3SOIA

Crystallographic structure of bacillus licheniformis beta-lactamase w210f/w229f/w251f at 1.73 angstrom resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDFMKRNTTGDALIRAGVPDGFEVADKTGAASYGTRNDIAIIFPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title X-ray evidence of a native state with increased compactness populated by tryptophan-less B. licheniformis beta-lactamase.
pubmed doi rcsb
source organism Bacillus licheniformis
total genus 90
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3soiA00
3BEBA 4FSFA 1NZUA 1PW8A 3UPPA 4OLDA 2ZM8A 1OMEA 4OPZA 1VQQA 2ZC5B 4BL2A 2A49A 4XUXA 3HLGA 4BJPA 2WGWB 2ZJ9A 5EVID 1O07A 1ERQA 1YT4A 3WS1A 1YM1A 5A93A 5KMWA 3ITAA 1YLTA 3BRMA 4HEFA 4X56A 5JYOA 2WGVA 3VP4A 3NIAA 4WZ4A 1L0GA 3PBOA 2ZC6B 1PWGA 4EBNA 1GA9A 4FD8A 1MWSA 5EVIC 4E6XA 2CC1A 5F83A 5FASA 4E3JA 2HDRA 2VGJA 4FCFA 3Q7VB 4ZJ1A 5F1FA 4OP5A 5EUAA 5EVIB 3RJUA 3FV7A 4YINA 4OQ0A 1MBLA 3NDGA 4JXVA 1HD8A 1PZPA 1ALQA 5GLAA 2X02A 1ONHA 2R9XA 3HBRA 4WYYA 5F1GA 4NK3A 5CGSA 3PBTA 4BQMA 4F94A 5CRFA 4OH0A 1EI5A 2WZXA 3JYIA 4KZ6A 1XGJA 2Q9NA 1W8QA 4JXWA 5GHXA 3GTCA 4M3KA 1XKZA 3WS5A 4LV0A 3LCEA 4S2KA 3PAEA 3BECA 1N9BA 1M6KA 2EX9A 2HDQA 2HDUA 1NYYA 3IT9A 3Q82A 3IQAA 4KZAA 3VFHA 4DRTA 3SS5A 3A3JA 1ES3A 4P6BA 3NI9A 3VP2A 5CEDA 1PZOA 1FQGA 4OOLA 5DF9A 3IWIA 3NC8A 4ZJ2A 3LY3A 1IELA 2V20A 1K25A 2H0YA 1K54A 3MZFA 2XFSA 5HAIA 5D3OA 1ES2A 3PAGA 4UA7A 4KZBA 3MXRA 1XA1A 4MNRA 2H10A 1G6AA 2X71A 4EBPA 1YLWA 1CEGA 4JF5A 1TDGA 1LI9A 5EOEA 4DE1A 4QD4A 1GCEA 1LL5A 1YMXA 4JF6A 4DE0A 2UWXA 3C7VA 4R1GA 3LEZA 1GHMA 4GD8A 4GD6A 3BLSA 4UA6A 4P85A 4E3IA 2RL3A 3WS2A 1Z6FA 1EWZA 5BOHA 5CGXA 5CTMA 2OLUA 3WS0A 5GLBA 3BLMA 2ZD8A 4X68A 4X53A 1YLZA 2JBFA 2JCHA 3IHBA 2ZLYA 4IVIA 2ZQ9A 5J8XA 4Y0OA 3VFFA 2J9OA 4OKPA 1NJ4A 1VM1A 3OPRA 4BL3A 4S2PA 5FI2A 1QMFA 3DW0A 4GN2A 4KQQA 2Y2KA 3O86A 3D4FA 3PBQA 3GSGA 3TG9A 2RCXA 1FCOA 1K54C 1K6SA 1XXMA 4KQOA 4DXCA 5I94A 4PM8A 4B88A 2Y2IA 4H8RA 3VSLA 4MBHA 3V39A 4RYEA 4S2LA 4BLMA 4EQIA 3BFCA 3HL9A 3QHYA 4GDNA 2XDMA 3OC2A 4EV4A 1BZAA 4R3JA 2Y91A 2PBYA 5E43A 1SDNA 1IYQA 1BLCA 3VP1A 2WAFA 4HBUA 2Z2MB 1GA0A 2DNSA 4MBKA 1K56A 4DDYA 3ZCZA 4WZ5A 1KE4A 2WK0A 2ZC4B 3VOYA 1BSGA 1ZC2A 1O7EA 2Y59A 5FSRA 3HLWA 1I5QA 3UDFA 3TSGA 3GMWA 3HUMA 1FOFA 3OZHA 5E2EA 2QMIA 2WKEA 3EQUA 1DJCA 1NXYA 3IXHA 4PPRA 3PBRA 4E3NA 4K0WA 1H8ZA 3VSKA 4OOMA 4IVKA 2C5WB 4KZ5A 4KZ4A 5KSHA 3W4PA 4C6YA 1KVMA 5HL1A 5AQAA 5M19A 4LV2A 3RXXA 1ERMA 1K56D 4RX2A 3QNCA 3ZGAB 4IEDA 3GRJA 3RXWA 3HLCA 3Q1FA 1JTDA 4IBXA 1L0DA 5DF8A 4Y0UA 3G2ZA 4E3KA 2ZC7A 1K38A 2R9WA 4HESA 1K55A 1YLPA 4OPRA 1H5XA 3PBSA 2XH9A 2ZQDA 3DTMA 4U0TA 2V2FF 1W79A 5FQJA 1L2SA 2HP5A 4WZ5C 1C3BA 5GLCA 1DY6A 2FFYA 2B5RA 3S1YA 3UE0A 3G34A 3M6BA 1E3UA 2XQZA 4PM5A 4GZBA 2XEPA 2ZM2A 4BENA 2WGIA 1XA7A 2P74A 1BTLA 4PM6A 2WKHA 3ZG9B 3MKFA 4DDSA 4C75A 3CJMA 3LY4A 3S4XA 3G35A 2Y2JA 3BFEA 4YFMA 1KVLA 1JWPA 2P9VA 3OCNA 2WAEA 1U60A 3AGDA 1ZG6A 4Z9QA 1S6RA 4WELA 5CTNA 4B4ZA 2Y2MA 3ZFZA 5CECA 5HAPA 3W4QA 3ZVWA 1H8YA 3HVFA 3VP3A 4U0XA 2J8YA 4JKTA 3C5AA 1E3UD 1GHPA 1NRFA 1LI0A 4OQGA 4ID4A 4BD1A 1K55C 2IWDA 2ZM0A 5EOOA 5E2FA 4FH4A 4DXBA 3AGEA 1XX2A 1K4EA 5AQ9A 4KZ7A 1GHIA 1JTGA 4FH2A 3WS4A 1XPBA 5HARA 3BFFA 1LL9A 3BFGA 1CI8A 2EXBA 5FDHA 2E8IA 4B4XA 1NYMA 2ZQAA 4Y0TA 1KDWA 3OPLA 3GVBA 3N8RA 1WYBA 3ZNYA 4DE2A 2HP9A 4U3TA 1N4OA 4E3OA 1W8YA 3W4OA 1BT5A 3QNBA 1IYOA 3V3SA 2ZC3B 3IWQA 3IXDA 4KG6A 2HDSA 4P0MA 2IWBA 3UE3A 1MWTA 4ZAMA 5E2GA 1JVJA 4A5RA 1RGZA 2XFTA 2Y2NA 4X55A 3N8LA 5F82A 4XXRA 3BM6A 2P9VB 4KG5A 4GDBA 2QZ6A 3G31A 4X6TA 2WZZA 1BULA 2OSUA 1FSYA 1G68A 2PU2A 2XF3A 3N8SA 4N9KA 4LV3A 5TFQA 1MPLA 4X69A 2XGNA 3ZNTA 4ZDXA 3CG5A 1KDSA 5M1AA 4UHUA 1TDLA 1IKIA 3V50A 3N7WA 4JXGA 1LHYA 2I72A 2ZQ7A 3UY6A 4PM9A 4N9LA 4GNUA 3A3FA 2DCFA 1ONGA 2ZQCA 4S2IA 4C3QA 2Y2OA 2WADA 2Z2LB 2XK1A 1PI5A 4GKUA 5CHMA 1MWUA 1BLSA 3HLFA 4GB7A 3MZEA 1MWRA 4RX3A 3V3RA 2Q9MA 5CXWA 3TOIA 5EVLA 4NETA 4JXSA 3WRTA 4CPKA 1KGFA 3GR2A 3PBNA 3HLEA 5DTKA 5FQMA 2HP6A 3MZDA 1JWVA 2G2UA 2EX2A 2EFUA 5IHVA 2H0TA 3HREA 4JBFA 2EX6A 3VMAA 4KZ3A 2XD5A 1HTZA 3SS3A 4MEZA 1I2SA 4ZJ3A 4OPYA 1AXBA 2G2WA 1QMEA 3EQVA 5AQBA 1RCJA 1L0FA 5FATA 1YMSA 3FKWA 1IYPA 2J7VA 1TEMA 5FQQA 3SH8A 1YLYA 4LCLA 1WYCA 1XP4A 3N4IA 1ES4A 4UA9A 3UO9A 3FYZA 4K91A 4WMCA 2Y2PA 3MXSA 5GHYA 5FAQA 2EX8A 3M6HA 3ZG8B 4WEJA 2PU4A 2IWCA 3C4PA 3FKVA 4R4SA 4S2MA 3P98A 3OCLA 4ZTKA 3OPHA 5CEBA 1MKIA 3VP0A 1SHVA 4QB8A 4MBFA 1HZOA 4Y7PA 5FI7A 3BFDA 3WRZA 1FR6A 3C4OA 3HLDA 2Y2QA 1TVFA 3IH8A 5HX9A 3P09A 4QHCA 4E3LA 1IYSA 1FCNA 2Y55A 4BD0A 3IH9A 2Y2HA 2WYXA 1HVBA 3VOZA 4WMCD 1Q2QA 1YQSA 1WE4A 4JF4A 2OV5A 3ZG0A 5HAQA 5FA7A 1E4DA 5DTTA 4EUZA 5A90A 5GL9A 3HUNA 3UE1A 3Q7ZA 1J9MA 4LV1A 2VGKA 4S2JA 5EPHA 1PI4A 3E2LA 1ESIA 1ZKJA 3UDXA 3ZDJA 4QJGA 2Y2LA 3B3XA 1K57C 1MY8A 4DE3A 5FQIA 3V5MA 2Y4AA 1PWCA 2JE5A 3Q81A 3M2JA 2X01A 3NBLA 4JLFA 4N1XA 4E6WA 3ZHHA 4MLLA 3IF6A 1DJBA 4R3BA 1BLPA 1CI9A 3GQZA 1L0EA 1SCWA 4KQRA 4OQIA 4OPQA 3G4PA 3ZVTA 1E25A 3BYDA 1EROA 5CERA 4KENB 3GV9A 4RVAA 4WBGA 3IXBA 4LENA 1Q2PA 5L2FA 5EECA 3S22A 2OLVA 4CJNA 1KGGA 5FQKA 3OPPA 3SH7A 3DWKA 3UDIA 3UPNA 2J9PA 4XUZA 1SDEA 4RA7A 1ESUA 5FAPA 5DF7A 5EE8A 4HBTA 2WUQA 2XLNA 2FFFB 3IHAA 1KGEA 4P87A 2DRWA 3N6IA 4DKIA 4DF6A 1SKFA 1KE3A 1W7FA 4R0QA 3PTEA 4N1HA 4QU3A 2ZMAA 3A3DA 3E2KA 1K4FA 1DJAA 1LLBA 3SOIA 4PMAA 2XD1A 3HUOA 2JC7A 1KE0A 4KZ9A 3A3IA 1ZG4A 4OP8A 4UAAA 1NZOA 2Y2GA 3DWZA 1PIOA 1K6RA 2BLSA 2EXAA 5CGWA 4QY5A 2C6WB 3AGFA 4N92A 1MXOA 5KSCA 1YLJA 3IF6C 4PM7A 3SH9A 5CHJA 4OOYA 3M2KA 4IBRA 4EBLA 3IWOA 4S2NA 1PYYA 2QPNA 3Q07A 3IF6B 3G2YA 4WEKA 3HLBA 4R4RA 2HPBA 3WWXA 3IF5A 3UN7A 5U47A 4JPMA 5A92A 5DTSA 4K0XA 5AQ7A 4GOGA 1NY0A 1Y54A 4QY6A 3ZG7B 3IXGA 3MFDA 1CEFA 3SS4A 1XGIA 3A3EA 5CHUA 5TR7A 1FCMA 1S0WA 2WGWA 3O3VA 1M40A 3O88A 2V1ZA 2ZQ8A 5JYPA 4OLGA 5G18A 5KZHA 3FWLA 1IKGA 5FAOA 4KZ8A 2BG1A 2H5SA 4Q8IA 2XR0A 3CMZA 2A3UA 3LO7A 5HW3A 4O7DA 3G32A 5TGFA 4OONA 4R23A 3O87A 1IEMA 5FI6A 5E2HA 3MKEA 4OVDA 3NY4A 3ISGA 1CK3A 4ZBEA 4L0LA 2WKIA 4WM9A 5A91A 4S2OA 3Q7VA 4S2NC 3NDEA 1BLHA 5EVIA 3ZG5A 2EFXA 4D2OA 1BUEA 3NCKA 1W5DA 1ES5A 4OQHA 1RGYA 4LCMA 3C7UA 1FR1A 3G30A 5FQ9A 1PW1A 3W8KA 3CZDA 1JWZA 5M18A 5HFOA 2GDNA 3I7JA 4EWFA 3UNWA 3FZCA 5GHZA 1K57A 5GLDA 5DVAA 4KG2A 1FSWA 1RP5A 3UPOA 4E3MA 3ITBA 3MBZA 1PWDA 1I2WA
chains in the Genus database with same CATH superfamily
