4JXSA

X-ray crystal structure of ampc beta-lactamase from e. coli in complex with a non-covalent inhibitor 3-[(4-carboxybenzyl)sulfamoyl]thiophene-2-carboxylic acid (compound 4)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
358
structure length
352
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase
publication title Structure-based efforts to optimize a non-beta-lactam inhibitor of AmpC beta-lactamase.
pubmed doi rcsb
source organism Escherichia coli
total genus 117
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4jxsA00
5EOOA 4OPRA 3UE0A 1CEGA 1HD8A 2WGIA 3V3SA 2UWXA 2XD1A 1HVBA 5FI7A 4Y7PA 3NIAA 3PBOA 1MPLA 2ZC6B 4S2NC 3NDEA 1DJBA 1RGZA 1MXOA 3A3EA 1ZG4A 4KZAA 5CXWA 3C4OA 3TSGA 4OONA 4CJNA 3IWQA 4R0QA 4DDSA 2WGVA 4R3JA 3O3VA 3PAGA 5EVIB 3HL9A 2JE5A 4ZJ3A 2H0TA 4GN2A 1K6SA 4S2PA 4BD1A 4L0LA 3UDFA 3BFDA 4LCLA 3ZNYA 1PYYA 3SS3A 1K56D 3IF6A 3VFHA 3VP3A 1XGIA 2HDSA 3MFDA 2R9WA 1K57A 1VQQA 4OQHA 3W4PA 2XR0A 1HTZA 1MWUA 2WADA 4RYEA 4KZ5A 1MWRA 4BQMA 4E3OA 2DRWA 3BEBA 1TDGA 2H10A 4OPZA 4N92A 4UA7A 5A92A 2XEPA 2BLSA 2XH9A 3OPRA 4JXWA 2OSUA 5FAQA 4WZ5C 2ZQ9A 3ZHHA 3V3RA 4BD0A 4BL2A 4DKIA 4WM9A 4DXCA 4U0XA 1NYMA 3PTEA 2DCFA 1FOFA 2P9VA 3WWXA 4WYYA 2HDRA 2QMIA 4JF6A 4E6XA 1IKIA 2WKIA 5DTSA 5E2FA 4QY5A 5F83A 1KVMA 2C5WB 3ZVWA 3I7JA 2J8YA 3N8RA 5GHXA 4IBRA 1KGFA 3A3JA 5F82A 4GDBA 4C6YA 5DF9A 5GLDA 1XKZA 4OPQA 1JWVA 3M6BA 1JTDA 2RL3A 3HREA 4PM7A 3Q7ZA 4M3KA 3RJUA 2EFXA 1CI9A 4P6BA 3HUNA 1S0WA 3LEZA 3N4IA 4JF4A 1O7EA 3MKFA 5CEBA 2EX6A 1K55A 3FWLA 3HLFA 3IXHA 4LV3A 4R4SA 3VP1A 1SHVA 3LY4A 5CERA 3HLBA 3Q7VB 1FCMA 4LCMA 4EQIA 3HLWA 4MBFA 1K56A 3AGDA 4MLLA 3PBNA 3E2KA 4LV1A 3PAEA 5E2EA 3V39A 1W5DA 1N9BA 2JC7A 3TG9A 2A49A 3IF5A 4X55A 3C7UA 2Y4AA 2OLUA 3UPNA 5GLAA 3ZCZA 2G2UA 4HEFA 1TVFA 2XD5A 3WS5A 3SH9A 1LI0A 1SDNA 1XGJA 1XA1A 3OPHA 1K4EA 4FD8A 4GZBA 3G4PA 1KGGA 1MWTA 2ZQ7A 4RVAA 3BM6A 5F1GA 1J9MA 1KDSA 2FFYA 4WEKA 3GQZA 5G18A 3SOIA 3HLCA 4B4XA 4DE1A 1XX2A 5EVIA 5FQJA 1H5XA 5CHJA 1I5QA 4GDNA 4S2OA 1ONHA 4KZ6A 3PBQA 4YFMA 1K38A 4KZ8A 3B3XA 3OPLA 2Y2JA 1W8YA 3S22A 3P09A 5HW3A 1ZC2A 1PW1A 4QJGA 5M1AA 1ES4A 3MZEA 5I94A 1LL9A 2HP9A 3S1YA 1RGYA 2EX9A 4JPMA 4JXSA 3FV7A 3IXBA 4S2IA 4KZ7A 4GD6A 4EBPA 5FA7A 5FSRA 4S2KA 5CGWA 4QU3A 5CECA 5FATA 3WS2A 4EBLA 2V1ZA 5FI2A 5HX9A 3G2ZA 4OP8A 3CJMA 4S2JA 3LY3A 3UDXA 1IEMA 4GD8A 1EROA 4R4RA 2WZXA 4FSFA 4JBFA 1JVJA 5CGSA 4UHUA 5BOHA 3ITBA 2VGKA 3QHYA 4E3LA 3OZHA 4OH0A 4U3TA 2R9XA 3W4OA 4UA9A 1PZPA 3BFEA 3C4PA 5GLBA 4LENA 4RX2A 1WYCA 1RP5A 5EECA 2JCHA 3N6IA 3NCKA 3M2KA 4OKPA 5M18A 3IXDA 1KDWA 1NRFA 1KGEA 4E3MA 1DY6A 2Z2LB 2HP5A 4P0MA 4WBGA 1BUEA 3Q7VA 5EOEA 3HVFA 3Q1FA 1FCOA 4KZ4A 3FKVA 2EXBA 3HLEA 1SCWA 2WK0A 4Y0OA 2C6WB 4IEDA 4WELA 1NZUA 1ES2A 2IWDA 1JWZA 1YLPA 4KENB 1L0EA 3TOIA 1YT4A 2CC1A 4R23A 1QMEA 4YINA 2ZC3B 1YLTA 2XFSA 4FH2A 5KMWA 5D3OA 4MBKA 5FAPA 1PI4A 3E2LA 5HL1A 1WE4A 2E8IA 1EWZA 3IHAA 3MZFA 3W4QA 3MBZA 2IWCA 2J7VA 2ZJ9A 3M6HA 3SH8A 4DE0A 4C3QA 2Q9NA 3G30A 3VP2A 3W8KA 4KG5A 5E2HA 1L0GA 2Y2OA 3ZGAB 1GHIA 3BRMA 1YLJA 2Y2IA 3ZVTA 5L2FA 3CMZA 1M6KA 1IYOA 3N7WA 3ZNTA 3IF6C 1L0FA 2ZLYA 3NI9A 4QB8A 1K57C 2PBYA 4QY6A 1ALQA 5FI6A 4HBUA 5DVAA 3IHBA 1C3BA 3SS5A 4MEZA 2XQZA 1FR1A 3O86A 2V20A 3QNCA 4Z9QA 3DWZA 3M2JA 4ZDXA 3C7VA 1PI5A 2XF3A 3V5MA 4PM5A 5DTTA 2EFUA 4P85A 1BLSA 4BENA 1ES5A 2Y2PA 3OC2A 4GNUA 2Y2NA 3G35A 4KZBA 4KQQA 3LCEA 4R1GA 4OLGA 4WMCD 2I72A 3ISGA 4DF6A 1TEMA 1Y54A 1YM1A 1Q2PA 4BL3A 2QZ6A 1PWDA 2HDQA 4JXGA 3VMAA 2VGJA 1GA9A 2X71A 4OQGA 4BJPA 4X6TA 2ZC7A 3G34A 3RXWA 1U60A 4E3KA 3G2YA 4XXRA 5GHZA 4NK3A 1KVLA 2OV5A 1ERQA 2GDNA 1I2WA 4KZ3A 2X01A 4RX3A 3OCLA 2Y2GA 4ZJ2A 4E3JA 1ERMA 1PW8A 4JF5A 4PM9A 3WS0A 3VOZA 1K54A 2FFFB 1M40A 3LO7A 3P98A 2ZM2A 1G6AA 1S6RA 3PBSA 3SS4A 4BLMA 4NETA 2Y59A 3HUOA 3JYIA 4MNRA 2HPBA 5TGFA 1XXMA 3G32A 1MBLA 1NZOA 1YLYA 4OOYA 1YQSA 3WS4A 4CPKA 5M19A 3O88A 3SH7A 4S2MA 4N9LA 4X69A 1E3UD 1PWCA 3PBRA 1KE3A 3WS1A 3MZDA 2HDUA 2ZQ8A 1BTLA 1W79A 3MXSA 5AQ7A 3C5AA 3IXGA 4S2LA 3UE3A 4WZ4A 4WMCA 2WGWB 3GTCA 4KQRA 3FZCA 5HARA 5TR7A 4WEJA 3VP4A 1SDEA 1BLCA 4FH4A 2IWBA 3IQAA 4UA6A 1MKIA 5HAPA 5EVIC 1IYQA 3ZG7B 4DDYA 2WYXA 3Q81A 2G2WA 3UDIA 2X02A 3ZFZA 5FQIA 5GHYA 2Y2MA 3MXRA 4PPRA 5GLCA 4JXVA 4S2NA 3UO9A 1I2SA 3BFCA 4ZBEA 3N8LA 4EBNA 1ONGA 3WRZA 3BLMA 4FCFA 1QMFA 2HP6A 4OLDA 5EUAA 1CK3A 4EUZA 1PIOA 4OQ0A 1CI8A 2PU2A 1FSWA 1H8ZA 2Y91A 1JTGA 1Z6FA 4B4ZA 3GMWA 2H5SA 5CEDA 5EVLA 1G68A 3UE1A 4E3NA 1DJAA 1FR6A 4Y0UA 2Y2QA 3UPPA 1K6RA 4XUZA 1FQGA 1BULA 1MWSA 1E3UA 3OPPA 3FYZA 4LV2A 5HAQA 2ZM0A 2H0YA 1GHMA 2XLNA 3A3FA 5GL9A 4X53A 3BFGA 1L0DA 4WZ5A 3AGFA 2XDMA 5U47A 5JYOA 3AGEA 5AQAA 1ES3A 2PU4A 2XK1A 4JKTA 1ESUA 1N4OA 1L2SA 3HLGA 4DE2A 4E3IA 1Q2QA 3Q07A 1EI5A 1OMEA 4KZ9A 3BYDA 3BFFA 1O07A 3PBTA 1IKGA 3HUMA 5E43A 3S4XA 2WAEA 2ZD8A 2BG1A 3VP0A 3WRTA 3ZG0A 2WUQA 4QD4A 4ZJ1A 1KE0A 4DRTA 5FQ9A 3RXXA 4X56A 2ZQAA 1GCEA 3ZG8B 3VOYA 1IYPA 2Q9MA 2EX2A 1IELA 3GRJA 4D2OA 4XUXA 1IYSA 1WYBA 1DJCA 1NY0A 3NDGA 5CHMA 3IWOA 3ZG5A 2WKEA 5J8XA 2DNSA 3BECA 2Y55A 2ZQCA 3OCNA 4UAAA 1JWPA 4EV4A 4OP5A 2OLVA 3QNBA 5CGXA 1ESIA 1MY8A 1VM1A 3IH9A 4GB7A 4OPYA 2Y2LA 1NJ4A 1YMSA 5EVID 4KG6A 2WGWA 4Y0TA 1GHPA 4OOLA 1HZOA 3G31A 3MKEA 3DWKA 3ITAA 1LI9A 3NC8A 5E2GA 4IBXA 3O87A 3DW0A 5A91A 4LV0A 5CTMA 5FQMA 4ZTKA 3UNWA 3A3DA 4PMAA 5KZHA 1CEFA 4PM8A 4R3BA 1XPBA 3VSLA 2B5RA 3DTMA 3EQVA 1BLPA 5DF8A 3IT9A 1AXBA 1ZKJA 2P74A 4MBHA 1FSYA 5EE8A 4GOGA 2ZM8A 3N8SA 4ZAMA 2Y2KA 1BSGA 1LHYA 5A93A 4X68A 1ZG6A 4QHCA 2WZZA 4GKUA 5AQ9A 2EXAA 3NBLA 4N1XA 4JLFA 3NY4A 1E25A 1SKFA 4H8RA 4KG2A 4DE3A 1TDLA 1RCJA 1PWGA 1K4FA 3BLSA 3CZDA 3IF6B 3ZG9B 1GA0A 1K55C 2XGNA 4OQIA 1YLWA 2EX8A 5CRFA 5DF7A 1W8QA 1PZOA 1XA7A 2ZC4B 3V50A 4PM6A 5FDHA 4KQOA 4DXBA 2Y2HA 4B88A 2Z2MB 5EPHA 3UPOA 3FKWA 5CHUA 2RCXA 3UY6A 5KSCA 1YMXA 1XP4A 5FASA 1LLBA 2P9VB 4N1HA 4N9KA 3IWIA 3A3IA 5FAOA 4P87A 1NYYA 1YLZA 4EWFA 3D4FA 1K54C 5FQKA 4Q8IA 4C75A 4U0TA 2JBFA 1LL5A 1NXYA 2J9PA 3GSGA 3CG5A 5IHVA 1E4DA 1BLHA 3EQUA 1BZAA 3VFFA 2J9OA 4HBTA 5TFQA 2WKHA 4IVKA 5DTKA 4F94A 1FCNA 1W7FA 3GVBA 4HESA 5FQQA 3HBRA 5F1FA 4OOMA 4K0WA 1K25A 4E6WA 1H8YA 4O7DA 4OVDA 2V2FF 3VSKA 2ZC5B 3IH8A 2WAFA 3GV9A 2XFTA 5CTNA 3UN7A 4ID4A 4K0XA 5HFOA 4IVIA 3ZDJA 5HAIA 4RA7A 2A3UA 3GR2A 2QPNA 3Q82A 4K91A 5A90A 3HLDA 5AQBA 2ZQDA 4A5RA 1BT5A 5KSHA 5JYPA 2ZMAA 1KE4A
chains in the Genus database with same CATH superfamily
