3SOIA

Crystallographic structure of bacillus licheniformis beta-lactamase w210f/w229f/w251f at 1.73 angstrom resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDFMKRNTTGDALIRAGVPDGFEVADKTGAASYGTRNDIAIIFPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray evidence of a native state with increased compactness populated by tryptophan-less B. licheniformis beta-lactamase.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 90
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3soiA00
2ZM8A 3PBRA 1XA7A 3S1YA 4X69A 2Y2JA 2WKIA 3O3VA 3VP1A 1ESIA 4GN2A 2H10A 1XP4A 3HUOA 4X6TA 3ZG5A 1KGGA 4E3KA 3HVFA 1ES3A 1LL9A 3V39A 1JTDA 5HAIA 1RGYA 2BG1A 2QZ6A 3ZGAB 2R9WA 3PAGA 5A92A 5I94A 3HLBA 3OZHA 4DXCA 1JWZA 5FAOA 1FCOA 3GVBA 1NRFA 3Q07A 1YM1A 4Y7PA 3WRZA 3CG5A 1W5DA 4CJNA 3Q7VB 5D3OA 5E2EA 1GA9A 2HPBA 4H8RA 2WADA 1K6RA 5DF8A 5AQBA 3NC8A 2Y2QA 4S2MA 3AGEA 1I2SA 4K0XA 2XQZA 4JBFA 2V1ZA 4RVAA 3G2ZA 1IKGA 1PZPA 1DJBA 4MLLA 2ZQAA 3G34A 4BD1A 3LY3A 3ISGA 3IXGA 4P87A 4IVIA 4E6XA 5CEBA 2C5WB 2XEPA 4UA9A 4EBPA 1K38A 4YFMA 4R0QA 1RP5A 3SS5A 4JXSA 3RXWA 5HARA 3S22A 1J9MA 1FR1A 4BENA 2EX8A 3W4PA 4OONA 5AQ7A 4GNUA 1K55C 4DKIA 4WEJA 2XDMA 3MZEA 3NCKA 2ZQ9A 2X01A 4KZ3A 1BTLA 5IHVA 2B5RA 2C6WB 4JF4A 4OKPA 4E3IA 3VFHA 3FKWA 2G2WA 3IXBA 3TSGA 4R1GA 1CK3A 2RCXA 4OQHA 4F94A 3E2LA 3WWXA 5CTMA 2Y2NA 5BOHA 4QHCA 1KVLA 3JYIA 3IH8A 1IEMA 2ZC3B 3LY4A 1GCEA 3CMZA 3M2JA 4HBTA 3IWQA 3VP3A 2HDQA 5HFOA 3IXDA 5KSCA 2OSUA 5CHUA 1BLPA 4R3JA 4GOGA 1Q2QA 5EE8A 1L0GA 1HD8A 2WAFA 1ZKJA 1BT5A 1BLCA 5DF7A 3B3XA 4DE0A 4E3MA 2Z2MB 4LV2A 5CERA 1HVBA 4KENB 3UNWA 1PW1A 1S6RA 4KZ8A 5CECA 1U60A 1W8YA 3IHBA 4OPZA 1W79A 1K54A 1SCWA 3A3EA 3OCNA 3RXXA 4BD0A 4BL2A 5HL1A 1WE4A 2WKEA 4NK3A 4XUZA 3UE0A 1NJ4A 1ZG6A 4KZBA 1YLTA 2ZQCA 2IWBA 2EFUA 3MXRA 3UPNA 4BLMA 4ZAMA 1K56A 1ES4A 5EVLA 4S2PA 2I72A 5A91A 4S2KA 4OPRA 5AQAA 4BQMA 4LV3A 4IEDA 4JKTA 1YLPA 1ZC2A 5E2GA 2JCHA 3HUNA 3SS4A 4JXGA 4PM9A 2Y2HA 3N8LA 2Y59A 4E6WA 4OVDA 3DWZA 4GDNA 1PYYA 4WYYA 3BFFA 2EX9A 3G4PA 3DW0A 2RL3A 1PZOA 1L0DA 3C4PA 5FI2A 5FQIA 2WGIA 2ZD8A 1HZOA 3P98A 4JF6A 2ZMAA 3IF6C 4ZBEA 4KZ7A 2XFSA 5EPHA 5U47A 2WK0A 1TDLA 3ZG7B 2OLUA 3IF6B 4S2LA 3DWKA 3RJUA 2Y2LA 4FD8A 3ZNTA 4S2JA 4WZ5C 1I5QA 4HBUA 1YLZA 4C75A 3FKVA 3OCLA 2Y91A 4U0XA 5EVIA 4P85A 3VOZA 3AGDA 3W8KA 4Q8IA 2XH9A 2WGVA 2Y4AA 4KZ6A 2WZXA 4WZ4A 3S4XA 3V3SA 4D2OA 2XD5A 4OLDA 2V2FF 3G35A 3MBZA 5M19A 4PM6A 2DRWA 4E3NA 5FDHA 4JLFA 4GDBA 1NYMA 2WZZA 1KE3A 1PWCA 1ESUA 2Y2MA 4RA7A 2PBYA 1ES5A 3IF5A 1K4EA 5HW3A 2Y2IA 1NY0A 4FSFA 3WS4A 3Q1FA 2WAEA 1NYYA 3BFCA 1ERQA 2JBFA 4U0TA 3UPPA 3OC2A 2JC7A 3E2KA 5AQ9A 3VMAA 2EXBA 3ZG8B 3SOIA 5FQQA 4WEKA 1JVJA 1GHPA 1CEGA 3HLFA 3CZDA 5CEDA 2EXAA 1Q2PA 1DJAA 3UE1A 3OPLA 1LI9A 1LI0A 2HP6A 5JYPA 2VGKA 3ITBA 3NY4A 3ZHHA 5FAQA 3QNBA 2UWXA 1ES2A 5A90A 5M1AA 3MZFA 1FCNA 2HP5A 3O88A 3IF6A 1PI5A 4KQOA 4OP8A 5EECA 1IKIA 5GL9A 3A3FA 5E2FA 5KZHA 3PBOA 3UDFA 1MWUA 5CGWA 2OLVA 5EVIB 2DCFA 1YMXA 4DDSA 4Y0TA 3N6IA 2ZM2A 4OPQA 4ZTKA 1ALQA 3GRJA 4R23A 5GHXA 5KSHA 3V5MA 2X02A 3C7UA 4B4XA 1E3UD 3IT9A 4Z9QA 4E3LA 4UAAA 2PU2A 1N9BA 1SDNA 4UHUA 3HLGA 1KE4A 1DJCA 2IWDA 2EX2A 3BFDA 4QB8A 4KG6A 3G32A 3FZCA 4LCLA 3EQUA 1LL5A 1N4OA 4UA7A 4WM9A 1PI4A 3WS0A 1K57C 1MKIA 1BULA 3MKEA 5GLDA 4YINA 1K55A 3QNCA 3N7WA 1H8YA 1VQQA 4OH0A 2XGNA 3IHAA 3HLEA 1H8ZA 4QD4A 3BFEA 4JXVA 3VSLA 1MPLA 1XGJA 3I7JA 2P9VB 5CHMA 4S2IA 4OQIA 1K25A 3W4OA 3GV9A 3VP2A 4X55A 3Q7ZA 4ID4A 4DXBA 3HREA 4OLGA 1GHIA 1W8QA 4MBKA 5KMWA 3BRMA 2WKHA 4WBGA 5GLCA 5HX9A 3GR2A 4JF5A 3A3IA 4GKUA 3O87A 1IYQA 1JTGA 3LCEA 3PBNA 4N1XA 3ZFZA 1S0WA 3V50A 2GDNA 1VM1A 1IYSA 2WGWB 1K56D 2Y2PA 3BM6A 4N9LA 3NIAA 4LV0A 3D4FA 4FH2A 5DTSA 4OOLA 4BL3A 1MWSA 1JWPA 2Q9MA 2PU4A 1E4DA 4EBNA 5L2FA 2G2UA 2HP9A 2X71A 3G30A 1XA1A 4MBFA 2FFYA 1RGZA 4MNRA 3N4IA 3ZG0A 4Y0UA 1MY8A 4PPRA 1WYBA 3C4OA 1CI9A 1GA0A 1NXYA 4P6BA 1G68A 1K57A 1KDWA 1NZOA 4O7DA 1IYPA 5CHJA 3SH9A 4U3TA 1W7FA 2ZC4B 3HLWA 1QMEA 4GD8A 4LV1A 1BLHA 2XD1A 4C3QA 1LLBA 4QU3A 5FQMA 3Q81A 3ZCZA 5J8XA 3EQVA 2QMIA 4S2NC 3HLDA 5FQ9A 3M2KA 3BEBA 2J7VA 1ONGA 3SH8A 4K0WA 3GTCA 1FQGA 3BLMA 4OOMA 5EUAA 3ITAA 4GZBA 1DY6A 5M18A 3O86A 2XK1A 1YT4A 5F82A 1Y54A 2QPNA 2ZC7A 4B4ZA 1YLYA 5CGXA 2VGJA 5EVID 1FCMA 2WUQA 3OPRA 4OOYA 1QMFA 5EVIC 1ONHA 5GLAA 1FR6A 4DF6A 3UE3A 1E25A 2J9OA 3ZNYA 5FQJA 4S2OA 4OQ0A 3OPPA 5CGSA 1YLWA 3VSKA 4E3JA 1L0FA 4KG2A 1PWDA 3IWOA 1XX2A 2HDRA 4MEZA 3PBQA 5G18A 3VP4A 3TOIA 1PIOA 4JXWA 2DNSA 2XLNA 1KGEA 2JE5A 1WYCA 5FQKA 4XUXA 3DTMA 2IWCA 2Y2OA 4GD6A 4IBRA 4C6YA 4ZDXA 3BFGA 4X56A 3HBRA 2BLSA 4Y0OA 1NZUA 1CEFA 4DE3A 2Y2GA 3BYDA 1EWZA 5FAPA 3BECA 4BJPA 3ZVWA 4N92A 3SH7A 3CJMA 3VFFA 1XXMA 1SKFA 1MXOA 4L0LA 5GLBA 4EWFA 5DTKA 4NETA 1E3UA 5TFQA 3GSGA 3UN7A 3V3RA 1BUEA 3NDGA 1IYOA 2H0YA 5DF9A 1PWGA 3UPOA 1L0EA 3UDIA 4DRTA 5FA7A 4X53A 3N8RA 5F1GA 4ZJ1A 4OQGA 1TDGA 2H5SA 3ZDJA 3MZDA 3BLSA 3WS5A 5CRFA 3P09A 3PAEA 5GHZA 5TGFA 1JWVA 2ZQ8A 4ZJ2A 4KZ9A 2J9PA 3SS3A 4EV4A 4DE2A 2E8IA 4E3OA 4HEFA 3UY6A 2H0TA 4KG5A 4KQRA 2ZJ9A 4IVKA 5CXWA 1SDEA 5EOOA 1Z6FA 2ZQ7A 3NI9A 2ZC6B 1IELA 5DVAA 4OP5A 2J8YA 5A93A 1BSGA 2XR0A 1H5XA 1OMEA 3MXSA 4EQIA 1AXBA 3FWLA 5E43A 2HDUA 2ZLYA 3G31A 3IWIA 4JPMA 4EBLA 1YLJA 2XFTA 3OPHA 4LCMA 4ZJ3A 3WRTA 1HTZA 5FI7A 1M6KA 1K6SA 3LEZA 1EROA 2CC1A 1FOFA 3GMWA 2V20A 1BZAA 3M6HA 1ERMA 1EI5A 1TEMA 2WYXA 4N1HA 3NDEA 2ZM0A 4PM8A 1YMSA 4R4RA 5HAPA 2ZC5B 3C7VA 4RX3A 4DE1A 4UA6A 1CI8A 1KDSA 3HL9A 1PW8A 1MWTA 1XGIA 1C3BA 4KZ5A 4WELA 2EFXA 4P0MA 4KZ4A 3Q82A 3HUMA 1FSYA 3VOYA 4KZAA 1K54C 4DDYA 2XF3A 3NBLA 2WGWA 2OV5A 2P9VA 5F1FA 3IXHA 1ZG4A 4RX2A 2HDSA 2A3UA 5FATA 1XKZA 5FI6A 2Q9NA 4HESA 3LO7A 4MBHA 5TR7A 4K91A 2Y55A 5DTTA 5JYOA 4KQQA 4X68A 3M6BA 1I2WA 4R3BA 4LENA 3FV7A 1YQSA 3MKFA 3VP0A 1SHVA 2R9XA 3Q7VA 3QHYA 1LHYA 3IQAA 3HLCA 3FYZA 5CTNA 3PBTA 4WMCA 3TG9A 4QJGA 4R4SA 1KE0A 1MWRA 4S2NA 1GHMA 4QY5A 1O07A 1KVMA 2Y2KA 5EOEA 4IBXA 1K4FA 1TVFA 1M40A 4RYEA 4WZ5A 4A5RA 4WMCD 3A3JA 1L2SA 3UDXA 5FASA 4CPKA 1MBLA 5FSRA 3N8SA 4QY6A 1KGFA 4B88A 3PTEA 5E2HA 1FSWA 4PMAA 1G6AA 2FFFB 3MFDA 4OPYA 3UO9A 2ZQDA 4N9KA 3PBSA 5GHYA 3ZVTA 4EUZA 2Z2LB 3A3DA 3GQZA 4PM5A 3C5AA 4FCFA 1RCJA 4M3KA 4PM7A 3WS2A 4XXRA 2P74A 3ZG9B 3IH9A 1O7EA 4GB7A 1BLSA 3W4QA 4FH4A 5F83A 3AGFA 2A49A 5HAQA 3WS1A 2EX6A 1XPBA 3G2YA
chains in the Genus database with same CATH superfamily
