3SOIA

Crystallographic structure of bacillus licheniformis beta-lactamase w210f/w229f/w251f at 1.73 angstrom resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDFMKRNTTGDALIRAGVPDGFEVADKTGAASYGTRNDIAIIFPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title X-ray evidence of a native state with increased compactness populated by tryptophan-less B. licheniformis beta-lactamase.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 90
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3soiA00
4RX3A 4YFMA 4E3OA 1YT4A 3AGDA 4E6XA 4NK3A 3NBLA 2ZC3B 1KGEA 4JF5A 4OOLA 3FYZA 5GHXA 1K54A 4KZ4A 4OQ0A 4R1GA 5FI2A 2XDMA 3Q82A 4Y0UA 1BSGA 2G2WA 3HUOA 1FCMA 4OOMA 4WM9A 2ZC5B 5FASA 5I94A 1AXBA 4WMCA 4Y0OA 3G2ZA 4QY6A 3SS4A 5F1FA 2Y2HA 3O86A 4QD4A 1W8QA 1FCNA 2OLVA 4MBHA 3W4OA 1EROA 2RCXA 4OONA 4PM6A 3ZVTA 2BLSA 4EBPA 4RVAA 3V39A 5TGFA 4IBRA 1JTDA 1K54C 1E3UA 1YMXA 4JXWA 3PAEA 1OMEA 3EQUA 1HD8A 1ONGA 4PM8A 5FAPA 3UE0A 1I5QA 3PBOA 3A3DA 3ISGA 3RJUA 3MKEA 3OC2A 2HP6A 3Q7VA 4KZ5A 3V50A 2WGIA 3HUNA 4MLLA 2A3UA 1NZUA 1KDWA 5AQAA 5EVLA 4E3IA 3VOYA 4KZ6A 3MKFA 4IVIA 1RGYA 4LCLA 2OSUA 3IF6B 1Y54A 1KE0A 1FSYA 4S2NA 4GD6A 1DJAA 1LL5A 1K6RA 4N9LA 5CHJA 5EPHA 1G68A 4IVKA 4RX2A 1IYPA 3PBQA 1TEMA 3UPOA 1WYBA 4XUXA 4XXRA 3BRMA 4ZBEA 3WS0A 1SCWA 1MBLA 2WGWB 1YMSA 5EECA 3EQVA 1M6KA 1L0DA 2QZ6A 3NDGA 3VMAA 1I2SA 3IQAA 3A3EA 1IELA 2ZMAA 3BEBA 2J8YA 5GHYA 3UDIA 2R9XA 4OPYA 3ZVWA 3M6HA 1PWCA 2Y2QA 2ZC4B 2Q9MA 4N1XA 4ZJ3A 4EV4A 1HTZA 1YLWA 3WS1A 3ZG8B 4Y0TA 5A93A 4Z9QA 4PM5A 4S2NC 3B3XA 2WKIA 2Y2IA 3LCEA 4OLGA 2IWBA 2WAFA 3PTEA 3W4PA 1KE3A 3SH9A 3M2JA 1NYMA 3Q7ZA 1PWDA 2H0YA 1O07A 2Y59A 1BZAA 3FKVA 4LCMA 2EFUA 2WGVA 5FQ9A 4O7DA 2Y2KA 4OPRA 1L2SA 4ZJ2A 1O7EA 3NI9A 5CEDA 1IYSA 1CEGA 1K4FA 4A5RA 4DE2A 4KQOA 4UAAA 1N4OA 3P09A 4QHCA 4WELA 2ZQAA 1VM1A 5E2HA 3UY6A 3P98A 4KG2A 2VGKA 1MWTA 1PZOA 1BLHA 1XKZA 1YLJA 3ZHHA 3ITBA 2Y2GA 4R4RA 3VP1A 3I7JA 4R3BA 1WE4A 5L2FA 2V1ZA 4C3QA 3BYDA 1ERQA 4P0MA 1K38A 1NZOA 5FQMA 2EX9A 2XH9A 5AQBA 2XFSA 2XQZA 5E43A 5M19A 5DF7A 1K56A 2G2UA 2XEPA 1ZG4A 3FZCA 4DE3A 4DXBA 1BLSA 1CEFA 1JTGA 4JXSA 3SS3A 3C7UA 1ESIA 5EVID 3Q7VB 5AQ7A 5CTNA 3V3RA 1GHIA 5J8XA 1Z6FA 2XK1A 2FFYA 1W5DA 4EUZA 1K57A 1S0WA 2J9OA 3WRTA 3HLWA 4BLMA 1ES3A 1NYYA 2CC1A 5CTMA 5HW3A 4OLDA 3E2KA 1YLPA 3N8RA 2Y55A 4DE1A 3FV7A 2ZM2A 4BQMA 4K91A 4HEFA 1N9BA 3SH7A 4KENB 4R23A 3NIAA 3HLDA 2PU2A 2EXAA 2WZZA 2XD1A 4JXVA 4LV2A 1KGFA 5DTTA 1FR6A 1CI9A 3MZFA 1JVJA 3MZDA 2PBYA 4WBGA 2EXBA 5CGXA 4OPZA 4U0TA 1IYOA 5HAQA 3ITAA 5TFQA 3IWOA 4HBUA 2Z2LB 5F83A 3RXXA 2A49A 5CECA 2HP5A 3UPPA 1K25A 4KQQA 5F82A 1MWUA 2B5RA 3HLFA 3M6BA 4RYEA 3A3FA 1DJBA 4BJPA 2ZC6B 3GMWA 2X71A 1ERMA 1K4EA 1BTLA 4Y7PA 3AGEA 4JXGA 2Q9NA 2ZQ7A 4YINA 3CJMA 1KDSA 3PAGA 1ZKJA 4KG6A 3VP4A 1MY8A 3IXDA 5U47A 4EBNA 5JYPA 1ZC2A 5JYOA 3V5MA 4FD8A 4OPQA 3PBNA 3VSKA 4NETA 4B4ZA 4BD0A 4F94A 2WKHA 3G4PA 4MBFA 5CXWA 4WZ5A 2WUQA 5HL1A 4DF6A 1NJ4A 4XUZA 1VQQA 1FCOA 3IF5A 1CI8A 3MBZA 1PYYA 2GDNA 2JE5A 1CK3A 1C3BA 2EX8A 3HREA 4N9KA 4K0XA 4MBKA 3C4PA 2Y2LA 2ZLYA 4E3KA 4UA9A 1PW8A 1GA9A 1KE4A 2WZXA 3VFHA 4X68A 4UA6A 3N8SA 3LO7A 4IBXA 1BLCA 5G18A 3FWLA 4GNUA 5GLDA 2ZC7A 4DE0A 1MXOA 3Q07A 3BFCA 4WZ5C 5GHZA 4JBFA 5EUAA 3DTMA 5FQQA 1XA7A 1FOFA 1QMFA 3E2LA 1EWZA 4ZDXA 4X53A 1MWRA 5CHUA 1U60A 1XPBA 4EQIA 4X6TA 4OH0A 2C6WB 3HLGA 2P9VB 5FATA 4FH4A 1TDGA 4KG5A 4X55A 5M1AA 3UE3A 4QJGA 5IHVA 4PMAA 3LY4A 2I72A 3QHYA 4R3JA 3BLMA 4WZ4A 2Y4AA 2ZM8A 1FSWA 3G35A 5GL9A 1PZPA 4U3TA 3A3JA 2H10A 1I2WA 2WYXA 3G2YA 4S2JA 2HDRA 3JYIA 3IWIA 1S6RA 4ID4A 2UWXA 3PBRA 1DY6A 5HX9A 2X01A 1GA0A 2WKEA 3IHBA 3GTCA 4KQRA 3IHAA 1IKIA 3RXWA 5A92A 1ES4A 2OV5A 4WYYA 4PM9A 2BG1A 2ZM0A 5HARA 1K6SA 2DNSA 4Q8IA 1Q2QA 3UPNA 1TDLA 5FI7A 2ZJ9A 1TVFA 1YLTA 3VP3A 1ES2A 3NY4A 1ZG6A 4OQGA 2HP9A 4FSFA 5F1GA 3CZDA 5HAIA 4EBLA 2PU4A 5M18A 3QNCA 1ES5A 2WK0A 5GLCA 5EOEA 4ZTKA 1YQSA 1QMEA 3BFDA 1MWSA 5HFOA 5EOOA 5DF8A 4DDYA 3NC8A 3TSGA 3UO9A 2ZD8A 2JBFA 1IYQA 1IEMA 3CG5A 3SS5A 1EI5A 5DF9A 5GLBA 3VSLA 5KSCA 3C7VA 4OQIA 3ZDJA 3UDFA 3D4FA 3C4OA 5FSRA 1PI5A 3OCLA 1BLPA 1LLBA 3PBTA 5GLAA 1L0GA 1SKFA 3HLEA 5EVIA 3WS2A 2HDUA 3NCKA 1RGZA 1H8YA 2H5SA 1PW1A 2IWDA 3CMZA 1G6AA 3G30A 4KZ3A 4BD1A 3G32A 1PI4A 1XGJA 3Q1FA 2E8IA 1IKGA 3G34A 3VP0A 4UHUA 1SDNA 4KZ9A 3ZCZA 4LV3A 4JF6A 4LV0A 3Q81A 3A3IA 3G31A 1MPLA 3IF6C 2WAEA 4S2KA 4E3LA 1XGIA 3VP2A 5EVIC 4S2MA 3IXGA 1KVLA 1H8ZA 2ZQ8A 4R4SA 3MZEA 2DRWA 1Q2PA 3OZHA 4WMCD 1HZOA 4L0LA 1W79A 3HBRA 4UA7A 1E25A 3SOIA 2Y2JA 1FR1A 3O87A 1GHMA 1XA1A 2EX2A 3TG9A 4ZAMA 4BL3A 3DWKA 4C6YA 3O88A 3OCNA 1W7FA 2ZQ9A 4GD8A 1E3UD 2J7VA 3IT9A 3HUMA 4N1HA 4KZBA 1ESUA 3IH8A 4GOGA 5CGSA 1W8YA 5FDHA 2IWCA 1JWZA 3UDXA 3IXHA 3C5AA 3WWXA 1BT5A 3M2KA 3UE1A 3VFFA 3ZFZA 3BLSA 4M3KA 4EWFA 4GB7A 1H5XA 3BM6A 4JPMA 4P87A 2Y2PA 4LENA 4BENA 4X56A 4B88A 1RP5A 4X69A 1BUEA 3HVFA 2HPBA 4FCFA 4HESA 3ZG9B 4PPRA 1JWVA 4ZJ1A 3N8LA 3N6IA 3TOIA 4CPKA 5E2EA 3IWQA 3FKWA 1RCJA 1GCEA 5FQKA 2R9WA 3BFEA 3BFFA 2V2FF 2QPNA 3VOZA 3ZG5A 1PWGA 5CERA 2C5WB 5DVAA 2H0TA 3OPLA 5TR7A 4E6WA 5A90A 3OPHA 3WS4A 3GVBA 4GDNA 3MXRA 1M40A 2Z2MB 2XF3A 5EE8A 5EVIB 3ZG0A 1ALQA 4U0XA 3ZNYA 2HDSA 2V20A 4GN2A 3S22A 4QY5A 4GKUA 1NY0A 4S2IA 5HAPA 4OQHA 4E3NA 2JC7A 2XFTA 2Y2NA 4LV1A 5FQIA 3S4XA 4QU3A 3W4QA 4DXCA 1NXYA 2QMIA 5DTKA 5E2FA 1DJCA 2X02A 4R0QA 4CJNA 4K0WA 2OLUA 2J9PA 4DKIA 4P6BA 4OP5A 5FAOA 2DCFA 4C75A 4N92A 1BULA 3IXBA 1XP4A 4B4XA 4S2OA 5CHMA 2JCHA 2ZQCA 1KGGA 3GQZA 2Y2OA 3OPPA 4KZAA 1XXMA 5CRFA 3W8KA 2VGJA 3IH9A 5FQJA 3UN7A 4E3MA 3GRJA 4QB8A 1YLZA 2XLNA 4JLFA 4OVDA 4S2PA 4D2OA 4DRTA 1JWPA 4KZ8A 3BECA 5DTSA 2Y2MA 1ONHA 1GHPA 3HLCA 2EFXA 4P85A 3LY3A 3ZG7B 5CEBA 3SH8A 4GDBA 4OOYA 3UNWA 4WEJA 1K56D 5CGWA 4IEDA 4MEZA 4MNRA 1LI0A 4GZBA 4OKPA 5KSHA 2RL3A 2Y91A 1L0EA 5E2GA 2XD5A 4JKTA 1WYCA 4BL2A 5A91A 5BOHA 3ZGAB 3BFGA 3V3SA 1MKIA 2EX6A 1FQGA 3HL9A 3N7WA 1NRFA 3WRZA 3N4IA 2HDQA 3WS5A 1L0FA 4KZ7A 3LEZA 3S1YA 3IF6A 2FFFB 3NDEA 4OP8A 3DWZA 1LI9A 1K55A 3GR2A 1YM1A 4FH2A 4RA7A 2XR0A 5D3OA 1LL9A 1PIOA 3O3VA 3QNBA 2WGWA 3MFDA 1E4DA 4S2LA 1LHYA 5FA7A 4E3JA 1J9MA 4PM7A 5AQ9A 1SDEA 3PBSA 5FAQA 1YLYA 3GV9A 5KZHA 3ZNTA 2ZQDA 4HBTA 1KVMA 1HVBA 5KMWA 5FI6A 2WADA 1K55C 2XGNA 4DDSA 3AGFA 2P74A 2P9VA 1XX2A 3GSGA 3DW0A 4JF4A 4WEKA 3OPRA 3HLBA 1K57C 3MXSA 4H8RA 1SHVA
chains in the Genus database with same CATH superfamily
