5J7E A;  1H3Q A;  5KSH A;  3LR5 A;  4NXG A;  2IWB A;  3U4L P;  2WYX A;  5C5K A;  4UA7 A;  4EUZ A;  4KEN B;  4N1H A;  5TBM A;  5A8B A;  3PYP A;  1L2S A;  4QD4 A;  4JKT A;  4WL9 A;  4XT2 B;  4O0P A;  1CEF A;  1NLZ A;  3IWO A;  5HAI A;  3NI9 A;  3HLC A;  2GJ3 A;  5HAR A;  4JGR A;  4GS9 B;  3ZHH A;  2ZQ7 A;  4OOM A;  5FQ9 A;  1M6K A;  2XFT A;  4KZ9 A;  5L07 A;  4FSF A;  1RP5 A;  4MLL A;  4FUW A;  1K4E A;  3KSH A;  2XF3 A;  2VGJ A;  5TJJ A;  1HTZ A;  3OC2 A;  1UGU A;  2EWW A;  5HW3 A;  3BFC A;  2EWV A;  3IXG A;  4R0Q A;  3M2K A;  1P9W A;  3V67 A;  1H8Z A;  3DW0 A;  3LEZ A;  3ZG9 B;  5FDH A;  1KDS A;  4Y17 A;  2Y2L A;  5F1F A;  3WRZ A;  1PWC A;  1OJ5 A;  3N6I A;  3K3C A;  5EM1 A;  2VGL S;  3LIE A;  3C2W A;  2LB5 A;  1K56 A;  1DRM A;  4JXW A;  4BD1 A;  4KZ3 A;  3T12 B;  3A3F A;  1VEU B;  3VP4 A;  1TF1 A;  4L0L A;  1XP4 A;  4JGQ A;  4JF4 A;  4GCZ A;  3IXB A;  4EQI A;  1GCE A;  2A3U A;  3RFB A;  3MFX A;  4DJ2 A;  3GTC A;  1IKG A;  5HL6 A;  5GLD A;  3PBS A;  1FQG A;  4ZBE A;  4ZAM A;  4GD8 A;  3ZVT A;  3BM6 A;  5CHJ A;  2M7U A;  1NZO A;  2Q9N A;  4OQ0 A;  4S2N C;  3EGX C;  3IT9 A;  3UMD A;  2ZC5 B;  1S67 L;  1U60 A;  1ZTU A;  2Z2M B;  5HAP A;  3MZE A;  4I3A A;  2ZBB A;  3UPN A;  1XX2 A;  3MQQ A;  1K57 C;  1JTD A;  3C5A A;  2QPN A;  1T1A A;  3FYZ A;  1IEM A;  3M6H A;  2QHK A;  3QP8 A;  3HBR A;  3OCN A;  1ESU A;  4ZJ1 A;  3TOI A;  4ETZ A;  4KZ6 A;  3OBF A;  3WS0 A;  3BLS A;  5J3W A;  2RL3 A;  3BJN A;  3HRE A;  5A90 A;  3PBQ A;  1J3W A;  1XFQ A;  1RGY A;  3C4P A;  3MKF A;  5HAQ A;  5HPF A;  3M2J A;  1CI8 A;  4GNU A;  5CXW A;  1BZA A;  3MZD A;  3G35 A;  1JWZ A;  2YKF A;  5E2H A;  3LGO A;  4PMA A;  1KGE A;  3TW8 A;  4IUK A;  2P9V A;  3HCY A;  1IYQ A;  3QP6 A;  1V9Y A;  3MQO A;  4Y0T A;  1KVM A;  4ARZ A;  2HDR A;  3TG9 A;  4O8G A;  1ACF A;  4BQM A;  1GA0 A;  4OP5 A;  4WM9 A;  4QB8 A;  5L8M A;  3EWK A;  2CC1 A;  5FI6 A;  1E4D A;  3A0R A;  3VE4 A;  3W4O A;  4OON A;  1DP8 A;  2WK0 A;  2FH5 A;  4B88 A;  4P6B A;  1PW1 A;  2VGK A;  5TGF A;  5HSQ A;  4GLQ A;  4KG6 A;  3QP1 A;  1J9M A;  1K0K A;  4O01 A;  5FI2 A;  3KYZ A;  4JF5 A;  2O99 A;  2XLN A;  2UV0 E;  5HFO A;  4YWZ A;  1PI4 A;  4B93 A;  4WYY A;  3AGF A;  1FSY A;  2JKF A;  1JNU A;  4GD6 A;  3T4S A;  4PM6 A;  4O7D A;  2WZX A;  2ZM0 A;  4NXB A;  2ZJ9 A;  3NUL A;  3UB8 A;  1K4F A;  1YQS A;  4ESP A;  1OTI A;  2PU4 A;  1UWP X;  2EXB A;  3ICY A;  3PXP A;  2ZMA A;  3NOU C;  3G32 A;  3IQA A;  1HLU P;  1ZG4 A;  3I7J A;  1KGF A;  3PHY A;  3G4P A;  1XJ4 A;  1C3B A;  1VQQ A;  4P85 A;  4CLC E;  3VP3 A;  4X1M A;  4RVA A;  3VP1 A;  1OME A;  3LUQ A;  1XJ3 A;  