3A3JA

Crystal structures of penicillin binding protein 5 from haemophilus influenzae
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
344
structure length
344
Chain Sequence
b'GVTPPQITAQTYVLMDYNSGAILTALNPDQRQYPASLTKMMTSYVVGVALKQGKIHNTDMVTIGESAWGRNFPDSSKMFLDLNTQVSVADLNRGVIVVSGNDATVALAEHISGNVPNFVETMNKYVQQFGLKNTNFTTPHGLDDPNQYSSARDMAIIGAHIIRDLPEEYKIYSEKDFTFNKIKQPNRNGLLWDKTINVDGMKTGHTSQAGYNLVASATTSNNMRLISVVMGVPTYKGREVESKKLLQWGFANFETFKTLEAGKEISEQRVYYGDKNSVKLGAFMDHFITIPKGKQSEVKARYELADKNLQAPLAKGQVIGKVVYALDGKDIASANLQVMNDVGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PBP5
publication title Crystal structures of penicillin-binding proteins 4 and 5 from Haemophilus influenzae
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
total genus 106
structure length 344
sequence length 344
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2009-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07943 PBP5_C Penicillin-binding protein 5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.410.10 Mainly Beta Sandwich Peptidoglycan synthesis regulatory factor (PBP3), Domain 2 D-Ala-D-Ala carboxypeptidase, C-terminal domain 3a3jA02
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3a3jA01
2VGKA 5M19A 1BUEA 1TEMA 5JYPA 4HESA 2BG1A 4MBFA 2A49A 3GR2A 1BLCA 3BECA 2XF3A 4JXWA 5GLCA 1SHVA 3IHBA 3ZG0A 1Z6FA 1YLJA 4PM5A 5EOEA 3HUNA 4PM7A 5EECA 2ZMAA 4IVKA 1MWSA 1KE4A 2ZQDA 3IXHA 4UA6A 1XGIA 3GVBA 3VP3A 3A3FA 5KZHA 2Y59A 3VSKA 5AQ7A 5EE8A 3CZDA 4DXCA 1XA7A 1JVJA 2XH9A 1ESIA 4KG5A 2Q9NA 2BLSA 2Y2HA 4Q8IA 1PIOA 3ZHHA 4B4ZA 3HBRA 1DY6A 2PU4A 2HP5A 3IWQA 2WK0A 3VP1A 5EVIA 4JF4A 1EWZA 4C75A 3G2ZA 3Q07A 4OPYA 2QPNA 2XQZA 1FCOA 3ISGA 4KZ3A 3VSLA 1QMEA 1L0DA 4FH2A 4RVAA 4K0WA 3UO9A 1MWTA 3WS1A 4GB7A 4WM9A 3TSGA 1NXYA 2XEPA 3PBOA 4S2NA 4WBGA 3WWXA 4LCMA 1JWZA 1MXOA 5IHVA 3SS5A 2EX6A 3GMWA 3CG5A 1XPBA 5JYOA 5L2FA 4KENB 3Q7VA 4UA9A 5KMWA 