3SOIA

Crystallographic structure of bacillus licheniformis beta-lactamase w210f/w229f/w251f at 1.73 angstrom resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDFMKRNTTGDALIRAGVPDGFEVADKTGAASYGTRNDIAIIFPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title X-ray evidence of a native state with increased compactness populated by tryptophan-less B. licheniformis beta-lactamase.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 90
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3soiA00
3HUNA 1SKFA 1YMSA 4DDSA 1H5XA 2JC7A 3FKVA 3W4PA 3MFDA 4KZ7A 4LCMA 5DTSA 2G2WA 3VFHA 4FCFA 3ZG0A 3CJMA 3M6HA 1S6RA 2X02A 5D3OA 2PU4A 1KGEA 5FI7A 5JYPA 3NDEA 5E43A 1HZOA 3P98A 1RGYA 4HEFA 3UNWA 3ZGAB 2Y91A 1ES4A 4S2NA 2XR0A 1OMEA 3IQAA 3UDFA 3WRTA 2R9WA 5CTNA 4GOGA 3NI9A 2XD5A 4HBUA 4OQIA 3B3XA 4C6YA 4GDNA 2ZMAA 4DE1A 1ZKJA 3NCKA 4PPRA 3HUOA 4WYYA 4S2PA 1LI0A 3MXSA 3TSGA 2BG1A 2DRWA 5AQBA 2HDSA 4R23A 3A3DA 4S2KA 4K0XA 4P87A 1YT4A 1VM1A 2ZQCA 2H10A 3QHYA 5GHXA 4KENB 3HLEA 2IWDA 2XD1A 5FQMA 3IXDA 5FATA 2XEPA 3C4OA 3C7UA 3EQVA 3Q7VA 2XQZA 3V50A 3G34A 3A3JA 5HARA 3ZFZA 1S0WA 3O86A 3ZDJA 3LY4A 1IYOA 4KZ3A 5KSHA 4F94A 3SH7A 4BD0A 3EQUA 3BFEA 5J8XA 3BM6A 4M3KA 4R4SA 1K4FA 1K25A 3OZHA 4EUZA 4DDYA 2WK0A 5M18A 4X6TA 4WBGA 4S2JA 1K4EA 5E2EA 2X01A 1CI8A 4OPZA 5CERA 1Q2QA 5TGFA 4FSFA 5DTTA 4ZJ3A 2PBYA 1TEMA 2QZ6A 4OLGA 3PBTA 1YM1A 1KDWA 2VGJA 2WAFA 2A49A 4KZ9A 5CGSA 2ZC4B 2Z2LB 3VP1A 1MY8A 3A3IA 2RCXA 4HESA 4N1XA 4PM8A 4WMCA 1KE4A 4N9LA 4X69A 1YMXA 3BRMA 5U47A 4B4XA 4OVDA 4OP5A 2QPNA 4WMCD 4PM5A 5A90A 3MZDA 4LENA 3M2KA 1GHPA 1BULA 3N4IA 3C4PA 3UE0A 3G2YA 3CG5A 4JXSA 1L2SA 2ZC5B 2HPBA 3G31A 3NIAA 3GRJA 1BT5A 3WS5A 5FQIA 4E3KA 1K38A 4RA7A 3FKWA 5EOEA 2P9VB 1NJ4A 4WEKA 5EVIB 2I72A 3HLCA 4P0MA 4DF6A 1ONGA 3PBRA 3W8KA 1MPLA 3OPRA 4MBKA 4ZDXA 1DJBA 4RVAA 1E4DA 3UY6A 2ZQDA 2RL3A 1KGFA 4MNRA 1I2WA 3SS4A 3TG9A 1NY0A 5GLBA 3MZEA 3QNCA 2H0TA 4UA6A 4JF4A 2Y59A 4XUZA 3ZG7B 3HLGA 1U60A 4BLMA 3IF6C 3V5MA 4DRTA 1K57C 1C3BA 2J9PA 3UE1A 5HAQA 4P85A 1K54A 4UAAA 2WUQA 2ZLYA 4S2MA 4QU3A 5KMWA 2V2FF 3HLDA 5I94A 4Q8IA 1L0GA 4GZBA 4DKIA 2OSUA 4OP8A 1W7FA 2Q9NA 1NXYA 3OCLA 1HTZA 2XLNA 4FH4A 4RX3A 3SS3A 2P74A 1ZC2A 5FI6A 5FAOA 4IBXA 3VMAA 1Q2PA 3PBQA 4OPYA 5HFOA 4IVKA 3OPHA 4RX2A 1GHIA 2XFSA 4ZTKA 3GMWA 5CECA 4PM7A 4DE2A 3SOIA 1JWVA 1M40A 1FCNA 2ZC6B 3Q82A 4R0QA 3GTCA 4KZ8A 2ZJ9A 3NY4A 2HP5A 3RJUA 4BJPA 2ZC3B 3N8LA 4X55A 2C6WB 1SHVA 1VQQA 1ZG4A 1BLPA 1Z6FA 2Y2PA 1EROA 3MZFA 4N1HA 1BLHA 3A3FA 4N92A 3BFCA 4OOYA 3VOYA 3JYIA 2Y2KA 5FAQA 3UDXA 1E3UA 3BLSA 1XA1A 1FQGA 1XGIA 2B5RA 3CMZA 4GB7A 3ZG5A 4BD1A 3VSLA 1E3UD 5CXWA 5EUAA 5GHZA 4KZBA 2ZQ8A 1TDLA 2EXAA 4OKPA 4WZ5A 2R9XA 4JF6A 3Q81A 3UDIA 2Y2QA 1K6SA 1WYCA 4A5RA 4U3TA 3PTEA 3G30A 1AXBA 3IWQA 3FWLA 5GLCA 4ZJ1A 3FYZA 1KDSA 3Q7ZA 4GDBA 3ZHHA 4EBLA 5KZHA 5FQJA 3ZNYA 2ZQ7A 3WWXA 3A3EA 5HL1A 2OLUA 3G2ZA 4JLFA 3MKFA 4S2OA 1GA9A 3MXRA 1ERMA 4UA9A 5FSRA 4UA7A 4JXVA 1YLTA 1FSWA 4H8RA 5FQKA 3VP3A 5IHVA 4EV4A 3Q7VB 1FSYA 1O07A 3OPPA 3CZDA 5TR7A 1ALQA 5CGXA 4NETA 3UPOA 3DWZA 1KGGA 4KZ6A 4E3JA 1PWDA 1PYYA 4FD8A 1G6AA 4JKTA 5E2FA 3VP4A 1PWCA 3WS4A 3IXHA 4JF5A 4RYEA 1YLWA 5FI2A 3UE3A 3WS0A 5KSCA 4LV3A 1MBLA 3G4PA 3FV7A 4R3JA 5CHMA 4DE0A 3IT9A 1H8ZA 4QD4A 3AGDA 4NK3A 2JCHA 2WZXA 2WZZA 5FASA 3ZVWA 1LHYA 4LV2A 2Y2LA 4Z9QA 3TOIA 4CPKA 4QJGA 1JTDA 4EBNA 3WRZA 4KG2A 1G68A 2H0YA 4B4ZA 4GNUA 3N6IA 4OQ0A 1I2SA 4N9KA 4P6BA 4JXWA 3QNBA 4OOMA 3NC8A 4GKUA 4U0TA 4K91A 3IWOA 3IHAA 5F83A 1XA7A 2QMIA 2ZM2A 3HLBA 4QB8A 1W79A 2HP9A 1MKIA 5JYOA 1L0DA 3VP2A 1FCMA 3WS2A 4IEDA 2Y2JA 2VGKA 5EPHA 1JVJA 1W8YA 1WE4A 4L0LA 1K55C 4XXRA 5EVIC 4ZJ2A 1HD8A 2Y2GA 1I5QA 1XXMA 4EQIA 2J7VA 1K6RA 2EX6A 3BFFA 3M6BA 5DF8A 5L2FA 4JPMA 4E3IA 4MBHA 2G2UA 3IH8A 5GL9A 1PW1A 3D4FA 5EECA 4KZ4A 1W8QA 3IWIA 4D2OA 4BL2A 5FA7A 3OC2A 1FCOA 4BL3A 5EVIA 1PIOA 3IH9A 3ITAA 4OLDA 4XUXA 3VP0A 3AGFA 3PBNA 1H8YA 1M6KA 3VSKA 1HVBA 5F1FA 3BFDA 3LEZA 2FFYA 1LL5A 4DXBA 3C7VA 2WGWA 3V39A 1ES2A 2WYXA 4X68A 3ZNTA 4FH2A 5AQ7A 4BQMA 3N8RA 3GVBA 4X56A 3ITBA 4QY5A 3VFFA 1KE0A 4OONA 1O7EA 1ES3A 4KQQA 1MWSA 3S4XA 3IF6A 3BYDA 5GHYA 3G32A 1K57A 4O7DA 4JBFA 3ZG9B 2DCFA 1FR1A 1IKGA 1RP5A 3MKEA 4Y0TA 1KVLA 1IYPA 3BECA 3MBZA 2EX8A 1L0FA 1RCJA 1TDGA 4KQRA 2H5SA 4MLLA 2J9OA 1NZOA 2C5WB 2Y2OA 3ZG8B 1DJAA 3HL9A 3RXWA 1L0EA 1XP4A 2XDMA 1PI4A 4KQOA 1NRFA 5F82A 1XKZA 5GLAA 1N4OA 4WZ4A 3M2JA 2EX9A 1XPBA 3SS5A 5DVAA 1E25A 1DY6A 2Y55A 1BLCA 3HVFA 4U0XA 3UO9A 5FQ9A 2BLSA 1BZAA 2WGVA 4IVIA 4ZBEA 5BOHA 1ERQA 4KG5A 1CK3A 1PI5A 4C3QA 5DF7A 3HLWA 3N8SA 3I7JA 5FAPA 5M1AA 1JTGA 1PZOA 2XGNA 3NBLA 5CGWA 5FQQA 5CRFA 2JBFA 1LL9A 2EFUA 4R3BA 4Y0UA 1MWRA 2Y2MA 3SH9A 5HAPA 3C5AA 1QMFA 2ZQAA 5DF9A 1YLZA 4X53A 2E8IA 1NYMA 3P09A 1CEGA 2J8YA 3BLMA 2WAEA 1IEMA 1ESUA 3LCEA 1ZG6A 5FDHA 2WGIA 2Q9MA 2OV5A 2ZM8A 3FZCA 2WKIA 5F1GA 2UWXA 1PWGA 1NZUA 2Y2IA 4E6XA 3AGEA 4ZAMA 1FOFA 3RXXA 1W5DA 5A93A 1GA0A 3ZCZA 5CHJA 4PM9A 2HDRA 2XH9A 3O87A 1KE3A 1IYQA 1QMEA 1IKIA 3OCNA 4GD8A 4DE3A 4OQHA 3HUMA 5CEBA 4S2IA 4OPQA 3IHBA 1BLSA 2EX2A 4OH0A 2GDNA 4Y7PA 1CI9A 5AQ9A 1JWPA 1FR6A 4E3OA 3IXBA 1YLYA 1Y54A 4YFMA 1BUEA 3V3SA 1SCWA 3IF5A 3GR2A 3LO7A 1ESIA 2V20A 4MBFA 4OQGA 5CTMA 2ZQ9A 3IXGA 5CEDA 3OPLA 1XGJA 3DTMA 2HDQA 2Y2NA 5EVLA 4E3LA 3DWKA 4KZ5A 4WELA 4ID4A 5HAIA 3Q07A 4OPRA 5EE8A 4DXCA 2X71A 1LI9A 5TFQA 1BSGA 3ZVTA 3W4OA 1MXOA 5HX9A 4E3MA 4HBTA 3LY3A 3WS1A 4B88A 1BTLA 2Z2MB 4QHCA 5E2HA 1IYSA 3V3RA 4QY6A 4WM9A 1MWUA 2EFXA 3G35A 4LV0A 3PBSA 3GQZA 3S22A 3E2KA 3S1YA 5E2GA 2XF3A 3GV9A 4JXGA 4WEJA 5A91A 4EBPA 3SH8A 4MEZA 3E2LA 3O3VA 4R4RA 3VOZA 1SDEA 4LCLA 4CJNA 5AQAA 1IELA 4E3NA 4GD6A 2WKEA 2OLVA 1N9BA 5DTKA 3UPPA 1K55A 1ES5A 2P9VA 5A92A 1EI5A 1YQSA 2EXBA 1K54C 1PW8A 5EVID 1GHMA 3N7WA 1MWTA 1DJCA 4IBRA 4UHUA 1ONHA 4PM6A 2WGWB 1YLJA 5M19A 1GCEA 5GLDA 3BEBA 1LLBA 2CC1A 1TVFA 5HW3A 3PBOA 2JE5A 3IF6B 1NYYA 4YINA 4K0WA 2IWBA 1EWZA 3W4QA 4LV1A 2PU2A 1XX2A 2ZC7A 3Q1FA 2V1ZA 3UPNA 3PAGA 4Y0OA 1SDNA 4EWFA 3HLFA 4BENA 2XK1A 1J9MA 2Y2HA 1KVMA 5EOOA 1PZPA 4S2LA 3DW0A 2DNSA 2FFFB 2A3UA 2WKHA 2Y4AA 3O88A 5CHUA 5G18A 4C75A 1K56A 4PMAA 3PAEA 4KZAA 1RGZA 4R1GA 2HDUA 1WYBA 1K56D 1JWZA 3GSGA 3NDGA 2XFTA 2ZM0A 4KG6A 3BFGA 1CEFA 3HREA 4S2NC 2IWCA 4GN2A 4OOLA 3UN7A 4E6WA 2HP6A 3HBRA 4WZ5C 2WADA 1YLPA 3ISGA 2ZD8A
chains in the Genus database with same CATH superfamily