1WA9A 4HP4A 4X69A 3VP1A 1ESIA 3E4PA 3HUOA 2PR6A 3HVFA 3UB7A 5C5KA 3PAGA 5KIZA 4XT2B 4DXCA 2VGLM 2Z6DA 2VV8A 3GVBA 1NRFA 3Q07A 3CG5A 1W5DA 3UB6A 2MJ6A 4CJNA 3BQ8A 3Q7VB 2JKTM 2PYPA 4S2MA 1VEUA 3ULFA 1PZPA 1DJBA 3G34A 4BD1A 3LY3A 4IVIA 2C5WB 2XEPA 4UA9A 4JXSA 5HPFA 3RXWA 3LYXA 1J9MA 4GCZA 1K55C 3IBRA 4DKIA 2ZQ9A 3FC7A 2JN7A 1V9ZA 2VZWA 2B5RA 4OKPA 3L7HA 2XRNA 4OQHA 3UB9A 4QPRA 2V0UA 2ZBBA 5CHUA 1BLPA 1Q2QA 1HD8A 1ZKJA 5DF7A 2JKFA 5CERA 3UB8A 3A3EA 3RXXA 5HL1A 1F5MA 4NK3A 1NJ4A 1ZG6A 2ZQCA 2IWBA 3UPNA 4OPRA 4JKTA 1YLPA 5E2GA 4PM9A 4EW7A 3DWZA 1MC0A 2RL3A 1L0DA 2WGIA 2ZD8A 4G3VA 4KZ7A 3TW8A 5EPHA 2VGLS 2A24B 2WK0A 1TDLA 2QKPA 1TS7A 4WZ5C 4HBUA 5EVIA 4P85A 2Y4AA 2HZ5A 2WZXA 2XD5A 5FDSA 3KSIA 2DRWA 4JLFA 2VK3A 4GDBA 1NYMA 1KE3A 1YKDA 2Y2MA 4RA7A 2PBYA 1G28A 5HW3A 4FSFA 3B42A 3H7WA 2QJ7A 3UPPA 3OC2A 2JC7A 4I3AA 3E2KA 2EXBA 4FUWA 3LEQA 1GHPA 3V67A 1DJAA 1F2KA 3GECA 3NY4A 1ES2A 3MXQA 3MZFA 3S7OA 5EECA 1OT6A 5GL9A 3UDFA 2J3TD 5CGWA 2OLVA 1P0ZA 1TS0A 1YMXA 4DDSA 1ALQA 5GHXA 2O9AA 3C7UA 4Z9QA 3IT9A 3CPTA 2PU2A 1N9BA 1SDNA 4MN6A 3HLGA 5J4EA 4KG6A 4FTXA 3G32A 3EQUA 3WS0A 2ZMVA 5GLDA 4YINA 1K55A 4GHIB 4HJ3A 1YPRA 1DP9A 2XGNA 2W3DA 5AVEA 4JXVA 3C30A 4DN0A 5CHMA 3W4OA 1K25A 1L3LA 5G4YA 2W3EA 4X55A 4Q0HA 2VV6A 1ODVA 3A3IA 3O87A 1JTGA 3PBNA 1GSWA 5DFXA 2GDNA 2WGWB 3BM6A 4HJ4A 4N9LA 4LV0A 4BL3A 1JWPA 2Q9MA 3T1QB 2OAQ1 4ARZB 2HP9A 1XA1A 1RGZA 5EM1A 1TD5A 1GA0A 2PRFA 4NG2A 1G68A 1K57A 5CHJA 1CQAA 4F3LA 2WKRA 2XD1A 5J8XA 3E4QA 3GTCA 4GZBA 1DY6A 3O86A 5F68A 2LB5A 5EVID 1FCMA 4LRXC 5EVIC 4M4XA 1VETB 4DF6A 5FQJA 3EEHA 3H9WA 1YLWA 4MN7A 5EFWA 2HDRA 4MEZA 3E0YA 4HIAA 5FQKA 4XUXA 2LB9A 2A2LA 3K3DA 4GD6A 3BFGA 2BTFP 1EWZA 4R70A 5FAPA 3BECA 3CJMA 5LBRA 2XSSA 4YOFA 4L0LA 4Y3IA 3T50A 5DTKA 4NETA 5TFQA 4CLCA 1IYOA 3SW1A 1L0EA 3EGXC 4NXBA 4ZJ1A 1LSXA 1TDGA 1W63Q 4IJGA 5CRFA 3PAEA 2W3FA 2ZQ8A 4ZJ2A 2CMNA 3SS3A 4EV4A 4DE2A 4E3OA 4LRZE 5EOOA 1SDEA 5L07A 3NI9A 2ZC6B 5DVAA 1XJ6A 2XR0A 1S1ZA 3MXSA 4ESPA 2ZLYA 4LCMA 1K6SA 5HPIA 2CC1A 1FOFA 3F1OA 5HD3A 4NXEA 3M6HA 1ERMA 5L8MA 1EI5A 4N1HA 3NULA 2E8JA 1YMSA 4RQ9A 4RX3A 4UA6A 1CI8A 1KDSA 1P97A 3QP5A 4II7A 4GW9A 4P0MA 1FSYA 3VOYA 3KYZA 5IT5A 2P9VA 4GS9B 2HDSA 3BY8A 5FI6A 4HESA 5TR7A 5JYOA 4KQQA 2B18A 3PYPA 4HH3A 4DMZA 3QHYA 1LHYA 3IQAA 3HLCA 5CTNA 4QJGA 4R4SA 1KE0A 1GHMA 1O07A 2Y2KA 4XT2A 4WZ5A 4WMCD 3A3JA 4CPKA 5FSRA 1G6AA 3T4KA 4LLOB 5HDSA 4N9KA 4HNBA 4FCFA 4M3KA 3WS2A 1OTIA 2VV7A 3IH9A 1O7EA 1UWPX 5F83A 4EXOA 2YKHA 3G2YA 1NLZA 3S1YA 1XJ4A 2Y2JA 2WKIA 2H10A 3ZG5A 1KGGA 5HD5A 2QZ6A 2R9WA 2P7JA 1PNEA 2L1MA 5FAOA 5HWWA 1FCOA 4Y7PA 2M7VA 3S7QA 5E2EA 4L9EA 1K6RA 3BY9A 2JKTI 2Y2QA 3CPTB 4K0XA 2V1ZA 4RVAA 1P9WA 1IKGA 3G2ZA 4MLLA 4JGQA 3IXGA 3KO6A 2V9AA 4G3KA 4AFIA 4YFMA 1RP5A 5A8BA 5HARA 3T1SA 3W4PA 4OONA 5AQ7A 4GNUA 3LIEA 3NCKA 4JF4A 3LGOA 4E3IA 4R1GA 4F94A 4LRYC 3WWXA 5BOHA 1H8MA 1NLYA 3DTKA 3JYIA 3LY4A 5J7EA 3IWQA 5HFOA 4I3JA 4R3JA 2W1TA 3HJIA 1L0GA 1S4SA 2ZOIA 1BLCA 4E3MA 4DJ2A 2FH5A 4WF0A 1HVBA 1S66L 1S6RA 4KZ8A 3CITA 3IHBA 1XFQA 2M7UA 2HJ9C 4BD0A 3MJQA 1WE4A 4IUHA 4XUZA 3UE0A 5F6AA 4CQHA 4F3LB 2EFUA 4S2PA 2Y79A 1G5UA 4LV3A 4IEDA 2JCHA 2Y59A 3QP4A 2EX9A 4H6JA 3DW0A 1PZOA 3C4PA 3JVVA 2EWVA 5EV0A 2ZL1A 4ZBEA 2XFSA 5AJGA 3IF6B 4KUOA 3ZNTA 3DWKA 4S2JA 3F1PB 4C75A 3IBJA 3FKVA 3W8KA 2XH9A 2QJ5A 2GJ3A 2L0WA 3CWFA 4D2OA 2V2FF 5M19A 4E3NA 1W63M 2WZZA 1ESUA 3IF5A 2WAEA 4PAUA 4P6ZS 3MSHA 2OWJA 3ZG8B 5FQQA 5CEDA 3CZDA 1HLUP 4CLCB 3UMDA 5JYPA 4ZRRA 5M1AA 4OP8A 1PI5A 5E2FA 5KZHA 3PBOA 1GSXA 3QP2A 1MWUA 2DCFA 2XA7S 2ZM2A 3LIDA 4ZTKA 3JVUA 2EA9A 3V5MA 2X02A 3C8CA 4UAAA 2HJEA 2J80A 2IWDA 3BFDA 4QB8A 4LCLA 2HF6A 1LL5A 4UA7A 1PI4A 3OLOA 1T1AA 1MKIA 2IA2A 3FPWA 1OPXA 1H8YA 1VQQA 1H8ZA 2PDRA 1XGJA 4L9FA 3I7JA 1GSVA 3GV9A 4ID4A 1H3QA 3HREA 1W8QA 5DKKA 4MBKA 4WBGA 4K08A 5GLCA 2QHKA 3GR2A 3UMEA 1TF1A 1JNUA 3E98A 3KSGA 5IS1A 4EESA 4N1XA 1H0MA 3V50A 3R7WA 1N9NA 1VM1A 2VJWA 1K56D 3UB5P 3NIAA 2W1RA 2QYBA 2PU4A 4MCWA 4BBUA 4EBNA 5L2FA 3G30A 4MBFA 3ZG0A 4PPRA 1WYBA 5L10A 3A0RA 4YWZA 1NZOA 4O7DA 1IYPA 3SH9A 3T1RA 3CAXA 4LV1A 1LLBA 4QU3A 3Q81A 3ZCZA 3A0SA 3C38A 5K5BA 5FQ9A 3UE6A 1LSWA 2J7VA 3BEBA 4MN5A 1ONGA 2KDKA 1FQGA 3F1NB 4CLCC 4EERA 5F82A 1D06A 5TBMA 1Y54A 2QPNA 2ZC7A 2EWWA 1YLYA 2VGJA 3OPRA 1FR6A 1E25A 3OPPA 4ARZA 4E3JA 1L0FA 1XX2A 3PBQA 3VP4A 1PIOA 4JXWA 4HI4A 4NXFA 1KGEA 2JE5A 3NOTC 4IBRA 4ZDXA 2BASA 1XXMA 1SKFA 3D3OA 1E3UA 3GSGA 3V3RA 3UDIA 4DRTA 4X53A 3ZDJA 3MZDA 2ACGA 4PKYA 2PHYA 1CJFA 5TGFA 1S67L 4HEFA 4BBTA 4HHDA 4EQ1A 2ZJ9A 2XROA 1Z6FA 3OBFA 1YSQA 4EQIA 2DMWA 4JPMA 2XFTA 1M6KA 3GMWA 1BZAA 3CUEA 1TEMA 3HJKA 4MDZA 5I5LA 4NEED 2ZC5B 4DE1A 3KSHA 3HL9A 1PW8A 1MWTA 1XGIA 1LT0A 4H6JB 2EFXA 3P7NA 3MQOA 4KZAA 2XF3A 3NBLA 2V8FA 1DP6A 2WKPA 5F1FA 4RX2A 2GNXA 2W3GA 3LO7A 4K91A 2Y55A 1I2WA 4Y2FA 3ZYTA 3MR0A 3VP0A 2R9XA 3LR4A 3TG9A 1VEUB 4QY5A 4B93A 2FZ0A 1KVMA 5EOEA 5FASA 3N8SA 4QY6A 1KGFA 4B88A 5E2HA 2FFFB 3UO9A 1UWNX 5GHYA 4DJ3A 3A3DA 4EUZA 4PM5A 1RCJA 3CHWP 4XXRA 2P74A 5DKLA 1SKOA 4ME4A 4O01A 2A49A 5G4ZA 1G6OA 5HWVA 3O3VA 2JKRI 2D01A 4Y5FA 4GN2A 3PHYA 4X6TA 4E3KA 1T1BA 3V39A 1JTDA 5HAIA 2BG1A 5I94A 1JWZA 4QWOA 3MQ0A 1YM1A 4GLQA 3WRZA 1T19A 1GA9A 2HPBA 5F5YA 3FPVA 5DF8A 3NC8A 1AWIA 2XQZA 2ZQAA 3ISGA 2V1AA 4EBPA 1K38A 2G7UA 4R0QA 1YSPA 3SZTA 1F9IA 3LFVA 3SS5A 2O99A 1FR1A 2EX8A 2PD8A 3R7WB 3H82A 4WEJA 2XDMA 3MZEA 3BW6A 4KZ3A 3K2NA 2C6WB 2GX5A 1SKOB 1UGUA 3FKWA 2G2WA 3TSGA 4MMNA 2RCXA 4YNRA 2Q0OA 3E2LA 2O0YA 5CTMA 4QHCA 1GCEA 3CMZA 3M2JA 3VP3A 2HDQA 4KQDA 4GOGA 3IS2A 2WAFA 1BT5A 4R38A 4LV2A 4KENB 3UNWA 2PAVP 3T12B 4OPZA 3F1NA 1K54A 1SCWA 3OCNA 2ZOHA 4BL2A 2WKEA 4X25A 4KZBA 1A0KA 1K56A 4X1MA 4ZAMA 5EVLA 5A91A 4S2KA 1F98A 4JGOA 5AQAA 4BQMA 3QP8A 4UQIS 4FOFA 2V0WA 4I39A 1Y28A 1ZC2A 3HUNA 3SS4A 3NHQA 2Y2HA 4E6WA 4OVDA 4GDNA 1PYYA 4WYYA 4EEUA 2OAP1 5FI2A 1HZOA 3P98A 2ZMAA 1Z09A 5U47A 3ZG7B 3RJUA 2V1BA 1I5QA 3OCLA 3KX0X 4U0XA 3VOZA 4Q8IA 3U2AA 4BWIA 3S4XA 3B33A 3EWKA 3MBZA 3T1XA 4PM6A 3GDIA 1D7EA 1K4EA 2Y2IA 1NY0A 4NXGA 1NYYA 3BFCA 2J3WA 1ERQA 2JBFA 4U0TA 3VMAA 3SOIA 1JVJA 2EXAA 2OOLA 2HP6A 3ITBA 2V8CA 1FCNA 5DFYA 5AVFA 2P04A 3IF6A 4KQOA 1TS6A 1IKIA 2K31A 2QWSA 2M1CA 4Y0TA 3N6IA 2W0NA 3T4TA 4R23A 3GRJA 5EM0A 5KSHA 1XJ3A 1IOUA 1E3UD 4E3LA 1OJ5A 3E4OA 4ETZA 4R3AA 4UHUA 1KE4A 1DJCA 2EX2A 3NJAA 3S7PA 1K57C 3C2WA 3G6OA 1BULA 3MKEA 4I5SA 4LPZA 3EEAA 2Y8HA 4QD4A 3BFEA 1MPLA 3MFXA 4S2IA 3CUEC 3BJNA 1VETA 4DXBA 1GHIA 2O9BA 5DJUA 3BRMA 2VX8A 3LCEA 1K0KA 3ZFZA 1S0WA 1MZUA 5DTSA 4OOLA 1MWSA 2PBDP 3P01A 1E4DA 2G2UA 2KLIA 2FFYA 4MNRA 2B02A 3C4OA 2WKQA 4P6BA 1KDWA 1W7FA 3HLWA 4GD8A 1STZA 4C3QA 3CLOA 3EQVA 1EW0A 1V9YA 2QMIA 4S2NC 3M2KA 2KOIA 4EU0A 4K0WA 3BLMA 3A0VA 3MS6A 4GHIA 2W27A 3T4LA 1YT4A 2ZL1B 4B4ZA 3VE4A 4JGPA 2J9OA 3LR0A 3OOVA 4CLCD 1PWDA 1OTAA 3TOIA 2DNSA 3QP6A 2XLNA 4Y13A 2K7SA 3DTMA 2Y2OA 4C6YA 5L09A 3HBRA 1NZUA 1P9RA 4DE3A 1DP8A 3BYDA 4O0PA 4BJPA 4N92A 2JKGA 3SH7A 3VFFA 2J3TC 3IX8A 1MXOA 3UN7A 2KX6A 5HZHA 3NDGA 2H0YA 5DF9A 3FG8A 5F1GA 3BLSA 3WS5A 3P09A 5GHZA 1JWVA 3PR6A 4KZ9A 2J9PA 2E8IA 3S7NA 4EUVA 2H0TA 4GJ4A 4KG5A 4IVKA 3DAVA 2J8YA 5A93A 3TJZC 4HOIA 1H5XA 1OMEA 4UQIM 5E43A 3FWLA 2O9CA 3ICYA 4PKYG 4EBLA 3OPHA 4ZJ3A 3WRTA 1IFQA 1N9LA 2V20A 3KSFA 2H28A 2L4RA 4B9OA 3NDEA 2ZM0A 4PM8A 2PT7A 4R4RA 5HAPA 3D72A 3LUQA 4KZ5A 3D9YA 4KZ4A 3Q82A 3HUMA 1K54C 4DDYA 1YAXA 