4RX3A 4YFMA 3AGDA 1KOUA 4OOLA 5FEFA 2L4RA 4KZ4A 2W3FA 4OQ0A 4R1GA 2G2WA 3HUOA 2LB5A 4OOMA 4WM9A 4WMCA 4FUWA 4EETB 1STZA 1FCNA 4MBHA 3W4OA 1Y4OA 3V39A 1VEUB 3W2ZA 3CPTA 3PAEA 5F69A 1OMEA 4MN5A 5FAPA 3UE0A 3HUNA 5AQAA 1KDWA 5EVLA 3VOYA 3IF6B 1KE0A 1IFQA 1LL5A 2O99A 4N9LA 1VB6A 4RX2A 3PXPA 3PBQA 1TEMA 3UB8A 1WYBA 4XUXA 1MBLA 2WGWB 3EQVA 3ZVWA 2J8YA 1PWCA 4N1XA 4CLCD 3WS1A 4Z9QA 4PM5A 2WKIA 2Y2IA 3L7HA 2VK3A 1NLZA 1KE3A 4HOIA 4KUOA 5TJJA 3R7WB 3DTIA 2QJ5A 1BZAA 2W3DA 1SKOB 4O7DA 2BASA 2Y2KA 3EGDC 4Z1WA 4E04A 3EEAA 3P09A 4BBUA 4CLCE 1JNUA 4KG2A 2YKHA 1PRQA 4WN5A 2XROA 1YLJA 5DFYA 2Y2GA 4R4RA 3VP1A 3T4OA 1G5UA 5L2FA 4C3QA 1ERQA 1K38A 5FQMA 5AQBA 5DF7A 1K56A 2G2UA 4UQIS 3V67A 1S4RA 4DXBA 4JXSA 3SS3A 4II7A 1K57A 2JHEA 4BLMA 2JN7A 5EV0A 3E2KA 5DJUA 1YLPA 3N8RA 3FV7A 2ZM2A 4BQMA 4X1LA 2PU2A 2XD1A 4JXVA 5I5LA 3NOPC 1KGFA 5DTTA 2V8FA 3HCYA 4KQDA 2EXBA 4U0TA 5TFQA 3IWOA 5F83A 3UB7A 5CECA 1S66L 5IS1A 5F82A 2B5RA 3HLFA 3M6BA 1ODVA 3IX3A 3A3FA 3MQ0A 5FEGA 3E4PA 3P01A 1ZKJA 2FZ0A 1MY8A 3ZYTA 4EBNA 4Y13A 3V5MA 2A24B 4BD0A 2WKHA 3G4PA 4O0PA 3OBFA 2WUQA 4WZ5A 5HL1A 3T50A 2GDNA 3LIDA 3G6OA 1C3BA 2VLGA 4K0XA 4MBKA 2ZLYA 4UA9A 1KE4A 2PD8A 3VFHA 2WKRA 2GJ3A 2B18A 4DE0A 1J3WA 5GHZA 3DTKA 2VV8A 4MN6A 4GLQA 3DTMA 4P6ZS 1XA7A 4I5SA 3LR3A 1L3LA 3HJKA 4X6TA 4FH4A 4QJGA 3UE3A 4PMAA 2Y4AA 3E0YA 1N9LA 2H10A 3JYIA 1LSWA 4ID4A 4X1MA 4GHIB 1GA0A 3VE4A 3GTCA 4EW7A 5A92A 2JKFA 5HARA 2ZM0A 1TDLA 5FI7A 4CLCC 4EUVA 3VP3A 1ZG6A 3MSHA 2QYBA 4EESA 3IBRA 2PU4A 4LFUA 5M18A 1DP8A 1LL8A 4ZTKA 3BFDA 1MWSA 5HFOA 5EOOA 4DDYA 3OOVA 1H3QA 4G3VA 1IEMA 3CAXA 5DF9A 5GLBA 3CUEA 3ZDJA 3KSFA 1L0GA 5GLAA 4WLAA 3G32A 1XGJA 2WKPA 1T19A 3BW6A 1SDNA 3ZCZA 4HP9A 4LV0A 3HJIA 3IF6C 1TD5A 2OWJA 4E3LA 1Z09A 1H8ZA 2PT7A 2ZQ8A 2HV1A 1Q2PA 3QP1A 3F1PA 4UA7A 2Y2JA 1GHMA 1N9OA 4WL9A 1P9WA 4ZAMA 4C6YA 3O88A 5IT5A 2KX6A 5AVFA 2EWVA 4GD8A 2J7VA 5A8BA 3HUMA 3MFXA 3NHQA 1ESUA 4KZBA 2IWCA 4GW9A 4H6JB 1BT5A 4ETZA 3M2KA 4EWFA 1H5XA 2W3HA 2O9AA 5G4ZA 4BENA 4G3WA 2QHKA 4FCFA 4HESA 1JWVA 3FKWA 1GCEA 2R9WA 3BFEA 3OPHA 2JKGA 3MXRA 4DJ3A 1OTDA 1S67L 4U0XA 2HJ9C 3CHWP 3S22A 4OQHA 2XFTA 3W4QA 2QMIA 4K0WA 1FIKA 3T4QA 2OOLA 3SW1A 4S2OA 2INWA 2ZQCA 3GQZA 2Y2OA 5HWVA 2VGJA 3IH9A 5FQJA 3GRJA 4QB8A 1YLZA 2ACGA 4S2PA 4D2OA 3BECA 2EFXA 4MN7A 5L09A 4EEUA 1V9YA 4IEDA 4MEZA 2XD5A 3T4TA 2W3EA 5A91A 4Y3IA 1MKIA 1FQGA 2JKTI 1L0FA 3S1YA 3QP8A 1P97A 4OP8A 1K55A 3GR2A 1YM1A 4RA7A 1PIOA 2AVXA 1E4DA 1FILA 2KDKA 5AQ9A 3PBSA 3S7PA 1OTBA 5AVEA 3UB9A 2ZQDA 5HPIA 2Z6DA 3GSGA 3DW0A 2PDRA 4H8RA 4ETXA 1YT4A 3OLOA 4GJ4A 4JF5A 4LRYC 3FYZA 3LFVA 4HH3A 2XDMA 4Y0UA 1BSGA 2ZMVA 5I94A 2ZC5B 1MZUA 3G2ZA 4QY6A 3TRCA 2Y2HA 2NUPC 3ZVTA 2Y79A 4EBPA 2RCXA 2BLSA 5TGFA 1JTDA 1K54C 1E3UA 2V0UA 1YMXA 5EVEA 4X25A 3PBOA 3ISGA 3RJUA 3Q7VA 2HP6A 5HD5A 3JVUA 4E3IA 4LCLA 4IVIA 2ZOIA 5TBMA 1Y54A 1DJAA 2O9CA 1K6RA 5EPHA 1G68A 2W0NA 1SCWA 4L9FA 3C38A 1X0OA 5EECA 2QZ6A 3VMAA 3NDGA 1YSQA 3A3EA 3IQAA 3UDIA 2Q9MA 2PRFA 4NKPA 4NXGA 4EV4A 1YLWA 3ZG8B 3B3XA 2PAVP 3LCEA 3IX4A 2V0WA 2XA7S 3F1NB 4QPRA 1D1JA 3Q7ZA 3BY9A 2Y59A 4LCMA 5FQ9A 3T1QB 2EFUA 2WGVA 4OPRA 1L2SA 5DKLA 3NOUC 1IYSA 1K4FA 4UAAA 4IUKA 2IA2A 4QHCA 1DRMA 1VM1A 2VGKA 2VA0A 1YPRA 1PZOA 1BLHA 2P7JA 4P0MA 2PYRA 1NZOA 2XFSA 3MMHA 3CPTB 3C7UA 5EVID 5AQ7A 5J8XA 4HQAA 1OT9A 2A2LA 1ES3A 2R78A 3D9YA 3LIBA 4WUJA 1ACFA 1N9BA 2HF6A 3SH7A 4KENB 3HLDA 2WZZA 3O5YA 1FR6A 1JVJA 1UWNX 2QJ7A 4HJ6A 4HBUA 2Z2LB 5EFWA 3T12B 2VEAA 4BJPA 3GMWA 2X71A 1K4EA 4LPZA 4Y7PA 2JKTM 2W27A 2Q9NA 2ZQ7A 2W1TA 4YINA 3UB5P 4OPQA 3PBNA 4B4ZA 4MBFA 5CXWA 3JVVA 4XUZA 1VQQA 1FCOA 3IF5A 4YWZA 4I3AA 4F3LA 1CF0A 1VETA 3C4PA 2H28A 2Y2LA 4E3KA 1PW8A 1GA9A 2WZXA 3FC7A 4X68A 3FWLA 4GNUA 1UWPX 2J3WA 5EUAA 5F5YA 1QMFA 5HDDA 1U60A 2C6WB 3HLGA 2P9VB 4PAUA 5FATA 4KG5A 5IHVA 4PKYA 2I72A 4R3JA 3GECA 4CLCA 4U3TA 3A3JA 3RFBA 1I2WA 2HDRA 4LGWA 3BWLA 1S6RA 2D01A 2UWXA 1DY6A 2VGLM 5HX9A 4B93A 3IHBA 3IHAA 1IKIA 1ES4A 1S1ZA 1YSPA 2QKPA 1K6SA 5KIZA 1Q2QA 4LLOB 3VOLA 3QP5A 3MR0A 2W3GA 4O01A 3LR5A 4FSFA 5F1GA 3CZDA 2VJWA 4Y17A 3QNCA 1VEUA 5EOEA 1F5MA 4M4XA 3IS2B 2ZD8A 3CG5A 1EI5A 3VSLA 5KSCA 2OAP1 4ME4A 4OQIA 3C4OA 1PI5A 1LLBA 3PBTA 3VV4A 1SKFA 2P04A 3NCKA 4FOFA 1RGZA 1H8YA 2IWDA 3CMZA 3G30A 4BD1A 4CQHA 4KZ9A 4JF6A 3Q81A 5F68A 1XGIA 5EVIC 1KVLA 4HNBA 3R7WA 1OPXA 1FR1A 3TG9A 4BL3A 3OCNA 2HGVA 4PKYG 3MJQA 3IT9A 4N1HA 2PBDP 5CGSA 5FDHA 1JWZA 3UDXA 3C5AA 1NRJA 1N9NA 3QP6A 4HP4A 3T4LA 3UE1A 3VFFA 3ZFZA 3BLSA 2EA9A 3ULFA 1D06A 1RP5A 1NWZA 4PPRA 4CPKA 2V2FF 2QPNA 5CERA 2H0TA 3OPLA 4GDNA 3MF0A 5EE8A 3BQAA 4HIAA 1ALQA 2V20A 5HAPA 3K2NA 2JC7A 3S4XA 4NEED 5FQIA 1NXYA 5DTKA 5E2FA 2X02A 4PHTA 3F1OA 4B4XA 1T1BA 2GX5A 5CHMA 4ARZB 2JCHA 1KGGA 3LI8A 2Y8HA 4KZAA 1XXMA 3T4SA 1A0KA 3F1PB 4E3MA 1H8MA 2XLNA 4JLFA 1YAXA 5HDSA 5DTSA 5HZHA 1ONHA 3ZG7B 3SH8A 4GDBA 4OOYA 4WEJA 3LICA 3ICYA 5KSHA 4GZBA 2RL3A 2Y91A 1L0EA 5E2GA 3MQOA 4G3KA 4BL2A 3ZGAB 3BFGA 3V3SA 3D72A 3WS5A 1TS8A 2PR5A 3UMEA 3DWZA 1LI9A 2UV0E 2XR0A 1H0MA 3D3OA 3MFDA 4S2LA 5FA7A 1XJ3A 1CQAA 5KZHA 1KVMA 3DBAA 5KMWA 2XGNA 3H82A 4DDSA 4NXFA 1XX2A 1DP9A 3HLBA 1K57C 3A0SA 4E3OA 3NBLA 2ZC3B 5C5KA 3KYQA 2PD7A 5GHXA 1K54A 5CX7A 4R3AA 2V9AA 3EEHA 5FASA 3SS4A 5F1FA 3O86A 1XFQA 1Y28A 4QD4A 1EROA 4BBVA 3K3DA 3EQUA 1HD8A 4PM8A 2J80A 1I5QA 1D7EA 3OC2A 4KZ5A 2WGIA 2A3UA 3GDIA 3MKFA 1RGYA 2OSUA 4IVKA 1IYPA 3UPOA 3WS0A 1YMSA 1M6KA 1L0DA 2D02A 3LR4A 1I2SA 2I9VA 3BEBA 5GHYA 3M6HA 2Y2QA 4LRZE 5L8MA 4ZJ3A 4Y0TA 4S2NC 4BMWA 2IWBA 2WAFA 3PTEA 3W4PA 3SH9A 3M2JA 3H9WA 1PWDA 2H0YA 4ZJ2A 1O7EA 2K2NA 4DE2A 4KQOA 1N4OA 2PR6A 4WELA 3CWFA 3UY6A 3P98A 5HSQA 2OAQ1 3ITBA 3I7JA 4R3BA 1WE4A 4H6JA 2V1ZA 3BYDA 2EX9A 2XH9A 2QWSA 2XQZA 1S4SA 2NUTC 3FZCA 4DE3A 1BLSA 1JTGA 1ESIA 4ESPA 2M1CA 3Q7VB 5CTNA 3V3RA 1Z6FA 2XK1A 2GNXA 1W5DA 1S0WA 2J9OA 4O8GA 3HLWA 3WRTA 5J4EA 2CC1A 5CTMA 3KYEA 1HLUP 2Y55A 4DE1A 2M7VA 4K91A 1G6OA 3MXQA 4I3JA 3NIAA 2EXAA 5F6AA 4UQIM 5L10A 1CI9A 3MZDA 1T18A 4BBTA 2PBYA 5CGXA 4OPZA 5J3WA 5HAQA 3UPPA 1K25A 4NXEA 3BQ8A 4KQQA 2P08A 3T1SA 1DJBA 1ERMA 4L9GA 3AGEA 4JXGA 4KUKA 1KDSA 1OJ5A 2ZL1A 3IXDA 5U47A 5IU1A 5JYPA 1ZC2A 5JYOA 3IBJA 3VSKA 4NETA 4HJ4A 3LEQA 4DF6A 1NJ4A 2EWWA 5DFXA 1CI8A 3MBZA 1PYYA 2JE5A 1F9IA 4N9KA 3HREA 4DMZA 3LO7A 1TS6A 3H7WB 5GLDA 2ZC7A 3Q07A 4IHQA 1W63M 5FQQA 2XSSA 1FOFA 1TS7A 3E2LA 1EWZA 4ZDXA 3PHYA 4X53A 1MWRA 4X55A 3KSHA 3L9KA 4R38A 1FSWA 3G35A 1F98A 3IX8A 2WYXA 4S2JA 4GS9A 4MCWA 4P6ZM 4KQRA 1XJ2A 5HWWA 2WKQA 4LRXC 4WYYA 4PM9A 2DNSA 4Q8IA 2ZJ9A 1YLTA 2VX8A 3VE3A 2V8CA 4OQGA 2HP9A 5HAIA 1ES5A 1OTEA 1XFNA 2WK0A 1YQSA 1T1AA 4HI4A 2JBFA 3B33A 1IYQA 1VETB 4I38A 3UDFA 3D4FA 5FSRA 3OCLA 1BLPA 1MC0A 5EVIA 3WS2A 1VHMA 4DJ2A 3DAVA 4L9EA 3KSGA 1IKGA 3VP0A 4UHUA 3UB6A 3G31A 1MPLA 3VP2A 3R4KA 3IXGA 3MZEA 4EEPA 3S7OA 2DRWA 3OZHA 5LBRA 4CLCB 4WMCD 4L0LA 3B42A 3HBRA 4Y2FA 3O87A 2BTFP 2EX2A 3DWKA 3NJAA 1W7FA 3LI9A 4GOGA 1W8YA 2CMNA 1V9ZA 1BYWA 4M3KA 4GB7A 3BM6A 4P87A 4JPMA 3U2AA 2B02A 3E98A 4X69A 1BUEA 5HD3A 3T4KA 4ZJ1A 3N8LA 2HZ5A 3N6IA 5FL3A 3TOIA 3IWQA 5FQKA 3C30A 3BFFA 4B9OA 3VOZA 1PWGA 2C5WB 5DVAA 5A90A 5TR7A 4E6WA 3FPWA 3WS4A 1M40A 1DP6A 2XF3A 3ZG0A 3E4QA 3ZNYA 2HDSA 1LSVA 4QY5A 1NY0A 4FTXA 4XT2A 5EM0A 4E3NA 4LV1A 2KLIA 3KSIA 4QU3A 4CJNA 3NOTC 1W63Q 2J9PA 3LIFA 4N92A 1BULA 4Q0HA 4WF0A 3W8KA 2ZOHA 4AFIA 4HH2A 2JKRI 1EW0A 1JWPA 4KZ8A 4QWOA 1GHPA 