4DDSA 3EEAA 3MFDA 4KZ7A 4WL9A 4Q0HA 4FCFA 3ZG0A 3CJMA 2AVXA 5G4YA 1S6RA 2X02A 5FL3A 3P98A 5DKLA 2EA9A 3WRTA 3B47A 3NI9A 1YPRA 4OQIA 4GDNA 2ZMAA 3L9KA 3TSGA 4IHQA 2PRFA 1VM1A 3IBJA 3H82B 5GHXA 5FQMA 5FATA 2XEPA 3EQVA 4F3LA 3Q7VA 1S0WA 3O86A 5KSHA 2W3DA 3UB5P 3BFEA 2JKTI 4R4SA 2O0YA 1K4EA 4OPZA 3O5YA 3NHQA 5DTTA 2QZ6A 1KDWA 2M7UA 3LUQA 3VP1A 2Z2LB 2ZMFA 3ZYTA 3T12B 5AJGA 4B4XA 4HJ4A 1GHPA 3P01A 2ZMVA 3D72A 4L9EA 3G31A 4E3KA 1K38A 4WEKA 1TS7A 1GSWA 3HLCA 1ONGA 3W8KA 3LYXA 3OPRA 3TJZC 1KGFA 2VGLS 3T1QB 3KSFA 1NY0A 3QNCA 4P85A 2VEAA 4UAAA 5HWTA 4QU3A 4NKPA 1OJGA 1NXYA 3OCLA 4CLCE 2P74A 4HNBA 5FAOA 4IBXA 3PBQA 3MSHA 4I3JA 5CECA 4PM7A 1OJ5A 3DTEA 3DTIA 4BJPA 1ZG4A 1EROA 1G28A 3BFCA 5DJTA 3BLSA 3ZG5A 1E3UD 3UB9A 2R9XA 3Q81A 4ZJ1A 1KDSA 5FQJA 3WWXA 3G2ZA 4MN6A 5FSRA 1FSWA 4H8RA 3EGXC 3OLOA 3VP3A 5AVFA 1O07A 1ALQA 5CGXA 3PYPA 3UPOA 2O9BA 1PWDA 5E2FA 2XSSA 2JKFA 1T19A 1YSPA 4JF5A 4RYEA 4BWIA 3UE3A 5CHMA 4DE0A 3TRCA 4QD4A 3TW8A 1DP8A 5FASA 2Y2LA 2W3FA 4EBNA 4KG2A 4MDZA 1I2SA 5DFXA 4P6BA 4U0TA 2PBDP 4KUOA 4OOMA 2J3TC 5F83A 4GHIA 1XA7A 4QB8A 1W79A 1FCMA 2OWHA 4Y15A 2JHEA 1WE4A 1W8YA 3CITA 4Z1WA 1K55C 4LLOB 4ZJ2A 4EQIA 2PR5A 4ETZA 4E3IA 5CX7A 1DP9A 1W8QA 4EETB 1XJ4A 5HD5A 1PIOA 1H8YA 1M6KA 3VSKA 2V8FA 3LEZA 3C7VA 2WGWA 3UE6A 3V39A 1ES2A 2WYXA 3ZNTA 2PDRA 4Y13A 3LR5A 4QY5A 3VFFA 1A0KA 3FPVA 1ES3A 1MWSA 3G32A 2J80A 2JKGA 4JBFA 1IKGA 5C5KA 3MKEA 4Y0TA 2EX8A 1TDGA 3MQOA 1MC0A 1NZOA 3ZG8B 2QYBA 1L0EA 1N4OA 4DJ3A 1XPBA 2Y55A 3UO9A 2BLSA 1STZA 2XRNA 1T1AA 3W2ZA 4ME4A 5FQQA 2EFUA 3SH9A 4G3VA 3C5AA 1QMFA 3H7WA 2A24B 4G3KA 4EUVA 1P9RA 4DN0A 2OV5A 1MKMA 1OT9A 2H28A 1KE3A 3BQ8A 1L3LA 4OQHA 1F2KA 1DRMA 3V3SA 3IF5A 3WS5A 2W1RA 2ZQ9A 5EVLA 3DWKA 1VEUA 2OOLA 4L9GA 2Q0OA 1TS6A 3W4OA 3ZVTA 3LY3A 5J7EA 3V3RA 5E2HA 3S22A 1T1BA 3E2KA 4EBPA 3CUEC 4MEZA 3O3VA 5F6AA 3NOPC 1H0MA 5HDCA 4GD6A 2WKEA 2OLVA 1N9BA 1S66L 1EI5A 1BYWA 1D1JA 2EWVA 2B95A 1GHMA 4UHUA 1WA9A 4HOIA 3EWKA 1H8MA 5M19A 4Y17A 5TBMB 3BEBA 5HWWA 1TVFA 3IF6B 1NYYA 1EWZA 3BWLA 4FTXA 3Q1FA 4Y2FA 3F1OB 3UPNA 3PAGA 4YWZA 1SDNA 2Y2HA 1J9MA 3T1RA 5F5YA 3DW0A 2DNSA 1CQAA 3SW1A 4CLCC 4EW7A 1S67L 1JWZA 3UMDA 2ZM0A 4KG6A 5HDSA 2V9AA 4OOLA 3HBRA 4WZ5C 5HD3A 3ISGA 2ZD8A 3BY8A 4YNRA 4LCMA 5DTSA 4CLCA 5EFWA 2PU4A 1KGEA 2FH5A 1VETA 4HHDA 4P6ZM 4HEFA 4B93A 2Y91A 1ES4A 3IQAA 3UDFA 2R9WA 5CTNA 2XD5A 4BBTA 3B3XA 4C6YA 2JN7A 3CPTA 2BTFP 3HUOA 3T4OA 1LI0A 3MXSA 3LR3A 4H6JB 2BG1A 2JKRM 5AQBA 4R23A 4P87A 2ZQCA 3U4LP 3HLEA 1W63M 3IXDA 1XJ3A 3C4OA 2Z6DA 3VE3A 1GSXA 3R7WB 3A3JA 3ZDJA 2PHYA 4G3WA 4KZ3A 5HDDA 2O9AA 4FOFA 3EQUA 1K4FA 3OZHA 3JVVA 3PR6A 4WBGA 5FDSA 1CI8A 4KQDA 4FSFA 1TEMA 1LSWA 2QKPA 1YM1A 2WAFA 3P7NA 2RCXA 4HESA 4WMCA 4IUHA 1KE4A 5U47A 1YMXA 3BRMA 4OVDA 4LENA 1BULA 3G2YA 3CG5A 1L2SA 2HPBA 3CLOA 3NIAA 1LSVA 3MFXA 4RA7A 2Z6CA 1NJ4A 3NECA 4MBKA 1E4DA 3UY6A 5HZHA 3MZEA 3ZG7B 2H0TA 4HI4A 4Y3IA 1U60A 4GJ4A 1K57C 1C3BA 1F5MA 3G6OA 2HJ9C 4S2MA 3HLDA 5I94A 4GZBA 1D7EA 4FH4A 2V1BA 3MR0A 1UWPX 3VOLA 1ZTUA 2B18A 1Q2PA 4RX2A 2I9VA 4ZTKA 2VK3A 4DE2A 3SOIA 1JWVA 1M40A 1FCNA 4I3IA 2ZJ9A 4HP9A 1SHVA 5DJUA 1BLPA 1Z6FA 1BLHA 1H3QA 4ARZA 3ULFA 3VOYA 3JYIA 3LGOA 5FAQA 3CMZA 1FQGA 3VSLA 5GHZA 4KZBA 2YKHA 4JF6A 3S7PA 1K6SA 2WKPA 3IWQA 5GLCA 4O01A 5KZHA 2JKTM 5HL1A 3MKFA 5IU1A 3S7QA 4KUKA 1YLTA 4YOFA 3T4KA 4EV4A 4F3LB 3Q7VB 2K7SA 4NETA 3T4LA 4O8GA 3VP4A 3WS4A 4JKTA 1J3WA 4I38A 3E4QA 1MZUA 1MBLA 3G4PA 5FEGA 1H8ZA 4MN5A 4NK3A 2WZZA 1LHYA 2GNXA 1XJ2A 1FIKA 4LV2A 3TOIA 1JTDA 1G68A 4GNUA 3N6IA 1V9ZA 1VB6A 4N9KA 4JXWA 3NC8A 3IHAA 4BBVA 2HP9A 3MQ0A 1JVJA 4XXRA 2VKSA 1I5QA 3UB7A 2J7VA 2EX6A 3BFFA 3S7OA 3QP4A 4JPMA 3B33A 5GL9A 3CI6A 4WLAA 1PW1A 5HL6A 2J3TD 5EECA 4KZ4A 3IWIA 2VGLM 5TJJA 4BL2A 5FA7A 4M4XA 5F1FA 3KYZA 1LL5A 2VV6A 1PRQA 2WKRA 4FH2A 4BQMA 1KE0A 4KQQA 3S4XA 4O7DA 2GX5A 3ICYA 1OTDA 1KVLA 1IYPA 3BECA 3FG8A 3MBZA 1OTIA 4UQIM 4MLLA 2C5WB 1VHMA 2PYPA 2XA7M 1XP4A 2MJ6A 1N9OA 2L0WA 4KQOA 1NRFA 2W1TA 4PKYA 5GLAA 4R6LA 4WZ4A 2EX9A 4EXOA 3SS5A 2L1MA 1BLCA 5FQ9A 1CK3A 1PI5A 2HV1A 4C3QA 3HLWA 3HCYA 5CGWA 4HJ6A 4R3BA 3D9YA 4X53A 3P09A 2J8YA 3BLMA 2DMWA 1ZG6A 3FZCA 3RFBA 4JGRA 5F1GA 2UWXA 1LT0A 4E6XA 3AGEA 1FOFA 3KX0X 5F68A 5CHJA 2HDRA 2XH9A 3T4TA 2ACGA 3T50A 4GD8A 4DE3A 4S2IA 3A0RA 3IHBA 1BLSA 2EX2A 4OH0A 4QPRA 2GDNA 3IX3A 4UEYA 5AQ9A 1JWPA 4E3OA 5A8BA 3IXBA 2LB9A 1YLYA 2OAQ1 4QJGA 3LIFA 2V20A 5CTMA 4OQGA 5KIZA 1XGJA 3DTMA 4GHIB 3K2NA 5EE8A 4DXCA 1BSGA 1YAXA 4B88A 2Z2MB 1IYSA 4QY6A 2HJEA 1MWUA 3GQZA 3QP2A 3S1YA 2XF3A 3E98A 3GV9A 5A91A 3DAVA 4R4RA 3VOZA 2KDKA 3MMHA 3IX4A 3UPPA 5DTKA 5A92A 1K55A 2P9VA 2EXBA 1K54C 1PW8A 5EVID 3FPWA 2BASA 1NLYA 4PM6A 5HSQA 2WGWB 1YLJA 3LFVA 1NWZA 1GCEA 1N9LA 1LLBA 2CC1A 1UGUA 2JE5A 3LI8A 4YINA 4GS9A 3W4QA 4D60A 4LV1A 2PU2A 1XX2A 2ZC7A 2V1ZA 3HLFA 4BENA 4RQ9A 1KVMA 4S2LA 2FFFB 2A3UA 1EW0A 1OTAA 2K31A 2V1AA 3F1PB 4R1GA 3LICA 3HREA 4E6WA 3E0YA 1YLPA 3HUNA 1H5XA 3FKVA 1S1ZA 3VFHA 5FI7A 5E43A 4CLCD 3KO6A 3UNWA 3FC7A 1OMEA 3K3DA 3H7WB 3KSHA 4WF0A 3KYEA 2Y79A 2KOIA 3EGDC 3NCKA 4PPRA 4WYYA 4S2PA 2DRWA 3A3DA 4S2KA 1PNEA 4R70A 3QHYA 4KENB 2XD1A 1V9YA 4EEPA 3C7UA 2QWSA 1OTEA 3V50A 3CAXA 3LY4A 4F94A 3SH7A 5J4EA 5J8XA 3BM6A 1K25A 4DDYA 2WK0A 4S2JA 5E2EA 2X01A 3H9WA 5CERA 1Q2QA 4ZJ3A 3T1SA 3VV4A 1DP6A 1VEUB 3PBTA 5CGSA 4NEED 3QP8A 4PM8A 4N1XA 4PM5A 2QPNA 2ZL1A 4WMCD 1P97A 3MZDA 5A90A 3N4IA 3C4PA 4JXSA 2ZC5B 3GRJA 5FQIA 4R3AA 2LB5A 1LSXA 5EOEA 5EVIB 5EM1A 2OAP1 2VLGA 1OPXA 5F69A 3PBRA 3KYQA 3T4JA 1MPLA 2ZQDA 4MNRA 3RTYA 2B02A 1I2WA 3CUEA 4JGQA 4UA6A 4JF4A 4BLMA 2V0UA 3IF6C 3V5MA 3UE1A 2HGVA 2ZLYA 3F1NA 4Q8IA 1L0GA 4DKIA 2OSUA 2Q9NA 1HTZA 4RX3A 4AFIA 3VMAA 5HFOA 4LRZE 3JPUA 2ZC6B 3Q82A 4R0QA 3QP5A 4KZ8A 2HP5A 4EQ1A 3RJUA 1ZHHB 4CQHA 2ZC3B 3N8LA 4X55A 1VQQA 3MZFA 1N9NA 4N1HA 4CLCB 4N92A 4OOYA 3HJIA 3UDXA 1VETB 1IOUA 2B5RA 4BD1A 5CXWA 5EUAA 2ZQ8A 4WUJA 1UWNX 2EXAA 4OKPA 4WZ5A 3LR0A 4EERA 4A5RA 4U3TA 3PTEA 3CPTB 3G30A 1SZVA 4P6ZS 2NUPC 4EBLA 5K5BA 3ZNYA 2OLUA 5EM0A 2A2LA 3MXRA 4UA9A 4K08A 3JVUA 2PD7A 5FQKA 1FSYA 4HQAA 2PD8A 4R38A 4Y5FA 4KZ6A 4H6JA 4FD8A 3IS2A 2K2NA 4MCWA 1YLWA 5KSCA 4LV3A 3FV7A 4R3JA 2L4RA 5IS1A 3IT9A 5EV0A 3AGDA 3E4OA 2JCHA 2WZXA 3ZVWA 2P08A 4Z9QA 4CPKA 2OWJA 2H0YA 4B4ZA 2XROA 3QNBA 1OT6A 3CWFA 3IWOA 2G7UA 2QMIA 5JYOA 1L0DA 4HP4A 2Y2JA 1Y4OA 1SKOB 3E4PA 1OTBA 4O0PA 3M6BA 1K6RA 3MXQA 5L2FA 2GZAA 2G2UA 4I39A 3D4FA 3IH9A 3ITAA 4OLDA 3LIDA 3AGFA 2W27A 3D3OA 4XT2A 4DMZA 5J3WA 4X68A 5AQ7A 3N8RA 2GJ3A 3ITBA 3HJKA 4OONA 4ETXA 3BYDA 4WN5A 1K57A 5DKKA 3ZG9B 1FR1A 1RCJA 4GW9A 2PAVP 4BBUA 2Y2OA 4ARZB 1YKDA 2XDMA 1PI4A 3M2JA 3OOVA 1E25A 4U0XA 4Q0JA 1BZAA 2WGVA 4ZBEA 5BOHA 3N8SA 1FILA 3I7JA 5M1AA 1JTGA 1MWRA 5HAPA 4ESPA 2QHKA 3RH8B 1NYMA 4I3AA 2WAEA 1IEMA 1ESUA 3LCEA 5FDHA 2Q9MA 4QWOA 2WKIA 2HF6A 1S4RA 3H82A 4ZAMA 3RXXA 1W5DA 5A93A 1GA0A 3L7HA 3ZCZA 3O87A 4FUWA 1IYQA 1QMEA 3OCNA 4EESA 4X25A 5CEBA 4OPQA 2R78A 1CI9A 1FR6A 1Y54A 1BUEA 4MBFA 1SCWA 4E3NA 3IXGA 4PKYG 4KZ5A 4ID4A 5HAIA 2X71A 4E3MA 5HX9A 3SZTA 4EU0A 3NOUC 1BTLA 4QHCA 1NRJA 4WM9A 3UMEA 2EFXA 3G35A 4LV0A 2W3HA 3LIAA 4JXGA 1F9IA 4WEJA 3SH8A 3LIEA 3E2LA 2VV7A 2PR6A 1IELA 4NXFA 1ES5A 2W3EA 3UB8A 5AVEA 5EVEA 4LPZA 3BJNA 2D02A 4L9FA 3PBOA 4K0WA 3BY9A 5L09A 4Y0OA 4EWFA 5EOOA 3TE8A 2KX6A 3DTKA 5G18A 1K56A 3PAEA 1RGZA 2HDUA 1WYBA 2ZBBA 4HY8A 3C30A 3BFGA 1KOUA 2W1TB 4S2NC 2IWCA 