3A3JA

Crystal structures of penicillin binding protein 5 from haemophilus influenzae
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
344
structure length
344
Chain Sequence
GVTPPQITAQTYVLMDYNSGAILTALNPDQRQYPASLTKMMTSYVVGVALKQGKIHNTDMVTIGESAWGRNFPDSSKMFLDLNTQVSVADLNRGVIVVSGNDATVALAEHISGNVPNFVETMNKYVQQFGLKNTNFTTPHGLDDPNQYSSARDMAIIGAHIIRDLPEEYKIYSEKDFTFNKIKQPNRNGLLWDKTINVDGMKTGHTSQAGYNLVASATTSNNMRLISVVMGVPTYKGREVESKKLLQWGFANFETFKTLEAGKEISEQRVYYGDKNSVKLGAFMDHFITIPKGKQSEVKARYELADKNLQAPLAKGQVIGKVVYALDGKDIASANLQVMNDVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PBP5
publication title Crystal structures of penicillin-binding proteins 4 and 5 from Haemophilus influenzae
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 106
structure length 344
sequence length 344
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2009-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07943 PBP5_C Penicillin-binding protein 5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.410.10 Mainly Beta Sandwich Peptidoglycan synthesis regulatory factor (PBP3), Domain 2 D-Ala-D-Ala carboxypeptidase, C-terminal domain 3a3jA02
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3a3jA01
2RL3A 4GN2A 3IHAA 4KG6A 1Z6FA 3ZGAB 4RVAA 5JYOA 2Y2LA 3N8LA 1YLZA 3MZEA 3BFDA 4PM8A 4QD4A 5CGXA 1PZPA 4P85A 2XK1A 3N8SA 2V20A 5HW3A 2Y2KA 4ZJ3A 3FKVA 5D3OA 1E25A 4KZ7A 3UE3A 3P98A 4FH2A 5JYPA 1GHIA 5CHUA 1CI9A 5EVLA 4MNRA 3SOIA 5GLCA 4PMAA 3VP2A 3BECA 4JLFA 2VGKA 2WKIA 3VOZA 2XD5A 3A3EA 1K54A 3M6BA 1H5XA 4UA7A 5CHJA 3UE0A 5F82A 3HLEA 4KZ8A 4OVDA 1TEMA 2Y2HA 3C7UA 4LV0A 4WMCD 1NRFA 3MZFA 3O88A 5DVAA 4WEJA 2WKHA 3ZG0A 1L0FA 1K56D 4UAAA 3IWOA 1IYPA 4HESA 2Y2GA 4OKPA 4OOYA 3IWQA 1IKIA 1YLPA 1TVFA 5F1GA 4ZJ1A 3SS3A 4FSFA 5DTTA 4OQ0A 4XUXA 4EBNA 5GHXA 4K91A 4FH4A 1JWPA 2JE5A 3M6HA 1EROA 3MKEA 1AXBA 3LEZA 3SH7A 4WZ4A 1JWZA 1BLSA 3IHBA 5FAOA 1MPLA 1NJ4A 4NK3A 3OPPA 1FCMA 4N1XA 3SH9A 2HP5A 1S0WA 1PW8A 3VOYA 2HPBA 3IF5A 3ZG7B 2BG1A 4GZBA 1HVBA 2EFXA 2EX2A 5CHMA 3G2ZA 3SS5A 5AQBA 2Y2NA 1K38A 4FCFA 2WKEA 4N9LA 2Y2IA 2XEPA 4RA7A 3Q82A 1DJBA 3UDIA 3VP0A 1ONGA 3BLSA 4FD8A 5EE8A 2C5WB 1PWCA 4S2LA 4DRTA 2EFUA 3LCEA 3Q7VA 4E3LA 4GDBA 4QY5A 4MEZA 2XR0A 3ZG5A 3HLCA 3PTEA 4R0QA 1GA9A 3W4QA 1ERQA 3MKFA 1IKGA 3G34A 1MWUA 2OLUA 4ZAMA 1SHVA 4KZ3A 1S6RA 3AGDA 5DTSA 2UWXA 4DE1A 3UPOA 4P6BA 4HBUA 3EQVA 3IH9A 4M3KA 5E2EA 3RXXA 3ISGA 1VQQA 4OQGA 5EPHA 4E3JA 1SCWA 5FA7A 3TG9A 1C3BA 1CEGA 1BLCA 3E2KA 3G32A 5EOEA 4LENA 4OPRA 4QY6A 3I7JA 4RX3A 5CGSA 2H0TA 2JCHA 1ES5A 3G31A 3HLDA 5KMWA 2FFFB 2I72A 5FAQA 2ZD8A 1HD8A 1K57A 1TDLA 1E3UD 2P9VA 2Y59A 2Y2MA 4QU3A 1YT4A 3MFDA 4R3JA 4U3TA 1PW1A 1OMEA 4S2NA 5DF8A 3TOIA 2XDMA 4JBFA 5DF9A 1EI5A 1YM1A 1LI0A 4IBRA 2XFSA 4GB7A 3OCNA 3C7VA 4S2KA 5FI7A 3GSGA 5FATA 3G2YA 3ZVWA 3HVFA 4E3MA 2OLVA 5GLDA 3BEBA 5EVIC 3ZNTA 3S1YA 4BLMA 1ESUA 1PWDA 3PBTA 3A3FA 1CI8A 4KG2A 2WAFA 4JXWA 3PBRA 3Q7VB 3VP4A 2ZM0A 5FQIA 1PI4A 2WUQA 3N4IA 4X68A 3N8RA 5GHYA 4MBKA 1BLHA 4OOMA 1PWGA 3N6IA 3Q81A 3CJMA 5DF7A 3UDXA 3EQUA 5FQKA 5HARA 3ZFZA 3ZDJA 1JWVA 2B5RA 1IYSA 4ZTKA 4E6XA 1BTLA 3OPRA 2V2FF 3NBLA 2Y4AA 4PM5A 4OH0A 1FR1A 1JTGA 2OSUA 1W5DA 4X6TA 3BYDA 3NIAA 5CTNA 1H8YA 1BULA 1RCJA 3GQZA 1DY6A 2A3UA 3E2LA 1GA0A 3MXSA 2PBYA 4GKUA 3GRJA 4PM9A 1RP5A 3GMWA 4KG5A 1K55C 3ITBA 3GR2A 3IF6C 3NDEA 2P9VB 3OCLA 2ZLYA 1I5QA 2WGWA 5KSCA 5FQ9A 1J9MA 4DE2A 3G30A 1PIOA 1NXYA 4XXRA 1PI5A 5EVIA 2WADA 3WS2A 1K25A 3ZG8B 1XA1A 3GV9A 1TDGA 4PM7A 4Q8IA 2ZQDA 1ERMA 1YLWA 5CGWA 3HLGA 3NCKA 1WYBA 3PBNA 2ZQ7A 4OPZA 1IEMA 4S2OA 3HUNA 5KSHA 3CZDA 1XGJA 3DWZA 1KGGA 4KZ5A 4U0XA 3PAGA 3VSLA 1YQSA 3VMAA 2J9PA 4MBHA 5E43A 1KVMA 4IVKA 4BL3A 5FI6A 4QJGA 5FDHA 3QNBA 1LL5A 4WELA 3RJUA 2Y2OA 1Q2QA 5GHZA 2Z2MB 4JXGA 2X02A 3MBZA 3O87A 1DJCA 1MWSA 5FI2A 3HLBA 3P09A 3N7WA 1ES2A 3FZCA 1M40A 3GVBA 4XUZA 2PU4A 5AQAA 5HL1A 3V5MA 3A3IA 1MXOA 5F1FA 3BFEA 1LL9A 4OLGA 2EX6A 2HDRA 3M2KA 1XX2A 1XKZA 5TR7A 2IWCA 4QB8A 3BFGA 5GL9A 3C4PA 3NY4A 4JXVA 3O3VA 3IF6A 1G68A 1ZC2A 2ZC4B 3BLMA 1GHPA 3GTCA 3PAEA 4P0MA 5FQJA 4DDYA 1W8YA 5KZHA 1FQGA 3IXBA 3B3XA 2WGIA 4E3KA 4IEDA 3IXGA 5FQQA 2R9XA 4UA9A 4ZBEA 2QMIA 4KZAA 4JF6A 3C5AA 2HDQA 1N4OA 4S2MA 3RXWA 1DJAA 4LV2A 2QPNA 3UO9A 1K56A 5A90A 4C3QA 2WGWB 4EBPA 3V50A 1FCOA 5M18A 4EQIA 1LHYA 3ITAA 2DCFA 4DDSA 1BSGA 3MXRA 5EVIB 2ZM2A 1VM1A 3OC2A 2IWBA 5CERA 4E3NA 2PU2A 3HUMA 2XGNA 5CXWA 2HP9A 3V3SA 1E4DA 2XLNA 5E2FA 5HAIA 1NY0A 4JXSA 4CPKA 5HAQA 3NC8A 4X53A 2Y91A 4GNUA 4EUZA 4BJPA 3SH8A 4DXCA 1W8QA 1ONHA 2Y2PA 3V3RA 4NETA 3W4OA 5CRFA 1RGZA 3WWXA 3S4XA 2X71A 3ZVTA 4KZ6A 3LY3A 2ZC7A 2Y2JA 4GD8A 4EBLA 5AQ9A 2ZJ9A 1ES4A 4Z9QA 3VFFA 3W8KA 2J9OA 4F94A 2Z2LB 2ZQCA 3AGEA 1Y54A 1JTDA 2EX8A 1U60A 1NZUA 1SDEA 2XFTA 5J8XA 2RCXA 4ZDXA 1MBLA 1W79A 5IHVA 3UPNA 3IF6B 4PPRA 1MWTA 4KQRA 1RGYA 2WZZA 4H8RA 1ALQA 1BUEA 4K0WA 3FKWA 1L0DA 4Y0UA 4B88A 3DTMA 4KZBA 1G6AA 4MLLA 2XF3A 4OPYA 4Y7PA 2V1ZA 4BD1A 1KE0A 1KDSA 3S22A 1LI9A 2ZQ9A 1K54C 4O7DA 1K4FA 1ZKJA 3FV7A 4OPQA 4E3IA 1WYCA 3M2JA 4WM9A 1XA7A 3G4PA 3FWLA 2WZXA 2EXAA 4Y0TA 1NYYA 3V39A 4P87A 4DE0A 2ZC6B 1HTZA 3WS1A 5AQ7A 2H10A 4BENA 1KVLA 1ZG4A 4BL2A 4MBFA 5FASA 2G2UA 1K6RA 3IXHA 2ZC5B 1KGFA 3CG5A 1NYMA 4JF4A 1KGEA 1YLYA 3DW0A 2WK0A 4YFMA 2OV5A 2QZ6A 1FOFA 1KE4A 3IQAA 1L0EA 1O07A 3AGFA 3FYZA 4JPMA 1XXMA 1EWZA 3PBQA 4N9KA 3LO7A 4GDNA 3WRZA 2X01A 2EX9A 2J8YA 4R23A 3UPPA 4ID4A 3BM6A 5EECA 3OPLA 5EOOA 1BZAA 3W4PA 2H5SA 5HX9A 3WS4A 3DWKA 1CK3A 1L2SA 1YLJA 3O86A 5U47A 1QMEA 4K0XA 2ZQAA 1YMXA 1N9BA 1K4EA 2WYXA 1XP4A 1GHMA 2ZMAA 4X56A 4E6WA 5BOHA 5TFQA 4C75A 1NZOA 2C6WB 3IXDA 3VP3A 3Q07A 1IYQA 5TGFA 1FSWA 5EUAA 5GLBA 3UE1A 4N92A 2Q9MA 4ZJ2A 4LV1A 1KE3A 2Y55A 3NI9A 5FQMA 4DE3A 3QNCA 4S2JA 4KZ9A 2Q9NA 4QHCA 4E3OA 1LLBA 2ZM8A 5A93A 4JF5A 4GD6A 2A49A 4KQOA 3UN7A 5CECA 2ZC3B 3ZG9B 4DKIA 3IWIA 3IT9A 2FFYA 4X55A 4YINA 2Y2QA 4X69A 5FAPA 2IWDA 1XGIA 5A91A 2WAEA 1BT5A 1K55A 1MWRA 1YLTA 2P74A 4A5RA 3BRMA 2DRWA 1CEFA 4OONA 2XD1A 4WZ5C 2HDUA 4OQIA 4OLDA 5CEBA 5CTMA 2DNSA 1HZOA 4UA6A 4R4RA 1WE4A 2EXBA 1K57C 1YMSA 4WMCA 3ZCZA 2CC1A 3LY4A 3ZNYA 2H0YA 4R3BA 1L0GA 4DF6A 1O7EA 1SDNA 1QMFA 1ES3A 5I94A 1BLPA 4WYYA 4S2NC 3Q7ZA 1KDWA 1M6KA 4JKTA 5DTKA 4IVIA 3A3DA 3MZDA 3SS4A 3WS5A 4EWFA 4KENB 1H8ZA 2HP6A 4IBXA 4B4ZA 5M19A 1GCEA 5L2FA 1XPBA 1FSYA 3QHYA 4U0TA 3OPHA 4KQQA 5A92A 1ESIA 3HL9A 3OZHA 3BFCA 4LCMA 2E8IA 4OQHA 4PM6A 5E2HA 3HLFA 4BQMA 3PBSA 5E2GA 2GDNA 3IH8A 4WEKA 4B4XA 4EV4A 4R1GA 4GOGA 1ZG6A 4DXBA 5GLAA 1I2SA 1I2WA 3D4FA 3HUOA 4RX2A 3VFHA 4WZ5A 1JVJA 1IYOA 4R4SA 4Y0OA 4WBGA 4KZ4A 4LV3A 4UHUA 5FSRA 5HFOA 4OP8A 4BD0A 3WRTA 1MKIA 3JYIA 3WS0A 3UDFA 3PBOA 4LCLA 3NDGA 1K6SA 2JBFA 5M1AA 4C6YA 5CEDA 1W7FA 2R9WA 1FR6A 4L0LA 1SKFA 3G35A 2XQZA 4RYEA 3HLWA 3TSGA 5EVID 1MY8A 3VP1A 5G18A 2JC7A 4OP5A 3HREA 4OOLA 2G2WA 3C4OA 3Q1FA 3UNWA 2ZQ8A 3VSKA 1IELA 4CJNA 3A3JA 5HAPA 3UY6A 2VGJA 2XH9A 2WGVA 5F83A 1Q2PA 4HEFA 3ZHHA 4S2IA 4HBTA 4N1HA 2HDSA 2BLSA 2J7VA 4S2PA 1E3UA 1PYYA 1FCNA 3BFFA 4D2OA 1PZOA 3HBRA 3CMZA