3ZG8B 2G2UA 4WEJA 1FCNA 1H8ZA 5GHZA 1K4EA 3W4OA 3NIAA 1PI5A 2XLNA 3O86A 2OLUA 5HX9A 3G2YA 4N1HA 3JYIA 1ZG4A 4CPKA 3NCKA 5F1GA 1NRFA 4ZAMA 4BL3A 1K54A 4DDSA 4OKPA 4PM8A 4F94A 3DTMA 3UDFA 4KZ8A 5E2HA 3FZCA 1Q2PA 5F82A 3S1YA 4EQIA 4UAAA 3Q7VB 2E8IA 4OQ0A 3ZNYA 1M6KA 2G2WA 4DRTA 3ZNTA 4DE0A 5FI7A 3SS4A 3NY4A 3BFDA 1LI0A 3ZG5A 5CXWA 3UNWA 4U0TA 5CGSA 1SDNA 3BEBA 4HEFA 4A5RA 1U60A 5CTNA 5FAQA 1MWRA 2Y2MA 3UPNA 4OPRA 3ZFZA 3GSGA 4ZJ2A 2WGWA 4IVIA 4QU3A 4OP5A 4E3NA 2EXBA 1GA0A 3IWIA 4LCLA 3G4PA 4R4SA 3OCNA 2JC7A 1LI9A 3HLFA 3MKFA 2JCHA 3P98A 3QNBA 1NYMA 4GD6A 1ALQA 4OQIA 1W79A 4RX3A 5AQAA 4R1GA 2EFXA 2HDQA 3GV9A 4XUZA 3FWLA 1K4FA 3W4PA 1K38A 1HTZA 3BFCA 1NYYA 2B5RA 3IWOA 4EUZA 4RX2A 3G30A 4E6XA 4PM6A 5GL9A 4FSFA 1YQSA 2P74A 2WGVA 1JTDA 2IWDA 3HLDA 1CK3A 1SCWA 4BD1A 4DE3A 1LL5A 3VOZA 3BLMA 1IEMA 3PTEA 3HUOA 4P6BA 4QY5A 4R0QA 2Z2LB 4BD0A 4NETA 3NBLA 3HREA 1PWGA 3ZCZA 4KZ9A 2ZC6B 3A3EA 2EX2A 4DF6A 4B88A 1NZUA 5E43A 2R9XA 4JLFA 4E3KA 2H10A 3PBSA 3WS2A 2EFUA 1ES2A 1GA9A 4QD4A 4KQRA 1K6SA 1CI9A 2HP6A 3QNCA 5A90A 3HLWA 4OOYA 4E3JA 1ZG6A 1ZKJA 1FOFA 4WZ5A 4U3TA 1K57A 4GOGA 4KZ7A 4XUXA 5J8XA 2ZM0A 4S2MA 4E3OA 5EVID 1ONHA 1PWCA 5CGXA 4BL2A 2Y2QA 3IF5A 3SOIA 5GHXA 5M1AA 4HBTA 3V50A 1FCMA 4GZBA 3E2LA 2EX9A 4M3KA 1ES4A 1YLWA 3N8LA 3N8SA 4N9KA 4QY6A 3RJUA 5DTKA 3WRTA 1K56A 5GLBA 4WZ4A 4OVDA 2FFFB 2Y2IA 3VP2A 4L0LA 1BSGA 1GHMA 2EXAA 1BLHA 3G34A 1OMEA 1S0WA 4GN2A 4FH4A 3C5AA 3CJMA 3OPPA 2Y91A 2V2FF 5TFQA 1E3UA 1PZPA 3VP4A 3PBRA 3FKVA 4PM9A 2A3UA 3C4PA 3IXGA 4X55A 4X6TA 3UE3A 3EQVA 4C6YA 2Y2PA 1KGGA 4S2OA 5TGFA 1E25A 5CTMA 1K25A 2IWBA 1MKIA 4MBHA 4DKIA 3BFGA 3FKWA 3IH9A 5A91A 2WADA 5F83A 2FFYA 3V3RA 2XD1A 3G31A 5FSRA 2DRWA 5HFOA 3N4IA 3N7WA 4KQOA 3MXRA 2Y2GA 1FR6A 4K0XA 1BZAA 5CHUA 2WKHA 2J8YA 3TG9A 4HBUA 4ZTKA 3PBTA 3OPLA 4GD8A 5FQIA 5CEDA 2R9WA 2ZQCA 1YLTA 3OC2A 5CERA 5FQJA 4UHUA 1YLPA 3BRMA 5FQKA 3WS5A 5HL1A 4Y0OA 3MXSA 1S6RA 2QMIA 1K6RA 