3D9Y A;  2WKE A;  4D2O A;  4KZA A;  2HPB A;  3LIF A;  1K55 A;  2J9O A;  1K56 D;  2RCX A;  3GMW A;  1KE4 A;  4GDB A;  1K54 C;  2QJ5 A;  5HZH A;  3MXR A;  2QMI A;  2G2W A;  1FSW A;  5DF9 A;  1GHI A;  2WKR A;  3H82 A;  4H8R A;  2JC7 A;  2OV5 A;  1N9O A;  3G34 A;  3EEA A;  3UME A;  5GHX A;  1MY8 A;  5CER A;  1L0G A;  1IEL A;  2XDM A;  2FFY A;  1MKM A;  1IKI A;  3V3S A;  3T4T A;  2ZQA A;  1HVB A;  4S2I A;  3TRC A;  4YIN A;  2W3G A;  3IBJ A;  5DJU A;  2WGV A;  2JKT I;  1OTD A;  1SKO B;  2CMN A;  2HDS A;  4EBN A;  4JBF A;  2VEA A;  1FCM A;  1G6A A;  1Y54 A;  2V0U A;  4WEK A;  3QHY A;  4EBP A;  2PU2 A;  3TE8 A;  3GRJ A;  1TD5 A;  4Y15 A;  1NXY A;  5DTS A;  5DTK A;  3RTY A;  4D60 A;  1FIK A;  1MPL A;  4UQI M;  2EXA A;  1HZO A;  2H10 A;  5IS1 A;  4NKP A;  2JCH A;  4X25 A;  3WS2 A;  1BT5 A;  2ZC4 B;  1CI9 A;  2P04 A;  3PAG A;  1GSX A;  4G3V A;  2JKR I;  4IBR A;  4IED A;  2WAF A;  5EV0 A;  4HI4 A;  1MWR A;  2OLV A;  2PBY A;  2O0Y A;  3HLD A;  2W3E A;  4LV2 A;  1X0O A;  3VFF A;  4CLC B;  2Q0O A;  3QP2 A;  3HL9 A;  1P97 A;  4X1L A;  2ZMF A;  4HNB A;  2C5W B;  4GOG A;  1S1Y A;  1XGJ A;  3LY4 A;  4EQ1 A;  2Y2G A;  4R4R A;  2E8J A;  1K6S A;  1OPX A;  2H5S A;  4N92 A;  1MC0 A;  2ZM8 A;  2Y2O A;  4HP9 A;  1MBL A;  1DP9 A;  1MWU A;  1CEG A;  1ZHH B;  2ZMV A;  3E0Y A;  3VFH A;  3T50 A;  4CLC A;  1E3U A;  1WA9 A;  3UN7 A;  4Q0H A;  3L7H A;  3T1Q B;  3Q82 A;  3VP2 A;  2XQZ A;  3G2Y A;  5HDD A;  5CGW A;  3W4Q A;  1S66 L;  3PBT A;  3E2K A;  5D3O A;  3RXW A;  4HHD A;  3GSG A;  1FIL A;  1G28 A;  4UEY A;  4KZ5 A;  1TDG A;  4B4Z A;  3DBA A;  1PIO A;  1FCO A;  1ZG6 A;  2L4R A;  3A3I A;  1NJ4 A;  1SDN A;  3LYX A;  1ONH A;  2B18 A;  1G68 A;  2ZOH A;  3Q7Z A;  3MJQ A;  5FQM A;  3Q81 A;  1MZU A;  4PAU A;  1DY6 A;  1WE4 A;  4PHT A;  2K7S A;  2HF6 A;  2OOL A;  3N8R A;  1SZV A;  4EU0 A;  3JVU A;  4BLM A;  3IWI A;  1BLP A;  4EWF A;  2Y4A A;  2HV1 A;  5FAQ A;  3LIB A;  3H9W A;  5EFW A;  2OWH A;  3OCL A;  3P09 A;  2XH9 A;  1BTL A;  3WRT A;  4OOY A;  1YMS A;  5FQK A;  1K25 A;  4JPM A;  4K0X A;  3UE6 A;  5DVA A;  5EVI A;  3LR0 A;  5JYP A;  4OKP A;  4DN0 A;  1W79 A;  4KUK A;  5GHY A;  2Q9M A;  3HJI A;  4WLA A;  4P0M A;  5FEF A;  3VSL A;  2V2F F;  3UPP A;  2B5R A;  1WYC A;  1S1Z A;  3G30 A;  2JBF A;  2XA7 S;  3GVB A;  3BEC A;  3OPH A;  4WEJ A;  1N9B A;  1IOU A;  3ULF A;  2PD7 A;  3GEC A;  1L0E A;  2W3H A;  4PM8 A;  3DTK A;  3CWF A;  4DE2 A;  3ZG8 B;  3NY4 A;  4WZ5 C;  4WMC A;  1NWZ A;  4MN6 A;  4JF6 A;  4MEZ A;  3MR0 A;  1EW0 A;  2Y2K A;  3S7Q A;  5F69 A;  3UB6 A;  1PWD A;  4IBX A;  2H0Y A;  4HY8 A;  4CPK A;  1ODV A;  5GLB