2VA0A 3MJQA 4QWOA 3UE0A 4R38A 1F9IA 5FI7A 4ZRRA 4S2NC 5HWTA 1DJBA 4KZAA 3TSGA 1ZG4A 4NXGA 4OONA 4D60A 4CJNA 3LFVA 1K6SA 3UDFA 1K56D 1XGIA 3EEAA 2R9WA 1K57A 1VQQA 1KOUA 2WADA 1MWRA 5HDSA 4NXEA 3MR0A 2LB9A 1TDGA 4N92A 5A92A 2PHYA 3ZHHA 4WZ5C 2ZQ9A 4H6JA 3V3RA 3HCYA 2ZMVA 3A0VA 4WYYA 2QMIA 4E6XA 4II7A 3ZVWA 2WKRA 3I7JA 3N8RA 3H9WA 5F82A 1GSXA 4C6YA 3T4LA 1JWVA 4PM7A 2EFXA 3HUNA 1S0WA 1O7EA 1Y28A 1K55A 3FWLA 4LV3A 3IXHA 3VP1A 1NWZA 1PRQA 2M1CA 2W3FA 3LY4A 4LCMA 3T1RA 1W5DA 1N9BA 2JC7A 2JKTI 2A49A 3IF5A 3K3DA 4X55A 4EW7A 2Y4AA 2OLUA 1CQAA 3KYEA 5GLAA 1XJ6A 4HEFA 3P01A 3WS5A 1LI0A 1S1ZA 1MWTA 3EWKA 4Y15A 4RVAA 3GQZA 1D1JA 2WKQA 3HLCA 4EU0A 2VGLM 5FQJA 1H5XA 1I5QA 3H7WB 1ONHA 3OPLA 1OTIA 3P09A 1PW1A 4XT2B 2HP9A 3DTIA 1TS0A 3IXBA 1T18A 5FSRA 4S2KA 4WL9A 5FATA 5HX9A 3G2ZA 2NUPC 2WZXA 1JVJA 5CGSA 3KSIA 4U3TA 4UA9A 1FIKA 2Z6DA 4LENA 5I5LA 3M2KA 4E04A 5M18A 2HGVA 3LUQA 3F1NB 2Z2LB 2PYPA 1FCOA 4KZ4A 3FKVA 4WLAA 5HWVA 4IEDA 4WELA 3S7PA 2V8FA 1ES2A 3DTEA 1JWZA 4KENB 2O9CA 1L0EA 2W1RA 2ZC3B 1YLTA 1W63Q 5D3OA 4MBKA 5FAPA 4HH3A 1XFQA 3W4QA 2J7VA 3M6HA 5E2HA 2Y2IA 5L2FA 4YWZA 3IF6C 1L0FA 3LYXA 4QB8A 2W3HA 3H82B 3IHBA 4IUKA 4MEZA 2XQZA 3LIAA 1ODVA 3QNCA 2HJ9C 4BENA 3UO9A 3G35A 4KZBA 3CPTA 1H3QA 1Q2PA 4BL3A 1T19A 3VMAA 2X71A 1UWNX 4UQIM 3RXWA 4GCZA 4Q0IA 3CUEC 3LIDA 3QP1A 3KYQA 2Y2GA 5F69A 3BQ8A 1K54A 2PDRA 1M40A 3LO7A 4PKYG 2EWWA 2Y59A 2JHEA 3G32A 1NZOA 1YQSA 4CPKA 2JKTM 5M19A 3BQAA 3O88A 1PWCA 1KE3A 3WS1A 3ICYA 2HDUA 3T50A 1BTLA 4LGWA 5AQ7A 4S2LA 3L9KA 5TR7A 3VP4A 4WEJA 1P97A 2IWBA 5IS1A 5DKLA 1JNUA 2J3TC 5FQIA 2Y2MA 1UWPX 3TRCA 4S2NA 3BFCA 1XJ4A 2HP6A 2W3DA 4EUZA 4L9FA 2Q0OA 4G3KA 1Z6FA 2H5SA 4E3NA 2HZ5A 3UPPA 5AVFA 3LIBA 1MWSA 2V0UA 2H0YA 1GHMA 3FG8A 4WZ5A 3E4QA 2PU4A 4EQ1A 1L2SA 4MN6A 2M7UA 1OMEA 3BYDA 1A0KA 3BFFA 3PBTA 5E43A 2ZD8A 4QD4A 4DRTA 1VETB 3L7HA 3VOYA 4DMZA 1F5MA 3GRJA 4XUXA 3D9YA 4FUWA 1DJCA 3LI9A 3IWOA 3BY9A 3UB9A 3ZG5A 5AJGA 3QP4A 4F3LA 1OJGA 5J4EA 2ZQCA 4UAAA 3QP6A 1JWPA 4HHDA 2ZMFA 3NHQA 1ESIA 3PHYA 1YSQA 5EVID 2WGWA 3O87A 1Y4OA 3DW0A 5A91A 4LV0A 3IX4A 5FQMA 5KZHA 1CEFA 5DF8A 3KSHA 2P74A 4LPZA 4MBHA 4AFIA 5F68A 3N8SA 1SKOA 3NBLA 4DE3A 1SKFA 1K4FA 3CZDA 1K55C 5J7EA 2EX8A 3P7NA 5CRFA 3MQOA 3V50A 4PM6A 4KQOA 4DXBA 3UMDA 2Y2HA 2Z2MB 3E4PA 1SZVA 2P9VB 2VEAA 2IA2A 3A3IA 1NYYA 4BBTA 5FQKA 3F1PA 4KUKA 2J9PA 2R78A 3CG5A 4WN5A 1BZAA 5TFQA 2WKHA 2PR6A 4F94A 2UV0E 4OOMA 4O7DA 4B93A 3IH8A 3E0YA 5MC7A 2XFTA 5CTNA 5HFOA 5DKKA 4B9OA 3EEHA 4RA7A 1WA9A 2QPNA 3Q82A 2YKFA 4K91A 5A90A 2HV1A 5EOOA 4OPRA 1HD8A 1HVBA 4Y7PA 3NIAA 1MPLA 4WUJA 3NDEA 3A3EA 4DDSA 2WGVA 4R3JA 3PAGA 2H0TA 4GN2A 2Y8HA 4LCLA 3ZNYA 3IF6A 3VFHA 2HDSA 3MFDA 3W4PA 4RYEA 3UB8A 3CAXA 4OPZA 2XEPA 2K2NA 4BD0A 2Z6CA 4DXCA 1NYMA 3PTEA 2A2LA 3WWXA 2HDRA 2I9VA 1S4SA 2C5WB 3RFBA 2J8YA 3T1QB 3A3JA 3DAVA 5J3WA 3CUEA 1LSVA 1XKZA 1JTDA 5F6AA 2RL3A 4KUOA 2GZAA 4M3KA 4P6BA 1P0ZA 3KSGA 3HLFA 4R4SA 3HLBA 3Q7VB 1FILA 4GS9A 4MBFA 1K56A 3PBNA 4LV1A 3PAEA 5HPFA 3ZCZA 5HZHA 5FEFA 3FPVA 2XD5A 1LL8A 4JGPA 4FD8A 3G4PA 1KGGA 2W1TB 2ZQ7A 2G7UA 3SOIA 4B4XA 1NLYA 2PYRA 1X0OA 4S2OA 4YFMA 4KZ8A 2P04A 3B3XA 3K2NA 2Y2JA 5HW3A 1J3WA 4QJGA 3MZEA 5I94A 1LL9A 1RGYA 2EX9A 4JPMA 4JXSA 4S2IA 3DTKA 3WS2A 2W3GA 1MC0A 4UHUA 3ITBA 3QHYA 4E3LA 3OZHA 3C4PA 2W0NA 4PHTA 1RP5A 5EECA 2JCHA 1MZUA 4OKPA 3B42A 3IXDA 1KDWA 1NRFA 5IT5A 1BUEA 3HVFA 3Q1FA 1SCWA 2C6WB 4ETZA 2O0YA 1IOUA 4R70A 2CC1A 4R23A 3F1OB 3QP2A 4FH2A 5KMWA 2OAP1 4IJGA 1WE4A 3MZFA 3E98A 2ZJ9A 4DE0A 3S7OA 2Q9NA 3ZGAB 4KG5A 1L0GA 2Y2OA 1DP6A 1HLUP 3CMZA 5HL6A 3H7WA 1PFLA 4MN7A 4QY6A 1C3BA 3E4OA 4XT2A 2V20A 2CMNA 4MDZA 4ZDXA 1F2KA 1OTAA 1PI5A 5DTTA 1ES5A 2W27A 3OC2A 4B4ZA 2Y2NA 4KQQA 3LCEA 4WMCD 1VEUB 2DMWA 2VV7A 4JXGA 1TS6A 5KIZA 4DJ2A 5GHZA 3K3CA 2OV5A 4FOFA 4KZ3A 3LGOA 3OCLA 4E3JA 1PW8A 4JF5A 3CI6A 2H28A 3LR4A 2ZM2A 1S6RA 1F98A 3F1NA 2QKPA 3SS4A 2JN7A 2V1BA 3JYIA 5FL3A 1XXMA 3MXQA 1MBLA 1YLYA 4HJ4A 1YPRA 1EW0A 1W79A 4NG2A 5HARA 1SDEA 3C8CA 2ZOIA 3VE3A 1MKIA 1GSVA 5DFXA 3Q81A 3UDIA 1ZHHB 2X02A 4JXVA 1I2SA 4HI4A 3H82A 4Y3IA 1D7EA 2L0WA 1ONGA 4EERA 1QMFA 4OLDA 5EUAA 3NECA 3SW1A 1PIOA 1FSWA 1H8ZA 2Y91A 4HP9A 3C30A 1DP9A 1DJAA 4Y0UA 3GDIA 5HAQA 2ZM0A 1OTBA 1L0DA 3AGFA 2XDMA 5U47A 2JKFA 3AGEA 1ES3A 2XK1A 2XA7S 1ESUA 4DE2A 4E3IA 4EEPA 2D02A 2E8JA 1G6OA 3S4XA 3WRTA 3IBRA 4Z1WA 3TJZC 1STZA 5FQ9A 1IYPA 2Q9MA 2EX2A 4D2OA 4L9GA 1NY0A 2WKEA 3BECA 2Y55A 5TJJA 3QP8A 4OP5A 2ACGA 1MY8A 4OPYA 3IH9A 2Y2LA 4GJ4A 1GHPA 4OOLA 1HZOA 1T1BA 1LI9A 3NC8A 2PRFA 1OT9A 2Y79A 3A3DA 1CJFA 4R3BA 3DTMA 4X25A 4CLCB 1AXBA 1VHMA 2ZM8A 4GOGA 4NEED 4ZAMA 1BSGA 4X68A 2V0WA 2VV8A 4N1XA 3V67A 4KG2A 3D3OA 1RCJA 3ZG9B 4OQIA 4B88A 5EPHA 3FKWA 1YMXA 4CLCD 1XP4A 1LLBA 4JGQA 4N1HA 4R3AA 2QJ5A 3IWIA 5FAOA 3D4FA 2W3EA 4C75A 2JBFA 1IFQA 1BLHA 1VETA 3G6OA 4HESA 3GVBA 5F1FA 3HBRA 5HDCA 2O9AA 2V2FF 1N9LA 3NJAA 5HSQA 4ID4A 2VLGA 1P9RA 4JGOA 3IX3A 2BTFP 5KSHA 2MJ6A 2ZMAA 1KE4A 3OOVA 1YSPA 2UWXA 3LR0A 4EESA 1DP8A 4Q0JA 1MXOA 3IS2B 3IWQA 4CLCE 4R0QA 4HIAA 5EVIB 3HL9A 2JE5A 4ZJ3A 4BD1A 4S2PA 4L0LA 3VP3A 5DFYA 2XR0A 1HTZA 1MWUA 4E3OA 2DRWA 3BEBA 2H10A 2XH9A 2OSUA 5FAQA 4BL2A 3UB6A 2L1MA 2DCFA 1FOFA 2P9VA 1LSXA 4JF6A 1IKIA 2J3WA 1LSWA 5F83A 1KVMA 5GHXA 4IBRA 1T1CA 5TBMB 1S1YA 4OPQA 3EOIA 3HREA 3Q7ZA 3PXPA 3RJUA 3N4IA 4JF4A 3MKFA 5CEBA 4HH2A 2EX6A 4MMNA 1G5UA 3KX0X 1SHVA 5CERA 3C38A 1FCMA 1VB6A 3R7WB 3U4LP 3AGDA 4GHIB 4MLLA 5E2EA 2PR5A 4Y17A 3SZTA 3HJKA 4K08A 3T1SA 5L07A 1XGJA 5DJTA 3BM6A 4WEKA 4DE1A 1TD5A 1W63M 4GDNA 3JPUA 4G3VA 3BWLA 1K38A 3S22A 1ZC2A 4YOFA 2EWVA 4LRZE 3S1YA 2XRNA 3FV7A 4EBPA 5FA7A 1XJ2A 2V1ZA 4IHQA 5EM0A 5FI2A 4EUVA 3S7NA 5A8BA 4GD8A 5FEGA 2VGKA 5EM1A 3LR5A 4OH0A 3O5YA 2R9XA 1PZPA 3BFEA 2V8CA 3CLOA 1WYCA 3LICA 3T12B 1P9WA 4HNBA 1KGEA 4P0MA 4GLQA 4WBGA 3Q7VA 2M7VA 2WK0A 1PNEA 1T1AA 1GSWA 2IWDA 1YLPA 2VZWA 3TOIA 1YT4A 2W1TA 4CLCC 5HWWA 1PI4A 3E2LA 5HL1A 1EWZA 3IHAA 4I39A 3MBZA 2IWCA 3SH8A 3G30A 3VP2A 3BRMA 2QHKA 3N7WA 5C5KA 2ZLYA 3NI9A 2PBYA 1ALQA 5FI6A 5DVAA 1FR1A 4Z9QA 3M2JA 3T4JA 4PM5A 2XF3A 5F5YA 2K7SA 2Y2PA 4R1GA 4OLGA 1TEMA 1Y54A 1YM1A 1PWDA 2VGJA 4OQGA 2ZC7A 4XXRA 2OWJA 4NK3A 1KVLA 2B95A 3A0RA 1YKDA 2V9AA 2JKGA 1ERMA 2D01A 2FFFB 3P98A 1G6AA 3PBSA 4BLMA 3HUOA 2A24B 4MNRA 2HPBA 1MKMA 2WKPA 5TGFA 4OOYA 3WS4A 4N9LA 1NLZA 1E3UD 3PYPA 2ZQ8A 1TS7A 3U2AA 3IXGA 3UE3A 3F1OA 4BBUA 4WMCA 3GTCA 4KQRA 3FZCA 4ARZB 4UA6A 5HAPA 5EVIC 3ZG7B 1S67L 2VKSA 2WYXA 2G2WA 3ZFZA 2EA9A 3MXRA 4PPRA 5HPIA 2ZBBA 1N9NA 3UMEA 2HF6A 3LI8A 4ZBEA 3N8LA 1AWIA 4EBNA 1S4RA 3OLOA 4FCFA 4OQ0A 4EXOA 1JTGA 5CX7A 5EFWA 3GMWA 1N9OA 1VEUA 5CEDA 3T1XA 5EVLA 1G68A 3UE1A 1K6RA 4XUZA 1FQGA 2HJEA 3FYZA 3A3FA 4P6ZM 5JYOA 5AQAA 4NKPA 4JKTA 1N4OA 4Y2FA 2VJWA 1Q2QA 3Q07A 1EI5A 4KZ9A 2XROA 2PAVP 2WAEA 2BG1A 3ZG0A 2WUQA 3NOTC 1KE0A 4ZJ1A 3RXXA 3ZG8B 1GCEA 1L3LA 1IYSA 1WYBA 2ZL1B 2XSSA 5J8XA 3MQQA 3OCNA 4HJ6A 4EV4A 2OLVA 3QNBA 4GB7A 1VM1A 4L9EA 3D72A 1YMSA 4Y0TA 3MF0A 3G31A 1BYWA 3DWKA 3ITAA 2J3TD 3S7QA 3UNWA 4PMAA 4P6ZS 3VSLA 2B5RA 2VV6A 3EQVA 3IT9A 3RH8B 1FSYA 2PD7A 5EE8A 2Y2KA 1ZG6A 4QHCA 2WZZA 4GKUA 5AQ9A 4JLFA 3NY4A 4GW9A 1TDLA 3BLSA 2XGNA 1XA7A 5FDHA 3T4OA 3BY8A 4EETB 5CHUA 3IBJA 5G4ZA 4H6JB 5KSCA 4X1LA 5HDDA 4LRXC 4ESPA 3B33A 5AVEA 4WF0A 1YLZA 5HD5A 2XA7M 4U0TA 1LL5A 4NXFA 1NXYA 3CHWP 1E4DA 2B18A 3VFFA 4HBTA 5DTKA 1W7FA 