2H0TA

Crystal structure of the m69v e166a double mutant of shv-1 b-lactamase complexed to clavulanic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMVSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWATELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Broad-spectrum beta-lactamase SHV-1
publication title Effect of the inhibitor-resistant M69V substitution on the structures and populations of trans-enamine beta-lactamase intermediates.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 98
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2h0tA00
1ES3A 1K54A 1SDEA 3CJMA 4K91A 5AQ9A 1MWTA 1FCOA 2A3UA 5FAQA 4DRTA 1L0FA 3C4PA 3OCLA 3A3DA 3UPNA 3HLWA 1ONGA 2H0YA 1BLHA 4JXSA 3W4OA 5IHVA 3GR2A 3MBZA 3ZVTA 4HEFA 4E3LA 5A93A 4U3TA 4OPQA 1PW1A 1TVFA 1K38A 2V20A 5GHYA 3BLSA 2WAFA 3OC2A 5U47A 3AGFA 3TSGA 3FKWA 4X69A 4A5RA 3MKFA 4UA6A 2UWXA 1MWRA 1YLJA 4OPRA 2IWDA 1FCNA 3ZCZA 4Z9QA 3ISGA 3WRZA 3IWQA 4KG6A 2XF3A 5A92A 1K4FA 3NDGA 1KVLA 1ZG4A 4KZ6A 4RX3A 1CEFA 3C5AA 3IXBA 3N8RA 4OLDA 4C75A 1BZAA 4WZ4A 5FQMA 3W8KA 5DF8A 1BLSA 5CGXA 2WKIA 3HBRA 1E3UA 4NETA 4QY5A 3IXDA 1WYCA 3ZDJA 4PMAA 4FCFA 5G18A 5E43A 1YLYA 4KZ9A 4PM5A 4E3KA 2EFXA 4S2MA 3HREA 5JYOA 5GHXA 4OVDA 2E8IA 4BQMA 1NZOA 4Y0UA 1MWUA 1E3UD 4S2NC 5EVIA 4E3MA 4E6XA 1NY0A 2DRWA 4R3BA 5DTTA 3N6IA 5FI2A 1DJCA 4EBPA 1ERMA 2ZC7A 4JKTA 1PZOA 4X68A 3VMAA 1XPBA 1ESIA 2P9VB 5DF9A 2FFYA 4GD8A 2EX2A 2OLUA 2P74A 4UAAA 1DJAA 1TDLA 3IF6B 3NCKA 3UO9A 3VP0A 3VP1A 3BRMA 1HZOA 5EVID 1E4DA 1Y54A 3N4IA 3G2YA 1LHYA 3N8SA 3OPRA 4OQIA 4X53A 3UE3A 3UN7A 4KZBA 1LL9A 4D2OA 1FQGA 3IF6C 3IF5A 1KGGA 5GLBA 3SH8A 3DWKA 4CPKA 4P87A 1LLBA 2PBYA 3SH7A 3TG9A 3LO7A 4E6WA 1IYOA 1LL5A 3OPHA 1QMFA 4HBUA 2R9WA 3NI9A 3SS5A 1KE0A 1YLTA 1Q2QA 5TGFA 3SS4A 3VP3A 4JBFA 5TFQA 4P6BA 2HDUA 2XLNA 5FI7A 4K0WA 3OPPA 4WMCA 4ZJ1A 1KE3A 1H8ZA 1IKIA 1RP5A 4U0TA 2WUQA 4X55A 3MXSA 2Y2GA 2HPBA 3HLFA 5CHUA 3IWOA 3EQVA 4UA7A 3IHAA 2Y2IA 2Y55A 1WYBA 1W7FA 1XA1A 2HDQA 3BECA 3G34A 1JVJA 4PM7A 1CEGA 5CHJA 4WMCD 1IYQA 3WS0A 3B3XA 4WELA 5E2GA 3BFCA 4CJNA 1IEMA 4EBLA 1EROA 3IH8A 3MXRA 3DWZA 4OQ0A 5CTNA 3UE1A 4ZJ3A 1AXBA 1PWGA 4WEJA 5HFOA 4PM8A 1G68A 3BLMA 3RXWA 3MZDA 5EE8A 1GHPA 5JYPA 2WGVA 3VOZA 2ZQ9A 3LY4A 3O3VA 3O86A 3UDIA 1YT4A 4JF4A 2DCFA 3Q81A 2JE5A 1NZUA 5FQ9A 4ID4A 2Y2OA 1W79A 2IWCA 3ITBA 3MZEA 1M40A 1PIOA 1NJ4A 1SHVA 5CXWA 2Y2LA 3RXXA 4NK3A 4HESA 1K57C 4LCLA 3WS1A 1BT5A 2HDSA 3OCNA 5CTMA 3UDXA 4GOGA 4Y7PA 5FAOA 2ZM8A 4DXBA 2WYXA 3FZCA 1BULA 3VOYA 1ALQA 4B88A 2X02A 3BYDA 2EXBA 4WZ5A 3NDEA 3Q7VB 1DJBA 5HAIA 4S2PA 2Y2QA 1EI5A 3OPLA 2XR0A 3N7WA 2X71A 5E2FA 5GLAA 3UPPA 3LY3A 2JC7A 3GRJA 1K55C 2ZM2A 4WM9A 5FQIA 4OONA 4S2JA 4YFMA 2RCXA 5TR7A 3S22A 5FQJA 3HLEA 2Q9MA 4ZTKA 4FH4A 4F94A 1PZPA 2R9XA 2Z2MB 4QD4A 5CGSA 3V5MA 4B4ZA 4PPRA 3GV9A 1SDNA 3PBOA 2ZQ8A 5BOHA 1FSYA 4KQRA 3IQAA 2G2UA 3PBTA 4DF6A 1FCMA 1H5XA 1VM1A 3GMWA 5A90A 2QZ6A 4WYYA 3C7VA 4ZAMA 5AQ7A 3E2LA 2H10A 4EUZA 3ZHHA 4UHUA 1MKIA 4IBXA 4B4XA 2B5RA 4GN2A 4Y0TA 3ZG9B 4JF6A 3HUMA 2ZM0A 1O07A 1JWPA 1HD8A 4KZ4A 1U60A 1DY6A 1RGYA 1KE4A 3PBRA 4R3JA 3DW0A 4DDYA 4PM6A 4C6YA 3Q7VA 3CMZA 3PTEA 2C5WB 5GLCA 5EOOA 2CC1A 5I94A 4IVKA 1RCJA 4P85A 1JTGA 1KVMA 4E3OA 3QNBA 1YMXA 5M18A 3UNWA 3UY6A 1E25A 2Y2NA 3ZG8B 2Y4AA 2ZQAA 4P0MA 1IYSA 3ZFZA 4BD1A 2XDMA 2Y2JA 3GTCA 4GD6A 3WS5A 5F1FA 5GL9A 3IHBA 1ERQA 1XGIA 2J9OA 4KZ7A 5M19A 3I7JA 1W8YA 4BJPA 1JWZA 2WKEA 4EQIA 3V3RA 3ZVWA 2XK1A 4OH0A 1IKGA 4OPYA 4QY6A 1WE4A 2XFTA 3WWXA 2ZMAA 3UE0A 1YMSA 5FDHA 5E2HA 1PI4A 4BD0A 3GSGA 1MY8A 4O7DA 2ZC6B 3VFHA 1KDWA 5DVAA 4BL3A 4JXGA 1XA7A 1ZKJA 3M2JA 3MFDA 1N4OA 3QNCA 4S2NA 3ZNYA 3G30A 1SCWA 2EX9A 1FOFA 1JWVA 4E3JA 5GLDA 2VGKA 5AQBA 3P98A 1YLPA 3JYIA 2OV5A 2Y2PA 5DTSA 3PAGA 1BTLA 3FYZA 1BLCA 1K56A 2J8YA 2ZC5B 3G35A 3G32A 2P9VA 3HLCA 4FH2A 4K0XA 5A91A 4C3QA 1ZC2A 3GQZA 3IF6A 4IBRA 1FR6A 2GDNA 1Z6FA 3MZFA 1JTDA 3VSKA 1CI8A 3PBNA 4OOLA 3FWLA 4KZ3A 2OLVA 4WEKA 1TDGA 5HX9A 3DTMA 4XUXA 3PBSA 2WZZA 1ES5A 1K56D 5EVLA 3UPOA 5EUAA 2Y91A 4FD8A 3IWIA 1MWSA 1KGEA 1W5DA 4OKPA 3ZGAB 3M2KA 4LENA 1S0WA 3M6BA 4GDBA 2QMIA 4RYEA 2I72A 1NYMA 2HDRA 5FAPA 3VFFA 4KZ8A 4JXWA 3WRTA 2J9PA 3PAEA 4IEDA 5KMWA 1GA9A 5KSCA 5EECA 5FA7A 4Q8IA 3ZNTA 4MBKA 3NC8A 1L0DA 4X56A 5GHZA 2IWBA 4N1HA 3ZG0A 1PYYA 3HLDA 1OMEA 1H8YA 3S4XA 3TOIA 4MBHA 4LV2A 4N92A 3WS4A 3AGEA 5EOEA 4DE2A 1ZG6A 1FR1A 3LEZA 2PU2A 2Q9NA 4LCMA 5F82A 3UDFA 2EFUA 5CECA 1L0GA 2DNSA 2XFSA 4KZ5A 4N9LA 2JBFA 5HAQA 3C4OA 1ES4A 1GA0A 1XXMA 3HLBA 5EVIB 4RA7A 2WAEA 1J9MA 2Y2KA 4DXCA 2ZJ9A 4R23A 3HLGA 2WADA 4KZAA 1RGZA 3IH9A 4KG5A 3HUOA 5EVIC 3BFEA 2PU4A 1K57A 2WGIA 1LI0A 3BEBA 3CG5A 4IVIA 4MLLA 3MKEA 3PBQA 4QU3A 5CRFA 4E3NA 5FASA 2WK0A 2OSUA 2XQZA 1IELA 4OQHA 5FI6A 1LI9A 4N1XA 1VQQA 4M3KA 3BFFA 4GKUA 5FATA 5CEDA 4JLFA 1YLZA 2Y59A 1ONHA 3G4PA 5KZHA 2ZD8A 3HL9A 3NIAA 4OLGA 4ZDXA 4S2KA 4OOMA 2EX6A 5KSHA 3BFGA 1K55A 3V3SA 4H8RA 1CK3A 1FSWA 4KQQA 2A49A 2Y2MA 1MXOA 3NBLA 1YLWA 4WBGA 1HTZA 2V2FF 2BG1A 2ZC4B 2X01A 4RX2A 3ZG7B 2Z2LB 4FSFA 1C3BA 1L2SA 5CGWA 3N8LA 4KG2A 4R1GA 4KQOA 3E2KA 4LV3A 2WGWB 2H5SA 2WZXA 3SOIA 1XKZA 4BENA 3GVBA 2EXAA 4U0XA 2JCHA 3Q07A 4GNUA 3ZG5A 5HW3A 1S6RA 3C7UA 4OP5A 3OZHA 1I5QA 1N9BA 1ESUA 1PWCA 1O7EA 3W4PA 3WS2A 1NXYA 3HUNA 1PI5A 4JXVA 5L2FA 2HP6A 3M6HA 1Q2PA 2HP5A 1MBLA 4UA9A 1K6RA 1ES2A 3ITAA 1K4EA 1TEMA 3HVFA 1I2SA 1M6KA 4R4RA 3V39A 4GDNA 3FKVA 2ZC3B 5F1GA 1L0EA 3D4FA 1XP4A 3BM6A 5CERA 3BFDA 4DKIA 5DTKA 3A3JA 5HL1A 1HVBA 4OOYA 5F83A 3SS3A 2V1ZA 3QHYA 1GHMA 1KGFA 4R0QA 4S2LA 5E2EA 4EWFA 1YQSA 1K6SA 2VGJA 3IT9A 5D3OA 1IYPA 3V50A 4BL2A 2BLSA 4YINA 1K25A 3A3IA 4GZBA 5HAPA 4OPZA 4MEZA 1SKFA 1CI9A 1NRFA 1K54C 1QMEA 4OQGA 2XH9A 4S2OA 1KDSA 4HBTA 2XD1A 3VSLA 4S2IA 5CEBA 1I2WA 3G31A 2XGNA 4GB7A 2ZLYA 3P09A 4EBNA 5DF7A 4X6TA 3LCEA 5EPHA 3S1YA 3SH9A 4BLMA 3CZDA 2J7VA 2RL3A 2EX8A 4QB8A 5FQKA 4LV0A 1BSGA 4R4SA 4WZ5C 2ZQ7A 2HP9A 3Q82A 3O87A 3VP2A 2WGWA 1BLPA 3Q1FA 5HARA 3NY4A 1MPLA 1PW8A 2QPNA 3EQUA 3W4QA 3A3EA 4QHCA 4L0LA 3RJUA 2G2WA 3AGDA 3IXGA 4E3IA 5J8XA 2WKHA 4JF5A 1GHIA 5FSRA 3Q7ZA 4JPMA 3G2ZA 4OP8A 4DE1A 3IXHA 1G6AA 5M1AA 4EV4A 1PWDA 4XXRA 2C6WB 5FQQA 4MNRA 4QJGA 4Y0OA 4ZJ2A 2ZQDA 1YM1A 3A3FA 2FFFB 2Y2HA 2XEPA 4N9KA 2H0TA 4KENB 1BUEA 3O88A 4DDSA 2XD5A 4RVAA 1XX2A 4PM9A 4DE0A 2ZQCA 5CHMA 4XUZA 4MBFA 1EWZA 1XGJA 5AQAA 3FV7A 1GCEA 1NYYA 4DE3A 4ZBEA 3VP4A 4LV1A 1W8QA
chains in the Genus database with same CATH superfamily