1UGUA 3HLCA 4P85A 5CEBA 5HPFA 3ZQ5A 3LYXA 1K56D 4MNRA 3U4LP 2GZAA 2PYPA 1ZHHB 5BOHA 2ZMFA 2EX6A 3N7WA 1NRFA 2HDQA 4KZ7A 3IF6A 3LUQA 3NDEA 4IJGA 4FH2A 3A0RA 1IOUA 2O0YA 1LL9A 1PNEA 3KX0X 3O3VA 4Q0JA 2WGWA 3TE8A 5DKKA 2ZBBA 1J9MA 4PM7A 1SDEA 1CJFA 4D60A 3ZNTA 2DMWA 3QP2A 4HBTA 1HVBA 2L1MA 5FI6A 1AWIA 3AGFA 2P9VA 4WEKA 3OPRA 1PFLA 3F1OB 1SKOA 4E6XA 4NK3A 1KGEA 4NXBA 3MS6A 3FPVA 5FI2A 3Q82A 3C2WA 1FCMA 1TS0A 1AXBA 4Y0OA 1F2KA 2J3TD 1W8QA 2OLVA 4PM6A 4OONA 4RVAA 3NULA 4IBRA 4Q0IA 4JXWA 1LT0A 1S1YA 1ONGA 1LSXA 3PYPA 1T1CA 3A3DA 3MKEA 4Y5FA 3V50A 4MLLA 2O9BA 1NZUA 4KZ6A 2K31A 4S2NA 1FSYA 3IS2A 4GD6A 5CHJA 4XXRA 3BRMA 4ZBEA 4JGRA 1IELA 2ZMAA 2R9XA 4OPYA 3BY8A 2ZC4B 1K0KA 1HTZA 3A0VA 5A93A 4OLGA 3H82B 3TW8A 4JGPA 3E4OA 1NYMA 1O07A 3FKVA 4R6LA 3NI9A 5CEDA 1CEGA 4A5RA 5HWTA 4RQ9A 2ZQAA 1OT6A 5E2HA 1MWTA 1XKZA 2A24A 3ZHHA 1G28A 2E8JA 3P7NA 3CI6A 2XA7M 2L0WA 2VZWA 5E43A 5M19A 3KYZA 2XEPA 1ZG4A 2VV6A 1XJ6A 1CEFA 4HJ3A 1GHIA 2FFYA 4EUZA 3LGOA 1NYYA 5HW3A 4OLDA 5FDSA 3CLOA 2B95A 4HEFA 2VV7A 3LR0A 1SZVA 4R23A 2Q0OA 2JKRM 4LV2A 3MZFA 1XJ4A 4WBGA 4R70A 1IYOA 4BWIA 3ITAA 3RXXA 2A49A 2HP5A 3BJNA 4EU0A 4GHIA 1MWUA 4RYEA 4ARZA 2ZC6B 1BTLA 3CJMA 4KG6A 3PAGA 3VP4A 2V1AA 3EOIA 4DN0A 4FD8A 2FH5A 4F94A 3LIEA 5DJTA 4JGOA 4EQ1A 1CK3A 2EX8A 3T1XA 5K5BA 4UEYA 2KOIA 4UA6A 3N8SA 4IBXA 1BLCA 5G18A 1NLYA 1MXOA 4WZ5C 3BFCA 2VGLS 2YKFA 2J3TC 4JBFA 4I3IA 3S7QA 5CHUA 1XPBA 4EQIA 4OH0A 5M1AA 1TDGA 3LY4A 4MDZA 3QHYA 3CITA 4JGQA 2K7SA 3BLMA 4WZ4A 2ZM8A 3PR6A 4EXOA 5GL9A 1PZPA 3G2YA 5AJGA 3IWIA 3RTYA 1YKDA 3PBRA 3S7NA 2X01A 3MQQA 2WKEA 3RXWA 2OV5A 3SZTA 2BG1A 3UPNA 1TVFA 1ES2A 1ZTUA 3NY4A 2ZL1B 4K08A 2HJEA 3C8CA 4EBLA 4I39A 5EM1A 5GLCA 1QMEA 1OTAA 5L07A 5TBMB 5DF8A 2Z6CA 3NC8A 3TSGA 3UO9A 3JPUA 4Y15A 3SS5A 3B47A 3C7VA 3HLEA 2HDUA 2H5SA 1PW1A 1G6AA 4KZ3A 1PI4A 3Q1FA 2E8IA 1WA9A 3G34A 4LV3A 1OTIA 4GCZA 1TF1A 3A3IA 3CUEC 2WAEA 4S2KA 3FG8A 4S2MA 4R4SA 2LB9A 1GSWA 1HZOA 1W79A 3RH8B 1E25A 3SOIA 1XA1A 4GS9B 2VKSA 2ZQ9A 4HY8A 1E3UD 4NG2A 3K3CA 3IH8A 3IXHA 3WWXA 4HHDA 2Y2PA 4LENA 4X56A 4B88A 3HVFA 2HPBA 3ZG9B 5E2EA 3UMDA 1GSXA 1RCJA 3ZG5A 3UE6A 2OWHA 4YNRA 4YOFA 3GVBA 5HDCA 2Z2MB 4EERA 5HL6A 5EVIB 2PHYA 4GN2A 4GKUA 4S2IA 3TJZC 2Y2NA 2V1BA 4DXCA 1DJCA 1OJGA 4R0QA 2MJ6A 2OLUA 4DKIA 4P6BA 4OP5A 5FAOA 2DCFA 4C75A 2G7UA 3IXBA 1XP4A 3LIAA 4MMNA 3KO6A 5CRFA 3OPPA 3UN7A 3DTEA 4OVDA 2W1TB 4DRTA 2Y2MA 3LY3A 3EGXC 3NECA 3UNWA 2W1RA 5CGWA 3T4JA 3T1RA 1LI0A 4OKPA 2XRNA 4JKTA 1WYCA 3QP4A 3HL9A 4F3LB 3WRZA 5G4YA 3N4IA 1P0ZA 3LEZA 5J7EA 2FFFB 4IUHA 1GSVA 1MKMA 5D3OA 3QNBA 5MC7A 1LHYA 3H7WA 4E3JA 5FAQA 1YLYA 3GV9A 1P9RA 4ZRRA 4XT2B 2M7UA 2WADA 1K55C 3F1NA 2P74A 3EWKA 4JF4A 3MXSA 1SHVA
chains in the Genus database with same CATH topology
4RX3A 4YFMA 4E3OA 1YT4A 3AGDA 4E6XA 4NK3A 3NBLA 2ZC3B 1KGEA 4JF5A 4OOLA 3FYZA 5GHXA 1K54A 4KZ4A 4OQ0A 4R1GA 5FI2A 2XDMA 3Q82A 4Y0UA 1BSGA 2G2WA 3HUOA 1FCMA 4OOMA 4WM9A 2ZC5B 5FASA 5I94A 1AXBA 4WMCA 4Y0OA 3G2ZA 4QY6A 3SS4A 5F1FA 2Y2HA 3O86A 4QD4A 1W8QA 1FCNA 2OLVA 4MBHA 3W4OA 1EROA 2RCXA 4OONA 4PM6A 3ZVTA 2BLSA 4EBPA 4RVAA 3V39A 5TGFA 4IBRA 1JTDA 1K54C 1E3UA 1YMXA 4JXWA 3PAEA 1OMEA 3EQUA 1HD8A 1ONGA 4PM8A 5FAPA 3UE0A 1I5QA 3PBOA 3A3DA 3ISGA 3RJUA 3MKEA 3OC2A 2HP6A 3Q7VA 4KZ5A 3V50A 2WGIA 3HUNA 4MLLA 2A3UA 1NZUA 1KDWA 5AQAA 5EVLA 4E3IA 3VOYA 4KZ6A 3MKFA 4IVIA 1RGYA 4LCLA 2OSUA 3IF6B 1Y54A 1KE0A 1FSYA 4S2NA 4GD6A 1DJAA 1LL5A 1K6RA 4N9LA 5CHJA 5EPHA 1G68A 4IVKA 4RX2A 1IYPA 3PBQA 1TEMA 3UPOA 1WYBA 4XUXA 4XXRA 3BRMA 4ZBEA 3WS0A 1SCWA 1MBLA 2WGWB 1YMSA 5EECA 3EQVA 1M6KA 1L0DA 2QZ6A 3NDGA 3VMAA 1I2SA 3IQAA 3A3EA 1IELA 2ZMAA 3BEBA 2J8YA 5GHYA 3UDIA 2R9XA 4OPYA 3ZVWA 3M6HA 1PWCA 2Y2QA 2ZC4B 2Q9MA 4N1XA 4ZJ3A 4EV4A 1HTZA 1YLWA 3WS1A 3ZG8B 4Y0TA 5A93A 4Z9QA 4PM5A 4S2NC 3B3XA 2WKIA 2Y2IA 3LCEA 4OLGA 2IWBA 2WAFA 3PTEA 3W4PA 1KE3A 3SH9A 3M2JA 1NYMA 3Q7ZA 1PWDA 2H0YA 1O07A 2Y59A 1BZAA 3FKVA 4LCMA 2EFUA 2WGVA 5FQ9A 4O7DA 2Y2KA 4OPRA 1L2SA 4ZJ2A 1O7EA 3NI9A 5CEDA 1IYSA 1CEGA 1K4FA 4A5RA 4DE2A 4KQOA 4UAAA 1N4OA 3P09A 4QHCA 4WELA 2ZQAA 1VM1A 5E2HA 3UY6A 3P98A 4KG2A 2VGKA 1MWTA 1PZOA 1BLHA 1XKZA 1YLJA 3ZHHA 3ITBA 2Y2GA 4R4RA 3VP1A 3I7JA 4R3BA 1WE4A 5L2FA 2V1ZA 4C3QA 3BYDA 1ERQA 4P0MA 1K38A 1NZOA 5FQMA 2EX9A 2XH9A 5AQBA 2XFSA 2XQZA 5E43A 5M19A 5DF7A 1K56A 2G2UA 2XEPA 1ZG4A 3FZCA 4DE3A 4DXBA 1BLSA 1CEFA 1JTGA 4JXSA 3SS3A 3C7UA 1ESIA 5EVID 3Q7VB 5AQ7A 5CTNA 3V3RA 1GHIA 5J8XA 1Z6FA 2XK1A 2FFYA 1W5DA 4EUZA 1K57A 1S0WA 2J9OA 3WRTA 3HLWA 4BLMA 1ES3A 1NYYA 2CC1A 5CTMA 5HW3A 4OLDA 3E2KA 1YLPA 3N8RA 2Y55A 4DE1A 3FV7A 2ZM2A 4BQMA 4K91A 4HEFA 1N9BA 3SH7A 4KENB 4R23A 3NIAA 3HLDA 2PU2A 2EXAA 2WZZA 2XD1A 4JXVA 4LV2A 1KGFA 5DTTA 1FR6A 1CI9A 3MZFA 1JVJA 3MZDA 2PBYA 4WBGA 2EXBA 5CGXA 4OPZA 4U0TA 1IYOA 5HAQA 3ITAA 5TFQA 3IWOA 4HBUA 2Z2LB 5F83A 3RXXA 2A49A 5CECA 2HP5A 3UPPA 1K25A 4KQQA 5F82A 1MWUA 2B5RA 3HLFA 3M6BA 4RYEA 3A3FA 1DJBA 4BJPA 2ZC6B 3GMWA 2X71A 1ERMA 1K4EA 1BTLA 4Y7PA 3AGEA 4JXGA 2Q9NA 2ZQ7A 4YINA 3CJMA 1KDSA 3PAGA 1ZKJA 4KG6A 3VP4A 1MY8A 3IXDA 5U47A 4EBNA 5JYPA 1ZC2A 5JYOA 3V5MA 4FD8A 4OPQA 3PBNA 3VSKA 4NETA 4B4ZA 4BD0A 4F94A 2WKHA 3G4PA 4MBFA 5CXWA 4WZ5A 2WUQA 5HL1A 4DF6A 1NJ4A 4XUZA 1VQQA 1FCOA 3IF5A 1CI8A 3MBZA 1PYYA 2GDNA 2JE5A 1CK3A 1C3BA 2EX8A 3HREA 4N9KA 4K0XA 4MBKA 3C4PA 2Y2LA 2ZLYA 4E3KA 4UA9A 1PW8A 1GA9A 1KE4A 2WZXA 3VFHA 4X68A 4UA6A 3N8SA 3LO7A 4IBXA 1BLCA 5G18A 3FWLA 4GNUA 5GLDA 2ZC7A 4DE0A 1MXOA 3Q07A 3BFCA 4WZ5C 5GHZA 4JBFA 5EUAA 3DTMA 5FQQA 1XA7A 1FOFA 1QMFA 3E2LA 1EWZA 4ZDXA 4X53A 1MWRA 5CHUA 1U60A 1XPBA 4EQIA 4X6TA 4OH0A 2C6WB 3HLGA 2P9VB 5FATA 4FH4A 1TDGA 4KG5A 4X55A 5M1AA 3UE3A 4QJGA 5IHVA 4PMAA 3LY4A 2I72A 3QHYA 4R3JA 3BLMA 4WZ4A 2Y4AA 2ZM8A 1FSWA 3G35A 5GL9A 1PZPA 4U3TA 3A3JA 2H10A 1I2WA 2WYXA 3G2YA 4S2JA 2HDRA 3JYIA 3IWIA 1S6RA 4ID4A 2UWXA 3PBRA 1DY6A 5HX9A 2X01A 1GA0A 2WKEA 3IHBA 3GTCA 4KQRA 3IHAA 1IKIA 3RXWA 5A92A 1ES4A 2OV5A 4WYYA 4PM9A 2BG1A 2ZM0A 5HARA 1K6SA 2DNSA 4Q8IA 1Q2QA 3UPNA 1TDLA 5FI7A 2ZJ9A 1TVFA 1YLTA 3VP3A 1ES2A 3NY4A 1ZG6A 4OQGA 2HP9A 4FSFA 5F1GA 3CZDA 5HAIA 4EBLA 2PU4A 5M18A 3QNCA 1ES5A 2WK0A 5GLCA 5EOEA 4ZTKA 1YQSA 1QMEA 3BFDA 1MWSA 5HFOA 5EOOA 5DF8A 4DDYA 3NC8A 3TSGA 3UO9A 2ZD8A 2JBFA 1IYQA 1IEMA 3CG5A 3SS5A 1EI5A 5DF9A 5GLBA 3VSLA 5KSCA 3C7VA 4OQIA 3ZDJA 3UDFA 3D4FA 3C4OA 5FSRA 1PI5A 3OCLA 1BLPA 1LLBA 3PBTA 5GLAA 1L0GA 1SKFA 3HLEA 5EVIA 3WS2A 2HDUA 3NCKA 1RGZA 1H8YA 2H5SA 1PW1A 2IWDA 3CMZA 1G6AA 3G30A 4KZ3A 4BD1A 3G32A 1PI4A 1XGJA 3Q1FA 2E8IA 1IKGA 3G34A 3VP0A 4UHUA 1SDNA 4KZ9A 3ZCZA 4LV3A 4JF6A 4LV0A 3Q81A 3A3IA 3G31A 1MPLA 3IF6C 2WAEA 4S2KA 4E3LA 1XGIA 3VP2A 5EVIC 4S2MA 3IXGA 1KVLA 1H8ZA 2ZQ8A 4R4SA 3MZEA 2DRWA 1Q2PA 3OZHA 4WMCD 1HZOA 4L0LA 1W79A 3HBRA 4UA7A 1E25A 3SOIA 2Y2JA 1FR1A 3O87A 1GHMA 1XA1A 2EX2A 3TG9A 4ZAMA 4BL3A 3DWKA 4C6YA 3O88A 3OCNA 1W7FA 2ZQ9A 4GD8A 1E3UD 2J7VA 3IT9A 