1K0KA 4GN2A 4UQIS 4LGWA 2XA7S 1SKFA 1YMSA 4X1LA 2JC7A 1YSQA 3W4PA 1Z09A 2G2WA 5IT5A 3BQAA 3M6HA 5D3OA 5JYPA 3NDEA 1HZOA 1RGYA 4ZRRA 3ZGAB 4S2NA 1S4SA 2XR0A 3A0SA 3QP1A 4GOGA 3CHWP 4HBUA 5L10A 4DE1A 1ZKJA 4HJ3A 2J3WA 2HDSA 4K0XA 1YT4A 1D06A 2H10A 4PAUA 2IWDA 2XQZA 3G34A 3ZFZA 5HARA 1IYOA 1XFQA 3KSGA 4BD0A 4LRYC 4M3KA 2W3GA 4EUZA 5M18A 5I5LA 4X6TA 4Q0IA 3KSIA 5TGFA 2PBYA 2VV8A 3PXPA 4OLGA 2O99A 2VGJA 2A49A 4KZ9A 2ZC4B 1MY8A 3A3IA 5MC7A 4N9LA 4X69A 3VE4A 4OP5A 3M2KA 3MS6A 3UE0A 2VX8A 1BT5A 3MQQA 3FKWA 4HH3A 2P9VB 1CJFA 5HPIA 2I72A 4EEUA 4P0MA 3U2AA 4DF6A 4ZDXA 1DJBA 2VA0A 4RVAA 4NXEA 1XJ6A 4JGOA 2RL3A 3SS4A 3TG9A 2PT7A 3C38A 3LIBA 5GLBA 2Y59A 4XUZA 3HLGA 1TF1A 3MJQA 4DRTA 4GS9B 2J9PA 5HAQA 1K54A 4HH2A 2WUQA 5KMWA 2V2FF 4OP8A 1W7FA 1ACFA 3NOTC 4II7A 2XLNA 1X0OA 1F98A 3SS3A 1ZC2A 5FI6A 4OPYA 4IVKA 3OPHA 4NXGA 1GHIA 2XFSA 3GMWA 2M7VA 1P0ZA 5LBRA 3GTCA 3BW6A 3NY4A 1T1CA 3GDIA 2C6WB 2UV0E 3GECA 3UB6A 2Y2PA 3A3FA 3F1PA 1Y28A 2Y2KA 1E3UA 1XA1A 1XGIA 3IBRA 4GB7A 1TDLA 3IX8A 4LRXC 3UDIA 2Y2QA 1WYCA 1AXBA 3FWLA 3FYZA 3Q7ZA 4GDBA 3B42A 1XFNA 3ZHHA 2ZQ7A 1GSVA 3A3EA 4JLFA 4S2OA 1GA9A 1ERMA 4UA7A 4JXVA 4I5SA 2A24A 5IHVA 1G6OA 3OBFA 1TD5A 3OPPA 3CZDA 5TR7A 3C2WA 3DWZA 1KGGA 4E3JA 2YKFA 1PYYA 1G6AA 1PWCA 5HWVA 1P9WA 3IXHA 4NG2A 3V67A 2ZOHA 4IUKA 3LR4A 3LI9A 3MF0A 2M1CA 4JGPA 4PHTA 5FI2A 3WS0A 1ODVA 2IA2A 2PYRA 2HZ5A 4NXBA 3WRZA 2CMNA 2KLIA 2E8JA 4OQ0A 3QP6A 1PFLA 2ZL1B 4GKUA 4K91A 4MN7A 2ZM2A 3HLBA 1MKIA 3VP2A 3WS2A 4IEDA 5FEFA 2VGKA 5EPHA 1TS0A 5L8MA 4L0LA 5EVIC 1HD8A 2Y2GA 1XXMA 5DF8A 4MBHA 2EWWA 3IH8A 2INWA 2VZWA 1HLUP 4D2OA 3NULA 3OC2A 2V8CA 1FCOA 4BL3A 5DFYA 5EVIA 1AWIA 4XUXA 3VP0A 3F1NB 3PBNA 1HVBA 3BFDA 2FFYA 4DXBA 3EEHA 4X56A 3GVBA 2ZOIA 5TBMA 5HPFA 5G4ZA 1O7EA 5L07A 3IF6A 3PHYA 5GHYA 2P04A 4DJ2A 2DCFA 1RP5A 3F1OA 4KQRA 1L0FA 4GCZA 2H5SA 2J9OA 1NLZA 1TS8A 3R4KA 1DJAA 3HL9A 3RXWA 5F82A 1XKZA 5DVAA 1DY6A 4MMNA 1IFQA 3HVFA 4IVIA 4E04A 1ERQA 4KG5A 1W63Q 5DF7A 3K3CA 5FAPA 1PZOA 2XGNA 3NBLA 5CRFA 3EOIA 2JBFA 1LL9A 4Y0UA 1G5UA 2Y2MA 3LEQA 2ZQAA 2VJWA 5DF9A 1YLZA 2E8IA 4X1MA 1CEGA 1LL8A 2WGIA 2W0NA 3T1XA 2ZM8A 3IS2B 2NUTC 1PWGA 1NZUA 2P7JA 2Y2IA 3ZQ5A 4IJGA 4PM9A 4BMWA 1IKIA 3R7WA 2QJ7A 3HUMA 4HIAA 4Y7PA 2JKRI 4GLQA 4LFUA 4YFMA 1T18A 3GR2A 1ESIA 3LO7A 5CEDA 3OPLA 2WKQA 2HDQA 2Y2NA 4E3LA 4WELA 3Q07A 4OPRA 1LI9A 5TFQA 1MXOA 4HBTA 3WS1A 1JNUA 3PBSA 5E2GA 3DBAA 1SDEA 4LCLA 4CJNA 5AQAA 3T4SA 1CF0A 1SKOA 3T4QA 1YQSA 2Y8HA 2V0WA 1MWTA 1DJCA 3C8CA 3N7WA 4IBRA 4XT2B 1ONHA 5GLDA 2FZ0A 5HW3A 2IWBA 2XK1A 1PZPA 2Y4AA 2WKHA 3O88A 5CHUA 3A0VA 4C75A 4PMAA 4KZAA 2QJ5A 1K56D 3GSGA 3NDGA 2XFTA 4B9OA 1CEFA 2O9CA 3S7NA 1S1YA 3UN7A 2HP6A 2WADA 2D01A 3NJAA
chains in the Genus database with same CATH topology
3HUNA 1SKFA 1YMSA 4DDSA 1H5XA 2JC7A 3FKVA 3W4PA 3MFDA 4KZ7A 4LCMA 5DTSA 2G2WA 3VFHA 4FCFA 3ZG0A 3CJMA 3M6HA 1S6RA 2X02A 5D3OA 2PU4A 1KGEA 5FI7A 5JYPA 3NDEA 5E43A 1HZOA 3P98A 1RGYA 4HEFA 3UNWA 3ZGAB 2Y91A 1ES4A 4S2NA 2XR0A 1OMEA 3IQAA 3UDFA 3WRTA 2R9WA 5CTNA 4GOGA 3NI9A 2XD5A 4HBUA 4OQIA 3B3XA 4C6YA 4GDNA 2ZMAA 4DE1A 1ZKJA 3NCKA 4PPRA 3HUOA 4WYYA 4S2PA 1LI0A 3MXSA 3TSGA 2BG1A 2DRWA 5AQBA 2HDSA 4R23A 3A3DA 4S2KA 4K0XA 4P87A 1YT4A 1VM1A 2ZQCA 2H10A 3QHYA 5GHXA 4KENB 3HLEA 2IWDA 2XD1A 5FQMA 3IXDA 5FATA 2XEPA 3C4OA 3C7UA 3EQVA 3Q7VA 2XQZA 3V50A 3G34A 3A3JA 5HARA 3ZFZA 1S0WA 3O86A 3ZDJA 3LY4A 1IYOA 4KZ3A 5KSHA 4F94A 3SH7A 4BD0A 3EQUA 3BFEA 5J8XA 3BM6A 4M3KA 4R4SA 1K4FA 1K25A 3OZHA 4EUZA 4DDYA 2WK0A 5M18A 4X6TA 4WBGA 4S2JA 1K4EA 5E2EA 2X01A 1CI8A 4OPZA 5CERA 1Q2QA 5TGFA 4FSFA 5DTTA 4ZJ3A 2PBYA 1TEMA 2QZ6A 4OLGA 3PBTA 1YM1A 1KDWA 2VGJA 2WAFA 2A49A 4KZ9A 5CGSA 2ZC4B 2Z2LB 3VP1A 1MY8A 3A3IA 2RCXA 4HESA 4N1XA 4PM8A 4WMCA 1KE4A 4N9LA 4X69A 1YMXA 3BRMA 5U47A 4B4XA 4OVDA 4OP5A 2QPNA 4WMCD 4PM5A 5A90A 3MZDA 4LENA 3M2KA 1GHPA 1BULA 3N4IA 3C4PA 3UE0A 3G2YA 3CG5A 4JXSA 1L2SA 2ZC5B 2HPBA 3G31A 3NIAA 3GRJA 1BT5A 3WS5A 5FQIA 4E3KA 1K38A 4RA7A 3FKWA 5EOEA 2P9VB 1NJ4A 4WEKA 5EVIB 2I72A 3HLCA 4P0MA 4DF6A 1ONGA 3PBRA 3W8KA 1MPLA 3OPRA 4MBKA 4ZDXA 1DJBA 4RVAA 1E4DA 3UY6A 2ZQDA 2RL3A 1KGFA 4MNRA 1I2WA 3SS4A 3TG9A 1NY0A 5GLBA 3MZEA 3QNCA 2H0TA 4UA6A 4JF4A 2Y59A 4XUZA 3ZG7B 3HLGA 1U60A 4BLMA 3IF6C 3V5MA 4DRTA 1K57C 1C3BA 2J9PA 3UE1A 5HAQA 4P85A 1K54A 4UAAA 2WUQA 2ZLYA 4S2MA 4QU3A 5KMWA 2V2FF 3HLDA 5I94A 4Q8IA 1L0GA 4GZBA 4DKIA 2OSUA 4OP8A 1W7FA 2Q9NA 1NXYA 3OCLA 1HTZA 2XLNA 4FH4A 4RX3A 3SS3A 2P74A 1ZC2A 5FI6A 5FAOA 4IBXA 3VMAA 1Q2PA 3PBQA 4OPYA 5HFOA 4IVKA 3OPHA 4RX2A 1GHIA 2XFSA 4ZTKA 3GMWA 5CECA 4PM7A 4DE2A 3SOIA 1JWVA 1M40A 1FCNA 2ZC6B 3Q82A 4R0QA 3GTCA 4KZ8A 2ZJ9A 3NY4A 2HP5A 3RJUA 4BJPA 2ZC3B 3N8LA 4X55A 2C6WB 1SHVA 1VQQA 1ZG4A 1BLPA 1Z6FA 2Y2PA 1EROA 3MZFA 4N1HA 1BLHA 3A3FA 4N92A 3BFCA 4OOYA 3VOYA 3JYIA 2Y2KA 5FAQA 3UDXA 1E3UA 3BLSA 1XA1A 1FQGA 1XGIA 2B5RA 3CMZA 4GB7A 3ZG5A 4BD1A 3VSLA 1E3UD 5CXWA 5EUAA 5GHZA 4KZBA 2ZQ8A 1TDLA 2EXAA 4OKPA 4WZ5A 2R9XA 4JF6A 3Q81A 3UDIA 2Y2QA 1K6SA 1WYCA 4A5RA 4U3TA 3PTEA 3G30A 1AXBA 3IWQA 3FWLA 5GLCA 4ZJ1A 3FYZA 1KDSA 3Q7ZA 4GDBA 3ZHHA 4EBLA 5KZHA 5FQJA 3ZNYA 2ZQ7A 3WWXA 3A3EA 5HL1A 2OLUA 3G2ZA 4JLFA 3MKFA 4S2OA 1GA9A 3MXRA 1ERMA 4UA9A 5FSRA 4UA7A 4JXVA 1YLTA 1FSWA 4H8RA 5FQKA 3VP3A 5IHVA 4EV4A 3Q7VB 1FSYA 1O07A 3OPPA 3CZDA 5TR7A 1ALQA 5CGXA 4NETA 3UPOA 3DWZA 1KGGA 4KZ6A 4E3JA 1PWDA 1PYYA 4FD8A 1G6AA 4JKTA 5E2FA 3VP4A 1PWCA 3WS4A 3IXHA 4JF5A 4RYEA 1YLWA 5FI2A 3UE3A 3WS0A 5KSCA 4LV3A 1MBLA 3G4PA 3FV7A 4R3JA 5CHMA 4DE0A 3IT9A 1H8ZA 4QD4A 3AGDA 4NK3A 2JCHA 2WZXA 2WZZA 5FASA 3ZVWA 1LHYA 4LV2A 2Y2LA 4Z9QA 3TOIA 4CPKA 4QJGA 1JTDA 4EBNA 3WRZA 4KG2A 1G68A 2H0YA 4B4ZA 4GNUA 3N6IA 4OQ0A 1I2SA 4N9KA 4P6BA 4JXWA 3QNBA 4OOMA 3NC8A 4GKUA 4U0TA 4K91A 3IWOA 3IHAA 5F83A 1XA7A 2QMIA 2ZM2A 3HLBA 4QB8A 1W79A 2HP9A 1MKIA 5JYOA 1L0DA 3VP2A 1FCMA 3WS2A 4IEDA 2Y2JA 2VGKA 5EPHA 1JVJA 1W8YA 1WE4A 4L0LA 1K55C 4XXRA 5EVIC 4ZJ2A 1HD8A 2Y2GA 1I5QA 1XXMA 4EQIA 2J7VA 1K6RA 2EX6A 3BFFA 3M6BA 5DF8A 5L2FA 4JPMA 4E3IA 4MBHA 2G2UA 3IH8A 5GL9A 1PW1A 3D4FA 5EECA 4KZ4A 1W8QA 3IWIA 4D2OA 4BL2A 5FA7A 3OC2A 1FCOA 4BL3A 5EVIA 1PIOA 3IH9A 3ITAA 4OLDA 4XUXA 3VP0A 3AGFA 3PBNA 1H8YA 1M6KA 3VSKA 1HVBA 5F1FA 3BFDA 3LEZA 2FFYA 1LL5A 4DXBA 3C7VA 2WGWA 3V39A 1ES2A 2WYXA 4X68A 3ZNTA 4FH2A 5AQ7A 4BQMA 3N8RA 3GVBA 4X56A 3ITBA 4QY5A 3VFFA 1KE0A 4OONA 1O7EA 1ES3A 4KQQA 1MWSA 3S4XA 3IF6A 3BYDA 5GHYA 3G32A 1K57A 4O7DA 4JBFA 3ZG9B 2DCFA 1FR1A 1IKGA 1RP5A 3MKEA 4Y0TA 1KVLA 1IYPA 3BECA 3MBZA 2EX8A 1L0FA 1RCJA 1TDGA 4KQRA 2H5SA 4MLLA 2J9OA 1NZOA 2C5WB 2Y2OA 3ZG8B 1DJAA 3HL9A 3RXWA 1L0EA 1XP4A 2XDMA 1PI4A 4KQOA 1NRFA 5F82A 1XKZA 5GLAA 1N4OA 4WZ4A 3M2JA 2EX9A 1XPBA 3SS5A 5DVAA 1E25A 1DY6A 2Y55A 1BLCA 3HVFA 4U0XA 3UO9A 5FQ9A 2BLSA 1BZAA 2WGVA 4IVIA 4ZBEA 5BOHA 1ERQA 4KG5A 1CK3A 1PI5A 4C3QA 5DF7A 3HLWA 3N8SA 3I7JA 5FAPA 5M1AA 1JTGA 1PZOA 2XGNA 3NBLA 5CGWA 