1SDEA 4HH3A 3MSHA 4DRTA 2XRNA 1ONGA 1VB6A 2V8CA 4OPQA 4U3TA 5K5BA 5GHYA 4UA6A 1VHMA 2UWXA 5HDDA 2IWDA 2G7UA 3HCYA 3ZCZA 3WRZA 1K4FA 3NDGA 1KVLA 1ZG4A 3C5AA 2J3TC 2VV8A 3OBFA 1YSPA 1BLSA 3P01A 4QY5A 3T1SA 1WYCA 4FCFA 4Y13A 4UEYA 2VEAA 2W3FA 1NZOA 5EVIA 4E6XA 3N6IA 2ZC7A 3VMAA 4DJ2A 5EFWA 3BRMA 5EVID 3N4IA 4X53A 3O5YA 5J7EA 1FQGA 3IF5A 3OOVA 4CPKA 2PR5A 3SH7A 3LO7A 4E6WA 3U4LP 1LL5A 2R9WA 1KE0A 1YLTA 1Q2QA 5TGFA 5TFQA 3DBAA 4EUVA 4KUOA 5FI7A 4ZJ1A 4WMCA 2KLIA 4I38A 1P97A 2Y2GA 3HLFA 3IWOA 3EQVA 2Y2IA 5MC7A 1WYBA 2VV6A 4WMCD 3WS0A 3B3XA 1IEMA 4EBLA 1EROA 3DWZA 3UE1A 1AXBA 1PWGA 1T1AA 4PM8A 3BLMA 3H7WA 5JYPA 3VOZA 4Q0HA 3O3VA 3EGDC 2HJEA 3RFBA 2Y2OA 1DP8A 2IWCA 3ITBA 1NJ4A 5CXWA 4LCLA 2ZL1B 1CF0A 3VE4A 3FZCA 1ALQA 3CHWP 4KUKA 3NDEA 3Q7VB 5HAIA 4S2PA 5GLAA 2Y8HA 4F3LB 2FZ0A 2QHKA 4LFUA 4WM9A 3CITA 4S2JA 2RCXA 3S22A 3HLEA 4ZTKA 3BY8A 4FH4A 3KYZA 1H0MA 1PZPA 3DTEA 4II7A 3GECA 3T1XA 2IA2A 4NEED 1MKMA 3GMWA 2GNXA 2P7JA 4WYYA 5AQ7A 3KX0X 4JGRA 3ZG9B 4KZ4A 3E4QA 3PBRA 2JKFA 4PM6A 4LRYC 3PTEA 3LGOA 4P85A 1KVMA 4LGWA 4BD1A 1L3LA 2Y2JA 3LR5A 1ERQA 2J9OA 1W8YA 2XK1A 2VV7A 4GCZA 4H6JA 5HPIA 1YMSA 4IUHA 5E2HA 1PI4A 2J3TD 1TS6A 5HWTA 1XFQA 5HL6A 5DVAA 4BL3A 1XA7A 3T4LA 3TE8A 3ZNYA 5J4EA 2QJ7A 5AQBA 4JGQA 1N9OA 5DTSA 3PAGA 1BLCA 3BJNA 4K0XA 4LPZA 3UB5P 2PD8A 3CWFA 1JTDA 1CI8A 4L9EA 5HX9A 3DTMA 1V9YA 2WZZA 3UPOA 5EUAA 4FD8A 3IBJA 1W5DA 3ZGAB 3M2KA 1S0WA 3M6BA 3E0YA 2W0NA 1NYMA 4JXWA 3C38A 3PAEA 5KSCA 1IFQA 3ZNTA 4MBKA 3NC8A 1P9WA 4X56A 5A8BA 4Y15A 3A0VA 2IWBA 4EQ1A 3ZG0A 3LIBA 4CLCC 3HLDA 3S4XA 4MBHA 1N9NA 1ZG6A 1FR1A 1W63M 4N9LA 4BWIA 5HAQA 3C4OA 5EVIB 3T4OA 3D3OA 3HLGA 3HUOA 4M4XA 1FILA 1K0KA 3BEBA 4MLLA 1OTDA 5FASA 2XQZA 4JGOA 4L9FA 1VQQA 3BFFA 3QP1A 4JLFA 1YLZA 1D06A 1F2KA 2Y59A 1HLUP 1ONHA 3HL9A 3NIAA 3TRCA 3V3SA 3CUEC 2A49A 1YLWA 1OT6A 1HTZA 5IS1A 5L09A 3ZG7B 1G6OA 4IJGA 1L2SA 4KG2A 4KQOA 4LV3A 2WGWB 2H5SA 2OOLA 4I3JA 3SOIA 2GX5A 2EXAA 4ARZA 3Q07A 4GNUA 2LB9A 1ESUA 1O7EA 5L2FA 3H7WB 2HJ9C 1ES2A 1K4EA 2B95A 1TEMA 3HVFA 3F1NA 3V39A 3VOLA 1OPXA 2ZC3B 3D4FA 4YWZA 4R3AA 5G4YA 3BM6A 2VLGA 5F83A 2V1ZA 1KGFA 4S2LA 4EWFA 1YQSA 3FC7A 5HAPA 1QMEA 4HBTA 2B18A 3CZDA 2EX8A 3Q82A 5DFYA 1DRMA 2XSSA 3W4QA 3EQUA 3A3EA 4L0LA 3RJUA 3LI8A 4E3IA 2WKHA 1GHIA 2O0YA 4PAUA 5F69A 4WN5A 3NOPC 1G6AA 5M1AA 3QP8A 3BQ8A 2PYRA 2H0TA 4DDSA 2XD5A 4XUZA 5AQAA 2Y79A 3LR3A 1GCEA 1MWTA 3C2WA 3V67A 5FAQA 4NXGA 2ZOHA 3VV4A 3OCLA 3UPNA 3HLWA 3UMEA 3W4OA 3ZVTA 4HEFA 5A93A 1K38A 5EM1A 2W1TB 3UB6A 2O9BA 3FKWA 5DKKA 4A5RA 3FPWA 3PHYA 1FCNA 3ISGA 5A92A 4KZ6A 1LL8A 4RX3A 1CEFA 4K08A 2P08A 2PBDP 4CLCA 4H6JB 1BZAA 5FQMA 3HBRA 3ZDJA 1SKOA 4CLCD 1LT0A 2EFXA 4S2MA 3HREA 4OVDA 3FPVA 2E8IA 1D1JA 4FOFA 4Y0UA 4GS9B 4S2NC 2DRWA 3F1PA 4X68A 4JKTA 4GD8A 3UB9A 1DJAA 1OJ5A 1TDLA 3UO9A 3VP1A 1HZOA 1E4DA 3G2YA 3N8SA 4KZBA 5TBMA 3IF6C 5FEFA 4P87A 3KSFA 2OAP1 1IYOA 2OWHA 2VKSA 3CUEA 4HNBA 2NUTC 3JPUA 2M7VA 2KDKA 3SS4A 4JBFA 2XLNA 2QWSA 1KE3A 1H8ZA 1RP5A 4X55A 2WUQA 4YOFA 1H3QA 2HPBA 3BY9A 2O9AA 1XA1A 2HDQA 3BECA 3GDIA 1ACFA 2Q0OA 2QYBA 3MXRA 4OQ0A 5CTNA 4D60A 2JHEA 3F1OA 2ZQ9A 4WL9A 3LY4A 3O86A 1YT4A 5FQ9A 3MZEA 1PIOA 4BBTA 1SHVA 2Y2LA 3ICYA 1BT5A 3H9WA 4Y7PA 2WYXA 4NXFA 4HY8A 3BYDA 2EXBA 2V1BA 2Y2QA 3NOTC 1EI5A 3OPLA 4HOIA 1STZA 3UPPA 2JC7A 4DJ3A 3QP6A 5FQJA 1W63Q 2YKHA 3LICA 3V5MA 4B4ZA 4BBUA 3GV9A 5DKLA 4Q0IA 2ZQ8A 3EOIA 4KQRA 2WKQA 3LIDA 4DF6A 3F1NB 1H5XA 3H82B 3E2LA 4EUZA 1EW0A 1MKIA 4GN2A 4JF6A 1XFNA 3HUMA 3NULA 1JWPA 1RGYA 3HJIA 4DDYA 1PFLA 3LI9A 2VK3A 1Y4OA 2CC1A 3T50A 2Y2NA 2GJ3A 2QKPA 2Y4AA 2ZQAA 3ZFZA 2XDMA 1S4SA 3QP4A 3WS5A 5FEGA 1XGIA 4KZ7A 2PHYA 4BJPA 1JWZA 3UE6A 3KYQA 3FG8A 1WE4A 2XFTA 3UE0A 1G28A 2M1CA 2PT7A 3VFHA 2ZC6B 3KSHA 5DJUA 1ZKJA 3MFDA 3QNCA 3ZYTA 4S2NA 4NXEA 4YNRA 3JYIA 2OV5A 5FDSA 1XJ6A 3T1RA 1TS7A 4FH2A 2J8YA 4O01A 5A91A 4C3QA 2P9VA 1ZC2A 3IF6A 1Z6FA 3MZFA 3VSKA 3PBNA 4OOLA 4KZ3A 4WEKA 2OLVA 1TDGA 3PBSA 1ES5A 3EEHA 1MWSA 4LENA 3LIEA 4GDBA 2HF6A 3A0SA 3UMDA 4KZ8A 3L9KA 2ZMVA 4G3WA 4CLCB 5KMWA 5AJGA 5FA7A 3CI6A 4EEPA 1NLZA 5GHZA 2KX6A 5HD3A 2W3DA 1H8YA 3TOIA 1SKOB 5F82A 2PU2A 1LSWA 5CECA 4NKPA 4KZ5A 2PRFA 3HLBA 1GA0A 1XXMA 3F1PB 2PU4A 1LI0A 2MJ6A 2FH5A 3LR4A 3MKEA 3PBQA 4QU3A 4E3NA 3HJKA 2WK0A 5FATA 4GKUA 2KOIA 4JGPA 2K2NA 4ZDXA 4Y3IA 4OOMA 3T1QB 2EX6A 5KSHA 1S66L 1FSWA 4KQQA 4XT2A 3KSIA 2ZC4B 3E98A 3MFXA 2Z2LB 5G4ZA 3NJAA 4PKYA 5CGWA 2L4RA 3N8LA 4R1GA 5HDSA 2WZXA 1XKZA 4BENA 3GVBA 4G3VA 1TF1A 1NRJA 4ME4A 4LRZE 1N9BA 3W4PA 1NXYA 4ESPA 3HUNA 1PI5A 2HP6A 4MN7A 3TW8A 1MBLA 1M6KA 3FKVA 4B9OA 3BFDA 4DKIA 5DTKA 1HVBA 4R0QA 1K6SA 3T4QA 3T4SA 3IT9A 2A24A 3V50A 2BLSA 4YINA 1K25A 3A3IA 5AVEA 4MEZA 4S2OA 1NRFA 3LYXA 4S2IA 4GB7A 5DF7A 4BLMA 3S1YA 2RL3A 2L1MA 3DAVA 4LV0A 1BSGA 4R4SA 3O87A 4PKYG 3MF0A 1PW8A 2QPNA 3LIAA 2G2WA 2LB5A 5FSRA 5F6AA 4WUJA 3G2ZA 4DE1A 4EV4A 1PWDA 5EV0A 3A3FA 2Y2HA 4KENB 4RVAA 4PM9A 1OT9A 2ZQCA 4DE0A 4EESA 4MBFA 1NWZA 3FV7A 2O9CA 3VP4A 1K54A 1VEUA 4K91A 5AQ9A 4Y17A 3C4PA 1GSVA 1JNUA 3A3DA 1OJGA 2H0YA 1BLHA 5IHVA 3MBZA 3L7HA 1PW1A 3OC2A 3AGFA 1T1CA 4X69A 3KO6A 1YLJA 4OPRA 4MN6A 5EVEA 4KG6A 1F9IA 4BBVA 2XF3A 1MZUA 3IXBA 4CLCE 1ODVA 3IS2A 4MN5A 5CGXA 2WKIA 1GSXA 4NETA 3IXDA 1YSQA 2ACGA 1YAXA 5E43A 1YLYA 5JYOA 5GHXA 4BQMA 1MWUA 4E3MA 3JVUA 5FI2A 4I39A 4MCWA 1DJCA 4EBPA 1ERMA 1PZOA 4BMWA 1ESIA 1TS8A 2P9VB 5DF9A 4CQHA 2EX2A 2OLUA 3EWKA 3IF6B 3NECA 3OPRA 4OQIA 1LHYA 3K3CA 4EU0A 4D2OA 1LLBA 2PBYA 2ZMFA 3TG9A 2H28A 3OPHA 3SS5A 1S67L 4X1MA 3S7QA 4K0WA 3OPPA 1UWPX 1CQAA 1IKIA 4U0TA 5I5LA 2JKRM 5TJJA 5CHUA 4UA7A 3IHAA 1W7FA 3PYPA 1JVJA 4PM7A 5CHJA 3MQOA 1S4RA 5E2GA 4CJNA 3MQQA 1PRQA 4ZJ3A 5HFOA 4WEJA 5DJTA 1G68A 4R38A 5HDCA 2WGVA 3UDIA 4JF4A 3Q81A 2JE5A 4ID4A 2D02A 4HESA 3WS1A 2HDSA 2D01A 5CTMA 4GOGA 5FAOA 3VOYA 3CAXA 4B88A 1DJBA 3N7WA 4XT2B 5E2FA 1J3WA 1F5MA 3GRJA 1K55C 2HZ5A 5FQIA 4X1LA 3BQAA 4YFMA 3LIFA 4O8GA 2R9XA 4QD4A 3MQ0A 1SDNA 3IQAA 3PBTA 2QZ6A 4ZAMA 3VE3A 2H10A 3BW6A 4UHUA 2K31A 4B4XA 3C8CA 1O07A 2QJ5A 1Y28A 2EWVA 1S1ZA 1KE4A 2A24B 3DW0A 4DMZA 2V1AA 2INWA 1XJ4A 3Q7VA 3CMZA 3CPTA 5EOOA 2I9VA 2V9AA 1RCJA 4F3LA 5M18A 3UY6A 1E25A 1OTIA 3ZG8B 4FTXA 1IYSA 2VX8A 3I7JA 3ZVWA 4OH0A 1IKGA 4OPYA 4QY6A 1LSVA 5IU1A 5F5YA 2ZMAA 4GJ4A 5FDHA 3GSGA 4JXGA 3M2JA 1N4OA 3G30A 1SCWA 3C30A 1JWVA 4E3JA 1VEUB 4ZRRA 3T12B 2VGKA 4WF0A 3P98A 1YLPA 1TS0A 3FYZA 1K56A 3G35A 3G32A 3HLCA 3GQZA 4IBRA 2GDNA 2PYPA 1YPRA 3FWLA 1KOUA 3R7WA 2JKTM 5J3WA 4XUXA 3IX8A 1K56D 4G3KA 2Y91A 4I3IA 4MDZA 2I72A 2HDRA 3LR0A 3VFFA 3WRTA 1UWNX 1GA9A 1BYWA 4Q8IA 3IS2B 1L0DA 4N1HA 1PYYA 1OMEA 2WKRA 4LV2A 3WS4A 4LCMA 2Q9NA 3UDFA 2EFUA 2DNSA 2XFSA 4ARZB 4NXBA 3K3DA 4RA7A 4DXCA 1OTBA 3P7NA 2ZJ9A 4R23A 2WADA 3IH9A 4KG5A 4DN0A 5AVFA 3CG5A 2WGIA 2W3EA 4IVIA 4GW9A 5CRFA 5HD5A 1UGUA 2OSUA 5CX7A 1IELA 4OQHA 5L07A 2O99A 3MS6A 4M3KA 5CEDA 1DP6A 3G4PA 5KZHA 2ZD8A 4S2KA 2K7SA 3BFGA 5DFXA 1DP9A 1K55A 4H8RA 1CK3A 2Y2MA 1MXOA 3NBLA 4WBGA 3RTYA 2X01A 3E2KA 2J80A 2AVXA 5LBRA 3T4JA 3KYEA 2JCHA 2DMWA 3OZHA 2PAVP 1I5QA 1VETA 1PWCA 3WS2A 1TD5A 4JXVA 3M6HA 1Q2PA 2JKRI 1K6RA 3ITAA 1I2SA 2W1RA 4R4RA 3ULFA 3D9YA 5CERA 5HL1A 2XA7M 1GHMA 5E2EA 4R70A 3MMHA 4HI4A 1YKDA 4BL2A 1XJ3A 4GZBA 4OPZA 2Z6DA 1CI9A 2W27A 1K54C 3VSLA 1OTEA 2XH9A 4EW7A 1KDSA 2XD1A 5CEBA 2XGNA 2ZLYA 4X6TA 3LCEA 3SH9A 5FQKA 2VZWA 