3HUMA 4N1HA 4KZBA 1ESUA 3IH8A 4GOGA 5CGSA 1W8YA 5FDHA 2IWCA 1JWZA 3UDXA 3IXHA 3C5AA 3WWXA 1BT5A 3M2KA 3UE1A 3VFFA 3ZFZA 3BLSA 4M3KA 4EWFA 4GB7A 1H5XA 3BM6A 4JPMA 4P87A 2Y2PA 4LENA 4BENA 4X56A 4B88A 1RP5A 4X69A 1BUEA 3HVFA 2HPBA 4FCFA 4HESA 3ZG9B 4PPRA 1JWVA 4ZJ1A 3N8LA 3N6IA 3TOIA 4CPKA 5E2EA 3IWQA 3FKWA 1RCJA 1GCEA 5FQKA 2R9WA 3BFEA 3BFFA 2V2FF 2QPNA 3VOZA 3ZG5A 1PWGA 5CERA 2C5WB 5DVAA 2H0TA 3OPLA 5TR7A 4E6WA 5A90A 3OPHA 3WS4A 3GVBA 4GDNA 3MXRA 1M40A 2Z2MB 2XF3A 5EE8A 5EVIB 3ZG0A 1ALQA 4U0XA 3ZNYA 2HDSA 2V20A 4GN2A 3S22A 4QY5A 4GKUA 1NY0A 4S2IA 5HAPA 4OQHA 4E3NA 2JC7A 2XFTA 2Y2NA 4LV1A 5FQIA 3S4XA 4QU3A 3W4QA 4DXCA 1NXYA 2QMIA 5DTKA 5E2FA 1DJCA 2X02A 4R0QA 4CJNA 4K0WA 2OLUA 2J9PA 4DKIA 4P6BA 4OP5A 5FAOA 2DCFA 4C75A 4N92A 1BULA 3IXBA 1XP4A 4B4XA 4S2OA 5CHMA 2JCHA 2ZQCA 1KGGA 3GQZA 2Y2OA 3OPPA 4KZAA 1XXMA 5CRFA 3W8KA 2VGJA 3IH9A 5FQJA 3UN7A 4E3MA 3GRJA 4QB8A 1YLZA 2XLNA 4JLFA 4OVDA 4S2PA 4D2OA 4DRTA 1JWPA 4KZ8A 3BECA 5DTSA 2Y2MA 1ONHA 1GHPA 3HLCA 2EFXA 4P85A 3LY3A 3ZG7B 5CEBA 3SH8A 4GDBA 4OOYA 3UNWA 4WEJA 1K56D 5CGWA 4IEDA 4MEZA 4MNRA 1LI0A 4GZBA 4OKPA 5KSHA 2RL3A 2Y91A 1L0EA 5E2GA 2XD5A 4JKTA 1WYCA 4BL2A 5A91A 5BOHA 3ZGAB 3BFGA 3V3SA 1MKIA 2EX6A 1FQGA 3HL9A 3N7WA 1NRFA 3WRZA 3N4IA 2HDQA 3WS5A 1L0FA 4KZ7A 3LEZA 3S1YA 3IF6A 2FFFB 3NDEA 4OP8A 3DWZA 1LI9A 1K55A 3GR2A 1YM1A 4FH2A 4RA7A 2XR0A 5D3OA 1LL9A 1PIOA 3O3VA 3QNBA 2WGWA 3MFDA 1E4DA 4S2LA 1LHYA 5FA7A 4E3JA 1J9MA 4PM7A 5AQ9A 1SDEA 3PBSA 5FAQA 1YLYA 3GV9A 5KZHA 3ZNTA 2ZQDA 4HBTA 1KVMA 1HVBA 5KMWA 5FI6A 2WADA 1K55C 2XGNA 4DDSA 3AGFA 2P74A 2P9VA 1XX2A 3GSGA 3DW0A 4JF4A 4WEKA 3OPRA 3HLBA 1K57C 3MXSA 4H8RA 1SHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RX3 A;  4YFM A;  4E3O A;  1YT4 A;  3AGD A;  4E6X A;  4NK3 A;  3NBL A;  2ZC3 B;  1KGE A;  4JF5 A;  4OOL A;  3FYZ A;  5GHX A;  1K54 A;  4KZ4 A;  4OQ0 A;  4R1G A;  5FI2 A;  2XDM A;  3Q82 A;  4Y0U A;  1BSG A;  2G2W A;  3HUO A;  1FCM A;  4OOM A;  4WM9 A;  2ZC5 B;  5FAS A;  5I94 A;  1AXB A;  4WMC A;  4Y0O A;  3G2Z A;  4QY6 A;  3SS4 A;  5F1F A;  2Y2H A;  3O86 A;  4QD4 A;  1W8Q A;  1FCN A;  2OLV A;  4MBH A;  3W4O A;  1ERO A;  2RCX A;  4OON A;  4PM6 A;  3ZVT A;  2BLS A;  4EBP A;  4RVA A;  3V39 A;  5TGF A;  4IBR A;  1JTD A;  1K54 C;  1E3U A;  1YMX A;  4JXW A;  3PAE A;  1OME A;  3EQU A;  1HD8 A;  1ONG A;  4PM8 A;  5FAP A;  3UE0 A;  1I5Q A;  3PBO A;  3A3D A;  3ISG A;  3RJU A;  3MKE A;  3OC2 A;  2HP6 A;  3Q7V A;  4KZ5 A;  3V50 A;  2WGI A;  3HUN A;  4MLL A;  2A3U A;  1NZU A;  1KDW A;  5AQA A;  5EVL A;  4E3I A;  3VOY A;  4KZ6 A;  3MKF A;  4IVI A;  1RGY A;  4LCL A;  2OSU A;  3IF6 B;  1Y54 A;  1KE0 A;  1FSY A;  4S2N A;  4GD6 A;  1DJA A;  1LL5 A;  1K6R A;  4N9L A;  5CHJ A;  5EPH A;  1G68 A;  4IVK A;  4RX2 A;  1IYP A;  3PBQ A;  1TEM A;  3UPO A;  1WYB A;  4XUX A;  4XXR A;  3BRM A;  4ZBE A;  3WS0 A;  1SCW A;  1MBL A;  2WGW B;  1YMS A;  5EEC A;  3EQV A;  1M6K A;  1L0D A;  2QZ6 A;  3NDG A;  3VMA A;  1I2S A;  3IQA A;  3A3E A;  1IEL A;  2ZMA A;  3BEB A;  2J8Y A;  5GHY A;  3UDI A;  2R9X A;  4OPY A;  3ZVW A;  3M6H A;  1PWC A;  2Y2Q A;  2ZC4 B;  2Q9M A;  4N1X A;  4ZJ3 A;  4EV4 A;  1HTZ A;  1YLW A;  3WS1 A;  3ZG8 B;  4Y0T A;  5A93 A;  4Z9Q A;  4PM5 A;  4S2N C;  3B3X A;  2WKI A;  2Y2I A;  3LCE A;  4OLG A;  2IWB A;  2WAF A;  3PTE A;  3W4P A;  1KE3 A;  3SH9 A;  3M2J A;  1NYM A;  3Q7Z A;  1PWD A;  2H0Y A;  1O07 A;  2Y59 A;  1BZA A;  3FKV A;  4LCM A;  2EFU A;  2WGV A;  5FQ9 A;  4O7D A;  2Y2K A;  4OPR A;  1L2S A;  4ZJ2 A;  1O7E A;  3NI9 A;  5CED A;  1IYS A;  1CEG A;  1K4F A;  4A5R A;  4DE2 A;  4KQO A;  4UAA A;  1N4O A;  3P09 A;  4QHC A;  4WEL A;  2ZQA A;  1VM1 A;  5E2H A;  3UY6 A;  3P98 A;  4KG2 A;  2VGK A;  1MWT A;  1PZO A;  1BLH A;  1XKZ A;  1YLJ A;  3ZHH A;  3ITB A;  2Y2G A;  4R4R A;  3VP1 A;  3I7J A;  4R3B A;  1WE4 A;  5L2F A;  2V1Z A;  4C3Q A;  3BYD A;  1ERQ A;  4P0M A;  1K38 A;  1NZO A;  5FQM A;  2EX9 A;  2XH9 A;  5AQB A;  2XFS A;  2XQZ A;  5E43 A;  5M19 A;  5DF7 A;  1K56 A;  2G2U A;  2XEP A;  1ZG4 A;  3FZC A;  4DE3 A;  4DXB A;  1BLS A;  1CEF A;  1JTG A;  4JXS A;  3SS3 A;  3C7U A;  1ESI A;  5EVI D;  3Q7V B;  5AQ7 A;  5CTN A;  3V3R A;  1GHI A;  5J8X A;  1Z6F A;  2XK1 A;  2FFY A;  1W5D A;  4EUZ A;  1K57 A;  1S0W A;  2J9O A;  3WRT A;  3HLW A;  4BLM A;  1ES3 A;  1NYY A;  2CC1 A;  5CTM A;  5HW3 A;  4OLD A;  3E2K A;  1YLP A;  3N8R A;  2Y55 A;  4DE1 A;  3FV7 A;  2ZM2 A;  4BQM A;  4K91 A;  4HEF A;  1N9B A;  3SH7 A;  4KEN B;  4R23 A;  3NIA A;  3HLD A;  2PU2 A;  2EXA A;  2WZZ A;  2XD1 A;  4JXV A;  4LV2 A;  1KGF A;  5DTT A;  1FR6 A;  1CI9 A;  3MZF A;  1JVJ A;  3MZD A;  2PBY A;  4WBG A;  2EXB A;  5CGX A;  4OPZ A;  4U0T A;  1IYO A;  5HAQ A;  3ITA A;  5TFQ A;  3IWO A;  4HBU A;  2Z2L B;  5F83 A;  3RXX A;  2A49 A;  5CEC A;  2HP5 A;  3UPP A;  1K25 A;  4KQQ A;  5F82 A;  1MWU A;  2B5R A;  3HLF A;  3M6B A;  4RYE A;  3A3F A;  1DJB A;  4BJP A;  2ZC6 B;  3GMW A;  2X71 A;  1ERM A;  1K4E A;  1BTL A;  4Y7P A;  3AGE A;  4JXG A;  2Q9N A;  2ZQ7 A;  4YIN A;  3CJM A;  1KDS A;  3PAG A;  1ZKJ A;  4KG6 A;  3VP4 A;  1MY8 A;  3IXD A;  5U47 A;  4EBN A;  5JYP A;  1ZC2 A;  5JYO A;  3V5M A;  4FD8 A;  4OPQ A;  3PBN A;  3VSK A;  4NET A;  4B4Z A;  4BD0 A;  4F94 A;  2WKH A;  3G4P A;  4MBF A;  5CXW A;  4WZ5 A;  2WUQ A;  5HL1 A;  4DF6 A;  1NJ4 A;  4XUZ A;  1VQQ A;  1FCO A;  3IF5 A;  1CI8 A;  3MBZ A;  1PYY A;  2GDN A;  2JE5 A;  1CK3 A;  1C3B A;  2EX8 A;  3HRE A;  4N9K A;  4K0X A;  4MBK A;  3C4P A;  2Y2L A;  2ZLY A;  4E3K A;  4UA9 A;  1PW8 A;  1GA9 A;  1KE4 A;  2WZX A;  3VFH A;  4X68 A;  4UA6 A;  3N8S A;  3LO7 A;  4IBX A;  1BLC A;  5G18 A;  3FWL A;  4GNU A;  5GLD A;  2ZC7 A;  4DE0 A;  1MXO A;  3Q07 A;  3BFC A;  4WZ5 C;  5GHZ A;  4JBF A;  5EUA A;  3DTM A;  5FQQ A;  1XA7 A;  1FOF A;  1QMF A;  3E2L A;  1EWZ A;  4ZDX A;  4X53 A;  1MWR A;  5CHU A;  1U60 A;  1XPB A;  4EQI A;  4X6T A;  4OH0 A;  2C6W B;  3HLG A;  2P9V B;  5FAT A;  4FH4 A;  1TDG A;  4KG5 A;  4X55 A;  5M1A A;  3UE3 A;  4QJG A;  5IHV A;  4PMA A;  3LY4 A;  2I72 A;  3QHY A;  4R3J A;  3BLM A;  4WZ4 A;  2Y4A A;  2ZM8 A;  1FSW A;  3G35 A;  5GL9 A;  1PZP A;  4U3T A;  3A3J A;  2H10 A;  1I2W A;  2WYX A;  3G2Y A;  4S2J A;  2HDR A;  3JYI A;  3IWI A;  1S6R A;  4ID4 A;  2UWX A;  3PBR A;  1DY6 A;  5HX9 A;  2X01 A;  1GA0 A;  2WKE A;  3IHB A;  3GTC A;  4KQR A;  3IHA A;  1IKI A;  3RXW A;  5A92 A;  1ES4 A;  2OV5 A;  4WYY A;  4PM9 A;  2BG1 A;  2ZM0 A;  5HAR A;  1K6S A;  2DNS A;  4Q8I A;  1Q2Q A;  3UPN A;  1TDL A;  5FI7 A;  2ZJ9 A;  1TVF A;  1YLT A;  3VP3 A;  1ES2 A;  3NY4 A;  1ZG6 A;  4OQG A;  2HP9 A;  4FSF A;  5F1G A;  3CZD A;  5HAI A;  4EBL A;  2PU4 A;  5M18 A;  3QNC A;  1ES5 A;  2WK0 A;  5GLC A;  5EOE A;  4ZTK A;  1YQS A;  1QME A;  3BFD A;  1MWS A;  5HFO A;  5EOO A;  5DF8 A;  4DDY A;  3NC8 A;  