4JXSA

X-ray crystal structure of ampc beta-lactamase from e. coli in complex with a non-covalent inhibitor 3-[(4-carboxybenzyl)sulfamoyl]thiophene-2-carboxylic acid (compound 4)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
358
structure length
352
Chain Sequence
b'APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure-based efforts to optimize a non-beta-lactam inhibitor of AmpC beta-lactamase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 117
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4jxsA00
4DF6A 1XXMA 2B5RA 3VMAA 4JF5A 5EVID 4E3KA 3A3IA 5CGWA 3BFGA 1NRFA 3G32A 3V50A 2PBYA 3M2JA 1SDEA 4B4XA 5IHVA 4S2NC 2EFXA 4MNRA 3W8KA 4WMCD 2EX2A 3BLSA 1QMEA 1ES3A 1JTGA 3PBOA 3Q81A 3UE3A 4BLMA 3ZG5A 2HDSA 3UN7A 1JWVA 4RVAA 4C6YA 2Y2GA 3A3JA 5E43A 3ZG8B 3P09A 1ZC2A 5JYOA 3WS4A 2QPNA 2WKHA 4EBPA 1CEGA 5EOEA 1YLTA 4QU3A 3FYZA 3VSLA 1IYOA 2WADA 3OPPA 3Q07A 1BULA 4MEZA 5EPHA 5HFOA 2XR0A 4FH2A 5F1GA 5G18A 4DDYA 1S6RA 4DDSA 3FZCA 2Y55A 2ZC7A 4ZDXA 5CEBA 5CEDA 3UDFA 1YLZA 5F1FA 2JC7A 4OKPA 2HP9A 4IBRA 5FAOA 4FSFA 4GDNA 4KG6A 4S2OA 3PTEA 1CEFA 1XKZA 4R3BA 3TG9A 1NYMA 4JXGA 2P9VA 2ZC3B 3ZNTA 3VP4A 3A3FA 4DXBA 5FDHA 1LI9A 3PAEA 2ZQ8A 3LCEA 3BYDA 3NDGA 3ZHHA 3GRJA 1O7EA 1NY0A 1SHVA 4GN2A 1ESUA 2WYXA 2HDQA 4H8RA 5DF8A 1H8ZA 2WGVA 4HEFA 3IF5A 4K91A 4X68A 3IF6B 5GLDA 5GLAA 3IXDA 2Y59A 4IVIA 3O88A 2BLSA 3N8RA 4E3MA 5CGXA 2V20A 4MBFA 3UDIA 4JF4A 3NDEA 4JXWA 5F82A 3C4OA 4PM8A 2Y2PA 4JF6A 4PM7A 3UY6A 4WEKA 4Y0TA 5FA7A 5GHXA 3DW0A 3UE0A 5D3OA 2H0TA 3NIAA 4BQMA 4ZBEA 3HLEA 4PM5A 4RX2A 4QJGA 2JBFA 4Y0OA 1HZOA 1L0DA 3MXSA 2E8IA 2Y2HA 3OZHA 4KQOA 1RP5A 4S2KA 1FR6A 4YFMA 5KSHA 3O87A 3GQZA 5JYPA 4HBTA 2A49A 5U47A 3CMZA 1DJBA 1U60A 1LL5A 2Q9MA 4D2OA 1KE0A 4UAAA 4IBXA 1KDSA 1JTDA 1DJCA 4N92A 3C5AA 4LV2A 3HLBA 5CHMA 5TFQA 1H8YA 4KENB 4OPRA 4QY5A 1L0EA 3Q82A 5M19A 3G34A 4OLDA 1RGZA 1JWZA 2ZQDA 1K57C 3PBQA 3Q7ZA 4N9KA 3LEZA 3IWIA 2ZM8A 3GMWA 5GLBA 4GOGA 1PIOA 3PBNA 4P85A 1PW1A 1OMEA 5KZHA 3VSKA 4KG2A 3W4PA 3HUNA 5EOOA 3OCLA 3G2YA 1YM1A 5CECA 5I94A 3IXGA 1Z6FA 2HP6A 2ZC4B 1SKFA 3P98A 1DJAA 3PBSA 1YLWA 2QZ6A 4WYYA 2OV5A 3BEBA 1YMSA 5F83A 3E2LA 1TDLA 4UA7A 1EI5A 5GLCA 3N8SA 1PWCA 4FH4A 3S1YA 1K4FA 2PU2A 1M6KA 1GCEA 1NZOA 3CJMA 4WM9A 5GHYA 5TGFA 3OPRA 4N1HA 4B4ZA 2RCXA 4KG5A 4K0WA 5FAPA 3S4XA 3HUOA 2XK1A 1CK3A 3SS4A 3IF6A 3IH8A 3ZDJA 4FCFA 4NETA 4LV0A 4GDBA 5GHZA 3V3RA 1NJ4A 5HAIA 2XD1A 4JBFA 2FFFB 4LV3A 1LL9A 5CHUA 4GNUA 3MFDA 2ZQ7A 1TVFA 1ES4A 1MWTA 3ZCZA 5FQIA 1CI9A 5CHJA 3ZG7B 3V3SA 1MWRA 4X55A 2ZD8A 3SS3A 2X02A 3AGEA 3UPNA 1FQGA 3CG5A 2A3UA 4DXCA 4EWFA 4OQHA 4UA6A 5CRFA 1IYPA 1LHYA 1L0FA 2G2WA 3M6BA 3Q7VB 1FSYA 1FOFA 1H5XA 4CPKA 2H0YA 5CGSA 1ZKJA 1HVBA 3PAGA 2HPBA 4WZ5C 2I72A 3B3XA 4GB7A 1W5DA 1WYBA 4DE2A 1M40A 2WZXA 4X6TA 1SDNA 2V2FF 1BLHA 1K25A 3MBZA 3NC8A 4S2MA 2XEPA 4N9LA 4UHUA 3HLCA 3OCNA 4KZ4A 5AQ9A 3VOYA 1O07A 2OLVA 4RX3A 4F94A 4KZAA 4P0MA 4A5RA 1MY8A 2VGJA 3AGDA 4E3JA 1SCWA 3NCKA 2IWBA 1Q2QA 1G6AA 1XA7A 3IHAA 1K38A 2EX6A 4OOMA 2DRWA 1XA1A 3A3EA 3RXWA 3HLWA 5FATA 1NYYA 4RA7A 3EQVA 2HDUA 5FQ9A 1PYYA 4E3LA 2X01A 4R23A 1BLSA 5KMWA 1KE3A 4KQQA 5EUAA 3MXRA 3M2KA 3O3VA 5HX9A 2IWDA 4Y7PA 1K54C 1PZPA 2Y91A 1WYCA 1EWZA 2Y4AA 4ZTKA 3N8LA 3HL9A 1FR1A 4EBLA 5FASA 5EECA 1KGEA 5DTKA 3G30A 3N6IA 3BFDA 4KZ6A 3ZNYA 3VP1A 5CTNA 4OP8A 3UNWA 4DE3A 1FCNA 4OQIA 4Q8IA 4BL2A 2OSUA 4OPZA 3A3DA 3OPHA 5CXWA 1BSGA 4X56A 3UE1A 5EE8A 1E25A 3VOZA 1PWDA 4K0XA 3LY4A 2QMIA 2XLNA 2CC1A 2Y2NA 2WKEA 4GKUA 4GD8A 2WKIA 1CI8A 4IVKA 1KE4A 1E3UA 3IH9A 4N1XA 4OOYA 4KZ7A 4X69A 4DRTA 5TR7A 3VP0A 1K55C 3C7VA 5AQBA 4P6BA 1I2WA 4WBGA 1KDWA 4BD0A 2ZQ9A 2HDRA 2R9XA 1XGIA 3Q7VA 4LENA 4PM6A 4RYEA 4PPRA 3WRTA 4QB8A 3W4QA 2XGNA 3SH8A 1GA0A 3GV9A 1ERMA 3C4PA 2WGWB 3DTMA 3IT9A 3IQAA 4UA9A 5CTMA 3PBTA 4HESA 3NY4A 4BL3A 4BENA 1ZG4A 3RXXA 2WAEA 2Z2MB 4MLLA 4WZ4A 1GA9A 3QHYA 5FAQA 3WWXA 3BFCA 3ZG0A 5HAQA 1C3BA 3ISGA 2PU4A 4JKTA 2JCHA 3QNCA 1IEMA 1N4OA 2XH9A 4Y0UA 2WUQA 1QMFA 3SH7A 1KVLA 3WS1A 5CERA 3N4IA 5EVIC 4S2LA 3BRMA 4BD1A 4DE1A 4EQIA 1ONGA 4KZ5A 3ZG9B 1PI4A 4IEDA 2R9WA 3ITAA 2RL3A 1FCMA 5FQQA 5E2GA 3RJUA 3HVFA 3G35A 1E4DA 1YLYA 1MPLA 1JWPA 1YQSA 2OLUA 2WZZA 3FWLA 3TOIA 3VFHA 2ZC6B 4JPMA 1LI0A 4S2NA 3TSGA 5A91A 4R4RA 1E3UD 4ID4A 2Y2KA 4OVDA 1KGGA 2G2UA 1LLBA 1J9MA 4QD4A 2XFSA 3NI9A 4XUZA 3G31A 3SH9A 4O7DA 4GZBA 4WELA 1Q2PA 2IWCA 3UPPA 2J8YA 2ZQCA 3W4OA 4S2IA 4LV1A 5FQMA 2HP5A 4KZ9A 3D4FA 3E2KA 3BLMA 4R1GA 4S2PA 1K4EA 5M1AA 1W7FA 4KZBA 1IYSA 2Y2JA 5L2FA 2ZJ9A 3IXBA 5FQKA 5M18A 3IWQA 3NBLA 3FKVA 2XD5A 4E6WA 2ZQAA 2Y2IA 4M3KA 4E6XA 1I5QA 1IKIA 4JXVA 3HBRA 1W79A 3IF6C 3IXHA 3MZFA 4XXRA 2P74A 4C75A 4CJNA 3OC2A 2X71A 5HARA 3PBRA 3VP3A 3MKEA 1BZAA 4QHCA 4JXSA 5DTSA 1MKIA 4X53A 3IHBA 5EVIB 1ONHA 5FI6A 1MXOA 2FFYA 3OPLA 5FI7A 2XQZA 3UPOA 4S2JA 3LO7A 1BUEA 4C3QA 5E2HA 3UO9A 1FCOA 1PWGA 3SS5A 4U0XA 2EXBA 1KVMA 3GTCA 5BOHA 2DNSA 1K54A 1W8YA 4LCLA 3O86A 3G4PA 5J8XA 1MWUA 3ZVWA 4DKIA 4KZ3A 4BJPA 1DY6A 1PZOA 2H5SA 4LCMA 1ES2A 3CZDA 2WGWA 1TEMA 3SOIA 4OPYA 5DTTA 4OPQA 3DWKA 4EV4A 1ALQA 3MKFA 3MZDA 5AQ7A 4B88A 5A90A 2DCFA 4ZJ2A 1XP4A 2JE5A 5HAPA 1YLPA 5DVAA 1VQQA 2UWXA 3WS0A 1K56A 1NXYA 4L0LA 4FD8A 1IKGA 1BTLA 1RCJA 2V1ZA 4KQRA 1WE4A 1L0GA 1FSWA 3AGFA 5FSRA 4ZJ1A 5A93A 1GHIA 1L2SA 1PI5A 2XDMA 5A92A 1KGFA 2Y2LA 1JVJA 1BLPA 5KSCA 2C6WB 2XF3A 3GVBA 4MBHA 4PMAA 3ZFZA 4DE0A 4R4SA 4PM9A 5DF7A 1HD8A 1S0WA 1NZUA 5GL9A 1K6SA 4OOLA 1GHPA 4E3IA 3LY3A 1K57A 1TDGA 2ZM0A 1K55A 4KZ8A 3VFFA 1Y54A 4OP5A 1XGJA 1VM1A 1GHMA 2EFUA 3VP2A 3JYIA 1I2SA 1K6RA 4U3TA 2Y2OA 4YINA 4QY6A 4ZAMA 3GR2A 2BG1A 5E2EA 3FV7A 3BFEA 3C7UA 2WK0A 2VGKA 3V5MA 3ZGAB 1YMXA 4GD6A 4WEJA 4Z9QA 3V39A 1ERQA 1RGYA 1HTZA 2Q9NA 5HW3A 2P9VB 1XPBA 3M6HA 1K56D 3DWZA 3Q1FA 3MZEA 5EVIA 3UDXA 1YLJA 4U0TA 3GSGA 5FI2A 3I7JA 1PW8A 4OQGA 5AQAA 4E3OA 3G2ZA 1ZG6A 4WMCA 1N9BA 3FKWA 3BECA 3HLFA 3WS5A 2ZM2A 5DF9A 2WAFA 1EROA 4OQ0A 1MWSA 1XX2A 2ZC5B 3ITBA 3HUMA 4HBUA 4JLFA 4NK3A 5E2FA 3HLGA 5EVLA 3WRZA 5HL1A 2WGIA 3BFFA 1W8QA 3BM6A 2C5WB 1MBLA 4ZJ3A 2Y2MA 3N7WA 3ZVTA 1ESIA 1IELA 2ZMAA 4R0QA 3HREA 2ZLYA 4EBNA 5FQJA 4OONA 2XFTA 4R3JA 4XUXA 3EQUA 1AXBA 1IYQA 2J7VA 2J9PA 4OLGA 4OH0A 2H10A 1BLCA 1G68A 2EX8A 4MBKA 3IWOA 1YT4A 3WS2A 2EXAA 4EUZA 2GDNA 2J9OA 3HLDA 3QNBA 4P87A 1BT5A 3S22A 1ES5A 2EX9A 2Z2LB 2Y2QA 4WZ5A 4E3NA
chains in the Genus database with same CATH superfamily