5FQQA 5CRFA 2JBFA 1LL9A 2EFUA 4R3BA 4Y0UA 1MWRA 2Y2MA 3SH9A 5HAPA 3C5AA 1QMFA 2ZQAA 5DF9A 1YLZA 4X53A 2E8IA 1NYMA 3P09A 1CEGA 2J8YA 3BLMA 2WAEA 1IEMA 1ESUA 3LCEA 1ZG6A 5FDHA 2WGIA 2Q9MA 2OV5A 2ZM8A 3FZCA 2WKIA 5F1GA 2UWXA 1PWGA 1NZUA 2Y2IA 4E6XA 3AGEA 4ZAMA 1FOFA 3RXXA 1W5DA 5A93A 1GA0A 3ZCZA 5CHJA 4PM9A 2HDRA 2XH9A 3O87A 1KE3A 1IYQA 1QMEA 1IKIA 3OCNA 4GD8A 4DE3A 4OQHA 3HUMA 5CEBA 4S2IA 4OPQA 3IHBA 1BLSA 2EX2A 4OH0A 2GDNA 4Y7PA 1CI9A 5AQ9A 1JWPA 1FR6A 4E3OA 3IXBA 1YLYA 1Y54A 4YFMA 1BUEA 3V3SA 1SCWA 3IF5A 3GR2A 3LO7A 1ESIA 2V20A 4MBFA 4OQGA 5CTMA 2ZQ9A 3IXGA 5CEDA 3OPLA 1XGJA 3DTMA 2HDQA 2Y2NA 5EVLA 4E3LA 3DWKA 4KZ5A 4WELA 4ID4A 5HAIA 3Q07A 4OPRA 5EE8A 4DXCA 2X71A 1LI9A 5TFQA 1BSGA 3ZVTA 3W4OA 1MXOA 5HX9A 4E3MA 4HBTA 3LY3A 3WS1A 4B88A 1BTLA 2Z2MB 4QHCA 5E2HA 1IYSA 3V3RA 4QY6A 4WM9A 1MWUA 2EFXA 3G35A 4LV0A 3PBSA 3GQZA 3S22A 3E2KA 3S1YA 5E2GA 2XF3A 3GV9A 4JXGA 4WEJA 5A91A 4EBPA 3SH8A 4MEZA 3E2LA 3O3VA 4R4RA 3VOZA 1SDEA 4LCLA 4CJNA 5AQAA 1IELA 4E3NA 4GD6A 2WKEA 2OLVA 1N9BA 5DTKA 3UPPA 1K55A 1ES5A 2P9VA 5A92A 1EI5A 1YQSA 2EXBA 1K54C 1PW8A 5EVID 1GHMA 3N7WA 1MWTA 1DJCA 4IBRA 4UHUA 1ONHA 4PM6A 2WGWB 1YLJA 5M19A 1GCEA 5GLDA 3BEBA 1LLBA 2CC1A 1TVFA 5HW3A 3PBOA 2JE5A 3IF6B 1NYYA 4YINA 4K0WA 2IWBA 1EWZA 3W4QA 4LV1A 2PU2A 1XX2A 2ZC7A 3Q1FA 2V1ZA 3UPNA 3PAGA 4Y0OA 1SDNA 4EWFA 3HLFA 4BENA 2XK1A 1J9MA 2Y2HA 1KVMA 5EOOA 1PZPA 4S2LA 3DW0A 2DNSA 2FFFB 2A3UA 2WKHA 2Y4AA 3O88A 5CHUA 5G18A 4C75A 1K56A 4PMAA 3PAEA 4KZAA 1RGZA 4R1GA 2HDUA 1WYBA 1K56D 1JWZA 3GSGA 3NDGA 2XFTA 2ZM0A 4KG6A 3BFGA 1CEFA 3HREA 4S2NC 2IWCA 4GN2A 4OOLA 3UN7A 4E6WA 2HP6A 3HBRA 4WZ5C 2WADA 1YLPA 3ISGA 2ZD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUN A;  1SKF A;  1YMS A;  4DDS A;  1H5X A;  2JC7 A;  3FKV A;  3W4P A;  3MFD A;  4KZ7 A;  4LCM A;  5DTS A;  2G2W A;  3VFH A;  4FCF A;  3ZG0 A;  3CJM A;  3M6H A;  1S6R A;  2X02 A;  5D3O A;  2PU4 A;  1KGE A;  5FI7 A;  5JYP A;  3NDE A;  5E43 A;  1HZO A;  3P98 A;  1RGY A;  4HEF A;  3UNW A;  3ZGA B;  2Y91 A;  1ES4 A;  4S2N A;  2XR0 A;  1OME A;  3IQA A;  3UDF A;  3WRT A;  2R9W A;  5CTN A;  4GOG A;  3NI9 A;  2XD5 A;  4HBU A;  4OQI A;  3B3X A;  4C6Y A;  4GDN A;  2ZMA A;  4DE1 A;  1ZKJ A;  3NCK A;  4PPR A;  3HUO A;  4WYY A;  4S2P A;  1LI0 A;  3MXS A;  3TSG A;  2BG1 A;  2DRW A;  5AQB A;  2HDS A;  4R23 A;  3A3D A;  4S2K A;  4K0X A;  4P87 A;  1YT4 A;  1VM1 A;  2ZQC A;  2H10 A;  3QHY A;  5GHX A;  4KEN B;  3HLE A;  2IWD A;  2XD1 A;  5FQM A;  3IXD A;  5FAT A;  2XEP A;  3C4O A;  3C7U A;  3EQV A;  3Q7V A;  2XQZ A;  3V50 A;  3G34 A;  3A3J A;  5HAR A;  3ZFZ A;  1S0W A;  3O86 A;  3ZDJ A;  3LY4 A;  1IYO A;  4KZ3 A;  5KSH A;  4F94 A;  3SH7 A;  4BD0 A;  3EQU A;  3BFE A;  5J8X A;  3BM6 A;  4M3K A;  4R4S A;  1K4F A;  1K25 A;  3OZH A;  4EUZ A;  4DDY A;  2WK0 A;  5M18 A;  4X6T A;  4WBG A;  4S2J A;  1K4E A;  5E2E A;  2X01 A;  1CI8 A;  4OPZ A;  5CER A;  1Q2Q A;  5TGF A;  4FSF A;  5DTT A;  4ZJ3 A;  2PBY A;  1TEM A;  2QZ6 A;  4OLG A;  3PBT A;  1YM1 A;  1KDW A;  2VGJ A;  2WAF A;  2A49 A;  4KZ9 A;  5CGS A;  2ZC4 B;  2Z2L B;  3VP1 A;  1MY8 A;  3A3I A;  2RCX A;  4HES A;  4N1X A;  4PM8 A;  4WMC A;  1KE4 A;  4N9L A;  4X69 A;  1YMX A;  3BRM A;  5U47 A;  4B4X A;  4OVD A;  4OP5 A;  2QPN A;  4WMC D;  4PM5 A;  5A90 A;  3MZD A;  4LEN A;  3M2K A;  1GHP A;  1BUL A;  3N4I A;  3C4P A;  3UE0 A;  3G2Y A;  3CG5 A;  4JXS A;  1L2S A;  2ZC5 B;  2HPB A;  3G31 A;  3NIA A;  3GRJ A;  1BT5 A;  3WS5 A;  5FQI A;  4E3K A;  1K38 A;  4RA7 A;  3FKW A;  5EOE A;  2P9V B;  1NJ4 A;  4WEK A;  5EVI B;  2I72 A;  3HLC A;  4P0M A;  4DF6 A;  1ONG A;  3PBR A;  3W8K A;  1MPL A;  3OPR A;  4MBK A;  4ZDX A;  1DJB A;  4RVA A;  1E4D A;  3UY6 A;  2ZQD A;  2RL3 A;  1KGF A;  4MNR A;  1I2W A;  3SS4 A;  3TG9 A;  1NY0 A;  5GLB A;  3MZE A;  3QNC A;  2H0T A;  4UA6 A;  4JF4 A;  2Y59 A;  4XUZ A;  3ZG7 B;  3HLG A;  1U60 A;  4BLM A;  3IF6 C;  3V5M A;  4DRT A;  1K57 C;  1C3B A;  2J9P A;  3UE1 A;  5HAQ A;  4P85 A;  1K54 A;  4UAA A;  2WUQ A;  2ZLY A;  4S2M A;  4QU3 A;  5KMW A;  2V2F F;  3HLD A;  5I94 A;  4Q8I A;  1L0G A;  4GZB A;  4DKI A;  2OSU A;  4OP8 A;  1W7F A;  2Q9N A;  1NXY A;  3OCL A;  1HTZ A;  2XLN A;  4FH4 A;  4RX3 A;  3SS3 A;  2P74 A;  1ZC2 A;  5FI6 A;  5FAO A;  4IBX A;  3VMA A;  1Q2P A;  3PBQ A;  4OPY A;  5HFO A;  4IVK A;  3OPH A;  4RX2 A;  1GHI A;  2XFS A;  4ZTK A;  3GMW A;  5CEC A;  4PM7 A;  4DE2 A;  3SOI A;  1JWV A;  1M40 A;  1FCN A;  2ZC6 B;  3Q82 A;  4R0Q A;  3GTC A;  4KZ8 A;  2ZJ9 A;  3NY4 A;  2HP5 A;  3RJU A;  4BJP A;  2ZC3 B;  3N8L A;  4X55 A;  2C6W B;  1SHV A;  1VQQ A;  1ZG4 A;  1BLP A;  1Z6F A;  2Y2P A;  1ERO A;  3MZF A;  4N1H A;  1BLH A;  3A3F A;  4N92 A;  3BFC A;  4OOY A;  3VOY A;  3JYI A;  2Y2K A;  5FAQ A;  3UDX A;  1E3U A;  3BLS A;  1XA1 A;  1FQG A;  1XGI A;  2B5R A;  3CMZ A;  4GB7 A;  3ZG5 A;  4BD1 A;  3VSL A;  1E3U D;  5CXW A;  5EUA A;  5GHZ A;  4KZB A;  2ZQ8 A;  1TDL A;  2EXA A;  4OKP A;  4WZ5 A;  2R9X A;  4JF6 A;  3Q81 A;  3UDI A;  2Y2Q A;  1K6S A;  1WYC A;  4A5R A;  4U3T A;  3PTE A;  3G30 A;  1AXB A;  3IWQ A;  3FWL A;  5GLC A;  4ZJ1 A;  3FYZ A;  1KDS A;  3Q7Z A;  4GDB A;  3ZHH A;  4EBL A;  5KZH A;  5FQJ A;  3ZNY A;  2ZQ7 A;  3WWX A;  3A3E A;  5HL1 A;  2OLU A;  3G2Z A;  4JLF A;  3MKF A;  4S2O A;  1GA9 A;  3MXR A;  1ERM A;  4UA9 A;  5FSR A;  4UA7 A;  4JXV A;  1YLT A;  1FSW A;  4H8R A;  5FQK A;  3VP3 A;  5IHV A;  4EV4 A;  3Q7V B;  1FSY A;  1O07 A;  3OPP A;  3CZD A;  5TR7 A;  1ALQ A;  5CGX A;  4NET A;  3UPO A;  3DWZ A;  1KGG A;  4KZ6 A;  4E3J A;  1PWD A;  1PYY A;  4FD8 A;  1G6A A;  4JKT A;  5E2F A;  3VP4 A;  1PWC A;  3WS4 A;  3IXH A;  4JF5 A;  4RYE A;  1YLW A;  5FI2 A;  3UE3 A;  3WS0 A;  5KSC A;  4LV3 A;  1MBL A;  3G4P A;  3FV7 A;  4R3J A;  5CHM A;  4DE0 A;  3IT9 A;  1H8Z A;  4QD4 A;  3AGD A;  4NK3 A;  2JCH A;  2WZX A;  2WZZ A;  5FAS A;  3ZVW A;  1LHY A;  4LV2 A;  2Y2L A;  4Z9Q A;  3TOI A;  4CPK A;  4QJG A;  1JTD A;  4EBN A;  3WRZ A;  4KG2 A;  1G68 A;  2H0Y A;  4B4Z A;  4GNU A;  3N6I A;  4OQ0 A;  1I2S A;  4N9K A;  4P6B A;  4JXW A;  3QNB A;  4OOM A;  3NC8 A;  4GKU A;  4U0T A;  4K91 A;  3IWO A;  3IHA A;  5F83 A;  1XA7 A;  2QMI A;  2ZM2 A;  3HLB A;  4QB8 A;  1W79 A;  2HP9 A;  1MKI A;  5JYO A;  1L0D A;  3VP2 A;  1FCM A;  3WS2 A;  4IED A;  2Y2J A;  2VGK A;  5EPH A;  1JVJ A;  1W8Y A;  1WE4 A;  4L0L A;  1K55 C;  4XXR A;  5EVI C;  4ZJ2 A;  1HD8 A;  2Y2G A;  1I5Q A;  1XXM A;  4EQI A;  2J7V A;  1K6R A;  2EX6 A;  3BFF A;  3M6B A;  5DF8 A;  5L2F A;  4JPM A;  4E3I A;  4MBH A;  2G2U A;  3IH8 A;  5GL9 A;  1PW1 A;  3D4F A;  5EEC A;  4KZ4 A;  1W8Q A;  3IWI A;  4D2O A;  4BL2 A;  5FA7 A;  3OC2 A;  1FCO A;  4BL3 A;  5EVI A;  1PIO A;  3IH9 A;  3ITA A;  4OLD A;  4XUX A;  3VP0 A;  3AGF A;  3PBN A;  1H8Y A;  1M6K A;  3VSK A;  1HVB A;  5F1F A;  3BFD A;  