1PW8A 3UPPA 4OLDA 4OPZA 1OMEA 1VQQA 4BL2A 2WGWB 2PYPA 1YT4A 2O9AA 1YM1A 3ITAA 1YLTA 3BRMA 5JYOA 4KUKA 3K2NA 4FD8A 4E6XA 5F83A 2JHEA 2VGJA 2QWSA 1PZPA 1H0MA 2R9XA 2V1AA 5CGSA 2XSSA 5CRFA 2E8JA 1XGJA 4JXWA 2LB5A 3ULFA 4LV0A 3LCEA 1S67L 1N9BA 4I39A 3BWLA 3T50A 4ZJ2A 3LY3A 3KSHA 2QJ7A 3H82A 2OWJA 2HGVA 3PAGA 4UA7A 4KZBA 1TS7A 2H10A 1G6AA 2JKTM 1XFQA 5EOEA 1GSVA 1YMXA 4DE0A 2W3GA 1GHMA 3EGXC 4GD6A 3BLSA 4UA6A 4P85A 5BOHA 3WS0A 4X68A 2J3TC 3IHBA 3LI8A 2ZQ9A 5EM0A 3LIDA 3MR0A 3UB9A 1S4SA 4OKPA 1NJ4A 4BL3A 5FI2A 3DW0A 1LL8A 3O86A 2RCXA 1K6SA 3EOIA 4NG2A 5I94A 2Y2IA 3VSLA 4QWOA 4Z1WA 4S2LA 4GDNA 2XDMA 1BZAA 5HPIA 3GECA 1SDNA 4HBUA 2YKHA 4JGOA 4WZ5A 2ZC4B 4F3LA 3CPTB 1T18A 3UDFA 3GMWA 3H9WA 4NXGA 1ACFA 1NLZA 4ETZA 1NXYA 3PBRA 4PAUA 1H8ZA 2QHKA 5HWWA 5G4YA 1K56D 4RX2A 2PHYA 3ZGAB 3HLCA 2A2LA 1L0DA 4HOIA 4Y0UA 1OTAA 2HF6A 2ZC7A 4E3KA 1S1ZA 1K55A 5J4EA 1YLPA 1H5XA 1AWIA 2ZQDA 2V2FF 1L2SA 4WZ5C 1C3BA 2VZWA 2FFYA 2B5RA 3UE0A 3M6BA 3QP6A 2ZM2A 2P74A 4DDSA 1SKOA 3CJMA 3S4XA 2Y2JA 4YFMA 3BJNA 3MQ0A 2WAEA 3AGDA 1UWNX 3PR6A 4Z9QA 4WELA 5CECA 5HDCA 3HVFA 3C5AA 2HZ5A 1LI0A 4OQGA 2P7JA 4BD1A 1K55C 5EOOA 4AFIA 3AGEA 3R4KA 5AQ9A 3LGOA 2V8FA 3WS4A 5HARA 1UWPX 2VK3A 1VHMA 2E8IA 4B4XA 4Y0TA 3P01A 3GVBA 3N8RA 1WYBA 2J3TD 4DE2A 2HP9A 4U3TA 3EEHA 5F5YA 1DP8A 2IWBA 4A5RA 4O0PA 1RGZA 4H6JB 4KG5A 5TJJA 4X1MA 1FSYA 1G68A 1N9OA 4WN5A 5TFQA 4ZDXA 5DKKA 1NLYA 4PM9A 4GNUA 3A3FA 3DBAA 2J80A 2PAVP 1XJ2A 2ZQCA 4C3QA 1STZA 4RX3A 3MZEA 1MWRA 1ZTUA 3TOIA 5CXWA 2WKPA 1S1YA 4JXSA 3WRTA 3SZTA 3HLEA 2JKTI 2EFUA 2EX6A 3SS3A 3F1PB 1NWZA 1L3LA 4II7A 5AQBA 2B02A 2VJWA 1L0FA 4DJ3A 4GS9B 3C30A 4XT2A 4LCLA 3RH8B 2O99A 1WYCA 3LUQA 4K91A 3NECA 4WEJA 3P98A 4QB8A 1HZOA 2PRFA 5DJTA 4L9GA 3BFDA 2D01A 4GHIB 2PR6A 3S7NA 3C4OA 3HLDA 2Y2QA 2ZL1A 4QHCA 4BWIA 2V8CA 4CLCA 3F1OB 3ZG0A 1E4DA 5A90A 2XROA 4L9EA 5HSQA 3MSHA 2Y8HA 3B47A 3ICYA 4S2JA 5EPHA 4QJGA 2Y2LA 1K57C 3V5MA 2JE5A 4JLFA 4E6WA 2HV1A 4I3JA 3BQ8A 3GQZA 1L0EA 2JN7A 3G4PA 3L7HA 2W1TB 4RVAA 1Q2PA 5L2FA 5EECA 4R3AA 4CJNA 3LR5A 3G6OA 3OPPA 4CLCC 5DF7A 5EE8A 1G28A 2XLNA 2FFFB 3T4OA 1KE3A 5HPFA 3E2KA 1K4FA 1KE0A 3JVUA 3MJQA 3A3IA 4LRZE 1G5UA 3DWZA 1OJGA 2C6WB 1P97A 4X1LA 4PM7A 4WUJA 2PDRA 3IWOA 3NJAA 4EEUA 4PKYA 3LIBA 2K7SA 4WEKA 3HLBA 3WWXA 1P0ZA 4HH3A 5G4ZA 1YSPA 4G3WA 3SS4A 4Y5FA 1S0WA 3O3VA 3R7WB 4GHIA 4HY8A 2LB9A 2GZAA 2H5SA 5CX7A 5TGFA 2KLIA 4Y15A 5E2HA 2BASA 3ISGA 1CK3A 5A91A 2K31A 3ZG5A 3MF0A 1ES5A 4LCMA 2GJ3A 2GDNA 3I7JA 2VEAA 4Y17A 2PT7A 3FZCA 5GHZA 5DVAA 1FSWA 4E3MA 3VP1A 3KSIA 4ETXA 5AVEA 2ZM8A 2A49A 4XUXA 1CQAA 2PR5A 5EVID 4NXFA 3HJKA 4X56A 4NKPA 3PBOA 2ZC6B 5FASA 4E3JA 2HDRA 3KSGA 4LRYC 1XJ3A 4OP5A 3NDGA 4JXVA 2W3FA 3T1QB 3HBRA 1V9ZA 4F94A 3EGDC 1EI5A 4KZ6A 2ZMVA 5I5LA 1MKMA 3GTCA 3H7WB 1D7EA 3WS5A 2EX9A 2VX8A 3VFHA 1NYYA 3IQAA 3A3JA 1ES3A 4P6BA 5CEDA 4OOLA 3IWIA 2V20A 1K25A 4EETB 2H0YA 1K54A 3MZFA 3V67A 1ES2A 4HNBA 4EBPA 2ACGA 1GCEA 1XJ4A 3C7VA 3B33A 4GD8A 4NEED 2EA9A 2ZOHA 1EWZA 5CTMA 2OLUA 5GLBA 2ZD8A 2JBFA 2JCHA 2ZLYA 3TRCA 1TS0A 2A24A 4Y0OA 5C5KA 4S2PA 1Y28A 4GN2A 3TG9A 3PBQA 1FCOA 1K54C 4KQOA 4PM8A 1GSWA 4B88A 4MBHA 4EQIA 4NXBA 3HL9A 3QHYA 3H82B 4P6ZM 4YNRA 3OOVA 1W63M 2Z2MB 2M7VA 1K56A 3GDIA 3ZCZA 1KE4A 2WK0A 4ESPA 1ZC2A 5FSRA 3HLWA 3TSGA 2W3DA 2QMIA 3H7WA 4E3NA 4K0WA 4KZ4A 4HI4A 5M19A 5HL1A 3T4SA 4LV2A 1ERMA 3RXWA 3A0VA 1JTDA 4IBXA 3B42A 3G2ZA 4OPRA 3DTMA 1W79A 1OT6A 3BY8A 2OAP1 4HIAA 3G34A 3QP1A 4GZBA 4BENA 4F3LB 2WGIA 4PM6A 1BTLA 3ZG9B 1X0OA 3BFEA 3TJZC 2P9VA 3OCNA 3VOLA 5EVEA 4B4ZA 3UE6A 1YSQA 1NRFA 3U2AA 4HJ4A 5E2FA 2JKRI 4MN5A 1EW0A 5L10A 1GHIA 3T4QA 3OLOA 3BFFA 3SW1A 1NYMA 1KDWA 3W2ZA 4E3OA 1IYOA 3V3SA 2ZC3B 5L09A 3UB6A 1SKOB 4EUVA 1JVJA 3D72A 2QZ6A 3G31A 4X6TA 2WZZA 3BQAA 2OSUA 5HWTA 1Z09A 4N9KA 3E4OA 4X25A 1D06A 2XGNA 3CG5A 1KDSA 5M1AA 4UHUA 2V1BA 4BBUA 1IKIA 3N7WA 2WKQA 2ZQ7A 3KYZA 2NUPC 1OTEA 4S2IA 4YWZA 3LI9A 4GJ4A 2Y2OA 4HQAA 4MN6A 5AJGA 2Z2LB 1PI5A 5CHMA 1MWUA 3HLFA 2V9AA 2W0NA 2Q9MA 3CHWP 4CPKA 1KGFA 3F1NA 1JWVA 2W27A 2EX2A 3HREA 2XD5A 1HTZA 3NOUC 4MEZA 4PKYG 4OPYA 3ZYTA 2G2WA 1YAXA 2INWA 1YKDA 3T4TA 3JVVA 4MMNA 1YMSA 3FKWA 1IYPA 3S7QA 3SH8A 4GLQA 4EW7A 1XP4A 1ES4A 4UA9A 3FYZA 2Y2PA 2EX8A 3CITA 2PU4A 3C4PA 2W3EA 4ZTKA 1MKIA 1SHVA 4Y7PA 4MN7A 4KUOA 2KOIA 3IH8A 1TVFA 5HX9A 2DMWA 2Y55A 2WYXA 5TBMA 3VOZA 4WMCD 3T4KA 4JF4A 2OV5A 2ZOIA 4EUZA 4QPRA 3HUNA 1KOUA 1PI4A 5K5BA 4EERA 5J3WA 4XT2B 1MY8A 5FQIA 2Y4AA 1PWCA 3Q81A 3IF6A 4Y3IA 1CI9A 4KQRA 4OQIA 5FEGA 2JKGA 3GV9A 4WBGA 1KGGA 5FQKA 4HJ6A 4EEPA 1SDEA 4RA7A 3MQQA 2ZL1B 2HJEA 3IHAA 3LR3A 3T4JA 4DKIA 4CLCB 3N6IA 4DF6A 1SZVA 1SKFA 4R0QA 4QU3A 3TE8A 3A3DA 2VGLM 4ME4A 1FILA 4OP8A 1NZOA 2Y2GA 1PIOA 1K6RA 5CGWA 3AGFA 3FPVA 3IF6C 5CHJA 1T1BA 4GCZA 1S4RA 2HPBA 3UN7A 5U47A 5A92A 4GOGA 4IJGA 4CLCE 1Y54A 2KDKA 3IXGA 3MFDA 1XFNA 4Q0HA 3A3EA 1F9IA 1M40A 3O88A 4OLGA 3FWLA 2BG1A 3UB5P 5F6AA 2CMNA 4O7DA 1IEMA 4ZBEA 4L0LA 3Q7VA 1F98A 3NDEA 1BLHA 5EVIA 2EFXA 2ZMFA 1BUEA 1BYWA 4Q0JA 1N9NA 3C7UA 1PW1A 3CZDA 1JWZA 5M18A 5HFOA 1HLUP 1K57A 1PFLA 1RP5A 3UPOA 3BEBA 2ZC5B 3HLGA 2ZJ9A 1O07A 3KO6A 1LSXA 1XJ6A 3WS1A 5A93A 1VETA 4HEFA 3P7NA 3VP4A 4WZ4A 1L0GA 4EBNA 5HL6A 1MWSA 5EVIC 4IHQA 4BBVA 1PNEA 4DMZA 1VEUA 3VE4A 3FV7A 4YINA 4OQ0A 1MBLA 5GLAA 2X02A 3IBRA 3PBTA 2WZXA 5GHXA 4S2KA 3PAEA 3BECA 2HDUA 3Q82A 3NI9A 3VP2A 3BY9A 1FQGA 3VV4A 5DF9A 4B9OA 3NC8A 4Y13A 2QJ5A 2WKRA 5D3OA 1CEGA 1TDGA 1LI9A 3C8CA 5L07A 4DE1A 4QD4A 4JF6A 2L0WA 3LEZA 3EWKA 2RL3A 3WS2A 1Z6FA 1IFQA 2IA2A 1T19A 4GW9A 1YLZA 3S7PA 3VFFA 2J9OA 1VM1A 3OPRA 1OPXA 3QP2A 4KQQA 3D4FA 1OTBA 5HDSA 1N9LA 4DXCA 2FH5A 2FZ0A 2JKFA 4BLMA 4FOFA 4HHDA 4EV4A 4R3JA 4FUWA 5A8BA 1IYQA 5HDDA 2M1CA 2DNSA 2ZBBA 4DDYA 1O7EA 2Y59A 4P6ZS 2VKSA 3HUMA 1FOFA 3DTKA 3EQUA 1DJCA 2A24B 3IXHA 4PPRA 2P04A 3MXQA 4YOFA 3VSKA 4IVKA 4R38A 1CJFA 4LFUA 4C6YA 1KVMA 5KSHA 2J3WA 5DJUA 5F68A 4IEDA 4LRXC 1K38A 2OOLA 2R9WA 4JGQA 1H3QA 3PBSA 2GNXA 5FQJA 2HP5A 2OWHA 1OJ5A 3S1YA 2XEPA 1XA7A 3MKFA 5LBRA 3G35A 1KVLA 1JWPA 1ZG6A 5CTNA 4HP4A 2Y2MA 5HAPA 3VE3A 3ZVWA 4D60A 1E3UD 2B18A 3IS2A 4M4XA 4ID4A 2ZM0A 2IWDA 1K4EA 3KYEA 4KZ7A 4IUHA 1JTGA 1XPBA 1CI8A 5FDHA 3E98A 3OPLA 1N4OA 1BT5A 3CWFA 1W63Q 3IXDA 2HDSA 4B93A 3UE3A 4X55A 5F82A 2P9VB 4GDBA 2I9VA 1J3WA 4UEYA 3T1XA 2XF3A 3N8SA 4LV3A 4X69A 1TDLA 1LHYA 4IUKA 3LR4A 4N9LA 2DCFA 1ZHHB 5DFYA 2WADA 2XK1A 4GB7A 4FTXA 3V3RA 5EVLA 2BTFP 3PBNA 2HP6A 3MZDA 5EV0A 2H0TA 1LSWA 4JBFA 2MJ6A 1GSXA 4ZJ3A 1AXBA 4EXOA 2J7VA 1TEMA 1OTDA 3UO9A 4WMCA 3MXSA 5GHYA 5FAQA 3U4LP 3RTYA 3FKVA 3OCLA 3OPHA 2VV7A 4MBFA 3NULA 1VB6A 4O8GA 5FI7A 3WRZA 3P09A 3F1NB 3QP8A 4E3LA 1IYSA 1FCNA 3IH9A 2Y2HA 3MFXA 3E4QA 1YQSA 2W1RA 5DTTA 2Z6DA 5GL9A 4ARZA 3UE1A 3Q7ZA 4LV1A 2VGKA 3JPUA 3E2LA 2O0YA 3UDXA 3B3XA 5FEFA 4DE3A 1UGUA 1G6OA 2X01A 3NBLA 2Z6CA 4MLLA 1DJBA 1E25A 3BYDA 1EROA 5CERA 3IXBA 4LENA 4BMWA 3HJIA 3ZQ5A 3UDIA 3UPNA 2J9PA 4XUZA 1ESUA 2YKFA 4HBTA 2VV8A 2UV0E 4L9FA 4P87A 4UQIM 5TBMB 3PTEA 4N1HA 1DJAA 1LLBA 3SOIA 4PMAA 2PBDP 3CAXA 4KZ9A 4R70A 4PHTA 2EXAA 2XA7M 3SH9A 4OOYA 2B95A 3NOPC 4S2NA 3Q07A 3IF6B 3T4LA 2VGLS 3IF5A 5DTSA 4HH2A 1XGIA 2WGWA 2V1ZA 2ZQ8A 5G18A 4CQHA 4Q8IA 2XR0A 3CMZA 3QP5A 5HWVA 3RFBA 3LO7A 5HW3A 4OONA 4R23A 5FI6A 3MKEA 4Q0IA 3NY4A 4WM9A 4S2OA 4S2NC 2VV6A 4OQHA 1RGYA 3G30A 5FQ9A 1S66L 4EWFA 2W3HA 3UNWA 5GLDA 4KG2A 2L1MA 3ITBA 3FPWA 3MBZA 