A;  5DJT A;  1ERQ A;  1W63 M;  4XUZ A;  2OSU A;  4RA7 A;  3FKW A;  4LRY C;  2OAQ 1;  4DE3 A;  1ERO A;  1PW8 A;  1H5X A;  4QWO A;  4FOF A;  3T1X A;  3LIA A;  3BRM A;  1VHM A;  3K3D A;  4HEF A;  5AVE A;  4XT2 A;  3NOT C;  4F3L B;  3A3D A;  5DF7 A;  3NDG A;  3ZQ5 A;  3FPV A;  2J9P A;  4EES A;  4KG5 A;  2EA9 A;  4GS9 A;  1KGG A;  1LSX A;  3HLG A;  3IF6 B;  3E2L A;  4UA6 A;  1G6O A;  3MBZ A;  3B3X A;  4LV1 A;  5F82 A;  4IVI A;  5FAO A;  2J3T D;  4F3L A;  4Y5F A;  1XXM A;  4M4X A;  3T4L A;  2GNX A;  1S0W A;  4Y2F A;  3O3V A;  1CQA A;  4LPZ A;  5HX9 A;  3QP4 A;  2KDK A;  5HWW A;  3CPT B;  3T4O A;  4EV4 A;  4PPR A;  4HJ3 A;  4OLD A;  2UWX A;  2HJE A;  5I5L A;  5LBR A;  1QME A;  1XKZ A;  2ZQ9 A;  1FR6 A;  3K2N A;  3D3O A;  2JHE A;  4KZB A;  4ZJ3 A;  4DRT A;  4MN5 A;  3U2A A;  4R3J A;  4I3J A;  3UB7 A;  4JLF A;  1YAX A;  1VEU A;  1F2K A;  2EX2 A;  3ZGA B;  3CG5 A;  2W0N A;  5DFY A;  4KZ8 A;  2QKP A;  5FAP A;  2V1B A;  1O7E A;  3FPW A;  3S4X A;  1L0F A;  2W3D A;  3BYD A;  5CED A;  2DNS A;  1DJC A;  1H0M A;  4GZB A;  4K08 A;  1S6R A;  1XJ6 A;  2XGN A;  3C30 A;  3MZF A;  3FKV A;  2P7J A;  3F1O B;  2ZOI A;  1BLH A;  4WEL A;  2ZM2 A;  2GDN A;  3T4J A;  4DXB A;  4G3K A;  4WUJ A;  2ZC6 B;  4DMZ A;  3CI6 A;  4X55 A;  4HH2 A;  4OOL A;  3A3E A;  5CGS A;  2PDR A;  4E3O A;  1YT4 A;  5EVI D;  5DTT A;  1W5D A;  3OPR A;  2WAD A;  3F1O A;  5CRF A;  5MC7 A;  4K91 A;  2BLS A;  3ZDJ A;  1KVL A;  3KYE A;  1LL8 A;  5DKK A;  5HPI A;  2D01 A;  1F9I A;  3VSK A;  4L9E A;  5FDS A;  3CHW P;  4C75 A;  3L9K A;  4MBK A;  1WYB A;  1SCW A;  2Y2N A;  3NBL A;  1PWG A;  4UAA A;  3S7P A;  4DF6 A;  2VLG A;  2VA0 A;  2W1R A;  3LY3 A;  4GDN A;  3NOP C;  4MN7 A;  1K55 C;  3UE0 A;  4WMC D;  2VV6 A;  4RX3 A;  2O9A A;  5AQA A;  1NZU A;  5EOE A;  1A0K A;  3OPP A;  2ZC3 B;  4HBT A;  5F83 A;  1H8M A;  5FQQ A;  1UWN X;  2OWJ A;  2PR5 A;  4S2N A;  1YPR A;  4LRX C;  1MWS A;  4Q0J A;  2WGI A;  4CQH A;  4ZJ2 A;  2ZQC A;  5EE8 A;  2QYB A;  4MCW A;  1D06 A;  3LID A;  4QPR A;  2L0W A;  1FR1 A;  4OQI A;  1LLB A;  4NK3 A;  2PAV P;  1OTA A;  4HOI A;  3G2Z A;  3ZG5 A;  2HGV A;  2I72 A;  2ZLY A;  5M19 A;  4QY5 A;  3ZVW A;  4X69 A;  3F1P B;  1IYP A;  2HDQ A;  5L09 A;  5FAS A;  4LFU A;  4C6Y A;  4MBH A;  3W2Z A;  3A0V A;  3G6O A;  3CUE C;  4U0T A;  5I94 A;  4S2J A;  4LV0 A;  2PBD P;  4FCF A;  4E3K A;  1Q2P A;  3V39 A;  3IH9 A;  3SOI A;  4JXS A;  2M1C A;  5HDC A;  5DKL A;  1YLP A;  4R23 A;  1XA7 A;  2C6W B;  3BQA A;  3P98 A;  2W1T B;  4HH3 A;  5CTM A;  2XEP A;  4NXF A;  5CX7 A;  1ZKJ A;  4F94 A;  3KSI A;  3DWZ A;  1N4O A;  5HD3 A;  1BUE A;  1JWV