chains in the Genus database with same CATH superfamily
4GN2A 2D01A 4KG6A 4LFUA 3ZGAB 3N8LA 1YLZA 3MZEA 3BFDA 4PM8A 5CGXA 3N8SA 1ZTUA 5DFYA 4UQIS 5JYPA 4FH2A 5GLCA 4HNBA 2GNXA 4MDZA 3M6BA 1H5XA 2G7UA 3UE0A 3LR5A 3KYEA 2PDRA 4OVDA 1TEMA 3SW1A 1G5UA 2XA7M 1K56D 2W27A 3IWQA 1YLPA 4FSFA 3HJKA 1JWPA 3M6HA 4I5SA 4WZ4A 1JWZA 3DBAA 2L0WA 4N1XA 2HP5A 1PNEA 4GZBA 2KDKA 2Y2NA 4FCFA 2WKEA 3LICA 3BLSA 4FD8A 2L4RA 2D02A 4QPRA 3UB8A 3W4QA 3MKFA 3R7WB 1OTBA 3B47A 4H6JB 4ZRRA 4KZ3A 5DTSA 4Z1WA 3RXXA 3ISGA 5EPHA 1T1CA 5FA7A 2W3DA 1C3BA 1XFQA 4LENA 4KUOA 3NHQA 2JCHA 2FFFB 1STZA 2Y59A 1YT4A 4U3TA 1PW1A 4CLCB 1SKOB 3TOIA 4BWIA 4R6LA 4S2KA 3GSGA 5DJUA 3HVFA 4E3MA 2OLVA 5L10A 5EVIC 3ZNTA 2CMNA 1CI8A 4ETZA 3PBRA 5J7EA 3IBJA 1VEUB 2M7UA 1VHMA 5TJJA 3E98A 1PWGA 4EU0A 5HZHA 5DF7A 3ZFZA 5FQKA 2B5RA 2B02A 3NIAA 1RCJA 5IS1A 1TS7A 2O9AA 3GRJA 5I5LA 1RP5A 3GMWA 2V9AA 3H7WB 3IF6C 4H6JA 3QP6A 3R7WA 3VE4A 3OCLA 4GLQA 1J9MA 1TD5A 3G30A 5EVIA 1PI5A 3H82B 2WADA 1K25A 3GV9A 4PM7A 4Q8IA 1ERMA 3EOIA 3HUNA 1XGJA 4HOIA 4BL3A 4HY8A 4WELA 1Q2QA 2K2NA 2VKSA 3CI6A 4G3VA 1N9NA 4LGWA 1DJCA 1MWSA 5FI2A 4GW9A 5TBMB 3A3IA 4O01A 3M2KA 1XX2A 3C4PA 3NY4A 4JXVA 4P0MA 3IF6A 3GTCA 3CITA 2V1BA 3B3XA 4IEDA 4UA9A 1DJAA 3UO9A 1K56A 5A90A 4GCZA 1FCOA 3V50A 4EQIA 1BSGA 1F98A 5F6AA 2ZM2A 5CERA 3MSHA 2PU2A 5CXWA 4Y2FA 3V3SA 1E4DA 4X25A 3F1PA 1NY0A 1S4RA 4CPKA 5HAQA 1H8MA 4DXCA 1ONHA 2OWHA 3ZVTA 2Y2JA 3T1XA 1YAXA 5AQ9A 3H82A 4Z9QA 4F94A 3GECA 2XFTA 5J8XA 3LR4A 1OTDA 5IHVA 1RGYA 2WZZA 2VLGA 3T1SA 1BUEA 4KZBA 4G3WA 4OPYA 4Y7PA 4QWOA 3S7QA 4O7DA 1K4FA 4II7A 4Y5FA 5TBMA 3SZTA 3G4PA 2P7JA 2QYBA 3V39A 2BASA 3TE8A 1KVLA 2ZC5B 2E8JA 1KGFA 3MFXA 4JF4A 2WK0A 1KOUA 3KSFA 3R4KA 4YFMA 4B93A 1KE4A 4Q0HA 1EWZA 3PBQA 3LO7A 3WRZA 5HDDA 4R23A 5IU1A 1DP6A 5EECA 5EOOA 3OPLA 5HX9A 1QMEA 2ZQAA 1YMXA 1XP4A 4X56A 4HP4A 5DKLA 4E6WA 5BOHA 5TFQA 1NZOA 2C6WB 1FSWA 4I39A 5EUAA 2Q9MA 4LRZE 2Q9NA 4QHCA 2WKRA 2A49A 4BBVA 3ZG9B 4X55A 4YINA 4ETXA 5FAPA 1XGIA 1BT5A 1K55A 1MWRA 1YLTA 2P74A 4A5RA 1NLYA 2VGLS 3D9YA 2XD1A 4WZ5C 4OQIA 2DNSA 3TJZC 1T1AA 2HF6A 4UA6A 1K57C 4WMCA 3ZCZA 4R3BA 2J80A 4WYYA 4S2NC 4JKTA 4EWFA 4KENB 1H8ZA 5M19A 1XPBA 2EWVA 3CUEA 5A92A 3OZHA 2GZAA 4CLCE 2GDNA 4B4XA 4R1GA 1I2WA 3BJNA 4WZ5A 1JVJA 2W0NA 4OP8A 3WRTA 1XJ6A 4O0PA 3MF0A 3TW8A 5HSQA 4JGQA 2XQZA 1OPXA 4NXFA 3VP1A 5G18A 4OP5A 3C4OA 4GS9B 3UY6A 2XH9A 3A0VA 5F83A 4HEFA 1CQAA 2Y8HA 4S2IA 3EGDC 4L9FA 3LUQA 1ACFA 2MJ6A 1PYYA 1FCNA 3BFFA 4D2OA 1PZOA 3HUMA 1H3QA 4RVAA 4QD4A 2V20A 3UB7A 3FKVA 3RH8B 3UE3A 3E4QA 5CHUA 1CI9A 5EVLA 4MNRA 4GHIB 4PMAA 5K5BA 2UV0E 2W1RA 5F82A 4EERA 4XT2B 4KZ8A 5DVAA 1NRFA 2VJWA 2WKHA 4LRYC 1IYPA 4OKPA 1F2KA 3KSHA 3KSGA 3KYZA 4XUXA 4EBNA 3JPUA 3MKEA 4MMNA 4EUVA 1FCMA 3E0YA 3MR0A 1YSQA 1NWZA 1PW8A 2P04A 2A24B 1HVBA 2EFXA 3G6OA 2AVXA 3G2ZA 4GS9A 4EQ1A 4MN6A 3IBRA 4RA7A 3UDIA 2OWJA 1LSXA 3K3DA 4DRTA 3LCEA 1FIKA 1BYWA 4QY5A 2XR0A 3ZG5A 1IKGA 4YOFA 3G34A 1MKMA 4ZAMA 3NJAA 2FH5A 3EQVA 3IH9A 2OOLA 4M3KA 5E2EA 1VQQA 2PT7A 4LRXC 4RX3A 3I7JA 5DJTA 3BW6A 5HD5A 2I72A 5FAQA 1HD8A 1E3UD 4XT2A 3E4PA 3MQ0A 2VEAA 1LI0A 4IBRA 4GB7A 3OCNA 3C7VA 3NULA 5GLDA 2ZBBA 2XA7S 3E4OA 2VK3A 3T4JA 2ZM0A 3LEQA 1PI4A 2A24A 3QP2A 3FPWA 3C30A 5GHYA 1BLHA 4OOMA 3Q81A 3UDXA 3T4SA 1JWVA 4ZTKA 1IYSA 4BMWA 3OPRA 3NBLA 2Y4AA 1FR1A 1W5DA 4X6TA 5J3WA 5CTNA 1BULA 4DJ2A 3E2LA 2PBYA 4GKUA 4CLCD 4KG5A 3PHYA 3GR2A 5KSCA 2LB5A 1XA1A 1V9ZA 2ZQDA 5CGWA 3HLGA 4S2OA 3PBNA 4OPZA 3T4TA 5KSHA 3CZDA 3DWZA 4EESA 2XRNA 2J9PA 4MBHA 5E43A 1S66L 4IVKA 5FI6A 2YKHA 5FDHA 4RQ9A 2VX8A 2VV7A 3EEHA 4JXGA 4CQHA 1A0KA 4NKPA 3O87A 3BQAA 5F1FA 3CPTB 5TR7A 2IWCA 5GL9A 5DF8A 1G68A 1ZC2A 2ZC4B 3PAEA 4DDYA 2PAVP 2WGIA 4I38A 5FQQA 3K2NA 4JF6A 1N4OA 3RXWA 2QPNA 4ARZB 4C3QA 1OTEA 1LHYA 2DCFA 4DDSA 3MXRA 5EVIB 2IWBA 1VM1A 4E3NA 2HP9A 1XJ4A 5HAIA 3A0SA 3NC8A 1OJGA 3SH8A 3W2ZA 3V3RA 5CRFA 2H28A 3LY3A 4B9OA 2B95A 3LIAA 2ZJ9A 3VFFA 3W8KA 2Z6DA 1PRQA 2ZQCA 2EX8A 2V0WA 5FL3A 1SDEA 1MBLA 2Q0OA 2PYPA 3UPNA 2PRFA 3IF6B 4KQRA 4H8RA 4K0WA 3DTMA 4BD1A 4MLLA 1G6AA 1EW0A 1KDSA 1LI9A 3F1OB 1K54C 4X1LA 1XA7A 2WZXA 3CPTA 5LBRA 5L8MA 4EXOA 4Y17A 4P87A 1HTZA 2H10A 3QP5A 1K0KA 1ZG4A 3T4QA 5FASA 4MBFA 3IXHA 3F1PB 1LSVA 1NYMA 1JNUA 3DW0A 4X1MA 1PFLA 4IUKA 3UB5P 4ARZA 2EX9A 3L9KA 3ZQ5A 4CLCC 4ID4A 4I3AA 5G4ZA 2H5SA 3WS4A 3DWKA 3K3CA 1YLJA 1L3LA 4NEED 4K0XA 1K4EA 3IXDA 1IYQA 5GLBA 2VA0A 4E04A 3T1RA 3MXQA 1OT6A 2Y55A 3NI9A 4DE3A 4S2JA 4KZ9A 2LB9A 2ZM8A 4JF5A 3MQOA 4DN0A 3IT9A 2Y2QA 4X69A 3LYXA 3FG8A 2WAEA 4Y15A 2KLIA 2Y79A 3BRMA 1CEFA 4DJ3A 1VB6A 4P6ZS 3KO6A 2HDUA 4OLDA 5CTMA 3F1OA 1HZOA 4R4RA 1WE4A 4HJ3A 2EXBA 3NECA 2JKTI 1L0GA 4DF6A 1SDNA 1QMFA 1BLPA 3Q7ZA 3DTKA 1M6KA 5EFWA 5EVEA 4IVIA 5EV0A 3MZDA 2JHEA 4L9EA 3C38A 2KX6A 1GCEA 5L2FA 2JKTM 1FSYA 2R78A 3HL9A 2E8IA 5KIZA 1S1ZA 5GLAA 4EEUA 1I2SA 3HUOA 1N9OA 4RX2A 1G28A 1IYOA 4Y0OA 4WBGA 4UHUA 5FSRA 4LCLA 3NDGA 1K6SA 2PHYA 5AVEA 4L0LA 1SKFA 3B33A 5MC7A 4O8GA 3DTEA 3TSGA 1MY8A 3EWKA 1ODVA 2QKPA 2JKGA 4OOLA 5G4YA 1IELA 3GDIA 3A3JA 4WUJA 1P9RA 1TF1A 2JN7A 2HDSA 2BLSA 4S2PA 3BY9A 2QHKA 4R70A 3HBRA 3CMZA 1Z6FA 2VV6A 3S7NA 2XK1A 2O0YA 2Y2KA 4ZJ3A 5D3OA 1E25A 4KZ7A 3P98A 1GHIA 3VP2A 2VGKA 2WKIA 3A3EA 3HLEA 4NG2A 3MZFA 3O88A 4WEJA 4UAAA 3IWOA 4HESA 4OOYA 5F1GA 1IKIA 4ZJ1A 3SS3A 5DTTA 1OTIA 4OQ0A 4ME4A 4K91A 4FH4A 2JE5A 1AXBA 3U2AA 5C5KA 5FAOA 1MPLA 1Z09A 4NK3A 3OPPA 1S0WA 3VOYA 2HPBA 3IF5A 3ZG7B 2BG1A 3IX8A 5CHMA 5AQBA 1IOUA 1DJBA 1ONGA 5EE8A 3T12B 4S2LA 2EFUA 3Q7VA 4GDBA 5HL6A 4MEZA 1S1YA 3QP1A 2ACGA 3PTEA 4R0QA 1GA9A 1ERQA 5DKKA 1MWUA 2OLUA 3AGDA 4DE1A 4M4XA 1P9WA 4P6BA 2HV1A 3T50A 4HIAA 4ESPA 4E3JA 3TG9A 4WLAA 1CEGA 3DAVA 3E2KA 3G32A 4OPRA 4QY6A 5CGSA 3HLDA 2P9VA 1K57A 1TDLA 3HCYA 4S2NA 4JBFA 5DF9A 5HWTA 3LGOA 5FI7A 5FATA 3G2YA 3ZVWA 5L09A 3BEBA 3S1YA 1Y28A 1ESUA 2J3WA 4BLMA 3PBTA 3A3FA 3EEAA 4KG2A 5FQIA 2WUQA 3N4IA 3N8RA 2VV8A 1LL8A 3ZDJA 4PM5A 4OH0A 1JTGA 1N9LA 2OSUA 5HD3A 3BYDA 4HH3A 2ZOIA 3A0RA 2JKRI 3MXSA 1DY6A 2A3UA 1GA0A 3GQZA 4PM9A 3ITBA 3NDEA 2ZLYA 1I5QA 2J3TD 2WGWA 3MS6A 5FQ9A 5HDCA 4DE2A 1PIOA 4JGOA 4XXRA 3WS2A 1TDGA 2JKRM 1YLWA 3NCKA 1WYBA 2ZQ7A 1IEMA 1FILA 2NUPC 1KGGA 2B18A 4U0XA 3VSLA 1WA9A 1YQSA 4Q0JA 1KVMA 1ZHHB 3UE6A 3QNBA 3RJUA 3T4OA 2X02A 3MBZA 4HI4A 3HLBA 1DP8A 3N7WA 3FZCA 3GVBA 5AQAA 4XUZA 2PU4A 5HL1A 3L7HA 1MXOA 3BFEA 1LL9A 4OLGA 1XKZA 4EW7A 4QB8A 2XROA 3BFGA 2ZOHA 3BLMA 4JGPA 5FQJA 3OLOA 4UEYA 5HWWA 4KQDA 3IXBA 4ZBEA 3O5YA 3C5AA 2HDQA 4S2MA 2PBDP 3PXPA 1F9IA 4R38A 1T19A 1YSPA 2XLNA 5E2FA 4L9GA 4X53A 4BJPA 2Y2PA 2O9CA 4NETA 4LPZA 3S4XA 1CJFA 2X71A 4KZ6A 1GSVA 1ES4A 4HJ6A 5AJGA 2Z2LB 3AGEA 1Y54A 1JTDA 1U60A 2QJ5A 3LIFA 1W79A 4HH2A 3P7NA 3T4LA 1ALQA 3FKWA 1L0DA 4B88A 4PKYG 3NOPC 3P01A 1D1JA 2V1ZA 3S22A 1ZKJA 4OPQA 4E3IA 3IS2A 3M2JA 4EEPA 3FWLA 5F69A 1IFQA 1MZUA 1NYYA 4DE0A 5DFXA 3WS1A 4BENA 1K6RA 1GSXA 3KSIA 1KGEA 3S7OA 