3K3DA 2IA2A 1F9IA 3KSFA 3G32A 3V50A 2PBYA 1PNEA 3UMEA 4C6YA 1FIKA 2G7UA 3P09A 1YSQA 4HP9A 5JYOA 2WKHA 1CEGA 5HD3A 3MF0A 4G3VA 4MEZA 5F1GA 3T4OA 1K0KA 1T1AA 4DDSA 4ZDXA 3H9WA 4OKPA 4JGOA 2HF6A 4GDNA 4KG6A 4S2OA 4R3BA 4I3JA 3TG9A 4E04A 4JXGA 3CAXA 1UWNX 2P9VA 2ZC3B 2ZOHA 3VP4A 2K2NA 1LI9A 3PAEA 3QP2A 3LCEA 3ZHHA 1SHVA 3MQOA 1ESUA 2WYXA 4GN2A 1H8ZA 4K91A 4Y13A 5GLAA 2Y59A 4IVIA 4G3WA 4WF0A 4E3MA 2V20A 2Y2PA 4H6JB 4PM7A 4Q0HA 3ZQ5A 3EGXC 3NIAA 1G6OA 3HLEA 3LIFA 4Y0OA 1L0DA 3R7WB 3MXSA 3LR3A 3ULFA 4S2KA 3NECA 3CPTB 5JYPA 1LSXA 4HBTA 3CMZA 1U60A 4IBXA 2NUTC 1KDSA 3C5AA 2JKTI 2W0NA 5CHMA 1N9NA 4Y5FA 5M19A 5HZHA 4N9KA 5DFYA 5G4ZA 5GLBA 4MMNA 3VSKA 5EOOA 1P97A 1Z6FA 4K08A 2HP6A 2ZC4B 3CWFA 3E4OA 1YLWA 2QZ6A 4NXGA 2OV5A 4QPRA 2W3FA 3VE4A 1TDLA 5IT5A 2Z6DA 1F2KA 1TS7A 3U4LP 4FH4A 4AFIA 2E8JA 1NZOA 4GLQA 2RCXA 5FAPA 2XK1A 1S67L 4NKPA 3QP8A 3B33A 5HAIA 1L3LA 1S1ZA 2ZQ7A 3ZCZA 4H6JA 4HOIA 1FQGA 3CG5A 1SZVA 1LHYA 1L0FA 2KOIA 4CPKA 3D72A 3R7WA 4EEPA 4GHIB 2GNXA 3PAGA 2I72A 5DKLA 4KQDA 3D9YA 4KZ4A 4NXEA 2I9VA 3KYQA 2VGJA 2IWBA 3RXWA 3HLWA 3EQVA 5FQ9A 4HJ3A 3LIBA 1K54C 4ME4A 4HQAA 1OJ5A 1EWZA 2Y4AA 2K7SA 2KLIA 3HL9A 1KGEA 5DTKA 1XFNA 3ZNYA 4OP8A 2V0WA 4FOFA 3UNWA 4Q8IA 4BL2A 3OPHA 5CXWA 1BSGA 1WA9A 2QMIA 2XLNA 3LR5A 2WKIA 4KZ7A 1T19A 5TR7A 4WBGA 1KDWA 2M1CA 4LENA 1T1CA 4Y3IA 4GHIA 3GV9A 3IT9A 2WGWB 3IQAA 2Y8HA 4UA9A 3NY4A 4BENA 3RXXA 4WZ4A 2PR5A 2Z2MB 1GA9A 5FAQA 3WWXA 3JPUA 4JKTA 2JCHA 1N4OA 3SH7A 1KVLA 3N4IA 4S2LA 5AJGA 4BD1A 1F5MA 4IEDA 1FCMA 5FQQA 2QJ7A 2WZZA 1YQSA 1E3UD 2K31A 5F68A 4QD4A 2KX6A 3NI9A 2J8YA 5L10A 4S2IA 3DTIA 4LV1A 3DAVA 1K4EA 1W7FA 2Y2JA 5FQKA 2HGVA 2Y2IA 4XXRA 2P74A 1VEUB 5HARA 5EVIB 4JXSA 4X53A 3IHBA 3LI9A 3UB6A 1MXOA 5DJTA 3UE6A 5E2HA 1FCOA 1PWGA 5HWTA 3SW1A 4U0XA 2W1RA 1XJ2A 4GJ4A 5BOHA 2W1TB 1W8YA 3O86A 3G4PA 3MMHA 4EEUA 1PZOA 4LCMA 5K5BA 1J3WA 2WGWA 1TEMA 3SOIA 5KIZA 2PD8A 2WKPA 5AQ7A 1G5UA 4CLCE 3MR0A 2MJ6A 4YWZA 2FZ0A 5FSRA 1GHIA 1L2SA 1JVJA 2PD7A 2C6WB 4LRZE 4MBHA 4PM9A 5DF7A 5GL9A 1K55A 2HZ5A 4I39A 5FEFA 3VP2A 3JYIA 4U3TA 2BG1A 4PHTA 1S4RA 3MXQA 4O0PA 1VEUA 1XPBA 3M6HA 3DWZA 5EVIA 1YLJA 5FI2A 3GSGA 3I7JA 1PW8A 1ZG6A 3HLFA 1X0OA 2OAP1 3IBRA 2KDKA 1AWIA 1ZTUA 1MWSA 1XX2A 3ITBA 3WRZA 3BFFA 1W8QA 4ZJ3A 3FPVA 1YAXA 2ZMAA 2OOLA 5FQJA 4PKYG 2VJWA 4OLGA 3LIAA 3NOTC 4OH0A 1ACFA 2J9OA 4I38A 1JNUA 1PFLA 2EX9A 1OT6A 3GECA 2FH5A 2AVXA 4F3LB 4GW9A 3W2ZA 4E3KA 3BFGA 3LEQA 5HDCA 4WMCD 3A0VA 2EX2A 3BLSA 1QMEA 1JTGA 3UN7A 1JWVA 2Y2GA 5E43A 3LI8A 4II7A 4LRYC 4QU3A 3VSLA 1BULA 4R38A 4FH2A 4DDYA 3FZCA 3UDFA 2YKFA 2ZMVA 5FAOA 4FSFA 2DMWA 3JVVA 3MFXA 4NXBA 5L09A 1CQAA 3LUQA 1NYMA 2ZL1B 3ZNTA 3A3FA 1LSVA 3RH8B 1STZA 4MN6A 3GRJA 3KX0X 4H8RA 2HDQA 4BBUA 2WGVA 4X68A 3UB7A 3IXDA 3E98A 2BLSA 4MBFA 1D06A 5F82A 3JVUA 4PM8A 3S7NA 2ZOIA 4WEKA 3UB8A 2W3GA 5GHXA 2B95A 3UE0A 1S1YA 2H0TA 3D3OA 4BQMA 4QJGA 4KQOA 3F1NB 5KSHA 1DJBA 1LL5A 3BWLA 3FPWA 4D2OA 3PXPA 1DJCA 4N92A 5TFQA 2ACGA 1H8YA 2OAQ1 5EVEA 4OPRA 4CLCB 1L0EA 1TF1A 3OLOA 3G34A 1JWZA 2ZQDA 4DMZA 3LEZA 2ZM8A 2QYBA 1PIOA 1OMEA 4KG2A 3W4PA 1YM1A 5CECA 4LRXC 4WYYA 3BEBA 5F83A 4UA7A 3T4SA 3NOUC 5GLCA 3N8SA 1PWCA 2ZL1A 2PU2A 3CJMA 5GHYA 5TGFA 4B4ZA 4KG5A 5EFWA 4HHDA 4MN5A 4I3AA 4FCFA 4NETA 4LV0A 5TBMB 1NJ4A 2XD1A 2FFFB 5CHUA 3MFDA 1TVFA 1MWTA 3O5YA 4LPZA 1Z09A 1CI9A 5CHJA 3H82B 3V3SA 1ZHHB 3UPNA 4Y15A 3QP1A 4Q0JA 4UA6A 3M6BA 3Q7VB 1H5XA 1FOFA 3F1NA 1T18A 3MQ0A 4GB7A 1W5DA 1SDNA 2V2FF 1BLHA 4S2MA 4UHUA 3KO6A 1IOUA 3VOYA 4RX3A 3IBJA 4P0MA 4A5RA 4CLCA 1MY8A 4E3JA 3AGDA 1Q2QA 2VA0A 1K38A 3T1SA 3BY8A 4Y2FA 2W3DA 2VZWA 1PYYA 5KMWA 3MXRA 5HX9A 3O3VA 3MS6A 3TJZC 4M4XA 4QWOA 4ZTKA 4FTXA 5EECA 4BWIA 4ETZA 5IU1A 3BFDA 3VP1A 2PBDP 4DE3A 3EGDC 1FCNA 2PYPA 4IUKA 3BQAA 2OSUA 4OPZA 3A3DA 5TBMA 4X56A 2WKEA 1S66L 3H82A 4CQHA 2JHEA 1K55C 5AQBA 1PRQA 3S7PA 3Q7VA 4QB8A 4JGQA 3SH8A 1ERMA 3C4PA 5CTMA 4HESA 4BL3A 2VGLS 3QHYA 4NEED 4R6LA 5HAQA 3ISGA 3A0SA 1NLYA 1IEMA 4Y0UA 2WUQA 1QMFA 5EVIC 2WKQA 1ONGA 4KZ5A 3ZG9B 1A0KA 2V1BA 4K0WA 3FWLA 2EA9A 4JPMA 4R4RA 2ZBBA 3G31A 3FG8A 3SH9A 4WELA 3RFBA 2L0WA 3UPPA 5FQMA 2HP5A 2O0YA 3B42A 3D4FA 5M1AA 1DP8A 3BLMA 1TS6A 5L2FA 2ZJ9A 3FKVA 2XD5A 1GSVA 1XJ4A 3LIEA 1IKIA 4JXVA 3HBRA 3IXHA 4CJNA 3OC2A 2X71A 3CITA 3VP3A 5FI6A 1ONHA 4L9EA 4MDZA 5FI7A 3BW6A 4HH2A 3OOVA 3UPOA 3T1RA 2INWA 3UO9A 3SS5A 1P9WA 3GTCA 4IUHA 1OTIA 2W27A 3L7HA 5J8XA 1OPXA 3S7OA 1MWUA 2JN7A 3ZVWA 4BJPA 3DTKA 4OPYA 5DTTA 3DWKA 2VK3A 2Z6CA 4PKYA 4WL9A 1XP4A 1YLPA 2UWXA 3WS0A 4L0LA 2V1ZA 3GDIA 3H7WB 1FSWA 3HJIA 5A92A 1KGFA 2Y2LA 1BLPA 4O8GA 2EWVA 4ARZB 4R4SA 1S0WA 4E3IA 2ZM0A 4KZ8A 1GHMA 4QY6A 3KYZA 1SKOB 1T1BA 2J3TC 2VGKA 3V5MA 3ZGAB 3NJAA 2XA7S 1YMXA 2R78A 4GD6A 2JKRM 1RGYA 2HJEA 5EV0A 4IJGA 3VE3A 4OQGA 3FKWA 2ZM2A 2WAFA 3HUMA 3HLGA 3BM6A 3L9KA 3N7WA 1VETB 1IELA 3HREA 4XUXA 3EQUA 1IYQA 2J7VA 2J9PA 3QP6A 2EX8A 4BBTA 2EXAA 2GDNA 4P87A 1TS0A 1UGUA 2Y2QA 3P01A 1XXMA 4L9FA 4JF5A 5EVID 5FASA 3A3IA 3H7WA 5CGWA 5G4YA 4B4XA 1SDEA 5IHVA 3T4JA 2EFXA 1NLZA 4MNRA 3W8KA 3B47A 1ES3A 3PBOA 2B18A 4RVAA 4ARZA 2L1MA 3LICA 2QPNA 3T4TA 3T4LA 5HPIA 2J80A 4EU0A 5EOEA 5I5LA 4EXOA 2WADA 3OPPA 5HFOA 5EPHA 2XR0A 3T12B 5G18A 1S6RA 2Y55A 5CEBA 1Y28A 5CEDA 5F1FA 1SKOA 2JC7A 4IBRA 5TJJA 2VV8A 4DXBA 2JKFA 5FDHA 2ZQ8A 4CLCC 5HWVA 1O7EA 1NY0A 5J3WA 5DF8A 4HEFA 5GLDA 3N8RA 1V9ZA 3NDEA 4JXWA 1VETA 4JF6A 1GSXA 3UY6A 4Y0TA 2M7VA 4LLOB 4ZBEA 4PM5A 1HZOA 3SZTA 3OZHA 1RP5A 2VGLM 4YFMA 4EESA 4EERA 5DKKA 2P04A 5U47A 3NOPC 2Q9MA 1KE0A 1JTDA 3BQ8A 3EEHA 4KENB 4B9OA 4QY5A 4OLDA 1RGZA 3Q7ZA 1K57C 3PBQA 2QJ5A 1XJ6A 3PBNA 3HUNA 1FILA 3G2YA 3C8CA 5I94A 3IXGA 3E4QA 3P98A 1DJAA 3EEAA 3PBSA 1YMSA 3E2LA 2CMNA 2J3TD 3C30A 3S1YA 2P08A 1K4FA 1GCEA 4WM9A 3OPRA 4N1HA 4WN5A 5J4EA 3SS4A 5HL6A 4GDBA 4JBFA 4LV3A 1LL9A 4GNUA 1ES4A 3HJKA 2OWHA 4X55A 1MZUA 2JKTM 4DXCA 4EWFA 4OQHA 5CRFA 1IYPA 4HI4A 4ZRRA 2H0YA 5CGSA 1ZKJA 2HPBA 4WZ5C 3B3XA 4DE2A 5A8BA 1Y4OA 2O9CA 1MKMA 4DJ3A 2VEAA 3G6OA 2QWSA 3OCNA 2OLVA 3HCYA 1P0ZA 3KYEA 1TD5A 1SCWA 3NCKA 1G6AA 1XA7A 4OOMA 2DRWA 1XA1A 2JKRI 3KSGA 5FATA 1NYYA 4RA7A 4E3LA 2X01A 4R23A 1BLSA 3F1PB 3M2KA 4Y7PA 4ESPA 2Y91A 1WYCA 2OWJA 4EBLA 1N9OA 1BYWA 1D7EA 2XA7M 3C2WA 3G30A 5LBRA 3TRCA 4OQIA 3E0YA 1UWPX 5J7EA 4CLCD 4Q0IA 3UE1A 3LR0A 3T1QB 3VOZA 2CC1A 3C38A 4GKUA 1CI8A 4N1XA 3IH9A 4L9GA 2XSSA 4X69A 3VP0A 3C7VA 3T1XA 5DJUA 2ZQ9A 2HDRA 2R9XA 1XGIA 4PPRA 1GA0A 3DTMA 3TE8A 2BASA 2QHKA 3PBTA 2WAEA 3ZG0A 3BFCA 2PU4A 4HJ4A 3WS1A 5CERA 3BRMA 2R9WA 3RJUA 3G35A 1E4DA 3TOIA 1JWPA 3VFHA 3IX3A 2GZAA 3TSGA 3F1PA 5HD5A 4ID4A 2Y2KA 1KGGA 2V9AA 2WKRA 1J9MA 4XUZA 2JKGA 3CI6A 1N9LA 1YSPA 4GZBA 4R70A 1Q2PA 5FDSA 3W4OA 2NUPC 3BY9A 2Y79A 2LB5A 4PAUA 3IXBA 4E6WA 4M3KA 1W63Q 1I5QA 2VV6A 4JGPA 5F5YA 4EETB 3IF6C 3MZFA 4C75A 3CHWP 1F98A 2PT7A 3PR6A 4S2JA 2EXBA 3T4QA 1KVMA 3QP4A 2PR6A 1DRMA 4LCLA 4DKIA 4KZ3A 3U2AA 1ES2A 1IFQA 4OPQA 4EV4A 1ALQA 3MKFA 3MZDA 4B88A 5A90A 2JE5A 5DVAA 1VQQA 1K56A 1NXYA 1IKGA 1BTLA 1WE4A 4EQ1A 1L0GA 5A93A 2XDMA 2W3HA 2XF3A 3GVBA 4LFUA 4PMAA 3UMDA 3P7NA 1HD8A 1K6SA 4OOLA 1K57A 3VFFA 1Y54A 1XGJA 2EFUA 1I2SA 4YINA 4ZAMA 3BFEA 4UQIS 3QP5A 3V39A 1HTZA 5C5KA 2Q9NA 5HW3A 4HH3A 3KSIA 5DFXA 4E3OA 3G2ZA 4FUWA 3WS5A 3K3CA 5DF9A 2A2LA 5E2FA 1D1JA 2ZC5B 4Z1WA 3EOIA 2WGIA 2C5WB 2Y2MA 1ESIA 4R0QA 1DP9A 2ZLYA 3LYXA 4EBNA 4NXFA 1W63M 4MN7A 2H10A 3EWKA 1BLCA 