2KLIA 4K0WA 1K25A 4BBVA 4E6WA 1H8YA 3BW6A 3VSKA 2ZC5B 1H0MA 4O8GA 1LT0A 4IVIA 3ZDJA 5HAIA 4M4XA 2A3UA 3GR2A 4I5SA 3UB7A 3HLDA 4A5RA 2ZQDA 1BT5A 2J80A 5JYPA 1CEGA 2WGIA 3V3SA 2XD1A 3MS6A 3BJNA 3PBOA 2ZC6B 3DBAA 4HP4A 4CLCA 1RGZA 5CXWA 3C4OA 2VGLS 4LRYC 3O3VA 1V9ZA 1ZTUA 3PR6A 4QPRA 3BFDA 1PYYA 3SS3A 2LB5A 4OQHA 5L8MA 4I3AA 4KZ5A 4BQMA 2NUTC 3VOLA 4UA7A 1K0KA 1XFNA 2BLSA 3OPRA 4JXWA 4BWIA 4DKIA 4WM9A 2PD8A 4U0XA 2K31A 4ME4A 4LFUA 2INWA 2WKIA 3MSHA 5DTSA 5E2FA 4QY5A 4FTXA 4HJ3A 4UEYA 1KGFA 2KOIA 3B47A 4GDBA 4PAUA 2VK3A 5DF9A 5GLDA 3M6BA 1CI9A 3LEZA 2ZOHA 2PT7A 4EQIA 3HLWA 3KO6A 2O99A 3E2KA 3V39A 3TG9A 3C7UA 3UPNA 4RQ9A 2G2UA 1TVFA 2BASA 3SH9A 1SDNA 3HJIA 1XA1A 3OPHA 1K4EA 4GZBA 4G3WA 5F1GA 5G18A 1J9MA 1KDSA 2FFYA 3IS2A 1XX2A 5EVIA 5CHJA 4X1MA 4CQHA 4KZ6A 3PBQA 4PKYA 1W8YA 5M1AA 4R6LA 1ES4A 1TF1A 4KZ7A 4GD6A 1NRJA 4YNRA 5CGWA 4QU3A 5CECA 3CPTB 4EBLA 1H8MA 5EVEA 4OP8A 3CJMA 4S2JA 1V9YA 3LY3A 3UDXA 1IEMA 4UQIS 1EROA 4R4RA 4FSFA 4JBFA 2B02A 5BOHA 4O01A 3VE4A 5TBMA 1G28A 3W4OA 3NOPC 5GLBA 4RX2A 4JGRA 2QWSA 3N6IA 3NCKA 1Z09A 4E3MA 1DY6A 2HP5A 5EOEA 2EXBA 3R7WA 3HLEA 3CWFA 4GHIA 4Y0OA 1NZUA 2KX6A 2FZ0A 4Q0HA 2GJ3A 3VV4A 1QMEA 4YINA 2XFSA 3MQ0A 2V1AA 2FH5A 2E8IA 3MFXA 3T4TA 1UGUA 4C3QA 1OTDA 3W8KA 3FC7A 1OTEA 2QJ7A 1GHIA 3LIEA 1YLJA 3A0SA 3ZVTA 3RTYA 1M6KA 1IYOA 3ZNTA 1K57C 4HBUA 3SS5A 3T4SA 3O86A 3T4QA 3R4KA 3DWZA 3JVVA 4DN0A 3C7VA 3V5MA 2EFUA 4P85A 1BLSA 4GNUA 4ZTKA 4DF6A 2I72A 3ISGA 2KDKA 2QZ6A 2HDQA 1GA9A 4BJPA 4X6TA 4MCWA 1S66L 3G34A 1U60A 5EV0A 3G2YA 4E3KA 2GX5A 4HQAA 1ERQA 2GDNA 1I2WA 2X01A 4RX3A 3KSFA 4ZJ2A 4PM9A 3WS0A 3VOZA 2JKRI 4NETA 4BMWA 3SH7A 4S2MA 4F3LB 4X69A 2OAQ1 3PBRA 3MZDA 3MXSA 3C5AA 4I38A 3JVUA 4WZ4A 2WGWB 1BLCA 4FH4A 3IQAA 3IX8A 4ETXA 2VX8A 1IYQA 4DDYA 4EEUA 1TS8A 5GHYA 5GLCA 5LBRA 3LEQA 3WRZA 3BLMA 1SKOB 1CK3A 1CI8A 2PU2A 1YAXA 2GNXA 3T4KA 3NULA 1FR6A 2Y2QA 1BULA 1E3UA 3OPPA 4LV2A 5GL9A 2XLNA 4X53A 1DRMA 3BFGA 3NOUC 2AVXA 2OOLA 3HLGA 3QP5A 3LIFA 3UE6A 3F1PB 1O07A 3ZQ5A 1IKGA 3HUMA 3VP0A 4Y5FA 4I3IA 4IUHA 3ULFA 2A24A 4X56A 5L10A 2ZQAA 3CITA 1IELA 3MMHA 3NDGA 5CHMA 2DNSA 3FPWA 4HY8A 5CGXA 3OBFA 1NJ4A 4KG6A 3ZYTA 3MKEA 1OPXA 4ARZA 4I3JA 4O0PA 5E2GA 4IBXA 4HOIA 1D06A 5CTMA 3TW8A 3C2WA 3KYZA 2P7JA 4PM8A 1XPBA 3GECA 1BLPA 4DJ3A 1ZKJA 3LR3A 1LHYA 5A93A 3EGDC 2EXAA 5L09A 1E25A 4H8RA 5IU1A 1PWGA 3IF6B 1GA0A 1YLWA 5DF7A 1W8QA 1PZOA 4LLOB 2ZC4B 1ACFA 1CF0A 3UPOA 2RCXA 3UY6A 5FASA 2QYBA 4MN5A 4NXBA 5K5BA 2O9BA 3TE8A 4N9KA 5DJUA 2JKRM 4P87A 4EWFA 2OWHA 1K54C 4Q8IA 2PBDP 2P08A 3GSGA 1OT6A 5IHVA 3EQUA 4Y13A 1OJ5A 5HD3A 2J9OA 4IVKA 2YKHA 1FCNA 5FQQA 2ZL1A 5FDSA 2L4RA 1XJ3A 4OVDA 4KQDA 3W2ZA 2WAFA 3GV9A 5G4YA 3UN7A 4K0XA 4GS9B 3EGXC 5AQBA 3UB5P
chains in the Genus database with same CATH topology
5EOOA 4OPRA 3UE0A 1CEGA 1HD8A 2WGIA 3V3SA 2UWXA 2XD1A 1HVBA 5FI7A 4Y7PA 3NIAA 3PBOA 1MPLA 2ZC6B 4S2NC 3NDEA 1DJBA 1RGZA 1MXOA 3A3EA 1ZG4A 4KZAA 5CXWA 3C4OA 3TSGA 4OONA 4CJNA 3IWQA 4R0QA 4DDSA 2WGVA 4R3JA 3O3VA 3PAGA 5EVIB 3HL9A 2JE5A 4ZJ3A 2H0TA 4GN2A 1K6SA 4S2PA 4BD1A 4L0LA 3UDFA 3BFDA 4LCLA 3ZNYA 1PYYA 3SS3A 1K56D 3IF6A 3VFHA 3VP3A 1XGIA 2HDSA 3MFDA 2R9WA 1K57A 1VQQA 4OQHA 3W4PA 2XR0A 1HTZA 1MWUA 2WADA 4RYEA 4KZ5A 1MWRA 4BQMA 4E3OA 2DRWA 3BEBA 1TDGA 2H10A 4OPZA 4N92A 4UA7A 5A92A 2XEPA 2BLSA 2XH9A 3OPRA 4JXWA 2OSUA 5FAQA 4WZ5C 2ZQ9A 3ZHHA 3V3RA 4BD0A 4BL2A 4DKIA 4WM9A 4DXCA 4U0XA 1NYMA 3PTEA 2DCFA 1FOFA 2P9VA 3WWXA 4WYYA 2HDRA 2QMIA 4JF6A 4E6XA 1IKIA 2WKIA 5DTSA 5E2FA 4QY5A 5F83A 1KVMA 2C5WB 3ZVWA 3I7JA 2J8YA 3N8RA 5GHXA 4IBRA 1KGFA 3A3JA 5F82A 4GDBA 4C6YA 5DF9A 5GLDA 1XKZA 4OPQA 1JWVA 3M6BA 1JTDA 2RL3A 3HREA 4PM7A 3Q7ZA 4M3KA 3RJUA 2EFXA 1CI9A 4P6BA 3HUNA 1S0WA 3LEZA 3N4IA 4JF4A 1O7EA 3MKFA 5CEBA 2EX6A 1K55A 3FWLA 3HLFA 3IXHA 4LV3A 4R4SA 3VP1A 1SHVA 3LY4A 5CERA 3HLBA 3Q7VB 1FCMA 4LCMA 4EQIA 3HLWA 4MBFA 1K56A 3AGDA 4MLLA 3PBNA 3E2KA 4LV1A 3PAEA 5E2EA 3V39A 1W5DA 1N9BA 2JC7A 3TG9A 2A49A 3IF5A 4X55A 3C7UA 2Y4AA 2OLUA 3UPNA 5GLAA 3ZCZA 2G2UA 4HEFA 1TVFA 2XD5A 3WS5A 3SH9A 1LI0A 1SDNA 1XGJA 1XA1A 3OPHA 1K4EA 4FD8A 4GZBA 3G4PA 1KGGA 1MWTA 2ZQ7A 4RVAA 3BM6A 5F1GA 1J9MA 1KDSA 2FFYA 4WEKA 3GQZA 5G18A 3SOIA 3HLCA 4B4XA 4DE1A 1XX2A 5EVIA 5FQJA 1H5XA 5CHJA 1I5QA 4GDNA 4S2OA 1ONHA 4KZ6A 3PBQA 4YFMA 1K38A 4KZ8A 3B3XA 3OPLA 2Y2JA 1W8YA 3S22A 3P09A 5HW3A 1ZC2A 1PW1A 4QJGA 5M1AA 1ES4A 3MZEA 5I94A 1LL9A 2HP9A 3S1YA 1RGYA 2EX9A 4JPMA 4JXSA 3FV7A 3IXBA 4S2IA 4KZ7A 4GD6A 4EBPA 5FA7A 5FSRA 4S2KA 5CGWA 4QU3A 5CECA 5FATA 3WS2A 4EBLA 2V1ZA 5FI2A 5HX9A 3G2ZA 4OP8A 3CJMA 4S2JA 3LY3A 3UDXA 1IEMA 4GD8A 1EROA 4R4RA 2WZXA 4FSFA 4JBFA 1JVJA 5CGSA 4UHUA 5BOHA 3ITBA 2VGKA 3QHYA 4E3LA 3OZHA 4OH0A 4U3TA 2R9XA 3W4OA 4UA9A 1PZPA 3BFEA 3C4PA 5GLBA 4LENA 4RX2A 1WYCA 1RP5A 5EECA 2JCHA 3N6IA 3NCKA 3M2KA 4OKPA 5M18A 3IXDA 1KDWA 1NRFA 1KGEA 4E3MA 1DY6A 2Z2LB 2HP5A 4P0MA 4WBGA 1BUEA 3Q7VA 5EOEA 3HVFA 3Q1FA 1FCOA 4KZ4A 3FKVA 2EXBA 3HLEA 1SCWA 2WK0A 4Y0OA 2C6WB 4IEDA 4WELA 1NZUA 1ES2A 2IWDA 1JWZA 1YLPA 4KENB 1L0EA 3TOIA 1YT4A 2CC1A 4R23A 1QMEA 4YINA 2ZC3B 1YLTA 2XFSA 4FH2A 5KMWA 5D3OA 4MBKA 5FAPA 1PI4A 3E2LA 5HL1A 1WE4A 2E8IA 1EWZA 3IHAA 3MZFA 3W4QA 3MBZA 2IWCA 2J7VA 2ZJ9A 3M6HA 3SH8A 4DE0A 4C3QA 2Q9NA 3G30A 3VP2A 3W8KA 4KG5A 5E2HA 1L0GA 2Y2OA 3ZGAB 1GHIA 3BRMA 1YLJA 2Y2IA 3ZVTA 5L2FA 3CMZA 1M6KA 1IYOA 3N7WA 3ZNTA 3IF6C 1L0FA 2ZLYA 3NI9A 4QB8A 1K57C 2PBYA 4QY6A 1ALQA 5FI6A 4HBUA 5DVAA 3IHBA 1C3BA 3SS5A 4MEZA 2XQZA 1FR1A 3O86A 2V20A 3QNCA 4Z9QA 3DWZA 3M2JA 4ZDXA 3C7VA 1PI5A 2XF3A 3V5MA 4PM5A 5DTTA 2EFUA 4P85A 1BLSA 4BENA 1ES5A 2Y2PA 3OC2A 4GNUA 2Y2NA 3G35A 4KZBA 4KQQA 3LCEA 4R1GA 4OLGA 4WMCD 2I72A 3ISGA 4DF6A 1TEMA 1Y54A 1YM1A 1Q2PA 4BL3A 2QZ6A 1PWDA 2HDQA 4JXGA 3VMAA 2VGJA 1GA9A 2X71A 4OQGA 4BJPA 4X6TA 2ZC7A 3G34A 3RXWA 1U60A 4E3KA 3G2YA 4XXRA 5GHZA 4NK3A 1KVLA 2OV5A 1ERQA 2GDNA 1I2WA 4KZ3A 2X01A 4RX3A 3OCLA 2Y2GA 4ZJ2A 4E3JA 1ERMA 1PW8A 4JF5A 4PM9A 3WS0A 3VOZA 1K54A 2FFFB 1M40A 3LO7A 3P98A 2ZM2A 1G6AA 1S6RA 3PBSA 3SS4A 4BLMA 4NETA 2Y59A 3HUOA 3JYIA 4MNRA 2HPBA 5TGFA 1XXMA 3G32A 1MBLA 1NZOA 1YLYA 4OOYA 1YQSA 3WS4A 4CPKA 5M19A 3O88A 3SH7A 4S2MA 4N9LA 4X69A 1E3UD 1PWCA 3PBRA 1KE3A 3WS1A 3MZDA 2HDUA 2ZQ8A 1BTLA 1W79A 3MXSA 5AQ7A 3C5AA 3IXGA 4S2LA 3UE3A 4WZ4A 4WMCA 2WGWB 3GTCA 4KQRA 3FZCA 5HARA 5TR7A 4WEJA 3VP4A 1SDEA 1BLCA 4FH4A 2IWBA 3IQAA 4UA6A 1MKIA 5HAPA 5EVIC 1IYQA 3ZG7B 4DDYA 2WYXA 3Q81A 2G2WA 3UDIA 2X02A 3ZFZA 5FQIA 5GHYA 2Y2MA 3MXRA 4PPRA 5GLCA 4JXVA 4S2NA 3UO9A 1I2SA 3BFCA 4ZBEA 3N8LA 4EBNA 1ONGA 3WRZA 3BLMA 4FCFA 1QMFA 2HP6A 4OLDA 5EUAA 1CK3A 4EUZA 1PIOA 4OQ0A 1CI8A 2PU2A 1FSWA 1H8ZA 2Y91A 1JTGA 1Z6FA 4B4ZA 3GMWA 2H5SA 5CEDA 5EVLA 1G68A 3UE1A 4E3NA 1DJAA 1FR6A 4Y0UA 2Y2QA 3UPPA 1K6RA 4XUZA 1FQGA 1BULA 1MWSA 1E3UA 3OPPA 3FYZA 4LV2A 5HAQA 2ZM0A 2H0YA 1GHMA 2XLNA 3A3FA 5GL9A 4X53A 3BFGA 1L0DA 4WZ5A 3AGFA 2XDMA 5U47A 