4FSFA 3D3OA 1NZUA 2Y79A 4K08A 4BJPA 4HJ3A 1ERQA 4MDZA 3T12B 5KMWA 4E04A 2WGVA 3NIAA 4I38A 3L9KA 1PWGA 1GA9A 2CC1A 4FCFA 5J7EA 3EEAA 3Q7VB 4ZJ1A 5F1FA 5EUAA 5EVIB 3KYQA 3RJUA 2O9BA 4I3IA 1HD8A 1ALQA 3LIAA 1ONHA 4WYYA 5F1GA 4NK3A 3LFVA 4BQMA 3C2WA 4OH0A 3JYIA 2Q9NA 1W8QA 3C38A 5HD5A 4M3KA 5IU1A 1XKZA 3A0SA 1M6KA 4DRTA 2HDQA 3UB7A 3IT9A 4KZAA 3SS5A 1ODVA 1TF1A 1VETB 1PZOA 1IELA 2XFSA 5HAIA 3MXRA 1XA1A 4MNRA 2X71A 1VEUB 1YLWA 4JF5A 1LL5A 2UWXA 4R1GA 4E3IA 1MC0A 3CPTA 5CGXA 3TW8A 3BLMA 3FG8A 3LIFA 4X53A 4IVIA 4RQ9A 5J8XA 1Y4OA 5MC7A 5HD3A 5HZHA 1QMFA 2Y2KA 4G3KA 5FDSA 3GSGA 3CUEA 1XXMA 4H8RA 3LICA 3V39A 4RYEA 3BFCA 3PXPA 3OC2A 2Y91A 2PBYA 5E43A 1BLCA 3HCYA 2WAFA 1OTIA 5EM1A 1GA0A 4MBKA 3VOYA 1BSGA 1I5QA 2QKPA 4R6LA 3OZHA 5E2EA 4MCWA 2WKEA 4O01A 3CUEC 4LLOB 3NHQA 1LSVA 4OOMA 1CF0A 2C5WB 4KZ5A 2KX6A 3O5YA 3W4PA 5AQAA 3RXXA 4JGRA 3QNCA 3GRJA 3Q1FA 5DF8A 1F2KA 3T1RA 4HESA 3MQOA 1FIKA 3UMEA 2XH9A 4U0TA 3KX0X 5GLCA 1DY6A 3MMHA 1E3UA 2XQZA 4PM5A 2P08A 2WKHA 4WLAA 2HJ9C 4C75A 3LY4A 4I3AA 3S7OA 2XRNA 4H6JA 1U60A 3KSFA 1S6RA 4EESA 3ZFZA 1NRJA 2QYBA 3UB8A 3W4QA 1H8YA 3VP3A 3IBJA 4U0XA 3DTIA 2J8YA 2V0UA 3BW6A 4JKTA 1GHPA 1DP9A 3E4PA 4FH4A 2H28A 4DXBA 1XX2A 5AVFA 4FH2A 4LGWA 1LL9A 3BFGA 2EXBA 2EWVA 4BBTA 2ZQAA 1H8MA 3ZNYA 1W8YA 3W4OA 3QNBA 4ZRRA 3IWQA 4KG6A 4P0MA 1MWTA 4ZAMA 5E2GA 2XFTA 2Y2NA 3N8LA 4XXRA 3BM6A 3F1PA 3K3CA 2L4RA 2O9CA 4WF0A 1BULA 1LT0A 2PU2A 5L8MA 1MPLA 4GS9A 3ZNTA 3IS2B 3LEQA 3V50A 4JXGA 2I72A 3UY6A 3DAVA 3LYXA 2AVXA 1ONGA 3CLOA 2V0WA 4GKUA 1BLSA 3FC7A 4Y2FA 4NETA 3GR2A 5DTKA 3PHYA 5FQMA 2G2UA 5IHVA 3VMAA 4KZ3A 1V9YA 3F1OA 1I2SA 1QMEA 3EQVA 5KIZA 1RCJA 4EU0A 3OBFA 5FATA 2OAQ1 3MS6A 5FQQA 1YLYA 3N4IA 1K0KA 1DP6A 5FL3A 3M6HA 3ZG8B 2Q0OA 2IWCA 4R4SA 4S2MA 1P9RA 2W1TA 5CEBA 1WA9A 3VP0A 1DRMA 3DTEA 2JKRM 1FR6A 2VA0A 1IOUA 4BD0A 1HVBA 3K3DA 1Q2QA 1WE4A 5HAQA 5DKLA 5FA7A 5IT5A 5EFWA 1D1JA 4LPZA 3CI6A 1J9MA 1ESIA 1TD5A 1ZKJA 3ZDJA 4KQDA 3E0YA 2PD8A 3M2JA 3IX3A 4DJ2A 1TS6A 4N1XA 4EQ1A 3ZHHA 5IS1A 4CLCD 4R3BA 1BLPA 3LR0A 1SCWA 4OPQA 3ZVTA 3IX8A 4KENB 3S22A 1T1CA 2OLVA 3SH7A 3T1SA 3DWKA 2NUTC 4WL9A 3R7WA 5FAPA 2WUQA 1YPRA 1KGEA 2DRWA 1W7FA 3D9YA 2ZMAA 3NOTC 4HP9A 4JGPA 1OT9A 2XD1A 2G7UA 2JC7A 3HUOA 1ZG4A 3A0RA 4UAAA 5DFXA 4ARZB 2BLSA 4I5SA 2PYRA 4QY5A 4DN0A 4N92A 2M7UA 1MXOA 2PD7A 5KSCA 1YLJA 2K2NA 3M2KA 4IBRA 4EBLA 1PYYA 2QPNA 4UQIS 3UMDA 2GX5A 1MZUA 3G2YA 4R4RA 4JPMA 3LIEA 4K0XA 5AQ7A 1NY0A 4QY6A 2XA7S 3ZG7B 4G3VA 1CEFA 5CHUA 5TR7A 1FCMA 1F5MA 5JYPA 1JNUA 3IX4A 2EWWA 5F69A 1IKGA 5FAOA 4KZ8A 5KZHA 2R78A 2D02A 2A3UA 3G32A 3O87A 4OVDA 1P9WA 2WKIA 4D2OA 1TS8A 1T1AA 3NCKA 1W5DA 3PYPA 1FR1A 3W8KA 3QP4A 4NXEA 1A0KA 2VLGA 1PRQA 1PWDA 1I2WA
chains in the Genus database with same CATH topology
3BEBA 4FSFA 1NZUA 1PW8A 3UPPA 4OLDA 2ZM8A 1OMEA 4OPZA 1VQQA 2ZC5B 4BL2A 2A49A 4XUXA 3HLGA 4BJPA 2WGWB 2ZJ9A 5EVID 1O07A 1ERQA 1YT4A 3WS1A 1YM1A 5A93A 5KMWA 3ITAA 1YLTA 3BRMA 4HEFA 4X56A 5JYOA 2WGVA 3VP4A 3NIAA 4WZ4A 1L0GA 3PBOA 2ZC6B 1PWGA 4EBNA 1GA9A 4FD8A 1MWSA 5EVIC 4E6XA 2CC1A 5F83A 5FASA 4E3JA 2HDRA 2VGJA 4FCFA 3Q7VB 4ZJ1A 5F1FA 4OP5A 5EUAA 5EVIB 3RJUA 3FV7A 4YINA 4OQ0A 1MBLA 3NDGA 4JXVA 1HD8A 1PZPA 1ALQA 5GLAA 2X02A 1ONHA 2R9XA 3HBRA 4WYYA 5F1GA 4NK3A 5CGSA 3PBTA 4BQMA 4F94A 5CRFA 4OH0A 1EI5A 2WZXA 3JYIA 4KZ6A 1XGJA 2Q9NA 1W8QA 4JXWA 5GHXA 3GTCA 4M3KA 1XKZA 3WS5A 4LV0A 3LCEA 4S2KA 3PAEA 3BECA 1N9BA 1M6KA 2EX9A 2HDQA 2HDUA 1NYYA 3IT9A 3Q82A 3IQAA 4KZAA 3VFHA 4DRTA 3SS5A 3A3JA 1ES3A 4P6BA 3NI9A 3VP2A 5CEDA 1PZOA 1FQGA 4OOLA 5DF9A 3IWIA 3NC8A 4ZJ2A 3LY3A 1IELA 2V20A 1K25A 2H0YA 1K54A 3MZFA 2XFSA 5HAIA 5D3OA 1ES2A 3PAGA 4UA7A 4KZBA 3MXRA 1XA1A 4MNRA 2H10A 1G6AA 2X71A 4EBPA 1YLWA 1CEGA 4JF5A 1TDGA 1LI9A 5EOEA 4DE1A 4QD4A 1GCEA 1LL5A 1YMXA 4JF6A 4DE0A 2UWXA 3C7VA 4R1GA 3LEZA 1GHMA 4GD8A 4GD6A 3BLSA 4UA6A 4P85A 4E3IA 2RL3A 3WS2A 1Z6FA 1EWZA 5BOHA 5CGXA 5CTMA 2OLUA 3WS0A 5GLBA 3BLMA 2ZD8A 4X68A 4X53A 1YLZA 2JBFA 2JCHA 3IHBA 2ZLYA 4IVIA 2ZQ9A 5J8XA 4Y0OA 3VFFA 2J9OA 4OKPA 1NJ4A 1VM1A 3OPRA 4BL3A 4S2PA 5FI2A 1QMFA 3DW0A 4GN2A 4KQQA 2Y2KA 3O86A 3D4FA 3PBQA 3GSGA 3TG9A 2RCXA 1FCOA 1K54C 1K6SA 1XXMA 4KQOA 4DXCA 5I94A 4PM8A 4B88A 2Y2IA 4H8RA 3VSLA 4MBHA 3V39A 4RYEA 4S2LA 4BLMA 4EQIA 3BFCA 3HL9A 3QHYA 4GDNA 2XDMA 3OC2A 4EV4A 1BZAA 4R3JA 2Y91A 2PBYA 5E43A 1SDNA 1IYQA 1BLCA 3VP1A 2WAFA 4HBUA 2Z2MB 1GA0A 2DNSA 4MBKA 1K56A 4DDYA 3ZCZA 4WZ5A 1KE4A 2WK0A 2ZC4B 3VOYA 1BSGA 1ZC2A 1O7EA 2Y59A 5FSRA 3HLWA 1I5QA 3UDFA 3TSGA 3GMWA 3HUMA 1FOFA 3OZHA 5E2EA 2QMIA 2WKEA 3EQUA 1DJCA 1NXYA 3IXHA 4PPRA 3PBRA 4E3NA 4K0WA 1H8ZA 3VSKA 4OOMA 4IVKA 2C5WB 4KZ5A 4KZ4A 5KSHA 3W4PA 4C6YA 1KVMA 5HL1A 5AQAA 5M19A 4LV2A 3RXXA 1ERMA 1K56D 4RX2A 3QNCA 3ZGAB 4IEDA 3GRJA 3RXWA 3HLCA 3Q1FA 1JTDA 4IBXA 1L0DA 5DF8A 4Y0UA 3G2ZA 4E3KA 2ZC7A 1K38A 2R9WA 4HESA 1K55A 1YLPA 4OPRA 1H5XA 3PBSA 2XH9A 2ZQDA 3DTMA 4U0TA 2V2FF 1W79A 5FQJA 1L2SA 2HP5A 4WZ5C 1C3BA 5GLCA 1DY6A 2FFYA 2B5RA 3S1YA 3UE0A 3G34A 3M6BA 1E3UA 2XQZA 4PM5A 4GZBA 2XEPA 2ZM2A 4BENA 2WGIA 1XA7A 2P74A 1BTLA 4PM6A 2WKHA 3ZG9B 3MKFA 4DDSA 4C75A 3CJMA 3LY4A 3S4XA 3G35A 2Y2JA 3BFEA 4YFMA 1KVLA 1JWPA 2P9VA 3OCNA 2WAEA 1U60A 3AGDA 1ZG6A 4Z9QA 1S6RA 4WELA 5CTNA 4B4ZA 2Y2MA 3ZFZA 5CECA 5HAPA 3W4QA 3ZVWA 1H8YA 3HVFA 3VP3A 4U0XA 2J8YA 4JKTA 3C5AA 1E3UD 1GHPA 1NRFA 1LI0A 4OQGA 4ID4A 4BD1A 1K55C 2IWDA 2ZM0A 5EOOA 5E2FA 4FH4A 4DXBA 3AGEA 1XX2A 1K4EA 5AQ9A 4KZ7A 1GHIA 1JTGA 4FH2A 3WS4A 1XPBA 5HARA 3BFFA 1LL9A 3BFGA 1CI8A 2EXBA 5FDHA 2E8IA 4B4XA 1NYMA 2ZQAA 4Y0TA 1KDWA 3OPLA 3GVBA 3N8RA 1WYBA 3ZNYA 4DE2A 2HP9A 4U3TA 1N4OA 4E3OA 1W8YA 3W4OA 1BT5A 3QNBA 1IYOA 3V3SA 2ZC3B 3IWQA 3IXDA 4KG6A 2HDSA 4P0MA 2IWBA 3UE3A 1MWTA 4ZAMA 5E2GA 1JVJA 4A5RA 1RGZA 2XFTA 2Y2NA 4X55A 3N8LA 5F82A 4XXRA 3BM6A 2P9VB 4KG5A 4GDBA 2QZ6A 3G31A 4X6TA 2WZZA 1BULA 2OSUA 1FSYA 1G68A 2PU2A 2XF3A 3N8SA 4N9KA 4LV3A 5TFQA 1MPLA 4X69A 2XGNA 3ZNTA 4ZDXA 3CG5A 1KDSA 5M1AA 4UHUA 1TDLA 1IKIA 3V50A 3N7WA 4JXGA 1LHYA 2I72A 2ZQ7A 3UY6A 4PM9A 4N9LA 4GNUA 3A3FA 2DCFA 1ONGA 2ZQCA 4S2IA 4C3QA 2Y2OA 2WADA 2Z2LB 2XK1A 1PI5A 4GKUA 5CHMA 1MWUA 1BLSA 3HLFA 4GB7A 3MZEA 1MWRA 4RX3A 3V3RA 2Q9MA 5CXWA 3TOIA 5EVLA 4NETA 4JXSA 3WRTA 4CPKA 1KGFA 3GR2A 3PBNA 3HLEA 5DTKA 5FQMA 2HP6A 3MZDA 1JWVA 2G2UA 2EX2A 2EFUA 5IHVA 2H0TA 3HREA 4JBFA 2EX6A 3VMAA 4KZ3A 2XD5A 1HTZA 3SS3A 4MEZA 1I2SA 4ZJ3A 4OPYA 1AXBA 2G2WA 1QMEA 3EQVA 5AQBA 1RCJA 1L0FA 5FATA 1YMSA 3FKWA 1IYPA 2J7VA 1TEMA 5FQQA 3SH8A 1YLYA 4LCLA 1WYCA 1XP4A 3N4IA 1ES4A 4UA9A 3UO9A 3FYZA 4K91A 4WMCA 2Y2PA 3MXSA 5GHYA 5FAQA 2EX8A 3M6HA 3ZG8B 4WEJA 2PU4A 2IWCA 3C4PA 3FKVA 4R4SA 4S2MA 3P98A 3OCLA 4ZTKA 3OPHA 5CEBA 1MKIA 3VP0A 1SHVA 4QB8A 4MBFA 1HZOA 4Y7PA 5FI7A 3BFDA 3WRZA 1FR6A 3C4OA 3HLDA 2Y2QA 1TVFA 3IH8A 5HX9A 3P09A 4QHCA 4E3LA 1IYSA 1FCNA 2Y55A 4BD0A 3IH9A 2Y2HA 2WYXA 1HVBA 3VOZA 4WMCD 1Q2QA 1YQSA 1WE4A 4JF4A 