4X69A 1YMXA 4LV1A 4OONA 5HAPA 5M18A 5TR7A 4E6WA 2WAEA 5FI6A 5DVAA 2ZC3B 4LV3A 3BYDA 3HLGA 4GDNA 4WYYA 1RP5A 3UPOA 4YINA 3AGFA 4C3QA 1ES3A 2WZZA 1W8QA 4E3LA 1PW8A 4K91A 1WE4A 2Y2OA 5I94A 3WRZA 2XR0A 3NC8A 4S2PA 2I72A 1DJBA 3LO7A 2XGNA 1MPLA 1YLYA 3OPRA 3ZG7B 1E4DA 1ESUA 3GQZA 1GHPA 3IT9A 2Z2MB 4KG6A 2Y2NA 4D2OA 2XD5A 3DW0A 4P0MA 2C5WB 5KSCA 5KSHA 2J9OA 2ZJ9A 4DDYA 4OLDA 3ZG9B 4Y0UA 1XP4A 3Q81A 4EWFA 5HW3A 4GNUA 1PW1A 2OSUA 3MBZA 5CHMA 3VMAA 3B3XA 3SH9A 1ES5A 4FD8A 5FQMA 1FR1A 2JE5A 1IYPA 1YMSA 4MBKA 1GHIA 3LEZA 4OQGA 5G18A 1MBLA 3AGDA 3RXWA 3UPPA 1K55C 3ZGAB 1XA1A 1EROA 3UDXA 1KGEA 1W5DA 3PAGA 3C7UA 2ZQ7A 3M2JA 5AQBA 2V1ZA 4LV0A 3WS4A 3NI9A 3PBNA 5HAIA 2ZD8A 4DXBA 2ZQAA 1RCJA 4OLGA 4DE1A 3MZFA 4YFMA 1LL9A 5CEBA 1K56D 3HLBA 4S2KA 4NK3A 1KDWA 1L0FA 3VFHA 2PBYA 3A3DA 3HLCA 4GKUA 4KQQA 5DTTA 1GCEA 1E3UD 1RGYA 3BM6A 5A93A 3W8KA 1WYBA 4JPMA 4X53A 1G68A 2DNSA 2RL3A 4MEZA 2WZXA 3ZVTA 1ZC2A 2EX8A 2XFSA 3MZDA 4KZ5A 3GRJA 5GLDA 1TDLA 4ID4A 4X68A 5DTSA 1ONGA 1PWDA 4JXVA 1IELA 3G35A 2X71A 1RGZA 5E2FA 3VP0A 4P85A 5FAPA 4OPZA 1XGJA 2HP9A 5CGWA 1L0GA 3HVFA 3Q7ZA 1N9BA 3I7JA 4Z9QA 5FDHA 1ERQA 1NY0A 3A3IA 2Y2LA 3UN7A 1XXMA 3QHYA 4EBPA 3LCEA 5AQ9A 1IYOA 5FA7A 2WKIA 4OPQA 3HUMA 4N92A 1G6AA 4CJNA 4R3BA 1VM1A 2H0YA 3SH8A 3SS3A 5CHJA 3BFEA 1KGFA 4WELA 2P9VB 1K55A 4KG2A 1FSYA 1L2SA 1LLBA 1K54C 3DWKA 2XK1A 1IKIA 1FQGA 3EQUA 1J9MA 3FV7A 3ITAA 2WAFA 4U0XA 5F1FA 4OQHA 2V20A 3TOIA 1W7FA 4ZJ3A 2WUQA 3S4XA 3UDIA 1KE0A 5DF7A 1M40A 3N8RA 2X01A 4ZDXA 5HARA 4ZJ1A 1QMFA 1I2SA 3BLSA 3LY4A 4O7DA 3C7VA 1AXBA 3NDGA 2OV5A 4QHCA 1EI5A 4MNRA 3ZDJA 5EUAA 5FI2A 5BOHA 3A3JA 2PU2A 4JKTA 2ZQ9A 1I5QA 4WMCA 1LHYA 2X02A 3ZVWA 4X56A 4E3MA 4QJGA 1Q2QA 4EBNA 4OOLA 3IF6C 4IBRA 3M6HA 2IWCA 1MWUA 4KZ6A 4S2IA 1C3BA 4KZBA 3AGEA 5CRFA 4PPRA 5DF9A 4R4RA 3IXDA 5U47A 2ZM2A 1YLZA 5FQQA 1O07A 3O3VA 1DJAA 2OLVA 4KZAA 4E3IA 2XDMA 2ZC5B 1JTGA 3ITBA 1KDSA 1YM1A 2WYXA 1CEGA 3CMZA 1KVLA 2ZM8A 