2HJEA 3C8CA 1T18A 2QZ6A 5FEFA 3IQAA 1O07A 4JPMA 1XXMA 3VE3A 4N9KA 3VOLA 2W3EA 2L1MA 3BM6A 3W4PA 4HJ4A 2J3TC 3KYQA 5U47A 1N9BA 2M7VA 3LIBA 4C75A 3VP3A 4BBTA 5TGFA 3UE1A 4ZJ2A 4LV1A 1KE3A 5FQMA 3FC7A 3QNCA 4LLOB 1XJ2A 1AWIA 4E3OA 1LLBA 1H0MA 4KQOA 2ZC3B 2FFYA 2IWDA 3CWFA 3PYPA 2DRWA 1P97A 3PR6A 4YWZA 4UQIM 4DMZA 5L07A 2CC1A 2H0YA 1ES3A 5I94A 2HZ5A 3KX0X 2Z6CA 1KDWA 4IUHA 3WS5A 4IBXA 3ZYTA 1Y4OA 3QHYA 3U4LP 3OPHA 2V8FA 3ICYA 4KQQA 1W63Q 3BFCA 3MJQA 4LCMA 4OQHA 3T1QB 3PBSA 1OJ5A 4WEKA 4IJGA 4EV4A 2VZWA 1ZG6A 4DXBA 2DMWA 3D4FA 1TS0A 1YKDA 3VFHA 5HPFA 4FOFA 4R4SA 4LV3A 4BD0A 1MKIA 3JYIA 3UDFA 1XJ3A 2JBFA 1UGUA 5CEDA 3UB9A 2O9BA 1FR6A 2M1CA 2R9WA 3LI8A 1GSWA 4PHTA 3HLWA 3C2WA 2JC7A 2PR5A 3Q1FA 3VSKA 2K7SA 2QWSA 3UMEA 2VGJA 2ZMVA 1Q2PA 4HBTA 2PD8A 1E3UA 1CF0A 4WF0A 2RL3A 1NLZA 2KOIA 3IHAA 4HQAA 5JYOA 2Y2LA 3BQ8A 2BTFP 1PZPA 4P85A 5HWVA 5HW3A 1DRMA 1MC0A 3VV4A 3SOIA 3BECA 4JLFA 5AVFA 3VOZA 2XD5A 5CHJA 1K54A 4UA7A 3NOUC 3C7UA 2Y2HA 4LV0A 4WMCD 3ZG0A 1L0FA 2Y2GA 1TVFA 2YKFA 2WKPA 3H9WA 5GHXA 1EROA 3JVVA 3LEZA 3SH7A 5EM1A 1BLSA 4F3LB 3IHBA 1SKOA 4CLCA 2EWWA 4Y3IA 1NJ4A 3SH9A 2ZMFA 2EX2A 3SS5A 1K38A 4WL9A 4N9LA 2Y2IA 2XEPA 3Q82A 3VP0A 4PAUA 5FEGA 1S67L 2C5WB 1PWCA 4E3LA 5HPIA 3HLCA 1VEUA 1SHVA 1D7EA 1S6RA 2UWXA 3UPOA 4HBUA 4OQGA 1SCWA 4GJ4A 5EOEA 1BLCA 2H0TA 5FDSA 3UMDA 1ES5A 3G31A 5KMWA 3H7WA 2ZD8A 2Y2MA 4QU3A 2GX5A 4MN5A 3MFDA 4R3JA 5HDSA 1OMEA 4I3IA 2A2LA 2XDMA 1V9YA 3LIDA 1EI5A 1YM1A 2XFSA 1W63M 3D72A 4P6ZM 1PWDA 1P0ZA 2WAFA 4JXWA 3CLOA 4F3LA 3Q7VB 3VP4A 4I3JA 4D60A 4NXBA 4X68A 4MBKA 3LIEA 3N6IA 3CJMA 4HP9A 1NRJA 3EQUA 5HARA 4IHQA 4E6XA 1T1BA 1BTLA 2V2FF 3F1NB 5J4EA 1H8YA 2OAP1 1K55C 3MQQA 2P9VB 1NXYA 1HLUP 1XFNA 3ZG8B 3FPVA 1TS8A 1TS6A 4KZ5A 3PAGA 3VMAA 2OAQ1 4PKYA 4QJGA 1LL5A 2QJ7A 2Y2OA 5GHZA 2Z2MB 2GJ3A 2JKFA 2XSSA 2V0UA 3CUEC 1OT9A 3P09A 1ES2A 1M40A 3V5MA 2EX6A 2HDRA 3MMHA 2IA2A 4HHDA 3O3VA 1GHPA 3LI9A 1W8YA 5KZHA 1FQGA 4E3KA 3IXGA 2R9XA 2QMIA 4KZAA 1G6OA 2ZL1B 4LV2A 2V1AA 2WGWB 4EBPA 5M18A 3ITAA 1X0OA 3OC2A 4FUWA 3F1NA 1F5MA 2XGNA 3OBFA 4JXSA 2EA9A 2Y91A 4GNUA 4EUZA 1LT0A 1W8QA 3W4OA 1RGZA 3WWXA 2ZC7A 3TRCA 4GD8A 4EBLA 2P08A 2I9VA 2J9OA 2V8CA 4Y13A 1UWPX 2VGLM 3RFBA 2W3GA 1NZUA 1SZVA 1VETB 3V67A 2RCXA 3LFVA 4ZDXA 3IX4A 4PPRA 3NOTC 1MWTA 3LR0A 4R3AA 2XF3A 3D3OA 2PYRA 1KE0A 2ZQ9A 3FV7A 1WYCA 4WM9A 2W3FA 2EXAA 4Y0TA 3OOVA 3QP8A 2ZC6B 4KUKA 5AQ7A 4BL2A 2G2UA 2PR6A 4FTXA 5EM0A 3CG5A 1YLYA 4NXGA 2OV5A 1FOFA 1J3WA 1L0EA 1S4SA 3AGFA 3FYZA 2ZL1A 2W1TB 4GDNA 4EETB 2X01A 3BY8A 1LSWA 2J8YA 3UPPA 1BZAA 1CK3A 1L2SA 3O86A 2ZMAA 2WYXA 1GHMA 4NXEA 3RTYA 3HJIA 3Q07A 4N92A 3UB6A 5A93A 4GD6A 3UN7A 3IS2B 5CECA 4DKIA 3IWIA 1VETA 5A91A 2WKQA 4YNRA 5IT5A 4OONA 3IX3A 5CEBA 4G3KA 1DP9A 1YMSA 3ZNYA 4MCWA 3LY4A 1O7EA 2O99A 3CHWP 5DTKA 3A3DA 3SS4A 2HP6A 4MN7A 5CX7A 4B4ZA 1UWNX 4WN5A 4U0TA 4BBUA 5F68A 3T4KA 2FZ0A 1ESIA 2K31A 2W1TA 3LR3A 4PM6A 3ULFA 5E2HA 3HLFA 4BQMA 1OTAA 2PD7A 2HJ9C 5E2GA 3IH8A 5A8BA 2NUTC 2W3HA 4GOGA 3QP4A 4GHIA 4KZ4A 3CAXA 5HFOA 3WS0A 4JGRA 3PBOA 3S7PA 3DTIA 5M1AA 4C6YA 3JVUA 1W7FA 1YPRA 4AFIA 3B42A 2HGVA 3G35A 4Q0IA 4RYEA 3BWLA 5EVID 1D06A 5F5YA 3HREA 4K08A 2G2WA 3UNWA 2ZQ8A 4CJNA 5HAPA 2WGVA 3ZHHA 4N1HA 2J7VA 2INWA 3EGXC 4Y0UA
chains in the Genus database with same CATH topology
2RL3A 4GN2A 3IHAA 4KG6A 1Z6FA 3ZGAB 4RVAA 5JYOA 2Y2LA 3N8LA 1YLZA 3MZEA 3BFDA 4PM8A 4QD4A 5CGXA 1PZPA 4P85A 2XK1A 3N8SA 2V20A 5HW3A 2Y2KA 4ZJ3A 3FKVA 5D3OA 1E25A 4KZ7A 3UE3A 3P98A 4FH2A 5JYPA 1GHIA 5CHUA 1CI9A 5EVLA 4MNRA 3SOIA 5GLCA 4PMAA 3VP2A 3BECA 4JLFA 2VGKA 2WKIA 3VOZA 2XD5A 3A3EA 1K54A 3M6BA 1H5XA 4UA7A 5CHJA 3UE0A 5F82A 3HLEA 4KZ8A 4OVDA 1TEMA 2Y2HA 3C7UA 4LV0A 4WMCD 1NRFA 3MZFA 3O88A 5DVAA 4WEJA 2WKHA 3ZG0A 1L0FA 1K56D 4UAAA 3IWOA 1IYPA 4HESA 2Y2GA 4OKPA 4OOYA 3IWQA 1IKIA 1YLPA 1TVFA 5F1GA 4ZJ1A 3SS3A 4FSFA 5DTTA 4OQ0A 4XUXA 4EBNA 5GHXA 4K91A 4FH4A 1JWPA 2JE5A 3M6HA 1EROA 3MKEA 1AXBA 3LEZA 3SH7A 4WZ4A 1JWZA 1BLSA 3IHBA 5FAOA 1MPLA 1NJ4A 4NK3A 3OPPA 1FCMA 4N1XA 3SH9A 2HP5A 1S0WA 1PW8A 3VOYA 2HPBA 3IF5A 3ZG7B 2BG1A 4GZBA 1HVBA 2EFXA 2EX2A 5CHMA 3G2ZA 3SS5A 5AQBA 2Y2NA 1K38A 4FCFA 2WKEA 4N9LA 2Y2IA 2XEPA 4RA7A 3Q82A 1DJBA 3UDIA 3VP0A 1ONGA 3BLSA 4FD8A 5EE8A 2C5WB 1PWCA 4S2LA 4DRTA 2EFUA 3LCEA 3Q7VA 4E3LA 4GDBA 4QY5A 4MEZA 2XR0A 3ZG5A 3HLCA 3PTEA 4R0QA 1GA9A 3W4QA 1ERQA 3MKFA 1IKGA 3G34A 1MWUA 2OLUA 4ZAMA 1SHVA 4KZ3A 1S6RA 3AGDA 5DTSA 2UWXA 4DE1A 3UPOA 4P6BA 4HBUA 3EQVA 3IH9A 4M3KA 5E2EA 3RXXA 3ISGA 1VQQA 4OQGA 5EPHA 4E3JA 1SCWA 5FA7A 3TG9A 1C3BA 1CEGA 1BLCA 3E2KA 3G32A 5EOEA 4LENA 4OPRA 4QY6A 3I7JA 4RX3A 5CGSA 2H0TA 2JCHA 1ES5A 3G31A 3HLDA 5KMWA 2FFFB 2I72A 5FAQA 2ZD8A 1HD8A 1K57A 1TDLA 1E3UD 2P9VA 2Y59A 2Y2MA 4QU3A 1YT4A 3MFDA 4R3JA 4U3TA 1PW1A 1OMEA 4S2NA 5DF8A 3TOIA 2XDMA 4JBFA 5DF9A 1EI5A 1YM1A 1LI0A 4IBRA 2XFSA 4GB7A 3OCNA 3C7VA 4S2KA 5FI7A 3GSGA 5FATA 3G2YA 3ZVWA 3HVFA 4E3MA 2OLVA 5GLDA 3BEBA 5EVIC 3ZNTA 3S1YA 4BLMA 1ESUA 1PWDA 3PBTA 3A3FA 1CI8A 4KG2A 2WAFA 4JXWA 3PBRA 3Q7VB 3VP4A 2ZM0A 5FQIA 1PI4A 2WUQA 3N4IA 4X68A 3N8RA 5GHYA 4MBKA 1BLHA 4OOMA 1PWGA 3N6IA 3Q81A 3CJMA 5DF7A 3UDXA 3EQUA 5FQKA 5HARA 3ZFZA 3ZDJA 1JWVA 2B5RA 1IYSA 4ZTKA 4E6XA 1BTLA 3OPRA 2V2FF 3NBLA 2Y4AA 4PM5A 4OH0A 1FR1A 1JTGA 2OSUA 1W5DA 4X6TA 3BYDA 3NIAA 5CTNA 1H8YA 1BULA 1RCJA 3GQZA 1DY6A 2A3UA 3E2LA 1GA0A 3MXSA 2PBYA 4GKUA 3GRJA 4PM9A 1RP5A 3GMWA 4KG5A 1K55C 3ITBA 3GR2A 3IF6C 3NDEA 2P9VB 3OCLA 2ZLYA 1I5QA 2WGWA 5KSCA 5FQ9A 1J9MA 4DE2A 3G30A 1PIOA 1NXYA 4XXRA 1PI5A 5EVIA 2WADA 3WS2A 1K25A 3ZG8B 1XA1A 3GV9A 1TDGA 4PM7A 4Q8IA 2ZQDA 1ERMA 1YLWA 5CGWA 3HLGA 3NCKA 1WYBA 3PBNA 2ZQ7A 4OPZA 1IEMA 4S2OA 3HUNA 5KSHA 3CZDA 1XGJA 3DWZA 1KGGA 4KZ5A 4U0XA 3PAGA 3VSLA 1YQSA 3VMAA 2J9PA 4MBHA 5E43A 1KVMA 4IVKA 4BL3A 5FI6A 4QJGA 5FDHA 3QNBA 1LL5A 4WELA 3RJUA 2Y2OA 1Q2QA 5GHZA 2Z2MB 4JXGA 2X02A 3MBZA 3O87A 1DJCA 1MWSA 5FI2A 3HLBA 3P09A 3N7WA 1ES2A 3FZCA 1M40A 3GVBA 4XUZA 2PU4A 5AQAA 5HL1A 3V5MA 3A3IA 1MXOA 5F1FA 3BFEA 1LL9A 4OLGA 2EX6A 2HDRA 3M2KA 1XX2A 1XKZA 5TR7A 2IWCA 4QB8A 3BFGA 5GL9A 3C4PA 3NY4A 4JXVA 3O3VA 3IF6A 1G68A 1ZC2A 2ZC4B 3BLMA 1GHPA 3GTCA 3PAEA 4P0MA 5FQJA 4DDYA 1W8YA 5KZHA 1FQGA 3IXBA 3B3XA 2WGIA 4E3KA 4IEDA 3IXGA 5FQQA 2R9XA 4UA9A 4ZBEA 2QMIA 4KZAA 4JF6A 3C5AA 2HDQA 1N4OA 4S2MA 3RXWA 1DJAA 4LV2A 2QPNA 3UO9A 1K56A 5A90A 4C3QA 2WGWB 4EBPA 3V50A 1FCOA 5M18A 4EQIA 1LHYA 3ITAA 2DCFA 4DDSA 1BSGA 3MXRA 5EVIB 2ZM2A 1VM1A 3OC2A 2IWBA 5CERA 4E3NA 2PU2A 3HUMA 2XGNA 5CXWA 2HP9A 3V3SA 1E4DA 2XLNA 5E2FA 5HAIA 1NY0A 4JXSA 4CPKA 5HAQA 3NC8A 4X53A 2Y91A 4GNUA 4EUZA 4BJPA 3SH8A 4DXCA 1W8QA 1ONHA 2Y2PA 3V3RA 4NETA 3W4OA 5CRFA 1RGZA 3WWXA 3S4XA 2X71A 3ZVTA 4KZ6A 3LY3A 2ZC7A 2Y2JA 4GD8A 4EBLA 5AQ9A 2ZJ9A 1ES4A 4Z9QA 3VFFA 3W8KA 2J9OA 4F94A 2Z2LB 2ZQCA 3AGEA 1Y54A 1JTDA 2EX8A 1U60A 1NZUA 1SDEA 2XFTA 5J8XA 2RCXA 4ZDXA 1MBLA 1W79A 5IHVA 3UPNA 3IF6B 4PPRA 1MWTA 4KQRA 1RGYA 2WZZA 4H8RA 1ALQA 1BUEA 4K0WA 3FKWA 1L0DA 4Y0UA 4B88A 