3LEZ A;  2FFY A;  1LL5 A;  4DXB A;  3C7V A;  2WGW A;  3V39 A;  1ES2 A;  2WYX A;  4X68 A;  3ZNT A;  4FH2 A;  5AQ7 A;  4BQM A;  3N8R A;  3GVB A;  4X56 A;  3ITB A;  4QY5 A;  3VFF A;  1KE0 A;  4OON A;  1O7E A;  1ES3 A;  4KQQ A;  1MWS A;  3S4X A;  3IF6 A;  3BYD A;  5GHY A;  3G32 A;  1K57 A;  4O7D A;  4JBF A;  3ZG9 B;  2DCF A;  1FR1 A;  1IKG A;  1RP5 A;  3MKE A;  4Y0T A;  1KVL A;  1IYP A;  3BEC A;  3MBZ A;  2EX8 A;  1L0F A;  1RCJ A;  1TDG A;  4KQR A;  2H5S A;  4MLL A;  2J9O A;  1NZO A;  2C5W B;  2Y2O A;  3ZG8 B;  1DJA A;  3HL9 A;  3RXW A;  1L0E A;  1XP4 A;  2XDM A;  1PI4 A;  4KQO A;  1NRF A;  5F82 A;  1XKZ A;  5GLA A;  1N4O A;  4WZ4 A;  3M2J A;  2EX9 A;  1XPB A;  3SS5 A;  5DVA A;  1E25 A;  1DY6 A;  2Y55 A;  1BLC A;  3HVF A;  4U0X A;  3UO9 A;  5FQ9 A;  2BLS A;  1BZA A;  2WGV A;  4IVI A;  4ZBE A;  5BOH A;  1ERQ A;  4KG5 A;  1CK3 A;  1PI5 A;  4C3Q A;  5DF7 A;  3HLW A;  3N8S A;  3I7J A;  5FAP A;  5M1A A;  1JTG A;  1PZO A;  2XGN A;  3NBL A;  5CGW A;  5FQQ A;  5CRF A;  2JBF A;  1LL9 A;  2EFU A;  4R3B A;  4Y0U A;  1MWR A;  2Y2M A;  3SH9 A;  5HAP A;  3C5A A;  1QMF A;  2ZQA A;  5DF9 A;  1YLZ A;  4X53 A;  2E8I A;  1NYM A;  3P09 A;  1CEG A;  2J8Y A;  3BLM A;  2WAE A;  1IEM A;  1ESU A;  3LCE A;  1ZG6 A;  5FDH A;  2WGI A;  2Q9M A;  2OV5 A;  2ZM8 A;  3FZC A;  2WKI A;  5F1G A;  2UWX A;  1PWG A;  1NZU A;  2Y2I A;  4E6X A;  3AGE A;  4ZAM A;  1FOF A;  3RXX A;  1W5D A;  5A93 A;  1GA0 A;  3ZCZ A;  5CHJ A;  4PM9 A;  2HDR A;  2XH9 A;  3O87 A;  1KE3 A;  1IYQ A;  1QME A;  1IKI A;  3OCN A;  4GD8 A;  4DE3 A;  4OQH A;  3HUM A;  5CEB A;  4S2I A;  4OPQ A;  3IHB A;  1BLS A;  2EX2 A;  4OH0 A;  2GDN A;  4Y7P A;  1CI9 A;  5AQ9 A;  1JWP A;  1FR6 A;  4E3O A;  3IXB A;  1YLY A;  1Y54 A;  4YFM A;  1BUE A;  3V3S A;  1SCW A;  3IF5 A;  3GR2 A;  3LO7 A;  1ESI A;  2V20 A;  4MBF A;  4OQG A;  5CTM A;  2ZQ9 A;  3IXG A;  5CED A;  3OPL A;  1XGJ A;  3DTM A;  2HDQ A;  2Y2N A;  5EVL A;  4E3L A;  3DWK A;  4KZ5 A;  4WEL A;  4ID4 A;  5HAI A;  3Q07 A;  4OPR A;  5EE8 A;  4DXC A;  2X71 A;  1LI9 A;  5TFQ A;  1BSG A;  3ZVT A;  3W4O A;  1MXO A;  5HX9 A;  4E3M A;  4HBT A;  3LY3 A;  3WS1 A;  4B88 A;  1BTL A;  2Z2M B;  4QHC A;  5E2H A;  1IYS A;  3V3R A;  4QY6 A;  4WM9 A;  1MWU A;  2EFX A;  3G35 A;  4LV0 A;  3PBS A;  3GQZ A;  3S22 A;  3E2K A;  3S1Y A;  5E2G A;  2XF3 A;  3GV9 A;  4JXG A;  4WEJ A;  5A91 A;  4EBP A;  3SH8 A;  4MEZ A;  3E2L A;  3O3V A;  4R4R A;  3VOZ A;  1SDE A;  4LCL A;  4CJN A;  5AQA A;  1IEL A;  4E3N A;  4GD6 A;  2WKE A;  2OLV A;  1N9B A;  5DTK A;  3UPP A;  1K55 A;  1ES5 A;  2P9V A;  5A92 A;  1EI5 A;  1YQS A;  2EXB A;  1K54 C;  1PW8 A;  5EVI D;  1GHM A;  3N7W A;  1MWT A;  1DJC A;  4IBR A;  4UHU A;  1ONH A;  4PM6 A;  2WGW B;  1YLJ A;  5M19 A;  1GCE A;  5GLD A;  3BEB A;  1LLB A;  2CC1 A;  1TVF A;  5HW3 A;  3PBO A;  2JE5 A;  3IF6 B;  1NYY A;  4YIN A;  4K0W A;  2IWB A;  1EWZ A;  3W4Q A;  4LV1 A;  2PU2 A;  1XX2 A;  2ZC7 A;  3Q1F A;  2V1Z A;  3UPN A;  3PAG A;  4Y0O A;  1SDN A;  4EWF A;  3HLF A;  4BEN A;  2XK1 A;  1J9M A;  2Y2H A;  1KVM A;  5EOO A;  1PZP A;  4S2L A;  3DW0 A;  2DNS A;  2FFF B;  2A3U A;  2WKH A;  2Y4A A;  3O88 A;  5CHU A;  5G18 A;  4C75 A;  1K56 A;  4PMA A;  3PAE A;  4KZA A;  1RGZ A;  4R1G A;  2HDU A;  1WYB A;  1K56 D;  1JWZ A;  3GSG A;  3NDG A;  2XFT A;  2ZM0 A;  4KG6 A;  3BFG A;  1CEF A;  3HRE A;  4S2N C;  2IWC A;  4GN2 A;  4OOL A;  3UN7 A;  4E6W A;  2HP6 A;  3HBR A;  4WZ5 C;  2WAD A;  1YLP A;  3ISG A;  2ZD8 A; 
#chains in the Genus database with same CATH topology
 4DDS A;  3EEA A;  3MFD A;  4KZ7 A;  4WL9 A;  4Q0H A;  4FCF A;  3ZG0 A;  3CJM A;  2AVX A;  5G4Y A;  1S6R A;  2X02 A;  5FL3 A;  3P98 A;  5DKL A;  2EA9 A;  3WRT A;  3B47 A;  3NI9 A;  1YPR A;  4OQI A;  4GDN A;  2ZMA A;  3L9K A;  3TSG A;  4IHQ A;  2PRF A;  1VM1 A;  3IBJ A;  3H82 B;  5GHX A;  5FQM A;  5FAT A;  2XEP A;  3EQV A;  4F3L A;  3Q7V A;  1S0W A;  3O86 A;  5KSH A;  2W3D A;  3UB5 P;  3BFE A;  2JKT I;  4R4S A;  2O0Y A;  1K4E A;  4OPZ A;  3O5Y A;  3NHQ A;  5DTT A;  2QZ6 A;  1KDW A;  2M7U A;  3LUQ A;  3VP1 A;  2Z2L B;  2ZMF A;  3ZYT A;  3T12 B;  5AJG A;  4B4X A;  4HJ4 A;  1GHP A;  3P01 A;  2ZMV A;  3D72 A;  4L9E A;  3G31 A;  4E3K A;  1K38 A;  4WEK A;  1TS7 A;  1GSW A;  3HLC A;  1ONG A;  3W8K A;  3LYX A;  3OPR A;  3TJZ C;  1KGF A;  2VGL S;  3T1Q B;  3KSF A;  1NY0 A;  3QNC A;  4P85 A;  2VEA A;  4UAA A;  5HWT A;  4QU3 A;  4NKP A;  1OJG A;  1NXY A;  3OCL A;  4CLC E;  2P74 A;  4HNB A;  5FAO A;  4IBX A;  3PBQ A;  3MSH A;  4I3J A;  5CEC A;  4PM7 A;  1OJ5 A;  3DTE A;  3DTI A;  4BJP A;  1ZG4 A;  1ERO A;  1G28 A;  3BFC A;  5DJT A;  3BLS A;  3ZG5 A;  1E3U D;  3UB9 A;  2R9X A;  3Q81 A;  4ZJ1 A;  1KDS A;  5FQJ A;  3WWX A;  3G2Z A;  4MN6 A;  5FSR A;  1FSW A;  4H8R A;  3EGX C;  3OLO A;  3VP3 A;  5AVF A;  1O07 A;  1ALQ A;  5CGX A;  3PYP A;  3UPO A;  2O9B A;  1PWD A;  5E2F A;  2XSS A;  2JKF A;  1T19 A;  1YSP A;  4JF5 A;  4RYE A;  4BWI A;  3UE3 A;  5CHM A;  4DE0 A;  3TRC A;  4QD4 A;  3TW8 A;  1DP8 A;  5FAS A;  2Y2L A;  2W3F A;  4EBN A;  4KG2 A;  4MDZ A;  1I2S A;  5DFX A;  4P6B A;  4U0T A;  2PBD P;  4KUO A;  4OOM A;  2J3T C;  5F83 A;  4GHI A;  1XA7 A;  4QB8 A;  1W79 A;  1FCM A;  2OWH A;  4Y15 A;  2JHE A;  1WE4 A;  1W8Y A;  3CIT A;  4Z1W A;  1K55 C;  4LLO B;  4ZJ2 A;  4EQI A;  2PR5 A;  4ETZ A;  4E3I A;  5CX7 A;  1DP9 A;  1W8Q A;  4EET B;  1XJ4 A;  5HD5 A;  1PIO A;  1H8Y A;  1M6K A;  3VSK A;  2V8F A;  3LEZ A;  3C7V A;  2WGW A;  3UE6 A;  3V39 A;  1ES2 A;  2WYX A;  3ZNT A;  2PDR A;  4Y13 A;  3LR5 A;  4QY5 A;  3VFF A;  1A0K A;  3FPV A;  1ES3 A;  1MWS A;  3G32 A;  2J80 A;  2JKG A;  4JBF A;  1IKG A;  5C5K A;  3MKE A;  4Y0T A;  2EX8 A;  1TDG A;  3MQO A;  1MC0 A;  1NZO A;  3ZG8 B;  2QYB A;  1L0E A;  1N4O A;  4DJ3 A;  1XPB A;  2Y55 A;  3UO9 A;  2BLS A;  1STZ A;  2XRN A;  1T1A A;  3W2Z A;  4ME4 A;  5FQQ A;  2EFU A;  3SH9 A;  4G3V A;  3C5A A;  1QMF A;  3H7W A;  2A24 B;  4G3K A;  4EUV A;  1P9R A;  4DN0 A;  2OV5 A;  1MKM A;  1OT9 A;  2H28 A;  1KE3 A;  3BQ8 A;  1L3L A;  4OQH A;  1F2K A;  1DRM A;  3V3S A;  3IF5 A;  3WS5 A;  2W1R A;  2ZQ9 A;  5EVL A;  3DWK A;  1VEU A;  2OOL A;  4L9G A;  2Q0O A;  1TS6 A;  3W4O A;  3ZVT A;  3LY3 A;  5J7E A;  3V3R A;  5E2H A;  3S22 A;  1T1B A;  3E2K A;  4EBP A;  3CUE C;  4MEZ A;  3O3V A;  5F6A A;  3NOP C;  1H0M A;  5HDC A;  4GD6 A;  2WKE A;  2OLV A;  1N9B A;  1S66 L;  1EI5 A;  1BYW A;  1D1J A;  2EWV A;  2B95 A;  1GHM A;  4UHU A;  1WA9 A;  4HOI A;  3EWK A;  1H8M A;  5M19 A;  4Y17 A;  5TBM B;  3BEB A;  5HWW A;  1TVF A;  3IF6 B;  1NYY A;  1EWZ A;  3BWL A;  4FTX A;  3Q1F A;  4Y2F A;  3F1O B;  3UPN A;  3PAG A;  4YWZ A;  1SDN A;  2Y2H A;  1J9M A;  3T1R A;  5F5Y A;  3DW0 A;  2DNS A;  1CQA A;  3SW1 A;  4CLC C;  4EW7 A;  1S67 L;  1JWZ A;  3UMD A;  2ZM0 A;  4KG6 