5JYOA 3AGEA 5AQAA 1ES3A 2PU4A 2XK1A 4JKTA 1ESUA 1N4OA 1L2SA 3HLGA 4DE2A 4E3IA 1Q2QA 3Q07A 1EI5A 1OMEA 4KZ9A 3BYDA 3BFFA 1O07A 3PBTA 1IKGA 3HUMA 5E43A 3S4XA 2WAEA 2ZD8A 2BG1A 3VP0A 3WRTA 3ZG0A 2WUQA 4QD4A 4ZJ1A 1KE0A 4DRTA 5FQ9A 3RXXA 4X56A 2ZQAA 1GCEA 3ZG8B 3VOYA 1IYPA 2Q9MA 2EX2A 1IELA 3GRJA 4D2OA 4XUXA 1IYSA 1WYBA 1DJCA 1NY0A 3NDGA 5CHMA 3IWOA 3ZG5A 2WKEA 5J8XA 2DNSA 3BECA 2Y55A 2ZQCA 3OCNA 4UAAA 1JWPA 4EV4A 4OP5A 2OLVA 3QNBA 5CGXA 1ESIA 1MY8A 1VM1A 3IH9A 4GB7A 4OPYA 2Y2LA 1NJ4A 1YMSA 5EVID 4KG6A 2WGWA 4Y0TA 1GHPA 4OOLA 1HZOA 3G31A 3MKEA 3DWKA 3ITAA 1LI9A 3NC8A 5E2GA 4IBXA 3O87A 3DW0A 5A91A 4LV0A 5CTMA 5FQMA 4ZTKA 3UNWA 3A3DA 4PMAA 5KZHA 1CEFA 4PM8A 4R3BA 1XPBA 3VSLA 2B5RA 3DTMA 3EQVA 1BLPA 5DF8A 3IT9A 1AXBA 1ZKJA 2P74A 4MBHA 1FSYA 5EE8A 4GOGA 2ZM8A 3N8SA 4ZAMA 2Y2KA 1BSGA 1LHYA 5A93A 4X68A 1ZG6A 4QHCA 2WZZA 4GKUA 5AQ9A 2EXAA 3NBLA 4N1XA 4JLFA 3NY4A 1E25A 1SKFA 4H8RA 4KG2A 4DE3A 1TDLA 1RCJA 1PWGA 1K4FA 3BLSA 3CZDA 3IF6B 3ZG9B 1GA0A 1K55C 2XGNA 4OQIA 1YLWA 2EX8A 5CRFA 5DF7A 1W8QA 1PZOA 1XA7A 2ZC4B 3V50A 4PM6A 5FDHA 4KQOA 4DXBA 2Y2HA 4B88A 2Z2MB 5EPHA 3UPOA 3FKWA 5CHUA 2RCXA 3UY6A 5KSCA 1YMXA 1XP4A 5FASA 1LLBA 2P9VB 4N1HA 4N9KA 3IWIA 3A3IA 5FAOA 4P87A 1NYYA 1YLZA 4EWFA 3D4FA 1K54C 5FQKA 4Q8IA 4C75A 4U0TA 2JBFA 1LL5A 1NXYA 2J9PA 3GSGA 3CG5A 5IHVA 1E4DA 1BLHA 3EQUA 1BZAA 3VFFA 2J9OA 4HBTA 5TFQA 2WKHA 4IVKA 5DTKA 4F94A 1FCNA 1W7FA 3GVBA 4HESA 5FQQA 3HBRA 5F1FA 4OOMA 4K0WA 1K25A 4E6WA 1H8YA 4O7DA 4OVDA 2V2FF 3VSKA 2ZC5B 3IH8A 2WAFA 3GV9A 2XFTA 5CTNA 3UN7A 4ID4A 4K0XA 5HFOA 4IVIA 3ZDJA 5HAIA 4RA7A 2A3UA 3GR2A 2QPNA 3Q82A 4K91A 5A90A 3HLDA 5AQBA 2ZQDA 4A5RA 1BT5A 5KSHA 5JYPA 2ZMAA 1KE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EOO A;  4OPR A;  3UE0 A;  1CEG A;  1HD8 A;  2WGI A;  3V3S A;  2UWX A;  2XD1 A;  1HVB A;  5FI7 A;  4Y7P A;  3NIA A;  3PBO A;  1MPL A;  2ZC6 B;  4S2N C;  3NDE A;  1DJB A;  1RGZ A;  1MXO A;  3A3E A;  1ZG4 A;  4KZA A;  5CXW A;  3C4O A;  3TSG A;  4OON A;  4CJN A;  3IWQ A;  4R0Q A;  4DDS A;  2WGV A;  4R3J A;  3O3V A;  3PAG A;  5EVI B;  3HL9 A;  2JE5 A;  4ZJ3 A;  2H0T A;  4GN2 A;  1K6S A;  4S2P A;  4BD1 A;  4L0L A;  3UDF A;  3BFD A;  4LCL A;  3ZNY A;  1PYY A;  3SS3 A;  1K56 D;  3IF6 A;  3VFH A;  3VP3 A;  1XGI A;  2HDS A;  3MFD A;  2R9W A;  1K57 A;  1VQQ A;  4OQH A;  3W4P A;  2XR0 A;  1HTZ A;  1MWU A;  2WAD A;  4RYE A;  4KZ5 A;  1MWR A;  4BQM A;  4E3O A;  2DRW A;  3BEB A;  1TDG A;  2H10 A;  4OPZ A;  4N92 A;  4UA7 A;  5A92 A;  2XEP A;  2BLS A;  2XH9 A;  3OPR A;  4JXW A;  2OSU A;  5FAQ A;  4WZ5 C;  2ZQ9 A;  3ZHH A;  3V3R A;  4BD0 A;  4BL2 A;  4DKI A;  4WM9 A;  4DXC A;  4U0X A;  1NYM A;  3PTE A;  2DCF A;  1FOF A;  2P9V A;  3WWX A;  4WYY A;  2HDR A;  2QMI A;  4JF6 A;  4E6X A;  1IKI A;  2WKI A;  5DTS A;  5E2F A;  4QY5 A;  5F83 A;  1KVM A;  2C5W B;  3ZVW A;  3I7J A;  2J8Y A;  3N8R A;  5GHX A;  4IBR A;  1KGF A;  3A3J A;  5F82 A;  4GDB A;  4C6Y A;  5DF9 A;  5GLD A;  1XKZ A;  4OPQ A;  1JWV A;  3M6B A;  1JTD A;  2RL3 A;  3HRE A;  4PM7 A;  3Q7Z A;  4M3K A;  3RJU A;  2EFX A;  1CI9 A;  4P6B A;  3HUN A;  1S0W A;  3LEZ A;  3N4I A;  4JF4 A;  1O7E A;  3MKF A;  5CEB A;  2EX6 A;  1K55 A;  3FWL A;  3HLF A;  3IXH A;  4LV3 A;  4R4S A;  3VP1 A;  1SHV A;  3LY4 A;  5CER A;  3HLB A;  3Q7V B;  1FCM A;  4LCM A;  4EQI A;  3HLW A;  4MBF A;  1K56 A;  3AGD A;  4MLL A;  3PBN A;  3E2K A;  4LV1 A;  3PAE A;  5E2E A;  3V39 A;  1W5D A;  1N9B A;  2JC7 A;  3TG9 A;  2A49 A;  3IF5 A;  4X55 A;  3C7U A;  2Y4A A;  2OLU A;  3UPN A;  5GLA A;  3ZCZ A;  2G2U A;  4HEF A;  1TVF A;  2XD5 A;  3WS5 A;  3SH9 A;  1LI0 A;  1SDN A;  1XGJ A;  1XA1 A;  3OPH A;  1K4E A;  4FD8 A;  4GZB A;  3G4P A;  1KGG A;  1MWT A;  2ZQ7 A;  4RVA A;  3BM6 A;  5F1G A;  1J9M A;  1KDS A;  2FFY A;  4WEK A;  3GQZ A;  5G18 A;  3SOI A;  3HLC A;  4B4X A;  4DE1 A;  1XX2 A;  5EVI A;  5FQJ A;  1H5X A;  5CHJ A;  1I5Q A;  4GDN A;  4S2O A;  1ONH A;  4KZ6 A;  3PBQ A;  4YFM A;  1K38 A;  4KZ8 A;  3B3X A;  3OPL A;  2Y2J A;  1W8Y A;  3S22 A;  3P09 A;  5HW3 A;  1ZC2 A;  1PW1 A;  4QJG A;  5M1A A;  1ES4 A;  3MZE A;  5I94 A;  1LL9 A;  2HP9 A;  3S1Y A;  1RGY A;  2EX9 A;  4JPM A;  4JXS A;  3FV7 A;  3IXB A;  4S2I A;  4KZ7 A;  4GD6 A;  4EBP A;  5FA7 A;  5FSR A;  4S2K A;  5CGW A;  4QU3 A;  5CEC A;  5FAT A;  3WS2 A;  4EBL A;  2V1Z A;  5FI2 A;  5HX9 A;  3G2Z A;  4OP8 A;  3CJM A;  4S2J A;  3LY3 A;  3UDX A;  1IEM A;  4GD8 A;  1ERO A;  4R4R A;  2WZX A;  4FSF A;  4JBF A;  1JVJ A;  5CGS A;  4UHU A;  5BOH A;  3ITB A;  2VGK A;  3QHY A;  4E3L A;  3OZH A;  4OH0 A;  4U3T A;  2R9X A;  3W4O A;  4UA9 A;  1PZP A;  3BFE A;  3C4P A;  5GLB A;  4LEN A;  4RX2 A;  1WYC A;  1RP5 A;  5EEC A;  2JCH A;  3N6I A;  3NCK A;  3M2K A;  4OKP A;  5M18 A;  3IXD A;  1KDW A;  1NRF A;  1KGE A;  4E3M A;  1DY6 A;  2Z2L B;  2HP5 A;  4P0M A;  4WBG A;  1BUE A;  3Q7V A;  5EOE A;  3HVF A;  3Q1F A;  1FCO A;  4KZ4 A;  3FKV A;  2EXB A;  3HLE A;  1SCW A;  2WK0 A;  4Y0O A;  2C6W B;  4IED A;  4WEL A;  1NZU A;  1ES2 A;  2IWD A;  1JWZ A;  1YLP A;  4KEN B;  1L0E A;  3TOI A;  1YT4 A;  2CC1 A;  4R23 A;  1QME A;  4YIN A;  2ZC3 B;  1YLT A;  2XFS A;  4FH2 A;  5KMW A;  5D3O A;  4MBK A;  5FAP A;  1PI4 A;  3E2L A;  5HL1 A;  1WE4 A;  2E8I A;  1EWZ A;  3IHA A;  3MZF A;  3W4Q A;  3MBZ A;  2IWC A;  2J7V A;  2ZJ9 A;  3M6H A;  3SH8 A;  4DE0 A;  4C3Q A;  2Q9N A;  3G30 A;  3VP2 A;  3W8K A;  4KG5 A;  5E2H A;  1L0G A;  2Y2O A;  3ZGA B;  1GHI A;  3BRM A;  1YLJ A;  2Y2I A;  3ZVT A;  5L2F A;  3CMZ A;  1M6K A;  1IYO A;  3N7W A;  3ZNT A;  3IF6 C;  1L0F A;  2ZLY A;  3NI9 A;  4QB8 A;  1K57 C;  2PBY A;  4QY6 A;  1ALQ A;  5FI6 A;  4HBU A;  5DVA A;  3IHB A;  1C3B A;  3SS5 A;  4MEZ A;  2XQZ A;  1FR1 A;  3O86 A;  2V20 A;  3QNC A;  4Z9Q A;  3DWZ A;  3M2J A;  4ZDX A;  3C7V A;  1PI5 A;  2XF3 A;  3V5M A;  4PM5 A;  5DTT A;  2EFU A;  4P85 A;  1BLS A;  4BEN A;  1ES5 A;  2Y2P A;  3OC2 A;  4GNU A;  2Y2N A;  3G35 A;  4KZB A;  4KQQ A;  3LCE A;  4R1G A;  4OLG A;  4WMC D;  2I72 A;  3ISG A;  4DF6 A;  1TEM A;  1Y54 A;  1YM1 A;  1Q2P A;  4BL3 A;  2QZ6 A;  1PWD A;  2HDQ A;  4JXG A;  3VMA A;  2VGJ A;  1GA9 A;  2X71 A;  4OQG A;  4BJP A;  4X6T A;  2ZC7 A;  3G34 A;  3RXW A;  1U60 A;  4E3K A;  3G2Y A;  4XXR A;  5GHZ A;  4NK3 A;  1KVL A;  2OV5 A;  1ERQ A;  2GDN A;  1I2W A;  4KZ3 A;  2X01 A;  4RX3 A;  3OCL A;  2Y2G A;  4ZJ2 A;  4E3J A;  1ERM A;  1PW8 A;  4JF5 A;  4PM9 A;  3WS0 A;  3VOZ A;  1K54 A;  2FFF B;  1M40 A;  3LO7 A;  3P98 A;  2ZM2 A;  1G6A A;  1S6R A;  3PBS A;  3SS4 A;  4BLM A;  4NET A;  2Y59 A;  3HUO A;  3JYI A;  4MNR A;  2HPB A;  5TGF A;  1XXM A;  3G32 A;  1MBL A;  1NZO A;  1YLY A;  4OOY A;  1YQS A;  3WS4 A;  4CPK A;  5M19 A;  3O88 A;  3SH7 A;  4S2M A;  4N9L A;  4X69 A;  1E3U D;  1PWC A;  3PBR A;  1KE3 A;  3WS1 A;  3MZD A;  2HDU A;  2ZQ8 A;  1BTL A;  