3TSG A;  3UO9 A;  2ZD8 A;  2JBF A;  1IYQ A;  1IEM A;  3CG5 A;  3SS5 A;  1EI5 A;  5DF9 A;  5GLB A;  3VSL A;  5KSC A;  3C7V A;  4OQI A;  3ZDJ A;  3UDF A;  3D4F A;  3C4O A;  5FSR A;  1PI5 A;  3OCL A;  1BLP A;  1LLB A;  3PBT A;  5GLA A;  1L0G A;  1SKF A;  3HLE A;  5EVI A;  3WS2 A;  2HDU A;  3NCK A;  1RGZ A;  1H8Y A;  2H5S A;  1PW1 A;  2IWD A;  3CMZ A;  1G6A A;  3G30 A;  4KZ3 A;  4BD1 A;  3G32 A;  1PI4 A;  1XGJ A;  3Q1F A;  2E8I A;  1IKG A;  3G34 A;  3VP0 A;  4UHU A;  1SDN A;  4KZ9 A;  3ZCZ A;  4LV3 A;  4JF6 A;  4LV0 A;  3Q81 A;  3A3I A;  3G31 A;  1MPL A;  3IF6 C;  2WAE A;  4S2K A;  4E3L A;  1XGI A;  3VP2 A;  5EVI C;  4S2M A;  3IXG A;  1KVL A;  1H8Z A;  2ZQ8 A;  4R4S A;  3MZE A;  2DRW A;  1Q2P A;  3OZH A;  4WMC D;  1HZO A;  4L0L A;  1W79 A;  3HBR A;  4UA7 A;  1E25 A;  3SOI A;  2Y2J A;  1FR1 A;  3O87 A;  1GHM A;  1XA1 A;  2EX2 A;  3TG9 A;  4ZAM A;  4BL3 A;  3DWK A;  4C6Y A;  3O88 A;  3OCN A;  1W7F A;  2ZQ9 A;  4GD8 A;  1E3U D;  2J7V A;  3IT9 A;  3HUM A;  4N1H A;  4KZB A;  1ESU A;  3IH8 A;  4GOG A;  5CGS A;  1W8Y A;  5FDH A;  2IWC A;  1JWZ A;  3UDX A;  3IXH A;  3C5A A;  3WWX A;  1BT5 A;  3M2K A;  3UE1 A;  3VFF A;  3ZFZ A;  3BLS A;  4M3K A;  4EWF A;  4GB7 A;  1H5X A;  3BM6 A;  4JPM A;  4P87 A;  2Y2P A;  4LEN A;  4BEN A;  4X56 A;  4B88 A;  1RP5 A;  4X69 A;  1BUE A;  3HVF A;  2HPB A;  4FCF A;  4HES A;  3ZG9 B;  4PPR A;  1JWV A;  4ZJ1 A;  3N8L A;  3N6I A;  3TOI A;  4CPK A;  5E2E A;  3IWQ A;  3FKW A;  1RCJ A;  1GCE A;  5FQK A;  2R9W A;  3BFE A;  3BFF A;  2V2F F;  2QPN A;  3VOZ A;  3ZG5 A;  1PWG A;  5CER A;  2C5W B;  5DVA A;  2H0T A;  3OPL A;  5TR7 A;  4E6W A;  5A90 A;  3OPH A;  3WS4 A;  3GVB A;  4GDN A;  3MXR A;  1M40 A;  2Z2M B;  2XF3 A;  5EE8 A;  5EVI B;  3ZG0 A;  1ALQ A;  4U0X A;  3ZNY A;  2HDS A;  2V20 A;  4GN2 A;  3S22 A;  4QY5 A;  4GKU A;  1NY0 A;  4S2I A;  5HAP A;  4OQH A;  4E3N A;  2JC7 A;  2XFT A;  2Y2N A;  4LV1 A;  5FQI A;  3S4X A;  4QU3 A;  3W4Q A;  4DXC A;  1NXY A;  2QMI A;  5DTK A;  5E2F A;  1DJC A;  2X02 A;  4R0Q A;  4CJN A;  4K0W A;  2OLU A;  2J9P A;  4DKI A;  4P6B A;  4OP5 A;  5FAO A;  2DCF A;  4C75 A;  4N92 A;  1BUL A;  3IXB A;  1XP4 A;  4B4X A;  4S2O A;  5CHM A;  2JCH A;  2ZQC A;  1KGG A;  3GQZ A;  2Y2O A;  3OPP A;  4KZA A;  1XXM A;  5CRF A;  3W8K A;  2VGJ A;  3IH9 A;  5FQJ A;  3UN7 A;  4E3M A;  3GRJ A;  4QB8 A;  1YLZ A;  2XLN A;  4JLF A;  4OVD A;  4S2P A;  4D2O A;  4DRT A;  1JWP A;  4KZ8 A;  3BEC A;  5DTS A;  2Y2M A;  1ONH A;  1GHP A;  3HLC A;  2EFX A;  4P85 A;  3LY3 A;  3ZG7 B;  5CEB A;  3SH8 A;  4GDB A;  4OOY A;  3UNW A;  4WEJ A;  1K56 D;  5CGW A;  4IED A;  4MEZ A;  4MNR A;  1LI0 A;  4GZB A;  4OKP A;  5KSH A;  2RL3 A;  2Y91 A;  1L0E A;  5E2G A;  2XD5 A;  4JKT A;  1WYC A;  4BL2 A;  5A91 A;  5BOH A;  3ZGA B;  3BFG A;  3V3S A;  1MKI A;  2EX6 A;  1FQG A;  3HL9 A;  3N7W A;  1NRF A;  3WRZ A;  3N4I A;  2HDQ A;  3WS5 A;  1L0F A;  4KZ7 A;  3LEZ A;  3S1Y A;  3IF6 A;  2FFF B;  3NDE A;  4OP8 A;  3DWZ A;  1LI9 A;  1K55 A;  3GR2 A;  1YM1 A;  4FH2 A;  4RA7 A;  2XR0 A;  5D3O A;  1LL9 A;  1PIO A;  3O3V A;  3QNB A;  2WGW A;  3MFD A;  1E4D A;  4S2L A;  1LHY A;  5FA7 A;  4E3J A;  1J9M A;  4PM7 A;  5AQ9 A;  1SDE A;  3PBS A;  5FAQ A;  1YLY A;  3GV9 A;  5KZH A;  3ZNT A;  2ZQD A;  4HBT A;  1KVM A;  1HVB A;  5KMW A;  5FI6 A;  2WAD A;  1K55 C;  2XGN A;  4DDS A;  3AGF A;  2P74 A;  2P9V A;  1XX2 A;  3GSG A;  3DW0 A;  4JF4 A;  4WEK A;  3OPR A;  3HLB A;  1K57 C;  3MXS A;  4H8R A;  1SHV A; 
#chains in the Genus database with same CATH topology
 4RX3 A;  4YFM A;  3AGD A;  1KOU A;  4OOL A;  5FEF A;  2L4R A;  4KZ4 A;  2W3F A;  4OQ0 A;  4R1G A;  2G2W A;  3HUO A;  2LB5 A;  4OOM A;  4WM9 A;  4WMC A;  4FUW A;  4EET B;  1STZ A;  1FCN A;  4MBH A;  3W4O A;  1Y4O A;  3V39 A;  1VEU B;  3W2Z A;  3CPT A;  3PAE A;  5F69 A;  1OME A;  4MN5 A;  5FAP A;  3UE0 A;  3HUN A;  5AQA A;  1KDW A;  5EVL A;  3VOY A;  3IF6 B;  1KE0 A;  1IFQ A;  1LL5 A;  2O99 A;  4N9L A;  1VB6 A;  4RX2 A;  3PXP A;  3PBQ A;  1TEM A;  3UB8 A;  1WYB A;  4XUX A;  1MBL A;  2WGW B;  3EQV A;  3ZVW A;  2J8Y A;  1PWC A;  4N1X A;  4CLC D;  3WS1 A;  4Z9Q A;  4PM5 A;  2WKI A;  2Y2I A;  3L7H A;  2VK3 A;  1NLZ A;  1KE3 A;  4HOI A;  4KUO A;  5TJJ A;  3R7W B;  3DTI A;  2QJ5 A;  1BZA A;  2W3D A;  1SKO B;  4O7D A;  2BAS A;  2Y2K A;  3EGD C;  4Z1W A;  4E04 A;  3EEA A;  3P09 A;  4BBU A;  4CLC E;  1JNU A;  4KG2 A;  2YKH A;  1PRQ A;  4WN5 A;  2XRO A;  1YLJ A;  5DFY A;  2Y2G A;  4R4R A;  3VP1 A;  3T4O A;  1G5U A;  5L2F A;  4C3Q A;  1ERQ A;  1K38 A;  5FQM A;  5AQB A;  5DF7 A;  1K56 A;  2G2U A;  4UQI S;  3V67 A;  1S4R A;  4DXB A;  4JXS A;  3SS3 A;  4II7 A;  1K57 A;  2JHE A;  4BLM A;  2JN7 A;  5EV0 A;  3E2K A;  5DJU A;  1YLP A;  3N8R A;  3FV7 A;  2ZM2 A;  4BQM A;  4X1L A;  2PU2 A;  2XD1 A;  4JXV A;  5I5L A;  3NOP C;  1KGF A;  5DTT A;  2V8F A;  3HCY A;  4KQD A;  2EXB A;  4U0T A;  5TFQ A;  3IWO A;  5F83 A;  3UB7 A;  5CEC A;  1S66 L;  5IS1 A;  5F82 A;  2B5R A;  3HLF A;  3M6B A;  1ODV A;  3IX3 A;  3A3F A;  3MQ0 A;  5FEG A;  3E4P A;  3P01 A;  1ZKJ A;  2FZ0 A;  1MY8 A;  3ZYT A;  4EBN A;  4Y13 A;  3V5M A;  2A24 B;  4BD0 A;  2WKH A;  3G4P A;  4O0P A;  3OBF A;  2WUQ A;  4WZ5 A;  5HL1 A;  3T50 A;  2GDN A;  3LID A;  3G6O A;  1C3B A;  2VLG A;  4K0X A;  4MBK A;  2ZLY A;  4UA9 A;  1KE4 A;  2PD8 A;  3VFH A;  2WKR A;  2GJ3 A;  2B18 A;  4DE0 A;  1J3W A;  5GHZ A;  3DTK A;  2VV8 A;  4MN6 A;  4GLQ A;  3DTM A;  4P6Z S;  1XA7 A;  4I5S A;  3LR3 A;  1L3L A;  3HJK A;  4X6T A;  4FH4 A;  4QJG A;  3UE3 A;  4PMA A;  2Y4A A;  3E0Y A;  1N9L A;  2H10 A;  3JYI A;  1LSW A;  4ID4 A;  4X1M A;  4GHI B;  1GA0 A;  3VE4 A;  3GTC A;  4EW7 A;  5A92 A;  2JKF A;  5HAR A;  2ZM0 A;  1TDL A;  5FI7 A;  4CLC C;  4EUV A;  3VP3 A;  1ZG6 A;  3MSH A;  2QYB A;  4EES A;  3IBR A;  2PU4 A;  4LFU A;  5M18 A;  1DP8 A;  1LL8 A;  4ZTK A;  3BFD A;  1MWS A;  5HFO A;  5EOO A;  4DDY A;  3OOV A;  1H3Q A;  4G3V A;  1IEM A;  3CAX A;  5DF9 A;  5GLB A;  3CUE A;  3ZDJ A;  3KSF A;  1L0G A;  5GLA A;  4WLA A;  3G32 A;  1XGJ A;  2WKP A;  1T19 A;  3BW6 A;  1SDN A;  3ZCZ A;  4HP9 A;  4LV0 A;  3HJI A;  3IF6 C;  1TD5 A;  2OWJ A;  4E3L A;  1Z09 A;  1H8Z A;  2PT7 A;  2ZQ8 A;  2HV1 A;  1Q2P A;  3QP1 A;  3F1P A;  4UA7 A;  2Y2J A;  1GHM A;  1N9O A;  4WL9 A;  1P9W A;  4ZAM A;  4C6Y A;  3O88 A;  5IT5 A;  2KX6 A;  5AVF A;  2EWV A;  4GD8 A;  2J7V A;  5A8B A;  3HUM A;  3MFX A;  3NHQ A;  1ESU A;  4KZB A;  2IWC A;  4GW9 A;  4H6J B;  1BT5 A;  4ETZ A;  3M2K A;  4EWF A;  1H5X A;  2W3H A;  2O9A A;  5G4Z A;  4BEN A;  4G3W A;  2QHK A;  4FCF A;  4HES A;  1JWV A;  3FKW A;  1GCE A;  2R9W A;  3BFE A;  3OPH A;  2JKG A;  3MXR A;  4DJ3 A;  1OTD A;  1S67 L;  4U0X A;  2HJ9 C;  3CHW P;  3S22 A;  4OQH A;  2XFT A;  3W4Q A;  2QMI A;  4K0W A;  1FIK A;  3T4Q A;  2OOL