1G68A 3DTEA 4MBKA 3WS2A 3VV4A 3HLDA 1BT5A 3RTYA 3A0RA 4X1MA 1ES5A 1VB6A 3V3RA 4WZ5A 4E3NA 4DF6A 2B5RA 2V1AA 3FC7A 3VMAA 1NRFA 3M2JA 5AVFA 3MJQA 4IHQA 4S2NC 4P6ZS 3UB5P 4MCWA 4BLMA 3Q81A 3UE3A 3ZG5A 2HDSA 3A3JA 1KOUA 3ZG8B 2GX5A 1ZC2A 3WS4A 3PHYA 4EBPA 1YLTA 3FYZA 3LR4A 1IYOA 4BBVA 3Q07A 3IS2B 3CPTA 2ZMFA 4HP4A 2ZC7A 1YLZA 2HP9A 3BJNA 3PTEA 1CEFA 1XKZA 3F1OB 4X1LA 3BYDA 3NDGA 2W3EA 4O01A 4X25A 3IF5A 1OJGA 2LB9A 4ETXA 3IF6B 3O88A 3OBFA 1LSWA 2EWWA 4Y17A 5CGXA 3T4KA 3UDIA 4JF4A 3C4OA 1XJ3A 5FA7A 3DW0A 3CUEA 5D3OA 1NWZA 4RX2A 2V8CA 3ICYA 2JBFA 3MQQA 2E8IA 1ODVA 2Y2HA 1FR6A 3O87A 5HPFA 3GQZA 2O9AA 2A49A 5CX7A 4UAAA 1S4SA 3HLBA 4LV2A 1EW0A 3IX8A 2J3WA 3Q82A 1GSWA 3IWIA 3GMWA 4GOGA 4P85A 1PW1A 5KZHA 3T50A 3OCLA 3IS2A 1SKFA 3LIDA 5AVEA 2H28A 1EI5A 3F1OA 1M6KA 3IX4A 4WUJA 3S4XA 3E4PA 3HUOA 1CK3A 3IF6A 3IH8A 4HIAA 4UEYA 3ZDJA 2D01A 5GHZA 4RQ9A 1H0MA 5FQIA 2XROA 1LL8A 5L07A 3ZG7B 1MWRA 1YKDA 2ZD8A 1YPRA 3SS3A 2X02A 3AGEA 2A3UA 3V67A 2G2WA 3LFVA 1FSYA 1H8MA 3PYPA 1HVBA 2V8FA 1WYBA 1XFQA 1M40A 2WZXA 2B02A 2YKHA 2GJ3A 4X6TA 3NC8A 3MBZA 1K25A 5EM0A 2XEPA 4N9LA 3HLCA 2HJ9C 5AQ9A 2PYRA 1O07A 4BMWA 4F94A 4KZAA 2XRNA 1HLUP 4GS9B 3IHAA 2EX6A 3A3EA 1H3QA 5HWWA 1DP6A 2VLGA 2HDUA 1KE3A 4KQQA 5EUAA 2IWDA 1PZPA 3CLOA 1LT0A 2QKPA 3N8LA 1FR1A 4UQIM 4NG2A 5L8MA 3N6IA 4EUVA 4KZ6A 5CTNA 2M7UA 1MC0A 5HDSA 2P7JA 5EE8A 1E25A 1CF0A 1PWDA 4K0XA 3LY4A 3UB9A 2Y2NA 3S7QA 4GD8A 4IVKA 1KE4A 1E3UA 4OOYA 4D60A 4DRTA 4G3KA 1OTAA 1OTBA 4P6BA 1I2WA 5HDDA 4BD0A 4RYEA 4PM6A 2O99A 4HY8A 3WRTA 3W4QA 2XGNA 1OTDA 1ZG4A 5F69A 4MLLA 3LGOA 1C3BA 4HJ6A 3QNCA 2XH9A 3KSHA 4EW7A 2VV7A 1OTEA 4DE1A 4I5SA 4EQIA 4DJ2A 4I3IA 2PRFA 1PI4A 3ITAA 4GS9A 4P6ZM 2RL3A 1TS8A 5E2GA 3HVFA 1YLYA 2OLUA 1MPLA 4YNRA 2W1TA 1NRJA 2ZC6B 1LI0A 4S2NA 3TW8A 5A91A 4OVDA 2G2UA 1LLBA 2UV0E 2XFSA 2Q0OA 4O7DA 5MC7A 2IWCA 4KUKA 4KUOA 2ZQCA 4JGRA 4KZ9A 3E2KA 4R1GA 4S2PA 4KZBA 1IYSA 1OT9A 5M18A 4YOFA 3IWQA 3NBLA 1V9YA 2ZQAA 5F6AA 4R3AA 4E6XA 4XT2B 1W79A 3PBRA 3MKEA 1BZAA 4QHCA 5DTSA 1MKIA 4LGWA 2FFYA 2VKSA 3OPLA 3R4KA 2XQZA 3LO7A 1BUEA 4C3QA 2A24B 2PDRA 2BTFP 2DNSA 1P9RA 1K54A 1DY6A 2H5SA 3CZDA 3VOLA 3DBAA 2DCFA 4ZJ2A 5HAPA 4FD8A 3K2NA 1RCJA 4KQRA 5FEGA 3AGFA 4ZJ1A 1PI5A 5KSCA 2L4RA 3ZFZA 4DE0A 2V0UA 1NZUA 1GHPA 4HNBA 3LY3A 1TDGA 5HSQA 3CUEC 4OP5A 1VM1A 4GCZA 1K6RA 2Y2OA 2VX8A 1G28A 3GR2A 4DN0A 4F3LA 5E2EA 3FV7A 3C7UA 2WK0A 4XT2A 4WEJA 4Z9QA 1ERQA 2P9VB 2HV1A 1K56D 2D02A 3NHQA 3Q1FA 2PAVP 3MZEA 3NULA 3UDXA 4U0TA 5IS1A 5AQAA 4WMCA 1N9BA 1CJFA 3BECA 1EROA 4OQ0A 4HBUA 4JLFA 4NK3A 5EVLA 2A24A 5HL1A 1VHMA 3MSHA 1MBLA 3ZVTA 3ZYTA 4OONA 2XFTA 4R3JA 5EM1A 1AXBA 3IWOA 1YT4A 5FL3A 4EUZA 2PHYA 3QNBA 2O9BA 3S22A 4WLAA 2Z2LB 4B93A
chains in the Genus database with same CATH topology
4DF6A 1XXMA 2B5RA 3VMAA 4JF5A 5EVID 4E3KA 3A3IA 5CGWA 3BFGA 1NRFA 3G32A 3V50A 2PBYA 3M2JA 1SDEA 4B4XA 5IHVA 4S2NC 2EFXA 4MNRA 3W8KA 4WMCD 2EX2A 3BLSA 1QMEA 1ES3A 1JTGA 3PBOA 3Q81A 3UE3A 4BLMA 3ZG5A 2HDSA 3UN7A 1JWVA 4RVAA 4C6YA 2Y2GA 3A3JA 5E43A 3ZG8B 3P09A 1ZC2A 5JYOA 3WS4A 2QPNA 2WKHA 4EBPA 1CEGA 5EOEA 1YLTA 4QU3A 3FYZA 3VSLA 1IYOA 2WADA 3OPPA 3Q07A 1BULA 4MEZA 5EPHA 5HFOA 2XR0A 4FH2A 5F1GA 5G18A 4DDYA 1S6RA 4DDSA 3FZCA 2Y55A 2ZC7A 4ZDXA 5CEBA 5CEDA 3UDFA 1YLZA 5F1FA 2JC7A 4OKPA 2HP9A 4IBRA 5FAOA 4FSFA 4GDNA 4KG6A 4S2OA 3PTEA 1CEFA 1XKZA 4R3BA 3TG9A 1NYMA 4JXGA 2P9VA 2ZC3B 3ZNTA 3VP4A 3A3FA 4DXBA 5FDHA 1LI9A 3PAEA 2ZQ8A 3LCEA 3BYDA 3NDGA 3ZHHA 3GRJA 1O7EA 1NY0A 1SHVA 4GN2A 1ESUA 2WYXA 2HDQA 4H8RA 5DF8A 1H8ZA 2WGVA 4HEFA 3IF5A 4K91A 4X68A 3IF6B 5GLDA 5GLAA 3IXDA 2Y59A 4IVIA 3O88A 2BLSA 3N8RA 4E3MA 5CGXA 2V20A 4MBFA 3UDIA 4JF4A 3NDEA 4JXWA 5F82A 3C4OA 4PM8A 2Y2PA 4JF6A 4PM7A 3UY6A 4WEKA 4Y0TA 5FA7A 5GHXA 3DW0A 3UE0A 5D3OA 2H0TA 3NIAA 4BQMA 4ZBEA 3HLEA 4PM5A 4RX2A 4QJGA 2JBFA 4Y0OA 1HZOA 1L0DA 3MXSA 2E8IA 2Y2HA 3OZHA 4KQOA 1RP5A 4S2KA 1FR6A 4YFMA 5KSHA 3O87A 3GQZA 5JYPA 4HBTA 2A49A 5U47A 3CMZA 1DJBA 1U60A 1LL5A 2Q9MA 4D2OA 1KE0A 4UAAA 4IBXA 1KDSA 1JTDA 1DJCA 4N92A 3C5AA 4LV2A 3HLBA 5CHMA 5TFQA 1H8YA 4KENB 4OPRA 4QY5A 1L0EA 3Q82A 5M19A 3G34A 4OLDA 1RGZA 1JWZA 2ZQDA 1K57C 3PBQA 3Q7ZA 4N9KA 3LEZA 3IWIA 2ZM8A 3GMWA 5GLBA 4GOGA 1PIOA 3PBNA 4P85A 1PW1A 1OMEA 5KZHA 3VSKA 4KG2A 3W4PA 3HUNA 5EOOA 3OCLA 3G2YA 1YM1A 5CECA 5I94A 3IXGA 1Z6FA 2HP6A 2ZC4B 1SKFA 3P98A 1DJAA 3PBSA 1YLWA 2QZ6A 4WYYA 2OV5A 3BEBA 1YMSA 5F83A 3E2LA 1TDLA 4UA7A 1EI5A 5GLCA 3N8SA 1PWCA 4FH4A 3S1YA 1K4FA 2PU2A 1M6KA 1GCEA 1NZOA 3CJMA 4WM9A 5GHYA 5TGFA 3OPRA 4N1HA 4B4ZA 2RCXA 4KG5A 4K0WA 5FAPA 3S4XA 3HUOA 2XK1A 1CK3A 3SS4A 3IF6A 3IH8A 3ZDJA 4FCFA 4NETA 4LV0A 4GDBA 5GHZA 3V3RA 1NJ4A 5HAIA 2XD1A 4JBFA 2FFFB 4LV3A 1LL9A 5CHUA 4GNUA 3MFDA 2ZQ7A 1TVFA 1ES4A 1MWTA 3ZCZA 5FQIA 1CI9A 5CHJA 3ZG7B 3V3SA 1MWRA 4X55A 2ZD8A 3SS3A 2X02A 3AGEA 3UPNA 1FQGA 3CG5A 2A3UA 4DXCA 4EWFA 4OQHA 4UA6A 5CRFA 1IYPA 1LHYA 1L0FA 2G2WA 3M6BA 3Q7VB 1FSYA 1FOFA 1H5XA 4CPKA 2H0YA 5CGSA 1ZKJA 1HVBA 3PAGA 2HPBA 4WZ5C 2I72A 3B3XA 4GB7A 1W5DA 1WYBA 4DE2A 1M40A 2WZXA 4X6TA 1SDNA 2V2FF 1BLHA 1K25A 3MBZA 3NC8A 4S2MA 2XEPA 4N9LA 4UHUA 3HLCA 3OCNA 4KZ4A 5AQ9A 3VOYA 1O07A 2OLVA 4RX3A 4F94A 4KZAA 4P0MA 4A5RA 1MY8A 2VGJA 3AGDA 4E3JA 1SCWA 3NCKA 2IWBA 1Q2QA 1G6AA 1XA7A 3IHAA 1K38A 2EX6A 4OOMA 2DRWA 1XA1A 3A3EA 3RXWA 3HLWA 5FATA 1NYYA 4RA7A 3EQVA 2HDUA 5FQ9A 1PYYA 4E3LA 2X01A 4R23A 1BLSA 5KMWA 1KE3A 4KQQA 5EUAA 3MXRA 3M2KA 3O3VA 5HX9A 2IWDA 4Y7PA 1K54C 1PZPA 2Y91A 1WYCA 1EWZA 2Y4AA 4ZTKA 3N8LA 3HL9A 1FR1A 4EBLA 5FASA 5EECA 1KGEA 5DTKA 3G30A 3N6IA 3BFDA 4KZ6A 3ZNYA 3VP1A 5CTNA 4OP8A 3UNWA 4DE3A 1FCNA 4OQIA 4Q8IA 4BL2A 2OSUA 4OPZA 3A3DA 3OPHA 5CXWA 1BSGA 4X56A 3UE1A 5EE8A 1E25A 3VOZA 1PWDA 4K0XA 3LY4A 2QMIA 2XLNA 2CC1A 2Y2NA 2WKEA 4GKUA 4GD8A 2WKIA 1CI8A 4IVKA 1KE4A 1E3UA 3IH9A 4N1XA 4OOYA 4KZ7A 4X69A 4DRTA 5TR7A 3VP0A 1K55C 3C7VA 5AQBA 4P6BA 1I2WA 4WBGA 1KDWA 4BD0A 2ZQ9A 2HDRA 2R9XA 1XGIA 3Q7VA 4LENA 4PM6A 4RYEA 4PPRA 3WRTA 4QB8A 3W4QA 2XGNA 3SH8A 1GA0A 3GV9A 1ERMA 3C4PA 2WGWB 3DTMA 3IT9A 3IQAA 4UA9A 5CTMA 3PBTA 4HESA 3NY4A 4BL3A 4BENA 1ZG4A 3RXXA 2WAEA 2Z2MB 4MLLA 4WZ4A 1GA9A 3QHYA 5FAQA 3WWXA 3BFCA 3ZG0A 5HAQA 1C3BA 3ISGA 2PU4A 4JKTA 2JCHA 3QNCA 1IEMA 1N4OA 2XH9A 4Y0UA 2WUQA 1QMFA 3SH7A 1KVLA 3WS1A 5CERA 3N4IA 5EVIC 4S2LA 3BRMA 4BD1A 4DE1A 4EQIA 1ONGA 4KZ5A 3ZG9B 1PI4A 4IEDA 2R9WA 3ITAA 2RL3A 1FCMA 5FQQA 5E2GA 3RJUA 3HVFA 3G35A 1E4DA 1YLYA 1MPLA 1JWPA 1YQSA 2OLUA 2WZZA 3FWLA 3TOIA 3VFHA 2ZC6B 4JPMA 1LI0A 4S2NA 3TSGA 5A91A 4R4RA 1E3UD 4ID4A 2Y2KA 4OVDA 1KGGA 2G2UA 1LLBA 1J9MA 4QD4A 2XFSA 3NI9A 4XUZA 3G31A 3SH9A 4O7DA 4GZBA 4WELA 1Q2PA 2IWCA 3UPPA 2J8YA 2ZQCA 3W4OA 4S2IA 4LV1A 5FQMA 2HP5A 4KZ9A 3D4FA 3E2KA 3BLMA 4R1GA 4S2PA 1K4EA 5M1AA 1W7FA 4KZBA 1IYSA 2Y2JA 5L2FA 2ZJ9A 3IXBA 5FQKA 5M18A 3IWQA 3NBLA 3FKVA 2XD5A 4E6WA 2ZQAA 2Y2IA 4M3KA 4E6XA 1I5QA 1IKIA 4JXVA 3HBRA 1W79A 3IF6C 