4H8RA 1PYYA 5EVIB 3HL9A 3G32A 1VQQA 4RA7A 5EVLA 4JF5A 3O88A 1H8YA 3OZHA 3V3SA 4BJPA 1KVMA 3MFDA 5D3OA 2ZLYA 1I2WA 2QZ6A 4JXGA 4N1XA 4OOMA 4S2LA 3WS0A 3RXXA 3SH7A 2Y2JA 2CC1A 5DF8A 3P09A 3UY6A 1CEFA 1PZOA 3LY3A 4JXSA 5EOOA 4RYEA 3UE0A 1IYQA 1L0EA 3Q1FA 2UWXA 3V5MA 4WZ5C 1SDEA 1K57C 2HPBA 5FQ9A 3M6BA 4FCFA 1DJCA 5FASA 2J9PA 1PI4A 1TDGA 5CECA 4BQMA 4BENA 2DCFA 2JBFA 3C4OA 5A92A 2HDUA 2Y55A 4R23A 4IBXA 4UA7A 4LV2A 5GLAA 4KZ4A 3W4QA 3N6IA 4MLLA 2RCXA 3IXBA 3V39A 3IF6A 1H5XA 4Y7PA 3GTCA 1HVBA 4EBLA 1XX2A 2HDRA 4P87A 3IH8A 4OP8A 1JWPA 3OPHA 3DWZA 3VOYA 1NJ4A 4N9LA 5GHYA 2XFTA 2Y2KA 2Y4AA 3Q82A 1IKGA 2HDSA 3MKEA 3OCLA 4GDBA 3FYZA 4JBFA 1CI8A 2GDNA 4IEDA 4DE2A 2WGWB 3HLEA 5E2EA 1O7EA 3IQAA 2VGJA 4WEKA 1KE3A 5EVIC 3O87A 4LENA 4ZBEA 1BTLA 3IF6B 5FAOA 2ZC7A 3S22A 1SKFA 2P9VA 4S2JA 1XKZA 1YT4A 3PBQA 4XXRA 1MY8A 1Y54A 2C6WB 5E2GA 1BLSA 3E2KA 5FATA 4QB8A 4S2NC 4R3JA 1TVFA 3M2KA 5HAQA 2ZQ8A 1JWVA 3MZEA 2J7VA 2Q9MA 3IHAA 5EPHA 4OH0A 4EV4A 1W8YA 4Y0TA 4JF6A 4PMAA 1BULA 3VFFA 1FSWA 3PAEA 3D4FA 2ZC4B 1N4OA 2H5SA 3UE1A 1BT5A 1HZOA 2WKEA 1HD8A 1IYSA 1BLPA 3NDEA 4WMCD 4BLMA 1NZOA 1WYCA 4B4XA 2WGIA 1ERMA 3BFFA 2H0TA
chains in the Genus database with same CATH superfamily
1X0OA 2Z6DA 1BUEA 4FUWA 2A49A 5GLCA 4JXWA 1SHVA 3TJZC 4Q0IA 2M1CA 4IVKA 2K2NA 2ZQDA 3A0VA 4O01A 3EWKA 1XJ2A 2Y2HA 2HV1A 2K7SA 2PU4A 3IWQA 4HP4A 4JF4A 1EWZA 5HPFA 4C75A 4K08A 4OPYA 4FTXA 4LLOB 1L0DA 4RVAA 3UO9A 1VETB 3WS1A 4GB7A 2V8CA 4LCMA 3SS5A 5HWWA 5L2FA 1NRJA 2H28A 4UQIS 5GHZA 3W4OA 2XLNA 3O86A 2OLUA 3NCKA 4ZAMA 4BL3A 1K54A 4F94A 5E2HA 5F82A 2GZAA 4EQIA 3KSIA 2W1RA 3ZNTA 3SS4A 1LI0A 2PYPA 5CXWA 5CGSA 2W3DA 1TS6A 4ZJ2A 4IVIA 3LR0A 2OAP1 4LCLA 3HLFA 2QJ5A 2JCHA 3HCYA 4GD6A 2K31A 1HTZA 2B5RA 3IWOA 4RX2A 4E6XA 4PM6A 2QHKA 3HLDA 1F98A 1SCWA 3NJAA 3MSHA 3NBLA 1PWGA 2EX2A 1NZUA 3T4KA 3JPUA 1SKOB 1ACFA 1ES2A 3HLWA 4E3JA 1ZKJA 3NHQA 4U3TA 1K57A 4KZ7A 4XUXA 4E3OA 5EVID 2YKFA 3SOIA 