A;  3SW1 A;  4S2O A;  2INW A;  2ZQC A;  3GQZ A;  2Y2O A;  5HWV A;  2VGJ A;  3IH9 A;  5FQJ A;  3GRJ A;  4QB8 A;  1YLZ A;  2ACG A;  4S2P A;  4D2O A;  3BEC A;  2EFX A;  4MN7 A;  5L09 A;  4EEU A;  1V9Y A;  4IED A;  4MEZ A;  2XD5 A;  3T4T A;  2W3E A;  5A91 A;  4Y3I A;  1MKI A;  1FQG A;  2JKT I;  1L0F A;  3S1Y A;  3QP8 A;  1P97 A;  4OP8 A;  1K55 A;  3GR2 A;  1YM1 A;  4RA7 A;  1PIO A;  2AVX A;  1E4D A;  1FIL A;  2KDK A;  5AQ9 A;  3PBS A;  3S7P A;  1OTB A;  5AVE A;  3UB9 A;  2ZQD A;  5HPI A;  2Z6D A;  3GSG A;  3DW0 A;  2PDR A;  4H8R A;  4ETX A;  1YT4 A;  3OLO A;  4GJ4 A;  4JF5 A;  4LRY C;  3FYZ A;  3LFV A;  4HH3 A;  2XDM A;  4Y0U A;  1BSG A;  2ZMV A;  5I94 A;  2ZC5 B;  1MZU A;  3G2Z A;  4QY6 A;  3TRC A;  2Y2H A;  2NUP C;  3ZVT A;  2Y79 A;  4EBP A;  2RCX A;  2BLS A;  5TGF A;  1JTD A;  1K54 C;  1E3U A;  2V0U A;  1YMX A;  5EVE A;  4X25 A;  3PBO A;  3ISG A;  3RJU A;  3Q7V A;  2HP6 A;  5HD5 A;  3JVU A;  4E3I A;  4LCL A;  4IVI A;  2ZOI A;  5TBM A;  1Y54 A;  1DJA A;  2O9C A;  1K6R A;  5EPH A;  1G68 A;  2W0N A;  1SCW A;  4L9F A;  3C38 A;  1X0O A;  5EEC A;  2QZ6 A;  3VMA A;  3NDG A;  1YSQ A;  3A3E A;  3IQA A;  3UDI A;  2Q9M A;  2PRF A;  4NKP A;  4NXG A;  4EV4 A;  1YLW A;  3ZG8 B;  3B3X A;  2PAV P;  3LCE A;  3IX4 A;  2V0W A;  2XA7 S;  3F1N B;  4QPR A;  1D1J A;  3Q7Z A;  3BY9 A;  2Y59 A;  4LCM A;  5FQ9 A;  3T1Q B;  2EFU A;  2WGV A;  4OPR A;  1L2S A;  5DKL A;  3NOU C;  1IYS A;  1K4F A;  4UAA A;  4IUK A;  2IA2 A;  4QHC A;  1DRM A;  1VM1 A;  2VGK A;  2VA0 A;  1YPR A;  1PZO A;  1BLH A;  2P7J A;  4P0M A;  2PYR A;  1NZO A;  2XFS A;  3MMH A;  3CPT B;  3C7U A;  5EVI D;  5AQ7 A;  5J8X A;  4HQA A;  1OT9 A;  2A2L A;  1ES3 A;  2R78 A;  3D9Y A;  3LIB A;  4WUJ A;  1ACF A;  1N9B A;  2HF6 A;  3SH7 A;  4KEN B;  3HLD A;  2WZZ A;  3O5Y A;  1FR6 A;  1JVJ A;  1UWN X;  2QJ7 A;  4HJ6 A;  4HBU A;  2Z2L B;  5EFW A;  3T12 B;  2VEA A;  4BJP A;  3GMW A;  2X71 A;  1K4E A;  4LPZ A;  4Y7P A;  2JKT M;  2W27 A;  2Q9N A;  2ZQ7 A;  2W1T A;  4YIN A;  3UB5 P;  4OPQ A;  3PBN A;  4B4Z A;  4MBF A;  5CXW A;  3JVV A;  4XUZ A;  1VQQ A;  1FCO A;  3IF5 A;  4YWZ A;  4I3A A;  4F3L A;  1CF0 A;  1VET A;  3C4P A;  2H28 A;  2Y2L A;  4E3K A;  1PW8 A;  1GA9 A;  2WZX A;  3FC7 A;  4X68 A;  3FWL A;  4GNU A;  1UWP X;  2J3W A;  5EUA A;  5F5Y A;  1QMF A;  5HDD A;  1U60 A;  2C6W B;  3HLG A;  2P9V B;  4PAU A;  5FAT A;  4KG5 A;  5IHV A;  4PKY A;  2I72 A;  4R3J A;  3GEC A;  4CLC A;  4U3T A;  3A3J A;  3RFB A;  1I2W A;  2HDR A;  4LGW A;  3BWL A;  1S6R A;  2D01 A;  2UWX A;  1DY6 A;  2VGL M;  5HX9 A;  4B93 A;  3IHB A;  3IHA A;  1IKI A;  1ES4 A;  1S1Z A;  1YSP A;  2QKP A;  1K6S A;  5KIZ A;  1Q2Q A;  4LLO B;  3VOL A;  3QP5 A;  3MR0 A;  2W3G A;  4O01 A;  3LR5 A;  4FSF A;  5F1G A;  3CZD A;  2VJW A;  4Y17 A;  3QNC A;  1VEU A;  5EOE A;  1F5M A;  4M4X A;  3IS2 B;  2ZD8 A;  3CG5 A;  1EI5 A;  3VSL A;  5KSC A;  2OAP 1;  4ME4 A;  4OQI A;  3C4O A;  1PI5 A;  1LLB A;  3PBT A;  3VV4 A;  1SKF A;  2P04 A;  3NCK A;  4FOF A;  1RGZ A;  1H8Y A;  2IWD A;  3CMZ A;  3G30 A;  4BD1 A;  4CQH A;  4KZ9 A;  4JF6 A;  3Q81 A;  5F68 A;  1XGI A;  5EVI C;  1KVL A;  4HNB A;  3R7W A;  1OPX A;  1FR1 A;  3TG9 A;  4BL3 A;  3OCN A;  2HGV A;  4PKY G;  3MJQ A;  3IT9 A;  4N1H A;  2PBD P;  5CGS A;  5FDH A;  1JWZ A;  3UDX A;  3C5A A;  1NRJ A;  1N9N A;  3QP6 A;  4HP4 A;  3T4L A;  3UE1 A;  3VFF A;  3ZFZ A;  3BLS A;  2EA9 A;  3ULF A;  1D06 A;  1RP5 A;  1NWZ A;  4PPR A;  4CPK A;  2V2F F;  2QPN A;  5CER A;  2H0T A;  3OPL A;  4GDN A;  3MF0 A;  5EE8 A;  3BQA A;  4HIA A;  1ALQ A;  2V20 A;  5HAP A;  3K2N A;  2JC7 A;  3S4X A;  4NEE D;  5FQI A;  1NXY A;  5DTK A;  5E2F A;  2X02 A;  4PHT A;  3F1O A;  4B4X A;  1T1B A;  2GX5 A;  5CHM A;  4ARZ B;  2JCH A;  1KGG A;  3LI8 A;  2Y8H A;  4KZA A;  1XXM A;  3T4S A;  1A0K A;  3F1P B;  4E3M A;  1H8M A;  2XLN A;  4JLF A;  1YAX A;  5HDS A;  5DTS A;  5HZH A;  1ONH A;  3ZG7 B;  3SH8 A;  4GDB A;  4OOY A;  4WEJ A;  3LIC A;  3ICY A;  5KSH A;  4GZB A;  2RL3 A;  2Y91 A;  1L0E A;  5E2G A;  3MQO A;  4G3K A;  4BL2 A;  3ZGA B;  3BFG A;  3V3S A;  3D72 A;  3WS5 A;  1TS8 A;  2PR5 A;  3UME A;  3DWZ A;  1LI9 A;  2UV0 E;  2XR0 A;  1H0M A;  3D3O A;  3MFD A;  4S2L A;  5FA7 A;  1XJ3 A;  1CQA A;  5KZH A;  1KVM A;  3DBA A;  5KMW A;  2XGN A;  3H82 A;  4DDS A;  4NXF A;  1XX2 A;  1DP9 A;  3HLB A;  1K57 C;  3A0S A;  4E3O A;  3NBL A;  2ZC3 B;  5C5K A;  3KYQ A;  2PD7 A;  5GHX A;  1K54 A;  5CX7 A;  4R3A A;  2V9A A;  3EEH A;  5FAS A;  3SS4 A;  5F1F A;  3O86 A;  1XFQ A;  1Y28 A;  4QD4 A;  1ERO A;  4BBV A;  3K3D A;  3EQU A;  1HD8 A;  4PM8 A;  2J80 A;  1I5Q A;  1D7E A;  3OC2 A;  4KZ5 A;  2WGI A;  2A3U A;  3GDI A;  3MKF A;  1RGY A;  2OSU A;  4IVK A;  1IYP A;  3UPO A;  3WS0 A;  1YMS A;  1M6K A;  1L0D A;  2D02 A;  3LR4 A;  1I2S A;  2I9V A;  3BEB A;  5GHY A;  3M6H A;  2Y2Q A;  4LRZ E;  5L8M A;  4ZJ3 A;  4Y0T A;  4S2N C;  4BMW A;  2IWB A;  2WAF A;  3PTE A;  3W4P A;  3SH9 A;  3M2J A;  3H9W A;  1PWD A;  2H0Y A;  4ZJ2 A;  1O7E A;  2K2N A;  4DE2 A;  4KQO A;  1N4O A;  2PR6 A;  4WEL A;  3CWF A;  3UY6 A;  3P98 A;  5HSQ A;  2OAQ 1;  3ITB A;  3I7J A;  4R3B A;  1WE4 A;  4H6J A;  2V1Z A;  3BYD A;  2EX9 A;  2XH9 A;  2QWS A;  2XQZ A;  1S4S A;  2NUT C;  3FZC A;  4DE3 A;  1BLS A;  1JTG A;  1ESI A;  4ESP A;  2M1C A;  3Q7V B;  5CTN A;  3V3R A;  1Z6F A;  2XK1 A;  2GNX A;  1W5D A;  1S0W A;  2J9O A;  4O8G A;  3HLW A;  3WRT A;  5J4E A;  2CC1 A;  5CTM A;  3KYE A;  1HLU P;  2Y55 A;  4DE1 A;  2M7V A;  4K91 A;  1G6O A;  3MXQ A;  4I3J A;  3NIA A;  2EXA A;  5F6A A;  4UQI M;  5L10 A;  1CI9 A;  3MZD A;  1T18 A;  4BBT A;  2PBY A;  5CGX A;  4OPZ A;  5J3W A;  5HAQ A;  3UPP A;  1K25 A;  4NXE A;  3BQ8 A;  4KQQ A;  2P08 A;  3T1S A;  1DJB A;  1ERM A;  4L9G A;  3AGE A;  4JXG A;  4KUK A;  1KDS A;  1OJ5 A;  2ZL1 A;  3IXD A;  5U47 A;  5IU1 A;  5JYP A;  1ZC2 A;  5JYO A;  3IBJ A;  3VSK A;  4NET A;  4HJ4 A;  3LEQ A;  4DF6 A;  1NJ4 A;  2EWW A;  5DFX A;  1CI8 A;  3MBZ A;  1PYY A;  2JE5 A;  1F9I A;  4N9K A;  3HRE A;  4DMZ A;  3LO7 A;  1TS6 A;  3H7W B;  5GLD A;  2ZC7 A;  3Q07 A;  4IHQ A;  1W63 M;  5FQQ A;  2XSS A;  1FOF A;  1TS7 A;  3E2L A;  1EWZ A;  4ZDX A;  3PHY A;  4X53 A;  1MWR A;  4X55 A;  3KSH A;  3L9K A;  4R38 A;  1FSW A;  3G35 A;  1F98 A;  3IX8 A;  2WYX A;  4S2J A;  4GS9 A;  4MCW A;  4P6Z M;  4KQR A;  1XJ2 A;  5HWW A;  2WKQ A;  4LRX C;  4WYY A;  4PM9 A;  2DNS A;  4Q8I A;  2ZJ9 A;  1YLT A;  2VX8 A;  3VE3 A;  2V8C A;  4OQG A;  2HP9 A;  5HAI A;  1ES5 A;  1OTE A;  1XFN A;  2WK0 A;  1YQS A;  1T1A A;  4HI4 A;  2JBF A;  3B33 A;  1IYQ A;  1VET B;  4I38 A;  3UDF A;  3D4F A;  5FSR A;  3OCL A;  1BLP A;  1MC0 A;  5EVI A;  3WS2 A;  1VHM A;  4DJ2 A;  3DAV A;  4L9E A;  3KSG A;  1IKG A;  3VP0 A;  4UHU A;  3UB6 A;  3G31 A;  1MPL A;  3VP2 A;  3R4K A;  3IXG A;  