A;  2H0T A;  2Y59 A;  2Z6D A;  1MWT A;  4BL3 A;  1OT6 A;  3VOY A;  2J3T C;  4QJG A;  4I5S A;  3D72 A;  3P01 A;  2W3F A;  3RJU A;  3SS5 A;  3V50 A;  1TS7 A;  1TEM A;  4ID4 A;  2BG1 A;  1XJ2 A;  3CMZ A;  4G3W A;  4KUO A;  1XPB A;  5A92 A;  4ZDX A;  1N9L A;  1TS6 A;  2QJ7 A;  4AFI A;  3PBO A;  4UQI S;  2HJ9 C;  2K2N A;  1PNE A;  5U47 A;  4EEP A;  3E4P A;  3F1N B;  2G7U A;  2Z2L B;  1TS0 A;  3EQU A;  3W4P A;  1LSW A;  1SKO A;  3ZCZ A;  1BSG A;  1K38 A;  5F68 A;  4ZTK A;  3WS1 A;  2INW A;  3CJM A;  5AQ9 A;  1LSV A;  1V9Z A;  3Q1F A;  4Q8I A;  1BUL A;  4XUX A;  3PBR A;  3N7W A;  2V0W A;  2Y2M A;  5TFQ A;  1JVJ A;  3F1N A;  3ITB A;  3BFE A;  3T4Q A;  2WUQ A;  2WKI A;  5FL3 A;  2J80 A;  2P08 A;  1TVF A;  4BEN A;  2GX5 A;  1PI5 A;  2IWC A;  2JE5 A;  1GSW A;  4R3B A;  2PT7 A;  1MKI A;  3IS2 B;  4A5R A;  2V1Z A;  3UY6 A;  3UPO A;  3LO7 A;  1S4R A;  3IHB A;  5IT5 A;  3UB9 A;  4N9L A;  4EXO A;  5EVI C;  5E43 A;  3Q7V B;  2XK1 A;  4GN2 A;  2PHY A;  2P74 A;  3IS2 A;  5HL1 A;  1L3L A;  4Y0O A;  3T1R A;  2I9V A;  3IBR A;  4BD0 A;  4M3K A;  5AQB A;  1BLS A;  5KZH A;  3P7N A;  4NET A;  1G5U A;  1IFQ A;  4H6J B;  4DKI A;  3Q7V A;  3T4K A;  1SDE A;  2KOI A;  3M6B A;  4IVK A;  1ERM A;  3OZH A;  1K6R A;  1XGI A;  1N9N A;  3DTM A;  1KE3 A;  3LI9 A;  2E8I A;  2DRW A;  4E04 A;  3PR6 A;  2Y91 A;  2Y2J A;  3V5M A;  3KSF A;  4ME4 A;  1OJG A;  3HLW A;  2MJ6 A;  1PZP A;  1Q2Q A;  4H6J A;  4GHI B;  3BWL A;  3HUN A;  1PRQ A;  3S22 A;  5G18 A;  2NUP C;  1CK3 A;  1GSV A;  1YSP A;  3FG8 A;  4X6T A;  4P6Z M;  2A24 B;  1YLY A;  4JXV A;  3UE3 A;  4BWI A;  5HDS A;  1T1C A;  1TS8 A;  4GHI A;  4KQR A;  4BBV A;  5E2E A;  4PM5 A;  1DJB A;  1ALQ A;  1GA9 A;  4E6W A;  4HJ4 A;  4WN5 A;  5HD5 A;  1OTB A;  4NG2 A;  3HUM A;  1YLT A;  4RYE A;  3IX8 A;  3GQZ A;  2EFU A;  5K5B A;  3BFF A;  3S1Y A;  1W63 Q;  2A24 A;  2ZQD A;  2WKP A;  2XD1 A;  3VV4 A;  2G2U A;  1ES4 A;  1YM1 A;  3MSH A;  1AWI A;  1LHY A;  5EOO A;  2Y79 A;  5KSC A;  5FQI A;  3R7W B;  1F5M A;  3UDF A;  3CIT A;  3KSG A;  3KYQ A;  1T19 A;  2A2L A;  4P87 A;  4R38 A;  1CF0 A;  2Y2H A;  2B95 A;  2FZ0 A;  4IUH A;  5EEC A;  4DJ3 A;  3R7W A;  2Y2P A;  4LCM A;  2XSS A;  3IXH A;  3B47 A;  1W8Y A;  3T1S A;  2M7V A;  1S4S A;  4HQA A;  4X68 A;  2Y2I A;  3HLB A;  4X53 A;  3PTE A;  4N1X A;  3ITA A;  3MXS A;  1IYS A;  3EOI A;  5EPH A;  2VZW A;  4CJN A;  3SH9 A;  4S2K A;  2ZC7 A;  3HLF A;  2FFF B;  4GKU A;  5EVL A;  3MXQ A;  5FI7 A;  4K0W A;  4YOF A;  2WKH A;  2PRF A;  4KQO A;  2XRO A;  4OQG A;  2ZL1 B;  5L2F A;  1YKD A;  3LR4 A;  1M40 A;  3C7V A;  3B42 A;  3S7O A;  5FEG A;  5AQ7 A;  