4I3AA 5CX7A 4GZBA 3N8SA 4QY6A 3RJUA 1GSVA 2V9AA 2FFFB 3LR3A 3MMHA 3T4QA 1BLHA 3G34A 3R4KA 1F5MA 1E3UA 1PZPA 2A3UA 4X55A 2D02A 4Y2FA 4MBHA 3UE6A 3F1PA 5LBRA 3G31A 3MFXA 3N7WA 1FR6A 4K0XA 5CHUA 2WKHA 3TG9A 3O5YA 3OPLA 5FQIA 5CEDA 2ZQCA 3OC2A 3LEQA 1AWIA 5FQJA 4UQIM 5FQKA 3WS5A 3MXSA 1YMXA 4OONA 3F1OA 4GHIB 3P7NA 5HAPA 4DMZA 5K5BA 5M18A 3CUEC 5DVAA 4LV3A 3BYDA 4WYYA 3UPOA 4C3QA 2EA9A 1WE4A 2Y2OA 1F9IA 3KX0X 4BMWA 3GQZA 1GHPA 3UB6A 2XD5A 5TBMB 4E04A 5KSHA 3IS2A 1S4SA 1PNEA 1VEUB 4BBUA 5IU1A 1FIKA 4WL9A 5FQMA 5HD3A 1FR1A 2JE5A 1IYPA 4MBKA 1GHIA 5FEFA 3C7UA 2W0NA 5HAIA 3MZFA 4HJ6A 3HLBA 3RH8B 4S2KA 4NK3A 1KDWA 4GLQA 4II7A 2PBYA 3HLCA 1RGYA 3KO6A 4ESPA 1G68A 2DNSA 2WZXA 2XFSA 1K0KA 1NWZA 2W3FA 3GRJA 1ONGA 3LUQA 2W1TA 1RGZA 4OPZA 3MXQA 3P01A 5CGWA 1L0GA 4L9EA 1ERQA 3A3IA 1IYOA 2XA7S 1TS0A 1YSPA 2WKIA 3HUMA 4OPQA 2HJ9C 4N92A 5HL6A 4CJNA 4R3BA 2PT7A 3UB9A 2ZMFA 4KUKA 5CHJA 3LI9A 1FQGA 3MQQA 3EQUA 3ITAA 1D1JA 3B42A 3H9WA 4PAUA 3S4XA 3UB8A 1ZHHB 4X25A 4ZJ1A 4O8GA 3C7VA 5HSQA 3CI6A 3MS6A 4QHCA 1EI5A 5EUAA 5FI2A 5BOHA 4JKTA 4F3LA 1LHYA 4X56A 4E3MA 4HIAA 3IF6C 2J80A 2L0WA 3IXDA 5FL3A 1O07A 4E3IA 2XDMA 1KDSA 1YM1A 1CQAA 3CMZA 4HJ3A 4H8RA 4ETXA 1VQQA 5EVLA 4YOFA 2W3EA 3OZHA 3A0RA 3V3SA 4BJPA 3MFDA 5D3OA 2HF6A 2AVXA 2ZLYA 2QZ6A 4N1XA 1DP6A 4OOMA 1LSXA 3SH7A 3VE3A 3S7QA 3E4PA 3LY3A 4GCZA 4JXSA 3UE0A 4WZ5C 5FASA 4FCFA 1TDGA 1GSWA 2JBFA 3H7WA 3C4OA 4HNBA 3NECA 2Y55A 3K3DA 5GLAA 4KZ4A 3IXBA 2PR5A 4P87A 3CUEA 3DWZA 3VOYA 4WUJA 3IX4A 1MC0A 2KOIA 4IEDA 5DFYA 5E2EA 2MJ6A 3DTEA 4LENA 3KSHA 4HH3A 5F6AA 1G6OA 3CAXA 2P9VA 3D72A 4HOIA 1Y54A 5FATA 3E2KA 1YAXA 1OJGA 2Q9MA 2M7UA 1W8YA 3K2NA 4ZRRA 4Y0TA 2XA7M 3VFFA 2ZC4B 2WKEA 1LSVA 5IT5A 3NDEA 4WMCD 1WYCA 4B4XA 3IX8A 3BFFA 2VGKA 1TEMA 2BG1A 3GR2A 1BLCA 3BECA 3E4OA 4DJ3A 1MKMA 3DAVA 4PM5A 3HUNA 4PM7A 3BQ8A 4HHDA 3IXHA 4UA6A 3GVBA 3A3FA 5AQ7A 1XA7A 4KG5A 1ESIA 2Q9NA 3ZHHA 2O9CA 1DY6A 2HP5A 2GJ3A 3VP1A 