3MZE A;  4EEP A;  3S7O A;  2DRW A;  3OZH A;  5LBR A;  4CLC B;  4WMC D;  4L0L A;  3B42 A;  3HBR A;  4Y2F A;  3O87 A;  2BTF P;  2EX2 A;  3DWK A;  3NJA A;  1W7F A;  3LI9 A;  4GOG A;  1W8Y A;  2CMN A;  1V9Z A;  1BYW A;  4M3K A;  4GB7 A;  3BM6 A;  4P87 A;  4JPM A;  3U2A A;  2B02 A;  3E98 A;  4X69 A;  1BUE A;  5HD3 A;  3T4K A;  4ZJ1 A;  3N8L A;  2HZ5 A;  3N6I A;  5FL3 A;  3TOI A;  3IWQ A;  5FQK A;  3C30 A;  3BFF A;  4B9O A;  3VOZ A;  1PWG A;  2C5W B;  5DVA A;  5A90 A;  5TR7 A;  4E6W A;  3FPW A;  3WS4 A;  1M40 A;  1DP6 A;  2XF3 A;  3ZG0 A;  3E4Q A;  3ZNY A;  2HDS A;  1LSV A;  4QY5 A;  1NY0 A;  4FTX A;  4XT2 A;  5EM0 A;  4E3N A;  4LV1 A;  2KLI A;  3KSI A;  4QU3 A;  4CJN A;  3NOT C;  1W63 Q;  2J9P A;  3LIF A;  4N92 A;  1BUL A;  4Q0H A;  4WF0 A;  3W8K A;  2ZOH A;  4AFI A;  4HH2 A;  2JKR I;  1EW0 A;  1JWP A;  4KZ8 A;  4QWO A;  1GHP A;  1UGU A;  3HLC A;  4P85 A;  5CEB A;  5HPF A;  3ZQ5 A;  3LYX A;  1K56 D;  4MNR A;  3U4L P;  2GZA A;  2PYP A;  1ZHH B;  5BOH A;  2ZMF A;  2EX6 A;  3N7W A;  1NRF A;  2HDQ A;  4KZ7 A;  3IF6 A;  3LUQ A;  3NDE A;  4IJG A;  4FH2 A;  3A0R A;  1IOU A;  2O0Y A;  1LL9 A;  1PNE A;  3KX0 X;  3O3V A;  4Q0J A;  2WGW A;  3TE8 A;  5DKK A;  2ZBB A;  1J9M A;  4PM7 A;  1SDE A;  1CJF A;  4D60 A;  3ZNT A;  2DMW A;  3QP2 A;  4HBT A;  1HVB A;  2L1M A;  5FI6 A;  1AWI A;  3AGF A;  2P9V A;  4WEK A;  3OPR A;  1PFL A;  3F1O B;  1SKO A;  4E6X A;  4NK3 A;  1KGE A;  4NXB A;  3MS6 A;  3FPV A;  5FI2 A;  3Q82 A;  3C2W A;  1FCM A;  1TS0 A;  1AXB A;  4Y0O A;  1F2K A;  2J3T D;  1W8Q A;  2OLV A;  4PM6 A;  4OON A;  4RVA A;  3NUL A;  4IBR A;  4Q0I A;  4JXW A;  1LT0 A;  1S1Y A;  1ONG A;  1LSX A;  3PYP A;  1T1C A;  3A3D A;  3MKE A;  4Y5F A;  3V50 A;  4MLL A;  2O9B A;  1NZU A;  4KZ6 A;  2K31 A;  4S2N A;  1FSY A;  3IS2 A;  4GD6 A;  5CHJ A;  4XXR A;  3BRM A;  4ZBE A;  4JGR A;  1IEL A;  2ZMA A;  2R9X A;  4OPY A;  3BY8 A;  2ZC4 B;  1K0K A;  1HTZ A;  3A0V A;  5A93 A;  4OLG A;  3H82 B;  3TW8 A;  4JGP A;  3E4O A;  1NYM A;  1O07 A;  3FKV A;  4R6L A;  3NI9 A;  5CED A;  1CEG A;  4A5R A;  5HWT A;  4RQ9 A;  2ZQA A;  1OT6 A;  5E2H A;  1MWT A;  1XKZ A;  2A24 A;  3ZHH A;  1G28 A;  2E8J A;  3P7N A;  3CI6 A;  2XA7 M;  2L0W A;  2VZW A;  5E43 A;  5M19 A;  3KYZ A;  2XEP A;  1ZG4 A;  2VV6 A;  1XJ6 A;  1CEF A;  4HJ3 A;  1GHI A;  2FFY A;  4EUZ A;  3LGO A;  1NYY A;  5HW3 A;  4OLD A;  5FDS A;  3CLO A;  2B95 A;  4HEF A;  2VV7 A;  3LR0 A;  1SZV A;  4R23 A;  2Q0O A;  2JKR M;  4LV2 A;  3MZF A;  1XJ4 A;  4WBG A;  4R70 A;  1IYO A;  4BWI A;  3ITA A;  3RXX A;  2A49 A;  2HP5 A;  3BJN A;  4EU0 A;  4GHI A;  1MWU A;  4RYE A;  4ARZ A;  2ZC6 B;  1BTL A;  3CJM A;  4KG6 A;  3PAG A;  3VP4 A;  2V1A A;  3EOI A;  4DN0 A;  4FD8 A;  2FH5 A;  4F94 A;  3LIE A;  5DJT A;  4JGO A;  4EQ1 A;  1CK3 A;  2EX8 A;  3T1X A;  5K5B A;  4UEY A;  2KOI A;  4UA6 A;  3N8S A;  4IBX A;  1BLC A;  5G18 A;  1NLY A;  1MXO A;  4WZ5 C;  3BFC A;  2VGL S;  2YKF A;  2J3T C;  4JBF A;  4I3I A;  3S7Q A;  5CHU A;  1XPB A;  4EQI A;  4OH0 A;  5M1A A;  1TDG A;  3LY4 A;  4MDZ A;  3QHY A;  3CIT A;  4JGQ A;  2K7S A;  3BLM A;  4WZ4 A;  2ZM8 A;  3PR6 A;  4EXO A;  5GL9 A;  1PZP A;  3G2Y A;  5AJG A;  3IWI A;  3RTY A;  1YKD A;  3PBR A;  3S7N A;  2X01 A;  3MQQ A;  2WKE A;  3RXW A;  2OV5 A;  3SZT A;  2BG1 A;  3UPN A;  1TVF A;  1ES2 A;  1ZTU A;  3NY4 A;  2ZL1 B;  4K08 A;  2HJE A;  3C8C A;  4EBL A;  4I39 A;  5EM1 A;  5GLC A;  1QME A;  1OTA A;  5L07 A;  5TBM B;  5DF8 A;  2Z6C A;  3NC8 A;  3TSG A;  3UO9 A;  3JPU A;  4Y15 A;  3SS5 A;  3B47 A;  3C7V A;  3HLE A;  2HDU A;  2H5S A;  1PW1 A;  1G6A A;  4KZ3 A;  1PI4 A;  3Q1F A;  2E8I A;  1WA9 A;  3G34 A;  4LV3 A;  1OTI A;  4GCZ A;  1TF1 A;  3A3I A;  3CUE C;  2WAE A;  4S2K A;  3FG8 A;  4S2M A;  4R4S A;  2LB9 A;  1GSW A;  1HZO A;  1W79 A;  3RH8 B;  1E25 A;  3SOI A;  1XA1 A;  4GS9 B;  2VKS A;  2ZQ9 A;  4HY8 A;  1E3U D;  4NG2 A;  3K3C A;  3IH8 A;  3IXH A;  3WWX A;  4HHD A;  2Y2P A;  4LEN A;  4X56 A;  4B88 A;  3HVF A;  2HPB A;  3ZG9 B;  5E2E A;  3UMD A;  1GSX A;  1RCJ A;  3ZG5 A;  3UE6 A;  2OWH A;  4YNR A;  4YOF A;  3GVB A;  5HDC A;  2Z2M B;  4EER A;  5HL6 A;  5EVI B;  2PHY A;  4GN2 A;  4GKU A;  4S2I A;  3TJZ C;  2Y2N A;  2V1B A;  4DXC A;  1DJC A;  1OJG A;  4R0Q A;  2MJ6 A;  2OLU A;  4DKI A;  4P6B A;  4OP5 A;  5FAO A;  2DCF A;  4C75 A;  2G7U A;  3IXB A;  1XP4 A;  3LIA A;  4MMN A;  3KO6 A;  5CRF A;  3OPP A;  3UN7 A;  3DTE A;  4OVD A;  2W1T B;  4DRT A;  2Y2M A;  3LY3 A;  3EGX C;  3NEC A;  3UNW A;  2W1R A;  5CGW A;  3T4J A;  3T1R A;  1LI0 A;  4OKP A;  2XRN A;  4JKT A;  1WYC A;  3QP4 A;  3HL9 A;  4F3L B;  3WRZ A;  5G4Y A;  3N4I A;  1P0Z A;  3LEZ A;  5J7E A;  2FFF B;  4IUH A;  1GSV A;  1MKM A;  5D3O A;  3QNB A;  5MC7 A;  1LHY A;  3H7W A;  4E3J A;  5FAQ A;  1YLY A;  3GV9 A;  1P9R A;  4ZRR A;  4XT2 B;  2M7U A;  2WAD A;  1K55 C;  3F1N A;  2P74 A;  3EWK A;  4JF4 A;  3MXS A;  1SHV A; 
#chains in the Genus database with same CATH homology
 4RX3 A;  4YFM A;  4E3O A;  1YT4 A;  3AGD A;  4E6X A;  4NK3 A;  3NBL A;  2ZC3 B;  1KGE A;  4JF5 A;  4OOL A;  3FYZ A;  5GHX A;  1K54 A;  4KZ4 A;  4OQ0 A;  4R1G A;  5FI2 A;  2XDM A;  3Q82 A;  4Y0U A;  1BSG A;  2G2W A;  3HUO A;  1FCM A;  4OOM A;  4WM9 A;  2ZC5 B;  5FAS A;  5I94 A;  1AXB A;  4WMC A;  4Y0O A;  3G2Z A;  4QY6 A;  3SS4 A;  5F1F A;  2Y2H A;  3O86 A;  4QD4 A;  1W8Q A;  1FCN A;  2OLV A;  4MBH A;  3W4O A;  1ERO A;  2RCX A;  4OON A;  4PM6 A;  3ZVT A;  2BLS A;  4EBP A;  4RVA A;  3V39 A;  5TGF A;  4IBR A;  1JTD A;  1K54 C;  1E3U A;  1YMX A;  4JXW A;  3PAE A;  1OME A;  3EQU A;  1HD8 A;  1ONG A;  4PM8 A;  5FAP A;  3UE0 A;  1I5Q A;  3PBO A;  3A3D A;  3ISG A;  3RJU A;  3MKE A;  3OC2 A;  2HP6 A;  3Q7V A;  4KZ5 A;  3V50 A;  2WGI A;  3HUN A;  4MLL A;  2A3U A;  1NZU A;  1KDW A;  5AQA A;  5EVL A;  4E3I A;  3VOY A;  4KZ6 A;  3MKF A;  4IVI A;  1RGY A;  4LCL A;  2OSU A;  3IF6 B;  1Y54 A;  1KE0 A;  1FSY A;  4S2N A;  4GD6 A;  1DJA A;  1LL5 A;  1K6R A;  4N9L A;  5CHJ A;  5EPH A;  1G68 A;  4IVK A;  4RX2 A;  1IYP A;  3PBQ A;  1TEM A;  3UPO A;  1WYB A;  4XUX A;  4XXR A;  3BRM A;  4ZBE A;  3WS0 A;  1SCW A;  1MBL A;  2WGW B;  1YMS A;  5EEC A;  3EQV A;  1M6K A;  1L0D A;  2QZ6 A;  3NDG A;  3VMA A;  1I2S A;  3IQA A;  3A3E A;  1IEL A;  2ZMA A;  3BEB A;  2J8Y A;  5GHY A;  3UDI A;  2R9X A;  4OPY A;  3ZVW A;  3M6H A;  1PWC A;  2Y2Q A;  2ZC4 B;  2Q9M A;  4N1X A;  4ZJ3 A;  4EV4 A;  1HTZ A;  1YLW A;  3WS1 A;  3ZG8 B;  4Y0T A;  5A93 A;  4Z9Q A;  4PM5 A;  4S2N C;  3B3X A;  2WKI A;  2Y2I A;  3LCE A;  4OLG A;  2IWB A;  2WAF A;  3PTE A;  3W4P A;  1KE3 A;  3SH9 A;  3M2J A;  1NYM A;  3Q7Z A;  1PWD A;  2H0Y A;  1O07 A;  2Y59 A;  1BZA A;  3FKV A;  4LCM A;  2EFU A;  2WGV A;  5FQ9 A;  4O7D A;  2Y2K A;  4OPR A;  1L2S A;  4ZJ2 A;  1O7E A;  3NI9 A;  5CED A;  