4WZ5C 2ZQ7A 2HP9A 3VP2A 2WGWA 3Q1FA 5HARA 3TJZC 3NY4A 3PXPA 3LEQA 3B47A 3UB8A 3AGDA 3IXGA 2BTFP 5J8XA 3MR0A 4JF5A 3Q7ZA 1OTAA 4JPMA 3IXHA 2C6WB 5FQQA 4QJGA 2L0WA 4ETZA 4RQ9A 1T1BA 5CHMA 1EWZA 5F68A 3ZQ5A 4ZBEA 1W8QA 1WA9A 1ES3A 1LSXA 3CJMA 4ETXA 1D7EA 2HV1A 1FCOA 2A3UA 1L0FA 5HWVA 4JXSA 3GR2A 4E3LA 3EEAA 5FL3A 1TVFA 3CPTB 2V20A 3BLSA 2WAFA 5U47A 4GHIA 3TSGA 3SZTA 3MKFA 4Y5FA 4UQIS 1MWRA 4WLAA 5TBMB 4Z9QA 3IWQA 5HSQA 2XROA 3NOUC 3LFVA 3E4PA 3N8RA 4OLDA 4C75A 4WZ4A 3W8KA 1P0ZA 5DF8A 1E3UA 2V0WA 1S1YA 4PMAA 5G18A 4KZ9A 4PM5A 4E3KA 1T19A 1E3UD 1NY0A 3IBRA 4R3BA 5DTTA 4HP9A 4IHQA 1XPBA 3DTIA 2FFYA 4FUWA 2P74A 4UAAA 3NCKA 3VP0A 2W1TA 3F1OB 4HQAA 3UE3A 1Y54A 3R7WB 3UN7A 3SW1A 1LL9A 2VA0A 2YKFA 1F98A 1KGGA 5GLBA 3SH8A 3DWKA 2UV0E 1PNEA 2ZBBA 1QMFA 4HBUA 2JN7A 3NI9A 3W2ZA 3A0RA 3VP3A 4P6BA 2HDUA 2WKPA 3MXSA 3DTKA 3QP5A 2JKTI 2Y55A 3G34A 1CEGA 1IYQA 4WELA 4I3AA 4GS9A 3BFCA 4HIAA 4EETB 3IH8A 4UQIM 2OWJA 2A2LA 3RXWA 3MZDA 5EE8A 1GHPA 4R6LA 4Q0JA 1AWIA 2VGLS 2DCFA 4LLOB 1NZUA 1W79A 4MMNA 1M40A 3RXXA 4NK3A 1P9RA 1K57C 3T4KA 3OCNA 2HGVA 5C5KA 3UDXA 3MXQA 2ZM8A 4DXBA 4EERA 3UB7A 1BULA 2X02A 1FIKA 4WZ5A 1NLYA 2XR0A 2X71A 2CMNA 3LY3A 3D72A 1SZVA 2ZM2A 4OONA 5TR7A 3JVVA 5L10A 2Q9MA 2W3HA 1MC0A 4F94A 2W3GA 3KSGA 2Z2MB 1VETB 5CGSA 4NG2A 4HP4A 4PPRA 3PBOA 5BOHA 1FSYA 4QPRA 2G2UA 4I5SA 1FCMA 5A90A 1VM1A 3C7VA 3ZHHA 4IBXA 2M7UA 2B5RA 4Y0TA 2ZM0A 1HD8A 5IT5A 1U60A 1DY6A 4R3JA 5HWWA 4GLQA 4C6YA 3NHQA 2C5WB 5GLCA 5I94A 4IVKA 1JTGA 4E3OA 3QNBA 1YMXA 3UNWA 3QP2A 3BWLA 4P0MA 3G6OA 4HJ6A 2VGLM 3GTCA 4GD6A 4B93A 5F1FA 3EGXC 3MJQA 5GL9A 2J3WA 3IHBA 5M19A 1T18A 2WKEA 4EQIA 3V3RA 4PHTA 2R78A 4KQDA 3WWXA 2P04A 4BD0A 1ZTUA 1MY8A 4O7DA 2PR6A 1KDWA 3H82A 4P6ZS 2EX9A 1FOFA 2OAQ1 5GLDA 2Y2PA 1BTLA 2ZC5B 2ZOIA 1CJFA 1FR6A 3B33A 1N9LA 4GHIB 5EVLA 3IWIA 1KGEA 1IOUA 4OKPA 2PD7A 2QMIA 4RYEA 5FAPA 3E4OA 3OLOA 5KIZA 2J9PA 4IEDA 2V0UA 5EECA 4LRXC 2B02A 5L8MA 4N92A 3AGEA 5EOEA 4DE2A 2NUPC 3LEZA 3B42A 5HPFA 3IX4A 2GZAA 1L0GA 2JBFA 1ES4A 4HJ3A 2WAEA 1J9MA 2Y2KA 4L9GA 4KZAA 1RGZA 2VJWA 5EVIC 3BFEA 5HZHA 1K57A 1ZHHB 3CLOA 3LUQA 4HJ4A 1A0KA 5FI6A 1LI9A 4N1XA 2BASA 2ZL1A 4P6ZM 4OLGA 1G5UA 1H8MA 4Z1WA 3S7PA 2V2FF 2BG1A 4RX2A 4FSFA 3S7NA 1C3BA 2JKGA 4Y2FA 4QWOA 4EEUA 4U0XA 3ZG5A 5HW3A 2EWWA 1S6RA 3C7UA 4OP5A 3U2AA 2HP5A 4UA9A 4AFIA 4GDNA 5EM0A 5F1GA 1L0EA 1X0OA 3IX3A 2PDRA 1XP4A 4HH2A 3A3JA 4HHDA 4EXOA 3K2NA 4OOYA 3SS3A 3QHYA 3S7OA 2VGJA 5D3OA 1IYPA 1SKFA 2V8FA 4OQGA 4E04A 1I2WA 3G31A 4X25A 4EBNA 3P09A 1Z09A 5EPHA 2J7VA 4QB8A 1GSWA 4O0PA 1BLPA 1MPLA 4QHCA 4IUKA 4OP8A 4XXRA 2E8JA 4MNRA 4Y0OA 4ZJ2A 2ZQDA 1YM1A 3PR6A 2FFFB 2XEPA 4N9KA 1BUEA 3O88A 1XX2A 2XA7S 1XJ2A 1V9ZA 3R4KA 1XGJA 2Z6CA 3RH8B 2EA9A 1NYYA 4DE3A 3T4TA 4LV1A
chains in the Genus database with same CATH topology
1ES3A 1K54A 1SDEA 3CJMA 4K91A 5AQ9A 1MWTA 1FCOA 2A3UA 5FAQA 4DRTA 1L0FA 3C4PA 3OCLA 3A3DA 3UPNA 3HLWA 1ONGA 2H0YA 1BLHA 4JXSA 3W4OA 5IHVA 3GR2A 3MBZA 3ZVTA 4HEFA 4E3LA 5A93A 4U3TA 4OPQA 1PW1A 1TVFA 1K38A 2V20A 5GHYA 3BLSA 2WAFA 3OC2A 5U47A 3AGFA 3TSGA 3FKWA 4X69A 4A5RA 3MKFA 4UA6A 2UWXA 1MWRA 1YLJA 4OPRA 2IWDA 1FCNA 3ZCZA 4Z9QA 3ISGA 3WRZA 3IWQA 4KG6A 2XF3A 5A92A 1K4FA 3NDGA 1KVLA 1ZG4A 4KZ6A 4RX3A 1CEFA 3C5AA 3IXBA 3N8RA 4OLDA 4C75A 1BZAA 4WZ4A 5FQMA 3W8KA 5DF8A 1BLSA 5CGXA 2WKIA 3HBRA 1E3UA 4NETA 4QY5A 3IXDA 1WYCA 3ZDJA 4PMAA 4FCFA 5G18A 5E43A 1YLYA 4KZ9A 4PM5A 4E3KA 2EFXA 4S2MA 3HREA 5JYOA 5GHXA 4OVDA 2E8IA 4BQMA 1NZOA 4Y0UA 1MWUA 1E3UD 4S2NC 5EVIA 4E3MA 4E6XA 1NY0A 2DRWA 4R3BA 5DTTA 3N6IA 5FI2A 1DJCA 4EBPA 1ERMA 2ZC7A 4JKTA 1PZOA 4X68A 3VMAA 1XPBA 1ESIA 2P9VB 5DF9A 2FFYA 4GD8A 2EX2A 2OLUA 2P74A 4UAAA 1DJAA 1TDLA 3IF6B 3NCKA 3UO9A 3VP0A 3VP1A 3BRMA 1HZOA 5EVID 1E4DA 1Y54A 3N4IA 3G2YA 1LHYA 3N8SA 3OPRA 4OQIA 4X53A 3UE3A 3UN7A 4KZBA 1LL9A 4D2OA 1FQGA 3IF6C 3IF5A 1KGGA 5GLBA 3SH8A 3DWKA 4CPKA 4P87A 1LLBA 2PBYA 3SH7A 3TG9A 3LO7A 4E6WA 1IYOA 1LL5A 3OPHA 1QMFA 4HBUA 2R9WA 3NI9A 3SS5A 1KE0A 1YLTA 1Q2QA 5TGFA 3SS4A 3VP3A 4JBFA 5TFQA 4P6BA 2HDUA 2XLNA 5FI7A 4K0WA 3OPPA 4WMCA 4ZJ1A 1KE3A 1H8ZA 1IKIA 1RP5A 4U0TA 2WUQA 4X55A 3MXSA 2Y2GA 2HPBA 3HLFA 5CHUA 3IWOA 3EQVA 4UA7A 3IHAA 2Y2IA 2Y55A 1WYBA 1W7FA 1XA1A 2HDQA 3BECA 3G34A 1JVJA 4PM7A 1CEGA 5CHJA 4WMCD 1IYQA 3WS0A 3B3XA 4WELA 5E2GA 3BFCA 4CJNA 1IEMA 4EBLA 1EROA 3IH8A 3MXRA 3DWZA 4OQ0A 5CTNA 3UE1A 4ZJ3A 1AXBA 1PWGA 4WEJA 5HFOA 4PM8A 1G68A 3BLMA 3RXWA 3MZDA 5EE8A 1GHPA 5JYPA 2WGVA 3VOZA 2ZQ9A 3LY4A 3O3VA 3O86A 3UDIA 1YT4A 4JF4A 2DCFA 3Q81A 2JE5A 1NZUA 5FQ9A 4ID4A 2Y2OA 1W79A 2IWCA 3ITBA 3MZEA 1M40A 1PIOA 1NJ4A 1SHVA 5CXWA 2Y2LA 3RXXA 4NK3A 4HESA 1K57C 4LCLA 3WS1A 1BT5A 2HDSA 3OCNA 5CTMA 3UDXA 4GOGA 4Y7PA 5FAOA 2ZM8A 4DXBA 2WYXA 3FZCA 1BULA 3VOYA 1ALQA 4B88A 2X02A 3BYDA 2EXBA 4WZ5A 3NDEA 3Q7VB 1DJBA 5HAIA 4S2PA 2Y2QA 1EI5A 3OPLA 2XR0A 3N7WA 2X71A 5E2FA 5GLAA 3UPPA 3LY3A 2JC7A 3GRJA 1K55C 2ZM2A 4WM9A 5FQIA 4OONA 4S2JA 4YFMA 2RCXA 5TR7A 3S22A 5FQJA 3HLEA 2Q9MA 4ZTKA 4FH4A 4F94A 1PZPA 2R9XA 2Z2MB 4QD4A 5CGSA 3V5MA 4B4ZA 4PPRA 3GV9A 1SDNA 3PBOA 2ZQ8A 5BOHA 1FSYA 4KQRA 3IQAA 2G2UA 3PBTA 4DF6A 1FCMA 1H5XA 1VM1A 3GMWA 5A90A 2QZ6A 4WYYA 3C7VA 4ZAMA 5AQ7A 3E2LA 2H10A 4EUZA 3ZHHA 4UHUA 1MKIA 4IBXA 4B4XA 2B5RA 4GN2A 4Y0TA 3ZG9B 4JF6A 3HUMA 2ZM0A 1O07A 1JWPA 1HD8A 4KZ4A 1U60A 1DY6A 1RGYA 1KE4A 3PBRA 4R3JA 3DW0A 4DDYA 4PM6A 4C6YA 3Q7VA 3CMZA 3PTEA 2C5WB 5GLCA 5EOOA 2CC1A 5I94A 4IVKA 1RCJA 4P85A 1JTGA 1KVMA 4E3OA 3QNBA 1YMXA 5M18A 3UNWA 3UY6A 1E25A 2Y2NA 3ZG8B 2Y4AA 2ZQAA 4P0MA 1IYSA 3ZFZA 4BD1A 2XDMA 2Y2JA 3GTCA 4GD6A 3WS5A 5F1FA 5GL9A 3IHBA 1ERQA 1XGIA 2J9OA 4KZ7A 5M19A 3I7JA 1W8YA 4BJPA 1JWZA 2WKEA 4EQIA 3V3RA 3ZVWA 2XK1A 4OH0A 1IKGA 4OPYA 4QY6A 1WE4A 2XFTA 3WWXA 2ZMAA 3UE0A 1YMSA 5FDHA 5E2HA 1PI4A 4BD0A 3GSGA 1MY8A 4O7DA 2ZC6B 3VFHA 1KDWA 5DVAA 4BL3A 4JXGA 1XA7A 1ZKJA 3M2JA 3MFDA 1N4OA 3QNCA 4S2NA 3ZNYA 3G30A 1SCWA 2EX9A 1FOFA 1JWVA 4E3JA 5GLDA 2VGKA 5AQBA 3P98A 1YLPA 3JYIA 2OV5A 2Y2PA 5DTSA 3PAGA 1BTLA 3FYZA 1BLCA 1K56A 2J8YA 2ZC5B 3G35A 3G32A 2P9VA 3HLCA 4FH2A 4K0XA 5A91A 4C3QA 1ZC2A 3GQZA 3IF6A 4IBRA 1FR6A 2GDNA 1Z6FA 3MZFA 1JTDA 3VSKA 1CI8A 3PBNA 4OOLA 3FWLA 4KZ3A 2OLVA 4WEKA 1TDGA 5HX9A 3DTMA 4XUXA 3PBSA 2WZZA 1ES5A 1K56D 5EVLA 3UPOA 5EUAA 2Y91A 4FD8A 3IWIA 1MWSA 1KGEA 1W5DA 4OKPA 3ZGAB 3M2KA 4LENA 1S0WA 3M6BA 4GDBA 2QMIA 4RYEA 2I72A 1NYMA 2HDRA 5FAPA 3VFFA 4KZ8A 4JXWA 3WRTA 2J9PA 3PAEA 4IEDA 5KMWA 1GA9A 5KSCA 5EECA 5FA7A 4Q8IA 3ZNTA 4MBKA 3NC8A 1L0DA 4X56A 5GHZA 2IWBA 4N1HA 3ZG0A 1PYYA 3HLDA 1OMEA 1H8YA 3S4XA 3TOIA 4MBHA 4LV2A 4N92A 3WS4A 3AGEA 5EOEA 4DE2A 1ZG6A 1FR1A 3LEZA 2PU2A 2Q9NA 4LCMA 5F82A 3UDFA 2EFUA 5CECA 1L0GA 2DNSA 2XFSA 4KZ5A 4N9LA 2JBFA 5HAQA 3C4OA 1ES4A 1GA0A 1XXMA 3HLBA 5EVIB 4RA7A 2WAEA 1J9MA 2Y2KA 4DXCA 2ZJ9A 4R23A 3HLGA 2WADA 4KZAA 1RGZA 3IH9A 4KG5A 3HUOA 5EVIC 3BFEA 2PU4A 1K57A 2WGIA 1LI0A 3BEBA 3CG5A 