5HSQA 2OV5A 1S1YA 1ZG4A 3LR3A 5FATA 4MBHA 1T1CA 3L9KA 4E04A 4Z1WA 3LICA 4R3BA 1YQSA 2HGVA 3FYZA 4WMCA 4S2NA 3NOPC 1K4FA 1TVFA 1L2SA 3UDXA 1MBLA 1FSWA 3MFDA 1XFNA 4OPYA 5HDCA 3PBSA 3ZVTA 2ZMFA 2VA0A 1BLSA 2JHEA 1XPBA 1TS8A 2ZM8A 3PBRA 1XA7A 1MKMA 3H82B 1CF0A 4JGRA 1XP4A 1ES3A 1LL9A 3W2ZA 1RGYA 1ZTUA 3ZGAB 5A92A 3HLBA 1OT9A 3OZHA 4L9GA 1VHMA 1VB6A 4Q0JA 5D3OA 4H8RA 5AQBA 2WADA 3IX4A 3AGEA 1I2SA 3IS2B 4JBFA 4WL9A 3NECA 4P87A 4E6XA 2D02A 5CEBA 3EOIA 4R6LA 3T4OA 1S4RA 4G3WA 1KOUA 3S22A 1SZVA 4BENA 3PXPA 2X01A 1BTLA 5IHVA 2NUTC 3VFHA 5F69A 3IXBA 1CK3A 4LGWA 2Y2NA 1FILA 1KVLA 3IH8A 1IEMA 2ZC3B 4HBTA 2VEAA 3IXDA 3KYEA 3RFBA 5KSCA 2OSUA 3HCYA 3MF0A 2NUPC 5EE8A 4NKPA 3B3XA 2R78A 4DE0A 2VLGA 2Z2MB 1PW1A 5CECA 3DTIA 1U60A 1W8YA 1W79A 4X1LA 3LI9A 1YLTA 3MXRA 4BLMA 2PD7A 2INWA 1OTDA 1ES4A 3VV4A 2I72A 4JXGA 2AVXA 3N8LA 2K2NA 3BFFA 3G4PA 5FQIA 2XA7M 1PRQA 4JF6A 3IF6C 2OLUA 4S2LA 3O5YA 2Y2LA 4FD8A 4EEPA 1LSVA 5MC7A 4UEYA 1YLZA 1OJGA 3RTYA 2Y91A 3AGDA 2WGVA 4KZ6A 4WZ4A 3V3SA 4OLDA 3G35A 5FDHA 3KYQA 1PWCA 4Y15A 1ZHHB 2PR5A 1ES5A 3WS4A 4D60A 3Q1FA 3IX3A 5AQ9A 2B95A 4WEKA 3HLFA 1CEGA 1PFLA 3T4QA 1Q2PA 3UE1A 1FIKA 3OPLA 1LI9A 1OTEA 1LI0A 2VGKA 3ZHHA 5FAQA 3QNBA 2UWXA 5A90A 4BMWA 2HP5A 3O88A 1XJ2A 3A3FA 5FL3A 5EVIB 4IHQA 4OPQA 4WUJA 4PHTA 4B4XA 3EGDC 4HQAA 3NOUC 3TRCA 3DTEA 3H7WB 1T18A 3BWLA 2Z6CA 3FZCA 1N4OA 4WM9A 3QNCA 3F1OB 3N7WA 4OH0A 3IHAA 3HLEA 3VSLA 2PYRA 3K3CA 2JKRM 2P9VB 4GS9A 4OQIA 3TE8A 3VP2A 3B47A 3Q7ZA 4HH2A 4OLGA 3JPUA 5KMWA 2WKHA 5HX9A 4KUKA 3U4LP 4JF5A 3VE3A 4GKUA 1J3WA 1IYQA 5DJTA 1IYSA 2Y2PA 3D4FA 4FH2A 5IU1A 2X71A 3RH8B 3N4IA 4Y0UA 1D1JA 1MY8A 2P08A 1CI9A 1NXYA 2HV1A 4U3TA 2ZC4B 3LR5A 1QMEA 1BLHA 1DRMA 5FQMA 3LI8A 3HLDA 3SH8A 2VKSA 4OOMA 5EUAA 3BQAA 5FEGA 3ITAA 2XK1A 3LIBA 4EETB 1X0OA 3DBAA 5CGXA 5HWTA 2A24A 3MMHA 2WUQA 5FEFA 4OOYA 1QMFA 5GLAA 1ONHA 4WLAA 1LL8A 3UE3A 3ZNYA 4S2OA 4OQ0A 3CI6A 5CGSA 3VSKA 4I3IA 4KG2A 3IWOA 5G18A 5CX7A 4WN5A 2W3HA 1WYCA 2IWCA 4HJ6A 4X56A 4Y0OA 2BLSA 1CEFA 4CLCE 2Y2GA 1ACFA 3ZVWA 2OWHA 5GLBA 3T4SA 4EWFA 5HDDA 1OTBA 1BUEA 4IUKA 1N9OA 1Y4OA 1PWGA 3UPOA 5FA7A 3N8RA 4OQGA 2H5SA 5TBMB 1BYWA 4HY8A 3UY6A 4KQRA 5CXWA 2ZQ7A 1IELA 4OP5A 1BSGA 3LIAA 1AXBA 2HDUA 3G31A 4LFUA 3IWIA 5M18A 1YLJA 1HTZA 5FI7A 3LEZA 1EROA 4Y17A 2W1TB 2WYXA 3ZQ5A 3MQQA 3R4KA 3C7VA 4O8GA 1C3BA 4WELA 3WS1A 2WGWA 3IXHA 3VOLA 2A3UA 1XKZA 2Q9NA 5DTTA 3F1PA 3T4JA 4X68A 3M6BA 2UV0E 5HL6A 3QP1A 4LENA 3FV7A 5EVEA 2GZAA 3MKFA 1SHVA 3Q7VA 3PBTA 5J3WA 1MWRA 4HP9A 1NRJA 4IBXA 4ETXA 4Q0IA 1M40A 4RYEA 4A5RA 4I38A 5TJJA 3PTEA 3LIFA 4PMAA 4P6ZM 2ZQDA 2YKFA 2Z2LB 3GQZA 3C5AA 1NWZA 4PM7A 4BBVA 3ZG9B 4GB7A 3W4QA 4FH4A 3AGFA 5HAQA 2I9VA 2EX6A
chains in the Genus database with same CATH topology
2ZM8A 3PBRA 1XA7A 3S1YA 4X69A 2Y2JA 2WKIA 3O3VA 3VP1A 1ESIA 4GN2A 2H10A 1XP4A 3HUOA 4X6TA 3ZG5A 1KGGA 4E3KA 3HVFA 1ES3A 1LL9A 3V39A 1JTDA 5HAIA 1RGYA 2BG1A 2QZ6A 3ZGAB 2R9WA 3PAGA 5A92A 5I94A 3HLBA 3OZHA 4DXCA 1JWZA 5FAOA 1FCOA 3GVBA 1NRFA 3Q07A 1YM1A 4Y7PA 3WRZA 3CG5A 1W5DA 4CJNA 3Q7VB 5D3OA 5E2EA 1GA9A 2HPBA 4H8RA 2WADA 1K6RA 5DF8A 5AQBA 3NC8A 2Y2QA 4S2MA 3AGEA 1I2SA 4K0XA 2XQZA 4JBFA 2V1ZA 4RVAA 3G2ZA 1IKGA 1PZPA 1DJBA 4MLLA 2ZQAA 3G34A 4BD1A 3LY3A 3ISGA 3IXGA 4P87A 4IVIA 4E6XA 5CEBA 2C5WB 2XEPA 4UA9A 4EBPA 1K38A 4YFMA 4R0QA 1RP5A 3SS5A 4JXSA 3RXWA 5HARA 3S22A 1J9MA 1FR1A 4BENA 2EX8A 3W4PA 4OONA 5AQ7A 4GNUA 1K55C 4DKIA 4WEJA 2XDMA 3MZEA 3NCKA 2ZQ9A 2X01A 4KZ3A 1BTLA 5IHVA 2B5RA 2C6WB 4JF4A 4OKPA 4E3IA 3VFHA 3FKWA 2G2WA 3IXBA 3TSGA 4R1GA 1CK3A 2RCXA 4OQHA 4F94A 3E2LA 3WWXA 5CTMA 2Y2NA 5BOHA 4QHCA 1KVLA 3JYIA 3IH8A 1IEMA 2ZC3B 3LY4A 1GCEA 3CMZA 3M2JA 4HBTA 3IWQA 3VP3A 2HDQA 5HFOA 3IXDA 5KSCA 2OSUA 5CHUA 1BLPA 4R3JA 4GOGA 1Q2QA 5EE8A 1L0GA 1HD8A 2WAFA 1ZKJA 1BT5A 1BLCA 5DF7A 3B3XA 4DE0A 4E3MA 2Z2MB 4LV2A 5CERA 1HVBA 4KENB 3UNWA 1PW1A 1S6RA 4KZ8A 5CECA 1U60A 1W8YA 3IHBA 4OPZA 1W79A 1K54A 1SCWA 3A3EA 3OCNA 3RXXA 4BD0A 4BL2A 5HL1A 1WE4A 2WKEA 4NK3A 4XUZA 3UE0A 1NJ4A 1ZG6A 4KZBA 1YLTA 2ZQCA 2IWBA 2EFUA 3MXRA 3UPNA 4BLMA 4ZAMA 1K56A 1ES4A 5EVLA 4S2PA 2I72A 5A91A 4S2KA 4OPRA 5AQAA 4BQMA 4LV3A 4IEDA 4JKTA 1YLPA 1ZC2A 5E2GA 2JCHA 3HUNA 3SS4A 4JXGA 4PM9A 2Y2HA 3N8LA 2Y59A 4E6WA 4OVDA 3DWZA 4GDNA 1PYYA 4WYYA 3BFFA 2EX9A 3G4PA 3DW0A 2RL3A 1PZOA 1L0DA 3C4PA 5FI2A 5FQIA 2WGIA 2ZD8A 1HZOA 3P98A 4JF6A 2ZMAA 3IF6C 4ZBEA 4KZ7A 2XFSA 5EPHA 5U47A 2WK0A 1TDLA 3ZG7B 2OLUA 3IF6B 4S2LA 3DWKA 3RJUA 2Y2LA 4FD8A 3ZNTA 4S2JA 4WZ5C 1I5QA 4HBUA 1YLZA 4C75A 3FKVA 3OCLA 2Y91A 4U0XA 5EVIA 4P85A 3VOZA 3AGDA 3W8KA 4Q8IA 2XH9A 2WGVA 2Y4AA 4KZ6A 2WZXA 4WZ4A 3S4XA 3V3SA 4D2OA 2XD5A 4OLDA 2V2FF 3G35A 3MBZA 5M19A 4PM6A 2DRWA 4E3NA 5FDHA 4JLFA 4GDBA 1NYMA 2WZZA 1KE3A 1PWCA 1ESUA 2Y2MA 4RA7A 2PBYA 1ES5A 3IF5A 1K4EA 5HW3A 2Y2IA 1NY0A 4FSFA 3WS4A 3Q1FA 2WAEA 1NYYA 3BFCA 1ERQA 2JBFA 4U0TA 3UPPA 3OC2A 2JC7A 3E2KA 5AQ9A 3VMAA 2EXBA 3ZG8B 3SOIA 5FQQA 4WEKA 1JVJA 1GHPA 1CEGA 3HLFA 3CZDA 5CEDA 2EXAA 1Q2PA 1DJAA 3UE1A 3OPLA 1LI9A 1LI0A 2HP6A 5JYPA 2VGKA 3ITBA 3NY4A 3ZHHA 5FAQA 3QNBA 2UWXA 1ES2A 5A90A 5M1AA 3MZFA 1FCNA 2HP5A 3O88A 3IF6A 1PI5A 4KQOA 4OP8A 5EECA 1IKIA 5GL9A 3A3FA 5E2FA 5KZHA 3PBOA 3UDFA 1MWUA 5CGWA 2OLVA 5EVIB 2DCFA 1YMXA 4DDSA 4Y0TA 3N6IA 2ZM2A 4OPQA 4ZTKA 1ALQA 3GRJA 4R23A 5GHXA 5KSHA 3V5MA 2X02A 3C7UA 4B4XA 1E3UD 3IT9A 4Z9QA 4E3LA 4UAAA 2PU2A 1N9BA 1SDNA 4UHUA 3HLGA 1KE4A 1DJCA 2IWDA 2EX2A 3BFDA 4QB8A 4KG6A 3G32A 3FZCA 4LCLA 3EQUA 1LL5A 1N4OA 4UA7A 4WM9A 1PI4A 3WS0A 1K57C 1MKIA 1BULA 3MKEA 5GLDA 4YINA 1K55A 3QNCA 3N7WA 1H8YA 1VQQA 4OH0A 2XGNA 3IHAA 3HLEA 1H8ZA 4QD4A 3BFEA 4JXVA 3VSLA 1MPLA 1XGJA 3I7JA 2P9VB 5CHMA 4S2IA 4OQIA 1K25A 3W4OA 3GV9A 3VP2A 4X55A 3Q7ZA 4ID4A 4DXBA 3HREA 4OLGA 1GHIA 1W8QA 4MBKA 5KMWA 3BRMA 2WKHA 4WBGA 5GLCA 5HX9A 3GR2A 4JF5A 3A3IA 4GKUA 3O87A 1IYQA 1JTGA 3LCEA 3PBNA 4N1XA 3ZFZA 1S0WA 3V50A 2GDNA 1VM1A 1IYSA 2WGWB 1K56D 2Y2PA 3BM6A 4N9LA 3NIAA 4LV0A 3D4FA 4FH2A 5DTSA 4OOLA 4BL3A 1MWSA 1JWPA 2Q9MA 2PU4A 1E4DA 4EBNA 5L2FA 2G2UA 2HP9A 2X71A 3G30A 1XA1A 4MBFA 2FFYA 1RGZA 4MNRA 3N4IA 3ZG0A 4Y0UA 1MY8A 4PPRA 1WYBA 3C4OA 1CI9A 1GA0A 1NXYA 4P6BA 1G68A 1K57A 1KDWA 1NZOA 4O7DA 1IYPA 5CHJA 3SH9A 4U3TA 1W7FA 2ZC4B 3HLWA 1QMEA 4GD8A 4LV1A 1BLHA 2XD1A 4C3QA 1LLBA 4QU3A 5FQMA 3Q81A 3ZCZA 5J8XA 3EQVA 2QMIA 4S2NC 3HLDA 5FQ9A 3M2KA 3BEBA 2J7VA 1ONGA 3SH8A 4K0WA 3GTCA 1FQGA 3BLMA 4OOMA 5EUAA 3ITAA 4GZBA 1DY6A 5M18A 3O86A 2XK1A 1YT4A 5F82A 1Y54A 2QPNA 2ZC7A 4B4ZA 1YLYA 5CGXA 2VGJA 5EVID 1FCMA 2WUQA 3OPRA 4OOYA 1QMFA 5EVIC 1ONHA 5GLAA 1FR6A 4DF6A 3UE3A 1E25A 2J9OA 3ZNYA 5FQJA 4S2OA 4OQ0A 3OPPA 5CGSA 1YLWA 3VSKA 4E3JA 1L0FA 4KG2A 1PWDA 3IWOA 1XX2A 2HDRA 4MEZA 3PBQA 5G18A 3VP4A 3TOIA 1PIOA 4JXWA 2DNSA 2XLNA 1KGEA 2JE5A 1WYCA 5FQKA 4XUXA 3DTMA 2IWCA 2Y2OA 4GD6A 4IBRA 4C6YA 4ZDXA 3BFGA 4X56A 3HBRA 2BLSA 4Y0OA 1NZUA 1CEFA 4DE3A 2Y2GA 3BYDA 