3IX3 A;  5CGX A;  1YMX A;  5CTN A;  1KDW A;  1YLZ A;  4HP4 A;  3ZNY A;  4E3M A;  4BBU A;  3FZC A;  4GW9 A;  5F1G A;  3ZFZ A;  4IHQ A;  1Y28 A;  4C3Q A;  1D1J A;  2ZL1 A;  1OTE A;  3HUO A;  3OPL A;  5GLC A;  3IH8 A;  1E25 A;  3IF6 A;  4R1G A;  4CLC D;  1E3U D;  3WS4 A;  4OVD A;  1YLJ A;  5CEB A;  4E6X A;  3LIC A;  4LEN A;  5FAT A;  1ONG A;  3VOL A;  3WWX A;  3SH8 A;  4WZ5 A;  3MQ0 A;  1D7E A;  4PKY G;  3NIA A;  5F6A A;  3N4I A;  2D02 A;  3LEQ A;  4PKY A;  2Y2Q A;  5A91 A;  5JYO A;  5IHV A;  2IWD A;  1VET B;  5E2G A;  4X56 A;  2ACG A;  5CEC A;  2VGL M;  3CPT A;  5KIZ A;  2X01 A;  4PM9 A;  2XD5 A;  4BJP A;  1O07 A;  3S7N A;  4S2P A;  4LGW A;  1RCJ A;  3R4K A;  3UNW A;  1NRF A;  4KG2 A;  5TR7 A;  3PAE A;  4KQD A;  1STZ A;  5AJG A;  3N8S A;  1VET A;  2GZA A;  3NJA A;  3IXD A;  4UA9 A;  2EX6 A;  2HP9 A;  4UHU A;  4OP8 A;  4DE0 A;  2HP6 A;  2QZ6 A;  3VOZ A;  5HWT A;  3IHA A;  5EVE A;  4KQQ A;  4I3I A;  4HES A;  3HJK A;  2O9B A;  2BAS A;  3NCK A;  3ISG A;  2KX6 A;  3CLO A;  4QY6 A;  4E3N A;  4E3I A;  3BY9 A;  1TDL A;  1RGZ A;  1XFN A;  2VV8 A;  3N8L A;  1I2S A;  4GB7 A;  5GLA A;  5GL9 A;  3NEC A;  4Y13 A;  2VX8 A;  2R9W A;  5E2F A;  1LL9 A;  3DTI A;  4GJ4 A;  4YFM A;  1LI0 A;  2V8F A;  3MS6 A;  2P9V B;  4YNR A;  4LCL A;  2NUT C;  4LLO B;  1GHP A;  2EFX A;  3AGE A;  3FV7 A;  4KZ7 A;  3LI8 A;  4MMN A;  1EI5 A;  4S2O A;  1Y4O A;  1KE0 A;  2JKG A;  4ARZ B;  2V8C A;  3FC7 A;  2WGW B;  4OPY A;  3HLE A;  1Z6F A;  2YKH A;  1T18 A;  3SW1 A;  3CZD A;  1CJF A;  1ZC2 A;  1LI9 A;  2X71 A;  3SS4 A;  4Z9Q A;  1HD8 A;  3EGD C;  5M18 A;  3UDX A;  4DXC A;  4U3T A;  3ZYT A;  3OLO A;  3W8K A;  2HZ5 A;  1NYY A;  1PFL A;  3H7W B;  4I39 A;  4JGP A;  2WGW A;  3Q07 A;  2R78 A;  3A3J A;  4IJG A;  1DP6 A;  3BFD A;  3VMA A;  1NY0 A;  4EBL A;  2WZZ A;  2EX8 A;  1I5Q A;  3TJZ C;  1DJA A;  3D4F A;  5IU1 A; 
#chains in the Genus database with same CATH homology
 1K25 A;  4JPM A;  1K56 A;  3CJM A;  4K0X A;  3WS5 A;  4JXW A;  4BD1 A;  5AQ9 A;  4KZ3 A;  4Y7P A;  5DVA A;  5EVI A;  3Q1F A;  4Q8I A;  1BUL A;  1K57 A;  5JYP A;  4XUX A;  4OKP A;  3A3F A;  3PBR A;  3VP4 A;  1W79 A;  3N7W A;  2Y2M A;  5TFQ A;  1JVJ A;  4L0L A;  1XP4 A;  5GHY A;  2Q9M A;  3ITB A;  3BFE A;  3SS3 A;  4JF4 A;  2WUQ A;  3IXB A;  2WKI A;  4EQI A;  1GCE A;  4P0M A;  3VSL A;  2A3U A;  2V2F F;  3UPP A;  2B5R A;  1TVF A;  1WYC A;  4BEN A;  1PI5 A;  2IWC A;  2JE5 A;  1IKG A;  2XR0 A;  3GTC A;  3PBS A;  4R3B A;  1FQG A;  3G30 A;  2V20 A;  5GLD A;  2JBF A;  4ZAM A;  4ZBE A;  4GD8 A;  3GVB A;  3BEC A;  3OPH A;  3ZVT A;  3BM6 A;  4E3J A;  4WEJ A;  1N9B A;  