3IXHA 3MZFA 4XXRA 2P74A 4C75A 4CJNA 3OC2A 2X71A 5HARA 3PBRA 3VP3A 3MKEA 1BZAA 4QHCA 4JXSA 5DTSA 1MKIA 4X53A 3IHBA 5EVIB 1ONHA 5FI6A 1MXOA 2FFYA 3OPLA 5FI7A 2XQZA 3UPOA 4S2JA 3LO7A 1BUEA 4C3QA 5E2HA 3UO9A 1FCOA 1PWGA 3SS5A 4U0XA 2EXBA 1KVMA 3GTCA 5BOHA 2DNSA 1K54A 1W8YA 4LCLA 3O86A 3G4PA 5J8XA 1MWUA 3ZVWA 4DKIA 4KZ3A 4BJPA 1DY6A 1PZOA 2H5SA 4LCMA 1ES2A 3CZDA 2WGWA 1TEMA 3SOIA 4OPYA 5DTTA 4OPQA 3DWKA 4EV4A 1ALQA 3MKFA 3MZDA 5AQ7A 4B88A 5A90A 2DCFA 4ZJ2A 1XP4A 2JE5A 5HAPA 1YLPA 5DVAA 1VQQA 2UWXA 3WS0A 1K56A 1NXYA 4L0LA 4FD8A 1IKGA 1BTLA 1RCJA 2V1ZA 4KQRA 1WE4A 1L0GA 1FSWA 3AGFA 5FSRA 4ZJ1A 5A93A 1GHIA 1L2SA 1PI5A 2XDMA 5A92A 1KGFA 2Y2LA 1JVJA 1BLPA 5KSCA 2C6WB 2XF3A 3GVBA 4MBHA 4PMAA 3ZFZA 4DE0A 4R4SA 4PM9A 5DF7A 1HD8A 1S0WA 1NZUA 5GL9A 1K6SA 4OOLA 1GHPA 4E3IA 3LY3A 1K57A 1TDGA 2ZM0A 1K55A 4KZ8A 3VFFA 1Y54A 4OP5A 1XGJA 1VM1A 1GHMA 2EFUA 3VP2A 3JYIA 1I2SA 1K6RA 4U3TA 2Y2OA 4YINA 4QY6A 4ZAMA 3GR2A 2BG1A 5E2EA 3FV7A 3BFEA 3C7UA 2WK0A 2VGKA 3V5MA 3ZGAB 1YMXA 4GD6A 4WEJA 4Z9QA 3V39A 1ERQA 1RGYA 1HTZA 2Q9NA 5HW3A 2P9VB 1XPBA 3M6HA 1K56D 3DWZA 3Q1FA 3MZEA 5EVIA 3UDXA 1YLJA 4U0TA 3GSGA 5FI2A 3I7JA 1PW8A 4OQGA 5AQAA 4E3OA 3G2ZA 1ZG6A 4WMCA 1N9BA 3FKWA 3BECA 3HLFA 3WS5A 2ZM2A 5DF9A 2WAFA 1EROA 4OQ0A 1MWSA 1XX2A 2ZC5B 3ITBA 3HUMA 4HBUA 4JLFA 4NK3A 5E2FA 3HLGA 5EVLA 3WRZA 5HL1A 2WGIA 3BFFA 1W8QA 3BM6A 2C5WB 1MBLA 4ZJ3A 2Y2MA 3N7WA 3ZVTA 1ESIA 1IELA 2ZMAA 4R0QA 3HREA 2ZLYA 4EBNA 5FQJA 4OONA 2XFTA 4R3JA 4XUXA 3EQUA 1AXBA 1IYQA 2J7VA 2J9PA 4OLGA 4OH0A 2H10A 1BLCA 1G68A 2EX8A 4MBKA 3IWOA 1YT4A 3WS2A 2EXAA 4EUZA 2GDNA 2J9OA 3HLDA 3QNBA 4P87A 1BT5A 3S22A 1ES5A 2EX9A 2Z2LB 2Y2QA 4WZ5A 4E3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DF6 A;  1XXM A;  2B5R A;  3VMA A;  4JF5 A;  5EVI D;  4E3K A;  3A3I A;  5CGW A;  3BFG A;  1NRF A;  3G32 A;  3V50 A;  2PBY A;  3M2J A;  1SDE A;  4B4X A;  5IHV A;  4S2N C;  2EFX A;  4MNR A;  3W8K A;  4WMC D;  2EX2 A;  3BLS A;  1QME A;  1ES3 A;  1JTG A;  3PBO A;  3Q81 A;  3UE3 A;  4BLM A;  3ZG5 A;  2HDS A;  3UN7 A;  1JWV A;  4RVA A;  4C6Y A;  2Y2G A;  3A3J A;  5E43 A;  3ZG8 B;  3P09 A;  1ZC2 A;  5JYO A;  3WS4 A;  2QPN A;  2WKH A;  4EBP A;  1CEG A;  5EOE A;  1YLT A;  4QU3 A;  3FYZ A;  3VSL A;  1IYO A;  2WAD A;  3OPP A;  3Q07 A;  1BUL A;  4MEZ A;  5EPH A;  5HFO A;  2XR0 A;  4FH2 A;  5F1G A;  5G18 A;  4DDY A;  1S6R A;  4DDS A;  3FZC A;  2Y55 A;  2ZC7 A;  4ZDX A;  5CEB A;  5CED A;  3UDF A;  1YLZ A;  5F1F A;  2JC7 A;  4OKP A;  2HP9 A;  4IBR A;  5FAO A;  4FSF A;  4GDN A;  4KG6 A;  4S2O A;  3PTE A;  1CEF A;  1XKZ A;  4R3B A;  3TG9 A;  1NYM A;  4JXG A;  2P9V A;  2ZC3 B;  3ZNT A;  3VP4 A;  3A3F A;  4DXB A;  5FDH A;  1LI9 A;  3PAE A;  2ZQ8 A;  3LCE A;  3BYD A;  3NDG A;  3ZHH A;  3GRJ A;  1O7E A;  1NY0 A;  1SHV A;  4GN2 A;  1ESU A;  2WYX A;  2HDQ A;  4H8R A;  5DF8 A;  1H8Z A;  2WGV A;  4HEF A;  3IF5 A;  4K91 A;  4X68 A;  3IF6 B;  5GLD A;  5GLA A;  3IXD A;  2Y59 A;  4IVI A;  3O88 A;  2BLS A;  3N8R A;  4E3M A;  5CGX A;  2V20 A;  4MBF A;  3UDI A;  4JF4 A;  3NDE A;  4JXW A;  5F82 A;  3C4O A;  4PM8 A;  2Y2P A;  4JF6 A;  4PM7 A;  3UY6 A;  4WEK A;  4Y0T A;  5FA7 A;  5GHX A;  3DW0 A;  3UE0 A;  5D3O A;  2H0T A;  3NIA A;  4BQM A;  4ZBE A;  3HLE A;  4PM5 A;  4RX2 A;  4QJG A;  2JBF A;  4Y0O A;  1HZO A;  1L0D A;  3MXS A;  2E8I A;  2Y2H A;  3OZH A;  4KQO A;  1RP5 A;  4S2K A;  1FR6 A;  4YFM A;  5KSH A;  3O87 A;  3GQZ A;  5JYP A;  4HBT A;  2A49 A;  5U47 A;  3CMZ A;  1DJB A;  1U60 A;  1LL5 A;  2Q9M A;  4D2O A;  1KE0 A;  4UAA A;  4IBX A;  1KDS A;  1JTD A;  1DJC A;  4N92 A;  3C5A A;  4LV2 A;  3HLB A;  5CHM A;  5TFQ A;  1H8Y A;  4KEN B;  4OPR A;  4QY5 A;  1L0E A;  3Q82 A;  5M19 A;  3G34 A;  4OLD A;  1RGZ A;  1JWZ A;  2ZQD A;  1K57 C;  3PBQ A;  3Q7Z A;  4N9K A;  3LEZ A;  3IWI A;  2ZM8 A;  3GMW A;  5GLB A;  4GOG A;  1PIO A;  3PBN A;  4P85 A;  1PW1 A;  1OME A;  5KZH A;  3VSK A;  4KG2 A;  3W4P A;  3HUN A;  5EOO A;  3OCL A;  3G2Y A;  1YM1 A;  5CEC A;  5I94 A;  3IXG A;  1Z6F A;  2HP6 A;  2ZC4 B;  1SKF A;  3P98 A;  1DJA A;  3PBS A;  1YLW A;  2QZ6 A;  4WYY A;  2OV5 A;  3BEB A;  1YMS A;  5F83 A;  3E2L A;  1TDL A;  4UA7 A;  1EI5 A;  5GLC A;  3N8S A;  1PWC A;  4FH4 A;  3S1Y A;  1K4F A;  2PU2 A;  1M6K A;  1GCE A;  1NZO A;  3CJM A;  4WM9 A;  5GHY A;  5TGF A;  3OPR A;  4N1H A;  4B4Z A;  2RCX A;  4KG5 A;  4K0W A;  5FAP A;  3S4X A;  3HUO A;  2XK1 A;  1CK3 A;  3SS4 A;  3IF6 A;  3IH8 A;  3ZDJ A;  4FCF A;  4NET A;  4LV0 A;  4GDB A;  5GHZ A;  3V3R A;  1NJ4 A;  5HAI A;  2XD1 A;  4JBF A;  2FFF B;  4LV3 A;  1LL9 A;  5CHU A;  4GNU A;  3MFD A;  2ZQ7 A;  1TVF A;  1ES4 A;  1MWT A;  3ZCZ A;  5FQI A;  1CI9 A;  5CHJ A;  3ZG7 B;  3V3S A;  1MWR A;  4X55 A;  2ZD8 A;  3SS3 A;  2X02 A;  3AGE A;  3UPN A;  1FQG A;  3CG5 A;  2A3U A;  4DXC A;  4EWF A;  4OQH A;  4UA6 A;  5CRF A;  1IYP A;  1LHY A;  1L0F A;  2G2W A;  3M6B A;  3Q7V B;  1FSY A;  1FOF A;  1H5X A;  4CPK A;  2H0Y A;  5CGS A;  1ZKJ A;  1HVB A;  3PAG A;  2HPB A;  4WZ5 C;  2I72 A;  3B3X A;  4GB7 A;  1W5D A;  1WYB A;  4DE2 A;  1M40 A;  2WZX A;  4X6T A;  1SDN A;  2V2F F;  1BLH A;  1K25 A;  3MBZ A;  3NC8 A;  4S2M A;  2XEP A;  4N9L A;  4UHU A;  3HLC A;  3OCN A;  4KZ4 A;  5AQ9 A;  3VOY A;  1O07 A;  2OLV A;  4RX3 A;  4F94 A;  4KZA A;  4P0M A;  4A5R A;  1MY8 A;  2VGJ A;  3AGD A;  4E3J A;  1SCW A;  3NCK A;  2IWB A;  1Q2Q A;  1G6A A;  1XA7 A;  3IHA A;  1K38 A;  2EX6 A;  4OOM A;  2DRW A;  1XA1 A;  3A3E A;  3RXW A;  3HLW A;  5FAT A;  1NYY A;  4RA7 A;  3EQV A;  2HDU A;  5FQ9 A;  1PYY A;  4E3L A;  2X01 A;  4R23 A;  1BLS A;  5KMW A;  1KE3 A;  4KQQ A;  5EUA A;  3MXR A;  3M2K A;  3O3V A;  5HX9 A;  2IWD A;  4Y7P A;  1K54 C;  1PZP A;  2Y91 A;  1WYC A;  1EWZ A;  2Y4A A;  4ZTK A;  3N8L A;  3HL9 A;  1FR1 A;  4EBL A;  5FAS A;  5EEC A;  1KGE A;  5DTK A;  3G30 A;  3N6I A;  3BFD A;  4KZ6 A;  3ZNY A;  3VP1 A;  5CTN A;  4OP8 A;  3UNW A;  4DE3 A;  1FCN A;  4OQI A;  4Q8I A;  4BL2 A;  2OSU A;  4OPZ A;  3A3D A;  3OPH A;  5CXW A;  1BSG A;  4X56 A;  3UE1 A;  5EE8 A;  1E25 A;  3VOZ A;  1PWD A;  4K0X A;  3LY4 A;  2QMI A;  2XLN A;  2CC1 A;  2Y2N A;  2WKE A;  4GKU A;  4GD8 A;  2WKI A;  1CI8 A;  4IVK A;  1KE4 A;  1E3U A;  3IH9 A;  4N1X A;  4OOY A;  4KZ7 A;  4X69 A;  4DRT A;  5TR7 A;  3VP0 A;  1K55 C;  3C7V A;  5AQB A;  4P6B A;  1I2W A;  4WBG A;  1KDW A;  4BD0 A;  2ZQ9 A;  2HDR A;  2R9X A;  1XGI A;  3Q7V A;  4LEN A;  4PM6 A;  4RYE A;  4PPR A;  3WRT A;  4QB8 A;  3W4Q A;  2XGN A;  3SH8 A;  1GA0 A;  3GV9 A;  1ERM A;  3C4P A;  2WGW B;  3DTM A;  3IT9 A;  3IQA A;  4UA9 A;  5CTM A;  3PBT A;  4HES A;  3NY4 A;  4BL3 A;  4BEN A;  1ZG4 A;  3RXX A;  2WAE A;  2Z2M B;  4MLL A;  4WZ4 A;  1GA9 A;  3QHY A;  5FAQ A;  3WWX A;  3BFC A;  3ZG0 A;  5HAQ A;  1C3B A;  3ISG A;  2PU4 A;  4JKT A;  2JCH A;  3QNC A;  1IEM A;  1N4O A;  