4IVIA 4MLLA 3MKEA 3PBQA 4QU3A 5CRFA 4E3NA 5FASA 2WK0A 2OSUA 2XQZA 1IELA 4OQHA 5FI6A 1LI9A 4N1XA 1VQQA 4M3KA 3BFFA 4GKUA 5FATA 5CEDA 4JLFA 1YLZA 2Y59A 1ONHA 3G4PA 5KZHA 2ZD8A 3HL9A 3NIAA 4OLGA 4ZDXA 4S2KA 4OOMA 2EX6A 5KSHA 3BFGA 1K55A 3V3SA 4H8RA 1CK3A 1FSWA 4KQQA 2A49A 2Y2MA 1MXOA 3NBLA 1YLWA 4WBGA 1HTZA 2V2FF 2BG1A 2ZC4B 2X01A 4RX2A 3ZG7B 2Z2LB 4FSFA 1C3BA 1L2SA 5CGWA 3N8LA 4KG2A 4R1GA 4KQOA 3E2KA 4LV3A 2WGWB 2H5SA 2WZXA 3SOIA 1XKZA 4BENA 3GVBA 2EXAA 4U0XA 2JCHA 3Q07A 4GNUA 3ZG5A 5HW3A 1S6RA 3C7UA 4OP5A 3OZHA 1I5QA 1N9BA 1ESUA 1PWCA 1O7EA 3W4PA 3WS2A 1NXYA 3HUNA 1PI5A 4JXVA 5L2FA 2HP6A 3M6HA 1Q2PA 2HP5A 1MBLA 4UA9A 1K6RA 1ES2A 3ITAA 1K4EA 1TEMA 3HVFA 1I2SA 1M6KA 4R4RA 3V39A 4GDNA 3FKVA 2ZC3B 5F1GA 1L0EA 3D4FA 1XP4A 3BM6A 5CERA 3BFDA 4DKIA 5DTKA 3A3JA 5HL1A 1HVBA 4OOYA 5F83A 3SS3A 2V1ZA 3QHYA 1GHMA 1KGFA 4R0QA 4S2LA 5E2EA 4EWFA 1YQSA 1K6SA 2VGJA 3IT9A 5D3OA 1IYPA 3V50A 4BL2A 2BLSA 4YINA 1K25A 3A3IA 4GZBA 5HAPA 4OPZA 4MEZA 1SKFA 1CI9A 1NRFA 1K54C 1QMEA 4OQGA 2XH9A 4S2OA 1KDSA 4HBTA 2XD1A 3VSLA 4S2IA 5CEBA 1I2WA 3G31A 2XGNA 4GB7A 2ZLYA 3P09A 4EBNA 5DF7A 4X6TA 3LCEA 5EPHA 3S1YA 3SH9A 4BLMA 3CZDA 2J7VA 2RL3A 2EX8A 4QB8A 5FQKA 4LV0A 1BSGA 4R4SA 4WZ5C 2ZQ7A 2HP9A 3Q82A 3O87A 3VP2A 2WGWA 1BLPA 3Q1FA 5HARA 3NY4A 1MPLA 1PW8A 2QPNA 3EQUA 3W4QA 3A3EA 4QHCA 4L0LA 3RJUA 2G2WA 3AGDA 3IXGA 4E3IA 5J8XA 2WKHA 4JF5A 1GHIA 5FSRA 3Q7ZA 4JPMA 3G2ZA 4OP8A 4DE1A 3IXHA 1G6AA 5M1AA 4EV4A 1PWDA 4XXRA 2C6WB 5FQQA 4MNRA 4QJGA 4Y0OA 4ZJ2A 2ZQDA 1YM1A 3A3FA 2FFFB 2Y2HA 2XEPA 4N9KA 2H0TA 4KENB 1BUEA 3O88A 4DDSA 2XD5A 4RVAA 1XX2A 4PM9A 4DE0A 2ZQCA 5CHMA 4XUZA 4MBFA 1EWZA 1XGJA 5AQAA 3FV7A 1GCEA 1NYYA 4DE3A 4ZBEA 3VP4A 4LV1A 1W8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ES3 A;  1K54 A;  1SDE A;  3CJM A;  4K91 A;  5AQ9 A;  1MWT A;  1FCO A;  2A3U A;  5FAQ A;  4DRT A;  1L0F A;  3C4P A;  3OCL A;  3A3D A;  3UPN A;  3HLW A;  1ONG A;  2H0Y A;  1BLH A;  4JXS A;  3W4O A;  5IHV A;  3GR2 A;  3MBZ A;  3ZVT A;  4HEF A;  4E3L A;  5A93 A;  4U3T A;  4OPQ A;  1PW1 A;  1TVF A;  1K38 A;  2V20 A;  5GHY A;  3BLS A;  2WAF A;  3OC2 A;  5U47 A;  3AGF A;  3TSG A;  3FKW A;  4X69 A;  4A5R A;  3MKF A;  4UA6 A;  2UWX A;  1MWR A;  1YLJ A;  4OPR A;  2IWD A;  1FCN A;  3ZCZ A;  4Z9Q A;  3ISG A;  3WRZ A;  3IWQ A;  4KG6 A;  2XF3 A;  5A92 A;  1K4F A;  3NDG A;  1KVL A;  1ZG4 A;  4KZ6 A;  4RX3 A;  1CEF A;  3C5A A;  3IXB A;  3N8R A;  4OLD A;  4C75 A;  1BZA A;  4WZ4 A;  5FQM A;  3W8K A;  5DF8 A;  1BLS A;  5CGX A;  2WKI A;  3HBR A;  1E3U A;  4NET A;  4QY5 A;  3IXD A;  1WYC A;  3ZDJ A;  4PMA A;  4FCF A;  5G18 A;  5E43 A;  1YLY A;  4KZ9 A;  4PM5 A;  4E3K A;  2EFX A;  4S2M A;  3HRE A;  5JYO A;  5GHX A;  4OVD A;  2E8I A;  4BQM A;  1NZO A;  4Y0U A;  1MWU A;  1E3U D;  4S2N C;  5EVI A;  4E3M A;  4E6X A;  1NY0 A;  2DRW A;  4R3B A;  5DTT A;  3N6I A;  5FI2 A;  1DJC A;  4EBP A;  1ERM A;  2ZC7 A;  4JKT A;  1PZO A;  4X68 A;  3VMA A;  1XPB A;  1ESI A;  2P9V B;  5DF9 A;  2FFY A;  4GD8 A;  2EX2 A;  2OLU A;  2P74 A;  4UAA A;  1DJA A;  1TDL A;  3IF6 B;  3NCK A;  3UO9 A;  3VP0 A;  3VP1 A;  3BRM A;  1HZO A;  5EVI D;  1E4D A;  1Y54 A;  3N4I A;  3G2Y A;  1LHY A;  3N8S A;  3OPR A;  4OQI A;  4X53 A;  3UE3 A;  3UN7 A;  4KZB A;  1LL9 A;  4D2O A;  1FQG A;  3IF6 C;  3IF5 A;  1KGG A;  5GLB A;  3SH8 A;  3DWK A;  4CPK A;  4P87 A;  1LLB A;  2PBY A;  3SH7 A;  3TG9 A;  3LO7 A;  4E6W A;  1IYO A;  1LL5 A;  3OPH A;  1QMF A;  4HBU A;  2R9W A;  3NI9 A;  3SS5 A;  1KE0 A;  1YLT A;  1Q2Q A;  5TGF A;  3SS4 A;  3VP3 A;  4JBF A;  5TFQ A;  4P6B A;  2HDU A;  2XLN A;  5FI7 A;  4K0W A;  3OPP A;  4WMC A;  4ZJ1 A;  1KE3 A;  1H8Z A;  1IKI A;  1RP5 A;  4U0T A;  2WUQ A;  4X55 A;  3MXS A;  2Y2G A;  2HPB A;  3HLF A;  5CHU A;  3IWO A;  3EQV A;  4UA7 A;  3IHA A;  2Y2I A;  2Y55 A;  1WYB A;  1W7F A;  1XA1 A;  2HDQ A;  3BEC A;  3G34 A;  1JVJ A;  4PM7 A;  1CEG A;  5CHJ A;  4WMC D;  1IYQ A;  3WS0 A;  3B3X A;  4WEL A;  5E2G A;  3BFC A;  4CJN A;  1IEM A;  4EBL A;  1ERO A;  3IH8 A;  3MXR A;  3DWZ A;  4OQ0 A;  5CTN A;  3UE1 A;  4ZJ3 A;  1AXB A;  1PWG A;  4WEJ A;  5HFO A;  4PM8 A;  1G68 A;  3BLM A;  3RXW A;  3MZD A;  5EE8 A;  1GHP A;  5JYP A;  2WGV A;  3VOZ A;  2ZQ9 A;  3LY4 A;  3O3V A;  3O86 A;  3UDI A;  1YT4 A;  4JF4 A;  2DCF A;  3Q81 A;  2JE5 A;  1NZU A;  5FQ9 A;  4ID4 A;  2Y2O A;  1W79 A;  2IWC A;  3ITB A;  3MZE A;  1M40 A;  1PIO A;  1NJ4 A;  1SHV A;  5CXW A;  2Y2L A;  3RXX A;  4NK3 A;  4HES A;  1K57 C;  4LCL A;  3WS1 A;  1BT5 A;  2HDS A;  3OCN A;  5CTM A;  3UDX A;  4GOG A;  4Y7P A;  5FAO A;  2ZM8 A;  4DXB A;  2WYX A;  3FZC A;  1BUL A;  3VOY A;  1ALQ A;  4B88 A;  2X02 A;  3BYD A;  2EXB A;  4WZ5 A;  3NDE A;  3Q7V B;  1DJB A;  5HAI A;  4S2P A;  2Y2Q A;  1EI5 A;  3OPL A;  2XR0 A;  3N7W A;  2X71 A;  5E2F A;  5GLA A;  3UPP A;  3LY3 A;  2JC7 A;  3GRJ A;  1K55 C;  2ZM2 A;  4WM9 A;  5FQI A;  4OON A;  4S2J A;  4YFM A;  2RCX A;  5TR7 A;  3S22 A;  5FQJ A;  3HLE A;  2Q9M A;  4ZTK A;  4FH4 A;  4F94 A;  1PZP A;  2R9X A;  2Z2M B;  4QD4 A;  5CGS A;  3V5M A;  4B4Z A;  4PPR A;  3GV9 A;  1SDN A;  3PBO A;  2ZQ8 A;  5BOH A;  1FSY A;  4KQR A;  3IQA A;  2G2U A;  3PBT A;  4DF6 A;  1FCM A;  1H5X A;  1VM1 A;  3GMW A;  5A90 A;  2QZ6 A;  4WYY A;  3C7V A;  4ZAM A;  5AQ7 A;  3E2L A;  2H10 A;  4EUZ A;  3ZHH A;  4UHU A;  1MKI A;  4IBX A;  4B4X A;  2B5R A;  4GN2 A;  4Y0T A;  3ZG9 B;  4JF6 A;  3HUM A;  2ZM0 A;  1O07 A;  1JWP A;  1HD8 A;  4KZ4 A;  1U60 A;  1DY6 A;  1RGY A;  1KE4 A;  3PBR A;  4R3J A;  3DW0 A;  4DDY A;  4PM6 A;  4C6Y A;  3Q7V A;  3CMZ A;  3PTE A;  2C5W B;  5GLC A;  5EOO A;  2CC1 A;  5I94 A;  4IVK A;  1RCJ A;  4P85 A;  1JTG A;  1KVM A;  4E3O A;  3QNB A;  1YMX A;  5M18 A;  3UNW A;  3UY6 A;  1E25 A;  2Y2N A;  3ZG8 B;  2Y4A A;  2ZQA A;  4P0M A;  1IYS A;  3ZFZ A;  4BD1 A;  2XDM A;  2Y2J A;  3GTC A;  4GD6 A;  3WS5 A;  5F1F A;  5GL9 A;  3IHB A;  1ERQ A;  1XGI A;  2J9O A;  4KZ7 A;  5M19 A;  3I7J A;  1W8Y A;  4BJP A;  1JWZ A;  2WKE A;  4EQI A;  3V3R A;  3ZVW A;  2XK1 A;  4OH0 A;  1IKG A;  4OPY A;  4QY6 A;  1WE4 A;  2XFT A;  3WWX A;  2ZMA A;  3UE0 A;  1YMS A;  5FDH A;  5E2H A;  1PI4 A;  4BD0 A;  3GSG A;  1MY8 A;  4O7D A;  2ZC6 B;  3VFH A;  1KDW A;  5DVA A;  4BL3 A;  4JXG A;  1XA7 A;  1ZKJ A;  3M2J A;  3MFD A;  1N4O A;  3QNC A;  4S2N A;  3ZNY A;  3G30 A;  1SCW A;  2EX9 A;  1FOF A;  1JWV A;  4E3J A;  5GLD A;  2VGK A;  5AQB A;  3P98 A;  1YLP A;  3JYI A;  2OV5 A;  2Y2P A;  5DTS A;  3PAG A;  1BTL A;  3FYZ A;  1BLC A;  1K56 A;  2J8Y A;  2ZC5 B;  3G35 A;  3G32 A;  2P9V A;  3HLC A;  4FH2 A;  4K0X A;  5A91 A;  4C3Q A;  1ZC2 A;  3GQZ A;  3IF6 A;  4IBR A;  1FR6 A;  2GDN A;  1Z6F A;  3MZF A;  1JTD A;  3VSK A;  1CI8 A;  3PBN A;  4OOL A;  3FWL A;  4KZ3 A;  2OLV A;  4WEK A;  1TDG A;  5HX9 A;  3DTM A;  4XUX A;  3PBS A;  2WZZ A;  1ES5 A;  1K56 