1W79 A;  3MXS A;  5AQ7 A;  3C5A A;  3IXG A;  4S2L A;  3UE3 A;  4WZ4 A;  4WMC A;  2WGW B;  3GTC A;  4KQR A;  3FZC A;  5HAR A;  5TR7 A;  4WEJ A;  3VP4 A;  1SDE A;  1BLC A;  4FH4 A;  2IWB A;  3IQA A;  4UA6 A;  1MKI A;  5HAP A;  5EVI C;  1IYQ A;  3ZG7 B;  4DDY A;  2WYX A;  3Q81 A;  2G2W A;  3UDI A;  2X02 A;  3ZFZ A;  5FQI A;  5GHY A;  2Y2M A;  3MXR A;  4PPR A;  5GLC A;  4JXV A;  4S2N A;  3UO9 A;  1I2S A;  3BFC A;  4ZBE A;  3N8L A;  4EBN A;  1ONG A;  3WRZ A;  3BLM A;  4FCF A;  1QMF A;  2HP6 A;  4OLD A;  5EUA A;  1CK3 A;  4EUZ A;  1PIO A;  4OQ0 A;  1CI8 A;  2PU2 A;  1FSW A;  1H8Z A;  2Y91 A;  1JTG A;  1Z6F A;  4B4Z A;  3GMW A;  2H5S A;  5CED A;  5EVL A;  1G68 A;  3UE1 A;  4E3N A;  1DJA A;  1FR6 A;  4Y0U A;  2Y2Q A;  3UPP A;  1K6R A;  4XUZ A;  1FQG A;  1BUL A;  1MWS A;  1E3U A;  3OPP A;  3FYZ A;  4LV2 A;  5HAQ A;  2ZM0 A;  2H0Y A;  1GHM A;  2XLN A;  3A3F A;  5GL9 A;  4X53 A;  3BFG A;  1L0D A;  4WZ5 A;  3AGF A;  2XDM A;  5U47 A;  5JYO A;  3AGE A;  5AQA A;  1ES3 A;  2PU4 A;  2XK1 A;  4JKT A;  1ESU A;  1N4O A;  1L2S A;  3HLG A;  4DE2 A;  4E3I A;  1Q2Q A;  3Q07 A;  1EI5 A;  1OME A;  4KZ9 A;  3BYD A;  3BFF A;  1O07 A;  3PBT A;  1IKG A;  3HUM A;  5E43 A;  3S4X A;  2WAE A;  2ZD8 A;  2BG1 A;  3VP0 A;  3WRT A;  3ZG0 A;  2WUQ A;  4QD4 A;  4ZJ1 A;  1KE0 A;  4DRT A;  5FQ9 A;  3RXX A;  4X56 A;  2ZQA A;  1GCE A;  3ZG8 B;  3VOY A;  1IYP A;  2Q9M A;  2EX2 A;  1IEL A;  3GRJ A;  4D2O A;  4XUX A;  1IYS A;  1WYB A;  1DJC A;  1NY0 A;  3NDG A;  5CHM A;  3IWO A;  3ZG5 A;  2WKE A;  5J8X A;  2DNS A;  3BEC A;  2Y55 A;  2ZQC A;  3OCN A;  4UAA A;  1JWP A;  4EV4 A;  4OP5 A;  2OLV A;  3QNB A;  5CGX A;  1ESI A;  1MY8 A;  1VM1 A;  3IH9 A;  4GB7 A;  4OPY A;  2Y2L A;  1NJ4 A;  1YMS A;  5EVI D;  4KG6 A;  2WGW A;  4Y0T A;  1GHP A;  4OOL A;  1HZO A;  3G31 A;  3MKE A;  3DWK A;  3ITA A;  1LI9 A;  3NC8 A;  5E2G A;  4IBX A;  3O87 A;  3DW0 A;  5A91 A;  4LV0 A;  5CTM A;  5FQM A;  4ZTK A;  3UNW A;  3A3D A;  4PMA A;  5KZH A;  1CEF A;  4PM8 A;  4R3B A;  1XPB A;  3VSL A;  2B5R A;  3DTM A;  3EQV A;  1BLP A;  5DF8 A;  3IT9 A;  1AXB A;  1ZKJ A;  2P74 A;  4MBH A;  1FSY A;  5EE8 A;  4GOG A;  2ZM8 A;  3N8S A;  4ZAM A;  2Y2K A;  1BSG A;  1LHY A;  5A93 A;  4X68 A;  1ZG6 A;  4QHC A;  2WZZ A;  4GKU A;  5AQ9 A;  2EXA A;  3NBL A;  4N1X A;  4JLF A;  3NY4 A;  1E25 A;  1SKF A;  4H8R A;  4KG2 A;  4DE3 A;  1TDL A;  1RCJ A;  1PWG A;  1K4F A;  3BLS A;  3CZD A;  3IF6 B;  3ZG9 B;  1GA0 A;  1K55 C;  2XGN A;  4OQI A;  1YLW A;  2EX8 A;  5CRF A;  5DF7 A;  1W8Q A;  1PZO A;  1XA7 A;  2ZC4 B;  3V50 A;  4PM6 A;  5FDH A;  4KQO A;  4DXB A;  2Y2H A;  4B88 A;  2Z2M B;  5EPH A;  3UPO A;  3FKW A;  5CHU A;  2RCX A;  3UY6 A;  5KSC A;  1YMX A;  1XP4 A;  5FAS A;  1LLB A;  2P9V B;  4N1H A;  4N9K A;  3IWI A;  3A3I A;  5FAO A;  4P87 A;  1NYY A;  1YLZ A;  4EWF A;  3D4F A;  1K54 C;  5FQK A;  4Q8I A;  4C75 A;  4U0T A;  2JBF A;  1LL5 A;  1NXY A;  2J9P A;  3GSG A;  3CG5 A;  5IHV A;  1E4D A;  1BLH A;  3EQU A;  1BZA A;  3VFF A;  2J9O A;  4HBT A;  5TFQ A;  2WKH A;  4IVK A;  5DTK A;  4F94 A;  1FCN A;  1W7F A;  3GVB A;  4HES A;  5FQQ A;  3HBR A;  5F1F A;  4OOM A;  4K0W A;  1K25 A;  4E6W A;  1H8Y A;  4O7D A;  4OVD A;  2V2F F;  3VSK A;  2ZC5 B;  3IH8 A;  2WAF A;  3GV9 A;  2XFT A;  5CTN A;  3UN7 A;  4ID4 A;  4K0X A;  5HFO A;  4IVI A;  3ZDJ A;  5HAI A;  4RA7 A;  2A3U A;  3GR2 A;  2QPN A;  3Q82 A;  4K91 A;  5A90 A;  3HLD A;  5AQB A;  2ZQD A;  4A5R A;  1BT5 A;  5KSH A;  5JYP A;  2ZMA A;  1KE4 A; 
#chains in the Genus database with same CATH topology
 2VA0 A;  3MJQ A;  4QWO A;  3UE0 A;  4R38 A;  1F9I A;  5FI7 A;  4ZRR A;  4S2N C;  5HWT A;  1DJB A;  4KZA A;  3TSG A;  1ZG4 A;  4NXG A;  4OON A;  4D60 A;  4CJN A;  3LFV A;  1K6S A;  3UDF A;  1K56 D;  1XGI A;  3EEA A;  2R9W A;  1K57 A;  1VQQ A;  1KOU A;  2WAD A;  1MWR A;  5HDS A;  4NXE A;  3MR0 A;  2LB9 A;  1TDG A;  4N92 A;  5A92 A;  2PHY A;  3ZHH A;  4WZ5 C;  2ZQ9 A;  4H6J A;  3V3R A;  3HCY A;  2ZMV A;  3A0V A;  4WYY A;  2QMI A;  4E6X A;  4II7 A;  3ZVW A;  2WKR A;  3I7J A;  3N8R A;  3H9W A;  5F82 A;  1GSX A;  4C6Y A;  3T4L A;  1JWV A;  4PM7 A;  2EFX A;  3HUN A;  1S0W A;  1O7E A;  1Y28 A;  1K55 A;  3FWL A;  4LV3 A;  3IXH A;  3VP1 A;  1NWZ A;  1PRQ A;  2M1C A;  2W3F A;  3LY4 A;  4LCM A;  3T1R A;  1W5D A;  1N9B A;  2JC7 A;  2JKT I;  2A49 A;  3IF5 A;  3K3D A;  4X55 A;  4EW7 A;  2Y4A A;  2OLU A;  1CQA A;  3KYE A;  5GLA A;  1XJ6 A;  4HEF A;  3P01 A;  3WS5 A;  1LI0 A;  1S1Z A;  1MWT A;  3EWK A;  4Y15 A;  4RVA A;  3GQZ A;  1D1J A;  2WKQ A;  3HLC A;  4EU0 A;  2VGL M;  5FQJ A;  1H5X A;  1I5Q A;  3H7W B;  1ONH A;  3OPL A;  1OTI A;  3P09 A;  1PW1 A;  4XT2 B;  2HP9 A;  3DTI A;  1TS0 A;  3IXB A;  1T18 A;  5FSR A;  4S2K A;  4WL9 A;  5FAT A;  5HX9 A;  3G2Z A;  2NUP C;  2WZX A;  1JVJ A;  5CGS A;  3KSI A;  4U3T A;  4UA9 A;  1FIK A;  2Z6D A;  4LEN A;  5I5L A;  3M2K A;  4E04 A;  5M18 A;  2HGV A;  3LUQ A;  3F1N B;  2Z2L B;  2PYP A;  1FCO A;  4KZ4 A;  3FKV A;  4WLA A;  5HWV A;  4IED A;  4WEL A;  3S7P A;  2V8F A;  1ES2 A;  3DTE A;  1JWZ A;  4KEN B;  2O9C A;  1L0E A;  2W1R A;  2ZC3 B;  1YLT A;  1W63 Q;  5D3O A;  4MBK A;  5FAP A;  4HH3 A;  1XFQ A;  3W4Q A;  2J7V A;  3M6H A;  5E2H A;  2Y2I A;  5L2F A;  4YWZ A;  3IF6 C;  1L0F A;  3LYX A;  4QB8 A;  2W3H A;  3H82 B;  3IHB A;  4IUK A;  4MEZ A;  2XQZ A;  3LIA A;  1ODV A;  3QNC A;  2HJ9 C;  4BEN A;  3UO9 A;  3G35 A;  4KZB A;  3CPT A;  1H3Q A;  1Q2P A;  4BL3 A;  1T19 A;  3VMA A;  2X71 A;  1UWN X;  4UQI M;  3RXW A;  4GCZ A;  4Q0I A;  3CUE C;  3LID A;  3QP1 A;  3KYQ A;  2Y2G A;  5F69 A;  3BQ8 A;  1K54 A;  2PDR A;  1M40 A;  3LO7 A;  4PKY G;  2EWW A;  2Y59 A;  2JHE A;  3G32 A;  1NZO A;  1YQS A;  4CPK A;  2JKT M;  5M19 A;  3BQA A;  3O88 A;  1PWC A;  1KE3 A;  3WS1 A;  3ICY A;  2HDU A;  3T50 A;  1BTL A;  4LGW A;  5AQ7 A;  4S2L A;  3L9K A;  5TR7 A;  3VP4 A;  4WEJ A;  1P97 A;  2IWB A;  5IS1 A;  5DKL A;  1JNU A;  2J3T C;  5FQI A;  2Y2M A;  1UWP X;  3TRC A;  4S2N A;  3BFC A;  1XJ4 A;  2HP6 A;  2W3D A;  4EUZ A;  4L9F A;  2Q0O A;  4G3K A;  1Z6F A;  2H5S A;  4E3N A;  2HZ5 A;  3UPP A;  5AVF A;  3LIB A;  1MWS A;  2V0U A;  2H0Y A;  1GHM A;  3FG8 A;  4WZ5 A;  3E4Q A;  2PU4 A;  4EQ1 A;  1L2S A;  4MN6 A;  2M7U A;  1OME A;  3BYD A;  1A0K A;  3BFF A;  3PBT A;  5E43 A;  2ZD8 A;  4QD4 A;  4DRT A;  1VET B;  3L7H A;  3VOY A;  4DMZ A;  1F5M A;  3GRJ A;  4XUX A;  3D9Y A;  4FUW A;  1DJC A;  3LI9 A;  3IWO A;  3BY9 A;  3UB9 A;  3ZG5 A;  5AJG A;  3QP4 A;  4F3L A;  1OJG A;  5J4E A;  2ZQC A;  4UAA A;  3QP6 A;  1JWP A;  4HHD A;  2ZMF A;  3NHQ A;  1ESI A;  3PHY A;  1YSQ A;  5EVI D;  2WGW A;  3O87 A;  1Y4O A;  3DW0 A;  5A91 A;  4LV0 A;  3IX4 A;  5FQM A;  5KZH A;  1CEF A;  5DF8 A;  3KSH A;  2P74 A;  4LPZ A;  4MBH A;  4AFI A;  5F68 A;  3N8S A;  1SKO A;  