1EWZA 5FAPA 3BECA 4BJPA 3ZVWA 4N92A 3SH7A 3CJMA 3VFFA 1XXMA 1SKFA 1MXOA 4L0LA 5GLBA 4EWFA 5DTKA 4NETA 1E3UA 5TFQA 3GSGA 3UN7A 3V3RA 1BUEA 3NDGA 1IYOA 2H0YA 5DF9A 1PWGA 3UPOA 1L0EA 3UDIA 4DRTA 5FA7A 4X53A 3N8RA 5F1GA 4ZJ1A 4OQGA 1TDGA 2H5SA 3ZDJA 3MZDA 3BLSA 3WS5A 5CRFA 3P09A 3PAEA 5GHZA 5TGFA 1JWVA 2ZQ8A 4ZJ2A 4KZ9A 2J9PA 3SS3A 4EV4A 4DE2A 2E8IA 4E3OA 4HEFA 3UY6A 2H0TA 4KG5A 4KQRA 2ZJ9A 4IVKA 5CXWA 1SDEA 5EOOA 1Z6FA 2ZQ7A 3NI9A 2ZC6B 1IELA 5DVAA 4OP5A 2J8YA 5A93A 1BSGA 2XR0A 1H5XA 1OMEA 3MXSA 4EQIA 1AXBA 3FWLA 5E43A 2HDUA 2ZLYA 3G31A 3IWIA 4JPMA 4EBLA 1YLJA 2XFTA 3OPHA 4LCMA 4ZJ3A 3WRTA 1HTZA 5FI7A 1M6KA 1K6SA 3LEZA 1EROA 2CC1A 1FOFA 3GMWA 2V20A 1BZAA 3M6HA 1ERMA 1EI5A 1TEMA 2WYXA 4N1HA 3NDEA 2ZM0A 4PM8A 1YMSA 4R4RA 5HAPA 2ZC5B 3C7VA 4RX3A 4DE1A 4UA6A 1CI8A 1KDSA 3HL9A 1PW8A 1MWTA 1XGIA 1C3BA 4KZ5A 4WELA 2EFXA 4P0MA 4KZ4A 3Q82A 3HUMA 1FSYA 3VOYA 4KZAA 1K54C 4DDYA 2XF3A 3NBLA 2WGWA 2OV5A 2P9VA 5F1FA 3IXHA 1ZG4A 4RX2A 2HDSA 2A3UA 5FATA 1XKZA 5FI6A 2Q9NA 4HESA 3LO7A 4MBHA 5TR7A 4K91A 2Y55A 5DTTA 5JYOA 4KQQA 4X68A 3M6BA 1I2WA 4R3BA 4LENA 3FV7A 1YQSA 3MKFA 3VP0A 1SHVA 2R9XA 3Q7VA 3QHYA 1LHYA 3IQAA 3HLCA 3FYZA 5CTNA 3PBTA 4WMCA 3TG9A 4QJGA 4R4SA 1KE0A 1MWRA 4S2NA 1GHMA 4QY5A 1O07A 1KVMA 2Y2KA 5EOEA 4IBXA 1K4FA 1TVFA 1M40A 4RYEA 4WZ5A 4A5RA 4WMCD 3A3JA 1L2SA 3UDXA 5FASA 4CPKA 1MBLA 5FSRA 3N8SA 4QY6A 1KGFA 4B88A 3PTEA 5E2HA 1FSWA 4PMAA 1G6AA 2FFFB 3MFDA 4OPYA 3UO9A 2ZQDA 4N9KA 3PBSA 5GHYA 3ZVTA 4EUZA 2Z2LB 3A3DA 3GQZA 4PM5A 3C5AA 4FCFA 1RCJA 4M3KA 4PM7A 3WS2A 4XXRA 2P74A 3ZG9B 3IH9A 1O7EA 4GB7A 1BLSA 3W4QA 4FH4A 5F83A 3AGFA 2A49A 5HAQA 3WS1A 2EX6A 1XPBA 3G2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM8 A;  3PBR A;  1XA7 A;  3S1Y A;  4X69 A;  2Y2J A;  2WKI A;  3O3V A;  3VP1 A;  1ESI A;  4GN2 A;  2H10 A;  1XP4 A;  3HUO A;  4X6T A;  3ZG5 A;  1KGG A;  4E3K A;  3HVF A;  1ES3 A;  1LL9 A;  3V39 A;  1JTD A;  5HAI A;  1RGY A;  2BG1 A;  2QZ6 A;  3ZGA B;  2R9W A;  3PAG A;  5A92 A;  5I94 A;  3HLB A;  3OZH A;  4DXC A;  1JWZ A;  5FAO A;  1FCO A;  3GVB A;  1NRF A;  3Q07 A;  1YM1 A;  4Y7P A;  3WRZ A;  3CG5 A;  1W5D A;  4CJN A;  3Q7V B;  5D3O A;  5E2E A;  1GA9 A;  2HPB A;  4H8R A;  2WAD A;  1K6R A;  5DF8 A;  5AQB A;  3NC8 A;  2Y2Q A;  4S2M A;  3AGE A;  1I2S A;  4K0X A;  2XQZ A;  4JBF A;  2V1Z A;  4RVA A;  3G2Z A;  1IKG A;  1PZP A;  1DJB A;  4MLL A;  2ZQA A;  3G34 A;  4BD1 A;  3LY3 A;  3ISG A;  3IXG A;  4P87 A;  4IVI A;  4E6X A;  5CEB A;  2C5W B;  2XEP A;  4UA9 A;  4EBP A;  1K38 A;  4YFM A;  4R0Q A;  1RP5 A;  3SS5 A;  4JXS A;  3RXW A;  5HAR A;  3S22 A;  1J9M A;  1FR1 A;  4BEN A;  2EX8 A;  3W4P A;  4OON A;  5AQ7 A;  4GNU A;  1K55 C;  4DKI A;  4WEJ A;  2XDM A;  3MZE A;  3NCK A;  2ZQ9 A;  2X01 A;  4KZ3 A;  1BTL A;  5IHV A;  2B5R A;  2C6W B;  4JF4 A;  4OKP A;  4E3I A;  3VFH A;  3FKW A;  2G2W A;  3IXB A;  3TSG A;  4R1G A;  1CK3 A;  2RCX A;  4OQH A;  4F94 A;  3E2L A;  3WWX A;  5CTM A;  2Y2N A;  5BOH A;  4QHC A;  1KVL A;  3JYI A;  3IH8 A;  1IEM A;  2ZC3 B;  3LY4 A;  1GCE A;  3CMZ A;  3M2J A;  4HBT A;  3IWQ A;  3VP3 A;  2HDQ A;  5HFO A;  3IXD A;  5KSC A;  2OSU A;  5CHU A;  1BLP A;  4R3J A;  4GOG A;  1Q2Q A;  5EE8 A;  1L0G A;  1HD8 A;  2WAF A;  1ZKJ A;  1BT5 A;  1BLC A;  5DF7 A;  3B3X A;  4DE0 A;  4E3M A;  2Z2M B;  4LV2 A;  5CER A;  1HVB A;  4KEN B;  3UNW A;  1PW1 A;  1S6R A;  4KZ8 A;  5CEC A;  1U60 A;  1W8Y A;  3IHB A;  4OPZ A;  1W79 A;  1K54 A;  1SCW A;  3A3E A;  3OCN A;  3RXX A;  4BD0 A;  4BL2 A;  5HL1 A;  1WE4 A;  2WKE A;  4NK3 A;  4XUZ A;  3UE0 A;  1NJ4 A;  1ZG6 A;  4KZB A;  1YLT A;  2ZQC A;  2IWB A;  2EFU A;  3MXR A;  3UPN A;  4BLM A;  4ZAM A;  1K56 A;  1ES4 A;  5EVL A;  4S2P A;  2I72 A;  5A91 A;  4S2K A;  4OPR A;  5AQA A;  4BQM A;  4LV3 A;  4IED A;  4JKT A;  1YLP A;  1ZC2 A;  5E2G A;  2JCH A;  3HUN A;  3SS4 A;  4JXG A;  4PM9 A;  2Y2H A;  3N8L A;  2Y59 A;  4E6W A;  4OVD A;  3DWZ A;  4GDN A;  1PYY A;  4WYY A;  3BFF A;  2EX9 A;  3G4P A;  3DW0 A;  2RL3 A;  1PZO A;  1L0D A;  3C4P A;  5FI2 A;  5FQI A;  2WGI A;  2ZD8 A;  1HZO A;  3P98 A;  4JF6 A;  2ZMA A;  3IF6 C;  4ZBE A;  4KZ7 A;  2XFS A;  5EPH A;  5U47 A;  2WK0 A;  1TDL A;  3ZG7 B;  2OLU A;  3IF6 B;  4S2L A;  3DWK A;  3RJU A;  2Y2L A;  4FD8 A;  3ZNT A;  4S2J A;  4WZ5 C;  1I5Q A;  4HBU A;  1YLZ A;  4C75 A;  3FKV A;  3OCL A;  2Y91 A;  4U0X A;  5EVI A;  4P85 A;  3VOZ A;  3AGD A;  3W8K A;  4Q8I A;  2XH9 A;  2WGV A;  2Y4A A;  4KZ6 A;  2WZX A;  4WZ4 A;  3S4X A;  3V3S A;  4D2O A;  2XD5 A;  4OLD A;  2V2F F;  3G35 A;  3MBZ A;  5M19 A;  4PM6 A;  2DRW A;  4E3N A;  5FDH A;  4JLF A;  4GDB A;  1NYM A;  2WZZ A;  1KE3 A;  1PWC A;  1ESU A;  2Y2M A;  4RA7 A;  2PBY A;  1ES5 A;  3IF5 A;  1K4E A;  5HW3 A;  2Y2I A;  1NY0 A;  4FSF A;  3WS4 A;  3Q1F A;  2WAE A;  1NYY A;  3BFC A;  1ERQ A;  2JBF A;  4U0T A;  3UPP A;  3OC2 A;  2JC7 A;  3E2K A;  5AQ9 A;  3VMA A;  2EXB A;  3ZG8 B;  3SOI A;  5FQQ A;  4WEK A;  1JVJ A;  1GHP A;  1CEG A;  3HLF A;  3CZD A;  5CED A;  2EXA A;  1Q2P A;  1DJA A;  3UE1 A;  3OPL A;  1LI9 A;  1LI0 A;  2HP6 A;  5JYP A;  2VGK A;  3ITB A;  3NY4 A;  3ZHH A;  5FAQ A;  3QNB A;  2UWX A;  1ES2 A;  5A90 A;  5M1A A;  3MZF A;  1FCN A;  2HP5 A;  3O88 A;  3IF6 A;  1PI5 A;  4KQO A;  4OP8 A;  5EEC A;  1IKI A;  5GL9 A;  3A3F A;  5E2F A;  5KZH A;  3PBO A;  3UDF A;  1MWU A;  5CGW A;  2OLV A;  5EVI B;  2DCF A;  1YMX A;  4DDS A;  4Y0T A;  3N6I A;  2ZM2 A;  4OPQ A;  4ZTK A;  1ALQ A;  3GRJ A;  4R23 A;  5GHX A;  5KSH A;  3V5M A;  2X02 A;  3C7U A;  4B4X A;  1E3U D;  3IT9 A;  4Z9Q A;  4E3L A;  4UAA A;  2PU2 A;  1N9B A;  1SDN A;  4UHU A;  3HLG A;  1KE4 A;  1DJC A;  2IWD A;  2EX2 A;  3BFD A;  4QB8 A;  4KG6 A;  3G32 A;  3FZC A;  4LCL A;  3EQU A;  1LL5 A;  1N4O A;  4UA7 A;  4WM9 A;  1PI4 A;  3WS0 A;  1K57 C;  1MKI A;  1BUL A;  3MKE A;  5GLD A;  4YIN A;  1K55 A;  3QNC A;  3N7W A;  1H8Y A;  1VQQ A;  4OH0 A;  2XGN A;  3IHA A;  3HLE A;  1H8Z A;  4QD4 A;  3BFE A;  4JXV A;  3VSL A;  1MPL A;  1XGJ A;  3I7J A;  2P9V B;  5CHM A;  4S2I A;  4OQI A;  1K25 A;  3W4O A;  3GV9 A;  3VP2 A;  4X55 A;  3Q7Z A;  4ID4 A;  4DXB A;  3HRE A;  4OLG A;  1GHI A;  1W8Q A;  4MBK A;  5KMW A;  3BRM A;  2WKH A;  4WBG A;  5GLC A;  5HX9 A;  3GR2 A;  4JF5 A;  3A3I A;  4GKU A;  3O87 A;  1IYQ A;  1JTG A;  3LCE A;  3PBN A;  4N1X A;  3ZFZ A;  1S0W A;  3V50 A;  2GDN A;  1VM1 A;  1IYS A;  2WGW B;  1K56 D;  2Y2P A;  3BM6 A;  4N9L A;  3NIA A;  4LV0 A;  3D4F A;  4FH2 A;  5DTS A;  4OOL A;  4BL3 A;  1MWS A;  1JWP A;  2Q9M A;  2PU4 A;  1E4D A;  4EBN A;  5L2F A;  2G2U A;  2HP9 A;  2X71 A;  3G30 A;  1XA1 A;  4MBF A;  2FFY A;  1RGZ A;  4MNR A;  3N4I A;  3ZG0 A;  4Y0U A;  1MY8 A;  4PPR A;  1WYB A;  3C4O A;  1CI9 A;  1GA0 A;  1NXY A;  4P6B A;  1G68 A;  1K57 A;  1KDW A;  1NZO A;  4O7D A;  1IYP A;  5CHJ A;  3SH9 A;  4U3T