3DTMA 4KZBA 1G6AA 4MLLA 2XF3A 4OPYA 4Y7PA 2V1ZA 4BD1A 1KE0A 1KDSA 3S22A 1LI9A 2ZQ9A 1K54C 4O7DA 1K4FA 1ZKJA 3FV7A 4OPQA 4E3IA 1WYCA 3M2JA 4WM9A 1XA7A 3G4PA 3FWLA 2WZXA 2EXAA 4Y0TA 1NYYA 3V39A 4P87A 4DE0A 2ZC6B 1HTZA 3WS1A 5AQ7A 2H10A 4BENA 1KVLA 1ZG4A 4BL2A 4MBFA 5FASA 2G2UA 1K6RA 3IXHA 2ZC5B 1KGFA 3CG5A 1NYMA 4JF4A 1KGEA 1YLYA 3DW0A 2WK0A 4YFMA 2OV5A 2QZ6A 1FOFA 1KE4A 3IQAA 1L0EA 1O07A 3AGFA 3FYZA 4JPMA 1XXMA 1EWZA 3PBQA 4N9KA 3LO7A 4GDNA 3WRZA 2X01A 2EX9A 2J8YA 4R23A 3UPPA 4ID4A 3BM6A 5EECA 3OPLA 5EOOA 1BZAA 3W4PA 2H5SA 5HX9A 3WS4A 3DWKA 1CK3A 1L2SA 1YLJA 3O86A 5U47A 1QMEA 4K0XA 2ZQAA 1YMXA 1N9BA 1K4EA 2WYXA 1XP4A 1GHMA 2ZMAA 4X56A 4E6WA 5BOHA 5TFQA 4C75A 1NZOA 2C6WB 3IXDA 3VP3A 3Q07A 1IYQA 5TGFA 1FSWA 5EUAA 5GLBA 3UE1A 4N92A 2Q9MA 4ZJ2A 4LV1A 1KE3A 2Y55A 3NI9A 5FQMA 4DE3A 3QNCA 4S2JA 4KZ9A 2Q9NA 4QHCA 4E3OA 1LLBA 2ZM8A 5A93A 4JF5A 4GD6A 2A49A 4KQOA 3UN7A 5CECA 2ZC3B 3ZG9B 4DKIA 3IWIA 3IT9A 2FFYA 4X55A 4YINA 2Y2QA 4X69A 5FAPA 2IWDA 1XGIA 5A91A 2WAEA 1BT5A 1K55A 1MWRA 1YLTA 2P74A 4A5RA 3BRMA 2DRWA 1CEFA 4OONA 2XD1A 4WZ5C 2HDUA 4OQIA 4OLDA 5CEBA 5CTMA 2DNSA 1HZOA 4UA6A 4R4RA 1WE4A 2EXBA 1K57C 1YMSA 4WMCA 3ZCZA 2CC1A 3LY4A 3ZNYA 2H0YA 4R3BA 1L0GA 4DF6A 1O7EA 1SDNA 1QMFA 1ES3A 5I94A 1BLPA 4WYYA 4S2NC 3Q7ZA 1KDWA 1M6KA 4JKTA 5DTKA 4IVIA 3A3DA 3MZDA 3SS4A 3WS5A 4EWFA 4KENB 1H8ZA 2HP6A 4IBXA 4B4ZA 5M19A 1GCEA 5L2FA 1XPBA 1FSYA 3QHYA 4U0TA 3OPHA 4KQQA 5A92A 1ESIA 3HL9A 3OZHA 3BFCA 4LCMA 2E8IA 4OQHA 4PM6A 5E2HA 3HLFA 4BQMA 3PBSA 5E2GA 2GDNA 3IH8A 4WEKA 4B4XA 4EV4A 4R1GA 4GOGA 1ZG6A 4DXBA 5GLAA 1I2SA 1I2WA 3D4FA 3HUOA 4RX2A 3VFHA 4WZ5A 1JVJA 1IYOA 4R4SA 4Y0OA 4WBGA 4KZ4A 4LV3A 4UHUA 5FSRA 5HFOA 4OP8A 4BD0A 3WRTA 1MKIA 3JYIA 3WS0A 3UDFA 3PBOA 4LCLA 3NDGA 1K6SA 2JBFA 5M1AA 4C6YA 5CEDA 1W7FA 2R9WA 1FR6A 4L0LA 1SKFA 3G35A 2XQZA 4RYEA 3HLWA 3TSGA 5EVID 1MY8A 3VP1A 5G18A 2JC7A 4OP5A 3HREA 4OOLA 2G2WA 3C4OA 3Q1FA 3UNWA 2ZQ8A 3VSKA 1IELA 4CJNA 3A3JA 5HAPA 3UY6A 2VGJA 2XH9A 2WGVA 5F83A 1Q2PA 4HEFA 3ZHHA 4S2IA 4HBTA 4N1HA 2HDSA 2BLSA 2J7VA 4S2PA 1E3UA 1PYYA 1FCNA 3BFFA 4D2OA 1PZOA 3HBRA 3CMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RL3 A;  4GN2 A;  3IHA A;  4KG6 A;  1Z6F A;  3ZGA B;  4RVA A;  5JYO A;  2Y2L A;  3N8L A;  1YLZ A;  3MZE A;  3BFD A;  4PM8 A;  4QD4 A;  5CGX A;  1PZP A;  4P85 A;  2XK1 A;  3N8S A;  2V20 A;  5HW3 A;  2Y2K A;  4ZJ3 A;  3FKV A;  5D3O A;  1E25 A;  4KZ7 A;  3UE3 A;  3P98 A;  4FH2 A;  5JYP A;  1GHI A;  5CHU A;  1CI9 A;  5EVL A;  4MNR A;  3SOI A;  5GLC A;  4PMA A;  3VP2 A;  3BEC A;  4JLF A;  2VGK A;  2WKI A;  3VOZ A;  2XD5 A;  3A3E A;  1K54 A;  3M6B A;  1H5X A;  4UA7 A;  5CHJ A;  3UE0 A;  5F82 A;  3HLE A;  4KZ8 A;  4OVD A;  1TEM A;  2Y2H A;  3C7U A;  4LV0 A;  4WMC D;  1NRF A;  3MZF A;  3O88 A;  5DVA A;  4WEJ A;  2WKH A;  3ZG0 A;  1L0F A;  1K56 D;  4UAA A;  3IWO A;  1IYP A;  4HES A;  2Y2G A;  4OKP A;  4OOY A;  3IWQ A;  1IKI A;  1YLP A;  1TVF A;  5F1G A;  4ZJ1 A;  3SS3 A;  4FSF A;  5DTT A;  4OQ0 A;  4XUX A;  4EBN A;  5GHX A;  4K91 A;  4FH4 A;  1JWP A;  2JE5 A;  3M6H A;  1ERO A;  3MKE A;  1AXB A;  3LEZ A;  3SH7 A;  4WZ4 A;  1JWZ A;  1BLS A;  3IHB A;  5FAO A;  1MPL A;  1NJ4 A;  4NK3 A;  3OPP A;  1FCM A;  4N1X A;  3SH9 A;  2HP5 A;  1S0W A;  1PW8 A;  3VOY A;  2HPB A;  3IF5 A;  3ZG7 B;  2BG1 A;  4GZB A;  1HVB A;  2EFX A;  2EX2 A;  5CHM A;  3G2Z A;  3SS5 A;  5AQB A;  2Y2N A;  1K38 A;  4FCF A;  2WKE A;  4N9L A;  2Y2I A;  2XEP A;  4RA7 A;  3Q82 A;  1DJB A;  3UDI A;  3VP0 A;  1ONG A;  3BLS A;  4FD8 A;  5EE8 A;  2C5W B;  1PWC A;  4S2L A;  4DRT A;  2EFU A;  3LCE A;  3Q7V A;  4E3L A;  4GDB A;  4QY5 A;  4MEZ A;  2XR0 A;  3ZG5 A;  3HLC A;  3PTE A;  4R0Q A;  1GA9 A;  3W4Q A;  1ERQ A;  3MKF A;  1IKG A;  3G34 A;  1MWU A;  2OLU A;  4ZAM A;  1SHV A;  4KZ3 A;  1S6R A;  3AGD A;  5DTS A;  2UWX A;  4DE1 A;  3UPO A;  4P6B A;  4HBU A;  3EQV A;  3IH9 A;  4M3K A;  5E2E A;  3RXX A;  3ISG A;  1VQQ A;  4OQG A;  5EPH A;  4E3J A;  1SCW A;  5FA7 A;  3TG9 A;  1C3B A;  1CEG A;  1BLC A;  3E2K A;  3G32 A;  5EOE A;  4LEN A;  4OPR A;  4QY6 A;  3I7J A;  4RX3 A;  5CGS A;  2H0T A;  2JCH A;  1ES5 A;  3G31 A;  3HLD A;  5KMW A;  2FFF B;  2I72 A;  5FAQ A;  2ZD8 A;  1HD8 A;  1K57 A;  1TDL A;  1E3U D;  2P9V A;  2Y59 A;  2Y2M A;  4QU3 A;  1YT4 A;  3MFD A;  4R3J A;  4U3T A;  1PW1 A;  1OME A;  4S2N A;  5DF8 A;  3TOI A;  2XDM A;  4JBF A;  5DF9 A;  1EI5 A;  1YM1 A;  1LI0 A;  4IBR A;  2XFS A;  4GB7 A;  3OCN A;  3C7V A;  4S2K A;  5FI7 A;  3GSG A;  5FAT A;  3G2Y A;  3ZVW A;  3HVF A;  4E3M A;  2OLV A;  5GLD A;  3BEB A;  5EVI C;  3ZNT A;  3S1Y A;  4BLM A;  1ESU A;  1PWD A;  3PBT A;  3A3F A;  1CI8 A;  4KG2 A;  2WAF A;  4JXW A;  3PBR A;  3Q7V B;  3VP4 A;  2ZM0 A;  5FQI A;  1PI4 A;  2WUQ A;  3N4I A;  4X68 A;  3N8R A;  5GHY A;  4MBK A;  1BLH A;  4OOM A;  1PWG A;  3N6I A;  3Q81 A;  3CJM A;  5DF7 A;  3UDX A;  3EQU A;  5FQK A;  5HAR A;  3ZFZ A;  3ZDJ A;  1JWV A;  2B5R A;  1IYS A;  4ZTK A;  4E6X A;  1BTL A;  3OPR A;  2V2F F;  3NBL A;  2Y4A A;  4PM5 A;  4OH0 A;  1FR1 A;  1JTG A;  2OSU A;  1W5D A;  4X6T A;  3BYD A;  3NIA A;  5CTN A;  1H8Y A;  1BUL A;  1RCJ A;  3GQZ A;  1DY6 A;  2A3U A;  3E2L A;  1GA0 A;  3MXS A;  2PBY A;  4GKU A;  3GRJ A;  4PM9 A;  1RP5 A;  3GMW A;  4KG5 A;  1K55 C;  3ITB A;  3GR2 A;  3IF6 C;  3NDE A;  2P9V B;  3OCL A;  2ZLY A;  1I5Q A;  2WGW A;  5KSC A;  5FQ9 A;  1J9M A;  4DE2 A;  3G30 A;  1PIO A;  1NXY A;  4XXR A;  1PI5 A;  5EVI A;  2WAD A;  3WS2 A;  1K25 A;  3ZG8 B;  1XA1 A;  3GV9 A;  1TDG A;  4PM7 A;  4Q8I A;  2ZQD A;  1ERM A;  1YLW A;  5CGW A;  3HLG A;  3NCK A;  1WYB A;  3PBN A;  2ZQ7 A;  4OPZ A;  1IEM A;  4S2O A;  3HUN A;  5KSH A;  3CZD A;  1XGJ A;  3DWZ A;  1KGG A;  4KZ5 A;  4U0X A;  3PAG A;  3VSL A;  1YQS A;  3VMA A;  2J9P A;  4MBH A;  5E43 A;  1KVM A;  4IVK A;  4BL3 A;  5FI6 A;  4QJG A;  5FDH A;  3QNB A;  1LL5 A;  4WEL A;  3RJU A;  2Y2O A;  1Q2Q A;  5GHZ A;  2Z2M B;  4JXG A;  2X02 A;  3MBZ A;  3O87 A;  1DJC A;  1MWS A;  5FI2 A;  3HLB A;  3P09 A;  3N7W A;  1ES2 A;  3FZC A;  1M40 A;  3GVB A;  4XUZ A;  2PU4 A;  5AQA A;  5HL1 A;  3V5M A;  3A3I A;  1MXO A;  5F1F A;  3BFE A;  1LL9 A;  4OLG A;  2EX6 A;  2HDR A;  3M2K A;  1XX2 A;  1XKZ A;  5TR7 A;  2IWC A;  4QB8 A;  3BFG A;  5GL9 A;  3C4P A;  3NY4 A;  4JXV A;  3O3V A;  3IF6 A;  1G68 A;  1ZC2 A;  2ZC4 B;  3BLM A;  1GHP A;  3GTC A;  3PAE A;  4P0M A;  5FQJ A;  4DDY A;  1W8Y A;  5KZH A;  1FQG A;  3IXB A;  3B3X A;  2WGI A;  4E3K A;  4IED A;  3IXG A;  5FQQ A;  2R9X A;  4UA9 A;  4ZBE A;  2QMI A;  4KZA A;  4JF6 A;  3C5A A;  2HDQ A;  1N4O A;  4S2M A;  3RXW A;  1DJA A;  4LV2 A;  2QPN A;  3UO9 A;  1K56 A;  5A90 A;  4C3Q A;  2WGW B;  4EBP A;  3V50 A;  1FCO A;  5M18 A;  4EQI A;  1LHY A;  3ITA A;  2DCF A;  4DDS A;  1BSG A;  3MXR A;  5EVI B;  2ZM2 A;  1VM1 A;  3OC2 A;  2IWB A;  5CER A;  4E3N A;  2PU2 A;  3HUM A;  2XGN A;  5CXW A;  2HP9 A;  3V3S A;  