3NBL A;  4DE3 A;  1SKF A;  1K4F A;  3CZD A;  1K55 C;  5J7E A;  2EX8 A;  3P7N A;  5CRF A;  3MQO A;  3V50 A;  4PM6 A;  4KQO A;  4DXB A;  3UMD A;  2Y2H A;  2Z2M B;  3E4P A;  1SZV A;  2P9V B;  2VEA A;  2IA2 A;  3A3I A;  1NYY A;  4BBT A;  5FQK A;  3F1P A;  4KUK A;  2J9P A;  2R78 A;  3CG5 A;  4WN5 A;  1BZA A;  5TFQ A;  2WKH A;  2PR6 A;  4F94 A;  2UV0 E;  4OOM A;  4O7D A;  4B93 A;  3IH8 A;  3E0Y A;  5MC7 A;  2XFT A;  5CTN A;  5HFO A;  5DKK A;  4B9O A;  3EEH A;  4RA7 A;  1WA9 A;  2QPN A;  3Q82 A;  2YKF A;  4K91 A;  5A90 A;  2HV1 A;  5EOO A;  4OPR A;  1HD8 A;  1HVB A;  4Y7P A;  3NIA A;  1MPL A;  4WUJ A;  3NDE A;  3A3E A;  4DDS A;  2WGV A;  4R3J A;  3PAG A;  2H0T A;  4GN2 A;  2Y8H A;  4LCL A;  3ZNY A;  3IF6 A;  3VFH A;  2HDS A;  3MFD A;  3W4P A;  4RYE A;  3UB8 A;  3CAX A;  4OPZ A;  2XEP A;  2K2N A;  4BD0 A;  2Z6C A;  4DXC A;  1NYM A;  3PTE A;  2A2L A;  3WWX A;  2HDR A;  2I9V A;  1S4S A;  2C5W B;  3RFB A;  2J8Y A;  3T1Q B;  3A3J A;  3DAV A;  5J3W A;  3CUE A;  1LSV A;  1XKZ A;  1JTD A;  5F6A A;  2RL3 A;  4KUO A;  2GZA A;  4M3K A;  4P6B A;  1P0Z A;  3KSG A;  3HLF A;  4R4S A;  3HLB A;  3Q7V B;  1FIL A;  4GS9 A;  4MBF A;  1K56 A;  3PBN A;  4LV1 A;  3PAE A;  5HPF A;  3ZCZ A;  5HZH A;  5FEF A;  3FPV A;  2XD5 A;  1LL8 A;  4JGP A;  4FD8 A;  3G4P A;  1KGG A;  2W1T B;  2ZQ7 A;  2G7U A;  3SOI A;  4B4X A;  1NLY A;  2PYR A;  1X0O A;  4S2O A;  4YFM A;  4KZ8 A;  2P04 A;  3B3X A;  3K2N A;  2Y2J A;  5HW3 A;  1J3W A;  4QJG A;  3MZE A;  5I94 A;  1LL9 A;  1RGY A;  2EX9 A;  4JPM A;  4JXS A;  4S2I A;  3DTK A;  3WS2 A;  2W3G A;  1MC0 A;  4UHU A;  3ITB A;  3QHY A;  4E3L A;  3OZH A;  3C4P A;  2W0N A;  4PHT A;  1RP5 A;  5EEC A;  2JCH A;  1MZU A;  4OKP A;  3B42 A;  3IXD A;  1KDW A;  1NRF A;  5IT5 A;  1BUE A;  3HVF A;  3Q1F A;  1SCW A;  2C6W B;  4ETZ A;  2O0Y A;  1IOU A;  4R70 A;  2CC1 A;  4R23 A;  3F1O B;  3QP2 A;  4FH2 A;  5KMW A;  2OAP 1;  4IJG A;  1WE4 A;  3MZF A;  3E98 A;  2ZJ9 A;  4DE0 A;  3S7O A;  2Q9N A;  3ZGA B;  4KG5 A;  1L0G A;  2Y2O A;  1DP6 A;  1HLU P;  3CMZ A;  5HL6 A;  3H7W A;  1PFL A;  4MN7 A;  4QY6 A;  1C3B A;  3E4O A;  4XT2 A;  2V20 A;  2CMN A;  4MDZ A;  4ZDX A;  1F2K A;  1OTA A;  1PI5 A;  5DTT A;  1ES5 A;  2W27 A;  3OC2 A;  4B4Z A;  2Y2N A;  4KQQ A;  3LCE A;  4WMC D;  1VEU B;  2DMW A;  2VV7 A;  4JXG A;  1TS6 A;  5KIZ A;  4DJ2 A;  5GHZ A;  3K3C A;  2OV5 A;  4FOF A;  4KZ3 A;  3LGO A;  3OCL A;  4E3J A;  1PW8 A;  4JF5 A;  3CI6 A;  2H28 A;  3LR4 A;  2ZM2 A;  1S6R A;  1F98 A;  3F1N A;  2QKP A;  3SS4 A;  2JN7 A;  2V1B A;  3JYI A;  5FL3 A;  1XXM A;  3MXQ A;  1MBL A;  1YLY A;  4HJ4 A;  1YPR A;  1EW0 A;  1W79 A;  4NG2 A;  5HAR A;  1SDE A;  3C8C A;  2ZOI A;  3VE3 A;  1MKI A;  1GSV A;  5DFX A;  3Q81 A;  3UDI A;  1ZHH B;  2X02 A;  4JXV A;  1I2S A;  4HI4 A;  3H82 A;  4Y3I A;  1D7E A;  2L0W A;  1ONG A;  4EER A;  1QMF A;  4OLD A;  5EUA A;  3NEC A;  3SW1 A;  1PIO A;  1FSW A;  1H8Z A;  2Y91 A;  4HP9 A;  3C30 A;  1DP9 A;  1DJA A;  4Y0U A;  3GDI A;  5HAQ A;  2ZM0 A;  1OTB A;  1L0D A;  3AGF A;  2XDM A;  5U47 A;  2JKF A;  3AGE A;  1ES3 A;  2XK1 A;  2XA7 S;  1ESU A;  4DE2 A;  4E3I A;  4EEP A;  2D02 A;  2E8J A;  1G6O A;  3S4X A;  3WRT A;  3IBR A;  4Z1W A;  3TJZ C;  1STZ A;  5FQ9 A;  1IYP A;  2Q9M A;  2EX2 A;  4D2O A;  4L9G A;  1NY0 A;  2WKE A;  3BEC A;  2Y55 A;  5TJJ A;  3QP8 A;  4OP5 A;  2ACG A;  1MY8 A;  4OPY A;  3IH9 A;  2Y2L A;  4GJ4 A;  1GHP A;  4OOL A;  1HZO A;  1T1B A;  1LI9 A;  3NC8 A;  2PRF A;  1OT9 A;  2Y79 A;  3A3D A;  1CJF A;  4R3B A;  3DTM A;  4X25 A;  4CLC B;  1AXB A;  1VHM A;  2ZM8 A;  4GOG A;  4NEE D;  4ZAM A;  1BSG A;  4X68 A;  2V0W A;  2VV8 A;  4N1X A;  3V67 A;  4KG2 A;  3D3O A;  1RCJ A;  3ZG9 B;  4OQI A;  4B88 A;  5EPH A;  3FKW A;  1YMX A;  4CLC D;  1XP4 A;  1LLB A;  4JGQ A;  4N1H A;  4R3A A;  2QJ5 A;  3IWI A;  5FAO A;  3D4F A;  2W3E A;  4C75 A;  2JBF A;  1IFQ A;  1BLH A;  1VET A;  3G6O A;  4HES A;  3GVB A;  5F1F A;  3HBR A;  5HDC A;  2O9A A;  2V2F F;  1N9L A;  3NJA A;  5HSQ A;  4ID4 A;  2VLG A;  1P9R A;  4JGO A;  3IX3 A;  2BTF P;  5KSH A;  2MJ6 A;  2ZMA A;  1KE4 A;  3OOV A;  1YSP A;  2UWX A;  3LR0 A;  4EES A;  1DP8 A;  4Q0J A;  1MXO A;  3IS2 B;  3IWQ A;  4CLC E;  4R0Q A;  4HIA A;  5EVI B;  3HL9 A;  2JE5 A;  4ZJ3 A;  4BD1 A;  4S2P A;  4L0L A;  3VP3 A;  5DFY A;  2XR0 A;  1HTZ A;  1MWU A;  4E3O A;  2DRW A;  3BEB A;  2H10 A;  2XH9 A;  2OSU A;  5FAQ A;  4BL2 A;  3UB6 A;  2L1M A;  2DCF A;  1FOF A;  2P9V A;  1LSX A;  4JF6 A;  1IKI A;  2J3W A;  1LSW A;  5F83 A;  1KVM A;  5GHX A;  4IBR A;  1T1C A;  5TBM B;  1S1Y A;  4OPQ A;  3EOI A;  3HRE A;  3Q7Z A;  3PXP A;  3RJU A;  3N4I A;  4JF4 A;  3MKF A;  5CEB A;  4HH2 A;  2EX6 A;  4MMN A;  1G5U A;  3KX0 X;  1SHV A;  5CER A;  3C38 A;  1FCM A;  1VB6 A;  3R7W B;  3U4L P;  3AGD A;  4GHI B;  4MLL A;  5E2E A;  2PR5 A;  4Y17 A;  3SZT A;  3HJK A;  4K08 A;  3T1S A;  5L07 A;  1XGJ A;  5DJT A;  3BM6 A;  4WEK A;  4DE1 A;  1TD5 A;  1W63 M;  4GDN A;  3JPU A;  4G3V A;  3BWL A;  1K38 A;  3S22 A;  1ZC2 A;  4YOF A;  2EWV A;  4LRZ E;  3S1Y A;  2XRN A;  3FV7 A;  4EBP A;  5FA7 A;  1XJ2 A;  2V1Z A;  4IHQ A;  5EM0 A;  5FI2 A;  4EUV A;  3S7N A;  5A8B A;  4GD8 A;  5FEG A;  2VGK A;  5EM1 A;  3LR5 A;  4OH0 A;  3O5Y A;  2R9X A;  1PZP A;  3BFE A;  2V8C A;  3CLO A;  1WYC A;  3LIC A;  3T12 B;  1P9W A;  4HNB A;  1KGE A;  4P0M A;  4GLQ A;  4WBG A;  3Q7V A;  2M7V A;  2WK0 A;  1PNE A;  1T1A A;  1GSW A;  2IWD A;  1YLP A;  2VZW A;  3TOI A;  1YT4 A;  2W1T A;  4CLC C;  5HWW A;  1PI4 A;  3E2L A;  5HL1 A;  1EWZ A;  3IHA A;  4I39 A;  3MBZ A;  2IWC A;  3SH8 A;  3G30 A;  3VP2 A;  3BRM A;  2QHK A;  3N7W A;  5C5K A;  2ZLY A;  3NI9 A;  2PBY A;  1ALQ A;  5FI6 A;  5DVA A;  1FR1 A;  4Z9Q A;  3M2J A;  3T4J A;  4PM5 A;  2XF3 A;  5F5Y A;  2K7S A;  2Y2P A;  4R1G A;  4OLG A;  1TEM A;  1Y54 A;  1YM1 A;  1PWD A;  2VGJ A;  4OQG A;  2ZC7 A;  4XXR A;  2OWJ A;  4NK3 A;  1KVL A;  2B95 A;  3A0R A;  1YKD A;  2V9A A;  2JKG A;  1ERM A;  2D01 A;  2FFF B;  3P98 A;  1G6A A;  3PBS A;  4BLM A;  3HUO A;  2A24 B;  4MNR A;  2HPB A;  1MKM A;  2WKP A;  5TGF A;  4OOY A;  3WS4 A;  4N9L A;  1NLZ A;  1E3U D;  3PYP A;  2ZQ8 A;  1TS7 A;  3U2A A;  3IXG A;  3UE3 A;  3F1O A;  4BBU A;  4WMC A;  3GTC A;  4KQR A;  3FZC A;  4ARZ B;  4UA6 A;  5HAP A;  5EVI C;  3ZG7 B;  1S67 L;  2VKS A;  2WYX A;  2G2W A;  3ZFZ A;  2EA9 A;  3MXR A;  4PPR A;  5HPI A;  2ZBB A;  1N9N A;  3UME A;  2HF6 A;  3LI8 A;  4ZBE A;  3N8L A;  1AWI A;  4EBN A;  1S4R A;  3OLO A;  4FCF A;  4OQ0 A;  4EXO A;  1JTG A;  5CX7 A;  5EFW A;  3GMW A;  1N9O A;  1VEU A;  5CED A;  3T1X A;  5EVL A;  1G68 A;  3UE1 A;  1K6R A;  4XUZ A;  1FQG A;  2HJE A;  3FYZ A;  3A3F A;  4P6Z M;  5JYO A;  5AQA A;  4NKP A;  4JKT A;  1N4O A;  4Y2F A;  2VJW A;  1Q2Q A;  3Q07 A;  1EI5 A;  4KZ9 A;  2XRO A;  2PAV