D;  5EVL A;  3UPO A;  5EUA A;  2Y91 A;  4FD8 A;  3IWI A;  1MWS A;  1KGE A;  1W5D A;  4OKP A;  3ZGA B;  3M2K A;  4LEN A;  1S0W A;  3M6B A;  4GDB A;  2QMI A;  4RYE A;  2I72 A;  1NYM A;  2HDR A;  5FAP A;  3VFF A;  4KZ8 A;  4JXW A;  3WRT A;  2J9P A;  3PAE A;  4IED A;  5KMW A;  1GA9 A;  5KSC A;  5EEC A;  5FA7 A;  4Q8I A;  3ZNT A;  4MBK A;  3NC8 A;  1L0D A;  4X56 A;  5GHZ A;  2IWB A;  4N1H A;  3ZG0 A;  1PYY A;  3HLD A;  1OME A;  1H8Y A;  3S4X A;  3TOI A;  4MBH A;  4LV2 A;  4N92 A;  3WS4 A;  3AGE A;  5EOE A;  4DE2 A;  1ZG6 A;  1FR1 A;  3LEZ A;  2PU2 A;  2Q9N A;  4LCM A;  5F82 A;  3UDF A;  2EFU A;  5CEC A;  1L0G A;  2DNS A;  2XFS A;  4KZ5 A;  4N9L A;  2JBF A;  5HAQ A;  3C4O A;  1ES4 A;  1GA0 A;  1XXM A;  3HLB A;  5EVI B;  4RA7 A;  2WAE A;  1J9M A;  2Y2K A;  4DXC A;  2ZJ9 A;  4R23 A;  3HLG A;  2WAD A;  4KZA A;  1RGZ A;  3IH9 A;  4KG5 A;  3HUO A;  5EVI C;  3BFE A;  2PU4 A;  1K57 A;  2WGI A;  1LI0 A;  3BEB A;  3CG5 A;  4IVI A;  4MLL A;  3MKE A;  3PBQ A;  4QU3 A;  5CRF A;  4E3N A;  5FAS A;  2WK0 A;  2OSU A;  2XQZ A;  1IEL A;  4OQH A;  5FI6 A;  1LI9 A;  4N1X A;  1VQQ A;  4M3K A;  3BFF A;  4GKU A;  5FAT A;  5CED A;  4JLF A;  1YLZ A;  2Y59 A;  1ONH A;  3G4P A;  5KZH A;  2ZD8 A;  3HL9 A;  3NIA A;  4OLG A;  4ZDX A;  4S2K A;  4OOM A;  2EX6 A;  5KSH A;  3BFG A;  1K55 A;  3V3S A;  4H8R A;  1CK3 A;  1FSW A;  4KQQ A;  2A49 A;  2Y2M A;  1MXO A;  3NBL A;  1YLW A;  4WBG A;  1HTZ A;  2V2F F;  2BG1 A;  2ZC4 B;  2X01 A;  4RX2 A;  3ZG7 B;  2Z2L B;  4FSF A;  1C3B A;  1L2S A;  5CGW A;  3N8L A;  4KG2 A;  4R1G A;  4KQO A;  3E2K A;  4LV3 A;  2WGW B;  2H5S A;  2WZX A;  3SOI A;  1XKZ A;  4BEN A;  3GVB A;  2EXA A;  4U0X A;  2JCH A;  3Q07 A;  4GNU A;  3ZG5 A;  5HW3 A;  1S6R A;  3C7U A;  4OP5 A;  3OZH A;  1I5Q A;  1N9B A;  1ESU A;  1PWC A;  1O7E A;  3W4P A;  3WS2 A;  1NXY A;  3HUN A;  1PI5 A;  4JXV A;  5L2F A;  2HP6 A;  3M6H A;  1Q2P A;  2HP5 A;  1MBL A;  4UA9 A;  1K6R A;  1ES2 A;  3ITA A;  1K4E A;  1TEM A;  3HVF A;  1I2S A;  1M6K A;  4R4R A;  3V39 A;  4GDN A;  3FKV A;  2ZC3 B;  5F1G A;  1L0E A;  3D4F A;  1XP4 A;  3BM6 A;  5CER A;  3BFD A;  4DKI A;  5DTK A;  3A3J A;  5HL1 A;  1HVB A;  4OOY A;  5F83 A;  3SS3 A;  2V1Z A;  3QHY A;  1GHM A;  1KGF A;  4R0Q A;  4S2L A;  5E2E A;  4EWF A;  1YQS A;  1K6S A;  2VGJ A;  3IT9 A;  5D3O A;  1IYP A;  3V50 A;  4BL2 A;  2BLS A;  4YIN A;  1K25 A;  3A3I A;  4GZB A;  5HAP A;  4OPZ A;  4MEZ A;  1SKF A;  1CI9 A;  1NRF A;  1K54 C;  1QME A;  4OQG A;  2XH9 A;  4S2O A;  1KDS A;  4HBT A;  2XD1 A;  3VSL A;  4S2I A;  5CEB A;  1I2W A;  3G31 A;  2XGN A;  4GB7 A;  2ZLY A;  3P09 A;  4EBN A;  5DF7 A;  4X6T A;  3LCE A;  5EPH A;  3S1Y A;  3SH9 A;  4BLM A;  3CZD A;  2J7V A;  2RL3 A;  2EX8 A;  4QB8 A;  5FQK A;  4LV0 A;  1BSG A;  4R4S A;  4WZ5 C;  2ZQ7 A;  2HP9 A;  3Q82 A;  3O87 A;  3VP2 A;  2WGW A;  1BLP A;  3Q1F A;  5HAR A;  3NY4 A;  1MPL A;  1PW8 A;  2QPN A;  3EQU A;  3W4Q A;  3A3E A;  4QHC A;  4L0L A;  3RJU A;  2G2W A;  3AGD A;  3IXG A;  4E3I A;  5J8X A;  2WKH A;  4JF5 A;  1GHI A;  5FSR A;  3Q7Z A;  4JPM A;  3G2Z A;  4OP8 A;  4DE1 A;  3IXH A;  1G6A A;  5M1A A;  4EV4 A;  1PWD A;  4XXR A;  2C6W B;  5FQQ A;  4MNR A;  4QJG A;  4Y0O A;  4ZJ2 A;  2ZQD A;  1YM1 A;  3A3F A;  2FFF B;  2Y2H A;  2XEP A;  4N9K A;  2H0T A;  4KEN B;  1BUE A;  3O88 A;  4DDS A;  2XD5 A;  4RVA A;  1XX2 A;  4PM9 A;  4DE0 A;  2ZQC A;  5CHM A;  4XUZ A;  4MBF A;  1EWZ A;  1XGJ A;  5AQA A;  3FV7 A;  1GCE A;  1NYY A;  4DE3 A;  4ZBE A;  3VP4 A;  4LV1 A;  1W8Q A; 
#chains in the Genus database with same CATH topology
 1SDE A;  4HH3 A;  3MSH A;  4DRT A;  2XRN A;  1ONG A;  1VB6 A;  2V8C A;  4OPQ A;  4U3T A;  5K5B A;  5GHY A;  4UA6 A;  1VHM A;  2UWX A;  5HDD A;  2IWD A;  2G7U A;  3HCY A;  3ZCZ A;  3WRZ A;  1K4F A;  3NDG A;  1KVL A;  1ZG4 A;  3C5A A;  2J3T C;  2VV8 A;  3OBF A;  1YSP A;  1BLS A;  3P01 A;  4QY5 A;  3T1S A;  1WYC A;  4FCF A;  4Y13 A;  4UEY A;  2VEA A;  2W3F A;  1NZO A;  5EVI A;  4E6X A;  3N6I A;  2ZC7 A;  3VMA A;  4DJ2 A;  5EFW A;  3BRM A;  5EVI D;  3N4I A;  4X53 A;  3O5Y A;  5J7E A;  1FQG A;  3IF5 A;  3OOV A;  4CPK A;  2PR5 A;  3SH7 A;  3LO7 A;  4E6W A;  3U4L P;  1LL5 A;  2R9W A;  1KE0 A;  1YLT A;  1Q2Q A;  5TGF A;  5TFQ A;  3DBA A;  4EUV A;  4KUO A;  5FI7 A;  4ZJ1 A;  4WMC A;  2KLI A;  4I38 A;  1P97 A;  2Y2G A;  3HLF A;  3IWO A;  3EQV A;  2Y2I A;  5MC7 A;  1WYB A;  2VV6 A;  4WMC D;  3WS0 A;  3B3X A;  1IEM A;  4EBL A;  1ERO A;  3DWZ A;  3UE1 A;  1AXB A;  1PWG A;  1T1A A;  4PM8 A;  3BLM A;  3H7W A;  5JYP A;  3VOZ A;  4Q0H A;  3O3V A;  3EGD C;  2HJE A;  3RFB A;  2Y2O A;  1DP8 A;  2IWC A;  3ITB A;  1NJ4 A;  5CXW A;  4LCL A;  2ZL1 B;  1CF0 A;  3VE4 A;  3FZC A;  1ALQ A;  3CHW P;  4KUK A;  3NDE A;  3Q7V B;  5HAI A;  4S2P A;  5GLA A;  2Y8H A;  4F3L B;  2FZ0 A;  2QHK A;  4LFU A;  4WM9 A;  3CIT A;  4S2J A;  2RCX A;  3S22 A;  3HLE A;  4ZTK A;  3BY8 A;  4FH4 A;  3KYZ A;  1H0M A;  1PZP A;  3DTE A;  4II7 A;  3GEC A;  3T1X A;  2IA2 A;  4NEE D;  1MKM A;  3GMW A;  2GNX A;  2P7J A;  4WYY A;  5AQ7 A;  3KX0 X;  4JGR A;  3ZG9 B;  4KZ4 A;  3E4Q A;  3PBR A;  2JKF A;  4PM6 A;  4LRY C;  3PTE A;  3LGO A;  4P85 A;  1KVM A;  4LGW A;  4BD1 A;  1L3L A;  2Y2J A;  3LR5 A;  1ERQ A;  2J9O A;  1W8Y A;  2XK1 A;  2VV7 A;  4GCZ A;  4H6J A;  5HPI A;  1YMS A;  4IUH A;  5E2H A;  1PI4 A;  2J3T D;  1TS6 A;  5HWT A;  1XFQ A;  5HL6 A;  5DVA A;  4BL3 A;  1XA7 A;  3T4L A;  3TE8 A;  3ZNY A;  5J4E A;  2QJ7 A;  5AQB A;  4JGQ A;  1N9O A;  5DTS A;  3PAG A;  1BLC A;  3BJN A;  4K0X A;  4LPZ A;  3UB5 P;  2PD8 A;  3CWF A;  1JTD A;  1CI8 A;  4L9E A;  5HX9 A;  3DTM A;  1V9Y A;  2WZZ A;  3UPO A;  5EUA A;  4FD8 A;  3IBJ A;  1W5D A;  3ZGA B;  3M2K A;  1S0W A;  3M6B A;  3E0Y A;  2W0N A;  1NYM A;  4JXW A;  3C38 A;  3PAE A;  5KSC A;  1IFQ A;  3ZNT A;  4MBK A;  3NC8 A;  1P9W A;  4X56 A;  5A8B A;  4Y15 A;  3A0V A;  2IWB A;  4EQ1 A;  3ZG0 A;  3LIB A;  4CLC C;  3HLD A;  3S4X A;  4MBH A;  1N9N A;  1ZG6 A;  1FR1 A;  1W63 M;  4N9L A;  4BWI A;  5HAQ A;  3C4O A;  5EVI B;  3T4O A;  3D3O A;  3HLG A;  3HUO A;  4M4X A;  1FIL A;  1K0K A;  3BEB A;  4MLL A;  1OTD A;  5FAS A;  2XQZ A;  4JGO A;  4L9F A;  1VQQ A;  3BFF A;  3QP1 A;  4JLF A;  1YLZ A;  1D06 A;  1F2K A;  2Y59 A;  1HLU P;  1ONH A;  3HL9 A;  3NIA A;  3TRC A;  3V3S A;  3CUE C;  2A49 A;  1YLW A;  1OT6 A;  1HTZ A;  5IS1 A;  5L09 A;  3ZG7 B;  1G6O A;  4IJG A;  1L2S A;  4KG2 A;  4KQO A;  4LV3 A;  2WGW B;  2H5S A;  2OOL A;  4I3J A;  3SOI A;  2GX5 A;  2EXA A;  4ARZ A;  3Q07 A;  4GNU A;  2LB9 A;  1ESU A;  1O7E A;  5L2F A;  3H7W B;  2HJ9 C;  1ES2 A;  1K4E A;  2B95 A;  1TEM A;  3HVF A;  3F1N A;  3V39 A;  3VOL A;  1OPX A;  2ZC3 B;  3D4F A;  4YWZ A;  4R3A A;  5G4Y A;  3BM6 A;  2VLG A;  5F83 A;  2V1Z A;  1KGF A;  4S2L A;  4EWF A;  1YQS A;  3FC7 A;  5HAP