1E4D A;  2XLN A;  5E2F A;  5HAI A;  1NY0 A;  4JXS A;  4CPK A;  5HAQ A;  3NC8 A;  4X53 A;  2Y91 A;  4GNU A;  4EUZ A;  4BJP A;  3SH8 A;  4DXC A;  1W8Q A;  1ONH A;  2Y2P A;  3V3R A;  4NET A;  3W4O A;  5CRF A;  1RGZ A;  3WWX A;  3S4X A;  2X71 A;  3ZVT A;  4KZ6 A;  3LY3 A;  2ZC7 A;  2Y2J A;  4GD8 A;  4EBL A;  5AQ9 A;  2ZJ9 A;  1ES4 A;  4Z9Q A;  3VFF A;  3W8K A;  2J9O A;  4F94 A;  2Z2L B;  2ZQC A;  3AGE A;  1Y54 A;  1JTD A;  2EX8 A;  1U60 A;  1NZU A;  1SDE A;  2XFT A;  5J8X A;  2RCX A;  4ZDX A;  1MBL A;  1W79 A;  5IHV A;  3UPN A;  3IF6 B;  4PPR A;  1MWT A;  4KQR A;  1RGY A;  2WZZ A;  4H8R A;  1ALQ A;  1BUE A;  4K0W A;  3FKW A;  1L0D A;  4Y0U A;  4B88 A;  3DTM A;  4KZB A;  1G6A A;  4MLL A;  2XF3 A;  4OPY A;  4Y7P A;  2V1Z A;  4BD1 A;  1KE0 A;  1KDS A;  3S22 A;  1LI9 A;  2ZQ9 A;  1K54 C;  4O7D A;  1K4F A;  1ZKJ A;  3FV7 A;  4OPQ A;  4E3I A;  1WYC A;  3M2J A;  4WM9 A;  1XA7 A;  3G4P A;  3FWL A;  2WZX A;  2EXA A;  4Y0T A;  1NYY A;  3V39 A;  4P87 A;  4DE0 A;  2ZC6 B;  1HTZ A;  3WS1 A;  5AQ7 A;  2H10 A;  4BEN A;  1KVL A;  1ZG4 A;  4BL2 A;  4MBF A;  5FAS A;  2G2U A;  1K6R A;  3IXH A;  2ZC5 B;  1KGF A;  3CG5 A;  1NYM A;  4JF4 A;  1KGE A;  1YLY A;  3DW0 A;  2WK0 A;  4YFM A;  2OV5 A;  2QZ6 A;  1FOF A;  1KE4 A;  3IQA A;  1L0E A;  1O07 A;  3AGF A;  3FYZ A;  4JPM A;  1XXM A;  1EWZ A;  3PBQ A;  4N9K A;  3LO7 A;  4GDN A;  3WRZ A;  2X01 A;  2EX9 A;  2J8Y A;  4R23 A;  3UPP A;  4ID4 A;  3BM6 A;  5EEC A;  3OPL A;  5EOO A;  1BZA A;  3W4P A;  2H5S A;  5HX9 A;  3WS4 A;  3DWK A;  1CK3 A;  1L2S A;  1YLJ A;  3O86 A;  5U47 A;  1QME A;  4K0X A;  2ZQA A;  1YMX A;  1N9B A;  1K4E A;  2WYX A;  1XP4 A;  1GHM A;  2ZMA A;  4X56 A;  4E6W A;  5BOH A;  5TFQ A;  4C75 A;  1NZO A;  2C6W B;  3IXD A;  3VP3 A;  3Q07 A;  1IYQ A;  5TGF A;  1FSW A;  5EUA A;  5GLB A;  3UE1 A;  4N92 A;  2Q9M A;  4ZJ2 A;  4LV1 A;  1KE3 A;  2Y55 A;  3NI9 A;  5FQM A;  4DE3 A;  3QNC A;  4S2J A;  4KZ9 A;  2Q9N A;  4QHC A;  4E3O A;  1LLB A;  2ZM8 A;  5A93 A;  4JF5 A;  4GD6 A;  2A49 A;  4KQO A;  3UN7 A;  5CEC A;  2ZC3 B;  3ZG9 B;  4DKI A;  3IWI A;  3IT9 A;  2FFY A;  4X55 A;  4YIN A;  2Y2Q A;  4X69 A;  5FAP A;  2IWD A;  1XGI A;  5A91 A;  2WAE A;  1BT5 A;  1K55 A;  1MWR A;  1YLT A;  2P74 A;  4A5R A;  3BRM A;  2DRW A;  1CEF A;  4OON A;  2XD1 A;  4WZ5 C;  2HDU A;  4OQI A;  4OLD A;  5CEB A;  5CTM A;  2DNS A;  1HZO A;  4UA6 A;  4R4R A;  1WE4 A;  2EXB A;  1K57 C;  1YMS A;  4WMC A;  3ZCZ A;  2CC1 A;  3LY4 A;  3ZNY A;  2H0Y A;  4R3B A;  1L0G A;  4DF6 A;  1O7E A;  1SDN A;  1QMF A;  1ES3 A;  5I94 A;  1BLP A;  4WYY A;  4S2N C;  3Q7Z A;  1KDW A;  1M6K A;  4JKT A;  5DTK A;  4IVI A;  3A3D A;  3MZD A;  3SS4 A;  3WS5 A;  4EWF A;  4KEN B;  1H8Z A;  2HP6 A;  4IBX A;  4B4Z A;  5M19 A;  1GCE A;  5L2F A;  1XPB A;  1FSY A;  3QHY A;  4U0T A;  3OPH A;  4KQQ A;  5A92 A;  1ESI A;  3HL9 A;  3OZH A;  3BFC A;  4LCM A;  2E8I A;  4OQH A;  4PM6 A;  5E2H A;  3HLF A;  4BQM A;  3PBS A;  5E2G A;  2GDN A;  3IH8 A;  4WEK A;  4B4X A;  4EV4 A;  4R1G A;  4GOG A;  1ZG6 A;  4DXB A;  5GLA A;  1I2S A;  1I2W A;  3D4F A;  3HUO A;  4RX2 A;  3VFH A;  4WZ5 A;  1JVJ A;  1IYO A;  4R4S A;  4Y0O A;  4WBG A;  4KZ4 A;  4LV3 A;  4UHU A;  5FSR A;  5HFO A;  4OP8 A;  4BD0 A;  3WRT A;  1MKI A;  3JYI A;  3WS0 A;  3UDF A;  3PBO A;  4LCL A;  3NDG A;  1K6S A;  2JBF A;  5M1A A;  4C6Y A;  5CED A;  1W7F A;  2R9W A;  1FR6 A;  4L0L A;  1SKF A;  3G35 A;  2XQZ A;  4RYE A;  3HLW A;  3TSG A;  5EVI D;  1MY8 A;  3VP1 A;  5G18 A;  2JC7 A;  4OP5 A;  3HRE A;  4OOL A;  2G2W A;  3C4O A;  3Q1F A;  3UNW A;  2ZQ8 A;  3VSK A;  1IEL A;  4CJN A;  3A3J A;  5HAP A;  3UY6 A;  2VGJ A;  2XH9 A;  2WGV A;  5F83 A;  1Q2P A;  4HEF A;  3ZHH A;  4S2I A;  4HBT A;  4N1H A;  2HDS A;  2BLS A;  2J7V A;  4S2P A;  1E3U A;  1PYY A;  1FCN A;  3BFF A;  4D2O A;  1PZO A;  3HBR A;  3CMZ A; 
#chains in the Genus database with same CATH topology
 4GN2 A;  2D01 A;  4KG6 A;  4LFU A;  3ZGA B;  3N8L A;  1YLZ A;  3MZE A;  3BFD A;  4PM8 A;  5CGX A;  3N8S A;  1ZTU A;  5DFY A;  4UQI S;  5JYP A;  4FH2 A;  5GLC A;  4HNB A;  2GNX A;  4MDZ A;  3M6B A;  1H5X A;  2G7U A;  3UE0 A;  3LR5 A;  3KYE A;  2PDR A;  4OVD A;  1TEM A;  3SW1 A;  1G5U A;  2XA7 M;  1K56 D;  2W27 A;  3IWQ A;  1YLP A;  4FSF A;  3HJK A;  1JWP A;  3M6H A;  4I5S A;  4WZ4 A;  1JWZ A;  3DBA A;  2L0W A;  4N1X A;  2HP5 A;  1PNE A;  4GZB A;  2KDK A;  2Y2N A;  4FCF A;  2WKE A;  3LIC A;  3BLS A;  4FD8 A;  2L4R A;  2D02 A;  4QPR A;  3UB8 A;  3W4Q A;  3MKF A;  3R7W B;  1OTB A;  3B47 A;  4H6J B;  4ZRR A;  4KZ3 A;  5DTS A;  4Z1W A;  3RXX A;  3ISG A;  5EPH A;  1T1C A;  5FA7 A;  2W3D A;  1C3B A;  1XFQ A;  4LEN A;  4KUO A;  3NHQ A;  2JCH A;  2FFF B;  1STZ A;  2Y59 A;  1YT4 A;  4U3T A;  1PW1 A;  4CLC B;  1SKO B;  3TOI A;  4BWI A;  4R6L A;  4S2K A;  3GSG A;  5DJU A;  3HVF A;  4E3M A;  2OLV A;  5L10 A;  5EVI C;  3ZNT A;  2CMN A;  1CI8 A;  4ETZ A;  3PBR A;  5J7E A;  3IBJ A;  1VEU B;  2M7U A;  1VHM A;  5TJJ A;  3E98 A;  1PWG A;  4EU0 A;  5HZH A;  5DF7 A;  3ZFZ A;  5FQK A;  2B5R A;  2B02 A;  3NIA A;  1RCJ A;  5IS1 A;  1TS7 A;  2O9A A;  3GRJ A;  5I5L A;  1RP5 A;  3GMW A;  2V9A A;  3H7W B;  3IF6 C;  4H6J A;  3QP6 A;  3R7W A;  3VE4 A;  3OCL A;  4GLQ A;  1J9M A;  1TD5 A;  3G30 A;  5EVI A;  1PI5 A;  3H82 B;  2WAD A;  1K25 A;  3GV9 A;  4PM7 A;  4Q8I A;  1ERM A;  3EOI A;  3HUN A;  1XGJ A;  4HOI A;  4BL3 A;  4HY8 A;  4WEL A;  1Q2Q A;  2K2N A;  2VKS A;  3CI6 A;  4G3V A;  1N9N A;  4LGW A;  1DJC A;  1MWS A;  5FI2 A;  4GW9 A;  5TBM B;  3A3I A;  4O01 A;  3M2K A;  1XX2 A;  3C4P A;  3NY4 A;  4JXV A;  4P0M A;  3IF6 A;  3GTC A;  3CIT A;  2V1B A;  3B3X A;  4IED A;  4UA9 A;  1DJA A;  3UO9 A;  1K56 A;  5A90 A;  4GCZ A;  1FCO A;  3V50 A;  4EQI A;  1BSG A;  1F98 A;  5F6A A;  2ZM2 A;  5CER A;  3MSH A;  2PU2 A;  5CXW A;  4Y2F A;  3V3S A;  1E4D A;  4X25 A;  3F1P A;  1NY0 A;  1S4R A;  4CPK A;  5HAQ A;  1H8M A;  4DXC A;  1ONH A;  2OWH A;  3ZVT A;  2Y2J A;  3T1X A;  1YAX A;  5AQ9 A;  3H82 A;  4Z9Q A;  4F94 A;  3GEC A;  2XFT A;  5J8X A;  3LR4 A;  1OTD A;  5IHV A;  1RGY A;  2WZZ A;  2VLG A;  3T1S A;  1BUE A;  4KZB A;  4G3W A;  4OPY A;  4Y7P A;  4QWO A;  3S7Q A;  4O7D A;  1K4F A;  4II7 A;  4Y5F A;  5TBM A;  3SZT A;  3G4P A;  2P7J A;  2QYB A;  3V39 A;  2BAS A;  3TE8 A;  1KVL A;  2ZC5 B;  2E8J A;  1KGF A;  3MFX A;  4JF4 A;  2WK0 A;  1KOU A;  3KSF A;  3R4K A;  4YFM A;  4B93 A;  1KE4 A;  4Q0H A;  1EWZ A;  3PBQ A;  3LO7 A;  3WRZ A;  5HDD A;  4R23 A;  5IU1 A;  1DP6 A;  5EEC A;  5EOO A;  3OPL A;  5HX9 A;  1QME A;  2ZQA A;  1YMX A;  1XP4 A;  4X56 A;  4HP4 A;  5DKL A;  4E6W A;  5BOH A;  5TFQ A;  1NZO A;  2C6W B;  1FSW A;  4I39 A;  5EUA A;  2Q9M A;  4LRZ E;  2Q9N A;  4QHC A;  2WKR A;  2A49 A;  4BBV A;  3ZG9 B;  4X55 A;  4YIN A;  4ETX A;  5FAP A;  1XGI A;  1BT5 A;  1K55 A;  1MWR A;  1YLT A;  2P74 A;  4A5R A;  1NLY A;  2VGL S;  3D9Y A;  2XD1 A;  