3LIFA 2QYBA 2QPNA 1FCOA 3HJIA 4WBGA 5IHVA 2EX6A 3LR4A 3LICA 4GS9A 3KSFA 2HZ5A 3F1PB 1PI5A 4HQAA 5HX9A 3G2YA 1LT0A 4N1HA 4NXBA 4DDSA 4PM8A 3BW6A 3FZCA 2YKHA 4WN5A 4UAAA 3Q7VB 2GNXA 2E8IA 2G2WA 4DE0A 5FI7A 1WA9A 3NY4A 4DN0A 3F1OB 3BEBA 4HEFA 4BBTA 5CTNA 2WGWA 1HLUP 2PYRA 4E3NA 1GA0A 3OCNA 1LI9A 3QNBA 1ALQA 4OQIA 4IUHA 1P97A 3GDIA 5AQAA 2HDQA 3GV9A 1K4FA 3QP2A 1NYYA 2PRFA 4EUZA 5GL9A 2WGVA 1LL5A 3IS2B 3BLMA 4P6BA 3TE8A 4R0QA 2ZC6B 4DF6A 3T1QB 4B88A 2WKPA 2R9XA 3PBSA 4PHTA 3WS2A 3LIBA 1GA9A 4QD4A 2HP6A 3QNCA 5A90A 4M4XA 1XJ6A 4WZ5A 3BQAA 5J8XA 1PWCA 5G4YA 5J3WA 2JKTM 1P0ZA 5M1AA 4M3KA 3SW1A 3LIEA 3N8LA 4N9KA 3WRTA 1K56A 2VK3A 1OTBA 3VP2A 3R7WA 1OMEA 3C5AA 3OPPA 2PDRA 3VP4A 3E98A 4X6TA 3C4PA 2Y2PA 4S2OA 5TGFA 5HWTA 3BFGA 3QP1A 5F83A 2XD1A 3UMDA 5EM1A 5FSRA 1ODVA 2DRWA 5HFOA 4KQOA 2Y2GA 4R70A 2J8YA 4HBUA 4ZTKA 3PBTA 2INWA 4JGRA 3T1RA 2R9WA 1YLTA 5CERA 3D9YA 4UHUA 1YLPA 3BRMA 2QMIA 4LV1A 4EW7A 4CLCE 5TR7A 2WAEA 5FI6A 2ZC3B 1KOUA 4GDNA 1RP5A 1S1ZA 3AGFA 3G6OA 5AVEA 4E3LA 1V9ZA 4K91A 2XR0A 2I72A 1DJBA 3S7OA 5A8BA 1YLYA 2WKRA 3OPRA 4KG6A 2V1AA 3DW0A 2J9OA 2W3HA 4DDYA 3ZG9B 3Q81A 4EWFA 4B93A 5HW3A 5FEGA 3SH9A 2JKFA 1ES5A 4FD8A 5DJTA 4OQGA 1YMSA 4GW9A 3LEZA 1MBLA 1XA1A 1EROA 1KGEA 5AQBA 4LV0A 4QWOA 3NI9A 1F2KA 4DXBA 1RCJA 2GX5A 4DE1A 5CEBA 1D7EA 5L07A 2LB5A 3VFHA 4GKUA 1GCEA 4EESA 3SZTA 3ZVTA 5L09A 4ID4A 4X68A 4JXVA 4Q0HA 3G35A 2X71A 4P85A 1XJ4A 1XGJA 1NY0A 1VHMA 4EBPA 3LCEA 1H3QA 5AQ9A 3T4SA 1NLYA 4UEYA 3TW8A 1KGFA 2P9VB 3VV4A 5HDSA 3DTIA 1IKIA 3C38A 2WAFA 4U0XA 2O9BA 5F1FA 2V20A 3TOIA 1W7FA 3H82A 1M40A 5HARA 1QMFA 4O7DA 4G3WA 3NDGA 4MNRA 2P7JA 5J4EA 3A3JA 3PXPA 2X02A 2ZMVA 4QJGA 4IBRA 3M6HA 5C5KA 4KZ6A 1MWUA 2JKTI 4D60A 1C3BA 4KZBA 3AGEA 3BY8A 5CRFA 4CQHA 5DF9A 2ZM2A 1DJAA 2OLVA 1JTGA 5MC7A 3HL9A 3G32A 3B33A 3O88A 2J3TC 3U4LP 4JXGA 4S2LA 3RXXA 3V67A 3EGXC 4GS9B 2LB9A 3W2ZA 1CJFA 1IYQA 1L0EA 2VZWA 2UWXA 3KYQA 3V5MA 1N9NA 1SDEA 2J9PA 