A;  1QME A;  4HBT A;  2B18 A;  3CZD A;  2EX8 A;  3Q82 A;  5DFY A;  1DRM A;  2XSS A;  3W4Q A;  3EQU A;  3A3E A;  4L0L A;  3RJU A;  3LI8 A;  4E3I A;  2WKH A;  1GHI A;  2O0Y A;  4PAU A;  5F69 A;  4WN5 A;  3NOP C;  1G6A A;  5M1A A;  3QP8 A;  3BQ8 A;  2PYR A;  2H0T A;  4DDS A;  2XD5 A;  4XUZ A;  5AQA A;  2Y79 A;  3LR3 A;  1GCE A;  1MWT A;  3C2W A;  3V67 A;  5FAQ A;  4NXG A;  2ZOH A;  3VV4 A;  3OCL A;  3UPN A;  3HLW A;  3UME A;  3W4O A;  3ZVT A;  4HEF A;  5A93 A;  1K38 A;  5EM1 A;  2W1T B;  3UB6 A;  2O9B A;  3FKW A;  5DKK A;  4A5R A;  3FPW A;  3PHY A;  1FCN A;  3ISG A;  5A92 A;  4KZ6 A;  1LL8 A;  4RX3 A;  1CEF A;  4K08 A;  2P08 A;  2PBD P;  4CLC A;  4H6J B;  1BZA A;  5FQM A;  3HBR A;  3ZDJ A;  1SKO A;  4CLC D;  1LT0 A;  2EFX A;  4S2M A;  3HRE A;  4OVD A;  3FPV A;  2E8I A;  1D1J A;  4FOF A;  4Y0U A;  4GS9 B;  4S2N C;  2DRW A;  3F1P A;  4X68 A;  4JKT A;  4GD8 A;  3UB9 A;  1DJA A;  1OJ5 A;  1TDL A;  3UO9 A;  3VP1 A;  1HZO A;  1E4D A;  3G2Y A;  3N8S A;  4KZB A;  5TBM A;  3IF6 C;  5FEF A;  4P87 A;  3KSF A;  2OAP 1;  1IYO A;  2OWH A;  2VKS A;  3CUE A;  4HNB A;  2NUT C;  3JPU A;  2M7V A;  2KDK A;  3SS4 A;  4JBF A;  2XLN A;  2QWS A;  1KE3 A;  1H8Z A;  1RP5 A;  4X55 A;  2WUQ A;  4YOF A;  1H3Q A;  2HPB A;  3BY9 A;  2O9A A;  1XA1 A;  2HDQ A;  3BEC A;  3GDI A;  1ACF A;  2Q0O A;  2QYB A;  3MXR A;  4OQ0 A;  5CTN A;  4D60 A;  2JHE A;  3F1O A;  2ZQ9 A;  4WL9 A;  3LY4 A;  3O86 A;  1YT4 A;  5FQ9 A;  3MZE A;  1PIO A;  4BBT A;  1SHV A;  2Y2L A;  3ICY A;  1BT5 A;  3H9W A;  4Y7P A;  2WYX A;  4NXF A;  4HY8 A;  3BYD A;  2EXB A;  2V1B A;  2Y2Q A;  3NOT C;  1EI5 A;  3OPL A;  4HOI A;  1STZ A;  3UPP A;  2JC7 A;  4DJ3 A;  3QP6 A;  5FQJ A;  1W63 Q;  2YKH A;  3LIC A;  3V5M A;  4B4Z A;  4BBU A;  3GV9 A;  5DKL A;  4Q0I A;  2ZQ8 A;  3EOI A;  4KQR A;  2WKQ A;  3LID A;  4DF6 A;  3F1N B;  1H5X A;  3H82 B;  3E2L A;  4EUZ A;  1EW0 A;  1MKI A;  4GN2 A;  4JF6 A;  1XFN A;  3HUM A;  3NUL A;  1JWP A;  1RGY A;  3HJI A;  4DDY A;  1PFL A;  3LI9 A;  2VK3 A;  1Y4O A;  2CC1 A;  3T50 A;  2Y2N A;  2GJ3 A;  2QKP A;  2Y4A A;  2ZQA A;  3ZFZ A;  2XDM A;  1S4S A;  3QP4 A;  3WS5 A;  5FEG A;  1XGI A;  4KZ7 A;  2PHY A;  4BJP A;  1JWZ A;  3UE6 A;  3KYQ A;  3FG8 A;  1WE4 A;  2XFT A;  3UE0 A;  1G28 A;  2M1C A;  2PT7 A;  3VFH A;  2ZC6 B;  3KSH A;  5DJU A;  1ZKJ A;  3MFD A;  3QNC A;  3ZYT A;  4S2N A;  4NXE A;  4YNR A;  3JYI A;  2OV5 A;  5FDS A;  1XJ6 A;  3T1R A;  1TS7 A;  4FH2 A;  2J8Y A;  4O01 A;  5A91 A;  4C3Q A;  2P9V A;  1ZC2 A;  3IF6 A;  1Z6F A;  3MZF A;  3VSK A;  3PBN A;  4OOL A;  4KZ3 A;  4WEK A;  2OLV A;  1TDG A;  3PBS A;  1ES5 A;  3EEH A;  1MWS A;  4LEN A;  3LIE A;  4GDB A;  2HF6 A;  3A0S A;  3UMD A;  4KZ8 A;  3L9K A;  2ZMV A;  4G3W A;  4CLC B;  5KMW A;  5AJG A;  5FA7 A;  3CI6 A;  4EEP A;  1NLZ A;  5GHZ A;  2KX6 A;  5HD3 A;  2W3D A;  1H8Y A;  3TOI A;  1SKO B;  5F82 A;  2PU2 A;  1LSW A;  5CEC A;  4NKP A;  4KZ5 A;  2PRF A;  3HLB A;  1GA0 A;  1XXM A;  3F1P B;  2PU4 A;  1LI0 A;  2MJ6 A;  2FH5 A;  3LR4 A;  3MKE A;  3PBQ A;  4QU3 A;  4E3N A;  3HJK A;  2WK0 A;  5FAT A;  4GKU A;  2KOI A;  4JGP A;  2K2N A;  4ZDX A;  4Y3I A;  4OOM A;  3T1Q B;  2EX6 A;  5KSH A;  1S66 L;  1FSW A;  4KQQ A;  4XT2 A;  3KSI A;  2ZC4 B;  3E98 A;  3MFX A;  2Z2L B;  5G4Z A;  3NJA A;  4PKY A;  5CGW A;  2L4R A;  3N8L A;  4R1G A;  5HDS A;  2WZX A;  1XKZ A;  4BEN A;  3GVB A;  4G3V A;  1TF1 A;  1NRJ A;  4ME4 A;  4LRZ E;  1N9B A;  3W4P A;  1NXY A;  4ESP A;  3HUN A;  1PI5 A;  2HP6 A;  4MN7 A;  3TW8 A;  1MBL A;  1M6K A;  3FKV A;  4B9O A;  3BFD A;  4DKI A;  5DTK A;  1HVB A;  4R0Q A;  1K6S A;  3T4Q A;  3T4S A;  3IT9 A;  2A24 A;  3V50 A;  2BLS A;  4YIN A;  1K25 A;  3A3I A;  5AVE A;  4MEZ A;  4S2O A;  1NRF A;  3LYX A;  4S2I A;  4GB7 A;  5DF7 A;  4BLM A;  3S1Y A;  2RL3 A;  2L1M A;  3DAV A;  4LV0 A;  1BSG A;  4R4S A;  3O87 A;  4PKY G;  3MF0 A;  1PW8 A;  2QPN A;  3LIA A;  2G2W A;  2LB5 A;  5FSR A;  5F6A A;  4WUJ A;  3G2Z A;  4DE1 A;  4EV4 A;  1PWD A;  5EV0 A;  3A3F A;  2Y2H A;  4KEN B;  4RVA A;  4PM9 A;  1OT9 A;  2ZQC A;  4DE0 A;  4EES A;  4MBF A;  1NWZ A;  3FV7 A;  2O9C A;  3VP4 A;  1K54 A;  1VEU A;  4K91 A;  5AQ9 A;  4Y17 A;  3C4P A;  1GSV A;  1JNU A;  3A3D A;  1OJG A;  2H0Y A;  1BLH A;  5IHV A;  3MBZ A;  3L7H A;  1PW1 A;  3OC2 A;  3AGF A;  1T1C A;  4X69 A;  3KO6 A;  1YLJ A;  4OPR A;  4MN6 A;  5EVE A;  4KG6 A;  1F9I A;  4BBV A;  2XF3 A;  1MZU A;  3IXB A;  4CLC E;  1ODV A;  3IS2 A;  4MN5 A;  5CGX A;  2WKI A;  1GSX A;  4NET A;  3IXD A;  1YSQ A;  2ACG A;  1YAX A;  5E43 A;  1YLY A;  5JYO A;  5GHX A;  4BQM A;  1MWU A;  4E3M A;  3JVU A;  5FI2 A;  4I39 A;  4MCW A;  1DJC A;  4EBP A;  1ERM A;  1PZO A;  4BMW A;  1ESI A;  1TS8 A;  2P9V B;  5DF9 A;  4CQH A;  2EX2 A;  2OLU A;  3EWK A;  3IF6 B;  3NEC A;  3OPR A;  4OQI A;  1LHY A;  3K3C A;  4EU0 A;  4D2O A;  1LLB A;  2PBY A;  2ZMF A;  3TG9 A;  2H28 A;  3OPH A;  3SS5 A;  1S67 L;  4X1M A;  3S7Q A;  4K0W A;  3OPP A;  1UWP X;  1CQA A;  1IKI A;  4U0T A;  5I5L A;  2JKR M;  5TJJ A;  5CHU A;  4UA7 A;  3IHA A;  1W7F A;  3PYP A;  1JVJ A;  4PM7 A;  5CHJ A;  3MQO A;  1S4R A;  5E2G A;  4CJN A;  3MQQ A;  1PRQ A;  4ZJ3 A;  5HFO A;  4WEJ A;  5DJT A;  1G68 A;  4R38 A;  5HDC A;  2WGV A;  3UDI A;  4JF4 A;  3Q81 A;  2JE5 A;  4ID4 A;  2D02 A;  4HES A;  3WS1 A;  2HDS A;  2D01 A;  5CTM A;  4GOG A;  5FAO A;  3VOY A;  3CAX A;  4B88 A;  1DJB A;  3N7W A;  4XT2 B;  5E2F A;  1J3W A;  1F5M A;  3GRJ A;  1K55 C;  2HZ5 A;  5FQI A;  4X1L A;  3BQA A;  4YFM A;  3LIF A;  4O8G A;  2R9X A;  4QD4 A;  3MQ0 A;  1SDN A;  3IQA A;  3PBT A;  2QZ6 A;  4ZAM A;  3VE3 A;  2H10 A;  3BW6 A;  4UHU A;  2K31 A;  4B4X A;  3C8C A;  1O07 A;  2QJ5 A;  1Y28 A;  2EWV A;  1S1Z A;  1KE4 A;  2A24 B;  3DW0 A;  4DMZ A;  2V1A A;  2INW A;  1XJ4 A;  3Q7V A;  3CMZ A;  3CPT A;  5EOO A;  2I9V A;  2V9A A;  1RCJ A;  4F3L A;  5M18 A;  3UY6 A;  1E25 A;  1OTI A;  3ZG8 B;  4FTX A;  1IYS A;  2VX8 A;  3I7J A;  3ZVW A;  4OH0 A;  1IKG A;  4OPY A;  4QY6 A;  1LSV A;  5IU1 A;  5F5Y A;  2ZMA A;  4GJ4 A;  5FDH A;  3GSG A;  4JXG A;  3M2J A;  1N4O A;  3G30 A;  1SCW A;  3C30 A;  1JWV A;  4E3J A;  1VEU B;  4ZRR A;  3T12 B;  2VGK A;  4WF0 A;  3P98 A;  1YLP A;  1TS0 A;  3FYZ A;  1K56 A;  3G35 A;  3G32 A;  3HLC A;  3GQZ A;  4IBR A;  2GDN A;  2PYP A;  1YPR A;  3FWL A;  1KOU A;  3R7W A;  2JKT M;  5J3W A;  4XUX A;  3IX8 A;  1K56 D;  4G3K A;  2Y91 A;  4I3I A;  4MDZ A;  2I72 A;  2HDR A;  3LR0 A;  3VFF A;  3WRT A;  1UWN X;  1GA9 A;  1BYW A;  4Q8I A;  3IS2 B;  1L0D A;  4N1H A;  1PYY A;  1OME A;  2WKR A;  4LV2 A;  3WS4 A;  4LCM A;  2Q9N A;  3UDF A;  2EFU A;  2DNS A;  2XFS A;  4ARZ B;  4NXB A;  3K3D A;  4RA7 A;  4DXC A;  1OTB A;  3P7N A;  2ZJ9 A;  4R23 A;  2WAD A;  3IH9 A;  4KG5 A;  4DN0 A;  5AVF A;  3CG5 A;  2WGI A;  2W3E A;  4IVI A;  4GW9 A;  