4WZ5 C;  4OQI A;  2DNS A;  3TJZ C;  1T1A A;  2HF6 A;  4UA6 A;  1K57 C;  4WMC A;  3ZCZ A;  4R3B A;  2J80 A;  4WYY A;  4S2N C;  4JKT A;  4EWF A;  4KEN B;  1H8Z A;  5M19 A;  1XPB A;  2EWV A;  3CUE A;  5A92 A;  3OZH A;  2GZA A;  4CLC E;  2GDN A;  4B4X A;  4R1G A;  1I2W A;  3BJN A;  4WZ5 A;  1JVJ A;  2W0N A;  4OP8 A;  3WRT A;  1XJ6 A;  4O0P A;  3MF0 A;  3TW8 A;  5HSQ A;  4JGQ A;  2XQZ A;  1OPX A;  4NXF A;  3VP1 A;  5G18 A;  4OP5 A;  3C4O A;  4GS9 B;  3UY6 A;  2XH9 A;  3A0V A;  5F83 A;  4HEF A;  1CQA A;  2Y8H A;  4S2I A;  3EGD C;  4L9F A;  3LUQ A;  1ACF A;  2MJ6 A;  1PYY A;  1FCN A;  3BFF A;  4D2O A;  1PZO A;  3HUM A;  1H3Q A;  4RVA A;  4QD4 A;  2V20 A;  3UB7 A;  3FKV A;  3RH8 B;  3UE3 A;  3E4Q A;  5CHU A;  1CI9 A;  5EVL A;  4MNR A;  4GHI B;  4PMA A;  5K5B A;  2UV0 E;  2W1R A;  5F82 A;  4EER A;  4XT2 B;  4KZ8 A;  5DVA A;  1NRF A;  2VJW A;  2WKH A;  4LRY C;  1IYP A;  4OKP A;  1F2K A;  3KSH A;  3KSG A;  3KYZ A;  4XUX A;  4EBN A;  3JPU A;  3MKE A;  4MMN A;  4EUV A;  1FCM A;  3E0Y A;  3MR0 A;  1YSQ A;  1NWZ A;  1PW8 A;  2P04 A;  2A24 B;  1HVB A;  2EFX A;  3G6O A;  2AVX A;  3G2Z A;  4GS9 A;  4EQ1 A;  4MN6 A;  3IBR A;  4RA7 A;  3UDI A;  2OWJ A;  1LSX A;  3K3D A;  4DRT A;  3LCE A;  1FIK A;  1BYW A;  4QY5 A;  2XR0 A;  3ZG5 A;  1IKG A;  4YOF A;  3G34 A;  1MKM A;  4ZAM A;  3NJA A;  2FH5 A;  3EQV A;  3IH9 A;  2OOL A;  4M3K A;  5E2E A;  1VQQ A;  2PT7 A;  4LRX C;  4RX3 A;  3I7J A;  5DJT A;  3BW6 A;  5HD5 A;  2I72 A;  5FAQ A;  1HD8 A;  1E3U D;  4XT2 A;  3E4P A;  3MQ0 A;  2VEA A;  1LI0 A;  4IBR A;  4GB7 A;  3OCN A;  3C7V A;  3NUL A;  5GLD A;  2ZBB A;  2XA7 S;  3E4O A;  2VK3 A;  3T4J A;  2ZM0 A;  3LEQ A;  1PI4 A;  2A24 A;  3QP2 A;  3FPW A;  3C30 A;  5GHY A;  1BLH A;  4OOM A;  3Q81 A;  3UDX A;  3T4S A;  1JWV A;  4ZTK A;  1IYS A;  4BMW A;  3OPR A;  3NBL A;  2Y4A A;  1FR1 A;  1W5D A;  4X6T A;  5J3W A;  5CTN A;  1BUL A;  4DJ2 A;  3E2L A;  2PBY A;  4GKU A;  4CLC D;  4KG5 A;  3PHY A;  3GR2 A;  5KSC A;  2LB5 A;  1XA1 A;  1V9Z A;  2ZQD A;  5CGW A;  3HLG A;  4S2O A;  3PBN A;  4OPZ A;  3T4T A;  5KSH A;  3CZD A;  3DWZ A;  4EES A;  2XRN A;  2J9P A;  4MBH A;  5E43 A;  1S66 L;  4IVK A;  5FI6 A;  2YKH A;  5FDH A;  4RQ9 A;  2VX8 A;  2VV7 A;  3EEH A;  4JXG A;  4CQH A;  1A0K A;  4NKP A;  3O87 A;  3BQA A;  5F1F A;  3CPT B;  5TR7 A;  2IWC A;  5GL9 A;  5DF8 A;  1G68 A;  1ZC2 A;  2ZC4 B;  3PAE A;  4DDY A;  2PAV P;  2WGI A;  4I38 A;  5FQQ A;  3K2N A;  4JF6 A;  1N4O A;  3RXW A;  2QPN A;  4ARZ B;  4C3Q A;  1OTE A;  1LHY A;  2DCF A;  4DDS A;  3MXR A;  5EVI B;  2IWB A;  1VM1 A;  4E3N A;  2HP9 A;  1XJ4 A;  5HAI A;  3A0S A;  3NC8 A;  1OJG A;  3SH8 A;  3W2Z A;  3V3R A;  5CRF A;  2H28 A;  3LY3 A;  4B9O A;  2B95 A;  3LIA A;  2ZJ9 A;  3VFF A;  3W8K A;  2Z6D A;  1PRQ A;  2ZQC A;  2EX8 A;  2V0W A;  5FL3 A;  1SDE A;  1MBL A;  2Q0O A;  2PYP A;  3UPN A;  2PRF A;  3IF6 B;  4KQR A;  4H8R A;  4K0W A;  3DTM A;  4BD1 A;  4MLL A;  1G6A A;  1EW0 A;  1KDS A;  1LI9 A;  3F1O B;  1K54 C;  4X1L A;  1XA7 A;  2WZX A;  3CPT A;  5LBR A;  5L8M A;  4EXO A;  4Y17 A;  4P87 A;  1HTZ A;  2H10 A;  3QP5 A;  1K0K A;  1ZG4 A;  3T4Q A;  5FAS A;  4MBF A;  3IXH A;  3F1P B;  1LSV A;  1NYM A;  1JNU A;  3DW0 A;  4X1M A;  1PFL A;  4IUK A;  3UB5 P;  4ARZ A;  2EX9 A;  3L9K A;  3ZQ5 A;  4CLC C;  4ID4 A;  4I3A A;  5G4Z A;  2H5S A;  3WS4 A;  3DWK A;  3K3C A;  1YLJ A;  1L3L A;  4NEE D;  4K0X A;  1K4E A;  3IXD A;  1IYQ A;  5GLB A;  2VA0 A;  4E04 A;  3T1R A;  3MXQ A;  1OT6 A;  2Y55 A;  3NI9 A;  4DE3 A;  4S2J A;  4KZ9 A;  2LB9 A;  2ZM8 A;  4JF5 A;  3MQO A;  4DN0 A;  3IT9 A;  2Y2Q A;  4X69 A;  3LYX A;  3FG8 A;  2WAE A;  4Y15 A;  2KLI A;  2Y79 A;  3BRM A;  1CEF A;  4DJ3 A;  1VB6 A;  4P6Z S;  3KO6 A;  2HDU A;  4OLD A;  5CTM A;  3F1O A;  1HZO A;  4R4R A;  1WE4 A;  4HJ3 A;  2EXB A;  3NEC A;  2JKT I;  1L0G A;  4DF6 A;  1SDN A;  1QMF A;  1BLP A;  3Q7Z A;  3DTK A;  1M6K A;  5EFW A;  5EVE A;  4IVI A;  5EV0 A;  3MZD A;  2JHE A;  4L9E A;  3C38 A;  2KX6 A;  1GCE A;  5L2F A;  2JKT M;  1FSY A;  2R78 A;  3HL9 A;  2E8I A;  5KIZ A;  1S1Z A;  5GLA A;  4EEU A;  1I2S A;  3HUO A;  1N9O A;  4RX2 A;  1G28 A;  1IYO A;  4Y0O A;  4WBG A;  4UHU A;  5FSR A;  4LCL A;  3NDG A;  1K6S A;  2PHY A;  5AVE A;  4L0L A;  1SKF A;  3B33 A;  5MC7 A;  4O8G A;  3DTE A;  3TSG A;  1MY8 A;  3EWK A;  1ODV A;  2QKP A;  2JKG A;  4OOL A;  5G4Y A;  1IEL A;  3GDI A;  3A3J A;  4WUJ A;  1P9R A;  1TF1 A;  2JN7 A;  2HDS A;  2BLS A;  4S2P A;  3BY9 A;  2QHK A;  4R70 A;  3HBR A;  3CMZ A;  1Z6F A;  2VV6 A;  3S7N A;  2XK1 A;  2O0Y A;  2Y2K A;  4ZJ3 A;  5D3O A;  1E25 A;  4KZ7 A;  3P98 A;  1GHI A;  3VP2 A;  2VGK A;  2WKI A;  3A3E A;  3HLE A;  4NG2 A;  3MZF A;  3O88 A;  4WEJ A;  4UAA A;  3IWO A;  4HES A;  4OOY A;  5F1G A;  1IKI A;  4ZJ1 A;  3SS3 A;  5DTT A;  1OTI A;  4OQ0 A;  4ME4 A;  4K91 A;  4FH4 A;  2JE5 A;  1AXB A;  3U2A A;  5C5K A;  5FAO A;  1MPL A;  1Z09 A;  4NK3 A;  3OPP A;  1S0W A;  3VOY A;  2HPB A;  3IF5 A;  3ZG7 B;  2BG1 A;  3IX8 A;  5CHM A;  5AQB A;  1IOU A;  1DJB A;  1ONG A;  5EE8 A;  3T12 B;  4S2L A;  2EFU A;  3Q7V A;  4GDB A;  5HL6 A;  4MEZ A;  1S1Y A;  3QP1 A;  2ACG A;  3PTE A;  4R0Q A;  1GA9 A;  1ERQ A;  5DKK A;  1MWU A;  2OLU A;  3AGD A;  4DE1 A;  4M4X A;  1P9W A;  4P6B A;  2HV1 A;  3T50 A;  4HIA A;  4ESP A;  4E3J A;  3TG9 A;  4WLA A;  1CEG A;  3DAV A;  3E2K A;  3G32 A;  4OPR A;  4QY6 A;  5CGS A;  3HLD A;  2P9V A;  1K57 A;  1TDL A;  3HCY A;  4S2N A;  4JBF A;  5DF9 A;  5HWT A;  3LGO A;  5FI7 A;  5FAT A;  3G2Y A;  3ZVW A;  5L09 A;  3BEB A;  3S1Y A;  1Y28 A;  1ESU A;  2J3W A;  4BLM A;  3PBT A;  3A3F A;  3EEA A;  4KG2 A;  5FQI A;  2WUQ A;  3N4I A;  3N8R A;  2VV8 A;  1LL8 A;  3ZDJ A;  4PM5 A;  4OH0 A;  1JTG A;  1N9L A;  2OSU A;  5HD3 A;  3BYD A;  4HH3 A;  2ZOI A;  3A0R A;  2JKR I;  3MXS A;  1DY6 A;  2A3U A;  1GA0 A;  3GQZ A;  4PM9 A;  3ITB A;  3NDE A;  2ZLY A;  1I5Q A;  2J3T D;  2WGW A;  3MS6 A;  5FQ9 A;  5HDC A;  4DE2 A;  1PIO A;  4JGO A;  4XXR A;  3WS2 A;  1TDG A;  2JKR M;  1YLW A;  3NCK A;  1WYB A;  2ZQ7 A;  1IEM A;  1FIL A;  2NUP C;  1KGG A;  2B18 A;  4U0X A;  3VSL A;  1WA9 A;  1YQS A;  4Q0J A;  1KVM A;  1ZHH B;  3UE6 A;  3QNB A;  3RJU A;  3T4O A;  2X02 A;  3MBZ A;  4HI4 A;  3HLB A;  1DP8 A;  3N7W A;  3FZC A;  3GVB A;  5AQA A;  4XUZ A;  2PU4 A;  5HL1 A;  3L7H A;  1MXO A;  3BFE A;  1LL9 A;  4OLG A;  1XKZ A;  4EW7 A;  4QB8 A;  2XRO A;  3BFG A;  2ZOH A;  3BLM A;  4JGP A;  5FQJ A;  3OLO A;  4UEY A;  5HWW A;  4KQD A;  3IXB A;  4ZBE A;  3O5Y A;  3C5A A;  2HDQ A;  4S2M A;  2PBD P;  3PXP A;  1F9I A;  4R38 A;  1T19 A;  1YSP A;  2XLN A;  5E2F A;  4L9G A;  4X53 A;  4BJP A;  2Y2P A;  2O9C A;  4NET A;  4LPZ A;  3S4X A;  1CJF A;  2X71 A;  4KZ6 A;  1GSV A;  1ES4 A;  4HJ6 A;  5AJG A;  2Z2L B;  3AGE A;  1Y54 A;  1JTD A;  1U60 A;  2QJ5 A;  3LIF A;  1W79 A;  4HH2 A;  3P7N A;  3T4L A;  1ALQ A;  3FKW A;  1L0D