P;  2WAE A;  2BG1 A;  3ZG0 A;  2WUQ A;  3NOT C;  1KE0 A;  4ZJ1 A;  3RXX A;  3ZG8 B;  1GCE A;  1L3L A;  1IYS A;  1WYB A;  2ZL1 B;  2XSS A;  5J8X A;  3MQQ A;  3OCN A;  4HJ6 A;  4EV4 A;  2OLV A;  3QNB A;  4GB7 A;  1VM1 A;  4L9E A;  3D72 A;  1YMS A;  4Y0T A;  3MF0 A;  3G31 A;  1BYW A;  3DWK A;  3ITA A;  2J3T D;  3S7Q A;  3UNW A;  4PMA A;  4P6Z S;  3VSL A;  2B5R A;  2VV6 A;  3EQV A;  3IT9 A;  3RH8 B;  1FSY A;  2PD7 A;  5EE8 A;  2Y2K A;  1ZG6 A;  4QHC A;  2WZZ A;  4GKU A;  5AQ9 A;  4JLF A;  3NY4 A;  4GW9 A;  1TDL A;  3BLS A;  2XGN A;  1XA7 A;  5FDH A;  3T4O A;  3BY8 A;  4EET B;  5CHU A;  3IBJ A;  5G4Z A;  4H6J B;  5KSC A;  4X1L A;  5HDD A;  4LRX C;  4ESP A;  3B33 A;  5AVE A;  4WF0 A;  1YLZ A;  5HD5 A;  2XA7 M;  4U0T A;  1LL5 A;  4NXF A;  1NXY A;  3CHW P;  1E4D A;  2B18 A;  3VFF A;  4HBT A;  5DTK A;  1W7F A;  2KLI A;  4K0W A;  1K25 A;  4BBV A;  4E6W A;  1H8Y A;  3BW6 A;  3VSK A;  2ZC5 B;  1H0M A;  4O8G A;  1LT0 A;  4IVI A;  3ZDJ A;  5HAI A;  4M4X A;  2A3U A;  3GR2 A;  4I5S A;  3UB7 A;  3HLD A;  4A5R A;  2ZQD A;  1BT5 A;  2J80 A;  5JYP A;  1CEG A;  2WGI A;  3V3S A;  2XD1 A;  3MS6 A;  3BJN A;  3PBO A;  2ZC6 B;  3DBA A;  4HP4 A;  4CLC A;  1RGZ A;  5CXW A;  3C4O A;  2VGL S;  4LRY C;  3O3V A;  1V9Z A;  1ZTU A;  3PR6 A;  4QPR A;  3BFD A;  1PYY A;  3SS3 A;  2LB5 A;  4OQH A;  5L8M A;  4I3A A;  4KZ5 A;  4BQM A;  2NUT C;  3VOL A;  4UA7 A;  1K0K A;  1XFN A;  2BLS A;  3OPR A;  4JXW A;  4BWI A;  4DKI A;  4WM9 A;  2PD8 A;  4U0X A;  2K31 A;  4ME4 A;  4LFU A;  2INW A;  2WKI A;  3MSH A;  5DTS A;  5E2F A;  4QY5 A;  4FTX A;  4HJ3 A;  4UEY A;  1KGF A;  2KOI A;  3B47 A;  4GDB A;  4PAU A;  2VK3 A;  5DF9 A;  5GLD A;  3M6B A;  1CI9 A;  3LEZ A;  2ZOH A;  2PT7 A;  4EQI A;  3HLW A;  3KO6 A;  2O99 A;  3E2K A;  3V39 A;  3TG9 A;  3C7U A;  3UPN A;  4RQ9 A;  2G2U A;  1TVF A;  2BAS A;  3SH9 A;  1SDN A;  3HJI A;  1XA1 A;  3OPH A;  1K4E A;  4GZB A;  4G3W A;  5F1G A;  5G18 A;  1J9M A;  1KDS A;  2FFY A;  3IS2 A;  1XX2 A;  5EVI A;  5CHJ A;  4X1M A;  4CQH A;  4KZ6 A;  3PBQ A;  4PKY A;  1W8Y A;  5M1A A;  4R6L A;  1ES4 A;  1TF1 A;  4KZ7 A;  4GD6 A;  1NRJ A;  4YNR A;  5CGW A;  4QU3 A;  5CEC A;  3CPT B;  4EBL A;  1H8M A;  5EVE A;  4OP8 A;  3CJM A;  4S2J A;  1V9Y A;  3LY3 A;  3UDX A;  1IEM A;  4UQI S;  1ERO A;  4R4R A;  4FSF A;  4JBF A;  2B02 A;  5BOH A;  4O01 A;  3VE4 A;  5TBM A;  1G28 A;  3W4O A;  3NOP C;  5GLB A;  4RX2 A;  4JGR A;  2QWS A;  3N6I A;  3NCK A;  1Z09 A;  4E3M A;  1DY6 A;  2HP5 A;  5EOE A;  2EXB A;  3R7W A;  3HLE A;  3CWF A;  4GHI A;  4Y0O A;  1NZU A;  2KX6 A;  2FZ0 A;  4Q0H A;  2GJ3 A;  3VV4 A;  1QME A;  4YIN A;  2XFS A;  3MQ0 A;  2V1A A;  2FH5 A;  2E8I A;  3MFX A;  3T4T A;  1UGU A;  4C3Q A;  1OTD A;  3W8K A;  3FC7 A;  1OTE A;  2QJ7 A;  1GHI A;  3LIE A;  1YLJ A;  3A0S A;  3ZVT A;  3RTY A;  1M6K A;  1IYO A;  3ZNT A;  1K57 C;  4HBU A;  3SS5 A;  3T4S A;  3O86 A;  3T4Q A;  3R4K A;  3DWZ A;  3JVV A;  4DN0 A;  3C7V A;  3V5M A;  2EFU A;  4P85 A;  1BLS A;  4GNU A;  4ZTK A;  4DF6 A;  2I72 A;  3ISG A;  2KDK A;  2QZ6 A;  2HDQ A;  1GA9 A;  4BJP A;  4X6T A;  4MCW A;  1S66 L;  3G34 A;  1U60 A;  5EV0 A;  3G2Y A;  4E3K A;  2GX5 A;  4HQA A;  1ERQ A;  2GDN A;  1I2W A;  2X01 A;  4RX3 A;  3KSF A;  4ZJ2 A;  4PM9 A;  3WS0 A;  3VOZ A;  2JKR I;  4NET A;  4BMW A;  3SH7 A;  4S2M A;  4F3L B;  4X69 A;  2OAQ 1;  3PBR A;  3MZD A;  3MXS A;  3C5A A;  4I38 A;  3JVU A;  4WZ4 A;  2WGW B;  1BLC A;  4FH4 A;  3IQA A;  3IX8 A;  4ETX A;  2VX8 A;  1IYQ A;  4DDY A;  4EEU A;  1TS8 A;  5GHY A;  5GLC A;  5LBR A;  3LEQ A;  3WRZ A;  3BLM A;  1SKO B;  1CK3 A;  1CI8 A;  2PU2 A;  1YAX A;  2GNX A;  3T4K A;  3NUL A;  1FR6 A;  2Y2Q A;  1BUL A;  1E3U A;  3OPP A;  4LV2 A;  5GL9 A;  2XLN A;  4X53 A;  1DRM A;  3BFG A;  3NOU C;  2AVX A;  2OOL A;  3HLG A;  3QP5 A;  3LIF A;  3UE6 A;  3F1P B;  1O07 A;  3ZQ5 A;  1IKG A;  3HUM A;  3VP0 A;  4Y5F A;  4I3I A;  4IUH A;  3ULF A;  2A24 A;  4X56 A;  5L10 A;  2ZQA A;  3CIT A;  1IEL A;  3MMH A;  3NDG A;  5CHM A;  2DNS A;  3FPW A;  4HY8 A;  5CGX A;  3OBF A;  1NJ4 A;  4KG6 A;  3ZYT A;  3MKE A;  1OPX A;  4ARZ A;  4I3J A;  4O0P A;  5E2G A;  4IBX A;  4HOI A;  1D06 A;  5CTM A;  3TW8 A;  3C2W A;  3KYZ A;  2P7J A;  4PM8 A;  1XPB A;  3GEC A;  1BLP A;  4DJ3 A;  1ZKJ A;  3LR3 A;  1LHY A;  5A93 A;  3EGD C;  2EXA A;  5L09 A;  1E25 A;  4H8R A;  5IU1 A;  1PWG A;  3IF6 B;  1GA0 A;  1YLW A;  5DF7 A;  1W8Q A;  1PZO A;  4LLO B;  2ZC4 B;  1ACF A;  1CF0 A;  3UPO A;  2RCX A;  3UY6 A;  5FAS A;  2QYB A;  4MN5 A;  4NXB A;  5K5B A;  2O9B A;  3TE8 A;  4N9K A;  5DJU A;  2JKR M;  4P87 A;  4EWF A;  2OWH A;  1K54 C;  4Q8I A;  2PBD P;  2P08 A;  3GSG A;  1OT6 A;  5IHV A;  3EQU A;  4Y13 A;  1OJ5 A;  5HD3 A;  2J9O A;  4IVK A;  2YKH A;  1FCN A;  5FQQ A;  2ZL1 A;  5FDS A;  2L4R A;  1XJ3 A;  4OVD A;  4KQD A;  3W2Z A;  2WAF A;  3GV9 A;  5G4Y A;  3UN7 A;  4K0X A;  4GS9 B;  3EGX C;  5AQB A;  3UB5 P; 
#chains in the Genus database with same CATH homology
 5EOO A;  4OPR A;  3UE0 A;  1CEG A;  1HD8 A;  2WGI A;  3V3S A;  2UWX A;  2XD1 A;  1HVB A;  5FI7 A;  4Y7P A;  3NIA A;  3PBO A;  1MPL A;  2ZC6 B;  4S2N C;  3NDE A;  1DJB A;  1RGZ A;  1MXO A;  3A3E A;  1ZG4 A;  4KZA A;  5CXW A;  3C4O A;  3TSG A;  4OON A;  4CJN A;  3IWQ A;  4R0Q A;  4DDS A;  2WGV A;  4R3J A;  3O3V A;  3PAG A;  5EVI B;  3HL9 A;  2JE5 A;  4ZJ3 A;  2H0T A;  4GN2 A;  1K6S A;  4S2P A;  4BD1 A;  4L0L A;  3UDF A;  3BFD A;  4LCL A;  3ZNY A;  1PYY A;  3SS3 A;  1K56 D;  3IF6 A;  3VFH A;  3VP3 A;  1XGI A;  2HDS A;  3MFD A;  2R9W A;  1K57 A;  1VQQ A;  4OQH A;  3W4P A;  2XR0 A;  1HTZ A;  1MWU A;  2WAD A;  4RYE A;  4KZ5 A;  1MWR A;  4BQM A;  4E3O A;  2DRW A;  3BEB A;  1TDG A;  2H10 A;  4OPZ A;  4N92 A;  4UA7 A;  5A92 A;  2XEP A;  2BLS A;  2XH9 A;  3OPR A;  4JXW A;  2OSU A;  5FAQ A;  4WZ5 C;  2ZQ9 A;  3ZHH A;  3V3R A;  4BD0 A;  4BL2 A;  4DKI A;  4WM9 A;  4DXC A;  4U0X A;  1NYM A;  3PTE A;  2DCF A;  1FOF A;  2P9V A;  3WWX A;  4WYY A;  2HDR A;  2QMI A;  4JF6 A;  4E6X A;  1IKI A;  2WKI A;  5DTS A;  5E2F A;  4QY5 A;  5F83 A;  1KVM A;  2C5W B;  3ZVW A;  3I7J A;  2J8Y A;  3N8R A;  5GHX A;  4IBR A;  1KGF A;  3A3J A;  5F82 A;  4GDB A;  4C6Y A;  5DF9 A;  5GLD A;  1XKZ A;  4OPQ A;  1JWV A;  3M6B A;  1JTD A;  2RL3 A;  3HRE A;  4PM7 A;  3Q7Z A;  4M3K A;  3RJU A;  2EFX A;  1CI9 A;  4P6B A;  3HUN A;  1S0W A;  3LEZ A;  3N4I A;  4JF4 A;  1O7E A;  3MKF A;  5CEB A;  2EX6 A;  1K55 A;  3FWL A;  3HLF A;  3IXH A;  4LV3 A;  4R4S A;  3VP1 A;  1SHV A;  3LY4 A;  5CER A;  3HLB A;  3Q7V B;  1FCM A;  4LCM A;  4EQI A;  3HLW A;  4MBF A;  1K56 A;  3AGD A;  4MLL A;  3PBN A;  3E2K A;  4LV1 A;  3PAE A;  5E2E A;  3V39 A;  1W5D A;  1N9B A;  2JC7 A;  3TG9 A;  2A49 A;  3IF5 A;  4X55 A;  3C7U A;  2Y4A A;  2OLU A;  3UPN A;  5GLA A;  3ZCZ A;  2G2U A;  4HEF