A;  1W7F A;  2ZC4 B;  3HLW A;  1QME A;  4GD8 A;  4LV1 A;  1BLH A;  2XD1 A;  4C3Q A;  1LLB A;  4QU3 A;  5FQM A;  3Q81 A;  3ZCZ A;  5J8X A;  3EQV A;  2QMI A;  4S2N C;  3HLD A;  5FQ9 A;  3M2K A;  3BEB A;  2J7V A;  1ONG A;  3SH8 A;  4K0W A;  3GTC A;  1FQG A;  3BLM A;  4OOM A;  5EUA A;  3ITA A;  4GZB A;  1DY6 A;  5M18 A;  3O86 A;  2XK1 A;  1YT4 A;  5F82 A;  1Y54 A;  2QPN A;  2ZC7 A;  4B4Z A;  1YLY A;  5CGX A;  2VGJ A;  5EVI D;  1FCM A;  2WUQ A;  3OPR A;  4OOY A;  1QMF A;  5EVI C;  1ONH A;  5GLA A;  1FR6 A;  4DF6 A;  3UE3 A;  1E25 A;  2J9O A;  3ZNY A;  5FQJ A;  4S2O A;  4OQ0 A;  3OPP A;  5CGS A;  1YLW A;  3VSK A;  4E3J A;  1L0F A;  4KG2 A;  1PWD A;  3IWO A;  1XX2 A;  2HDR A;  4MEZ A;  3PBQ A;  5G18 A;  3VP4 A;  3TOI A;  1PIO A;  4JXW A;  2DNS A;  2XLN A;  1KGE A;  2JE5 A;  1WYC A;  5FQK A;  4XUX A;  3DTM A;  2IWC A;  2Y2O A;  4GD6 A;  4IBR A;  4C6Y A;  4ZDX A;  3BFG A;  4X56 A;  3HBR A;  2BLS A;  4Y0O A;  1NZU A;  1CEF A;  4DE3 A;  2Y2G A;  3BYD A;  1EWZ A;  5FAP A;  3BEC A;  4BJP A;  3ZVW A;  4N92 A;  3SH7 A;  3CJM A;  3VFF A;  1XXM A;  1SKF A;  1MXO A;  4L0L A;  5GLB A;  4EWF A;  5DTK A;  4NET A;  1E3U A;  5TFQ A;  3GSG A;  3UN7 A;  3V3R A;  1BUE A;  3NDG A;  1IYO A;  2H0Y A;  5DF9 A;  1PWG A;  3UPO A;  1L0E A;  3UDI A;  4DRT A;  5FA7 A;  4X53 A;  3N8R A;  5F1G A;  4ZJ1 A;  4OQG A;  1TDG A;  2H5S A;  3ZDJ A;  3MZD A;  3BLS A;  3WS5 A;  5CRF A;  3P09 A;  3PAE A;  5GHZ A;  5TGF A;  1JWV A;  2ZQ8 A;  4ZJ2 A;  4KZ9 A;  2J9P A;  3SS3 A;  4EV4 A;  4DE2 A;  2E8I A;  4E3O A;  4HEF A;  3UY6 A;  2H0T A;  4KG5 A;  4KQR A;  2ZJ9 A;  4IVK A;  5CXW A;  1SDE A;  5EOO A;  1Z6F A;  2ZQ7 A;  3NI9 A;  2ZC6 B;  1IEL A;  5DVA A;  4OP5 A;  2J8Y A;  5A93 A;  1BSG A;  2XR0 A;  1H5X A;  1OME A;  3MXS A;  4EQI A;  1AXB A;  3FWL A;  5E43 A;  2HDU A;  2ZLY A;  3G31 A;  3IWI A;  4JPM A;  4EBL A;  1YLJ A;  2XFT A;  3OPH A;  4LCM A;  4ZJ3 A;  3WRT A;  1HTZ A;  5FI7 A;  1M6K A;  1K6S A;  3LEZ A;  1ERO A;  2CC1 A;  1FOF A;  3GMW A;  2V20 A;  1BZA A;  3M6H A;  1ERM A;  1EI5 A;  1TEM A;  2WYX A;  4N1H A;  3NDE A;  2ZM0 A;  4PM8 A;  1YMS A;  4R4R A;  5HAP A;  2ZC5 B;  3C7V A;  4RX3 A;  4DE1 A;  4UA6 A;  1CI8 A;  1KDS A;  3HL9 A;  1PW8 A;  1MWT A;  1XGI A;  1C3B A;  4KZ5 A;  4WEL A;  2EFX A;  4P0M A;  4KZ4 A;  3Q82 A;  3HUM A;  1FSY A;  3VOY A;  4KZA A;  1K54 C;  4DDY A;  2XF3 A;  3NBL A;  2WGW A;  2OV5 A;  2P9V A;  5F1F A;  3IXH A;  1ZG4 A;  4RX2 A;  2HDS A;  2A3U A;  5FAT A;  1XKZ A;  5FI6 A;  2Q9N A;  4HES A;  3LO7 A;  4MBH A;  5TR7 A;  4K91 A;  2Y55 A;  5DTT A;  5JYO A;  4KQQ A;  4X68 A;  3M6B A;  1I2W A;  4R3B A;  4LEN A;  3FV7 A;  1YQS A;  3MKF A;  3VP0 A;  1SHV A;  2R9X A;  3Q7V A;  3QHY A;  1LHY A;  3IQA A;  3HLC A;  3FYZ A;  5CTN A;  3PBT A;  4WMC A;  3TG9 A;  4QJG A;  4R4S A;  1KE0 A;  1MWR A;  4S2N A;  1GHM A;  4QY5 A;  1O07 A;  1KVM A;  2Y2K A;  5EOE A;  4IBX A;  1K4F A;  1TVF A;  1M40 A;  4RYE A;  4WZ5 A;  4A5R A;  4WMC D;  3A3J A;  1L2S A;  3UDX A;  5FAS A;  4CPK A;  1MBL A;  5FSR A;  3N8S A;  4QY6 A;  1KGF A;  4B88 A;  3PTE A;  5E2H A;  1FSW A;  4PMA A;  1G6A A;  2FFF B;  3MFD A;  4OPY A;  3UO9 A;  2ZQD A;  4N9K A;  3PBS A;  5GHY A;  3ZVT A;  4EUZ A;  2Z2L B;  3A3D A;  3GQZ A;  4PM5 A;  3C5A A;  4FCF A;  1RCJ A;  4M3K A;  4PM7 A;  3WS2 A;  4XXR A;  2P74 A;  3ZG9 B;  3IH9 A;  1O7E A;  4GB7 A;  1BLS A;  3W4Q A;  4FH4 A;  5F83 A;  3AGF A;  2A49 A;  5HAQ A;  3WS1 A;  2EX6 A;  1XPB A;  3G2Y A; 
#chains in the Genus database with same CATH topology
 1WA9 A;  4HP4 A;  4X69 A;  3VP1 A;  1ESI A;  3E4P A;  3HUO A;  2PR6 A;  3HVF A;  3UB7 A;  5C5K A;  3PAG A;  5KIZ A;  4XT2 B;  4DXC A;  2VGL M;  2Z6D A;  2VV8 A;  3GVB A;  1NRF A;  3Q07 A;  3CG5 A;  1W5D A;  3UB6 A;  2MJ6 A;  4CJN A;  3BQ8 A;  3Q7V B;  2JKT M;  2PYP A;  4S2M A;  1VEU A;  3ULF A;  1PZP A;  1DJB A;  3G34 A;  4BD1 A;  3LY3 A;  4IVI A;  2C5W B;  2XEP A;  4UA9 A;  4JXS A;  5HPF A;  3RXW A;  3LYX A;  1J9M A;  4GCZ A;  1K55 C;  3IBR A;  4DKI A;  2ZQ9 A;  3FC7 A;  2JN7 A;  1V9Z A;  2VZW A;  2B5R A;  4OKP A;  3L7H A;  2XRN A;  4OQH A;  3UB9 A;  4QPR A;  2V0U A;  2ZBB A;  5CHU A;  1BLP A;  1Q2Q A;  1HD8 A;  1ZKJ A;  5DF7 A;  2JKF A;  5CER A;  3UB8 A;  3A3E A;  3RXX A;  5HL1 A;  1F5M A;  4NK3 A;  1NJ4 A;  1ZG6 A;  2ZQC A;  2IWB A;  3UPN A;  4OPR A;  4JKT A;  1YLP A;  5E2G A;  4PM9 A;  4EW7 A;  3DWZ A;  1MC0 A;  2RL3 A;  1L0D A;  2WGI A;  2ZD8 A;  4G3V A;  4KZ7 A;  3TW8 A;  5EPH A;  2VGL S;  2A24 B;  2WK0 A;  1TDL A;  2QKP A;  1TS7 A;  4WZ5 C;  4HBU A;  5EVI A;  4P85 A;  2Y4A A;  2HZ5 A;  2WZX A;  2XD5 A;  5FDS A;  3KSI A;  2DRW A;  4JLF A;  2VK3 A;  4GDB A;  1NYM A;  1KE3 A;  1YKD A;  2Y2M A;  4RA7 A;  2PBY A;  1G28 A;  5HW3 A;  4FSF A;  3B42 A;  3H7W A;  2QJ7 A;  3UPP A;  3OC2 A;  2JC7 A;  4I3A A;  3E2K A;  2EXB A;  4FUW A;  3LEQ A;  1GHP A;  3V67 A;  1DJA A;  1F2K A;  3GEC A;  3NY4 A;  1ES2 A;  3MXQ A;  3MZF A;  3S7O A;  5EEC A;  1OT6 A;  5GL9 A;  3UDF A;  2J3T D;  5CGW A;  2OLV A;  1P0Z A;  1TS0 A;  1YMX A;  4DDS A;  1ALQ A;  5GHX A;  2O9A A;  3C7U A;  4Z9Q A;  3IT9 A;  3CPT A;  2PU2 A;  1N9B A;  1SDN A;  4MN6 A;  3HLG A;  5J4E A;  4KG6 A;  4FTX A;  3G32 A;  3EQU A;  3WS0 A;  2ZMV A;  5GLD A;  4YIN A;  1K55 A;  4GHI B;  4HJ3 A;  1YPR A;  1DP9 A;  2XGN A;  2W3D A;  5AVE A;  4JXV A;  3C30 A;  4DN0 A;  5CHM A;  3W4O A;  1K25 A;  1L3L A;  5G4Y A;  2W3E A;  4X55 A;  4Q0H A;  2VV6 A;  1ODV A;  3A3I A;  3O87 A;  1JTG A;  3PBN A;  1GSW A;  5DFX A;  2GDN A;  2WGW B;  3BM6 A;  4HJ4 A;  4N9L A;  4LV0 A;  4BL3 A;  1JWP A;  2Q9M A;  3T1Q B;  2OAQ 1;  4ARZ B;  2HP9 A;  1XA1 A;  1RGZ A;  5EM1 A;  1TD5 A;  1GA0 A;  2PRF A;  4NG2 A;  1G68 A;  1K57 A;  5CHJ A;  1CQA A;  4F3L A;  2WKR A;  2XD1 A;  5J8X A;  3E4Q A;  3GTC A;  4GZB A;  1DY6 A;  3O86 A;  5F68 A;  2LB5 A;  5EVI D;  1FCM A;  4LRX C;  5EVI C;  4M4X A;  1VET B;  4DF6 A;  5FQJ A;  3EEH A;  3H9W A;  1YLW A;  4MN7 A;  5EFW A;  2HDR A;  4MEZ A;  3E0Y A;  4HIA A;  5FQK A;  4XUX A;  2LB9 A;  2A2L A;  3K3D A;  4GD6 A;  3BFG A;  2BTF P;  1EWZ A;  4R70 A;  5FAP A;  3BEC A;  3CJM A;  5LBR A;  2XSS A;  4YOF A;  4L0L A;  4Y3I A;  3T50 A;  5DTK A;  4NET A;  5TFQ A;  4CLC A;  1IYO A;  3SW1 A;  1L0E A;  3EGX C;  4NXB A;  4ZJ1 A;  1LSX A;  1TDG A;  1W63 Q;  4IJG A;  5CRF A;  3PAE A;  2W3F A;  2ZQ8 A;  4ZJ2 A;  2CMN A;  3SS3 A;  4EV4 A;  4DE2 A;  4E3O A;  4LRZ E;  5EOO A;  1SDE A;  5L07 A;  3NI9 A;  2ZC6 B;  5DVA A;  1XJ6 A;  2XR0 A;  1S1Z A;  3MXS A;  4ESP A;  2ZLY A;  4LCM A;  1K6S A;  5HPI A;  2CC1 A;  1FOF A;  3F1O A;  5HD3 A;  4NXE A;  3M6H A;  1ERM A;  5L8M A;  1EI5 A;  4N1H A;  3NUL A;  2E8J A;  1YMS A;  4RQ9 A;  4RX3 A;  4UA6 A;  1CI8 A;  1KDS A;  1P97 A;  3QP5 A;  4II7 A;  4GW9 A;  4P0M A;  1FSY A;  3VOY A;  