A;  4B88 A;  4PKY G;  3NOP C;  3P01 A;  1D1J A;  2V1Z A;  3S22 A;  1ZKJ A;  4OPQ A;  4E3I A;  3IS2 A;  3M2J A;  4EEP A;  3FWL A;  5F69 A;  1IFQ A;  1MZU A;  1NYY A;  4DE0 A;  5DFX A;  3WS1 A;  4BEN A;  1K6R A;  1GSX A;  3KSI A;  1KGE A;  3S7O A;  2HJE A;  3C8C A;  1T18 A;  2QZ6 A;  5FEF A;  3IQA A;  1O07 A;  4JPM A;  1XXM A;  3VE3 A;  4N9K A;  3VOL A;  2W3E A;  2L1M A;  3BM6 A;  3W4P A;  4HJ4 A;  2J3T C;  3KYQ A;  5U47 A;  1N9B A;  2M7V A;  3LIB A;  4C75 A;  3VP3 A;  4BBT A;  5TGF A;  3UE1 A;  4ZJ2 A;  4LV1 A;  1KE3 A;  5FQM A;  3FC7 A;  3QNC A;  4LLO B;  1XJ2 A;  1AWI A;  4E3O A;  1LLB A;  1H0M A;  4KQO A;  2ZC3 B;  2FFY A;  2IWD A;  3CWF A;  3PYP A;  2DRW A;  1P97 A;  3PR6 A;  4YWZ A;  4UQI M;  4DMZ A;  5L07 A;  2CC1 A;  2H0Y A;  1ES3 A;  5I94 A;  2HZ5 A;  3KX0 X;  2Z6C A;  1KDW A;  4IUH A;  3WS5 A;  4IBX A;  3ZYT A;  1Y4O A;  3QHY A;  3U4L P;  3OPH A;  2V8F A;  3ICY A;  4KQQ A;  1W63 Q;  3BFC A;  3MJQ A;  4LCM A;  4OQH A;  3T1Q B;  3PBS A;  1OJ5 A;  4WEK A;  4IJG A;  4EV4 A;  2VZW A;  1ZG6 A;  4DXB A;  2DMW A;  3D4F A;  1TS0 A;  1YKD A;  3VFH A;  5HPF A;  4FOF A;  4R4S A;  4LV3 A;  4BD0 A;  1MKI A;  3JYI A;  3UDF A;  1XJ3 A;  2JBF A;  1UGU A;  5CED A;  3UB9 A;  2O9B A;  1FR6 A;  2M1C A;  2R9W A;  3LI8 A;  1GSW A;  4PHT A;  3HLW A;  3C2W A;  2JC7 A;  2PR5 A;  3Q1F A;  3VSK A;  2K7S A;  2QWS A;  3UME A;  2VGJ A;  2ZMV A;  1Q2P A;  4HBT A;  2PD8 A;  1E3U A;  1CF0 A;  4WF0 A;  2RL3 A;  1NLZ A;  2KOI A;  3IHA A;  4HQA A;  5JYO A;  2Y2L A;  3BQ8 A;  2BTF P;  1PZP A;  4P85 A;  5HWV A;  5HW3 A;  1DRM A;  1MC0 A;  3VV4 A;  3SOI A;  3BEC A;  4JLF A;  5AVF A;  3VOZ A;  2XD5 A;  5CHJ A;  1K54 A;  4UA7 A;  3NOU C;  3C7U A;  2Y2H A;  4LV0 A;  4WMC D;  3ZG0 A;  1L0F A;  2Y2G A;  1TVF A;  2YKF A;  2WKP A;  3H9W A;  5GHX A;  1ERO A;  3JVV A;  3LEZ A;  3SH7 A;  5EM1 A;  1BLS A;  4F3L B;  3IHB A;  1SKO A;  4CLC A;  2EWW A;  4Y3I A;  1NJ4 A;  3SH9 A;  2ZMF A;  2EX2 A;  3SS5 A;  1K38 A;  4WL9 A;  4N9L A;  2Y2I A;  2XEP A;  3Q82 A;  3VP0 A;  4PAU A;  5FEG A;  1S67 L;  2C5W B;  1PWC A;  4E3L A;  5HPI A;  3HLC A;  1VEU A;  1SHV A;  1D7E A;  1S6R A;  2UWX A;  3UPO A;  4HBU A;  4OQG A;  1SCW A;  4GJ4 A;  5EOE A;  1BLC A;  2H0T A;  5FDS A;  3UMD A;  1ES5 A;  3G31 A;  5KMW A;  3H7W A;  2ZD8 A;  2Y2M A;  4QU3 A;  2GX5 A;  4MN5 A;  3MFD A;  4R3J A;  5HDS A;  1OME A;  4I3I A;  2A2L A;  2XDM A;  1V9Y A;  3LID A;  1EI5 A;  1YM1 A;  2XFS A;  1W63 M;  3D72 A;  4P6Z M;  1PWD A;  1P0Z A;  2WAF A;  4JXW A;  3CLO A;  4F3L A;  3Q7V B;  3VP4 A;  4I3J A;  4D60 A;  4NXB A;  4X68 A;  4MBK A;  3LIE A;  3N6I A;  3CJM A;  4HP9 A;  1NRJ A;  3EQU A;  5HAR A;  4IHQ A;  4E6X A;  1T1B A;  1BTL A;  2V2F F;  3F1N B;  5J4E A;  1H8Y A;  2OAP 1;  1K55 C;  3MQQ A;  2P9V B;  1NXY A;  1HLU P;  1XFN A;  3ZG8 B;  3FPV A;  1TS8 A;  1TS6 A;  4KZ5 A;  3PAG A;  3VMA A;  2OAQ 1;  4PKY A;  4QJG A;  1LL5 A;  2QJ7 A;  2Y2O A;  5GHZ A;  2Z2M B;  2GJ3 A;  2JKF A;  2XSS A;  2V0U A;  3CUE C;  1OT9 A;  3P09 A;  1ES2 A;  1M40 A;  3V5M A;  2EX6 A;  2HDR A;  3MMH A;  2IA2 A;  4HHD A;  3O3V A;  1GHP A;  3LI9 A;  1W8Y A;  5KZH A;  1FQG A;  4E3K A;  3IXG A;  2R9X A;  2QMI A;  4KZA A;  1G6O A;  2ZL1 B;  4LV2 A;  2V1A A;  2WGW B;  4EBP A;  5M18 A;  3ITA A;  1X0O A;  3OC2 A;  4FUW A;  3F1N A;  1F5M A;  2XGN A;  3OBF A;  4JXS A;  2EA9 A;  2Y91 A;  4GNU A;  4EUZ A;  1LT0 A;  1W8Q A;  3W4O A;  1RGZ A;  3WWX A;  2ZC7 A;  3TRC A;  4GD8 A;  4EBL A;  2P08 A;  2I9V A;  2J9O A;  2V8C A;  4Y13 A;  1UWP X;  2VGL M;  3RFB A;  2W3G A;  1NZU A;  1SZV A;  1VET B;  3V67 A;  2RCX A;  3LFV A;  4ZDX A;  3IX4 A;  4PPR A;  3NOT C;  1MWT A;  3LR0 A;  4R3A A;  2XF3 A;  3D3O A;  2PYR A;  1KE0 A;  2ZQ9 A;  3FV7 A;  1WYC A;  4WM9 A;  2W3F A;  2EXA A;  4Y0T A;  3OOV A;  3QP8 A;  2ZC6 B;  4KUK A;  5AQ7 A;  4BL2 A;  2G2U A;  2PR6 A;  4FTX A;  5EM0 A;  3CG5 A;  1YLY A;  4NXG A;  2OV5 A;  1FOF A;  1J3W A;  1L0E A;  1S4S A;  3AGF A;  3FYZ A;  2ZL1 A;  2W1T B;  4GDN A;  4EET B;  2X01 A;  3BY8 A;  1LSW A;  2J8Y A;  3UPP A;  1BZA A;  1CK3 A;  1L2S A;  3O86 A;  2ZMA A;  2WYX A;  1GHM A;  4NXE A;  3RTY A;  3HJI A;  3Q07 A;  4N92 A;  3UB6 A;  5A93 A;  4GD6 A;  3UN7 A;  3IS2 B;  5CEC A;  4DKI A;  3IWI A;  1VET A;  5A91 A;  2WKQ A;  4YNR A;  5IT5 A;  4OON A;  3IX3 A;  5CEB A;  4G3K A;  1DP9 A;  1YMS A;  3ZNY A;  4MCW A;  3LY4 A;  1O7E A;  2O99 A;  3CHW P;  5DTK A;  3A3D A;  3SS4 A;  2HP6 A;  4MN7 A;  5CX7 A;  4B4Z A;  1UWN X;  4WN5 A;  4U0T A;  4BBU A;  5F68 A;  3T4K A;  2FZ0 A;  1ESI A;  2K31 A;  2W1T A;  3LR3 A;  4PM6 A;  3ULF A;  5E2H A;  3HLF A;  4BQM A;  1OTA A;  2PD7 A;  2HJ9 C;  5E2G A;  3IH8 A;  5A8B A;  2NUT C;  2W3H A;  4GOG A;  3QP4 A;  4GHI A;  4KZ4 A;  3CAX A;  5HFO A;  3WS0 A;  4JGR A;  3PBO A;  3S7P A;  3DTI A;  5M1A A;  4C6Y A;  3JVU A;  1W7F A;  1YPR A;  4AFI A;  3B42 A;  2HGV A;  3G35 A;  4Q0I A;  4RYE A;  3BWL A;  5EVI D;  1D06 A;  5F5Y A;  3HRE A;  4K08 A;  2G2W A;  3UNW A;  2ZQ8 A;  4CJN A;  5HAP A;  2WGV A;  3ZHH A;  4N1H A;  2J7V A;  2INW A;  3EGX C;  4Y0U A; 
#chains in the Genus database with same CATH homology
 2RL3 A;  4GN2 A;  3IHA A;  4KG6 A;  1Z6F A;  3ZGA B;  4RVA A;  5JYO A;  2Y2L A;  3N8L A;  1YLZ A;  3MZE A;  3BFD A;  4PM8 A;  4QD4 A;  5CGX A;  1PZP A;  4P85 A;  2XK1 A;  3N8S A;  2V20 A;  5HW3 A;  2Y2K A;  4ZJ3 A;  3FKV A;  5D3O A;  1E25 A;  4KZ7 A;  3UE3 A;  3P98 A;  4FH2 A;  5JYP A;  1GHI A;  5CHU A;  1CI9 A;  5EVL A;  4MNR A;  3SOI A;  5GLC A;  4PMA A;  3VP2 A;  3BEC A;  4JLF A;  2VGK A;  2WKI A;  3VOZ A;  2XD5 A;  3A3E A;  1K54 A;  3M6B A;  1H5X A;  4UA7 A;  5CHJ A;  3UE0 A;  5F82 A;  3HLE A;  4KZ8 A;  4OVD A;  1TEM A;  2Y2H A;  3C7U A;  4LV0 A;  4WMC D;  1NRF A;  3MZF A;  3O88 A;  5DVA A;  4WEJ A;  2WKH A;  3ZG0 A;  1L0F A;  1K56 D;  4UAA A;  3IWO A;  1IYP A;  4HES A;  2Y2G A;  4OKP A;  4OOY A;  3IWQ A;  1IKI A;  1YLP A;  1TVF A;  5F1G A;  4ZJ1 A;  3SS3 A;  4FSF A;  5DTT A;  4OQ0 A;  4XUX A;  4EBN A;  5GHX A;  4K91 A;  4FH4 A;  1JWP A;  2JE5 A;  3M6H A;  1ERO A;  3MKE A;  1AXB A;  3LEZ A;  3SH7 A;  4WZ4 A;  1JWZ A;  1BLS A;  3IHB A;  5FAO A;  1MPL A;  1NJ4 A;  4NK3 A;  3OPP A;  1FCM A;  4N1X A;  3SH9 A;  2HP5 A;  1S0W A;  1PW8 A;  3VOY A;  2HPB A;  3IF5 A;  3ZG7 B;  2BG1 A;  4GZB A;  1HVB A;  2EFX A;  2EX2 A;  5CHM A;  3G2Z A;  3SS5 A;  5AQB A;  2Y2N A;  1K38 A;  4FCF A;  2WKE A;  4N9L A;  2Y2I A;  2XEP A;  4RA7 A;  3Q82 A;  1DJB A;  3UDI A;  3VP0 A;  1ONG A;  3BLS A;  4FD8 A;  5EE8 A;  2C5W B;  1PWC A;  4S2L A;  4DRT A;  2EFU A;  3LCE A;  3Q7V A;  4E3L A;  4GDB A;  4QY5 A;  4MEZ A;  2XR0 A;  3ZG5 A;  3HLC A;  3PTE A;  4R0Q A;  1GA9 A;  3W4Q A;  1ERQ A;  3MKF A;  1IKG A;  3G34 A;  1MWU A;  2OLU A;  4ZAM A;  1SHV A;  4KZ3 A;  1S6R A;  3AGD A;  5DTS A;  2UWX A;  4DE1 A;  3UPO A;  4P6B A;  4HBU A;  3EQV A;  3IH9 A;  4M3K A;  5E2E