5CRF A;  5HD5 A;  1UGU A;  2OSU A;  5CX7 A;  1IEL A;  4OQH A;  5L07 A;  2O99 A;  3MS6 A;  4M3K A;  5CED A;  1DP6 A;  3G4P A;  5KZH A;  2ZD8 A;  4S2K A;  2K7S A;  3BFG A;  5DFX A;  1DP9 A;  1K55 A;  4H8R A;  1CK3 A;  2Y2M A;  1MXO A;  3NBL A;  4WBG A;  3RTY A;  2X01 A;  3E2K A;  2J80 A;  2AVX A;  5LBR A;  3T4J A;  3KYE A;  2JCH A;  2DMW A;  3OZH A;  2PAV P;  1I5Q A;  1VET A;  1PWC A;  3WS2 A;  1TD5 A;  4JXV A;  3M6H A;  1Q2P A;  2JKR I;  1K6R A;  3ITA A;  1I2S A;  2W1R A;  4R4R A;  3ULF A;  3D9Y A;  5CER A;  5HL1 A;  2XA7 M;  1GHM A;  5E2E A;  4R70 A;  3MMH A;  4HI4 A;  1YKD A;  4BL2 A;  1XJ3 A;  4GZB A;  4OPZ A;  2Z6D A;  1CI9 A;  2W27 A;  1K54 C;  3VSL A;  1OTE A;  2XH9 A;  4EW7 A;  1KDS A;  2XD1 A;  5CEB A;  2XGN A;  2ZLY A;  4X6T A;  3LCE A;  3SH9 A;  5FQK A;  2VZW A;  4WZ5 C;  2ZQ7 A;  2HP9 A;  3VP2 A;  2WGW A;  3Q1F A;  5HAR A;  3TJZ C;  3NY4 A;  3PXP A;  3LEQ A;  3B47 A;  3UB8 A;  3AGD A;  3IXG A;  2BTF P;  5J8X A;  3MR0 A;  4JF5 A;  3Q7Z A;  1OTA A;  4JPM A;  3IXH A;  2C6W B;  5FQQ A;  4QJG A;  2L0W A;  4ETZ A;  4RQ9 A;  1T1B A;  5CHM A;  1EWZ A;  5F68 A;  3ZQ5 A;  4ZBE A;  1W8Q A;  1WA9 A;  1ES3 A;  1LSX A;  3CJM A;  4ETX A;  1D7E A;  2HV1 A;  1FCO A;  2A3U A;  1L0F A;  5HWV A;  4JXS A;  3GR2 A;  4E3L A;  3EEA A;  5FL3 A;  1TVF A;  3CPT B;  2V20 A;  3BLS A;  2WAF A;  5U47 A;  4GHI A;  3TSG A;  3SZT A;  3MKF A;  4Y5F A;  4UQI S;  1MWR A;  4WLA A;  5TBM B;  4Z9Q A;  3IWQ A;  5HSQ A;  2XRO A;  3NOU C;  3LFV A;  3E4P A;  3N8R A;  4OLD A;  4C75 A;  4WZ4 A;  3W8K A;  1P0Z A;  5DF8 A;  1E3U A;  2V0W A;  1S1Y A;  4PMA A;  5G18 A;  4KZ9 A;  4PM5 A;  4E3K A;  1T19 A;  1E3U D;  1NY0 A;  3IBR A;  4R3B A;  5DTT A;  4HP9 A;  4IHQ A;  1XPB A;  3DTI A;  2FFY A;  4FUW A;  2P74 A;  4UAA A;  3NCK A;  3VP0 A;  2W1T A;  3F1O B;  4HQA A;  3UE3 A;  1Y54 A;  3R7W B;  3UN7 A;  3SW1 A;  1LL9 A;  2VA0 A;  2YKF A;  1F98 A;  1KGG A;  5GLB A;  3SH8 A;  3DWK A;  2UV0 E;  1PNE A;  2ZBB A;  1QMF A;  4HBU A;  2JN7 A;  3NI9 A;  3W2Z A;  3A0R A;  3VP3 A;  4P6B A;  2HDU A;  2WKP A;  3MXS A;  3DTK A;  3QP5 A;  2JKT I;  2Y55 A;  3G34 A;  1CEG A;  1IYQ A;  4WEL A;  4I3A A;  4GS9 A;  3BFC A;  4HIA A;  4EET B;  3IH8 A;  4UQI M;  2OWJ A;  2A2L A;  3RXW A;  3MZD A;  5EE8 A;  1GHP A;  4R6L A;  4Q0J A;  1AWI A;  2VGL S;  2DCF A;  4LLO B;  1NZU A;  1W79 A;  4MMN A;  1M40 A;  3RXX A;  4NK3 A;  1P9R A;  1K57 C;  3T4K A;  3OCN A;  2HGV A;  5C5K A;  3UDX A;  3MXQ A;  2ZM8 A;  4DXB A;  4EER A;  3UB7 A;  1BUL A;  2X02 A;  1FIK A;  4WZ5 A;  1NLY A;  2XR0 A;  2X71 A;  2CMN A;  3LY3 A;  3D72 A;  1SZV A;  2ZM2 A;  4OON A;  5TR7 A;  3JVV A;  5L10 A;  2Q9M A;  2W3H A;  1MC0 A;  4F94 A;  2W3G A;  3KSG A;  2Z2M B;  1VET B;  5CGS A;  4NG2 A;  4HP4 A;  4PPR A;  3PBO A;  5BOH A;  1FSY A;  4QPR A;  2G2U A;  4I5S A;  1FCM A;  5A90 A;  1VM1 A;  3C7V A;  3ZHH A;  4IBX A;  2M7U A;  2B5R A;  4Y0T A;  2ZM0 A;  1HD8 A;  5IT5 A;  1U60 A;  1DY6 A;  4R3J A;  5HWW A;  4GLQ A;  4C6Y A;  3NHQ A;  2C5W B;  5GLC A;  5I94 A;  4IVK A;  1JTG A;  4E3O A;  3QNB A;  1YMX A;  3UNW A;  3QP2 A;  3BWL A;  4P0M A;  3G6O A;  4HJ6 A;  2VGL M;  3GTC A;  4GD6 A;  4B93 A;  5F1F A;  3EGX C;  3MJQ A;  5GL9 A;  2J3W A;  3IHB A;  5M19 A;  1T18 A;  2WKE A;  4EQI A;  3V3R A;  4PHT A;  2R78 A;  4KQD A;  3WWX A;  2P04 A;  4BD0 A;  1ZTU A;  1MY8 A;  4O7D A;  2PR6 A;  1KDW A;  3H82 A;  4P6Z S;  2EX9 A;  1FOF A;  2OAQ 1;  5GLD A;  2Y2P A;  1BTL A;  2ZC5 B;  2ZOI A;  1CJF A;  1FR6 A;  3B33 A;  1N9L A;  4GHI B;  5EVL A;  3IWI A;  1KGE A;  1IOU A;  4OKP A;  2PD7 A;  2QMI A;  4RYE A;  5FAP A;  3E4O A;  3OLO A;  5KIZ A;  2J9P A;  4IED A;  2V0U A;  5EEC A;  4LRX C;  2B02 A;  5L8M A;  4N92 A;  3AGE A;  5EOE A;  4DE2 A;  2NUP C;  3LEZ A;  3B42 A;  5HPF A;  3IX4 A;  2GZA A;  1L0G A;  2JBF A;  1ES4 A;  4HJ3 A;  2WAE A;  1J9M A;  2Y2K A;  4L9G A;  4KZA A;  1RGZ A;  2VJW A;  5EVI C;  3BFE A;  5HZH A;  1K57 A;  1ZHH B;  3CLO A;  3LUQ A;  4HJ4 A;  1A0K A;  5FI6 A;  1LI9 A;  4N1X A;  2BAS A;  2ZL1 A;  4P6Z M;  4OLG A;  1G5U A;  1H8M A;  4Z1W A;  3S7P A;  2V2F F;  2BG1 A;  4RX2 A;  4FSF A;  3S7N A;  1C3B A;  2JKG A;  4Y2F A;  4QWO A;  4EEU A;  4U0X A;  3ZG5 A;  5HW3 A;  2EWW A;  1S6R A;  3C7U A;  4OP5 A;  3U2A A;  2HP5 A;  4UA9 A;  4AFI A;  4GDN A;  5EM0 A;  5F1G A;  1L0E A;  1X0O A;  3IX3 A;  2PDR A;  1XP4 A;  4HH2 A;  3A3J A;  4HHD A;  4EXO A;  3K2N A;  4OOY A;  3SS3 A;  3QHY A;  3S7O A;  2VGJ A;  5D3O A;  1IYP A;  1SKF A;  2V8F A;  4OQG A;  4E04 A;  1I2W A;  3G31 A;  4X25 A;  4EBN A;  3P09 A;  1Z09 A;  5EPH A;  2J7V A;  4QB8 A;  1GSW A;  4O0P A;  1BLP A;  1MPL A;  4QHC A;  4IUK A;  4OP8 A;  4XXR A;  2E8J A;  4MNR A;  4Y0O A;  4ZJ2 A;  2ZQD A;  1YM1 A;  3PR6 A;  2FFF B;  2XEP A;  4N9K A;  1BUE A;  3O88 A;  1XX2 A;  2XA7 S;  1XJ2 A;  1V9Z A;  3R4K A;  1XGJ A;  2Z6C A;  3RH8 B;  2EA9 A;  1NYY A;  4DE3 A;  3T4T A;  4LV1 A; 
#chains in the Genus database with same CATH homology
 1ES3 A;  1K54 A;  1SDE A;  3CJM A;  4K91 A;  5AQ9 A;  1MWT A;  1FCO A;  2A3U A;  5FAQ A;  4DRT A;  1L0F A;  3C4P A;  3OCL A;  3A3D A;  3UPN A;  3HLW A;  1ONG A;  2H0Y A;  1BLH A;  4JXS A;  3W4O A;  5IHV A;  3GR2 A;  3MBZ A;  3ZVT A;  4HEF A;  4E3L A;  5A93 A;  4U3T A;  4OPQ A;  1PW1 A;  1TVF A;  1K38 A;  2V20 A;  5GHY A;  3BLS A;  2WAF A;  3OC2 A;  5U47 A;  3AGF A;  3TSG A;  3FKW A;  4X69 A;  4A5R A;  3MKF A;  4UA6 A;  2UWX A;  1MWR A;  1YLJ A;  4OPR A;  2IWD A;  1FCN A;  3ZCZ A;  4Z9Q A;  3ISG A;  3WRZ A;  3IWQ A;  4KG6 A;  2XF3 A;  5A92 A;  1K4F A;  3NDG A;  1KVL A;  1ZG4 A;  4KZ6 A;  4RX3 A;  1CEF A;  3C5A A;  3IXB A;  3N8R A;  4OLD A;  4C75 A;  1BZA A;  4WZ4 A;  5FQM A;  3W8K A;  5DF8 A;  1BLS A;  5CGX A;  2WKI A;  3HBR A;  1E3U A;  4NET A;  4QY5 A;  3IXD A;  1WYC A;  3ZDJ A;  4PMA A;  4FCF A;  5G18 A;  5E43 A;  1YLY A;  4KZ9 A;  4PM5 A;  4E3K A;  2EFX A;  4S2M A;  3HRE A;  5JYO A;  5GHX A;  4OVD A;  2E8I A;  4BQM A;  1NZO A;  4Y0U A;  1MWU A;  1E3U D;  4S2N C;  5EVI A;  4E3M A;  4E6X A;  1NY0 A;  2DRW A;  4R3B A;  5DTT A;  3N6I A;  5FI2 A;  1DJC A;  4EBP A;  1ERM A;  2ZC7 A;  4JKT A;  1PZO A;  4X68 A;  3VMA A;  1XPB A;  1ESI A;  2P9V B;  5DF9 A;  2FFY A;  4GD8 A;  2EX2 A;  2OLU A;  2P74 A;  4UAA A;  1DJA A;  1TDL A;  3IF6 B;  3NCK A;  3UO9 A;  3VP0 A;  3VP1 A;  3BRM A;  1HZO A;  5EVI D;  1E4D A;  1Y54 A;  3N4I A;  3G2Y A;  1LHY A;  3N8S A;  3OPR A;  4OQI A;  4X53 A;  3UE3 A;  3UN7 A;  4KZB A;  1LL9 A;  4D2O A;  1FQG A;  3IF6 C;  3IF5 A;  1KGG A;  5GLB A;  3SH8 A;  3DWK A;  4CPK A;  4P87 A;  1LLB A;  2PBY A;  3SH7 A;  3TG9 A;  3LO7 A;  4E6W A;  1IYO A;  1LL5 A;  3OPH A;  1QMF A;  4HBU A;  2R9W A;  3NI9 A;  3SS5 A;  1KE0 A;  1YLT A;  1Q2Q A;  5TGF A;  3SS4 A;  3VP3 A;  4JBF A;  5TFQ A;  4P6B A;  2HDU A;  