3KYZ A;  5IT5 A;  2P9V A;  4GS9 B;  2HDS A;  3BY8 A;  5FI6 A;  4HES A;  5TR7 A;  5JYO A;  4KQQ A;  2B18 A;  3PYP A;  4HH3 A;  4DMZ A;  3QHY A;  1LHY A;  3IQA A;  3HLC A;  5CTN A;  4QJG A;  4R4S A;  1KE0 A;  1GHM A;  1O07 A;  2Y2K A;  4XT2 A;  4WZ5 A;  4WMC D;  3A3J A;  4CPK A;  5FSR A;  1G6A A;  3T4K A;  4LLO B;  5HDS A;  4N9K A;  4HNB A;  4FCF A;  4M3K A;  3WS2 A;  1OTI A;  2VV7 A;  3IH9 A;  1O7E A;  1UWP X;  5F83 A;  4EXO A;  2YKH A;  3G2Y A;  1NLZ A;  3S1Y A;  1XJ4 A;  2Y2J A;  2WKI A;  2H10 A;  3ZG5 A;  1KGG A;  5HD5 A;  2QZ6 A;  2R9W A;  2P7J A;  1PNE A;  2L1M A;  5FAO A;  5HWW A;  1FCO A;  4Y7P A;  2M7V A;  3S7Q A;  5E2E A;  4L9E A;  1K6R A;  3BY9 A;  2JKT I;  2Y2Q A;  3CPT B;  4K0X A;  2V1Z A;  4RVA A;  1P9W A;  1IKG A;  3G2Z A;  4MLL A;  4JGQ A;  3IXG A;  3KO6 A;  2V9A A;  4G3K A;  4AFI A;  4YFM A;  1RP5 A;  5A8B A;  5HAR A;  3T1S A;  3W4P A;  4OON A;  5AQ7 A;  4GNU A;  3LIE A;  3NCK A;  4JF4 A;  3LGO A;  4E3I A;  4R1G A;  4F94 A;  4LRY C;  3WWX A;  5BOH A;  1H8M A;  1NLY A;  3DTK A;  3JYI A;  3LY4 A;  5J7E A;  3IWQ A;  5HFO A;  4I3J A;  4R3J A;  2W1T A;  3HJI A;  1L0G A;  1S4S A;  2ZOI A;  1BLC A;  4E3M A;  4DJ2 A;  2FH5 A;  4WF0 A;  1HVB A;  1S66 L;  1S6R A;  4KZ8 A;  3CIT A;  3IHB A;  1XFQ A;  2M7U A;  2HJ9 C;  4BD0 A;  3MJQ A;  1WE4 A;  4IUH A;  4XUZ A;  3UE0 A;  5F6A A;  4CQH A;  4F3L B;  2EFU A;  4S2P A;  2Y79 A;  1G5U A;  4LV3 A;  4IED A;  2JCH A;  2Y59 A;  3QP4 A;  2EX9 A;  4H6J A;  3DW0 A;  1PZO A;  3C4P A;  3JVV A;  2EWV A;  5EV0 A;  2ZL1 A;  4ZBE A;  2XFS A;  5AJG A;  3IF6 B;  4KUO A;  3ZNT A;  3DWK A;  4S2J A;  3F1P B;  4C75 A;  3IBJ A;  3FKV A;  3W8K A;  2XH9 A;  2QJ5 A;  2GJ3 A;  2L0W A;  3CWF A;  4D2O A;  2V2F F;  5M19 A;  4E3N A;  1W63 M;  2WZZ A;  1ESU A;  3IF5 A;  2WAE A;  4PAU A;  4P6Z S;  3MSH A;  2OWJ A;  3ZG8 B;  5FQQ A;  5CED A;  3CZD A;  1HLU P;  4CLC B;  3UMD A;  5JYP A;  4ZRR A;  5M1A A;  4OP8 A;  1PI5 A;  5E2F A;  5KZH A;  3PBO A;  1GSX A;  3QP2 A;  1MWU A;  2DCF A;  2XA7 S;  2ZM2 A;  3LID A;  4ZTK A;  3JVU A;  2EA9 A;  3V5M A;  2X02 A;  3C8C A;  4UAA A;  2HJE A;  2J80 A;  2IWD A;  3BFD A;  4QB8 A;  4LCL A;  2HF6 A;  1LL5 A;  4UA7 A;  1PI4 A;  3OLO A;  1T1A A;  1MKI A;  2IA2 A;  3FPW A;  1OPX A;  1H8Y A;  1VQQ A;  1H8Z A;  2PDR A;  1XGJ A;  4L9F A;  3I7J A;  1GSV A;  3GV9 A;  4ID4 A;  1H3Q A;  3HRE A;  1W8Q A;  5DKK A;  4MBK A;  4WBG A;  4K08 A;  5GLC A;  2QHK A;  3GR2 A;  3UME A;  1TF1 A;  1JNU A;  3E98 A;  3KSG A;  5IS1 A;  4EES A;  4N1X A;  1H0M A;  3V50 A;  3R7W A;  1N9N A;  1VM1 A;  2VJW A;  1K56 D;  3UB5 P;  3NIA A;  2W1R A;  2QYB A;  2PU4 A;  4MCW A;  4BBU A;  4EBN A;  5L2F A;  3G30 A;  4MBF A;  3ZG0 A;  4PPR A;  1WYB A;  5L10 A;  3A0R A;  4YWZ A;  1NZO A;  4O7D A;  1IYP A;  3SH9 A;  3T1R A;  3CAX A;  4LV1 A;  1LLB A;  4QU3 A;  3Q81 A;  3ZCZ A;  3A0S A;  3C38 A;  5K5B A;  5FQ9 A;  3UE6 A;  1LSW A;  2J7V A;  3BEB A;  4MN5 A;  1ONG A;  2KDK A;  1FQG A;  3F1N B;  4CLC C;  4EER A;  5F82 A;  1D06 A;  5TBM A;  1Y54 A;  2QPN A;  2ZC7 A;  2EWW A;  1YLY A;  2VGJ A;  3OPR A;  1FR6 A;  1E25 A;  3OPP A;  4ARZ A;  4E3J A;  1L0F A;  1XX2 A;  3PBQ A;  3VP4 A;  1PIO A;  4JXW A;  4HI4 A;  4NXF A;  1KGE A;  2JE5 A;  3NOT C;  4IBR A;  4ZDX A;  2BAS A;  1XXM A;  1SKF A;  3D3O A;  1E3U A;  3GSG A;  3V3R A;  3UDI A;  4DRT A;  4X53 A;  3ZDJ A;  3MZD A;  2ACG A;  4PKY A;  2PHY A;  1CJF A;  5TGF A;  1S67 L;  4HEF A;  4BBT A;  4HHD A;  4EQ1 A;  2ZJ9 A;  2XRO A;  1Z6F A;  3OBF A;  1YSQ A;  4EQI A;  2DMW A;  4JPM A;  2XFT A;  1M6K A;  3GMW A;  1BZA A;  3CUE A;  1TEM A;  3HJK A;  4MDZ A;  5I5L A;  4NEE D;  2ZC5 B;  4DE1 A;  3KSH A;  3HL9 A;  1PW8 A;  1MWT A;  1XGI A;  1LT0 A;  4H6J B;  2EFX A;  3P7N A;  3MQO A;  4KZA A;  2XF3 A;  3NBL A;  2V8F A;  1DP6 A;  2WKP A;  5F1F A;  4RX2 A;  2GNX A;  2W3G A;  3LO7 A;  4K91 A;  2Y55 A;  1I2W A;  4Y2F A;  3ZYT A;  3MR0 A;  3VP0 A;  2R9X A;  3LR4 A;  3TG9 A;  1VEU B;  4QY5 A;  4B93 A;  2FZ0 A;  1KVM A;  5EOE A;  5FAS A;  3N8S A;  4QY6 A;  1KGF A;  4B88 A;  5E2H A;  2FFF B;  3UO9 A;  1UWN X;  5GHY A;  4DJ3 A;  3A3D A;  4EUZ A;  4PM5 A;  1RCJ A;  3CHW P;  4XXR A;  2P74 A;  5DKL A;  1SKO A;  4ME4 A;  4O01 A;  2A49 A;  5G4Z A;  1G6O A;  5HWV A;  3O3V A;  2JKR I;  2D01 A;  4Y5F A;  4GN2 A;  3PHY A;  4X6T A;  4E3K A;  1T1B A;  3V39 A;  1JTD A;  5HAI A;  2BG1 A;  5I94 A;  1JWZ A;  4QWO A;  3MQ0 A;  1YM1 A;  4GLQ A;  3WRZ A;  1T19 A;  1GA9 A;  2HPB A;  5F5Y A;  3FPV A;  5DF8 A;  3NC8 A;  1AWI A;  2XQZ A;  2ZQA A;  3ISG A;  2V1A A;  4EBP A;  1K38 A;  2G7U A;  4R0Q A;  1YSP A;  3SZT A;  1F9I A;  3LFV A;  3SS5 A;  2O99 A;  1FR1 A;  2EX8 A;  2PD8 A;  3R7W B;  3H82 A;  4WEJ A;  2XDM A;  3MZE A;  3BW6 A;  4KZ3 A;  3K2N A;  2C6W B;  2GX5 A;  1SKO B;  1UGU A;  3FKW A;  2G2W A;  3TSG A;  4MMN A;  2RCX A;  4YNR A;  2Q0O A;  3E2L A;  2O0Y A;  5CTM A;  4QHC A;  1GCE A;  3CMZ A;  3M2J A;  3VP3 A;  2HDQ A;  4KQD A;  4GOG A;  3IS2 A;  2WAF A;  1BT5 A;  4R38 A;  4LV2 A;  4KEN B;  3UNW A;  2PAV P;  3T12 B;  4OPZ A;  3F1N A;  1K54 A;  1SCW A;  3OCN A;  2ZOH A;  4BL2 A;  2WKE A;  4X25 A;  4KZB A;  1A0K A;  1K56 A;  4X1M A;  4ZAM A;  5EVL A;  5A91 A;  4S2K A;  1F98 A;  4JGO A;  5AQA A;  4BQM A;  3QP8 A;  4UQI S;  4FOF A;  2V0W A;  4I39 A;  1Y28 A;  1ZC2 A;  3HUN A;  3SS4 A;  3NHQ A;  2Y2H A;  4E6W A;  4OVD A;  4GDN A;  1PYY A;  4WYY A;  4EEU A;  2OAP 1;  5FI2 A;  1HZO A;  3P98 A;  2ZMA A;  1Z09 A;  5U47 A;  3ZG7 B;  3RJU A;  2V1B A;  1I5Q A;  3OCL A;  3KX0 X;  4U0X A;  3VOZ A;  4Q8I A;  3U2A A;  4BWI A;  3S4X A;  3B33 A;  3EWK A;  3MBZ A;  3T1X A;  4PM6 A;  3GDI A;  1D7E A;  1K4E A;  2Y2I A;  1NY0 A;  4NXG A;  1NYY A;  3BFC A;  2J3W A;  1ERQ A;  2JBF A;  4U0T A;  3VMA A;  3SOI A;  1JVJ A;  2EXA A;  2OOL A;  2HP6 A;  3ITB A;  2V8C A;  1FCN A;  5DFY A;  5AVF A;  2P04 A;  3IF6 A;  4KQO A;  1TS6 A;  1IKI A;  2K31 A;  2QWS A;  2M1C A;  4Y0T A;  3N6I A;  2W0N A;  3T4T A;  4R23 A;  3GRJ A;  5EM0 A;  5KSH A;  1XJ3 A;  1IOU A;  1E3U D;  4E3L A;  1OJ5 A;  3E4O A;  4ETZ A;  4R3A A;  4UHU A;  1KE4 A;  1DJC A;  2EX2 A;  3NJA A;  3S7P A;  1K57 C;  3C2W A;  3G6O A;  1BUL A;  3MKE A;  4I5S A;  4LPZ A;  3EEA A;  2Y8H A;  4QD4 A;  3BFE A;  1MPL A;  3MFX A;  4S2I A;  3CUE C;  3BJN A;  1VET A;  4DXB A;  1GHI A;  2O9B A;  5DJU A;  3BRM A;  2VX8 A;  3LCE A;  1K0K A;  3ZFZ A;  1S0W A;  1MZU A;  5DTS A;  4OOL A;  1MWS A;  2PBD P;  3P01 A;  1E4D A;  2G2U A;  2KLI A;  2FFY A;  4MNR A;  2B02 A;  3C4O A;  2WKQ A;  4P6B A;  1KDW A;  1W7F A;  3HLW A;  4GD8 A;  1STZ A;  4C3Q A;  3CLO A;  3EQV A;  1EW0 A;  1V9Y A;  2QMI A;  4S2N C;  3M2K A;  2KOI A;  4EU0 A;  4K0W A;  3BLM A;  3A0V A;  3MS6 A;  4GHI A;  2W27 A;  3T4L A;  1YT4 A;  2ZL1 B;  4B4Z A;  3VE4 A;  4JGP A;  