2XH9 A;  4Y0U A;  2WUQ A;  1QMF A;  3SH7 A;  1KVL A;  3WS1 A;  5CER A;  3N4I A;  5EVI C;  4S2L A;  3BRM A;  4BD1 A;  4DE1 A;  4EQI A;  1ONG A;  4KZ5 A;  3ZG9 B;  1PI4 A;  4IED A;  2R9W A;  3ITA A;  2RL3 A;  1FCM A;  5FQQ A;  5E2G A;  3RJU A;  3HVF A;  3G35 A;  1E4D A;  1YLY A;  1MPL A;  1JWP A;  1YQS A;  2OLU A;  2WZZ A;  3FWL A;  3TOI A;  3VFH A;  2ZC6 B;  4JPM A;  1LI0 A;  4S2N A;  3TSG A;  5A91 A;  4R4R A;  1E3U D;  4ID4 A;  2Y2K A;  4OVD A;  1KGG A;  2G2U A;  1LLB A;  1J9M A;  4QD4 A;  2XFS A;  3NI9 A;  4XUZ A;  3G31 A;  3SH9 A;  4O7D A;  4GZB A;  4WEL A;  1Q2P A;  2IWC A;  3UPP A;  2J8Y A;  2ZQC A;  3W4O A;  4S2I A;  4LV1 A;  5FQM A;  2HP5 A;  4KZ9 A;  3D4F A;  3E2K A;  3BLM A;  4R1G A;  4S2P A;  1K4E A;  5M1A A;  1W7F A;  4KZB A;  1IYS A;  2Y2J A;  5L2F A;  2ZJ9 A;  3IXB A;  5FQK A;  5M18 A;  3IWQ A;  3NBL A;  3FKV A;  2XD5 A;  4E6W A;  2ZQA A;  2Y2I A;  4M3K A;  4E6X A;  1I5Q A;  1IKI A;  4JXV A;  3HBR A;  1W79 A;  3IF6 C;  3IXH A;  3MZF A;  4XXR A;  2P74 A;  4C75 A;  4CJN A;  3OC2 A;  2X71 A;  5HAR A;  3PBR A;  3VP3 A;  3MKE A;  1BZA A;  4QHC A;  4JXS A;  5DTS A;  1MKI A;  4X53 A;  3IHB A;  5EVI B;  1ONH A;  5FI6 A;  1MXO A;  2FFY A;  3OPL A;  5FI7 A;  2XQZ A;  3UPO A;  4S2J A;  3LO7 A;  1BUE A;  4C3Q A;  5E2H A;  3UO9 A;  1FCO A;  1PWG A;  3SS5 A;  4U0X A;  2EXB A;  1KVM A;  3GTC A;  5BOH A;  2DNS A;  1K54 A;  1W8Y A;  4LCL A;  3O86 A;  3G4P A;  5J8X A;  1MWU A;  3ZVW A;  4DKI A;  4KZ3 A;  4BJP A;  1DY6 A;  1PZO A;  2H5S A;  4LCM A;  1ES2 A;  3CZD A;  2WGW A;  1TEM A;  3SOI A;  4OPY A;  5DTT A;  4OPQ A;  3DWK A;  4EV4 A;  1ALQ A;  3MKF A;  3MZD A;  5AQ7 A;  4B88 A;  5A90 A;  2DCF A;  4ZJ2 A;  1XP4 A;  2JE5 A;  5HAP A;  1YLP A;  5DVA A;  1VQQ A;  2UWX A;  3WS0 A;  1K56 A;  1NXY A;  4L0L A;  4FD8 A;  1IKG A;  1BTL A;  1RCJ A;  2V1Z A;  4KQR A;  1WE4 A;  1L0G A;  1FSW A;  3AGF A;  5FSR A;  4ZJ1 A;  5A93 A;  1GHI A;  1L2S A;  1PI5 A;  2XDM A;  5A92 A;  1KGF A;  2Y2L A;  1JVJ A;  1BLP A;  5KSC A;  2C6W B;  2XF3 A;  3GVB A;  4MBH A;  4PMA A;  3ZFZ A;  4DE0 A;  4R4S A;  4PM9 A;  5DF7 A;  1HD8 A;  1S0W A;  1NZU A;  5GL9 A;  1K6S A;  4OOL A;  1GHP A;  4E3I A;  3LY3 A;  1K57 A;  1TDG A;  2ZM0 A;  1K55 A;  4KZ8 A;  3VFF A;  1Y54 A;  4OP5 A;  1XGJ A;  1VM1 A;  1GHM A;  2EFU A;  3VP2 A;  3JYI A;  1I2S A;  1K6R A;  4U3T A;  2Y2O A;  4YIN A;  4QY6 A;  4ZAM A;  3GR2 A;  2BG1 A;  5E2E A;  3FV7 A;  3BFE A;  3C7U A;  2WK0 A;  2VGK A;  3V5M A;  3ZGA B;  1YMX A;  4GD6 A;  4WEJ A;  4Z9Q A;  3V39 A;  1ERQ A;  1RGY A;  1HTZ A;  2Q9N A;  5HW3 A;  2P9V B;  1XPB A;  3M6H A;  1K56 D;  3DWZ A;  3Q1F A;  3MZE A;  5EVI A;  3UDX A;  1YLJ A;  4U0T A;  3GSG A;  5FI2 A;  3I7J A;  1PW8 A;  4OQG A;  5AQA A;  4E3O A;  3G2Z A;  1ZG6 A;  4WMC A;  1N9B A;  3FKW A;  3BEC A;  3HLF A;  3WS5 A;  2ZM2 A;  5DF9 A;  2WAF A;  1ERO A;  4OQ0 A;  1MWS A;  1XX2 A;  2ZC5 B;  3ITB A;  3HUM A;  4HBU A;  4JLF A;  4NK3 A;  5E2F A;  3HLG A;  5EVL A;  3WRZ A;  5HL1 A;  2WGI A;  3BFF A;  1W8Q A;  3BM6 A;  2C5W B;  1MBL A;  4ZJ3 A;  2Y2M A;  3N7W A;  3ZVT A;  1ESI A;  1IEL A;  2ZMA A;  4R0Q A;  3HRE A;  2ZLY A;  4EBN A;  5FQJ A;  4OON A;  2XFT A;  4R3J A;  4XUX A;  3EQU A;  1AXB A;  1IYQ A;  2J7V A;  2J9P A;  4OLG A;  4OH0 A;  2H10 A;  1BLC A;  1G68 A;  2EX8 A;  4MBK A;  3IWO A;  1YT4 A;  3WS2 A;  2EXA A;  4EUZ A;  2GDN A;  2J9O A;  3HLD A;  3QNB A;  4P87 A;  1BT5 A;  3S22 A;  1ES5 A;  2EX9 A;  2Z2L B;  2Y2Q A;  4WZ5 A;  4E3N A; 
#chains in the Genus database with same CATH topology
 3K3D A;  2IA2 A;  1F9I A;  3KSF A;  3G32 A;  3V50 A;  2PBY A;  1PNE A;  3UME A;  4C6Y A;  1FIK A;  2G7U A;  3P09 A;  1YSQ A;  4HP9 A;  5JYO A;  2WKH A;  1CEG A;  5HD3 A;  3MF0 A;  4G3V A;  4MEZ A;  5F1G A;  3T4O A;  1K0K A;  1T1A A;  4DDS A;  4ZDX A;  3H9W A;  4OKP A;  4JGO A;  2HF6 A;  4GDN A;  4KG6 A;  4S2O A;  4R3B A;  4I3J A;  3TG9 A;  4E04 A;  4JXG A;  3CAX A;  1UWN X;  2P9V A;  2ZC3 B;  2ZOH A;  3VP4 A;  2K2N A;  1LI9 A;  3PAE A;  3QP2 A;  3LCE A;  3ZHH A;  1SHV A;  3MQO A;  1ESU A;  2WYX A;  4GN2 A;  1H8Z A;  4K91 A;  4Y13 A;  5GLA A;  2Y59 A;  4IVI A;  4G3W A;  4WF0 A;  4E3M A;  2V20 A;  2Y2P A;  4H6J B;  4PM7 A;  4Q0H A;  3ZQ5 A;  3EGX C;  3NIA A;  1G6O A;  3HLE A;  3LIF A;  4Y0O A;  1L0D A;  3R7W B;  3MXS A;  3LR3 A;  3ULF A;  4S2K A;  3NEC A;  3CPT B;  5JYP A;  1LSX A;  4HBT A;  3CMZ A;  1U60 A;  4IBX A;  2NUT C;  1KDS A;  3C5A A;  2JKT I;  2W0N A;  5CHM A;  1N9N A;  4Y5F A;  5M19 A;  5HZH A;  4N9K A;  5DFY A;  5G4Z A;  5GLB A;  4MMN A;  3VSK A;  5EOO A;  1P97 A;  1Z6F A;  4K08 A;  2HP6 A;  2ZC4 B;  3CWF A;  3E4O A;  1YLW A;  2QZ6 A;  4NXG A;  2OV5 A;  4QPR A;  2W3F A;  3VE4 A;  1TDL A;  5IT5 A;  2Z6D A;  1F2K A;  1TS7 A;  3U4L P;  4FH4 A;  4AFI A;  2E8J A;  1NZO A;  4GLQ A;  2RCX A;  5FAP A;  2XK1 A;  1S67 L;  4NKP A;  3QP8 A;  3B33 A;  5HAI A;  1L3L A;  1S1Z A;  2ZQ7 A;  3ZCZ A;  4H6J A;  4HOI A;  1FQG A;  3CG5 A;  1SZV A;  1LHY A;  1L0F A;  2KOI A;  4CPK A;  3D72 A;  3R7W A;  4EEP A;  4GHI B;  2GNX A;  3PAG A;  2I72 A;  5DKL A;  4KQD A;  3D9Y A;  4KZ4 A;  4NXE A;  2I9V A;  3KYQ A;  2VGJ A;  2IWB A;  3RXW A;  3HLW A;  3EQV A;  5FQ9 A;  4HJ3 A;  3LIB A;  1K54 C;  4ME4 A;  4HQA A;  1OJ5 A;  1EWZ A;  2Y4A A;  2K7S A;  2KLI A;  3HL9 A;  1KGE A;  5DTK A;  1XFN A;  3ZNY A;  4OP8 A;  2V0W A;  4FOF A;  3UNW A;  4Q8I A;  4BL2 A;  3OPH A;  5CXW A;  1BSG A;  1WA9 A;  2QMI A;  2XLN A;  3LR5 A;  2WKI A;  4KZ7 A;  1T19 A;  5TR7 A;  4WBG A;  1KDW A;  2M1C A;  4LEN A;  1T1C A;  4Y3I A;  4GHI A;  3GV9 A;  3IT9 A;  2WGW B;  3IQA A;  2Y8H A;  4UA9 A;  3NY4 A;  4BEN A;  3RXX A;  4WZ4 A;  2PR5 A;  2Z2M B;  1GA9 A;  5FAQ A;  3WWX A;  3JPU A;  4JKT A;  2JCH A;  1N4O A;  3SH7 A;  1KVL A;  3N4I A;  4S2L A;  5AJG A;  4BD1 A;  1F5M A;  4IED A;  1FCM A;  5FQQ A;  2QJ7 A;  2WZZ A;  1YQS A;  1E3U D;  2K31 A;  5F68 A;  4QD4 A;  2KX6 A;  3NI9 A;  2J8Y A;  5L10 A;  4S2I A;  3DTI A;  4LV1 A;  3DAV A;  1K4E A;  1W7F A;  2Y2J A;  5FQK A;  2HGV A;  2Y2I A;  4XXR A;  2P74 A;  1VEU B;  5HAR A;  5EVI B;  4JXS A;  4X53 A;  3IHB A;  3LI9 A;  3UB6 A;  1MXO A;  5DJT A;  3UE6 A;  5E2H A;  1FCO A;  1PWG A;  5HWT A;  3SW1 A;  4U0X A;  2W1R A;  1XJ2 A;  4GJ4 A;  5BOH A;  2W1T B;  1W8Y A;  3O86 A;  3G4P A;  3MMH A;  4EEU A;  1PZO A;  4LCM A;  5K5B A;  1J3W A;  2WGW A;  1TEM A;  3SOI A;  5KIZ A;  2PD8 A;  2WKP A;  5AQ7 A;  1G5U A;  4CLC E;  3MR0 A;  2MJ6 A;  4YWZ A;  2FZ0 A;  5FSR A;  1GHI A;  1L2S A;  1JVJ A;  2PD7 A;  2C6W B;  4LRZ E;  4MBH A;  4PM9 A;  5DF7 A;  5GL9 A;  1K55 A;  2HZ5 A;  4I39 A;  5FEF A;  3VP2 A;  3JYI A;  4U3T A;  2BG1 A;  4PHT A;  1S4R A;  3MXQ A;  4O0P A;  1VEU A;  1XPB A;  3M6H A;  3DWZ A;  5EVI A;  1YLJ A;  5FI2 A;  3GSG A;  3I7J A;  1PW8 A;  1ZG6 