2XLN A;  5FI7 A;  4K0W A;  3OPP A;  4WMC A;  4ZJ1 A;  1KE3 A;  1H8Z A;  1IKI A;  1RP5 A;  4U0T A;  2WUQ A;  4X55 A;  3MXS A;  2Y2G A;  2HPB A;  3HLF A;  5CHU A;  3IWO A;  3EQV A;  4UA7 A;  3IHA A;  2Y2I A;  2Y55 A;  1WYB A;  1W7F A;  1XA1 A;  2HDQ A;  3BEC A;  3G34 A;  1JVJ A;  4PM7 A;  1CEG A;  5CHJ A;  4WMC D;  1IYQ A;  3WS0 A;  3B3X A;  4WEL A;  5E2G A;  3BFC A;  4CJN A;  1IEM A;  4EBL A;  1ERO A;  3IH8 A;  3MXR A;  3DWZ A;  4OQ0 A;  5CTN A;  3UE1 A;  4ZJ3 A;  1AXB A;  1PWG A;  4WEJ A;  5HFO A;  4PM8 A;  1G68 A;  3BLM A;  3RXW A;  3MZD A;  5EE8 A;  1GHP A;  5JYP A;  2WGV A;  3VOZ A;  2ZQ9 A;  3LY4 A;  3O3V A;  3O86 A;  3UDI A;  1YT4 A;  4JF4 A;  2DCF A;  3Q81 A;  2JE5 A;  1NZU A;  5FQ9 A;  4ID4 A;  2Y2O A;  1W79 A;  2IWC A;  3ITB A;  3MZE A;  1M40 A;  1PIO A;  1NJ4 A;  1SHV A;  5CXW A;  2Y2L A;  3RXX A;  4NK3 A;  4HES A;  1K57 C;  4LCL A;  3WS1 A;  1BT5 A;  2HDS A;  3OCN A;  5CTM A;  3UDX A;  4GOG A;  4Y7P A;  5FAO A;  2ZM8 A;  4DXB A;  2WYX A;  3FZC A;  1BUL A;  3VOY A;  1ALQ A;  4B88 A;  2X02 A;  3BYD A;  2EXB A;  4WZ5 A;  3NDE A;  3Q7V B;  1DJB A;  5HAI A;  4S2P A;  2Y2Q A;  1EI5 A;  3OPL A;  2XR0 A;  3N7W A;  2X71 A;  5E2F A;  5GLA A;  3UPP A;  3LY3 A;  2JC7 A;  3GRJ A;  1K55 C;  2ZM2 A;  4WM9 A;  5FQI A;  4OON A;  4S2J A;  4YFM A;  2RCX A;  5TR7 A;  3S22 A;  5FQJ A;  3HLE A;  2Q9M A;  4ZTK A;  4FH4 A;  4F94 A;  1PZP A;  2R9X A;  2Z2M B;  4QD4 A;  5CGS A;  3V5M A;  4B4Z A;  4PPR A;  3GV9 A;  1SDN A;  3PBO A;  2ZQ8 A;  5BOH A;  1FSY A;  4KQR A;  3IQA A;  2G2U A;  3PBT A;  4DF6 A;  1FCM A;  1H5X A;  1VM1 A;  3GMW A;  5A90 A;  2QZ6 A;  4WYY A;  3C7V A;  4ZAM A;  5AQ7 A;  3E2L A;  2H10 A;  4EUZ A;  3ZHH A;  4UHU A;  1MKI A;  4IBX A;  4B4X A;  2B5R A;  4GN2 A;  4Y0T A;  3ZG9 B;  4JF6 A;  3HUM A;  2ZM0 A;  1O07 A;  1JWP A;  1HD8 A;  4KZ4 A;  1U60 A;  1DY6 A;  1RGY A;  1KE4 A;  3PBR A;  4R3J A;  3DW0 A;  4DDY A;  4PM6 A;  4C6Y A;  3Q7V A;  3CMZ A;  3PTE A;  2C5W B;  5GLC A;  5EOO A;  2CC1 A;  5I94 A;  4IVK A;  1RCJ A;  4P85 A;  1JTG A;  1KVM A;  4E3O A;  3QNB A;  1YMX A;  5M18 A;  3UNW A;  3UY6 A;  1E25 A;  2Y2N A;  3ZG8 B;  2Y4A A;  2ZQA A;  4P0M A;  1IYS A;  3ZFZ A;  4BD1 A;  2XDM A;  2Y2J A;  3GTC A;  4GD6 A;  3WS5 A;  5F1F A;  5GL9 A;  3IHB A;  1ERQ A;  1XGI A;  2J9O A;  4KZ7 A;  5M19 A;  3I7J A;  1W8Y A;  4BJP A;  1JWZ A;  2WKE A;  4EQI A;  3V3R A;  3ZVW A;  2XK1 A;  4OH0 A;  1IKG A;  4OPY A;  4QY6 A;  1WE4 A;  2XFT A;  3WWX A;  2ZMA A;  3UE0 A;  1YMS A;  5FDH A;  5E2H A;  1PI4 A;  4BD0 A;  3GSG A;  1MY8 A;  4O7D A;  2ZC6 B;  3VFH A;  1KDW A;  5DVA A;  4BL3 A;  4JXG A;  1XA7 A;  1ZKJ A;  3M2J A;  3MFD A;  1N4O A;  3QNC A;  4S2N A;  3ZNY A;  3G30 A;  1SCW A;  2EX9 A;  1FOF A;  1JWV A;  4E3J A;  5GLD A;  2VGK A;  5AQB A;  3P98 A;  1YLP A;  3JYI A;  2OV5 A;  2Y2P A;  5DTS A;  3PAG A;  1BTL A;  3FYZ A;  1BLC A;  1K56 A;  2J8Y A;  2ZC5 B;  3G35 A;  3G32 A;  2P9V A;  3HLC A;  4FH2 A;  4K0X A;  5A91 A;  4C3Q A;  1ZC2 A;  3GQZ A;  3IF6 A;  4IBR A;  1FR6 A;  2GDN A;  1Z6F A;  3MZF A;  1JTD A;  3VSK A;  1CI8 A;  3PBN A;  4OOL A;  3FWL A;  4KZ3 A;  2OLV A;  4WEK A;  1TDG A;  5HX9 A;  3DTM A;  4XUX A;  3PBS A;  2WZZ A;  1ES5 A;  1K56 D;  5EVL A;  3UPO A;  5EUA A;  2Y91 A;  4FD8 A;  3IWI A;  1MWS A;  1KGE A;  1W5D A;  4OKP A;  3ZGA B;  3M2K A;  4LEN A;  1S0W A;  3M6B A;  4GDB A;  2QMI A;  4RYE A;  2I72 A;  1NYM A;  2HDR A;  5FAP A;  3VFF A;  4KZ8 A;  4JXW A;  3WRT A;  2J9P A;  3PAE A;  4IED A;  5KMW A;  1GA9 A;  5KSC A;  5EEC A;  5FA7 A;  4Q8I A;  3ZNT A;  4MBK A;  3NC8 A;  1L0D A;  4X56 A;  5GHZ A;  2IWB A;  4N1H A;  3ZG0 A;  1PYY A;  3HLD A;  1OME A;  1H8Y A;  3S4X A;  3TOI A;  4MBH A;  4LV2 A;  4N92 A;  3WS4 A;  3AGE A;  5EOE A;  4DE2 A;  1ZG6 A;  1FR1 A;  3LEZ A;  2PU2 A;  2Q9N A;  4LCM A;  5F82 A;  3UDF A;  2EFU A;  5CEC A;  1L0G A;  2DNS A;  2XFS A;  4KZ5 A;  4N9L A;  2JBF A;  5HAQ A;  3C4O A;  1ES4 A;  1GA0 A;  1XXM A;  3HLB A;  5EVI B;  4RA7 A;  2WAE A;  1J9M A;  2Y2K A;  4DXC A;  2ZJ9 A;  4R23 A;  3HLG A;  2WAD A;  4KZA A;  1RGZ A;  3IH9 A;  4KG5 A;  3HUO A;  5EVI C;  3BFE A;  2PU4 A;  1K57 A;  2WGI A;  1LI0 A;  3BEB A;  3CG5 A;  4IVI A;  4MLL A;  3MKE A;  3PBQ A;  4QU3 A;  5CRF A;  4E3N A;  5FAS A;  2WK0 A;  2OSU A;  2XQZ A;  1IEL A;  4OQH A;  5FI6 A;  1LI9 A;  4N1X A;  1VQQ A;  4M3K A;  3BFF A;  4GKU A;  5FAT A;  5CED A;  4JLF A;  1YLZ A;  2Y59 A;  1ONH A;  3G4P A;  5KZH A;  2ZD8 A;  3HL9 A;  3NIA A;  4OLG A;  4ZDX A;  4S2K A;  4OOM A;  2EX6 A;  5KSH A;  3BFG A;  1K55 A;  3V3S A;  4H8R A;  1CK3 A;  1FSW A;  4KQQ A;  2A49 A;  2Y2M A;  1MXO A;  3NBL A;  1YLW A;  4WBG A;  1HTZ A;  2V2F F;  2BG1 A;  2ZC4 B;  2X01 A;  4RX2 A;  3ZG7 B;  2Z2L B;  4FSF A;  1C3B A;  1L2S A;  5CGW A;  3N8L A;  4KG2 A;  4R1G A;  4KQO A;  3E2K A;  4LV3 A;  2WGW B;  2H5S A;  2WZX A;  3SOI A;  1XKZ A;  4BEN A;  3GVB A;  2EXA A;  4U0X A;  2JCH A;  3Q07 A;  4GNU A;  3ZG5 A;  5HW3 A;  1S6R A;  3C7U A;  4OP5 A;  3OZH A;  1I5Q A;  1N9B A;  1ESU A;  1PWC A;  1O7E A;  3W4P A;  3WS2 A;  1NXY A;  3HUN A;  1PI5 A;  4JXV A;  5L2F A;  2HP6 A;  3M6H A;  1Q2P A;  2HP5 A;  1MBL A;  4UA9 A;  1K6R A;  1ES2 A;  3ITA A;  1K4E A;  1TEM A;  3HVF A;  1I2S A;  1M6K A;  4R4R A;  3V39 A;  4GDN A;  3FKV A;  2ZC3 B;  5F1G A;  1L0E A;  3D4F A;  1XP4 A;  3BM6 A;  5CER A;  3BFD A;  4DKI A;  5DTK A;  3A3J A;  5HL1 A;  1HVB A;  4OOY A;  5F83 A;  3SS3 A;  2V1Z A;  3QHY A;  1GHM A;  1KGF A;  4R0Q A;  4S2L A;  5E2E A;  4EWF A;  1YQS A;  1K6S A;  2VGJ A;  3IT9 A;  5D3O A;  1IYP A;  3V50 A;  4BL2 A;  2BLS A;  4YIN A;  1K25 A;  3A3I A;  4GZB A;  5HAP A;  4OPZ A;  4MEZ A;  1SKF A;  1CI9 A;  1NRF A;  1K54 C;  1QME A;  4OQG A;  2XH9 A;  4S2O A;  1KDS A;  4HBT A;  2XD1 A;  3VSL A;  4S2I A;  5CEB A;  1I2W A;  3G31 A;  2XGN A;  4GB7 A;  2ZLY A;  3P09 A;  4EBN A;  5DF7 A;  4X6T A;  3LCE A;  5EPH A;  3S1Y A;  3SH9 A;  4BLM A;  3CZD A;  2J7V A;  2RL3 A;  2EX8 A;  4QB8 A;  5FQK A;  4LV0 A;  1BSG A;  4R4S A;  4WZ5 C;  2ZQ7 A;  2HP9 A;  3Q82 A;  3O87 A;  3VP2 A;  2WGW A;  1BLP A;  3Q1F A;  5HAR A;  3NY4 A;  1MPL A;  1PW8 A;  2QPN A;  3EQU A;  3W4Q A;  3A3E A;  4QHC A;  4L0L A;  3RJU A;  2G2W A;  3AGD A;  3IXG A;  4E3I A;  5J8X A;  2WKH A;  4JF5 A;  1GHI A;  5FSR A;  3Q7Z A;  4JPM A;  3G2Z A;  4OP8 A;  4DE1 A;  3IXH A;  1G6A A;  5M1A A;  4EV4 A;  1PWD A;  4XXR A;  2C6W B;  5FQQ A;  4MNR A;  4QJG A;  4Y0O A;  4ZJ2 A;  2ZQD A;  1YM1 A;  3A3F A;  2FFF B;  2Y2H A;  2XEP A;  4N9K A;  2H0T A;  4KEN B;  1BUE A;  3O88 A;  4DDS A;  2XD5 A;  4RVA A;  1XX2 A;  4PM9 A;  4DE0 A;  2ZQC A;  5CHM A;  4XUZ A;  4MBF A;  1EWZ A;  1XGJ A;  5AQA A;  3FV7 A;  1GCE A;  1NYY A;  4DE3 A;  4ZBE A;  3VP4 A;  4LV1 A;  1W8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...