2OV5A 3ZG0A 5HAQA 5FA7A 1E4DA 5DTTA 4EUZA 5A90A 5GL9A 3HUNA 3UE1A 3Q7ZA 1J9MA 4LV1A 2VGKA 4S2JA 5EPHA 1PI4A 3E2LA 1ESIA 1ZKJA 3UDXA 3ZDJA 4QJGA 2Y2LA 3B3XA 1K57C 1MY8A 4DE3A 5FQIA 3V5MA 2Y4AA 1PWCA 2JE5A 3Q81A 3M2JA 2X01A 3NBLA 4JLFA 4N1XA 4E6WA 3ZHHA 4MLLA 3IF6A 1DJBA 4R3BA 1BLPA 1CI9A 3GQZA 1L0EA 1SCWA 4KQRA 4OQIA 4OPQA 3G4PA 3ZVTA 1E25A 3BYDA 1EROA 5CERA 4KENB 3GV9A 4RVAA 4WBGA 3IXBA 4LENA 1Q2PA 5L2FA 5EECA 3S22A 2OLVA 4CJNA 1KGGA 5FQKA 3OPPA 3SH7A 3DWKA 3UDIA 3UPNA 2J9PA 4XUZA 1SDEA 4RA7A 1ESUA 5FAPA 5DF7A 5EE8A 4HBTA 2WUQA 2XLNA 2FFFB 3IHAA 1KGEA 4P87A 2DRWA 3N6IA 4DKIA 4DF6A 1SKFA 1KE3A 1W7FA 4R0QA 3PTEA 4N1HA 4QU3A 2ZMAA 3A3DA 3E2KA 1K4FA 1DJAA 1LLBA 3SOIA 4PMAA 2XD1A 3HUOA 2JC7A 1KE0A 4KZ9A 3A3IA 1ZG4A 4OP8A 4UAAA 1NZOA 2Y2GA 3DWZA 1PIOA 1K6RA 2BLSA 2EXAA 5CGWA 4QY5A 2C6WB 3AGFA 4N92A 1MXOA 5KSCA 1YLJA 3IF6C 4PM7A 3SH9A 5CHJA 4OOYA 3M2KA 4IBRA 4EBLA 3IWOA 4S2NA 1PYYA 2QPNA 3Q07A 3IF6B 3G2YA 4WEKA 3HLBA 4R4RA 2HPBA 3WWXA 3IF5A 3UN7A 5U47A 4JPMA 5A92A 5DTSA 4K0XA 5AQ7A 4GOGA 1NY0A 1Y54A 4QY6A 3ZG7B 3IXGA 3MFDA 1CEFA 3SS4A 1XGIA 3A3EA 5CHUA 5TR7A 1FCMA 1S0WA 2WGWA 3O3VA 1M40A 3O88A 2V1ZA 2ZQ8A 5JYPA 4OLGA 5G18A 5KZHA 3FWLA 1IKGA 5FAOA 4KZ8A 2BG1A 2H5SA 4Q8IA 2XR0A 3CMZA 2A3UA 3LO7A 5HW3A 4O7DA 3G32A 5TGFA 4OONA 4R23A 3O87A 1IEMA 5FI6A 5E2HA 3MKEA 4OVDA 3NY4A 3ISGA 1CK3A 4ZBEA 4L0LA 2WKIA 4WM9A 5A91A 4S2OA 3Q7VA 4S2NC 3NDEA 1BLHA 5EVIA 3ZG5A 2EFXA 4D2OA 1BUEA 3NCKA 1W5DA 1ES5A 4OQHA 1RGYA 4LCMA 3C7UA 1FR1A 3G30A 5FQ9A 1PW1A 3W8KA 3CZDA 1JWZA 5M18A 5HFOA 2GDNA 3I7JA 4EWFA 3UNWA 3FZCA 5GHZA 1K57A 5GLDA 5DVAA 4KG2A 1FSWA 1RP5A 3UPOA 4E3MA 3ITBA 3MBZA 1PWDA 1I2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BEB A;  4FSF A;  1NZU A;  1PW8 A;  3UPP A;  4OLD A;  2ZM8 A;  1OME A;  4OPZ A;  1VQQ A;  2ZC5 B;  4BL2 A;  2A49 A;  4XUX A;  3HLG A;  4BJP A;  2WGW B;  2ZJ9 A;  5EVI D;  1O07 A;  1ERQ A;  1YT4 A;  3WS1 A;  1YM1 A;  5A93 A;  5KMW A;  3ITA A;  1YLT A;  3BRM A;  4HEF A;  4X56 A;  5JYO A;  2WGV A;  3VP4 A;  3NIA A;  4WZ4 A;  1L0G A;  3PBO A;  2ZC6 B;  1PWG A;  4EBN A;  1GA9 A;  4FD8 A;  1MWS A;  5EVI C;  4E6X A;  2CC1 A;  5F83 A;  5FAS A;  4E3J A;  2HDR A;  2VGJ A;  4FCF A;  3Q7V B;  4ZJ1 A;  5F1F A;  4OP5 A;  5EUA A;  5EVI B;  3RJU A;  3FV7 A;  4YIN A;  4OQ0 A;  1MBL A;  3NDG A;  4JXV A;  1HD8 A;  1PZP A;  1ALQ A;  5GLA A;  2X02 A;  1ONH A;  2R9X A;  3HBR A;  4WYY A;  5F1G A;  4NK3 A;  5CGS A;  3PBT A;  4BQM A;  4F94 A;  5CRF A;  4OH0 A;  1EI5 A;  2WZX A;  3JYI A;  4KZ6 A;  1XGJ A;  2Q9N A;  1W8Q A;  4JXW A;  5GHX A;  3GTC A;  4M3K A;  1XKZ A;  3WS5 A;  4LV0 A;  3LCE A;  4S2K A;  3PAE A;  3BEC A;  1N9B A;  1M6K A;  2EX9 A;  2HDQ A;  2HDU A;  1NYY A;  3IT9 A;  3Q82 A;  3IQA A;  4KZA A;  3VFH A;  4DRT A;  3SS5 A;  3A3J A;  1ES3 A;  4P6B A;  3NI9 A;  3VP2 A;  5CED A;  1PZO A;  1FQG A;  4OOL A;  5DF9 A;  3IWI A;  3NC8 A;  4ZJ2 A;  3LY3 A;  1IEL A;  2V20 A;  1K25 A;  2H0Y A;  1K54 A;  3MZF A;  2XFS A;  5HAI A;  5D3O A;  1ES2 A;  3PAG A;  4UA7 A;  4KZB A;  3MXR A;  1XA1 A;  4MNR A;  2H10 A;  1G6A A;  2X71 A;  4EBP A;  1YLW A;  1CEG A;  4JF5 A;  1TDG A;  1LI9 A;  5EOE A;  4DE1 A;  4QD4 A;  1GCE A;  1LL5 A;  1YMX A;  4JF6 A;  4DE0 A;  2UWX A;  3C7V A;  4R1G A;  3LEZ A;  1GHM A;  4GD8 A;  4GD6 A;  3BLS A;  4UA6 A;  4P85 A;  4E3I A;  2RL3 A;  3WS2 A;  1Z6F A;  1EWZ A;  5BOH A;  5CGX A;  5CTM A;  2OLU A;  3WS0 A;  5GLB A;  3BLM A;  2ZD8 A;  4X68 A;  4X53 A;  1YLZ A;  2JBF A;  2JCH A;  3IHB A;  2ZLY A;  4IVI A;  2ZQ9 A;  5J8X A;  4Y0O A;  3VFF A;  2J9O A;  4OKP A;  1NJ4 A;  1VM1 A;  3OPR A;  4BL3 A;  4S2P A;  5FI2 A;  1QMF A;  3DW0 A;  4GN2 A;  4KQQ A;  2Y2K A;  3O86 A;  3D4F A;  3PBQ A;  3GSG A;  3TG9 A;  2RCX A;  1FCO A;  1K54 C;  1K6S A;  1XXM A;  4KQO A;  4DXC A;  5I94 A;  4PM8 A;  4B88 A;  2Y2I A;  4H8R A;  3VSL A;  4MBH A;  3V39 A;  4RYE A;  4S2L A;  4BLM A;  4EQI A;  3BFC A;  3HL9 A;  3QHY A;  4GDN A;  2XDM A;  3OC2 A;  4EV4 A;  1BZA A;  4R3J A;  2Y91 A;  2PBY A;  5E43 A;  1SDN A;  1IYQ A;  1BLC A;  3VP1 A;  2WAF A;  4HBU A;  2Z2M B;  1GA0 A;  2DNS A;  4MBK A;  1K56 A;  4DDY A;  3ZCZ A;  4WZ5 A;  1KE4 A;  2WK0 A;  2ZC4 B;  3VOY A;  1BSG A;  1ZC2 A;  1O7E A;  2Y59 A;  5FSR A;  3HLW A;  1I5Q A;  3UDF A;  3TSG A;  3GMW A;  3HUM A;  1FOF A;  3OZH A;  5E2E A;  2QMI A;  2WKE A;  3EQU A;  1DJC A;  1NXY A;  3IXH A;  4PPR A;  3PBR A;  4E3N A;  4K0W A;  1H8Z A;  3VSK A;  4OOM A;  4IVK A;  2C5W B;  4KZ5 A;  4KZ4 A;  5KSH A;  3W4P A;  4C6Y A;  1KVM A;  5HL1 A;  5AQA A;  5M19 A;  4LV2 A;  3RXX A;  1ERM A;  1K56 D;  4RX2 A;  3QNC A;  3ZGA B;  4IED A;  3GRJ A;  3RXW A;  3HLC A;  3Q1F A;  1JTD A;  4IBX A;  1L0D A;  5DF8 A;  4Y0U A;  3G2Z A;  4E3K A;  2ZC7 A;  1K38 A;  2R9W A;  4HES A;  1K55 A;  1YLP A;  4OPR A;  1H5X A;  3PBS A;  2XH9 A;  2ZQD A;  3DTM A;  4U0T A;  2V2F F;  1W79 A;  5FQJ A;  1L2S A;  2HP5 A;  4WZ5 C;  1C3B A;  5GLC A;  1DY6 A;  2FFY A;  2B5R A;  3S1Y A;  3UE0 A;  3G34 A;  3M6B A;  1E3U A;  2XQZ A;  4PM5 A;  4GZB A;  2XEP A;  2ZM2 A;  4BEN A;  2WGI A;  1XA7 A;  2P74 A;  1BTL A;  4PM6 A;  2WKH A;  3ZG9 B;  3MKF A;  4DDS A;  4C75 A;  3CJM A;  3LY4 A;  3S4X A;  3G35 A;  2Y2J A;  3BFE A;  4YFM A;  1KVL A;  1JWP A;  2P9V A;  3OCN A;  2WAE A;  1U60 A;  3AGD A;  1ZG6 A;  4Z9Q A;  1S6R A;  4WEL A;  5CTN A;  4B4Z A;  2Y2M A;  3ZFZ A;  5CEC A;  5HAP A;  3W4Q A;  3ZVW A;  1H8Y A;  3HVF A;  3VP3 A;  4U0X A;  2J8Y A;  4JKT A;  3C5A A;  1E3U D;  1GHP A;  1NRF A;  1LI0 A;  4OQG A;  4ID4 A;  4BD1 A;  1K55 C;  2IWD A;  2ZM0 A;  5EOO A;  5E2F A;  4FH4 A;  4DXB A;  3AGE A;  1XX2 A;  1K4E A;  5AQ9 A;  4KZ7 A;  1GHI A;  1JTG A;  4FH2 A;  3WS4 A;  1XPB A;  5HAR A;  3BFF A;  1LL9 A;  3BFG A;  1CI8 A;  2EXB A;  5FDH A;  2E8I A;  4B4X A;  1NYM A;  2ZQA A;  4Y0T A;  1KDW A;  3OPL A;  3GVB A;  3N8R A;  1WYB A;  3ZNY A;  4DE2 A;  2HP9 A;  4U3T A;  1N4O A;  4E3O A;  1W8Y A;  3W4O A;  1BT5 A;  3QNB A;  1IYO A;  3V3S A;  2ZC3 B;  3IWQ A;  3IXD A;  4KG6 A;  2HDS A;  4P0M A;  2IWB A;  3UE3 A;  1MWT A;  4ZAM A;  5E2G A;  1JVJ A;  4A5R A;  1RGZ A;  2XFT A;  2Y2N A;  4X55 A;  3N8L A;  5F82 A;  4XXR A;  3BM6 A;  2P9V B;  4KG5 A;  4GDB A;  2QZ6 A;  3G31 A;  4X6T A;  2WZZ A;  1BUL A;  2OSU A;  1FSY A;  1G68 A;  2PU2 A;  2XF3 A;  3N8S A;  4N9K A;  4LV3 A;  5TFQ A;  1MPL A;  4X69 A;  2XGN A;  3ZNT A;  4ZDX A;  3CG5 A;  1KDS A;  5M1A A;  4UHU A;  1TDL A;  1IKI A;  3V50 A;  3N7W A;  4JXG A;  1LHY A;  2I72 A;  2ZQ7 A;  3UY6 A;  4PM9 A;  4N9L A;  4GNU A;  3A3F A;  2DCF A;  1ONG A;  2ZQC A;  4S2I A;  4C3Q A;  2Y2O A;  2WAD A;  2Z2L B;  2XK1 A;  1PI5 A;  4GKU A;  5CHM A;  1MWU A;  1BLS A;  3HLF A;  4GB7 A;  3MZE A;  1MWR A;  4RX3 A;  3V3R A;  2Q9M A;  5CXW A;  3TOI A;  5EVL A;  4NET A;  4JXS A;  3WRT A;  4CPK