A;  3HLF A;  1X0O A;  2OAP 1;  3IBR A;  2KDK A;  1AWI A;  1ZTU A;  1MWS A;  1XX2 A;  3ITB A;  3WRZ A;  3BFF A;  1W8Q A;  4ZJ3 A;  3FPV A;  1YAX A;  2ZMA A;  2OOL A;  5FQJ A;  4PKY G;  2VJW A;  4OLG A;  3LIA A;  3NOT C;  4OH0 A;  1ACF A;  2J9O A;  4I38 A;  1JNU A;  1PFL A;  2EX9 A;  1OT6 A;  3GEC A;  2FH5 A;  2AVX A;  4F3L B;  4GW9 A;  3W2Z A;  4E3K A;  3BFG A;  3LEQ A;  5HDC A;  4WMC D;  3A0V A;  2EX2 A;  3BLS A;  1QME A;  1JTG A;  3UN7 A;  1JWV A;  2Y2G A;  5E43 A;  3LI8 A;  4II7 A;  4LRY C;  4QU3 A;  3VSL A;  1BUL A;  4R38 A;  4FH2 A;  4DDY A;  3FZC A;  3UDF A;  2YKF A;  2ZMV A;  5FAO A;  4FSF A;  2DMW A;  3JVV A;  3MFX A;  4NXB A;  5L09 A;  1CQA A;  3LUQ A;  1NYM A;  2ZL1 B;  3ZNT A;  3A3F A;  1LSV A;  3RH8 B;  1STZ A;  4MN6 A;  3GRJ A;  3KX0 X;  4H8R A;  2HDQ A;  4BBU A;  2WGV A;  4X68 A;  3UB7 A;  3IXD A;  3E98 A;  2BLS A;  4MBF A;  1D06 A;  5F82 A;  3JVU A;  4PM8 A;  3S7N A;  2ZOI A;  4WEK A;  3UB8 A;  2W3G A;  5GHX A;  2B95 A;  3UE0 A;  1S1Y A;  2H0T A;  3D3O A;  4BQM A;  4QJG A;  4KQO A;  3F1N B;  5KSH A;  1DJB A;  1LL5 A;  3BWL A;  3FPW A;  4D2O A;  3PXP A;  1DJC A;  4N92 A;  5TFQ A;  2ACG A;  1H8Y A;  2OAQ 1;  5EVE A;  4OPR A;  4CLC B;  1L0E A;  1TF1 A;  3OLO A;  3G34 A;  1JWZ A;  2ZQD A;  4DMZ A;  3LEZ A;  2ZM8 A;  2QYB A;  1PIO A;  1OME A;  4KG2 A;  3W4P A;  1YM1 A;  5CEC A;  4LRX C;  4WYY A;  3BEB A;  5F83 A;  4UA7 A;  3T4S A;  3NOU C;  5GLC A;  3N8S A;  1PWC A;  2ZL1 A;  2PU2 A;  3CJM A;  5GHY A;  5TGF A;  4B4Z A;  4KG5 A;  5EFW A;  4HHD A;  4MN5 A;  4I3A A;  4FCF A;  4NET A;  4LV0 A;  5TBM B;  1NJ4 A;  2XD1 A;  2FFF B;  5CHU A;  3MFD A;  1TVF A;  1MWT A;  3O5Y A;  4LPZ A;  1Z09 A;  1CI9 A;  5CHJ A;  3H82 B;  3V3S A;  1ZHH B;  3UPN A;  4Y15 A;  3QP1 A;  4Q0J A;  4UA6 A;  3M6B A;  3Q7V B;  1H5X A;  1FOF A;  3F1N A;  1T18 A;  3MQ0 A;  4GB7 A;  1W5D A;  1SDN A;  2V2F F;  1BLH A;  4S2M A;  4UHU A;  3KO6 A;  1IOU A;  3VOY A;  4RX3 A;  3IBJ A;  4P0M A;  4A5R A;  4CLC A;  1MY8 A;  4E3J A;  3AGD A;  1Q2Q A;  2VA0 A;  1K38 A;  3T1S A;  3BY8 A;  4Y2F A;  2W3D A;  2VZW A;  1PYY A;  5KMW A;  3MXR A;  5HX9 A;  3O3V A;  3MS6 A;  3TJZ C;  4M4X A;  4QWO A;  4ZTK A;  4FTX A;  5EEC A;  4BWI A;  4ETZ A;  5IU1 A;  3BFD A;  3VP1 A;  2PBD P;  4DE3 A;  3EGD C;  1FCN A;  2PYP A;  4IUK A;  3BQA A;  2OSU A;  4OPZ A;  3A3D A;  5TBM A;  4X56 A;  2WKE A;  1S66 L;  3H82 A;  4CQH A;  2JHE A;  1K55 C;  5AQB A;  1PRQ A;  3S7P A;  3Q7V A;  4QB8 A;  4JGQ A;  3SH8 A;  1ERM A;  3C4P A;  5CTM A;  4HES A;  4BL3 A;  2VGL S;  3QHY A;  4NEE D;  4R6L A;  5HAQ A;  3ISG A;  3A0S A;  1NLY A;  1IEM A;  4Y0U A;  2WUQ A;  1QMF A;  5EVI C;  2WKQ A;  1ONG A;  4KZ5 A;  3ZG9 B;  1A0K A;  2V1B A;  4K0W A;  3FWL A;  2EA9 A;  4JPM A;  4R4R A;  2ZBB A;  3G31 A;  3FG8 A;  3SH9 A;  4WEL A;  3RFB A;  2L0W A;  3UPP A;  5FQM A;  2HP5 A;  2O0Y A;  3B42 A;  3D4F A;  5M1A A;  1DP8 A;  3BLM A;  1TS6 A;  5L2F A;  2ZJ9 A;  3FKV A;  2XD5 A;  1GSV A;  1XJ4 A;  3LIE A;  1IKI A;  4JXV A;  3HBR A;  3IXH A;  4CJN A;  3OC2 A;  2X71 A;  3CIT A;  3VP3 A;  5FI6 A;  1ONH A;  4L9E A;  4MDZ A;  5FI7 A;  3BW6 A;  4HH2 A;  3OOV A;  3UPO A;  3T1R A;  2INW A;  3UO9 A;  3SS5 A;  1P9W A;  3GTC A;  4IUH A;  1OTI A;  2W27 A;  3L7H A;  5J8X A;  1OPX A;  3S7O A;  1MWU A;  2JN7 A;  3ZVW A;  4BJP A;  3DTK A;  4OPY A;  5DTT A;  3DWK A;  2VK3 A;  2Z6C A;  4PKY A;  4WL9 A;  1XP4 A;  1YLP A;  2UWX A;  3WS0 A;  4L0L A;  2V1Z A;  3GDI A;  3H7W B;  1FSW A;  3HJI A;  5A92 A;  1KGF A;  2Y2L A;  1BLP A;  4O8G A;  2EWV A;  4ARZ B;  4R4S A;  1S0W A;  4E3I A;  2ZM0 A;  4KZ8 A;  1GHM A;  4QY6 A;  3KYZ A;  1SKO B;  1T1B A;  2J3T C;  2VGK A;  3V5M A;  3ZGA B;  3NJA A;  2XA7 S;  1YMX A;  2R78 A;  4GD6 A;  2JKR M;  1RGY A;  2HJE A;  5EV0 A;  4IJG A;  3VE3 A;  4OQG A;  3FKW A;  2ZM2 A;  2WAF A;  3HUM A;  3HLG A;  3BM6 A;  3L9K A;  3N7W A;  1VET B;  1IEL A;  3HRE A;  4XUX A;  3EQU A;  1IYQ A;  2J7V A;  2J9P A;  3QP6 A;  2EX8 A;  4BBT A;  2EXA A;  2GDN A;  4P87 A;  1TS0 A;  1UGU A;  2Y2Q A;  3P01 A;  1XXM A;  4L9F A;  4JF5 A;  5EVI D;  5FAS A;  3A3I A;  3H7W A;  5CGW A;  5G4Y A;  4B4X A;  1SDE A;  5IHV A;  3T4J A;  2EFX A;  1NLZ A;  4MNR A;  3W8K A;  3B47 A;  1ES3 A;  3PBO A;  2B18 A;  4RVA A;  4ARZ A;  2L1M A;  3LIC A;  2QPN A;  3T4T A;  3T4L A;  5HPI A;  2J80 A;  4EU0 A;  5EOE A;  5I5L A;  4EXO A;  2WAD A;  3OPP A;  5HFO A;  5EPH A;  2XR0 A;  3T12 B;  5G18 A;  1S6R A;  2Y55 A;  5CEB A;  1Y28 A;  5CED A;  5F1F A;  1SKO A;  2JC7 A;  4IBR A;  5TJJ A;  2VV8 A;  4DXB A;  2JKF A;  5FDH A;  2ZQ8 A;  4CLC C;  5HWV A;  1O7E A;  1NY0 A;  5J3W A;  5DF8 A;  4HEF A;  5GLD A;  3N8R A;  1V9Z A;  3NDE A;  4JXW A;  1VET A;  4JF6 A;  1GSX A;  3UY6 A;  4Y0T A;  2M7V A;  4LLO B;  4ZBE A;  4PM5 A;  1HZO A;  3SZT A;  3OZH A;  1RP5 A;  2VGL M;  4YFM A;  4EES A;  4EER A;  5DKK A;  2P04 A;  5U47 A;  3NOP C;  2Q9M A;  1KE0 A;  1JTD A;  3BQ8 A;  3EEH A;  4KEN B;  4B9O A;  4QY5 A;  4OLD A;  1RGZ A;  3Q7Z A;  1K57 C;  3PBQ A;  2QJ5 A;  1XJ6 A;  3PBN A;  3HUN A;  1FIL A;  3G2Y A;  3C8C A;  5I94 A;  3IXG A;  3E4Q A;  3P98 A;  1DJA A;  3EEA A;  3PBS A;  1YMS A;  3E2L A;  2CMN A;  2J3T D;  3C30 A;  3S1Y A;  2P08 A;  1K4F A;  1GCE A;  4WM9 A;  3OPR A;  4N1H A;  4WN5 A;  5J4E A;  3SS4 A;  5HL6 A;  4GDB A;  4JBF A;  4LV3 A;  1LL9 A;  4GNU A;  1ES4 A;  3HJK A;  2OWH A;  4X55 A;  1MZU A;  2JKT M;  4DXC A;  4EWF A;  4OQH A;  5CRF A;  1IYP A;  4HI4 A;  4ZRR A;  2H0Y A;  5CGS A;  1ZKJ A;  2HPB A;  4WZ5 C;  3B3X A;  4DE2 A;  5A8B A;  1Y4O A;  2O9C A;  1MKM A;  4DJ3 A;  2VEA A;  3G6O A;  2QWS A;  3OCN A;  2OLV A;  3HCY A;  1P0Z A;  3KYE A;  1TD5 A;  1SCW A;  3NCK A;  1G6A A;  1XA7 A;  4OOM A;  2DRW A;  1XA1 A;  2JKR I;  3KSG A;  5FAT A;  1NYY A;  4RA7 A;  4E3L A;  2X01 A;  4R23 A;  1BLS A;  3F1P B;  3M2K A;  4Y7P A;  4ESP A;  2Y91 A;  1WYC A;  2OWJ A;  4EBL A;  1N9O A;  1BYW A;  1D7E A;  2XA7 M;  3C2W A;  3G30 A;  5LBR A;  3TRC A;  4OQI A;  3E0Y A;  1UWP X;  5J7E A;  4CLC D;  4Q0I A;  3UE1 A;  3LR0 A;  3T1Q B;  3VOZ A;  2CC1 A;  3C38 A;  4GKU A;  1CI8 A;  4N1X A;  3IH9 A;  4L9G A;  2XSS A;  4X69 A;  3VP0 A;  3C7V A;  3T1X A;  5DJU A;  2ZQ9 A;  2HDR A;  2R9X A;  1XGI A;  4PPR A;  1GA0 A;  3DTM A;  3TE8 A;  2BAS A;  2QHK A;  3PBT A;  2WAE A;  3ZG0 A;  3BFC A;  2PU4 A;  4HJ4 A;  3WS1 A;  5CER A;  3BRM A;  2R9W A;  3RJU A;  3G35 A;  1E4D A;  3TOI A;  1JWP A;  3VFH A;  3IX3 A;  2GZA A;  3TSG A;  3F1P A;  5HD5 A;  4ID4 A;  2Y2K A;  1KGG A;  2V9A A;  2WKR A;  1J9M A;  4XUZ A;  2JKG A;  3CI6 A;  1N9L A;  1YSP A;  4GZB A;  4R70 A;  1Q2P A;  5FDS A;  3W4O A;  2NUP C;  3BY9 A;  2Y79 A;  2LB5 A;  4PAU A;  3IXB A;  4E6W A;  4M3K A;  1W63 Q;  1I5Q A;  2VV6 A;  4JGP A;  5F5Y A;  4EET B;  3IF6 C;  3MZF A;  4C75 A;  