2J9O A;  3LR0 A;  3OOV A;  4CLC D;  1PWD A;  1OTA A;  3TOI A;  2DNS A;  3QP6 A;  2XLN A;  4Y13 A;  2K7S A;  3DTM A;  2Y2O A;  4C6Y A;  5L09 A;  3HBR A;  1NZU A;  1P9R A;  4DE3 A;  1DP8 A;  3BYD A;  4O0P A;  4BJP A;  4N92 A;  2JKG A;  3SH7 A;  3VFF A;  2J3T C;  3IX8 A;  1MXO A;  3UN7 A;  2KX6 A;  5HZH A;  3NDG A;  2H0Y A;  5DF9 A;  3FG8 A;  5F1G A;  3BLS A;  3WS5 A;  3P09 A;  5GHZ A;  1JWV A;  3PR6 A;  4KZ9 A;  2J9P A;  2E8I A;  3S7N A;  4EUV A;  2H0T A;  4GJ4 A;  4KG5 A;  4IVK A;  3DAV A;  2J8Y A;  5A93 A;  3TJZ C;  4HOI A;  1H5X A;  1OME A;  4UQI M;  5E43 A;  3FWL A;  2O9C A;  3ICY A;  4PKY G;  4EBL A;  3OPH A;  4ZJ3 A;  3WRT A;  1IFQ A;  1N9L A;  2V20 A;  3KSF A;  2H28 A;  2L4R A;  4B9O A;  3NDE A;  2ZM0 A;  4PM8 A;  2PT7 A;  4R4R A;  5HAP A;  3D72 A;  3LUQ A;  4KZ5 A;  3D9Y A;  4KZ4 A;  3Q82 A;  3HUM A;  1K54 C;  4DDY A;  1YAX A;  5HSQ A;  2OV5 A;  1S1Y A;  1ZG4 A;  3LR3 A;  5FAT A;  4MBH A;  1T1C A;  3L9K A;  4E04 A;  4Z1W A;  3LIC A;  4R3B A;  1YQS A;  2HGV A;  3FYZ A;  4WMC A;  4S2N A;  3NOP C;  1K4F A;  1TVF A;  1L2S A;  3UDX A;  1MBL A;  1FSW A;  3MFD A;  1XFN A;  4OPY A;  5HDC A;  3PBS A;  3ZVT A;  2ZMF A;  2VA0 A;  1BLS A;  2JHE A;  1XPB A;  1TS8 A;  2ZM8 A;  3PBR A;  1XA7 A;  1MKM A;  3H82 B;  1CF0 A;  4JGR A;  1XP4 A;  1ES3 A;  1LL9 A;  3W2Z A;  1RGY A;  1ZTU A;  3ZGA B;  5A92 A;  3HLB A;  1OT9 A;  3OZH A;  4L9G A;  1VHM A;  1VB6 A;  4Q0J A;  5D3O A;  4H8R A;  5AQB A;  2WAD A;  3IX4 A;  3AGE A;  1I2S A;  3IS2 B;  4JBF A;  4WL9 A;  3NEC A;  4P87 A;  4E6X A;  2D02 A;  5CEB A;  3EOI A;  4R6L A;  3T4O A;  1S4R A;  4G3W A;  1KOU A;  3S22 A;  1SZV A;  4BEN A;  3PXP A;  2X01 A;  1BTL A;  5IHV A;  2NUT C;  3VFH A;  5F69 A;  3IXB A;  1CK3 A;  4LGW A;  2Y2N A;  1FIL A;  1KVL A;  3IH8 A;  1IEM A;  2ZC3 B;  4HBT A;  2VEA A;  3IXD A;  3KYE A;  3RFB A;  5KSC A;  2OSU A;  3HCY A;  3MF0 A;  2NUP C;  5EE8 A;  4NKP A;  3B3X A;  2R78 A;  4DE0 A;  2VLG A;  2Z2M B;  1PW1 A;  5CEC A;  3DTI A;  1U60 A;  1W8Y A;  1W79 A;  4X1L A;  3LI9 A;  1YLT A;  3MXR A;  4BLM A;  2PD7 A;  2INW A;  1OTD A;  1ES4 A;  3VV4 A;  2I72 A;  4JXG A;  2AVX A;  3N8L A;  2K2N A;  3BFF A;  3G4P A;  5FQI A;  2XA7 M;  1PRQ A;  4JF6 A;  3IF6 C;  2OLU A;  4S2L A;  3O5Y A;  2Y2L A;  4FD8 A;  4EEP A;  1LSV A;  5MC7 A;  4UEY A;  1YLZ A;  1OJG A;  3RTY A;  2Y91 A;  3AGD A;  2WGV A;  4KZ6 A;  4WZ4 A;  3V3S A;  4OLD A;  3G35 A;  5FDH A;  3KYQ A;  1PWC A;  4Y15 A;  1ZHH B;  2PR5 A;  1ES5 A;  3WS4 A;  4D60 A;  3Q1F A;  3IX3 A;  5AQ9 A;  2B95 A;  4WEK A;  3HLF A;  1CEG A;  1PFL A;  3T4Q A;  1Q2P A;  3UE1 A;  1FIK A;  3OPL A;  1LI9 A;  1OTE A;  1LI0 A;  2VGK A;  3ZHH A;  5FAQ A;  3QNB A;  2UWX A;  5A90 A;  4BMW A;  2HP5 A;  3O88 A;  1XJ2 A;  3A3F A;  5FL3 A;  5EVI B;  4IHQ A;  4OPQ A;  4WUJ A;  4PHT A;  4B4X A;  3EGD C;  4HQA A;  3NOU C;  3TRC A;  3DTE A;  3H7W B;  1T18 A;  3BWL A;  2Z6C A;  3FZC A;  1N4O A;  4WM9 A;  3QNC A;  3F1O B;  3N7W A;  4OH0 A;  3IHA A;  3HLE A;  3VSL A;  2PYR A;  3K3C A;  2JKR M;  2P9V B;  4GS9 A;  4OQI A;  3TE8 A;  3VP2 A;  3B47 A;  3Q7Z A;  4HH2 A;  4OLG A;  3JPU A;  5KMW A;  2WKH A;  5HX9 A;  4KUK A;  3U4L P;  4JF5 A;  3VE3 A;  4GKU A;  1J3W A;  1IYQ A;  5DJT A;  1IYS A;  2Y2P A;  3D4F A;  4FH2 A;  5IU1 A;  2X71 A;  3RH8 B;  3N4I A;  4Y0U A;  1D1J A;  1MY8 A;  2P08 A;  1CI9 A;  1NXY A;  2HV1 A;  4U3T A;  2ZC4 B;  3LR5 A;  1QME A;  1BLH A;  1DRM A;  5FQM A;  3LI8 A;  3HLD A;  3SH8 A;  2VKS A;  4OOM A;  5EUA A;  3BQA A;  5FEG A;  3ITA A;  2XK1 A;  3LIB A;  4EET B;  1X0O A;  3DBA A;  5CGX A;  5HWT A;  2A24 A;  3MMH A;  2WUQ A;  5FEF A;  4OOY A;  1QMF A;  5GLA A;  1ONH A;  4WLA A;  1LL8 A;  3UE3 A;  3ZNY A;  4S2O A;  4OQ0 A;  3CI6 A;  5CGS A;  3VSK A;  4I3I A;  4KG2 A;  3IWO A;  5G18 A;  5CX7 A;  4WN5 A;  2W3H A;  1WYC A;  2IWC A;  4HJ6 A;  4X56 A;  4Y0O A;  2BLS A;  1CEF A;  4CLC E;  2Y2G A;  1ACF A;  3ZVW A;  2OWH A;  5GLB A;  3T4S A;  4EWF A;  5HDD A;  1OTB A;  1BUE A;  4IUK A;  1N9O A;  1Y4O A;  1PWG A;  3UPO A;  5FA7 A;  3N8R A;  4OQG A;  2H5S A;  5TBM B;  1BYW A;  4HY8 A;  3UY6 A;  4KQR A;  5CXW A;  2ZQ7 A;  1IEL A;  4OP5 A;  1BSG A;  3LIA A;  1AXB A;  2HDU A;  3G31 A;  4LFU A;  3IWI A;  5M18 A;  1YLJ A;  1HTZ A;  5FI7 A;  3LEZ A;  1ERO A;  4Y17 A;  2W1T B;  2WYX A;  3ZQ5 A;  3MQQ A;  3R4K A;  3C7V A;  4O8G A;  1C3B A;  4WEL A;  3WS1 A;  2WGW A;  3IXH A;  3VOL A;  2A3U A;  1XKZ A;  2Q9N A;  5DTT A;  3F1P A;  3T4J A;  4X68 A;  3M6B A;  2UV0 E;  5HL6 A;  3QP1 A;  4LEN A;  3FV7 A;  5EVE A;  2GZA A;  3MKF A;  1SHV A;  3Q7V A;  3PBT A;  5J3W A;  1MWR A;  4HP9 A;  1NRJ A;  4IBX A;  4ETX A;  4Q0I A;  1M40 A;  4RYE A;  4A5R A;  4I38 A;  5TJJ A;  3PTE A;  3LIF A;  4PMA A;  4P6Z M;  2ZQD A;  2YKF A;  2Z2L B;  3GQZ A;  3C5A A;  1NWZ A;  4PM7 A;  4BBV A;  3ZG9 B;  4GB7 A;  3W4Q A;  4FH4 A;  3AGF A;  5HAQ A;  2I9V A;  2EX6 A; 
#chains in the Genus database with same CATH homology
 2ZM8 A;  3PBR A;  1XA7 A;  3S1Y A;  4X69 A;  2Y2J A;  2WKI A;  3O3V A;  3VP1 A;  1ESI A;  4GN2 A;  2H10 A;  1XP4 A;  3HUO A;  4X6T A;  3ZG5 A;  1KGG A;  4E3K A;  3HVF A;  1ES3 A;  1LL9 A;  3V39 A;  1JTD A;  5HAI A;  1RGY A;  2BG1 A;  2QZ6 A;  3ZGA B;  2R9W A;  3PAG A;  5A92 A;  5I94 A;  3HLB A;  3OZH A;  4DXC A;  1JWZ A;  5FAO A;  1FCO A;  3GVB A;  1NRF A;  3Q07 A;  1YM1 A;  4Y7P A;  3WRZ A;  3CG5 A;  1W5D A;  4CJN A;  3Q7V B;  5D3O A;  5E2E A;  1GA9 A;  2HPB A;  4H8R A;  2WAD A;  1K6R A;  5DF8 A;  5AQB A;  3NC8 A;  2Y2Q A;  4S2M A;  3AGE A;  1I2S A;  4K0X A;  2XQZ A;  4JBF A;  2V1Z A;  4RVA A;  3G2Z A;  1IKG A;  1PZP A;  1DJB A;  4MLL A;  2ZQA A;  3G34 A;  4BD1 A;  3LY3 A;  3ISG A;  3IXG A;  4P87 A;  4IVI A;  4E6X A;  5CEB A;  2C5W B;  2XEP A;  4UA9 A;  4EBP A;  1K38 A;  4YFM A;  4R0Q A;  1RP5 A;  3SS5 A;  4JXS A;  3RXW A;  5HAR A;  3S22 A;  1J9M A;  1FR1 A;  4BEN A;  2EX8 A;  3W4P A;  4OON A;  5AQ7 A;  4GNU A;  1K55 C;  4DKI A;  4WEJ A;  2XDM A;  3MZE A;  3NCK A;  2ZQ9 A;  2X01 A;  4KZ3 A;  1BTL A;  5IHV A;  2B5R A;  2C6W B;  4JF4 A;  4OKP A;  4E3I A;  3VFH A;  3FKW A;  2G2W A;  3IXB A;  3TSG A;  4R1G A;  1CK3 A;  2RCX A;  4OQH A;  4F94 A;  3E2L A;  3WWX A;  5CTM A;  2Y2N A;  5BOH A;  4QHC A;  1KVL A;  3JYI A;  3IH8 A;  1IEM A;  2ZC3 B;  3LY4 A;  1GCE A;  3CMZ A;  3M2J A;  4HBT A;  3IWQ A;  3VP3 A;  2HDQ A;  5HFO A;  3IXD A;  5KSC A;  2OSU A;  5CHU A;  1BLP A;  4R3J A;  4GOG A;  1Q2Q A;  5EE8 A;  1L0G A;  1HD8 A;  2WAF A;  1ZKJ A;  1BT5 A;  1BLC A;  5DF7 A;  3B3X A;  4DE0 A;  4E3M A;  2Z2M B;  4LV2 A;  5CER A;  1HVB A;  4KEN B;  3UNW A;  1PW1 A;  1S6R A;  4KZ8 A;  5CEC A;  1U60 A;  1W8Y A;  3IHB A;  4OPZ A;  1W79 A;  1K54 A;  1SCW A;  3A3E A;  3OCN A;  3RXX A;  4BD0 A;  4BL2 A;  5HL1 A;  1WE4 A;  2WKE A;  4NK3 A;  