A;  1KGF A;  3GR2 A;  3PBN A;  3HLE A;  5DTK A;  5FQM A;  2HP6 A;  3MZD A;  1JWV A;  2G2U A;  2EX2 A;  2EFU A;  5IHV A;  2H0T A;  3HRE A;  4JBF A;  2EX6 A;  3VMA A;  4KZ3 A;  2XD5 A;  1HTZ A;  3SS3 A;  4MEZ A;  1I2S A;  4ZJ3 A;  4OPY A;  1AXB A;  2G2W A;  1QME A;  3EQV A;  5AQB A;  1RCJ A;  1L0F A;  5FAT A;  1YMS A;  3FKW A;  1IYP A;  2J7V A;  1TEM A;  5FQQ A;  3SH8 A;  1YLY A;  4LCL A;  1WYC A;  1XP4 A;  3N4I A;  1ES4 A;  4UA9 A;  3UO9 A;  3FYZ A;  4K91 A;  4WMC A;  2Y2P A;  3MXS A;  5GHY A;  5FAQ A;  2EX8 A;  3M6H A;  3ZG8 B;  4WEJ A;  2PU4 A;  2IWC A;  3C4P A;  3FKV A;  4R4S A;  4S2M A;  3P98 A;  3OCL A;  4ZTK A;  3OPH A;  5CEB A;  1MKI A;  3VP0 A;  1SHV A;  4QB8 A;  4MBF A;  1HZO A;  4Y7P A;  5FI7 A;  3BFD A;  3WRZ A;  1FR6 A;  3C4O A;  3HLD A;  2Y2Q A;  1TVF A;  3IH8 A;  5HX9 A;  3P09 A;  4QHC A;  4E3L A;  1IYS A;  1FCN A;  2Y55 A;  4BD0 A;  3IH9 A;  2Y2H A;  2WYX A;  1HVB A;  3VOZ A;  4WMC D;  1Q2Q A;  1YQS A;  1WE4 A;  4JF4 A;  2OV5 A;  3ZG0 A;  5HAQ A;  5FA7 A;  1E4D A;  5DTT A;  4EUZ A;  5A90 A;  5GL9 A;  3HUN A;  3UE1 A;  3Q7Z A;  1J9M A;  4LV1 A;  2VGK A;  4S2J A;  5EPH A;  1PI4 A;  3E2L A;  1ESI A;  1ZKJ A;  3UDX A;  3ZDJ A;  4QJG A;  2Y2L A;  3B3X A;  1K57 C;  1MY8 A;  4DE3 A;  5FQI A;  3V5M A;  2Y4A A;  1PWC A;  2JE5 A;  3Q81 A;  3M2J A;  2X01 A;  3NBL A;  4JLF A;  4N1X A;  4E6W A;  3ZHH A;  4MLL A;  3IF6 A;  1DJB A;  4R3B A;  1BLP A;  1CI9 A;  3GQZ A;  1L0E A;  1SCW A;  4KQR A;  4OQI A;  4OPQ A;  3G4P A;  3ZVT A;  1E25 A;  3BYD A;  1ERO A;  5CER A;  4KEN B;  3GV9 A;  4RVA A;  4WBG A;  3IXB A;  4LEN A;  1Q2P A;  5L2F A;  5EEC A;  3S22 A;  2OLV A;  4CJN A;  1KGG A;  5FQK A;  3OPP A;  3SH7 A;  3DWK A;  3UDI A;  3UPN A;  2J9P A;  4XUZ A;  1SDE A;  4RA7 A;  1ESU A;  5FAP A;  5DF7 A;  5EE8 A;  4HBT A;  2WUQ A;  2XLN A;  2FFF B;  3IHA A;  1KGE A;  4P87 A;  2DRW A;  3N6I A;  4DKI A;  4DF6 A;  1SKF A;  1KE3 A;  1W7F A;  4R0Q A;  3PTE A;  4N1H A;  4QU3 A;  2ZMA A;  3A3D A;  3E2K A;  1K4F A;  1DJA A;  1LLB A;  3SOI A;  4PMA A;  2XD1 A;  3HUO A;  2JC7 A;  1KE0 A;  4KZ9 A;  3A3I A;  1ZG4 A;  4OP8 A;  4UAA A;  1NZO A;  2Y2G A;  3DWZ A;  1PIO A;  1K6R A;  2BLS A;  2EXA A;  5CGW A;  4QY5 A;  2C6W B;  3AGF A;  4N92 A;  1MXO A;  5KSC A;  1YLJ A;  3IF6 C;  4PM7 A;  3SH9 A;  5CHJ A;  4OOY A;  3M2K A;  4IBR A;  4EBL A;  3IWO A;  4S2N A;  1PYY A;  2QPN A;  3Q07 A;  3IF6 B;  3G2Y A;  4WEK A;  3HLB A;  4R4R A;  2HPB A;  3WWX A;  3IF5 A;  3UN7 A;  5U47 A;  4JPM A;  5A92 A;  5DTS A;  4K0X A;  5AQ7 A;  4GOG A;  1NY0 A;  1Y54 A;  4QY6 A;  3ZG7 B;  3IXG A;  3MFD A;  1CEF A;  3SS4 A;  1XGI A;  3A3E A;  5CHU A;  5TR7 A;  1FCM A;  1S0W A;  2WGW A;  3O3V A;  1M40 A;  3O88 A;  2V1Z A;  2ZQ8 A;  5JYP A;  4OLG A;  5G18 A;  5KZH A;  3FWL A;  1IKG A;  5FAO A;  4KZ8 A;  2BG1 A;  2H5S A;  4Q8I A;  2XR0 A;  3CMZ A;  2A3U A;  3LO7 A;  5HW3 A;  4O7D A;  3G32 A;  5TGF A;  4OON A;  4R23 A;  3O87 A;  1IEM A;  5FI6 A;  5E2H A;  3MKE A;  4OVD A;  3NY4 A;  3ISG A;  1CK3 A;  4ZBE A;  4L0L A;  2WKI A;  4WM9 A;  5A91 A;  4S2O A;  3Q7V A;  4S2N C;  3NDE A;  1BLH A;  5EVI A;  3ZG5 A;  2EFX A;  4D2O A;  1BUE A;  3NCK A;  1W5D A;  1ES5 A;  4OQH A;  1RGY A;  4LCM A;  3C7U A;  1FR1 A;  3G30 A;  5FQ9 A;  1PW1 A;  3W8K A;  3CZD A;  1JWZ A;  5M18 A;  5HFO A;  2GDN A;  3I7J A;  4EWF A;  3UNW A;  3FZC A;  5GHZ A;  1K57 A;  5GLD A;  5DVA A;  4KG2 A;  1FSW A;  1RP5 A;  3UPO A;  4E3M A;  3ITB A;  3MBZ A;  1PWD A;  1I2W A; 
#chains in the Genus database with same CATH topology
 1PW8 A;  3UPP A;  4OLD A;  4OPZ A;  1OME A;  1VQQ A;  4BL2 A;  2WGW B;  2PYP A;  1YT4 A;  2O9A A;  1YM1 A;  3ITA A;  1YLT A;  3BRM A;  5JYO A;  4KUK A;  3K2N A;  4FD8 A;  4E6X A;  5F83 A;  2JHE A;  2VGJ A;  2QWS A;  1PZP A;  1H0M A;  2R9X A;  2V1A A;  5CGS A;  2XSS A;  5CRF A;  2E8J A;  1XGJ A;  4JXW A;  2LB5 A;  3ULF A;  4LV0 A;  3LCE A;  1S67 L;  1N9B A;  4I39 A;  3BWL A;  3T50 A;  4ZJ2 A;  3LY3 A;  3KSH A;  2QJ7 A;  3H82 A;  2OWJ A;  2HGV A;  3PAG A;  4UA7 A;  4KZB A;  1TS7 A;  2H10 A;  1G6A A;  2JKT M;  1XFQ A;  5EOE A;  1GSV A;  1YMX A;  4DE0 A;  2W3G A;  1GHM A;  3EGX C;  4GD6 A;  3BLS A;  4UA6 A;  4P85 A;  5BOH A;  3WS0 A;  4X68 A;  2J3T C;  3IHB A;  3LI8 A;  2ZQ9 A;  5EM0 A;  3LID A;  3MR0 A;  3UB9 A;  1S4S A;  4OKP A;  1NJ4 A;  4BL3 A;  5FI2 A;  3DW0 A;  1LL8 A;  3O86 A;  2RCX A;  1K6S A;  3EOI A;  4NG2 A;  5I94 A;  2Y2I A;  3VSL A;  4QWO A;  4Z1W A;  4S2L A;  4GDN A;  2XDM A;  1BZA A;  5HPI A;  3GEC A;  1SDN A;  4HBU A;  2YKH A;  4JGO A;  4WZ5 A;  2ZC4 B;  4F3L A;  3CPT B;  1T18 A;  3UDF A;  3GMW A;  3H9W A;  4NXG A;  1ACF A;  1NLZ A;  4ETZ A;  1NXY A;  3PBR A;  4PAU A;  1H8Z A;  2QHK A;  5HWW A;  5G4Y A;  1K56 D;  4RX2 A;  2PHY A;  3ZGA B;  3HLC A;  2A2L A;  1L0D A;  4HOI A;  4Y0U A;  1OTA A;  2HF6 A;  2ZC7 A;  4E3K A;  1S1Z A;  1K55 A;  5J4E A;  1YLP A;  1H5X A;  1AWI A;  2ZQD A;  2V2F F;  1L2S A;  4WZ5 C;  1C3B A;  2VZW A;  2FFY A;  2B5R A;  3UE0 A;  3M6B A;  3QP6 A;  2ZM2 A;  2P74 A;  4DDS A;  1SKO A;  3CJM A;  3S4X A;  2Y2J A;  4YFM A;  3BJN A;  3MQ0 A;  2WAE A;  3AGD A;  1UWN X;  3PR6 A;  4Z9Q A;  4WEL A;  5CEC A;  5HDC A;  3HVF A;  3C5A A;  2HZ5 A;  1LI0 A;  4OQG A;  2P7J A;  4BD1 A;  1K55 C;  5EOO A;  4AFI A;  3AGE A;  3R4K A;  5AQ9 A;  3LGO A;  2V8F A;  3WS4 A;  5HAR A;  1UWP X;  2VK3 A;  1VHM A;  2E8I A;  4B4X A;  4Y0T A;  3P01 A;  3GVB A;  3N8R A;  1WYB A;  2J3T D;  4DE2 A;  2HP9 A;  4U3T A;  3EEH A;  5F5Y A;  1DP8 A;  2IWB A;  4A5R A;  4O0P A;  1RGZ A;  4H6J B;  4KG5 A;  5TJJ A;  4X1M A;  1FSY A;  1G68 A;  1N9O A;  4WN5 A;  5TFQ A;  4ZDX A;  5DKK A;  1NLY A;  4PM9 A;  4GNU A;  3A3F A;  3DBA A;  2J80 A;  2PAV P;  1XJ2 A;  2ZQC A;  4C3Q A;  1STZ A;  4RX3 A;  3MZE A;  1MWR A;  1ZTU A;  3TOI A;  5CXW A;  2WKP A;  1S1Y A;  4JXS A;  3WRT A;  3SZT A;  3HLE A;  2JKT I;  2EFU A;  2EX6 A;  3SS3 A;  3F1P B;  1NWZ A;  1L3L A;  4II7 A;  5AQB A;  2B02 A;  2VJW A;  1L0F A;  4DJ3 A;  4GS9 B;  3C30 A;  4XT2 A;  4LCL A;  3RH8 B;  2O99 A;  1WYC A;  3LUQ A;  4K91 A;  3NEC A;  4WEJ A;  3P98 A;  4QB8 A;  1HZO A;  2PRF A;  5DJT A;  4L9G A;  3BFD A;  2D01 A;  4GHI B;  2PR6 A;  3S7N A;  3C4O A;  3HLD A;  2Y2Q A;  2ZL1 A;  4QHC A;  4BWI A;  2V8C A;  4CLC A;  3F1O B;  3ZG0 A;  1E4D A;  5A90 A;  2XRO A;  4L9E A;  5HSQ A;  3MSH A;  2Y8H A;  3B47 A;  3ICY A;  4S2J A;  5EPH A;  4QJG A;  2Y2L A;  1K57 C;  3V5M A;  2JE5 A;  4JLF A;  4E6W A;  2HV1 A;  4I3J A;  3BQ8 A;  3GQZ A;  1L0E A;  2JN7 A;  3G4P A;  3L7H A;  2W1T B;  4RVA A;  1Q2P A;  5L2F A;  5EEC A;  4R3A A;  4CJN A;  3LR5 A;  3G6O A;  3OPP A;  4CLC C;  5DF7 A;  5EE8 A;  1G28 A;  2XLN A;  2FFF B;  3T4O A;  1KE3 A;  5HPF A;  3E2K A;  1K4F A;  1KE0 A;  3JVU A;  3MJQ A;  3A3I A;  4LRZ E;  1G5U A;  3DWZ A;  1OJG A;  2C6W B;  1P97 A;  4X1L A;  4PM7 A;  4WUJ A;  2PDR A;  3IWO A;  3NJA A;  4EEU A;  4PKY A;  3LIB A;  2K7S A;  4WEK A;  3HLB A;  3WWX A;  1P0Z A;  4HH3 A;  5G4Z A;  1YSP A;  4G3W A;  3SS4 A;  4Y5F A;  1S0W A;  3O3V A;  3R7W B;  4GHI A;  4HY8 A;  2LB9 A;  2GZA A;  2H5S A;  5CX7 A;  5TGF A;  2KLI A;  4Y15 A;  5E2H A;  2BAS A;  3ISG A;  1CK3 A;  5A91 A;  2K31 A;  3ZG5 A;  3MF0 A;  1ES5 A;  4LCM A;  2GJ3 A;  2GDN A;  3I7J A;  2VEA A;  4Y17 A;  2PT7 A;  3FZC A;  5GHZ A;  5DVA A;  1FSW A;  4E3M A;  3VP1 A;  3KSI A;  4ETX A;  5AVE A;  2ZM8 A;  2A49 A;  4XUX A;  1CQA A;  2PR5 A;  5EVI D;  4NXF A;  3HJK A;  4X56 A;  4NKP A;  3PBO A;  2ZC6 B;  5FAS A;  4E3J A;  2HDR A;  3KSG A;  4LRY C;  1XJ3 A;  4OP5 A;  3NDG A;  4JXV A;  2W3F A;  3T1Q B;  3HBR A;  1V9Z A;  4F94 A;  3EGD C;  1EI5 A;  4KZ6 A;  2ZMV A;  5I5L A;  1MKM A;  3GTC A;  3H7W B;  1D7E A;  3WS5 A;  2EX9 A;  2VX8 A;  3VFH A;  1NYY A;  3IQA A;  3A3J A;  1ES3 A;  4P6B A;  5CED A;  4OOL A;  3IWI A;  2V20 A;  1K25 A;  4EET B;  2H0Y A;  1K54 A;  3MZF A;  3V67 A;  1ES2 A;  4HNB A;  4EBP A;  2ACG A;  1GCE A;  1XJ4 A;  3C7V A;  3B33 A;  4GD8 A;  4NEE D;  2EA9 A;  2ZOH A;  1EWZ A;  5CTM A;  2OLU A;  5GLB A;  2ZD8 A;  2JBF A;  2JCH A;  2ZLY A;  3TRC A;  1TS0 A;  2A24 A;  4Y0O A;  5C5K A;  4S2P A;  1Y28 A;  4GN2 A;  3TG9 A;  3PBQ A;  1FCO A;  1K54 C;  4KQO A;  4PM8 A;  1GSW A;  4B88 A;  4MBH A;  4EQI A;  4NXB A;  3HL9 A;  3QHY A;  3H82 B;  4P6Z M;  4YNR A;  3OOV A;  1W63 M;  2Z2M B;  2M7V A;  1K56 A;  3GDI A;  3ZCZ A;  1KE4 A;  2WK0 A;  4ESP A;  1ZC2 A;  5FSR A;  3HLW A;  3TSG A;  2W3D A;  2QMI A;  3H7W A;  4E3N A;  4K0W A;  4KZ4 A;  4HI4 A;  5M19 A;  5HL1 A;  3T4S A;  4LV2 A;  1ERM A;  3RXW A;  3A0V A;  1JTD A;  4IBX A;  3B42 A;  3G2Z A;  4OPR A;  3DTM A;  1W79 A;  1OT6 A;  3BY8 A;  2OAP 1;  4HIA A;  3G34 A;  3QP1 A;  4GZB A;  4BEN A;  4F3L B;  2WGI A;  4PM6 A;  1BTL A;  3ZG9 B;  1X0O A;  3BFE A;  3TJZ C;  2P9V A;  3OCN A;  3VOL A;  5EVE A;  4B4Z A;  3UE6 A;  1YSQ A;  1NRF A;  3U2A A;  4HJ4 A;  5E2F A;  2JKR I;  4MN5 A;  1EW0 A;  5L10 A;  1GHI A;  3T4Q A;  3OLO A;  3BFF A;  3SW1 A;  1NYM A;  1KDW A;  3W2Z A;  4E3O A;  1IYO A;  3V3S A;  2ZC3 B;  5L09 A;  3UB6 A;  1SKO B;  4EUV A;  1JVJ A;  3D72 A;  2QZ6 A;  3G31 A;  4X6T A;  2WZZ A;  3BQA A;  2OSU A;  5HWT A;  1Z09 A;  4N9K A;  3E4O A;  4X25 A;  1D06 A;  2XGN A;  3CG5 A;  1KDS A;  5M1A A;  4UHU A;  2V1B A;  4BBU A;  1IKI A;  3N7W A;  2WKQ A;  2ZQ7 A;  3KYZ A;  2NUP C;  1OTE A;  4S2I A;  4YWZ A;  3LI9 A;  4GJ4 A;  2Y2O A;  4HQA A;  4MN6 A;  5AJG A;  2Z2L B;  1PI5 A;  5CHM A;  1MWU A;  3HLF A;  2V9A A;  2W0N A;  2Q9M A;  3CHW P;  4CPK A;  1KGF A;  3F1N A;  1JWV A;  2W27 A;  2EX2 A;  3HRE A;  2XD5 A;  1HTZ A;  3NOU C;  4MEZ A;  4PKY G;  4OPY A;  3ZYT A;  2G2W A;  1YAX A;  2INW A;  1YKD A;  3T4T A;  3JVV A;  4MMN A;  1YMS A;  3FKW A;  1IYP A;  3S7Q A;  3SH8 A;  4GLQ A;  4EW7 A;  1XP4 A;  1ES4 A;  4UA9 A;  3FYZ A;  2Y2P A;  2EX8 A;  3CIT A;  2PU4 A;  3C4P A;  2W3E A;  4ZTK A;  1MKI A;  1SHV A;  4Y7P A;  4MN7 A;  4KUO A;  2KOI A;  3IH8 A;  1TVF A;  5HX9 A;  2DMW A;  2Y55 A;  2WYX A;  5TBM A;  3VOZ A;  4WMC D;  3T4K A;  4JF4 A;  2OV5 A;  2ZOI A;  4EUZ A;  4QPR A;  3HUN A;  1KOU A;  1PI4 A;  5K5B A;  4EER A;  5J3W A;  4XT2 B;  1MY8 A;  5FQI A;  2Y4A A;  1PWC A;  3Q81 A;  3IF6 A;  4Y3I A;  1CI9 A;  4KQR A;  4OQI A;  5FEG A;  2JKG A;  3GV9 A;  4WBG A;  1KGG A;  5FQK A;  4HJ6 A;  4EEP A;  1SDE A;  4RA7 A;  3MQQ A;  2ZL1 B;  2HJE A;  3IHA A;  3LR3 A;  3T4J A;  4DKI A;  4CLC B;  3N6I A;  4DF6 A;  1SZV A;  1SKF A;  4R0Q A;  4QU3 A;  3TE8 A;  3A3D A;  2VGL M;  4ME4 A;  1FIL A;  4OP8 A;  1NZO A;  2Y2G A;  1PIO A;  1K6R A;  5CGW A;  3AGF A;  3FPV A;  3IF6 C;  5CHJ A;  1T1B A;  4GCZ A;  1S4R A;  2HPB A;  3UN7 A;  5U47 A;  5A92 A;  4GOG A;  4IJG A;  4CLC E;  1Y54 A;  2KDK A;  3IXG A;  3MFD A;  1XFN A;  4Q0H A;  3A3E A;  1F9I A;  1M40 A;  3O88 A;  4OLG A;  3FWL A;  2BG1 A;  3UB5 P;  5F6A A;  2CMN A;  4O7D A;  1IEM A;  4ZBE A;  4L0L A;  3Q7V A;  1F98 A;  3NDE A;  1BLH A;  5EVI A;  2EFX A;  2ZMF A;  1BUE A;  1BYW A;  4Q0J A;  1N9N A;  3C7U A;  1PW1 A;  3CZD A;  1JWZ A;  5M18 A;  5HFO A;  1HLU P;  1K57 A;  1PFL A;  1RP5 A;  3UPO A;  3BEB A;  2ZC5 B;  3HLG A;  2ZJ9 A;  1O07 A;  3KO6 A;  1LSX A;  1XJ6 A;  3WS1 A;  5A93 A;  1VET A;  4HEF A;  3P7N A;  3VP4 A;  4WZ4 A;  1L0G A;  4EBN A;  5HL6 A;  1MWS A;  5EVI C;  4IHQ A;  4BBV A;  1PNE A;  4DMZ A;  1VEU A;  3VE4 A;  3FV7 A;  4YIN A;  4OQ0 A;  1MBL A;  5GLA A;  2X02 A;  3IBR A;  3PBT A;  2WZX A;  5GHX A;  4S2K A;  3PAE A;  3BEC A;  2HDU A;  3Q82 A;  3NI9 A;  3VP2 A;  3BY9 A;  1FQG A;  3VV4 A;  5DF9 A;  4B9O A;  3NC8 A;  4Y13 A;  2QJ5 A;  2WKR A;  5D3O A;  1CEG A;  1TDG A;  1LI9 A;  3C8C A;  5L07 A;  4DE1 A;  4QD4 A;  4JF6 A;  2L0W A;  3LEZ A;  3EWK A;  2RL3 A;  3WS2 A;  1Z6F A;  1IFQ A;  2IA2 A;  1T19 A;  4GW9 A;  1YLZ A;  3S7P A;  3VFF A;  2J9O A;  1VM1 A;  3OPR A;  1OPX A;  3QP2 A;  4KQQ A;  3D4F A;  1OTB A;  5HDS A;  1N9L A;  4DXC A;  2FH5 A;  2FZ0 A;  2JKF A;  4BLM A;  4FOF A;  4HHD A;  4EV4 A;  4R3J A;  4FUW A;  5A8B A;  1IYQ A;  5HDD A;  2M1C A;  2DNS A;  2ZBB A;  4DDY A;  1O7E A;  2Y59 A;  4P6Z S;  2VKS A;  3HUM A;  1FOF A;  3DTK A;  3EQU A;  1DJC A;  2A24 B;  3IXH A;  4PPR A;  2P04 A;  3MXQ A;  4YOF A;  3VSK A;  4IVK A;  4R38 A;  1CJF A;  4LFU A;  4C6Y A;  1KVM A;  5KSH A;  2J3W A;  5DJU A;  5F68 A;  4IED A;  4LRX C;  1K38 A;  2OOL A;  2R9W A;  4JGQ A;  1H3Q A;  3PBS A;  2GNX A;  5FQJ A;  2HP5 A;  2OWH A;  1OJ5 A;  3S1Y A;  2XEP A;  1XA7 A;  3MKF A;  5LBR A;  3G35 A;  1KVL A;  1JWP A;  1ZG6 A;  5CTN A;  4HP4 A;  2Y2M A;  5HAP A;  3VE3 A;  3ZVW A;  4D60 A;  1E3U D;  2B18 A;  3IS2 A;  4M4X A;  4ID4 A;  2ZM0 A;  2IWD A;  1K4E A;  3KYE A;  4KZ7 A;  4IUH A;  1JTG A;  1XPB A;  1CI8 A;  5FDH A;  3E98 A;  3OPL A;  1N4O A;  1BT5 A;  3CWF A;  1W63 Q;  3IXD A;  2HDS A;  4B93 A;  3UE3 A;  4X55 A;  5F82 A;  2P9V B;  4GDB A;  2I9V A;  1J3W A;  4UEY A;  3T1X A;  2XF3 A;  3N8S A;  4LV3 A;  4X69 A;  1TDL A;  1LHY A;  4IUK A;  3LR4 A;  4N9L A;  2DCF A;  1ZHH B;  5DFY A;  2WAD A;  2XK1 A;  4GB7 A;  4FTX A;  3V3R A;  5EVL A;  2BTF P;  3PBN A;  2HP6 A;  3MZD A;  5EV0 A;  2H0T A;  1LSW A;  4JBF A;  2MJ6 A;  1GSX A;  4ZJ3 A;  1AXB A;  4EXO A;  2J7V A;  1TEM A;  1OTD A;  3UO9 A;  4WMC A;  3MXS A;  5GHY A;  5FAQ A;  3U4L P;  3RTY A;  3FKV A;  3OCL A;  3OPH A;  2VV7 A;  4MBF A;  3NUL A;  1VB6 A;  4O8G A;  5FI7 A;  3WRZ A;  3P09 A;  3F1N B;  3QP8 A;  4E3L A;  1IYS A;  1FCN A;  3IH9 A;  2Y2H A;  3MFX A;  3E4Q A;  1YQS A;  2W1R A;  5DTT A;  2Z6D A;  5GL9 A;  4ARZ A;  3UE1 A;  3Q7Z A;  4LV1 A;  2VGK A;  3JPU A;  3E2L A;  2O0Y A;  3UDX A;  3B3X A;  5FEF A;  4DE3 