5CHJ A;  1MKI A;  4OLG A;  4FD8 A;  4A5R A;  2V1Z A;  3UY6 A;  3WS1 A;  3UPO A;  1NZO A;  2Q9N A;  4OQ0 A;  3LO7 A;  4S2N C;  1L0E A;  3IT9 A;  4PM8 A;  3IHB A;  4DE2 A;  2ZC5 B;  3ZG8 B;  1U60 A;  2Z2M B;  3NY4 A;  4WZ5 C;  4WMC A;  4N9L A;  4OH0 A;  2J8Y A;  5HAP A;  3MZE A;  1EWZ A;  3UPN A;  1PYY A;  1XX2 A;  1W8Q A;  5EVI C;  3SH7 A;  1K57 C;  1JTD A;  3C5A A;  2QPN A;  5E43 A;  3Q7V B;  3FYZ A;  3M6H A;  1IEM A;  2XK1 A;  4JF6 A;  1ES2 A;  4GN2 A;  2P74 A;  3C4O A;  4MEZ A;  3HBR A;  3OCN A;  1ESU A;  4ZJ1 A;  3TOI A;  4OPQ A;  3BFG A;  5HL1 A;  2Y2K A;  4KZ6 A;  1MXO A;  4Y0O A;  1XA1 A;  3WS0 A;  4BD0 A;  3BLS A;  4M3K A;  1IYO A;  5AQB A;  1BLS A;  2RL3 A;  5KZH A;  1ESI A;  1PWD A;  3HRE A;  4IBX A;  5A90 A;  4S2L A;  3PBQ A;  2H0Y A;  4CPK A;  4NET A;  1RGY A;  5GLB A;  2A49 A;  1JTG A;  3C4P A;  3MKF A;  4DKI A;  5HAQ A;  1ERQ A;  3JYI A;  3Q7V A;  1SDE A;  3M2J A;  3M6B A;  4XUZ A;  1CI8 A;  4GNU A;  4IVK A;  1BZA A;  1ERM A;  1YLW A;  2OSU A;  5CXW A;  3OZH A;  4RA7 A;  3MZD A;  2DCF A;  1K6R A;  5KMW A;  3G35 A;  3FKW A;  1JWZ A;  3EQV A;  4WBG A;  1XGI A;  5CHM A;  3DTM A;  1KE3 A;  4HBU A;  1ERO A;  4DE3 A;  1PW8 A;  2E8I A;  5E2H A;  2DRW A;  4OPZ A;  1H5X A;  3BRM A;  2Y91 A;  2Y2J A;  4PMA A;  4HEF A;  3V5M A;  3ZNT A;  1KGE A;  2ZQ8 A;  1L0D A;  3A3D A;  3HLW A;  1PZP A;  1Q2Q A;  5DF7 A;  3NDG A;  2P9V A;  3HUN A;  5FSR A;  3S22 A;  2J9P A;  4KG5 A;  1BLC A;  1IYQ A;  1KGG A;  5G18 A;  3HLG A;  3IF6 B;  3E2L A;  4Y0T A;  1KVM A;  4UA6 A;  2HDR A;  1CK3 A;  3TG9 A;  4B4X A;  4BQM A;  1GA0 A;  3QNB A;  3MBZ A;  5FQJ A;  5EVL A;  4X6T A;  4OP5 A;  4WM9 A;  3B3X A;  4QB8 A;  1YLY A;  4JXV A;  4LV1 A;  5DF8 A;  5F82 A;  2CC1 A;  4IVI A;  5FAO A;  3UE3 A;  5FI6 A;  1E4D A;  2ZD8 A;  4QHC A;  4Y0U A;  1XXM A;  3O87 A;  1S0W A;  3W4O A;  3O3V A;  4OON A;  2WK0 A;  4KQR A;  4B88 A;  5HX9 A;  1NYM A;  4P6B A;  3BEB A;  1PW1 A;  2VGK A;  5E2E A;  5TGF A;  4PM5 A;  1DJB A;  1ALQ A;  1GA9 A;  1GHM A;  3UE1 A;  4E6W A;  4DDY A;  1ES3 A;  4EV4 A;  3HUM A;  4PPR A;  1YLT A;  4RYE A;  2OLU A;  2EFU A;  3GQZ A;  3BFF A;  4OLD A;  4KG6 A;  3S1Y A;  1J9M A;  2UWX A;  4S2M A;  1I2W A;  5M1A A;  2ZQD A;  5FI2 A;  1QME A;  2XD1 A;  4MBF A;  1XKZ A;  2ZQ9 A;  2WAE A;  4JF5 A;  4DDS A;  2G2U A;  2XLN A;  1ES4 A;  3G31 A;  1YM1 A;  5HFO A;  1FR6 A;  3NC8 A;  1PI4 A;  4KZB A;  4WYY A;  4ZJ3 A;  4DRT A;  1LHY A;  3AGF A;  5EOO A;  1FSY A;  5KSC A;  5FQI A;  3FWL A;  4R3J A;  4GD6 A;  4JLF A;  4PM6 A;  4O7D A;  2WZX A;  2ZM0 A;  2ZJ9 A;  3UDF A;  1K4F A;  4WZ4 A;  1YQS A;  2EX2 A;  