A;  5HDS A;  2V9A A;  4OOL A;  3HBR A;  4WZ5 C;  5HD3 A;  3ISG A;  2ZD8 A;  3BY8 A;  4YNR A;  4LCM A;  5DTS A;  4CLC A;  5EFW A;  2PU4 A;  1KGE A;  2FH5 A;  1VET A;  4HHD A;  4P6Z M;  4HEF A;  4B93 A;  2Y91 A;  1ES4 A;  3IQA A;  3UDF A;  2R9W A;  5CTN A;  2XD5 A;  4BBT A;  3B3X A;  4C6Y A;  2JN7 A;  3CPT A;  2BTF P;  3HUO A;  3T4O A;  1LI0 A;  3MXS A;  3LR3 A;  4H6J B;  2BG1 A;  2JKR M;  5AQB A;  4R23 A;  4P87 A;  2ZQC A;  3U4L P;  3HLE A;  1W63 M;  3IXD A;  1XJ3 A;  3C4O A;  2Z6D A;  3VE3 A;  1GSX A;  3R7W B;  3A3J A;  3ZDJ A;  2PHY A;  4G3W A;  4KZ3 A;  5HDD A;  2O9A A;  4FOF A;  3EQU A;  1K4F A;  3OZH A;  3JVV A;  3PR6 A;  4WBG A;  5FDS A;  1CI8 A;  4KQD A;  4FSF A;  1TEM A;  1LSW A;  2QKP A;  1YM1 A;  2WAF A;  3P7N A;  2RCX A;  4HES A;  4WMC A;  4IUH A;  1KE4 A;  5U47 A;  1YMX A;  3BRM A;  4OVD A;  4LEN A;  1BUL A;  3G2Y A;  3CG5 A;  1L2S A;  2HPB A;  3CLO A;  3NIA A;  1LSV A;  3MFX A;  4RA7 A;  2Z6C A;  1NJ4 A;  3NEC A;  4MBK A;  1E4D A;  3UY6 A;  5HZH A;  3MZE A;  3ZG7 B;  2H0T A;  4HI4 A;  4Y3I A;  1U60 A;  4GJ4 A;  1K57 C;  1C3B A;  1F5M A;  3G6O A;  2HJ9 C;  4S2M A;  3HLD A;  5I94 A;  4GZB A;  1D7E A;  4FH4 A;  2V1B A;  3MR0 A;  1UWP X;  3VOL A;  1ZTU A;  2B18 A;  1Q2P A;  4RX2 A;  2I9V A;  4ZTK A;  2VK3 A;  4DE2 A;  3SOI A;  1JWV A;  1M40 A;  1FCN A;  4I3I A;  2ZJ9 A;  4HP9 A;  1SHV A;  5DJU A;  1BLP A;  1Z6F A;  1BLH A;  1H3Q A;  4ARZ A;  3ULF A;  3VOY A;  3JYI A;  3LGO A;  5FAQ A;  3CMZ A;  1FQG A;  3VSL A;  5GHZ A;  4KZB A;  2YKH A;  4JF6 A;  3S7P A;  1K6S A;  2WKP A;  3IWQ A;  5GLC A;  4O01 A;  5KZH A;  2JKT M;  5HL1 A;  3MKF A;  5IU1 A;  3S7Q A;  4KUK A;  1YLT A;  4YOF A;  3T4K A;  4EV4 A;  4F3L B;  3Q7V B;  2K7S A;  4NET A;  3T4L A;  4O8G A;  3VP4 A;  3WS4 A;  4JKT A;  1J3W A;  4I38 A;  3E4Q A;  1MZU A;  1MBL A;  3G4P A;  5FEG A;  1H8Z A;  4MN5 A;  4NK3 A;  2WZZ A;  1LHY A;  2GNX A;  1XJ2 A;  1FIK A;  4LV2 A;  3TOI A;  1JTD A;  1G68 A;  4GNU A;  3N6I A;  1V9Z A;  1VB6 A;  4N9K A;  4JXW A;  3NC8 A;  3IHA A;  4BBV A;  2HP9 A;  3MQ0 A;  1JVJ A;  4XXR A;  2VKS A;  1I5Q A;  3UB7 A;  2J7V A;  2EX6 A;  3BFF A;  3S7O A;  3QP4 A;  4JPM A;  3B33 A;  5GL9 A;  3CI6 A;  4WLA A;  1PW1 A;  5HL6 A;  2J3T D;  5EEC A;  4KZ4 A;  3IWI A;  2VGL M;  5TJJ A;  4BL2 A;  5FA7 A;  4M4X A;  5F1F A;  3KYZ A;  1LL5 A;  2VV6 A;  1PRQ A;  2WKR A;  4FH2 A;  4BQM A;  1KE0 A;  4KQQ A;  3S4X A;  4O7D A;  2GX5 A;  3ICY A;  1OTD A;  1KVL A;  1IYP A;  3BEC A;  3FG8 A;  3MBZ A;  1OTI A;  4UQI M;  4MLL A;  2C5W B;  1VHM A;  2PYP A;  2XA7 M;  1XP4 A;  2MJ6 A;  1N9O A;  2L0W A;  4KQO A;  1NRF A;  2W1T A;  4PKY A;  5GLA A;  4R6L A;  4WZ4 A;  2EX9 A;  4EXO A;  3SS5 A;  2L1M A;  1BLC A;  5FQ9 A;  1CK3 A;  1PI5 A;  2HV1 A;  4C3Q A;  3HLW A;  3HCY A;  5CGW A;  4HJ6 A;  4R3B A;  3D9Y A;  4X53 A;  3P09 A;  2J8Y A;  3BLM A;  2DMW A;  1ZG6 A;  3FZC A;  3RFB A;  4JGR A;  5F1G A;  2UWX A;  1LT0 A;  4E6X A;  3AGE A;  1FOF A;  3KX0 X;  5F68 A;  5CHJ A;  2HDR A;  2XH9 A;  3T4T A;  2ACG A;  3T50 A;  4GD8 A;  4DE3 A;  4S2I A;  3A0R A;  3IHB A;  1BLS A;  2EX2 A;  4OH0 A;  4QPR A;  2GDN A;  3IX3 A;  4UEY A;  5AQ9 A;  1JWP A;  4E3O A;  5A8B A;  3IXB A;  2LB9 A;  1YLY A;  2OAQ 1;  4QJG A;  3LIF A;  2V20 A;  5CTM A;  4OQG A;  5KIZ A;  1XGJ A;  3DTM A;  4GHI B;  3K2N A;  5EE8 A;  4DXC A;  1BSG A;  1YAX A;  4B88 A;  2Z2M B;  1IYS A;  4QY6 A;  2HJE A;  1MWU A;  3GQZ A;  3QP2 A;  3S1Y A;  2XF3 A;  3E98 A;  3GV9 A;  5A91 A;  3DAV A;  4R4R A;  3VOZ A;  2KDK A;  3MMH A;  3IX4 A;  3UPP A;  5DTK A;  5A92 A;  1K55 A;  2P9V A;  2EXB A;  1K54 C;  1PW8 A;  5EVI D;  3FPW A;  2BAS A;  1NLY A;  4PM6 A;  5HSQ A;  2WGW B;  1YLJ A;  3LFV A;  1NWZ A;  1GCE A;  1N9L A;  1LLB A;  2CC1 A;  1UGU A;  2JE5 A;  3LI8 A;  4YIN A;  4GS9 A;  3W4Q A;  4D60 A;  4LV1 A;  2PU2 A;  1XX2 A;  2ZC7 A;  2V1Z A;  3HLF A;  4BEN A;  4RQ9 A;  1KVM A;  4S2L A;  2FFF B;  2A3U A;  1EW0 A;  1OTA A;  2K31 A;  2V1A A;  3F1P B;  4R1G A;  3LIC A;  3HRE A;  4E6W A;  3E0Y A;  1YLP A;  3HUN A;  1H5X A;  3FKV A;  1S1Z A;  3VFH A;  5FI7 A;  5E43 A;  4CLC D;  3KO6 A;  3UNW A;  3FC7 A;  1OME A;  3K3D A;  3H7W B;  3KSH A;  4WF0 A;  3KYE A;  2Y79 A;  2KOI A;  3EGD C;  3NCK A;  4PPR A;  4WYY A;  4S2P A;  2DRW A;  3A3D A;  4S2K A;  1PNE A;  4R70 A;  3QHY A;  4KEN B;  2XD1 A;  1V9Y A;  4EEP A;  3C7U A;  2QWS A;  1OTE A;  3V50 A;  3CAX A;  3LY4 A;  4F94 A;  3SH7 A;  5J4E A;  5J8X A;  3BM6 A;  1K25 A;  4DDY A;  2WK0 A;  4S2J A;  5E2E A;  2X01 A;  3H9W A;  5CER A;  1Q2Q A;  4ZJ3 A;  3T1S A;  3VV4 A;  1DP6 A;  1VEU B;  3PBT A;  5CGS A;  4NEE D;  3QP8 A;  4PM8 A;  4N1X A;  4PM5 A;  2QPN A;  2ZL1 A;  4WMC D;  1P97 A;  3MZD A;  5A90 A;  3N4I A;  3C4P A;  4JXS A;  2ZC5 B;  3GRJ A;  5FQI A;  4R3A A;  2LB5 A;  1LSX A;  5EOE A;  5EVI B;  5EM1 A;  2OAP 1;  2VLG A;  1OPX A;  5F69 A;  3PBR A;  3KYQ A;  3T4J A;  1MPL A;  2ZQD A;  4MNR A;  3RTY A;  2B02 A;  1I2W A;  3CUE A;  4JGQ A;  4UA6 A;  4JF4 A;  4BLM A;  2V0U A;  3IF6 C;  3V5M A;  3UE1 A;  2HGV A;  2ZLY A;  3F1N A;  4Q8I A;  1L0G A;  4DKI A;  2OSU A;  2Q9N A;  1HTZ A;  4RX3 A;  4AFI A;  3VMA A;  5HFO A;  4LRZ E;  3JPU A;  2ZC6 B;  3Q82 A;  4R0Q A;  3QP5 A;  4KZ8 A;  2HP5 A;  4EQ1 A;  3RJU A;  1ZHH B;  4CQH A;  2ZC3 B;  3N8L A;  4X55 A;  1VQQ A;  3MZF A;  1N9N A;  4N1H A;  4CLC B;  4N92 A;  4OOY A;  3HJI A;  3UDX A;  1VET B;  1IOU A;  2B5R A;  4BD1 A;  5CXW A;  5EUA A;  2ZQ8 A;  4WUJ A;  1UWN X;  2EXA A;  4OKP A;  4WZ5 A;  3LR0 A;  4EER A;  4A5R A;  4U3T A;  3PTE A;  3CPT B;  3G30 A;  1SZV A;  4P6Z S;  2NUP C;  4EBL A;  5K5B A;  3ZNY A;  2OLU A;  5EM0 A;  2A2L A;  3MXR A;  4UA9 A;  4K08 A;  3JVU A;  2PD7 A;  5FQK A;  1FSY A;  4HQA A;  2PD8 A;  4R38 A;  4Y5F A;  4KZ6 A;  4H6J A;  4FD8 A;  3IS2 A;  2K2N A;  4MCW A;  1YLW A;  5KSC A;  4LV3 A;  3FV7 A;  4R3J A;  2L4R A;  5IS1 A;  3IT9 A;  5EV0 A;  3AGD A;  3E4O A;  2JCH A;  2WZX A;  3ZVW A;  2P08 A;  4Z9Q A;  4CPK A;  2OWJ A;  2H0Y A;  4B4Z A;  2XRO A;  3QNB A;  1OT6 A;  3CWF A;  3IWO A;  2G7U A;  2QMI A;  5JYO A;  1L0D A;  4HP4 A;  2Y2J A;  1Y4O A;  1SKO B;  3E4P A;  1OTB A;  4O0P A;  3M6B A;  1K6R A;  3MXQ A;  5L2F A;  2GZA A;  2G2U A;  4I39 A;  3D4F A;  3IH9 A;  3ITA A;  4OLD A;  3LID A;  3AGF A;  2W27 A;  3D3O A;  4XT2 A;  4DMZ A;  5J3W A;  4X68 A;  5AQ7 A;  3N8R A;  2GJ3 A;  3ITB A;  3HJK A;  4OON A;  4ETX A;  3BYD A;  4WN5 A;  1K57 A;  5DKK A;  3ZG9 B;  1FR1 A;  1RCJ A;  4GW9 A;  2PAV P;  4BBU A;  2Y2O A;  4ARZ B;  1YKD A;  2XDM A;  1PI4 A;  3M2J A;  3OOV A;  1E25 A;  4U0X A;  4Q0J A;  1BZA A;  2WGV A;  4ZBE A;  5BOH A;  3N8S A;  1FIL A;  3I7J A;  5M1A A;  1JTG A;  1MWR A;  5HAP A;  4ESP A;  2QHK A;  3RH8 B;  1NYM A;  4I3A A;  2WAE A;  1IEM A;  1ESU A;  3LCE A;  5FDH A;  2Q9M A;  