A;  1UGU A;  1G6O A;  2X01 A;  3NBL A;  2Z6C A;  4MLL A;  1DJB A;  1E25 A;  3BYD A;  1ERO A;  5CER A;  3IXB A;  4LEN A;  4BMW A;  3HJI A;  3ZQ5 A;  3UDI A;  3UPN A;  2J9P A;  4XUZ A;  1ESU A;  2YKF A;  4HBT A;  2VV8 A;  2UV0 E;  4L9F A;  4P87 A;  4UQI M;  5TBM B;  3PTE A;  4N1H A;  1DJA A;  1LLB A;  3SOI A;  4PMA A;  2PBD P;  3CAX A;  4KZ9 A;  4R70 A;  4PHT A;  2EXA A;  2XA7 M;  3SH9 A;  4OOY A;  2B95 A;  3NOP C;  4S2N A;  3Q07 A;  3IF6 B;  3T4L A;  2VGL S;  3IF5 A;  5DTS A;  4HH2 A;  1XGI A;  2WGW A;  2V1Z A;  2ZQ8 A;  5G18 A;  4CQH A;  4Q8I A;  2XR0 A;  3CMZ A;  3QP5 A;  5HWV A;  3RFB A;  3LO7 A;  5HW3 A;  4OON A;  4R23 A;  5FI6 A;  3MKE A;  4Q0I A;  3NY4 A;  4WM9 A;  4S2O A;  4S2N C;  2VV6 A;  4OQH A;  1RGY A;  3G30 A;  5FQ9 A;  1S66 L;  4EWF A;  2W3H A;  3UNW A;  5GLD A;  4KG2 A;  2L1M A;  3ITB A;  3FPW A;  3MBZ A;  4FSF A;  3D3O A;  1NZU A;  2Y79 A;  4K08 A;  4BJP A;  4HJ3 A;  1ERQ A;  4MDZ A;  3T12 B;  5KMW A;  4E04 A;  2WGV A;  3NIA A;  4I38 A;  3L9K A;  1PWG A;  1GA9 A;  2CC1 A;  4FCF A;  5J7E A;  3EEA A;  3Q7V B;  4ZJ1 A;  5F1F A;  5EUA A;  5EVI B;  3KYQ A;  3RJU A;  2O9B A;  4I3I A;  1HD8 A;  1ALQ A;  3LIA A;  1ONH A;  4WYY A;  5F1G A;  4NK3 A;  3LFV A;  4BQM A;  3C2W A;  4OH0 A;  3JYI A;  2Q9N A;  1W8Q A;  3C38 A;  5HD5 A;  4M3K A;  5IU1 A;  1XKZ A;  3A0S A;  1M6K A;  4DRT A;  2HDQ A;  3UB7 A;  3IT9 A;  4KZA A;  3SS5 A;  1ODV A;  1TF1 A;  1VET B;  1PZO A;  1IEL A;  2XFS A;  5HAI A;  3MXR A;  1XA1 A;  4MNR A;  2X71 A;  1VEU B;  1YLW A;  4JF5 A;  1LL5 A;  2UWX A;  4R1G A;  4E3I A;  1MC0 A;  3CPT A;  5CGX A;  3TW8 A;  3BLM A;  3FG8 A;  3LIF A;  4X53 A;  4IVI A;  4RQ9 A;  5J8X A;  1Y4O A;  5MC7 A;  5HD3 A;  5HZH A;  1QMF A;  2Y2K A;  4G3K A;  5FDS A;  3GSG A;  3CUE A;  1XXM A;  4H8R A;  3LIC A;  3V39 A;  4RYE A;  3BFC A;  3PXP A;  3OC2 A;  2Y91 A;  2PBY A;  5E43 A;  1BLC A;  3HCY A;  2WAF A;  1OTI A;  5EM1 A;  1GA0 A;  4MBK A;  3VOY A;  1BSG A;  1I5Q A;  2QKP A;  4R6L A;  3OZH A;  5E2E A;  4MCW A;  2WKE A;  4O01 A;  3CUE C;  4LLO B;  3NHQ A;  1LSV A;  4OOM A;  1CF0 A;  2C5W B;  4KZ5 A;  2KX6 A;  3O5Y A;  3W4P A;  5AQA A;  3RXX A;  4JGR A;  3QNC A;  3GRJ A;  3Q1F A;  5DF8 A;  1F2K A;  3T1R A;  4HES A;  3MQO A;  1FIK A;  3UME A;  2XH9 A;  4U0T A;  3KX0 X;  5GLC A;  1DY6 A;  3MMH A;  1E3U A;  2XQZ A;  4PM5 A;  2P08 A;  2WKH A;  4WLA A;  2HJ9 C;  4C75 A;  3LY4 A;  4I3A A;  3S7O A;  2XRN A;  4H6J A;  1U60 A;  3KSF A;  1S6R A;  4EES A;  3ZFZ A;  1NRJ A;  2QYB A;  3UB8 A;  3W4Q A;  1H8Y A;  3VP3 A;  3IBJ A;  4U0X A;  3DTI A;  2J8Y A;  2V0U A;  3BW6 A;  4JKT A;  1GHP A;  1DP9 A;  3E4P A;  4FH4 A;  2H28 A;  4DXB A;  1XX2 A;  5AVF A;  4FH2 A;  4LGW A;  1LL9 A;  3BFG A;  2EXB A;  2EWV A;  4BBT A;  2ZQA A;  1H8M A;  3ZNY A;  1W8Y A;  3W4O A;  3QNB A;  4ZRR A;  3IWQ A;  4KG6 A;  4P0M A;  1MWT A;  4ZAM A;  5E2G A;  2XFT A;  2Y2N A;  3N8L A;  4XXR A;  3BM6 A;  3F1P A;  3K3C A;  2L4R A;  2O9C A;  4WF0 A;  1BUL A;  1LT0 A;  2PU2 A;  5L8M A;  1MPL A;  4GS9 A;  3ZNT A;  3IS2 B;  3LEQ A;  3V50 A;  4JXG A;  2I72 A;  3UY6 A;  3DAV A;  3LYX A;  2AVX A;  1ONG A;  3CLO A;  2V0W A;  4GKU A;  1BLS A;  3FC7 A;  4Y2F A;  4NET A;  3GR2 A;  5DTK A;  3PHY A;  5FQM A;  2G2U A;  5IHV A;  3VMA A;  4KZ3 A;  1V9Y A;  3F1O A;  1I2S A;  1QME A;  3EQV A;  5KIZ A;  1RCJ A;  4EU0 A;  3OBF A;  5FAT A;  2OAQ 1;  3MS6 A;  5FQQ A;  1YLY A;  3N4I A;  1K0K A;  1DP6 A;  5FL3 A;  3M6H A;  3ZG8 B;  2Q0O A;  2IWC A;  4R4S A;  4S2M A;  1P9R A;  2W1T A;  5CEB A;  1WA9 A;  3VP0 A;  1DRM A;  3DTE A;  2JKR M;  1FR6 A;  2VA0 A;  1IOU A;  4BD0 A;  1HVB A;  3K3D A;  1Q2Q A;  1WE4 A;  5HAQ A;  5DKL A;  5FA7 A;  5IT5 A;  5EFW A;  1D1J A;  4LPZ A;  3CI6 A;  1J9M A;  1ESI A;  1TD5 A;  1ZKJ A;  3ZDJ A;  4KQD A;  3E0Y A;  2PD8 A;  3M2J A;  3IX3 A;  4DJ2 A;  1TS6 A;  4N1X A;  4EQ1 A;  3ZHH A;  5IS1 A;  4CLC D;  4R3B A;  1BLP A;  3LR0 A;  1SCW A;  4OPQ A;  3ZVT A;  3IX8 A;  4KEN B;  3S22 A;  1T1C A;  2OLV A;  3SH7 A;  3T1S A;  3DWK A;  2NUT C;  4WL9 A;  3R7W A;  5FAP A;  2WUQ A;  1YPR A;  1KGE A;  2DRW A;  1W7F A;  3D9Y A;  2ZMA A;  3NOT C;  4HP9 A;  4JGP A;  1OT9 A;  2XD1 A;  2G7U A;  2JC7 A;  3HUO A;  1ZG4 A;  3A0R A;  4UAA A;  5DFX A;  4ARZ B;  2BLS A;  4I5S A;  2PYR A;  4QY5 A;  4DN0 A;  4N92 A;  2M7U A;  1MXO A;  2PD7 A;  5KSC A;  1YLJ A;  2K2N A;  3M2K A;  4IBR A;  4EBL A;  1PYY A;  2QPN A;  4UQI S;  3UMD A;  2GX5 A;  1MZU A;  3G2Y A;  4R4R A;  4JPM A;  3LIE A;  4K0X A;  5AQ7 A;  1NY0 A;  4QY6 A;  2XA7 S;  3ZG7 B;  4G3V A;  1CEF A;  5CHU A;  5TR7 A;  1FCM A;  1F5M A;  5JYP A;  1JNU A;  3IX4 A;  2EWW A;  5F69 A;  1IKG A;  5FAO A;  4KZ8 A;  5KZH A;  2R78 A;  2D02 A;  2A3U A;  3G32 A;  3O87 A;  4OVD A;  1P9W A;  2WKI A;  4D2O A;  1TS8 A;  1T1A A;  3NCK A;  1W5D A;  3PYP A;  1FR1 A;  3W8K A;  3QP4 A;  4NXE A;  1A0K A;  2VLG A;  1PRQ A;  1PWD A;  1I2W A; 
#chains in the Genus database with same CATH homology
 3BEB A;  4FSF A;  1NZU A;  1PW8 A;  3UPP A;  4OLD A;  2ZM8 A;  1OME A;  4OPZ A;  1VQQ A;  2ZC5 B;  4BL2 A;  2A49 A;  4XUX A;  3HLG A;  4BJP A;  2WGW B;  2ZJ9 A;  5EVI D;  1O07 A;  1ERQ A;  1YT4 A;  3WS1 A;  1YM1 A;  5A93 A;  5KMW A;  3ITA A;  1YLT A;  3BRM A;  4HEF A;  4X56 A;  5JYO A;  2WGV A;  3VP4 A;  3NIA A;  4WZ4 A;  1L0G A;  3PBO A;  2ZC6 B;  1PWG A;  4EBN A;  1GA9 A;  4FD8 A;  1MWS A;  5EVI C;  4E6X A;  2CC1 A;  5F83 A;  5FAS A;  4E3J A;  2HDR A;  2VGJ A;  4FCF A;  3Q7V B;  4ZJ1 A;  5F1F A;  4OP5 A;  5EUA A;  5EVI B;  3RJU A;  3FV7 A;  4YIN A;  4OQ0 A;  1MBL A;  3NDG A;  4JXV A;  1HD8 A;  1PZP A;  1ALQ A;  5GLA A;  2X02 A;  1ONH A;  2R9X A;  3HBR A;  4WYY A;  5F1G A;  4NK3 A;  5CGS A;  3PBT A;  4BQM A;  4F94 A;  5CRF A;  4OH0 A;  1EI5 A;  2WZX A;  3JYI A;  4KZ6 A;  1XGJ A;  2Q9N A;  1W8Q A;  4JXW A;  5GHX A;  3GTC A;  4M3K A;  1XKZ A;  3WS5 A;  4LV0 A;  3LCE A;  4S2K A;  3PAE A;  3BEC A;  1N9B A;  1M6K A;  2EX9 A;  2HDQ A;  2HDU A;  1NYY A;  3IT9 A;  3Q82 A;  3IQA A;  4KZA A;  3VFH A;  4DRT A;  3SS5 A;  3A3J A;  1ES3 A;  4P6B A;  3NI9 A;  3VP2 A;  5CED A;  1PZO A;  1FQG A;  4OOL A;  5DF9 A;  3IWI A;  3NC8 A;  4ZJ2 A;  3LY3 A;  1IEL A;  2V20 A;  1K25 A;  2H0Y A;  1K54 A;  3MZF A;  2XFS A;  5HAI A;  5D3O A;  1ES2 A;  3PAG A;  4UA7 A;  4KZB A;  3MXR A;  1XA1 A;  4MNR A;  2H10 A;  1G6A A;  2X71 A;  4EBP A;  1YLW A;  1CEG A;  4JF5 A;  1TDG A;  1LI9 A;  5EOE A;  4DE1 A;  4QD4 A;  1GCE A;  1LL5 A;  1YMX A;  4JF6 A;  4DE0 A;  2UWX A;  3C7V A;  4R1G A;  3LEZ A;  1GHM A;  4GD8 A;  4GD6 A;  3BLS A;  4UA6 A;  4P85 A;  4E3I A;  2RL3 A;  3WS2 A;  1Z6F A;  1EWZ A;  5BOH A;  5CGX A;  5CTM A;  2OLU A;  3WS0 A;  5GLB A;  3BLM A;  2ZD8 A;  4X68 A;  4X53 A;  1YLZ A;  2JBF A;  2JCH A;  3IHB A;  2ZLY A;  4IVI A;  2ZQ9 A;  5J8X A;  