4XUZ A;  3UE0 A;  1NJ4 A;  1ZG6 A;  4KZB A;  1YLT A;  2ZQC A;  2IWB A;  2EFU A;  3MXR A;  3UPN A;  4BLM A;  4ZAM A;  1K56 A;  1ES4 A;  5EVL A;  4S2P A;  2I72 A;  5A91 A;  4S2K A;  4OPR A;  5AQA A;  4BQM A;  4LV3 A;  4IED A;  4JKT A;  1YLP A;  1ZC2 A;  5E2G A;  2JCH A;  3HUN A;  3SS4 A;  4JXG A;  4PM9 A;  2Y2H A;  3N8L A;  2Y59 A;  4E6W A;  4OVD A;  3DWZ A;  4GDN A;  1PYY A;  4WYY A;  3BFF A;  2EX9 A;  3G4P A;  3DW0 A;  2RL3 A;  1PZO A;  1L0D A;  3C4P A;  5FI2 A;  5FQI A;  2WGI A;  2ZD8 A;  1HZO A;  3P98 A;  4JF6 A;  2ZMA A;  3IF6 C;  4ZBE A;  4KZ7 A;  2XFS A;  5EPH A;  5U47 A;  2WK0 A;  1TDL A;  3ZG7 B;  2OLU A;  3IF6 B;  4S2L A;  3DWK A;  3RJU A;  2Y2L A;  4FD8 A;  3ZNT A;  4S2J A;  4WZ5 C;  1I5Q A;  4HBU A;  1YLZ A;  4C75 A;  3FKV A;  3OCL A;  2Y91 A;  4U0X A;  5EVI A;  4P85 A;  3VOZ A;  3AGD A;  3W8K A;  4Q8I A;  2XH9 A;  2WGV A;  2Y4A A;  4KZ6 A;  2WZX A;  4WZ4 A;  3S4X A;  3V3S A;  4D2O A;  2XD5 A;  4OLD A;  2V2F F;  3G35 A;  3MBZ A;  5M19 A;  4PM6 A;  2DRW A;  4E3N A;  5FDH A;  4JLF A;  4GDB A;  1NYM A;  2WZZ A;  1KE3 A;  1PWC A;  1ESU A;  2Y2M A;  4RA7 A;  2PBY A;  1ES5 A;  3IF5 A;  1K4E A;  5HW3 A;  2Y2I A;  1NY0 A;  4FSF A;  3WS4 A;  3Q1F A;  2WAE A;  1NYY A;  3BFC A;  1ERQ A;  2JBF A;  4U0T A;  3UPP A;  3OC2 A;  2JC7 A;  3E2K A;  5AQ9 A;  3VMA A;  2EXB A;  3ZG8 B;  3SOI A;  5FQQ A;  4WEK A;  1JVJ A;  1GHP A;  1CEG A;  3HLF A;  3CZD A;  5CED A;  2EXA A;  1Q2P A;  1DJA A;  3UE1 A;  3OPL A;  1LI9 A;  1LI0 A;  2HP6 A;  5JYP A;  2VGK A;  3ITB A;  3NY4 A;  3ZHH A;  5FAQ A;  3QNB A;  2UWX A;  1ES2 A;  5A90 A;  5M1A A;  3MZF A;  1FCN A;  2HP5 A;  3O88 A;  3IF6 A;  1PI5 A;  4KQO A;  4OP8 A;  5EEC A;  1IKI A;  5GL9 A;  3A3F A;  5E2F A;  5KZH A;  3PBO A;  3UDF A;  1MWU A;  5CGW A;  2OLV A;  5EVI B;  2DCF A;  1YMX A;  4DDS A;  4Y0T A;  3N6I A;  2ZM2 A;  4OPQ A;  4ZTK A;  1ALQ A;  3GRJ A;  4R23 A;  5GHX A;  5KSH A;  3V5M A;  2X02 A;  3C7U A;  4B4X A;  1E3U D;  3IT9 A;  4Z9Q A;  4E3L A;  4UAA A;  2PU2 A;  1N9B A;  1SDN A;  4UHU A;  3HLG A;  1KE4 A;  1DJC A;  2IWD A;  2EX2 A;  3BFD A;  4QB8 A;  4KG6 A;  3G32 A;  3FZC A;  4LCL A;  3EQU A;  1LL5 A;  1N4O A;  4UA7 A;  4WM9 A;  1PI4 A;  3WS0 A;  1K57 C;  1MKI A;  1BUL A;  3MKE A;  5GLD A;  4YIN A;  1K55 A;  3QNC A;  3N7W A;  1H8Y A;  1VQQ A;  4OH0 A;  2XGN A;  3IHA A;  3HLE A;  1H8Z A;  4QD4 A;  3BFE A;  4JXV A;  3VSL A;  1MPL A;  1XGJ A;  3I7J A;  2P9V B;  5CHM A;  4S2I A;  4OQI A;  1K25 A;  3W4O A;  3GV9 A;  3VP2 A;  4X55 A;  3Q7Z A;  4ID4 A;  4DXB A;  3HRE A;  4OLG A;  1GHI A;  1W8Q A;  4MBK A;  5KMW A;  3BRM A;  2WKH A;  4WBG A;  5GLC A;  5HX9 A;  3GR2 A;  4JF5 A;  3A3I A;  4GKU A;  3O87 A;  1IYQ A;  1JTG A;  3LCE A;  3PBN A;  4N1X A;  3ZFZ A;  1S0W A;  3V50 A;  2GDN A;  1VM1 A;  1IYS A;  2WGW B;  1K56 D;  2Y2P A;  3BM6 A;  4N9L A;  3NIA A;  4LV0 A;  3D4F A;  4FH2 A;  5DTS A;  4OOL A;  4BL3 A;  1MWS A;  1JWP A;  2Q9M A;  2PU4 A;  1E4D A;  4EBN A;  5L2F A;  2G2U A;  2HP9 A;  2X71 A;  3G30 A;  1XA1 A;  4MBF A;  2FFY A;  1RGZ A;  4MNR A;  3N4I A;  3ZG0 A;  4Y0U A;  1MY8 A;  4PPR A;  1WYB A;  3C4O A;  1CI9 A;  1GA0 A;  1NXY A;  4P6B A;  1G68 A;  1K57 A;  1KDW A;  1NZO A;  4O7D A;  1IYP A;  5CHJ A;  3SH9 A;  4U3T A;  1W7F A;  2ZC4 B;  3HLW A;  1QME A;  4GD8 A;  4LV1 A;  1BLH A;  2XD1 A;  4C3Q A;  1LLB A;  4QU3 A;  5FQM A;  3Q81 A;  3ZCZ A;  5J8X A;  3EQV A;  2QMI A;  4S2N C;  3HLD A;  5FQ9 A;  3M2K A;  3BEB A;  2J7V A;  1ONG A;  3SH8 A;  4K0W A;  3GTC A;  1FQG A;  3BLM A;  4OOM A;  5EUA A;  3ITA A;  4GZB A;  1DY6 A;  5M18 A;  3O86 A;  2XK1 A;  1YT4 A;  5F82 A;  1Y54 A;  2QPN A;  2ZC7 A;  4B4Z A;  1YLY A;  5CGX A;  2VGJ A;  5EVI D;  1FCM A;  2WUQ A;  3OPR A;  4OOY A;  1QMF A;  5EVI C;  1ONH A;  5GLA A;  1FR6 A;  4DF6 A;  3UE3 A;  1E25 A;  2J9O A;  3ZNY A;  5FQJ A;  4S2O A;  4OQ0 A;  3OPP A;  5CGS A;  1YLW A;  3VSK A;  4E3J A;  1L0F A;  4KG2 A;  1PWD A;  3IWO A;  1XX2 A;  2HDR A;  4MEZ A;  3PBQ A;  5G18 A;  3VP4 A;  3TOI A;  1PIO A;  4JXW A;  2DNS A;  2XLN A;  1KGE A;  2JE5 A;  1WYC A;  5FQK A;  4XUX A;  3DTM A;  2IWC A;  2Y2O A;  4GD6 A;  4IBR A;  4C6Y A;  4ZDX A;  3BFG A;  4X56 A;  3HBR A;  2BLS A;  4Y0O A;  1NZU A;  1CEF A;  4DE3 A;  2Y2G A;  3BYD A;  1EWZ A;  5FAP A;  3BEC A;  4BJP A;  3ZVW A;  4N92 A;  3SH7 A;  3CJM A;  3VFF A;  1XXM A;  1SKF A;  1MXO A;  4L0L A;  5GLB A;  4EWF A;  5DTK A;  4NET A;  1E3U A;  5TFQ A;  3GSG A;  3UN7 A;  3V3R A;  1BUE A;  3NDG A;  1IYO A;  2H0Y A;  5DF9 A;  1PWG A;  3UPO A;  1L0E A;  3UDI A;  4DRT A;  5FA7 A;  4X53 A;  3N8R A;  5F1G A;  4ZJ1 A;  4OQG A;  1TDG A;  2H5S A;  3ZDJ A;  3MZD A;  3BLS A;  3WS5 A;  5CRF A;  3P09 A;  3PAE A;  5GHZ A;  5TGF A;  1JWV A;  2ZQ8 A;  4ZJ2 A;  4KZ9 A;  2J9P A;  3SS3 A;  4EV4 A;  4DE2 A;  2E8I A;  4E3O A;  4HEF A;  3UY6 A;  2H0T A;  4KG5 A;  4KQR A;  2ZJ9 A;  4IVK A;  5CXW A;  1SDE A;  5EOO A;  1Z6F A;  2ZQ7 A;  3NI9 A;  2ZC6 B;  1IEL A;  5DVA A;  4OP5 A;  2J8Y A;  5A93 A;  1BSG A;  2XR0 A;  1H5X A;  1OME A;  3MXS A;  4EQI A;  1AXB A;  3FWL A;  5E43 A;  2HDU A;  2ZLY A;  3G31 A;  3IWI A;  4JPM A;  4EBL A;  1YLJ A;  2XFT A;  3OPH A;  4LCM A;  4ZJ3 A;  3WRT A;  1HTZ A;  5FI7 A;  1M6K A;  1K6S A;  3LEZ A;  1ERO A;  2CC1 A;  1FOF A;  3GMW A;  2V20 A;  1BZA A;  3M6H A;  1ERM A;  1EI5 A;  1TEM A;  2WYX A;  4N1H A;  3NDE A;  2ZM0 A;  4PM8 A;  1YMS A;  4R4R A;  5HAP A;  2ZC5 B;  3C7V A;  4RX3 A;  4DE1 A;  4UA6 A;  1CI8 A;  1KDS A;  3HL9 A;  1PW8 A;  1MWT A;  1XGI A;  1C3B A;  4KZ5 A;  4WEL A;  2EFX A;  4P0M A;  4KZ4 A;  3Q82 A;  3HUM A;  1FSY A;  3VOY A;  4KZA A;  1K54 C;  4DDY A;  2XF3 A;  3NBL A;  2WGW A;  2OV5 A;  2P9V A;  5F1F A;  3IXH A;  1ZG4 A;  4RX2 A;  2HDS A;  2A3U A;  5FAT A;  1XKZ A;  5FI6 A;  2Q9N A;  4HES A;  3LO7 A;  4MBH A;  5TR7 A;  4K91 A;  2Y55 A;  5DTT A;  5JYO A;  4KQQ A;  4X68 A;  3M6B A;  1I2W A;  4R3B A;  4LEN A;  3FV7 A;  1YQS A;  3MKF A;  3VP0 A;  1SHV A;  2R9X A;  3Q7V A;  3QHY A;  1LHY A;  3IQA A;  3HLC A;  3FYZ A;  5CTN A;  3PBT A;  4WMC A;  3TG9 A;  4QJG A;  4R4S A;  1KE0 A;  1MWR A;  4S2N A;  1GHM A;  4QY5 A;  1O07 A;  1KVM A;  2Y2K A;  5EOE A;  4IBX A;  1K4F A;  1TVF A;  1M40 A;  4RYE A;  4WZ5 A;  4A5R A;  4WMC D;  3A3J A;  1L2S A;  3UDX A;  5FAS A;  4CPK A;  1MBL A;  5FSR A;  3N8S A;  4QY6 A;  1KGF A;  4B88 A;  3PTE A;  5E2H A;  1FSW A;  4PMA A;  1G6A A;  2FFF B;  3MFD A;  4OPY A;  3UO9 A;  2ZQD A;  4N9K A;  3PBS A;  5GHY A;  3ZVT A;  4EUZ A;  2Z2L B;  3A3D A;  3GQZ A;  4PM5 A;  3C5A A;  4FCF A;  1RCJ A;  4M3K A;  4PM7 A;  3WS2 A;  4XXR A;  2P74 A;  3ZG9 B;  3IH9 A;  1O7E A;  4GB7 A;  1BLS A;  3W4Q A;  4FH4 A;  5F83 A;  3AGF A;  2A49 A;  5HAQ A;  3WS1 A;  2EX6 A;  1XPB A;  3G2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...