4QWO A;  2WKI A;  2HF6 A;  1S4R A;  3H82 A;  4ZAM A;  3RXX A;  1W5D A;  5A93 A;  1GA0 A;  3L7H A;  3ZCZ A;  3O87 A;  4FUW A;  1IYQ A;  1QME A;  3OCN A;  4EES A;  4X25 A;  5CEB A;  4OPQ A;  2R78 A;  1CI9 A;  1FR6 A;  1Y54 A;  1BUE A;  4MBF A;  1SCW A;  4E3N A;  3IXG A;  4PKY G;  4KZ5 A;  4ID4 A;  5HAI A;  2X71 A;  4E3M A;  5HX9 A;  3SZT A;  4EU0 A;  3NOU C;  1BTL A;  4QHC A;  1NRJ A;  4WM9 A;  3UME A;  2EFX A;  3G35 A;  4LV0 A;  2W3H A;  3LIA A;  4JXG A;  1F9I A;  4WEJ A;  3SH8 A;  3LIE A;  3E2L A;  2VV7 A;  2PR6 A;  1IEL A;  4NXF A;  1ES5 A;  2W3E A;  3UB8 A;  5AVE A;  5EVE A;  4LPZ A;  3BJN A;  2D02 A;  4L9F A;  3PBO A;  4K0W A;  3BY9 A;  5L09 A;  4Y0O A;  4EWF A;  5EOO A;  3TE8 A;  2KX6 A;  3DTK A;  5G18 A;  1K56 A;  3PAE A;  1RGZ A;  2HDU A;  1WYB A;  2ZBB A;  4HY8 A;  3C30 A;  3BFG A;  1KOU A;  2W1T B;  4S2N C;  2IWC A;  1K0K A;  4GN2 A;  4UQI S;  4LGW A;  2XA7 S;  1SKF A;  1YMS A;  4X1L A;  2JC7 A;  1YSQ A;  3W4P A;  1Z09 A;  2G2W A;  5IT5 A;  3BQA A;  3M6H A;  5D3O A;  5JYP A;  3NDE A;  1HZO A;  1RGY A;  4ZRR A;  3ZGA B;  4S2N A;  1S4S A;  2XR0 A;  3A0S A;  3QP1 A;  4GOG A;  3CHW P;  4HBU A;  5L10 A;  4DE1 A;  1ZKJ A;  4HJ3 A;  2J3W A;  2HDS A;  4K0X A;  1YT4 A;  1D06 A;  2H10 A;  4PAU A;  2IWD A;  2XQZ A;  3G34 A;  3ZFZ A;  5HAR A;  1IYO A;  1XFQ A;  3KSG A;  4BD0 A;  4LRY C;  4M3K A;  2W3G A;  4EUZ A;  5M18 A;  5I5L A;  4X6T A;  4Q0I A;  3KSI A;  5TGF A;  2PBY A;  2VV8 A;  3PXP A;  4OLG A;  2O99 A;  2VGJ A;  2A49 A;  4KZ9 A;  2ZC4 B;  1MY8 A;  3A3I A;  5MC7 A;  4N9L A;  4X69 A;  3VE4 A;  4OP5 A;  3M2K A;  3MS6 A;  3UE0 A;  2VX8 A;  1BT5 A;  3MQQ A;  3FKW A;  4HH3 A;  2P9V B;  1CJF A;  5HPI A;  2I72 A;  4EEU A;  4P0M A;  3U2A A;  4DF6 A;  4ZDX A;  1DJB A;  2VA0 A;  4RVA A;  4NXE A;  1XJ6 A;  4JGO A;  2RL3 A;  3SS4 A;  3TG9 A;  2PT7 A;  3C38 A;  3LIB A;  5GLB A;  2Y59 A;  4XUZ A;  3HLG A;  1TF1 A;  3MJQ A;  4DRT A;  4GS9 B;  2J9P A;  5HAQ A;  1K54 A;  4HH2 A;  2WUQ A;  5KMW A;  2V2F F;  4OP8 A;  1W7F A;  1ACF A;  3NOT C;  4II7 A;  2XLN A;  1X0O A;  1F98 A;  3SS3 A;  1ZC2 A;  5FI6 A;  4OPY A;  4IVK A;  3OPH A;  4NXG A;  1GHI A;  2XFS A;  3GMW A;  2M7V A;  1P0Z A;  5LBR A;  3GTC A;  3BW6 A;  3NY4 A;  1T1C A;  3GDI A;  2C6W B;  2UV0 E;  3GEC A;  3UB6 A;  2Y2P A;  3A3F A;  3F1P A;  1Y28 A;  2Y2K A;  1E3U A;  1XA1 A;  1XGI A;  3IBR A;  4GB7 A;  1TDL A;  3IX8 A;  4LRX C;  3UDI A;  2Y2Q A;  1WYC A;  1AXB A;  3FWL A;  3FYZ A;  3Q7Z A;  4GDB A;  3B42 A;  1XFN A;  3ZHH A;  2ZQ7 A;  1GSV A;  3A3E A;  4JLF A;  4S2O A;  1GA9 A;  1ERM A;  4UA7 A;  4JXV A;  4I5S A;  2A24 A;  5IHV A;  1G6O A;  3OBF A;  1TD5 A;  3OPP A;  3CZD A;  5TR7 A;  3C2W A;  3DWZ A;  1KGG A;  4E3J A;  2YKF A;  1PYY A;  1G6A A;  1PWC A;  5HWV A;  1P9W A;  3IXH A;  4NG2 A;  3V67 A;  2ZOH A;  4IUK A;  3LR4 A;  3LI9 A;  3MF0 A;  2M1C A;  4JGP A;  4PHT A;  5FI2 A;  3WS0 A;  1ODV A;  2IA2 A;  2PYR A;  2HZ5 A;  4NXB A;  3WRZ A;  2CMN A;  2KLI A;  2E8J A;  4OQ0 A;  3QP6 A;  1PFL A;  2ZL1 B;  4GKU A;  4K91 A;  4MN7 A;  2ZM2 A;  3HLB A;  1MKI A;  3VP2 A;  3WS2 A;  4IED A;  5FEF A;  2VGK A;  5EPH A;  1TS0 A;  5L8M A;  4L0L A;  5EVI C;  1HD8 A;  2Y2G A;  1XXM A;  5DF8 A;  4MBH A;  2EWW A;  3IH8 A;  2INW A;  2VZW A;  1HLU P;  4D2O A;  3NUL A;  3OC2 A;  2V8C A;  1FCO A;  4BL3 A;  5DFY A;  5EVI A;  1AWI A;  4XUX A;  3VP0 A;  3F1N B;  3PBN A;  1HVB A;  3BFD A;  2FFY A;  4DXB A;  3EEH A;  4X56 A;  3GVB A;  2ZOI A;  5TBM A;  5HPF A;  5G4Z A;  1O7E A;  5L07 A;  3IF6 A;  3PHY A;  5GHY A;  2P04 A;  4DJ2 A;  2DCF A;  1RP5 A;  3F1O A;  4KQR A;  1L0F A;  4GCZ A;  2H5S A;  2J9O A;  1NLZ A;  1TS8 A;  3R4K A;  1DJA A;  3HL9 A;  3RXW A;  5F82 A;  1XKZ A;  5DVA A;  1DY6 A;  4MMN A;  1IFQ A;  3HVF A;  4IVI A;  4E04 A;  1ERQ A;  4KG5 A;  1W63 Q;  5DF7 A;  3K3C A;  5FAP A;  1PZO A;  2XGN A;  3NBL A;  5CRF A;  3EOI A;  2JBF A;  1LL9 A;  4Y0U A;  1G5U A;  2Y2M A;  3LEQ A;  2ZQA A;  2VJW A;  5DF9 A;  1YLZ A;  2E8I A;  4X1M A;  1CEG A;  1LL8 A;  2WGI A;  2W0N A;  3T1X A;  2ZM8 A;  3IS2 B;  2NUT C;  1PWG A;  1NZU A;  2P7J A;  2Y2I A;  3ZQ5 A;  4IJG A;  4PM9 A;  4BMW A;  1IKI A;  3R7W A;  2QJ7 A;  3HUM A;  4HIA A;  4Y7P A;  2JKR I;  4GLQ A;  4LFU A;  4YFM A;  1T18 A;  3GR2 A;  1ESI A;  3LO7 A;  5CED A;  3OPL A;  2WKQ A;  2HDQ A;  2Y2N A;  4E3L A;  4WEL A;  3Q07 A;  4OPR A;  1LI9 A;  5TFQ A;  1MXO A;  4HBT A;  3WS1 A;  1JNU A;  3PBS A;  5E2G A;  3DBA A;  1SDE A;  4LCL A;  4CJN A;  5AQA A;  3T4S A;  1CF0 A;  1SKO A;  3T4Q A;  1YQS A;  2Y8H A;  2V0W A;  1MWT A;  1DJC A;  3C8C A;  3N7W A;  4IBR A;  4XT2 B;  1ONH A;  5GLD A;  2FZ0 A;  5HW3 A;  2IWB A;  2XK1 A;  1PZP A;  2Y4A A;  2WKH A;  3O88 A;  5CHU A;  3A0V A;  4C75 A;  4PMA A;  4KZA A;  2QJ5 A;  1K56 D;  3GSG A;  3NDG A;  2XFT A;  4B9O A;  1CEF A;  2O9C A;  3S7N A;  1S1Y A;  3UN7 A;  2HP6 A;  2WAD A;  2D01 A;  3NJA A; 
#chains in the Genus database with same CATH homology
 3HUN A;  1SKF A;  1YMS A;  4DDS A;  1H5X A;  2JC7 A;  3FKV A;  3W4P A;  3MFD A;  4KZ7 A;  4LCM A;  5DTS A;  2G2W A;  3VFH A;  4FCF A;  3ZG0 A;  3CJM A;  3M6H A;  1S6R A;  2X02 A;  5D3O A;  2PU4 A;  1KGE A;  5FI7 A;  5JYP A;  3NDE A;  5E43 A;  1HZO A;  3P98 A;  1RGY A;  4HEF A;  3UNW A;  3ZGA B;  2Y91 A;  1ES4 A;  4S2N A;  2XR0 A;  1OME A;  3IQA A;  3UDF A;  3WRT A;  2R9W A;  5CTN A;  4GOG A;  3NI9 A;  2XD5 A;  4HBU A;  4OQI A;  3B3X A;  4C6Y A;  4GDN A;  2ZMA A;  4DE1 A;  1ZKJ A;  3NCK A;  4PPR A;  3HUO A;  4WYY A;  4S2P A;  1LI0 A;  3MXS A;  3TSG A;  2BG1 A;  2DRW A;  5AQB A;  2HDS A;  4R23 A;  3A3D A;  4S2K A;  4K0X A;  4P87 A;  1YT4 A;  1VM1 A;  2ZQC A;  2H10 A;  3QHY A;  5GHX A;  4KEN B;  3HLE A;  2IWD A;  2XD1 A;  5FQM A;  3IXD A;  5FAT A;  2XEP A;  3C4O A;  3C7U A;  3EQV A;  3Q7V A;  2XQZ A;  3V50 A;  3G34 A;  3A3J A;  5HAR A;  3ZFZ A;  1S0W A;  3O86 A;  3ZDJ A;  3LY4 A;  1IYO A;  4KZ3 A;  5KSH A;  4F94 A;  3SH7 A;  4BD0 A;  3EQU A;  3BFE A;  5J8X A;  3BM6 A;  4M3K A;  4R4S A;  1K4F A;  1K25 A;  3OZH A;  4EUZ A;  4DDY A;  2WK0 A;  5M18 A;  4X6T A;  4WBG A;  4S2J A;  1K4E A;  5E2E A;  2X01 A;  1CI8 A;  4OPZ A;  5CER A;  1Q2Q A;  5TGF A;  4FSF A;  5DTT A;  4ZJ3 A;  2PBY A;  1TEM A;  2QZ6 A;  4OLG A;  3PBT A;  1YM1 A;  1KDW A;  2VGJ A;  2WAF A;  2A49 A;  4KZ9 A;  5CGS A;  2ZC4 B;  2Z2L B;  3VP1 A;  1MY8 A;  3A3I A;  2RCX A;  4HES A;  4N1X A;  4PM8 A;  4WMC A;  1KE4 A;  4N9L A;  4X69 A;  1YMX A;  3BRM A;  5U47 A;  4B4X A;  4OVD A;  4OP5 A;  2QPN A;  4WMC D;  4PM5 A;  5A90 A;  3MZD A;  4LEN A;  3M2K A;  1GHP A;  1BUL A;  3N4I A;  3C4P A;  3UE0 A;  3G2Y A;  3CG5 A;  4JXS A;  1L2S A;  2ZC5 B;  2HPB A;  3G31 A;  3NIA A;  3GRJ A;  1BT5 A;  3WS5 A;  5FQI A;  4E3K A;  1K38 A;  4RA7 A;  3FKW A;  5EOE A;  2P9V B;  1NJ4 A;  