4Y0O A;  3VFF A;  2J9O A;  4OKP A;  1NJ4 A;  1VM1 A;  3OPR A;  4BL3 A;  4S2P A;  5FI2 A;  1QMF A;  3DW0 A;  4GN2 A;  4KQQ A;  2Y2K A;  3O86 A;  3D4F A;  3PBQ A;  3GSG A;  3TG9 A;  2RCX A;  1FCO A;  1K54 C;  1K6S A;  1XXM A;  4KQO A;  4DXC A;  5I94 A;  4PM8 A;  4B88 A;  2Y2I A;  4H8R A;  3VSL A;  4MBH A;  3V39 A;  4RYE A;  4S2L A;  4BLM A;  4EQI A;  3BFC A;  3HL9 A;  3QHY A;  4GDN A;  2XDM A;  3OC2 A;  4EV4 A;  1BZA A;  4R3J A;  2Y91 A;  2PBY A;  5E43 A;  1SDN A;  1IYQ A;  1BLC A;  3VP1 A;  2WAF A;  4HBU A;  2Z2M B;  1GA0 A;  2DNS A;  4MBK A;  1K56 A;  4DDY A;  3ZCZ A;  4WZ5 A;  1KE4 A;  2WK0 A;  2ZC4 B;  3VOY A;  1BSG A;  1ZC2 A;  1O7E A;  2Y59 A;  5FSR A;  3HLW A;  1I5Q A;  3UDF A;  3TSG A;  3GMW A;  3HUM A;  1FOF A;  3OZH A;  5E2E A;  2QMI A;  2WKE A;  3EQU A;  1DJC A;  1NXY A;  3IXH A;  4PPR A;  3PBR A;  4E3N A;  4K0W A;  1H8Z A;  3VSK A;  4OOM A;  4IVK A;  2C5W B;  4KZ5 A;  4KZ4 A;  5KSH A;  3W4P A;  4C6Y A;  1KVM A;  5HL1 A;  5AQA A;  5M19 A;  4LV2 A;  3RXX A;  1ERM A;  1K56 D;  4RX2 A;  3QNC A;  3ZGA B;  4IED A;  3GRJ A;  3RXW A;  3HLC A;  3Q1F A;  1JTD A;  4IBX A;  1L0D A;  5DF8 A;  4Y0U A;  3G2Z A;  4E3K A;  2ZC7 A;  1K38 A;  2R9W A;  4HES A;  1K55 A;  1YLP A;  4OPR A;  1H5X A;  3PBS A;  2XH9 A;  2ZQD A;  3DTM A;  4U0T A;  2V2F F;  1W79 A;  5FQJ A;  1L2S A;  2HP5 A;  4WZ5 C;  1C3B A;  5GLC A;  1DY6 A;  2FFY A;  2B5R A;  3S1Y A;  3UE0 A;  3G34 A;  3M6B A;  1E3U A;  2XQZ A;  4PM5 A;  4GZB A;  2XEP A;  2ZM2 A;  4BEN A;  2WGI A;  1XA7 A;  2P74 A;  1BTL A;  4PM6 A;  2WKH A;  3ZG9 B;  3MKF A;  4DDS A;  4C75 A;  3CJM A;  3LY4 A;  3S4X A;  3G35 A;  2Y2J A;  3BFE A;  4YFM A;  1KVL A;  1JWP A;  2P9V A;  3OCN A;  2WAE A;  1U60 A;  3AGD A;  1ZG6 A;  4Z9Q A;  1S6R A;  4WEL A;  5CTN A;  4B4Z A;  2Y2M A;  3ZFZ A;  5CEC A;  5HAP A;  3W4Q A;  3ZVW A;  1H8Y A;  3HVF A;  3VP3 A;  4U0X A;  2J8Y A;  4JKT A;  3C5A A;  1E3U D;  1GHP A;  1NRF A;  1LI0 A;  4OQG A;  4ID4 A;  4BD1 A;  1K55 C;  2IWD A;  2ZM0 A;  5EOO A;  5E2F A;  4FH4 A;  4DXB A;  3AGE A;  1XX2 A;  1K4E A;  5AQ9 A;  4KZ7 A;  1GHI A;  1JTG A;  4FH2 A;  3WS4 A;  1XPB A;  5HAR A;  3BFF A;  1LL9 A;  3BFG A;  1CI8 A;  2EXB A;  5FDH A;  2E8I A;  4B4X A;  1NYM A;  2ZQA A;  4Y0T A;  1KDW A;  3OPL A;  3GVB A;  3N8R A;  1WYB A;  3ZNY A;  4DE2 A;  2HP9 A;  4U3T A;  1N4O A;  4E3O A;  1W8Y A;  3W4O A;  1BT5 A;  3QNB A;  1IYO A;  3V3S A;  2ZC3 B;  3IWQ A;  3IXD A;  4KG6 A;  2HDS A;  4P0M A;  2IWB A;  3UE3 A;  1MWT A;  4ZAM A;  5E2G A;  1JVJ A;  4A5R A;  1RGZ A;  2XFT A;  2Y2N A;  4X55 A;  3N8L A;  5F82 A;  4XXR A;  3BM6 A;  2P9V B;  4KG5 A;  4GDB A;  2QZ6 A;  3G31 A;  4X6T A;  2WZZ A;  1BUL A;  2OSU A;  1FSY A;  1G68 A;  2PU2 A;  2XF3 A;  3N8S A;  4N9K A;  4LV3 A;  5TFQ A;  1MPL A;  4X69 A;  2XGN A;  3ZNT A;  4ZDX A;  3CG5 A;  1KDS A;  5M1A A;  4UHU A;  1TDL A;  1IKI A;  3V50 A;  3N7W A;  4JXG A;  1LHY A;  2I72 A;  2ZQ7 A;  3UY6 A;  4PM9 A;  4N9L A;  4GNU A;  3A3F A;  2DCF A;  1ONG A;  2ZQC A;  4S2I A;  4C3Q A;  2Y2O A;  2WAD A;  2Z2L B;  2XK1 A;  1PI5 A;  4GKU A;  5CHM A;  1MWU A;  1BLS A;  3HLF A;  4GB7 A;  3MZE A;  1MWR A;  4RX3 A;  3V3R A;  2Q9M A;  5CXW A;  3TOI A;  5EVL A;  4NET A;  4JXS A;  3WRT A;  4CPK A;  1KGF A;  3GR2 A;  3PBN A;  3HLE A;  5DTK A;  5FQM A;  2HP6 A;  3MZD A;  1JWV A;  2G2U A;  2EX2 A;  2EFU A;  5IHV A;  2H0T A;  3HRE A;  4JBF A;  2EX6 A;  3VMA A;  4KZ3 A;  2XD5 A;  1HTZ A;  3SS3 A;  4MEZ A;  1I2S A;  4ZJ3 A;  4OPY A;  1AXB A;  2G2W A;  1QME A;  3EQV A;  5AQB A;  1RCJ A;  1L0F A;  5FAT A;  1YMS A;  3FKW A;  1IYP A;  2J7V A;  1TEM A;  5FQQ A;  3SH8 A;  1YLY A;  4LCL A;  1WYC A;  1XP4 A;  3N4I A;  1ES4 A;  4UA9 A;  3UO9 A;  3FYZ A;  4K91 A;  4WMC A;  2Y2P A;  3MXS A;  5GHY A;  5FAQ A;  2EX8 A;  3M6H A;  3ZG8 B;  4WEJ A;  2PU4 A;  2IWC A;  3C4P A;  3FKV A;  4R4S A;  4S2M A;  3P98 A;  3OCL A;  4ZTK A;  3OPH A;  5CEB A;  1MKI A;  3VP0 A;  1SHV A;  4QB8 A;  4MBF A;  1HZO A;  4Y7P A;  5FI7 A;  3BFD A;  3WRZ A;  1FR6 A;  3C4O A;  3HLD A;  2Y2Q A;  1TVF A;  3IH8 A;  5HX9 A;  3P09 A;  4QHC A;  4E3L A;  1IYS A;  1FCN A;  2Y55 A;  4BD0 A;  3IH9 A;  2Y2H A;  2WYX A;  1HVB A;  3VOZ A;  4WMC D;  1Q2Q A;  1YQS A;  1WE4 A;  4JF4 A;  2OV5 A;  3ZG0 A;  5HAQ A;  5FA7 A;  1E4D A;  5DTT A;  4EUZ A;  5A90 A;  5GL9 A;  3HUN A;  3UE1 A;  3Q7Z A;  1J9M A;  4LV1 A;  2VGK A;  4S2J A;  5EPH A;  1PI4 A;  3E2L A;  1ESI A;  1ZKJ A;  3UDX A;  3ZDJ A;  4QJG A;  2Y2L A;  3B3X A;  1K57 C;  1MY8 A;  4DE3 A;  5FQI A;  3V5M A;  2Y4A A;  1PWC A;  2JE5 A;  3Q81 A;  3M2J A;  2X01 A;  3NBL A;  4JLF A;  4N1X A;  4E6W A;  3ZHH A;  4MLL A;  3IF6 A;  1DJB A;  4R3B A;  1BLP A;  1CI9 A;  3GQZ A;  1L0E A;  1SCW A;  4KQR A;  4OQI A;  4OPQ A;  3G4P A;  3ZVT A;  1E25 A;  3BYD A;  1ERO A;  5CER A;  4KEN B;  3GV9 A;  4RVA A;  4WBG A;  3IXB A;  4LEN A;  1Q2P A;  5L2F A;  5EEC A;  3S22 A;  2OLV A;  4CJN A;  1KGG A;  5FQK A;  3OPP A;  3SH7 A;  3DWK A;  3UDI A;  3UPN A;  2J9P A;  4XUZ A;  1SDE A;  4RA7 A;  1ESU A;  5FAP A;  5DF7 A;  5EE8 A;  4HBT A;  2WUQ A;  2XLN A;  2FFF B;  3IHA A;  1KGE A;  4P87 A;  2DRW A;  3N6I A;  4DKI A;  4DF6 A;  1SKF A;  1KE3 A;  1W7F A;  4R0Q A;  3PTE A;  4N1H A;  4QU3 A;  2ZMA A;  3A3D A;  3E2K A;  1K4F A;  1DJA A;  1LLB A;  3SOI A;  4PMA A;  2XD1 A;  3HUO A;  2JC7 A;  1KE0 A;  4KZ9 A;  3A3I A;  1ZG4 A;  4OP8 A;  4UAA A;  1NZO A;  2Y2G A;  3DWZ A;  1PIO A;  1K6R A;  2BLS A;  2EXA A;  5CGW A;  4QY5 A;  2C6W B;  3AGF A;  4N92 A;  1MXO A;  5KSC A;  1YLJ A;  3IF6 C;  4PM7 A;  3SH9 A;  5CHJ A;  4OOY A;  3M2K A;  4IBR A;  4EBL A;  3IWO A;  4S2N A;  1PYY A;  2QPN A;  3Q07 A;  3IF6 B;  3G2Y A;  4WEK A;  3HLB A;  4R4R A;  2HPB A;  3WWX A;  3IF5 A;  3UN7 A;  5U47 A;  4JPM A;  5A92 A;  5DTS A;  4K0X A;  5AQ7 A;  4GOG A;  1NY0 A;  1Y54 A;  4QY6 A;  3ZG7 B;  3IXG A;  3MFD A;  1CEF A;  3SS4 A;  1XGI A;  3A3E A;  5CHU A;  5TR7 A;  1FCM A;  1S0W A;  2WGW A;  3O3V A;  1M40 A;  3O88 A;  2V1Z A;  2ZQ8 A;  5JYP A;  4OLG A;  5G18 A;  5KZH A;  3FWL A;  1IKG A;  5FAO A;  4KZ8 A;  2BG1 A;  2H5S A;  4Q8I A;  2XR0 A;  3CMZ A;  2A3U A;  3LO7 A;  5HW3 A;  4O7D A;  3G32 A;  5TGF A;  4OON A;  4R23 A;  3O87 A;  1IEM A;  5FI6 A;  5E2H A;  3MKE A;  4OVD A;  3NY4 A;  3ISG A;  1CK3 A;  4ZBE A;  4L0L A;  2WKI A;  4WM9 A;  5A91 A;  4S2O A;  3Q7V A;  4S2N C;  3NDE A;  1BLH A;  5EVI A;  3ZG5 A;  2EFX A;  4D2O A;  1BUE A;  3NCK A;  1W5D A;  1ES5 A;  4OQH A;  1RGY A;  4LCM A;  3C7U A;  1FR1 A;  3G30 A;  5FQ9 A;  1PW1 A;  3W8K A;  3CZD A;  1JWZ A;  5M18 A;  5HFO A;  2GDN A;  3I7J A;  4EWF A;  3UNW A;  3FZC A;  5GHZ A;  1K57 A;  5GLD A;  5DVA A;  4KG2 A;  1FSW A;  1RP5 A;  3UPO A;  4E3M A;  3ITB A;  3MBZ A;  1PWD A;  1I2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...