3ZGA B;  3CG5 A;  4PM7 A;  1K54 A;  4KZ8 A;  3MFD A;  4P87 A;  1FOF A;  4MNR A;  2PU4 A;  5FAP A;  1O7E A;  3S4X A;  1L0F A;  2EXB A;  2Y2H A;  3BYD A;  5CED A;  5EEC A;  2DNS A;  2ZMA A;  1DJC A;  3G32 A;  1VM1 A;  3IQA A;  1ZG4 A;  3I7J A;  4GZB A;  1S6R A;  2Y2P A;  1KGF A;  2XGN A;  2EX9 A;  4LCM A;  3G4P A;  3IXH A;  1C3B A;  1VQQ A;  1W8Y A;  3FKV A;  3MZF A;  4P85 A;  3VP3 A;  3C7U A;  4RVA A;  3VP1 A;  2X02 A;  4X68 A;  2Y2I A;  1OME A;  3RXX A;  3O86 A;  3IWQ A;  1BLH A;  3HLB A;  4WEL A;  2Y55 A;  4X53 A;  3UDI A;  2ZM2 A;  3PTE A;  2GDN A;  2WKE A;  3AGD A;  4N1X A;  4D2O A;  4JXG A;  4DXB A;  3ITA A;  4KZA A;  2ZC6 B;  2HPB A;  1W7F A;  3MXS A;  1IYS A;  1K55 A;  5EPH A;  2J9O A;  1K56 D;  2RCX A;  3GMW A;  4X55 A;  1KE4 A;  3SH9 A;  4CJN A;  4GDB A;  1K54 C;  4E3L A;  4S2K A;  4OOL A;  3A3E A;  5CGS A;  2ZC7 A;  3HLF A;  4E3O A;  1YT4 A;  5EVI D;  2FFF B;  4GKU A;  1FCN A;  5DTT A;  3MXR A;  2QMI A;  2G2W A;  1FSW A;  1W5D A;  5DF9 A;  3OPR A;  1GHI A;  2WAD A;  5FI7 A;  4H8R A;  1SKF A;  2JC7 A;  4K0W A;  5CRF A;  2WKH A;  3MKE A;  4K91 A;  2BLS A;  2OV5 A;  3G34 A;  3ZDJ A;  4KQO A;  1KVL A;  4BL2 A;  2HP5 A;  5GHX A;  4DE1 A;  4OQG A;  1MY8 A;  5CER A;  5L2F A;  1L0G A;  1IEL A;  1M40 A;  3C7V A;  2XDM A;  4OQH A;  2FFY A;  4LV3 A;  5AQ7 A;  1IKI A;  2HDU A;  3V3S A;  3VSK A;  2ZQA A;  5CGX A;  1HVB A;  1YMX A;  4S2I A;  5CTN A;  4C75 A;  4YIN A;  1KDW A;  4MBK A;  1YLZ A;  1WYB A;  4N9K A;  1SCW A;  2J7V A;  2Y2N A;  3IF5 A;  2WGV A;  3NBL A;  3ZNY A;  1PWG A;  4UAA A;  4E3M A;  4QU3 A;  4DF6 A;  3FZC A;  5F1G A;  3V3R A;  3ZFZ A;  5EUA A;  3LY3 A;  2HDS A;  4EBN A;  4C3Q A;  4GDN A;  4JBF A;  5CHU A;  1K55 C;  1FCM A;  3UE0 A;  1G6A A;  4WMC D;  1Y54 A;  5EVI B;  4RX3 A;  4WEK A;  5AQA A;  3HUO A;  3QHY A;  3OPL A;  1NZU A;  5EOE A;  2PU2 A;  4EBP A;  3OPP A;  5GLC A;  2ZC3 B;  4HBT A;  5A93 A;  3GRJ A;  3IH8 A;  1E25 A;  3IF6 A;  3O88 A;  4R1G A;  1E3U D;  5F83 A;  3WS4 A;  4OVD A;  1H8Y A;  5FQQ A;  1YLJ A;  4FH4 A;  1NXY A;  5DTS A;  5DTK A;  5CEB A;  1MPL A;  4E6X A;  2EXA A;  1HZO A;  4LEN A;  4S2N A;  1MWS A;  2H10 A;  5FAT A;  2WGI A;  1ONG A;  3WWX A;  4ZJ2 A;  2JCH A;  2ZQC A;  5EE8 A;  5J8X A;  3SH8 A;  1SHV A;  4WZ5 A;  3WS2 A;  1BT5 A;  2ZC4 B;  1CI9 A;  2XFS A;  1ES5 A;  3PAG A;  3TSG A;  3NIA A;  1PZO A;  1FR1 A;  3N4I A;  4OQI A;  1LLB A;  2Y2Q A;  3LCE A;  5A91 A;  5IHV A;  5JYO A;  2IWD A;  4NK3 A;  4IBR A;  5E2G A;  4X56 A;  4R4S A;  4IED A;  5CEC A;  3HVF A;  2WAF A;  1MWR A;  2X01 A;  2OLV A;  2PBY A;  4PM9 A;  2XD5 A;  4BJP A;  4OPR A;  5GHZ A;  1JWP A;  1O07 A;  3G2Z A;  3ZG5 A;  2I72 A;  3HLD A;  2ZLY A;  4S2P A;  1RCJ A;  4KZ4 A;  4LV2 A;  3VP0 A;  3QNC A;  3UNW A;  5M19 A;  3VFF A;  1NRF A;  4QY5 A;  4KG2 A;  3ZVW A;  4RX2 A;  4X69 A;  5FA7 A;  5TR7 A;  3IF6 C;  1AXB A;  3HL9 A;  3PAE A;  1IYP A;  2HDQ A;  2C5W B;  4GOG A;  5FAS A;  1XGJ A;  3N8S A;  3LY4 A;  3ZG0 A;  2Y2G A;  3DWK A;  4R4R A;  4C6Y A;  4MBH A;  5BOH A;  1K6S A;  2H5S A;  3IXD A;  3PBN A;  2EX6 A;  4FH2 A;  4N92 A;  4UA9 A;  3UO9 A;  2HP9 A;  2ZM8 A;  3GV9 A;  4U0T A;  3BLM A;  5I94 A;  1QMF A;  2Y2O A;  4S2J A;  4UHU A;  4LV0 A;  3NDE A;  1MBL A;  4OP8 A;  4DE0 A;  4FCF A;  1MWU A;  4U0X A;  2R9X A;  1CEG A;  4E3K A;  1LL5 A;  1Q2P A;  2HP6 A;  2QZ6 A;  3IH9 A;  4JXS A;  3SOI A;  3V39 A;  3VOZ A;  3IHA A;  3VFH A;  4KQQ A;  3ZG7 B;  1E3U A;  4XXR A;  4HES A;  3GR2 A;  3UN7 A;  1YLP A;  3NCK A;  4R23 A;  1XA7 A;  2C6W B;  3ISG A;  5KSH A;  3Q82 A;  3VP2 A;  2XQZ A;  3G2Y A;  3P98 A;  2WYX A;  2IWB A;  4QY6 A;  4UA7 A;  5CGW A;  5CTM A;  3W4Q A;  2XEP A;  4E3N A;  4EUZ A;  4KEN B;  3PBT A;  3E2K A;  4N1H A;  5D3O A;  1ZKJ A;  4E3I A;  4F94 A;  3DWZ A;  1N4O A;  1L2S A;  1BUE A;  1JWV A;  1TDL A;  2H0T A;  1RGZ A;  4QD4 A;  3RXW A;  3N8L A;  2Y59 A;  4JKT A;  3GSG A;  1I2S A;  4GB7 A;  5GLA A;  5GL9 A;  4KZ5 A;  1MWT A;  1TDG A;  4B4Z A;  1CEF A;  2R9W A;  4BL3 A;  5E2F A;  1LL9 A;  1PIO A;  3IWO A;  4YFM A;  5HAI A;  1FCO A;  1LI0 A;  3NI9 A;  2P9V B;  1ZG6 A;  4LCL A;  3HLC A;  5HAR A;  3A3I A;  1NJ4 A;  1SDN A;  3VOY A;  1GHP A;  2EFX A;  3AGE A;  3FV7 A;  4KZ7 A;  4QJG A;  3ZHH A;  1EI5 A;  1ONH A;  2ZQ7 A;  4OOM A;  1G68 A;  4S2O A;  3Q7Z A;  5FQM A;  3Q81 A;  5FQ9 A;  1KE0 A;  1M6K A;  2WGW B;  2XFT A;  4OPY A;  3HLE A;  3RJU A;  1Z6F A;  4KZ9 A;  3CZD A;  3SS5 A;  3V50 A;  1ZC2 A;  4FSF A;  1RP5 A;  4MLL A;  1LI9 A;  1K4E A;  1TEM A;  4ID4 A;  2XF3 A;  2BG1 A;  2X71 A;  2VGJ A;  1DY6 A;  1WE4 A;  3SS4 A;  1HTZ A;  3OC2 A;  4Z9Q A;  3CMZ A;  5HW3 A;  3BFC A;  1XPB A;  1HD8 A;  5M18 A;  3IXG A;  4R0Q A;  3UDX A;  5A92 A;  4DXC A;  4U3T A;  3N8R A;  4ZDX A;  3M2K A;  3W8K A;  3PBO A;  4BLM A;  1H8Z A;  3DW0 A;  3LEZ A;  3ZG9 B;  3IWI A;  5FDH A;  1KDS A;  1BLP A;  1NYY A;  4EWF A;  2Y4A A;  5FAQ A;  2Y2L A;  5F1F A;  5U47 A;  3WRZ A;  2WGW A;  1PWC A;  3Q07 A;  3A3J A;  3N6I A;  3BFD A;  3OCL A;  2Z2L B;  3P09 A;  1NY0 A;  2XH9 A;  3EQU A;  3VMA A;  1BTL A;  4EBL A;  3W4P A;  2WZZ A;  3WRT A;  4OOY A;  2EX8 A;  1I5Q A;  1YMS A;  1BSG A;  3ZCZ A;  5FQK A;  1DJA A;  1K38 A;  4ZTK A;  3D4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...