3CHW P;  1F98 A;  2PT7 A;  3PR6 A;  4S2J A;  2EXB A;  3T4Q A;  1KVM A;  3QP4 A;  2PR6 A;  1DRM A;  4LCL A;  4DKI A;  4KZ3 A;  3U2A A;  1ES2 A;  1IFQ A;  4OPQ A;  4EV4 A;  1ALQ A;  3MKF A;  3MZD A;  4B88 A;  5A90 A;  2JE5 A;  5DVA A;  1VQQ A;  1K56 A;  1NXY A;  1IKG A;  1BTL A;  1WE4 A;  4EQ1 A;  1L0G A;  5A93 A;  2XDM A;  2W3H A;  2XF3 A;  3GVB A;  4LFU A;  4PMA A;  3UMD A;  3P7N A;  1HD8 A;  1K6S A;  4OOL A;  1K57 A;  3VFF A;  1Y54 A;  1XGJ A;  2EFU A;  1I2S A;  4YIN A;  4ZAM A;  3BFE A;  4UQI S;  3QP5 A;  3V39 A;  1HTZ A;  5C5K A;  2Q9N A;  5HW3 A;  4HH3 A;  3KSI A;  5DFX A;  4E3O A;  3G2Z A;  4FUW A;  3WS5 A;  3K3C A;  5DF9 A;  2A2L A;  5E2F A;  1D1J A;  2ZC5 B;  4Z1W A;  3EOI A;  2WGI A;  2C5W B;  2Y2M A;  1ESI A;  4R0Q A;  1DP9 A;  2ZLY A;  3LYX A;  4EBN A;  4NXF A;  1W63 M;  4MN7 A;  2H10 A;  3EWK A;  1BLC A;  1G68 A;  3DTE A;  4MBK A;  3WS2 A;  3VV4 A;  3HLD A;  1BT5 A;  3RTY A;  3A0R A;  4X1M A;  1ES5 A;  1VB6 A;  3V3R A;  4WZ5 A;  4E3N A;  4DF6 A;  2B5R A;  2V1A A;  3FC7 A;  3VMA A;  1NRF A;  3M2J A;  5AVF A;  3MJQ A;  4IHQ A;  4S2N C;  4P6Z S;  3UB5 P;  4MCW A;  4BLM A;  3Q81 A;  3UE3 A;  3ZG5 A;  2HDS A;  3A3J A;  1KOU A;  3ZG8 B;  2GX5 A;  1ZC2 A;  3WS4 A;  3PHY A;  4EBP A;  1YLT A;  3FYZ A;  3LR4 A;  1IYO A;  4BBV A;  3Q07 A;  3IS2 B;  3CPT A;  2ZMF A;  4HP4 A;  2ZC7 A;  1YLZ A;  2HP9 A;  3BJN A;  3PTE A;  1CEF A;  1XKZ A;  3F1O B;  4X1L A;  3BYD A;  3NDG A;  2W3E A;  4O01 A;  4X25 A;  3IF5 A;  1OJG A;  2LB9 A;  4ETX A;  3IF6 B;  3O88 A;  3OBF A;  1LSW A;  2EWW A;  4Y17 A;  5CGX A;  3T4K A;  3UDI A;  4JF4 A;  3C4O A;  1XJ3 A;  5FA7 A;  3DW0 A;  3CUE A;  5D3O A;  1NWZ A;  4RX2 A;  2V8C A;  3ICY A;  2JBF A;  3MQQ A;  2E8I A;  1ODV A;  2Y2H A;  1FR6 A;  3O87 A;  5HPF A;  3GQZ A;  2O9A A;  2A49 A;  5CX7 A;  4UAA A;  1S4S A;  3HLB A;  4LV2 A;  1EW0 A;  3IX8 A;  2J3W A;  3Q82 A;  1GSW A;  3IWI A;  3GMW A;  4GOG A;  4P85 A;  1PW1 A;  5KZH A;  3T50 A;  3OCL A;  3IS2 A;  1SKF A;  3LID A;  5AVE A;  2H28 A;  1EI5 A;  3F1O A;  1M6K A;  3IX4 A;  4WUJ A;  3S4X A;  3E4P A;  3HUO A;  1CK3 A;  3IF6 A;  3IH8 A;  4HIA A;  4UEY A;  3ZDJ A;  2D01 A;  5GHZ A;  4RQ9 A;  1H0M A;  5FQI A;  2XRO A;  1LL8 A;  5L07 A;  3ZG7 B;  1MWR A;  1YKD A;  2ZD8 A;  1YPR A;  3SS3 A;  2X02 A;  3AGE A;  2A3U A;  3V67 A;  2G2W A;  3LFV A;  1FSY A;  1H8M A;  3PYP A;  1HVB A;  2V8F A;  1WYB A;  1XFQ A;  1M40 A;  2WZX A;  2B02 A;  2YKH A;  2GJ3 A;  4X6T A;  3NC8 A;  3MBZ A;  1K25 A;  5EM0 A;  2XEP A;  4N9L A;  3HLC A;  2HJ9 C;  5AQ9 A;  2PYR A;  1O07 A;  4BMW A;  4F94 A;  4KZA A;  2XRN A;  1HLU P;  4GS9 B;  3IHA A;  2EX6 A;  3A3E A;  1H3Q A;  5HWW A;  1DP6 A;  2VLG A;  2HDU A;  1KE3 A;  4KQQ A;  5EUA A;  2IWD A;  1PZP A;  3CLO A;  1LT0 A;  2QKP A;  3N8L A;  1FR1 A;  4UQI M;  4NG2 A;  5L8M A;  3N6I A;  4EUV A;  4KZ6 A;  5CTN A;  2M7U A;  1MC0 A;  5HDS A;  2P7J A;  5EE8 A;  1E25 A;  1CF0 A;  1PWD A;  4K0X A;  3LY4 A;  3UB9 A;  2Y2N A;  3S7Q A;  4GD8 A;  4IVK A;  1KE4 A;  1E3U A;  4OOY A;  4D60 A;  4DRT A;  4G3K A;  1OTA A;  1OTB A;  4P6B A;  1I2W A;  5HDD A;  4BD0 A;  4RYE A;  4PM6 A;  2O99 A;  4HY8 A;  3WRT A;  3W4Q A;  2XGN A;  1OTD A;  1ZG4 A;  5F69 A;  4MLL A;  3LGO A;  1C3B A;  4HJ6 A;  3QNC A;  2XH9 A;  3KSH A;  4EW7 A;  2VV7 A;  1OTE A;  4DE1 A;  4I5S A;  4EQI A;  4DJ2 A;  4I3I A;  2PRF A;  1PI4 A;  3ITA A;  4GS9 A;  4P6Z M;  2RL3 A;  1TS8 A;  5E2G A;  3HVF A;  1YLY A;  2OLU A;  1MPL A;  4YNR A;  2W1T A;  1NRJ A;  2ZC6 B;  1LI0 A;  4S2N A;  3TW8 A;  5A91 A;  4OVD A;  2G2U A;  1LLB A;  2UV0 E;  2XFS A;  2Q0O A;  4O7D A;  5MC7 A;  2IWC A;  4KUK A;  4KUO A;  2ZQC A;  4JGR A;  4KZ9 A;  3E2K A;  4R1G A;  4S2P A;  4KZB A;  1IYS A;  1OT9 A;  5M18 A;  4YOF A;  3IWQ A;  3NBL A;  1V9Y A;  2ZQA A;  5F6A A;  4R3A A;  4E6X A;  4XT2 B;  1W79 A;  3PBR A;  3MKE A;  1BZA A;  4QHC A;  5DTS A;  1MKI A;  4LGW A;  2FFY A;  2VKS A;  3OPL A;  3R4K A;  2XQZ A;  3LO7 A;  1BUE A;  4C3Q A;  2A24 B;  2PDR A;  2BTF P;  2DNS A;  1P9R A;  1K54 A;  1DY6 A;  2H5S A;  3CZD A;  3VOL A;  3DBA A;  2DCF A;  4ZJ2 A;  5HAP A;  4FD8 A;  3K2N A;  1RCJ A;  4KQR A;  5FEG A;  3AGF A;  4ZJ1 A;  1PI5 A;  5KSC A;  2L4R A;  3ZFZ A;  4DE0 A;  2V0U A;  1NZU A;  1GHP A;  4HNB A;  3LY3 A;  1TDG A;  5HSQ A;  3CUE C;  4OP5 A;  1VM1 A;  4GCZ A;  1K6R A;  2Y2O A;  2VX8 A;  1G28 A;  3GR2 A;  4DN0 A;  4F3L A;  5E2E A;  3FV7 A;  3C7U A;  2WK0 A;  4XT2 A;  4WEJ A;  4Z9Q A;  1ERQ A;  2P9V B;  2HV1 A;  1K56 D;  2D02 A;  3NHQ A;  3Q1F A;  2PAV P;  3MZE A;  3NUL A;  3UDX A;  4U0T A;  5IS1 A;  5AQA A;  4WMC A;  1N9B A;  1CJF A;  3BEC A;  1ERO A;  4OQ0 A;  4HBU A;  4JLF A;  4NK3 A;  5EVL A;  2A24 A;  5HL1 A;  1VHM A;  3MSH A;  1MBL A;  3ZVT A;  3ZYT A;  4OON A;  2XFT A;  4R3J A;  5EM1 A;  1AXB A;  3IWO A;  1YT4 A;  5FL3 A;  4EUZ A;  2PHY A;  3QNB A;  2O9B A;  3S22 A;  4WLA A;  2Z2L B;  4B93 A; 
#chains in the Genus database with same CATH homology
 4DF6 A;  1XXM A;  2B5R A;  3VMA A;  4JF5 A;  5EVI D;  4E3K A;  3A3I A;  5CGW A;  3BFG A;  1NRF A;  3G32 A;  3V50 A;  2PBY A;  3M2J A;  1SDE A;  4B4X A;  5IHV A;  4S2N C;  2EFX A;  4MNR A;  3W8K A;  4WMC D;  2EX2 A;  3BLS A;  1QME A;  1ES3 A;  1JTG A;  3PBO A;  3Q81 A;  3UE3 A;  4BLM A;  3ZG5 A;  2HDS A;  3UN7 A;  1JWV A;  4RVA A;  4C6Y A;  2Y2G A;  3A3J A;  5E43 A;  3ZG8 B;  3P09 A;  1ZC2 A;  5JYO A;  3WS4 A;  2QPN A;  2WKH A;  4EBP A;  1CEG A;  5EOE A;  1YLT A;  4QU3 A;  3FYZ A;  3VSL A;  1IYO A;  2WAD A;  3OPP A;  3Q07 A;  1BUL A;  4MEZ A;  5EPH A;  5HFO A;  2XR0 A;  4FH2 A;  5F1G A;  5G18 A;  4DDY A;  1S6R A;  4DDS A;  3FZC A;  2Y55 A;  2ZC7 A;  4ZDX A;  5CEB A;  5CED A;  3UDF A;  1YLZ A;  5F1F A;  2JC7 A;  4OKP A;  2HP9 A;  4IBR A;  5FAO A;  4FSF A;  4GDN A;  4KG6 A;  4S2O A;  3PTE A;  1CEF A;  1XKZ A;  4R3B A;  3TG9 A;  1NYM A;  4JXG A;  2P9V A;  2ZC3 B;  3ZNT A;  3VP4 A;  3A3F A;  4DXB A;  5FDH A;  1LI9 A;  3PAE A;  2ZQ8 A;  3LCE A;  3BYD A;  3NDG A;  3ZHH A;  3GRJ A;  1O7E A;  1NY0 A;  1SHV A;  4GN2 A;  1ESU A;  2WYX A;  2HDQ A;  4H8R A;  5DF8 A;  1H8Z A;  2WGV A;  4HEF A;  3IF5 A;  4K91 A;  4X68 A;  3IF6 B;  5GLD A;  5GLA A;  3IXD A;  2Y59 A;  4IVI A;  3O88 A;  2BLS A;  3N8R A;  4E3M A;  5CGX A;  2V20 A;  4MBF A;  3UDI A;  4JF4 A;  3NDE A;  4JXW A;  5F82 A;  3C4O A;  4PM8 A;  2Y2P A;  4JF6 A;  4PM7 A;  3UY6 A;  4WEK A;  4Y0T A;  5FA7 A;  5GHX A;  3DW0 A;  3UE0 A;  5D3O A;  2H0T A;  3NIA A;  4BQM A;  4ZBE A;  3HLE A;  4PM5 A;  4RX2 A;  4QJG A;  2JBF A;  4Y0O A;  1HZO A;  1L0D A;  3MXS A;  2E8I A;  2Y2H A;  3OZH A;  4KQO A;  1RP5 A;  4S2K A;  1FR6 A;  4YFM A;  5KSH A;  3O87 A;  3GQZ A;  5JYP A;  4HBT A;  2A49 A;  5U47 A;  3CMZ A;  1DJB A;  1U60 A;  1LL5 A;  2Q9M A;  4D2O A;  1KE0 A;  4UAA A;  4IBX A;  1KDS A;  