2DCFA 5KIZA 2HDUA 4IBXA 2CMNA 2JKGA 3C30A 4MLLA 2P08A 4Y7PA 5IS1A 4EBLA 1T1CA 1NJ4A 3GECA 2XFTA 3Q82A 1IKGA 3MKEA 3D3OA 3PHYA 4GDBA 4HJ4A 4DE2A 2WGWB 1O7EA 3MF0A 1KE3A 3O87A 4ZBEA 2VA0A 2M7VA 5TJJA 4XT2A 3IF6B 4MN5A 1SKFA 4Z1WA 2KDKA 1XKZA 1Z09A 4EXOA 1TVFA 4CLCC 3IBJA 5HAQA 3T1XA 3RFBA 4JF6A 1BULA 3CPTA 1HD8A 1JNUA 2NUTC 1BLPA 2NUPC 2WGIA 3T4OA 2H0TA 1N9LA 5HL1A 5M19A 1ZTUA 2L4RA 4MBFA 1G28A 1YLJA 3VOLA 4I3IA 2J3WA 4EQ1A 1KE4A 3ULFA 1XGIA 4BWIA 5KZHA 2Y59A 5EE8A 3CZDA 4DXCA 4B9OA 4GJ4A 4Q8IA 2VX8A 4AFIA 2WK0A 2VV6A 5EVIA 3G2ZA 3Q07A 3FG8A 4KZ3A 3ISGA 3LIAA 2OOLA 3R7WB 3RTYA 3VSLA 1P9RA 1QMEA 4FH2A 1OT6A 4K0WA 1MWTA 4WM9A 3LR5A 2XEPA 3JVUA 1JWZA 3CG5A 5JYOA 4KENB 1VB6A 5KMWA 1P9WA 3ZG8B 2G2UA 4WEJA 1FCNA 1K4EA 3NIAA 2EWWA 2ZBBA 1CF0A 4CPKA 3JYIA 1ZG4A 4ETZA 5F1GA 1NRFA 4OKPA 3DTMA 5HZHA 3UDFA 4KZ8A 1J3WA 4EEPA 2JHEA 4OQ0A 2ZL1A 1M6KA 3ZNYA 1OTEA 2V1BA 2OWJA 3QP8A 3UNWA 1U60A 1MWRA 2Y2MA 3ZFZA 1XFNA 3GSGA 3IWIA 4YNRA 4R4SA 2JC7A 4EETB 3MKFA 1NYMA 5AVFA 4MCWA 1W79A 4ME4A 2EFXA 3FWLA 3W4PA 3NULA 2VGLS 3BFCA 3G30A 4FSFA 1YQSA 2P74A 3VOZA 1IEMA 3PTEA 4QY5A 2Z2LB 3HREA 4KZ9A 4E3KA 4IJGA 3ZYTA 1CI9A 2HJEA 3K3CA 4OOYA 1FOFA 4HY8A 4S2MA 2Q0OA 1ONHA 4BL2A 2Y2QA 3A0SA 1YSQA 3E2LA 2EX9A 1ES4A 3FPVA 3S7NA 5GLBA 3NOPC 2Y2IA 3U2AA 4L0LA 3KSGA 1BSGA 1GHMA 2EXAA 4JGQA 4GN2A 3CJMA 2Y91A 5DKLA 3PBRA 3FKVA 3IXGA 2IA2A 3UE3A 1KGGA 1K25A 2IWBA 4DKIA 3IH9A 3BY9A 1GSXA 1LSWA 5DFXA 2W3GA 3N4IA 2BASA 4LRXC 1OTIA 4GD8A 4CLCA 1IFQA 3MR0A 3OOVA 1K6RA 3BJNA 3T4JA 4Y15A 4E6WA 3H82B 5TBMA 3EGDC 3HLGA 2JN7A 4YINA 1ES3A 1S67L 1OT9A 5I94A 3WRZA 3NC8A 4S2PA 1DRMA 1MPLA 1PRQA 1E4DA 1ESUA 3PR6A 2B02A 4LGWA 3IT9A 4D2OA 4P0MA 2JKRM 4Y0UA 1PW1A 3B3XA 2VGLM 5G18A 3UPPA 3ZGAB 3UDXA 2ZQ7A 3M2JA 3WS4A 3PBNA 5DJUA 2OAQ1 4YFMA 2EWVA 1L0FA 3A3DA 1TF1A 1E3UD 3BM6A 1TS8A 5A93A 4X53A 2RL3A 4R3AA 1ZC2A 2EX8A 4KZ5A 5GLDA 3IX3A 4H6JA 5DTSA 4NXGA 1PWDA 5E2FA 3VP0A 2P04A 