4WEK A;  5EVI B;  2I72 A;  3HLC A;  4P0M A;  4DF6 A;  1ONG A;  3PBR A;  3W8K A;  1MPL A;  3OPR A;  4MBK A;  4ZDX A;  1DJB A;  4RVA A;  1E4D A;  3UY6 A;  2ZQD A;  2RL3 A;  1KGF A;  4MNR A;  1I2W A;  3SS4 A;  3TG9 A;  1NY0 A;  5GLB A;  3MZE A;  3QNC A;  2H0T A;  4UA6 A;  4JF4 A;  2Y59 A;  4XUZ A;  3ZG7 B;  3HLG A;  1U60 A;  4BLM A;  3IF6 C;  3V5M A;  4DRT A;  1K57 C;  1C3B A;  2J9P A;  3UE1 A;  5HAQ A;  4P85 A;  1K54 A;  4UAA A;  2WUQ A;  2ZLY A;  4S2M A;  4QU3 A;  5KMW A;  2V2F F;  3HLD A;  5I94 A;  4Q8I A;  1L0G A;  4GZB A;  4DKI A;  2OSU A;  4OP8 A;  1W7F A;  2Q9N A;  1NXY A;  3OCL A;  1HTZ A;  2XLN A;  4FH4 A;  4RX3 A;  3SS3 A;  2P74 A;  1ZC2 A;  5FI6 A;  5FAO A;  4IBX A;  3VMA A;  1Q2P A;  3PBQ A;  4OPY A;  5HFO A;  4IVK A;  3OPH A;  4RX2 A;  1GHI A;  2XFS A;  4ZTK A;  3GMW A;  5CEC A;  4PM7 A;  4DE2 A;  3SOI A;  1JWV A;  1M40 A;  1FCN A;  2ZC6 B;  3Q82 A;  4R0Q A;  3GTC A;  4KZ8 A;  2ZJ9 A;  3NY4 A;  2HP5 A;  3RJU A;  4BJP A;  2ZC3 B;  3N8L A;  4X55 A;  2C6W B;  1SHV A;  1VQQ A;  1ZG4 A;  1BLP A;  1Z6F A;  2Y2P A;  1ERO A;  3MZF A;  4N1H A;  1BLH A;  3A3F A;  4N92 A;  3BFC A;  4OOY A;  3VOY A;  3JYI A;  2Y2K A;  5FAQ A;  3UDX A;  1E3U A;  3BLS A;  1XA1 A;  1FQG A;  1XGI A;  2B5R A;  3CMZ A;  4GB7 A;  3ZG5 A;  4BD1 A;  3VSL A;  1E3U D;  5CXW A;  5EUA A;  5GHZ A;  4KZB A;  2ZQ8 A;  1TDL A;  2EXA A;  4OKP A;  4WZ5 A;  2R9X A;  4JF6 A;  3Q81 A;  3UDI A;  2Y2Q A;  1K6S A;  1WYC A;  4A5R A;  4U3T A;  3PTE A;  3G30 A;  1AXB A;  3IWQ A;  3FWL A;  5GLC A;  4ZJ1 A;  3FYZ A;  1KDS A;  3Q7Z A;  4GDB A;  3ZHH A;  4EBL A;  5KZH A;  5FQJ A;  3ZNY A;  2ZQ7 A;  3WWX A;  3A3E A;  5HL1 A;  2OLU A;  3G2Z A;  4JLF A;  3MKF A;  4S2O A;  1GA9 A;  3MXR A;  1ERM A;  4UA9 A;  5FSR A;  4UA7 A;  4JXV A;  1YLT A;  1FSW A;  4H8R A;  5FQK A;  3VP3 A;  5IHV A;  4EV4 A;  3Q7V B;  1FSY A;  1O07 A;  3OPP A;  3CZD A;  5TR7 A;  1ALQ A;  5CGX A;  4NET A;  3UPO A;  3DWZ A;  1KGG A;  4KZ6 A;  4E3J A;  1PWD A;  1PYY A;  4FD8 A;  1G6A A;  4JKT A;  5E2F A;  3VP4 A;  1PWC A;  3WS4 A;  3IXH A;  4JF5 A;  4RYE A;  1YLW A;  5FI2 A;  3UE3 A;  3WS0 A;  5KSC A;  4LV3 A;  1MBL A;  3G4P A;  3FV7 A;  4R3J A;  5CHM A;  4DE0 A;  3IT9 A;  1H8Z A;  4QD4 A;  3AGD A;  4NK3 A;  2JCH A;  2WZX A;  2WZZ A;  5FAS A;  3ZVW A;  1LHY A;  4LV2 A;  2Y2L A;  4Z9Q A;  3TOI A;  4CPK A;  4QJG A;  1JTD A;  4EBN A;  3WRZ A;  4KG2 A;  1G68 A;  2H0Y A;  4B4Z A;  4GNU A;  3N6I A;  4OQ0 A;  1I2S A;  4N9K A;  4P6B A;  4JXW A;  3QNB A;  4OOM A;  3NC8 A;  4GKU A;  4U0T A;  4K91 A;  3IWO A;  3IHA A;  5F83 A;  1XA7 A;  2QMI A;  2ZM2 A;  3HLB A;  4QB8 A;  1W79 A;  2HP9 A;  1MKI A;  5JYO A;  1L0D A;  3VP2 A;  1FCM A;  3WS2 A;  4IED A;  2Y2J A;  2VGK A;  5EPH A;  1JVJ A;  1W8Y A;  1WE4 A;  4L0L A;  1K55 C;  4XXR A;  5EVI C;  4ZJ2 A;  1HD8 A;  2Y2G A;  1I5Q A;  1XXM A;  4EQI A;  2J7V A;  1K6R A;  2EX6 A;  3BFF A;  3M6B A;  5DF8 A;  5L2F A;  4JPM A;  4E3I A;  4MBH A;  2G2U A;  3IH8 A;  5GL9 A;  1PW1 A;  3D4F A;  5EEC A;  4KZ4 A;  1W8Q A;  3IWI A;  4D2O A;  4BL2 A;  5FA7 A;  3OC2 A;  1FCO A;  4BL3 A;  5EVI A;  1PIO A;  3IH9 A;  3ITA A;  4OLD A;  4XUX A;  3VP0 A;  3AGF A;  3PBN A;  1H8Y A;  1M6K A;  3VSK A;  1HVB A;  5F1F A;  3BFD A;  3LEZ A;  2FFY A;  1LL5 A;  4DXB A;  3C7V A;  2WGW A;  3V39 A;  1ES2 A;  2WYX A;  4X68 A;  3ZNT A;  4FH2 A;  5AQ7 A;  4BQM A;  3N8R A;  3GVB A;  4X56 A;  3ITB A;  4QY5 A;  3VFF A;  1KE0 A;  4OON A;  1O7E A;  1ES3 A;  4KQQ A;  1MWS A;  3S4X A;  3IF6 A;  3BYD A;  5GHY A;  3G32 A;  1K57 A;  4O7D A;  4JBF A;  3ZG9 B;  2DCF A;  1FR1 A;  1IKG A;  1RP5 A;  3MKE A;  4Y0T A;  1KVL A;  1IYP A;  3BEC A;  3MBZ A;  2EX8 A;  1L0F A;  1RCJ A;  1TDG A;  4KQR A;  2H5S A;  4MLL A;  2J9O A;  1NZO A;  2C5W B;  2Y2O A;  3ZG8 B;  1DJA A;  3HL9 A;  3RXW A;  1L0E A;  1XP4 A;  2XDM A;  1PI4 A;  4KQO A;  1NRF A;  5F82 A;  1XKZ A;  5GLA A;  1N4O A;  4WZ4 A;  3M2J A;  2EX9 A;  1XPB A;  3SS5 A;  5DVA A;  1E25 A;  1DY6 A;  2Y55 A;  1BLC A;  3HVF A;  4U0X A;  3UO9 A;  5FQ9 A;  2BLS A;  1BZA A;  2WGV A;  4IVI A;  4ZBE A;  5BOH A;  1ERQ A;  4KG5 A;  1CK3 A;  1PI5 A;  4C3Q A;  5DF7 A;  3HLW A;  3N8S A;  3I7J A;  5FAP A;  5M1A A;  1JTG A;  1PZO A;  2XGN A;  3NBL A;  5CGW A;  5FQQ A;  5CRF A;  2JBF A;  1LL9 A;  2EFU A;  4R3B A;  4Y0U A;  1MWR A;  2Y2M A;  3SH9 A;  5HAP A;  3C5A A;  1QMF A;  2ZQA A;  5DF9 A;  1YLZ A;  4X53 A;  2E8I A;  1NYM A;  3P09 A;  1CEG A;  2J8Y A;  3BLM A;  2WAE A;  1IEM A;  1ESU A;  3LCE A;  1ZG6 A;  5FDH A;  2WGI A;  2Q9M A;  2OV5 A;  2ZM8 A;  3FZC A;  2WKI A;  5F1G A;  2UWX A;  1PWG A;  1NZU A;  2Y2I A;  4E6X A;  3AGE A;  4ZAM A;  1FOF A;  3RXX A;  1W5D A;  5A93 A;  1GA0 A;  3ZCZ A;  5CHJ A;  4PM9 A;  2HDR A;  2XH9 A;  3O87 A;  1KE3 A;  1IYQ A;  1QME A;  1IKI A;  3OCN A;  4GD8 A;  4DE3 A;  4OQH A;  3HUM A;  5CEB A;  4S2I A;  4OPQ A;  3IHB A;  1BLS A;  2EX2 A;  4OH0 A;  2GDN A;  4Y7P A;  1CI9 A;  5AQ9 A;  1JWP A;  1FR6 A;  4E3O A;  3IXB A;  1YLY A;  1Y54 A;  4YFM A;  1BUE A;  3V3S A;  1SCW A;  3IF5 A;  3GR2 A;  3LO7 A;  1ESI A;  2V20 A;  4MBF A;  4OQG A;  5CTM A;  2ZQ9 A;  3IXG A;  5CED A;  3OPL A;  1XGJ A;  3DTM A;  2HDQ A;  2Y2N A;  5EVL A;  4E3L A;  3DWK A;  4KZ5 A;  4WEL A;  4ID4 A;  5HAI A;  3Q07 A;  4OPR A;  5EE8 A;  4DXC A;  2X71 A;  1LI9 A;  5TFQ A;  1BSG A;  3ZVT A;  3W4O A;  1MXO A;  5HX9 A;  4E3M A;  4HBT A;  3LY3 A;  3WS1 A;  4B88 A;  1BTL A;  2Z2M B;  4QHC A;  5E2H A;  1IYS A;  3V3R A;  4QY6 A;  4WM9 A;  1MWU A;  2EFX A;  3G35 A;  4LV0 A;  3PBS A;  3GQZ A;  3S22 A;  3E2K A;  3S1Y A;  5E2G A;  2XF3 A;  3GV9 A;  4JXG A;  4WEJ A;  5A91 A;  4EBP A;  3SH8 A;  4MEZ A;  3E2L A;  3O3V A;  4R4R A;  3VOZ A;  1SDE A;  4LCL A;  4CJN A;  5AQA A;  1IEL A;  4E3N A;  4GD6 A;  2WKE A;  2OLV A;  1N9B A;  5DTK A;  3UPP A;  1K55 A;  1ES5 A;  2P9V A;  5A92 A;  1EI5 A;  1YQS A;  2EXB A;  1K54 C;  1PW8 A;  5EVI D;  1GHM A;  3N7W A;  1MWT A;  1DJC A;  4IBR A;  4UHU A;  1ONH A;  4PM6 A;  2WGW B;  1YLJ A;  5M19 A;  1GCE A;  5GLD A;  3BEB A;  1LLB A;  2CC1 A;  1TVF A;  5HW3 A;  3PBO A;  2JE5 A;  3IF6 B;  1NYY A;  4YIN A;  4K0W A;  2IWB A;  1EWZ A;  3W4Q A;  4LV1 A;  2PU2 A;  1XX2 A;  2ZC7 A;  3Q1F A;  2V1Z A;  3UPN A;  3PAG A;  4Y0O A;  1SDN A;  4EWF A;  3HLF A;  4BEN A;  2XK1 A;  1J9M A;  2Y2H A;  1KVM A;  5EOO A;  1PZP A;  4S2L A;  3DW0 A;  2DNS A;  2FFF B;  2A3U A;  2WKH A;  2Y4A A;  3O88 A;  5CHU A;  5G18 A;  4C75 A;  1K56 A;  4PMA A;  3PAE A;  4KZA A;  1RGZ A;  4R1G A;  2HDU A;  1WYB A;  1K56 D;  1JWZ A;  3GSG A;  3NDG A;  2XFT A;  2ZM0 A;  4KG6 A;  3BFG A;  1CEF A;  3HRE A;  4S2N C;  2IWC A;  4GN2 A;  4OOL A;  3UN7 A;  4E6W A;  2HP6 A;  3HBR A;  4WZ5 C;  2WAD A;  1YLP A;  3ISG A;  2ZD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...