1JTD A;  1DJC A;  4N92 A;  3C5A A;  4LV2 A;  3HLB A;  5CHM A;  5TFQ A;  1H8Y A;  4KEN B;  4OPR A;  4QY5 A;  1L0E A;  3Q82 A;  5M19 A;  3G34 A;  4OLD A;  1RGZ A;  1JWZ A;  2ZQD A;  1K57 C;  3PBQ A;  3Q7Z A;  4N9K A;  3LEZ A;  3IWI A;  2ZM8 A;  3GMW A;  5GLB A;  4GOG A;  1PIO A;  3PBN A;  4P85 A;  1PW1 A;  1OME A;  5KZH A;  3VSK A;  4KG2 A;  3W4P A;  3HUN A;  5EOO A;  3OCL A;  3G2Y A;  1YM1 A;  5CEC A;  5I94 A;  3IXG A;  1Z6F A;  2HP6 A;  2ZC4 B;  1SKF A;  3P98 A;  1DJA A;  3PBS A;  1YLW A;  2QZ6 A;  4WYY A;  2OV5 A;  3BEB A;  1YMS A;  5F83 A;  3E2L A;  1TDL A;  4UA7 A;  1EI5 A;  5GLC A;  3N8S A;  1PWC A;  4FH4 A;  3S1Y A;  1K4F A;  2PU2 A;  1M6K A;  1GCE A;  1NZO A;  3CJM A;  4WM9 A;  5GHY A;  5TGF A;  3OPR A;  4N1H A;  4B4Z A;  2RCX A;  4KG5 A;  4K0W A;  5FAP A;  3S4X A;  3HUO A;  2XK1 A;  1CK3 A;  3SS4 A;  3IF6 A;  3IH8 A;  3ZDJ A;  4FCF A;  4NET A;  4LV0 A;  4GDB A;  5GHZ A;  3V3R A;  1NJ4 A;  5HAI A;  2XD1 A;  4JBF A;  2FFF B;  4LV3 A;  1LL9 A;  5CHU A;  4GNU A;  3MFD A;  2ZQ7 A;  1TVF A;  1ES4 A;  1MWT A;  3ZCZ A;  5FQI A;  1CI9 A;  5CHJ A;  3ZG7 B;  3V3S A;  1MWR A;  4X55 A;  2ZD8 A;  3SS3 A;  2X02 A;  3AGE A;  3UPN A;  1FQG A;  3CG5 A;  2A3U A;  4DXC A;  4EWF A;  4OQH A;  4UA6 A;  5CRF A;  1IYP A;  1LHY A;  1L0F A;  2G2W A;  3M6B A;  3Q7V B;  1FSY A;  1FOF A;  1H5X A;  4CPK A;  2H0Y A;  5CGS A;  1ZKJ A;  1HVB A;  3PAG A;  2HPB A;  4WZ5 C;  2I72 A;  3B3X A;  4GB7 A;  1W5D A;  1WYB A;  4DE2 A;  1M40 A;  2WZX A;  4X6T A;  1SDN A;  2V2F F;  1BLH A;  1K25 A;  3MBZ A;  3NC8 A;  4S2M A;  2XEP A;  4N9L A;  4UHU A;  3HLC A;  3OCN A;  4KZ4 A;  5AQ9 A;  3VOY A;  1O07 A;  2OLV A;  4RX3 A;  4F94 A;  4KZA A;  4P0M A;  4A5R A;  1MY8 A;  2VGJ A;  3AGD A;  4E3J A;  1SCW A;  3NCK A;  2IWB A;  1Q2Q A;  1G6A A;  1XA7 A;  3IHA A;  1K38 A;  2EX6 A;  4OOM A;  2DRW A;  1XA1 A;  3A3E A;  3RXW A;  3HLW A;  5FAT A;  1NYY A;  4RA7 A;  3EQV A;  2HDU A;  5FQ9 A;  1PYY A;  4E3L A;  2X01 A;  4R23 A;  1BLS A;  5KMW A;  1KE3 A;  4KQQ A;  5EUA A;  3MXR A;  3M2K A;  3O3V A;  5HX9 A;  2IWD A;  4Y7P A;  1K54 C;  1PZP A;  2Y91 A;  1WYC A;  1EWZ A;  2Y4A A;  4ZTK A;  3N8L A;  3HL9 A;  1FR1 A;  4EBL A;  5FAS A;  5EEC A;  1KGE A;  5DTK A;  3G30 A;  3N6I A;  3BFD A;  4KZ6 A;  3ZNY A;  3VP1 A;  5CTN A;  4OP8 A;  3UNW A;  4DE3 A;  1FCN A;  4OQI A;  4Q8I A;  4BL2 A;  2OSU A;  4OPZ A;  3A3D A;  3OPH A;  5CXW A;  1BSG A;  4X56 A;  3UE1 A;  5EE8 A;  1E25 A;  3VOZ A;  1PWD A;  4K0X A;  3LY4 A;  2QMI A;  2XLN A;  2CC1 A;  2Y2N A;  2WKE A;  4GKU A;  4GD8 A;  2WKI A;  1CI8 A;  4IVK A;  1KE4 A;  1E3U A;  3IH9 A;  4N1X A;  4OOY A;  4KZ7 A;  4X69 A;  4DRT A;  5TR7 A;  3VP0 A;  1K55 C;  3C7V A;  5AQB A;  4P6B A;  1I2W A;  4WBG A;  1KDW A;  4BD0 A;  2ZQ9 A;  2HDR A;  2R9X A;  1XGI A;  3Q7V A;  4LEN A;  4PM6 A;  4RYE A;  4PPR A;  3WRT A;  4QB8 A;  3W4Q A;  2XGN A;  3SH8 A;  1GA0 A;  3GV9 A;  1ERM A;  3C4P A;  2WGW B;  3DTM A;  3IT9 A;  3IQA A;  4UA9 A;  5CTM A;  3PBT A;  4HES A;  3NY4 A;  4BL3 A;  4BEN A;  1ZG4 A;  3RXX A;  2WAE A;  2Z2M B;  4MLL A;  4WZ4 A;  1GA9 A;  3QHY A;  5FAQ A;  3WWX A;  3BFC A;  3ZG0 A;  5HAQ A;  1C3B A;  3ISG A;  2PU4 A;  4JKT A;  2JCH A;  3QNC A;  1IEM A;  1N4O A;  2XH9 A;  4Y0U A;  2WUQ A;  1QMF A;  3SH7 A;  1KVL A;  3WS1 A;  5CER A;  3N4I A;  5EVI C;  4S2L A;  3BRM A;  4BD1 A;  4DE1 A;  4EQI A;  1ONG A;  4KZ5 A;  3ZG9 B;  1PI4 A;  4IED A;  2R9W A;  3ITA A;  2RL3 A;  1FCM A;  5FQQ A;  5E2G A;  3RJU A;  3HVF A;  3G35 A;  1E4D A;  1YLY A;  1MPL A;  1JWP A;  1YQS A;  2OLU A;  2WZZ A;  3FWL A;  3TOI A;  3VFH A;  2ZC6 B;  4JPM A;  1LI0 A;  4S2N A;  3TSG A;  5A91 A;  4R4R A;  1E3U D;  4ID4 A;  2Y2K A;  4OVD A;  1KGG A;  2G2U A;  1LLB A;  1J9M A;  4QD4 A;  2XFS A;  3NI9 A;  4XUZ A;  3G31 A;  3SH9 A;  4O7D A;  4GZB A;  4WEL A;  1Q2P A;  2IWC A;  3UPP A;  2J8Y A;  2ZQC A;  3W4O A;  4S2I A;  4LV1 A;  5FQM A;  2HP5 A;  4KZ9 A;  3D4F A;  3E2K A;  3BLM A;  4R1G A;  4S2P A;  1K4E A;  5M1A A;  1W7F A;  4KZB A;  1IYS A;  2Y2J A;  5L2F A;  2ZJ9 A;  3IXB A;  5FQK A;  5M18 A;  3IWQ A;  3NBL A;  3FKV A;  2XD5 A;  4E6W A;  2ZQA A;  2Y2I A;  4M3K A;  4E6X A;  1I5Q A;  1IKI A;  4JXV A;  3HBR A;  1W79 A;  3IF6 C;  3IXH A;  3MZF A;  4XXR A;  2P74 A;  4C75 A;  4CJN A;  3OC2 A;  2X71 A;  5HAR A;  3PBR A;  3VP3 A;  3MKE A;  1BZA A;  4QHC A;  4JXS A;  5DTS A;  1MKI A;  4X53 A;  3IHB A;  5EVI B;  1ONH A;  5FI6 A;  1MXO A;  2FFY A;  3OPL A;  5FI7 A;  2XQZ A;  3UPO A;  4S2J A;  3LO7 A;  1BUE A;  4C3Q A;  5E2H A;  3UO9 A;  1FCO A;  1PWG A;  3SS5 A;  4U0X A;  2EXB A;  1KVM A;  3GTC A;  5BOH A;  2DNS A;  1K54 A;  1W8Y A;  4LCL A;  3O86 A;  3G4P A;  5J8X A;  1MWU A;  3ZVW A;  4DKI A;  4KZ3 A;  4BJP A;  1DY6 A;  1PZO A;  2H5S A;  4LCM A;  1ES2 A;  3CZD A;  2WGW A;  1TEM A;  3SOI A;  4OPY A;  5DTT A;  4OPQ A;  3DWK A;  4EV4 A;  1ALQ A;  3MKF A;  3MZD A;  5AQ7 A;  4B88 A;  5A90 A;  2DCF A;  4ZJ2 A;  1XP4 A;  2JE5 A;  5HAP A;  1YLP A;  5DVA A;  1VQQ A;  2UWX A;  3WS0 A;  1K56 A;  1NXY A;  4L0L A;  4FD8 A;  1IKG A;  1BTL A;  1RCJ A;  2V1Z A;  4KQR A;  1WE4 A;  1L0G A;  1FSW A;  3AGF A;  5FSR A;  4ZJ1 A;  5A93 A;  1GHI A;  1L2S A;  1PI5 A;  2XDM A;  5A92 A;  1KGF A;  2Y2L A;  1JVJ A;  1BLP A;  5KSC A;  2C6W B;  2XF3 A;  3GVB A;  4MBH A;  4PMA A;  3ZFZ A;  4DE0 A;  4R4S A;  4PM9 A;  5DF7 A;  1HD8 A;  1S0W A;  1NZU A;  5GL9 A;  1K6S A;  4OOL A;  1GHP A;  4E3I A;  3LY3 A;  1K57 A;  1TDG A;  2ZM0 A;  1K55 A;  4KZ8 A;  3VFF A;  1Y54 A;  4OP5 A;  1XGJ A;  1VM1 A;  1GHM A;  2EFU A;  3VP2 A;  3JYI A;  1I2S A;  1K6R A;  4U3T A;  2Y2O A;  4YIN A;  4QY6 A;  4ZAM A;  3GR2 A;  2BG1 A;  5E2E A;  3FV7 A;  3BFE A;  3C7U A;  2WK0 A;  2VGK A;  3V5M A;  3ZGA B;  1YMX A;  4GD6 A;  4WEJ A;  4Z9Q A;  3V39 A;  1ERQ A;  1RGY A;  1HTZ A;  2Q9N A;  5HW3 A;  2P9V B;  1XPB A;  3M6H A;  1K56 D;  3DWZ A;  3Q1F A;  3MZE A;  5EVI A;  3UDX A;  1YLJ A;  4U0T A;  3GSG A;  5FI2 A;  3I7J A;  1PW8 A;  4OQG A;  5AQA A;  4E3O A;  3G2Z A;  1ZG6 A;  4WMC A;  1N9B A;  3FKW A;  3BEC A;  3HLF A;  3WS5 A;  2ZM2 A;  5DF9 A;  2WAF A;  1ERO A;  4OQ0 A;  1MWS A;  1XX2 A;  2ZC5 B;  3ITB A;  3HUM A;  4HBU A;  4JLF A;  4NK3 A;  5E2F A;  3HLG A;  5EVL A;  3WRZ A;  5HL1 A;  2WGI A;  3BFF A;  1W8Q A;  3BM6 A;  2C5W B;  1MBL A;  4ZJ3 A;  2Y2M A;  3N7W A;  3ZVT A;  1ESI A;  1IEL A;  2ZMA A;  4R0Q A;  3HRE A;  2ZLY A;  4EBN A;  5FQJ A;  4OON A;  2XFT A;  4R3J A;  4XUX A;  3EQU A;  1AXB A;  1IYQ A;  2J7V A;  2J9P A;  4OLG A;  4OH0 A;  2H10 A;  1BLC A;  1G68 A;  2EX8 A;  4MBK A;  3IWO A;  1YT4 A;  3WS2 A;  2EXA A;  4EUZ A;  2GDN A;  2J9O A;  3HLD A;  3QNB A;  4P87 A;  1BT5 A;  3S22 A;  1ES5 A;  2EX9 A;  2Z2L B;  2Y2Q A;  4WZ5 A;  4E3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...