A;  3RXX A;  3ISG A;  1VQQ A;  4OQG A;  5EPH A;  4E3J A;  1SCW A;  5FA7 A;  3TG9 A;  1C3B A;  1CEG A;  1BLC A;  3E2K A;  3G32 A;  5EOE A;  4LEN A;  4OPR A;  4QY6 A;  3I7J A;  4RX3 A;  5CGS A;  2H0T A;  2JCH A;  1ES5 A;  3G31 A;  3HLD A;  5KMW A;  2FFF B;  2I72 A;  5FAQ A;  2ZD8 A;  1HD8 A;  1K57 A;  1TDL A;  1E3U D;  2P9V A;  2Y59 A;  2Y2M A;  4QU3 A;  1YT4 A;  3MFD A;  4R3J A;  4U3T A;  1PW1 A;  1OME A;  4S2N A;  5DF8 A;  3TOI A;  2XDM A;  4JBF A;  5DF9 A;  1EI5 A;  1YM1 A;  1LI0 A;  4IBR A;  2XFS A;  4GB7 A;  3OCN A;  3C7V A;  4S2K A;  5FI7 A;  3GSG A;  5FAT A;  3G2Y A;  3ZVW A;  3HVF A;  4E3M A;  2OLV A;  5GLD A;  3BEB A;  5EVI C;  3ZNT A;  3S1Y A;  4BLM A;  1ESU A;  1PWD A;  3PBT A;  3A3F A;  1CI8 A;  4KG2 A;  2WAF A;  4JXW A;  3PBR A;  3Q7V B;  3VP4 A;  2ZM0 A;  5FQI A;  1PI4 A;  2WUQ A;  3N4I A;  4X68 A;  3N8R A;  5GHY A;  4MBK A;  1BLH A;  4OOM A;  1PWG A;  3N6I A;  3Q81 A;  3CJM A;  5DF7 A;  3UDX A;  3EQU A;  5FQK A;  5HAR A;  3ZFZ A;  3ZDJ A;  1JWV A;  2B5R A;  1IYS A;  4ZTK A;  4E6X A;  1BTL A;  3OPR A;  2V2F F;  3NBL A;  2Y4A A;  4PM5 A;  4OH0 A;  1FR1 A;  1JTG A;  2OSU A;  1W5D A;  4X6T A;  3BYD A;  3NIA A;  5CTN A;  1H8Y A;  1BUL A;  1RCJ A;  3GQZ A;  1DY6 A;  2A3U A;  3E2L A;  1GA0 A;  3MXS A;  2PBY A;  4GKU A;  3GRJ A;  4PM9 A;  1RP5 A;  3GMW A;  4KG5 A;  1K55 C;  3ITB A;  3GR2 A;  3IF6 C;  3NDE A;  2P9V B;  3OCL A;  2ZLY A;  1I5Q A;  2WGW A;  5KSC A;  5FQ9 A;  1J9M A;  4DE2 A;  3G30 A;  1PIO A;  1NXY A;  4XXR A;  1PI5 A;  5EVI A;  2WAD A;  3WS2 A;  1K25 A;  3ZG8 B;  1XA1 A;  3GV9 A;  1TDG A;  4PM7 A;  4Q8I A;  2ZQD A;  1ERM A;  1YLW A;  5CGW A;  3HLG A;  3NCK A;  1WYB A;  3PBN A;  2ZQ7 A;  4OPZ A;  1IEM A;  4S2O A;  3HUN A;  5KSH A;  3CZD A;  1XGJ A;  3DWZ A;  1KGG A;  4KZ5 A;  4U0X A;  3PAG A;  3VSL A;  1YQS A;  3VMA A;  2J9P A;  4MBH A;  5E43 A;  1KVM A;  4IVK A;  4BL3 A;  5FI6 A;  4QJG A;  5FDH A;  3QNB A;  1LL5 A;  4WEL A;  3RJU A;  2Y2O A;  1Q2Q A;  5GHZ A;  2Z2M B;  4JXG A;  2X02 A;  3MBZ A;  3O87 A;  1DJC A;  1MWS A;  5FI2 A;  3HLB A;  3P09 A;  3N7W A;  1ES2 A;  3FZC A;  1M40 A;  3GVB A;  4XUZ A;  2PU4 A;  5AQA A;  5HL1 A;  3V5M A;  3A3I A;  1MXO A;  5F1F A;  3BFE A;  1LL9 A;  4OLG A;  2EX6 A;  2HDR A;  3M2K A;  1XX2 A;  1XKZ A;  5TR7 A;  2IWC A;  4QB8 A;  3BFG A;  5GL9 A;  3C4P A;  3NY4 A;  4JXV A;  3O3V A;  3IF6 A;  1G68 A;  1ZC2 A;  2ZC4 B;  3BLM A;  1GHP A;  3GTC A;  3PAE A;  4P0M A;  5FQJ A;  4DDY A;  1W8Y A;  5KZH A;  1FQG A;  3IXB A;  3B3X A;  2WGI A;  4E3K A;  4IED A;  3IXG A;  5FQQ A;  2R9X A;  4UA9 A;  4ZBE A;  2QMI A;  4KZA A;  4JF6 A;  3C5A A;  2HDQ A;  1N4O A;  4S2M A;  3RXW A;  1DJA A;  4LV2 A;  2QPN A;  3UO9 A;  1K56 A;  5A90 A;  4C3Q A;  2WGW B;  4EBP A;  3V50 A;  1FCO A;  5M18 A;  4EQI A;  1LHY A;  3ITA A;  2DCF A;  4DDS A;  1BSG A;  3MXR A;  5EVI B;  2ZM2 A;  1VM1 A;  3OC2 A;  2IWB A;  5CER A;  4E3N A;  2PU2 A;  3HUM A;  2XGN A;  5CXW A;  2HP9 A;  3V3S A;  1E4D A;  2XLN A;  5E2F A;  5HAI A;  1NY0 A;  4JXS A;  4CPK A;  5HAQ A;  3NC8 A;  4X53 A;  2Y91 A;  4GNU A;  4EUZ A;  4BJP A;  3SH8 A;  4DXC A;  1W8Q A;  1ONH A;  2Y2P A;  3V3R A;  4NET A;  3W4O A;  5CRF A;  1RGZ A;  3WWX A;  3S4X A;  2X71 A;  3ZVT A;  4KZ6 A;  3LY3 A;  2ZC7 A;  2Y2J A;  4GD8 A;  4EBL A;  5AQ9 A;  2ZJ9 A;  1ES4 A;  4Z9Q A;  3VFF A;  3W8K A;  2J9O A;  4F94 A;  2Z2L B;  2ZQC A;  3AGE A;  1Y54 A;  1JTD A;  2EX8 A;  1U60 A;  1NZU A;  1SDE A;  2XFT A;  5J8X A;  2RCX A;  4ZDX A;  1MBL A;  1W79 A;  5IHV A;  3UPN A;  3IF6 B;  4PPR A;  1MWT A;  4KQR A;  1RGY A;  2WZZ A;  4H8R A;  1ALQ A;  1BUE A;  4K0W A;  3FKW A;  1L0D A;  4Y0U A;  4B88 A;  3DTM A;  4KZB A;  1G6A A;  4MLL A;  2XF3 A;  4OPY A;  4Y7P A;  2V1Z A;  4BD1 A;  1KE0 A;  1KDS A;  3S22 A;  1LI9 A;  2ZQ9 A;  1K54 C;  4O7D A;  1K4F A;  1ZKJ A;  3FV7 A;  4OPQ A;  4E3I A;  1WYC A;  3M2J A;  4WM9 A;  1XA7 A;  3G4P A;  3FWL A;  2WZX A;  2EXA A;  4Y0T A;  1NYY A;  3V39 A;  4P87 A;  4DE0 A;  2ZC6 B;  1HTZ A;  3WS1 A;  5AQ7 A;  2H10 A;  4BEN A;  1KVL A;  1ZG4 A;  4BL2 A;  4MBF A;  5FAS A;  2G2U A;  1K6R A;  3IXH A;  2ZC5 B;  1KGF A;  3CG5 A;  1NYM A;  4JF4 A;  1KGE A;  1YLY A;  3DW0 A;  2WK0 A;  4YFM A;  2OV5 A;  2QZ6 A;  1FOF A;  1KE4 A;  3IQA A;  1L0E A;  1O07 A;  3AGF A;  3FYZ A;  4JPM A;  1XXM A;  1EWZ A;  3PBQ A;  4N9K A;  3LO7 A;  4GDN A;  3WRZ A;  2X01 A;  2EX9 A;  2J8Y A;  4R23 A;  3UPP A;  4ID4 A;  3BM6 A;  5EEC A;  3OPL A;  5EOO A;  1BZA A;  3W4P A;  2H5S A;  5HX9 A;  3WS4 A;  3DWK A;  1CK3 A;  1L2S A;  1YLJ A;  3O86 A;  5U47 A;  1QME A;  4K0X A;  2ZQA A;  1YMX A;  1N9B A;  1K4E A;  2WYX A;  1XP4 A;  1GHM A;  2ZMA A;  4X56 A;  4E6W A;  5BOH A;  5TFQ A;  4C75 A;  1NZO A;  2C6W B;  3IXD A;  3VP3 A;  3Q07 A;  1IYQ A;  5TGF A;  1FSW A;  5EUA A;  5GLB A;  3UE1 A;  4N92 A;  2Q9M A;  4ZJ2 A;  4LV1 A;  1KE3 A;  2Y55 A;  3NI9 A;  5FQM A;  4DE3 A;  3QNC A;  4S2J A;  4KZ9 A;  2Q9N A;  4QHC A;  4E3O A;  1LLB A;  2ZM8 A;  5A93 A;  4JF5 A;  4GD6 A;  2A49 A;  4KQO A;  3UN7 A;  5CEC A;  2ZC3 B;  3ZG9 B;  4DKI A;  3IWI A;  3IT9 A;  2FFY A;  4X55 A;  4YIN A;  2Y2Q A;  4X69 A;  5FAP A;  2IWD A;  1XGI A;  5A91 A;  2WAE A;  1BT5 A;  1K55 A;  1MWR A;  1YLT A;  2P74 A;  4A5R A;  3BRM A;  2DRW A;  1CEF A;  4OON A;  2XD1 A;  4WZ5 C;  2HDU A;  4OQI A;  4OLD A;  5CEB A;  5CTM A;  2DNS A;  1HZO A;  4UA6 A;  4R4R A;  1WE4 A;  2EXB A;  1K57 C;  1YMS A;  4WMC A;  3ZCZ A;  2CC1 A;  3LY4 A;  3ZNY A;  2H0Y A;  4R3B A;  1L0G A;  4DF6 A;  1O7E A;  1SDN A;  1QMF A;  1ES3 A;  5I94 A;  1BLP A;  4WYY A;  4S2N C;  3Q7Z A;  1KDW A;  1M6K A;  4JKT A;  5DTK A;  4IVI A;  3A3D A;  3MZD A;  3SS4 A;  3WS5 A;  4EWF A;  4KEN B;  1H8Z A;  2HP6 A;  4IBX A;  4B4Z A;  5M19 A;  1GCE A;  5L2F A;  1XPB A;  1FSY A;  3QHY A;  4U0T A;  3OPH A;  4KQQ A;  5A92 A;  1ESI A;  3HL9 A;  3OZH A;  3BFC A;  4LCM A;  2E8I A;  4OQH A;  4PM6 A;  5E2H A;  3HLF A;  4BQM A;  3PBS A;  5E2G A;  2GDN A;  3IH8 A;  4WEK A;  4B4X A;  4EV4 A;  4R1G A;  4GOG A;  1ZG6 A;  4DXB A;  5GLA A;  1I2S A;  1I2W A;  3D4F A;  3HUO A;  4RX2 A;  3VFH A;  4WZ5 A;  1JVJ A;  1IYO A;  4R4S A;  4Y0O A;  4WBG A;  4KZ4 A;  4LV3 A;  4UHU A;  5FSR A;  5HFO A;  4OP8 A;  4BD0 A;  3WRT A;  1MKI A;  3JYI A;  3WS0 A;  3UDF A;  3PBO A;  4LCL A;  3NDG A;  1K6S A;  2JBF A;  5M1A A;  4C6Y A;  5CED A;  1W7F A;  2R9W A;  1FR6 A;  4L0L A;  1SKF A;  3G35 A;  2XQZ A;  4RYE A;  3HLW A;  3TSG A;  5EVI D;  1MY8 A;  3VP1 A;  5G18 A;  2JC7 A;  4OP5 A;  3HRE A;  4OOL A;  2G2W A;  3C4O A;  3Q1F A;  3UNW A;  2ZQ8 A;  3VSK A;  1IEL A;  4CJN A;  3A3J A;  5HAP A;  3UY6 A;  2VGJ A;  2XH9 A;  2WGV A;  5F83 A;  1Q2P A;  4HEF A;  3ZHH A;  4S2I A;  4HBT A;  4N1H A;  2HDS A;  2BLS A;  2J7V A;  4S2P A;  1E3U A;  1PYY A;  1FCN A;  3BFF A;  4D2O A;  1PZO A;  3HBR A;  3CMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...