A;  1TVF A;  2XD5 A;  3WS5 A;  3SH9 A;  1LI0 A;  1SDN A;  1XGJ A;  1XA1 A;  3OPH A;  1K4E A;  4FD8 A;  4GZB A;  3G4P A;  1KGG A;  1MWT A;  2ZQ7 A;  4RVA A;  3BM6 A;  5F1G A;  1J9M A;  1KDS A;  2FFY A;  4WEK A;  3GQZ A;  5G18 A;  3SOI A;  3HLC A;  4B4X A;  4DE1 A;  1XX2 A;  5EVI A;  5FQJ A;  1H5X A;  5CHJ A;  1I5Q A;  4GDN A;  4S2O A;  1ONH A;  4KZ6 A;  3PBQ A;  4YFM A;  1K38 A;  4KZ8 A;  3B3X A;  3OPL A;  2Y2J A;  1W8Y A;  3S22 A;  3P09 A;  5HW3 A;  1ZC2 A;  1PW1 A;  4QJG A;  5M1A A;  1ES4 A;  3MZE A;  5I94 A;  1LL9 A;  2HP9 A;  3S1Y A;  1RGY A;  2EX9 A;  4JPM A;  4JXS A;  3FV7 A;  3IXB A;  4S2I A;  4KZ7 A;  4GD6 A;  4EBP A;  5FA7 A;  5FSR A;  4S2K A;  5CGW A;  4QU3 A;  5CEC A;  5FAT A;  3WS2 A;  4EBL A;  2V1Z A;  5FI2 A;  5HX9 A;  3G2Z A;  4OP8 A;  3CJM A;  4S2J A;  3LY3 A;  3UDX A;  1IEM A;  4GD8 A;  1ERO A;  4R4R A;  2WZX A;  4FSF A;  4JBF A;  1JVJ A;  5CGS A;  4UHU A;  5BOH A;  3ITB A;  2VGK A;  3QHY A;  4E3L A;  3OZH A;  4OH0 A;  4U3T A;  2R9X A;  3W4O A;  4UA9 A;  1PZP A;  3BFE A;  3C4P A;  5GLB A;  4LEN A;  4RX2 A;  1WYC A;  1RP5 A;  5EEC A;  2JCH A;  3N6I A;  3NCK A;  3M2K A;  4OKP A;  5M18 A;  3IXD A;  1KDW A;  1NRF A;  1KGE A;  4E3M A;  1DY6 A;  2Z2L B;  2HP5 A;  4P0M A;  4WBG A;  1BUE A;  3Q7V A;  5EOE A;  3HVF A;  3Q1F A;  1FCO A;  4KZ4 A;  3FKV A;  2EXB A;  3HLE A;  1SCW A;  2WK0 A;  4Y0O A;  2C6W B;  4IED A;  4WEL A;  1NZU A;  1ES2 A;  2IWD A;  1JWZ A;  1YLP A;  4KEN B;  1L0E A;  3TOI A;  1YT4 A;  2CC1 A;  4R23 A;  1QME A;  4YIN A;  2ZC3 B;  1YLT A;  2XFS A;  4FH2 A;  5KMW A;  5D3O A;  4MBK A;  5FAP A;  1PI4 A;  3E2L A;  5HL1 A;  1WE4 A;  2E8I A;  1EWZ A;  3IHA A;  3MZF A;  3W4Q A;  3MBZ A;  2IWC A;  2J7V A;  2ZJ9 A;  3M6H A;  3SH8 A;  4DE0 A;  4C3Q A;  2Q9N A;  3G30 A;  3VP2 A;  3W8K A;  4KG5 A;  5E2H A;  1L0G A;  2Y2O A;  3ZGA B;  1GHI A;  3BRM A;  1YLJ A;  2Y2I A;  3ZVT A;  5L2F A;  3CMZ A;  1M6K A;  1IYO A;  3N7W A;  3ZNT A;  3IF6 C;  1L0F A;  2ZLY A;  3NI9 A;  4QB8 A;  1K57 C;  2PBY A;  4QY6 A;  1ALQ A;  5FI6 A;  4HBU A;  5DVA A;  3IHB A;  1C3B A;  3SS5 A;  4MEZ A;  2XQZ A;  1FR1 A;  3O86 A;  2V20 A;  3QNC A;  4Z9Q A;  3DWZ A;  3M2J A;  4ZDX A;  3C7V A;  1PI5 A;  2XF3 A;  3V5M A;  4PM5 A;  5DTT A;  2EFU A;  4P85 A;  1BLS A;  4BEN A;  1ES5 A;  2Y2P A;  3OC2 A;  4GNU A;  2Y2N A;  3G35 A;  4KZB A;  4KQQ A;  3LCE A;  4R1G A;  4OLG A;  4WMC D;  2I72 A;  3ISG A;  4DF6 A;  1TEM A;  1Y54 A;  1YM1 A;  1Q2P A;  4BL3 A;  2QZ6 A;  1PWD A;  2HDQ A;  4JXG A;  3VMA A;  2VGJ A;  1GA9 A;  2X71 A;  4OQG A;  4BJP A;  4X6T A;  2ZC7 A;  3G34 A;  3RXW A;  1U60 A;  4E3K A;  3G2Y A;  4XXR A;  5GHZ A;  4NK3 A;  1KVL A;  2OV5 A;  1ERQ A;  2GDN A;  1I2W A;  4KZ3 A;  2X01 A;  4RX3 A;  3OCL A;  2Y2G A;  4ZJ2 A;  4E3J A;  1ERM A;  1PW8 A;  4JF5 A;  4PM9 A;  3WS0 A;  3VOZ A;  1K54 A;  2FFF B;  1M40 A;  3LO7 A;  3P98 A;  2ZM2 A;  1G6A A;  1S6R A;  3PBS A;  3SS4 A;  4BLM A;  4NET A;  2Y59 A;  3HUO A;  3JYI A;  4MNR A;  2HPB A;  5TGF A;  1XXM A;  3G32 A;  1MBL A;  1NZO A;  1YLY A;  4OOY A;  1YQS A;  3WS4 A;  4CPK A;  5M19 A;  3O88 A;  3SH7 A;  4S2M A;  4N9L A;  4X69 A;  1E3U D;  1PWC A;  3PBR A;  1KE3 A;  3WS1 A;  3MZD A;  2HDU A;  2ZQ8 A;  1BTL A;  1W79 A;  3MXS A;  5AQ7 A;  3C5A A;  3IXG A;  4S2L A;  3UE3 A;  4WZ4 A;  4WMC A;  2WGW B;  3GTC A;  4KQR A;  3FZC A;  5HAR A;  5TR7 A;  4WEJ A;  3VP4 A;  1SDE A;  1BLC A;  4FH4 A;  2IWB A;  3IQA A;  4UA6 A;  1MKI A;  5HAP A;  5EVI C;  1IYQ A;  3ZG7 B;  4DDY A;  2WYX A;  3Q81 A;  2G2W A;  3UDI A;  2X02 A;  3ZFZ A;  5FQI A;  5GHY A;  2Y2M A;  3MXR A;  4PPR A;  5GLC A;  4JXV A;  4S2N A;  3UO9 A;  1I2S A;  3BFC A;  4ZBE A;  3N8L A;  4EBN A;  1ONG A;  3WRZ A;  3BLM A;  4FCF A;  1QMF A;  2HP6 A;  4OLD A;  5EUA A;  1CK3 A;  4EUZ A;  1PIO A;  4OQ0 A;  1CI8 A;  2PU2 A;  1FSW A;  1H8Z A;  2Y91 A;  1JTG A;  1Z6F A;  4B4Z A;  3GMW A;  2H5S A;  5CED A;  5EVL A;  1G68 A;  3UE1 A;  4E3N A;  1DJA A;  1FR6 A;  4Y0U A;  2Y2Q A;  3UPP A;  1K6R A;  4XUZ A;  1FQG A;  1BUL A;  1MWS A;  1E3U A;  3OPP A;  3FYZ A;  4LV2 A;  5HAQ A;  2ZM0 A;  2H0Y A;  1GHM A;  2XLN A;  3A3F A;  5GL9 A;  4X53 A;  3BFG A;  1L0D A;  4WZ5 A;  3AGF A;  2XDM A;  5U47 A;  5JYO A;  3AGE A;  5AQA A;  1ES3 A;  2PU4 A;  2XK1 A;  4JKT A;  1ESU A;  1N4O A;  1L2S A;  3HLG A;  4DE2 A;  4E3I A;  1Q2Q A;  3Q07 A;  1EI5 A;  1OME A;  4KZ9 A;  3BYD A;  3BFF A;  1O07 A;  3PBT A;  1IKG A;  3HUM A;  5E43 A;  3S4X A;  2WAE A;  2ZD8 A;  2BG1 A;  3VP0 A;  3WRT A;  3ZG0 A;  2WUQ A;  4QD4 A;  4ZJ1 A;  1KE0 A;  4DRT A;  5FQ9 A;  3RXX A;  4X56 A;  2ZQA A;  1GCE A;  3ZG8 B;  3VOY A;  1IYP A;  2Q9M A;  2EX2 A;  1IEL A;  3GRJ A;  4D2O A;  4XUX A;  1IYS A;  1WYB A;  1DJC A;  1NY0 A;  3NDG A;  5CHM A;  3IWO A;  3ZG5 A;  2WKE A;  5J8X A;  2DNS A;  3BEC A;  2Y55 A;  2ZQC A;  3OCN A;  4UAA A;  1JWP A;  4EV4 A;  4OP5 A;  2OLV A;  3QNB A;  5CGX A;  1ESI A;  1MY8 A;  1VM1 A;  3IH9 A;  4GB7 A;  4OPY A;  2Y2L A;  1NJ4 A;  1YMS A;  5EVI D;  4KG6 A;  2WGW A;  4Y0T A;  1GHP A;  4OOL A;  1HZO A;  3G31 A;  3MKE A;  3DWK A;  3ITA A;  1LI9 A;  3NC8 A;  5E2G A;  4IBX A;  3O87 A;  3DW0 A;  5A91 A;  4LV0 A;  5CTM A;  5FQM A;  4ZTK A;  3UNW A;  3A3D A;  4PMA A;  5KZH A;  1CEF A;  4PM8 A;  4R3B A;  1XPB A;  3VSL A;  2B5R A;  3DTM A;  3EQV A;  1BLP A;  5DF8 A;  3IT9 A;  1AXB A;  1ZKJ A;  2P74 A;  4MBH A;  1FSY A;  5EE8 A;  4GOG A;  2ZM8 A;  3N8S A;  4ZAM A;  2Y2K A;  1BSG A;  1LHY A;  5A93 A;  4X68 A;  1ZG6 A;  4QHC A;  2WZZ A;  4GKU A;  5AQ9 A;  2EXA A;  3NBL A;  4N1X A;  4JLF A;  3NY4 A;  1E25 A;  1SKF A;  4H8R A;  4KG2 A;  4DE3 A;  1TDL A;  1RCJ A;  1PWG A;  1K4F A;  3BLS A;  3CZD A;  3IF6 B;  3ZG9 B;  1GA0 A;  1K55 C;  2XGN A;  4OQI A;  1YLW A;  2EX8 A;  5CRF A;  5DF7 A;  1W8Q A;  1PZO A;  1XA7 A;  2ZC4 B;  3V50 A;  4PM6 A;  5FDH A;  4KQO A;  4DXB A;  2Y2H A;  4B88 A;  2Z2M B;  5EPH A;  3UPO A;  3FKW A;  5CHU A;  2RCX A;  3UY6 A;  5KSC A;  1YMX A;  1XP4 A;  5FAS A;  1LLB A;  2P9V B;  4N1H A;  4N9K A;  3IWI A;  3A3I A;  5FAO A;  4P87 A;  1NYY A;  1YLZ A;  4EWF A;  3D4F A;  1K54 C;  5FQK A;  4Q8I A;  4C75 A;  4U0T A;  2JBF A;  1LL5 A;  1NXY A;  2J9P A;  3GSG A;  3CG5 A;  5IHV A;  1E4D A;  1BLH A;  3EQU A;  1BZA A;  3VFF A;  2J9O A;  4HBT A;  5TFQ A;  2WKH A;  4IVK A;  5DTK A;  4F94 A;  1FCN A;  1W7F A;  3GVB A;  4HES A;  5FQQ A;  3HBR A;  5F1F A;  4OOM A;  4K0W A;  1K25 A;  4E6W A;  1H8Y A;  4O7D A;  4OVD A;  2V2F F;  3VSK A;  2ZC5 B;  3IH8 A;  2WAF A;  3GV9 A;  2XFT A;  5CTN A;  3UN7 A;  4ID4 A;  4K0X A;  5HFO A;  4IVI A;  3ZDJ A;  5HAI A;  4RA7 A;  2A3U A;  3GR2 A;  2QPN A;  3Q82 A;  4K91 A;  5A90 A;  3HLD A;  5AQB A;  2ZQD A;  4A5R A;  1BT5 A;  5KSH A;  5JYP A;  2ZMA A;  1KE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...