1IYS A;  1CEG A;  1K4F A;  4A5R A;  4DE2 A;  4KQO A;  4UAA A;  1N4O A;  3P09 A;  4QHC A;  4WEL A;  2ZQA A;  1VM1 A;  5E2H A;  3UY6 A;  3P98 A;  4KG2 A;  2VGK A;  1MWT A;  1PZO A;  1BLH A;  1XKZ A;  1YLJ A;  3ZHH A;  3ITB A;  2Y2G A;  4R4R A;  3VP1 A;  3I7J A;  4R3B A;  1WE4 A;  5L2F A;  2V1Z A;  4C3Q A;  3BYD A;  1ERQ A;  4P0M A;  1K38 A;  1NZO A;  5FQM A;  2EX9 A;  2XH9 A;  5AQB A;  2XFS A;  2XQZ A;  5E43 A;  5M19 A;  5DF7 A;  1K56 A;  2G2U A;  2XEP A;  1ZG4 A;  3FZC A;  4DE3 A;  4DXB A;  1BLS A;  1CEF A;  1JTG A;  4JXS A;  3SS3 A;  3C7U A;  1ESI A;  5EVI D;  3Q7V B;  5AQ7 A;  5CTN A;  3V3R A;  1GHI A;  5J8X A;  1Z6F A;  2XK1 A;  2FFY A;  1W5D A;  4EUZ A;  1K57 A;  1S0W A;  2J9O A;  3WRT A;  3HLW A;  4BLM A;  1ES3 A;  1NYY A;  2CC1 A;  5CTM A;  5HW3 A;  4OLD A;  3E2K A;  1YLP A;  3N8R A;  2Y55 A;  4DE1 A;  3FV7 A;  2ZM2 A;  4BQM A;  4K91 A;  4HEF A;  1N9B A;  3SH7 A;  4KEN B;  4R23 A;  3NIA A;  3HLD A;  2PU2 A;  2EXA A;  2WZZ A;  2XD1 A;  4JXV A;  4LV2 A;  1KGF A;  5DTT A;  1FR6 A;  1CI9 A;  3MZF A;  1JVJ A;  3MZD A;  2PBY A;  4WBG A;  2EXB A;  5CGX A;  4OPZ A;  4U0T A;  1IYO A;  5HAQ A;  3ITA A;  5TFQ A;  3IWO A;  4HBU A;  2Z2L B;  5F83 A;  3RXX A;  2A49 A;  5CEC A;  2HP5 A;  3UPP A;  1K25 A;  4KQQ A;  5F82 A;  1MWU A;  2B5R A;  3HLF A;  3M6B A;  4RYE A;  3A3F A;  1DJB A;  4BJP A;  2ZC6 B;  3GMW A;  2X71 A;  1ERM A;  1K4E A;  1BTL A;  4Y7P A;  3AGE A;  4JXG A;  2Q9N A;  2ZQ7 A;  4YIN A;  3CJM A;  1KDS A;  3PAG A;  1ZKJ A;  4KG6 A;  3VP4 A;  1MY8 A;  3IXD A;  5U47 A;  4EBN A;  5JYP A;  1ZC2 A;  5JYO A;  3V5M A;  4FD8 A;  4OPQ A;  3PBN A;  3VSK A;  4NET A;  4B4Z A;  4BD0 A;  4F94 A;  2WKH A;  3G4P A;  4MBF A;  5CXW A;  4WZ5 A;  2WUQ A;  5HL1 A;  4DF6 A;  1NJ4 A;  4XUZ A;  1VQQ A;  1FCO A;  3IF5 A;  1CI8 A;  3MBZ A;  1PYY A;  2GDN A;  2JE5 A;  1CK3 A;  1C3B A;  2EX8 A;  3HRE A;  4N9K A;  4K0X A;  4MBK A;  3C4P A;  2Y2L A;  2ZLY A;  4E3K A;  4UA9 A;  1PW8 A;  1GA9 A;  1KE4 A;  2WZX A;  3VFH A;  4X68 A;  4UA6 A;  3N8S A;  3LO7 A;  4IBX A;  1BLC A;  5G18 A;  3FWL A;  4GNU A;  5GLD A;  2ZC7 A;  4DE0 A;  1MXO A;  3Q07 A;  3BFC A;  4WZ5 C;  5GHZ A;  4JBF A;  5EUA A;  3DTM A;  5FQQ A;  1XA7 A;  1FOF A;  1QMF A;  3E2L A;  1EWZ A;  4ZDX A;  4X53 A;  1MWR A;  5CHU A;  1U60 A;  1XPB A;  4EQI A;  4X6T A;  4OH0 A;  2C6W B;  3HLG A;  2P9V B;  5FAT A;  4FH4 A;  1TDG A;  4KG5 A;  4X55 A;  5M1A A;  3UE3 A;  4QJG A;  5IHV A;  4PMA A;  3LY4 A;  2I72 A;  3QHY A;  4R3J A;  3BLM A;  4WZ4 A;  2Y4A A;  2ZM8 A;  1FSW A;  3G35 A;  5GL9 A;  1PZP A;  4U3T A;  3A3J A;  2H10 A;  1I2W A;  2WYX A;  3G2Y A;  4S2J A;  2HDR A;  3JYI A;  3IWI A;  1S6R A;  4ID4 A;  2UWX A;  3PBR A;  1DY6 A;  5HX9 A;  2X01 A;  1GA0 A;  2WKE A;  3IHB A;  3GTC A;  4KQR A;  3IHA A;  1IKI A;  3RXW A;  5A92 A;  1ES4 A;  2OV5 A;  4WYY A;  4PM9 A;  2BG1 A;  2ZM0 A;  5HAR A;  1K6S A;  2DNS A;  4Q8I A;  1Q2Q A;  3UPN A;  1TDL A;  5FI7 A;  2ZJ9 A;  1TVF A;  1YLT A;  3VP3 A;  1ES2 A;  3NY4 A;  1ZG6 A;  4OQG A;  2HP9 A;  4FSF A;  5F1G A;  3CZD A;  5HAI A;  4EBL A;  2PU4 A;  5M18 A;  3QNC A;  1ES5 A;  2WK0 A;  5GLC A;  5EOE A;  4ZTK A;  1YQS A;  1QME A;  3BFD A;  1MWS A;  5HFO A;  5EOO A;  5DF8 A;  4DDY A;  3NC8 A;  3TSG A;  3UO9 A;  2ZD8 A;  2JBF A;  1IYQ A;  1IEM A;  3CG5 A;  3SS5 A;  1EI5 A;  5DF9 A;  5GLB A;  3VSL A;  5KSC A;  3C7V A;  4OQI A;  3ZDJ A;  3UDF A;  3D4F A;  3C4O A;  5FSR A;  1PI5 A;  3OCL A;  1BLP A;  1LLB A;  3PBT A;  5GLA A;  1L0G A;  1SKF A;  3HLE A;  5EVI A;  3WS2 A;  2HDU A;  3NCK A;  1RGZ A;  1H8Y A;  2H5S A;  1PW1 A;  2IWD A;  3CMZ A;  1G6A A;  3G30 A;  4KZ3 A;  4BD1 A;  3G32 A;  1PI4 A;  1XGJ A;  3Q1F A;  2E8I A;  1IKG A;  3G34 A;  3VP0 A;  4UHU A;  1SDN A;  4KZ9 A;  3ZCZ A;  4LV3 A;  4JF6 A;  4LV0 A;  3Q81 A;  3A3I A;  3G31 A;  1MPL A;  3IF6 C;  2WAE A;  4S2K A;  4E3L A;  1XGI A;  3VP2 A;  5EVI C;  4S2M A;  3IXG A;  1KVL A;  1H8Z A;  2ZQ8 A;  4R4S A;  3MZE A;  2DRW A;  1Q2P A;  3OZH A;  4WMC D;  1HZO A;  4L0L A;  1W79 A;  3HBR A;  4UA7 A;  1E25 A;  3SOI A;  2Y2J A;  1FR1 A;  3O87 A;  1GHM A;  1XA1 A;  2EX2 A;  3TG9 A;  4ZAM A;  4BL3 A;  3DWK A;  4C6Y A;  3O88 A;  3OCN A;  1W7F A;  2ZQ9 A;  4GD8 A;  1E3U D;  2J7V A;  3IT9 A;  3HUM A;  4N1H A;  4KZB A;  1ESU A;  3IH8 A;  4GOG A;  5CGS A;  1W8Y A;  5FDH A;  2IWC A;  1JWZ A;  3UDX A;  3IXH A;  3C5A A;  3WWX A;  1BT5 A;  3M2K A;  3UE1 A;  3VFF A;  3ZFZ A;  3BLS A;  4M3K A;  4EWF A;  4GB7 A;  1H5X A;  3BM6 A;  4JPM A;  4P87 A;  2Y2P A;  4LEN A;  4BEN A;  4X56 A;  4B88 A;  1RP5 A;  4X69 A;  1BUE A;  3HVF A;  2HPB A;  4FCF A;  4HES A;  3ZG9 B;  4PPR A;  1JWV A;  4ZJ1 A;  3N8L A;  3N6I A;  3TOI A;  4CPK A;  5E2E A;  3IWQ A;  3FKW A;  1RCJ A;  1GCE A;  5FQK A;  2R9W A;  3BFE A;  3BFF A;  2V2F F;  2QPN A;  3VOZ A;  3ZG5 A;  1PWG A;  5CER A;  2C5W B;  5DVA A;  2H0T A;  3OPL A;  5TR7 A;  4E6W A;  5A90 A;  3OPH A;  3WS4 A;  3GVB A;  4GDN A;  3MXR A;  1M40 A;  2Z2M B;  2XF3 A;  5EE8 A;  5EVI B;  3ZG0 A;  1ALQ A;  4U0X A;  3ZNY A;  2HDS A;  2V20 A;  4GN2 A;  3S22 A;  4QY5 A;  4GKU A;  1NY0 A;  4S2I A;  5HAP A;  4OQH A;  4E3N A;  2JC7 A;  2XFT A;  2Y2N A;  4LV1 A;  5FQI A;  3S4X A;  4QU3 A;  3W4Q A;  4DXC A;  1NXY A;  2QMI A;  5DTK A;  5E2F A;  1DJC A;  2X02 A;  4R0Q A;  4CJN A;  4K0W A;  2OLU A;  2J9P A;  4DKI A;  4P6B A;  4OP5 A;  5FAO A;  2DCF A;  4C75 A;  4N92 A;  1BUL A;  3IXB A;  1XP4 A;  4B4X A;  4S2O A;  5CHM A;  2JCH A;  2ZQC A;  1KGG A;  3GQZ A;  2Y2O A;  3OPP A;  4KZA A;  1XXM A;  5CRF A;  3W8K A;  2VGJ A;  3IH9 A;  5FQJ A;  3UN7 A;  4E3M A;  3GRJ A;  4QB8 A;  1YLZ A;  2XLN A;  4JLF A;  4OVD A;  4S2P A;  4D2O A;  4DRT A;  1JWP A;  4KZ8 A;  3BEC A;  5DTS A;  2Y2M A;  1ONH A;  1GHP A;  3HLC A;  2EFX A;  4P85 A;  3LY3 A;  3ZG7 B;  5CEB A;  3SH8 A;  4GDB A;  4OOY A;  3UNW A;  4WEJ A;  1K56 D;  5CGW A;  4IED A;  4MEZ A;  4MNR A;  1LI0 A;  4GZB A;  4OKP A;  5KSH A;  2RL3 A;  2Y91 A;  1L0E A;  5E2G A;  2XD5 A;  4JKT A;  1WYC A;  4BL2 A;  5A91 A;  5BOH A;  3ZGA B;  3BFG A;  3V3S A;  1MKI A;  2EX6 A;  1FQG A;  3HL9 A;  3N7W A;  1NRF A;  3WRZ A;  3N4I A;  2HDQ A;  3WS5 A;  1L0F A;  4KZ7 A;  3LEZ A;  3S1Y A;  3IF6 A;  2FFF B;  3NDE A;  4OP8 A;  3DWZ A;  1LI9 A;  1K55 A;  3GR2 A;  1YM1 A;  4FH2 A;  4RA7 A;  2XR0 A;  5D3O A;  1LL9 A;  1PIO A;  3O3V A;  3QNB A;  2WGW A;  3MFD A;  1E4D A;  4S2L A;  1LHY A;  5FA7 A;  4E3J A;  1J9M A;  4PM7 A;  5AQ9 A;  1SDE A;  3PBS A;  5FAQ A;  1YLY A;  3GV9 A;  5KZH A;  3ZNT A;  2ZQD A;  4HBT A;  1KVM A;  1HVB A;  5KMW A;  5FI6 A;  2WAD A;  1K55 C;  2XGN A;  4DDS A;  3AGF A;  2P74 A;  2P9V A;  1XX2 A;  3GSG A;  3DW0 A;  4JF4 A;  4WEK A;  3OPR A;  3HLB A;  1K57 C;  3MXS A;  4H8R A;  1SHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...