3KYEA 3HVFA 2Y8HA 3Q7ZA 2ACGA 4X1MA 4Z9QA 2Y2LA 2XROA 4QPRA 1T18A 1G6AA 1VM1A 1W63M 2W1TB 3SH8A 4XT2B 1DP9A 4WELA 2BTFP 4EU0A 1K55A 1FSYA 3UB5P 1T19A 2XK1A 2HGVA 2O9AA 4OQHA 4R38A 4ZJ3A 3CPTB 5DF7A 1XJ3A 4EERA 3BLSA 4Q0JA 3ZDJA 2A2LA 2PU2A 4WMCA 2O0YA 4HI4A 3ZVWA 1IOUA 1Q2QA 1G5UA 3T4LA 4EBNA 4S2IA 4HP9A 4G3VA 5U47A 3MQOA 5EV0A 2Z6CA 4JGPA 3ITBA 2WYXA 4F3LB 1KVLA 3E4QA 1PYYA 5EVIB 4RA7A 2UV0E 4JF5A 1H8YA 2DMWA 1KVMA 3DTKA 3ZQ5A 3WS0A 1Y4OA 2QJ7A 2Y2JA 4EUVA 5DF8A 3P09A 3UY6A 2QKPA 4RYEA 4I38A 3Q1FA 3M6BA 1PI4A 5CECA 2PD7A 4BENA 5A92A 4R23A 3L9KA 4UA7A 4LV2A 2ZOHA 3W4QA 3N6IA 3V39A 2RCXA 2ZL1B 4OP8A 1S66L 3OPHA 4PKYG 2VKSA 1STZA 2Y2KA 1FILA 1PFLA 3OCLA 2GDNA 3H7WB 4I39A 4NEED 2A24A 3HJKA 2VGJA 4WEKA 5EVIC 1BTLA 5FAOA 2ZC7A 3S22A 5EFWA 4S2JA 4MN6A 1YT4A 2C6WB 5E2GA 2VV8A 1BLSA 2JKRI 1S1YA 4R3JA 3M2KA 2ZQ8A 3IHAA 2J7VA 4EV4A 3LGOA 3LIDA 1FSWA 3PAEA 3UE1A 1N4OA 1HZOA 2D01A 4MMNA 2FH5A 1MZUA 4P6ZS 3VE4A 4NXEA 5JYPA 4HESA 1YKDA 3ICYA 3F1NA 2XF3A 3IHBA 3ZG0A 1Z6FA 5HDCA 5FDSA 5EOEA 5EECA 2ZMAA 1MWSA 1H0MA 3VP3A 3JVVA 3UB7A 3VSKA 3OBFA 1JVJA 2XH9A 2BLSA 1PIOA 4B4ZA 3HBRA 4LPZA 2XQZA 4L9FA 2PD8A 3PYPA 4NKPA 3CWFA 3TSGA 1NXYA 3PBOA 4S2NA 3WWXA 1MXOA 1N9OA 2V8FA 2ZOIA 3GMWA 1XPBA 4YWZA 3Q7VA 4UA9A 2PR6A 2I9VA 1H8ZA 1L3LA 3T4TA 2W27A 2OWHA 4CLCB 4IHQA 1Q2PA 3S1YA 4ARZA 3CITA 4WLAA 4MDZA 4NXFA 4DRTA 1TS7A 3BFDA 1S4RA 3T12B 3ZG5A 3DBAA 2G7UA 4U0TA 1SDNA 4A5RA 4LRZE 3QP6A 5FAQA 3UPNA 4OPRA 2J3TD 4QU3A 4OP5A 2EXBA 3FC7A 3G4PA 3QP5A 3P98A 4G3KA 2VLGA 4RQ9A 4RX3A 4R1GA 3OLOA 4XUZA 1K38A 1UWNX 3IBRA 4EEUA 1JTDA 2IWDA 3KYZA 1CK3A 5L10A 3UMEA 4BD1A 4DE3A 2V0WA 3HUOA 4BD0A 4NETA 3T50A 3ZCZA 3A3EA 2XSSA 4Y5FA 4I3JA 5E43A 3EOIA 4JLFA 2H10A 2EFUA 2PAVP 1TD5A 5HPIA 4KQRA 1K6SA 2KLIA 3MJQA 3L7HA 4P6ZM 1ZG6A 3NOTC 4GOGA 4KUOA 1V9YA 2ZM0A 5CGXA 3LI8A 3IF5A 5GHXA 4HBTA 4R6LA 3V50A 1FCMA 1YLWA 2XRNA 1SZVA 5DTKA 1OPXA 4WZ4A 2VJWA 4OVDA 4CLCD 2PHYA 2VEAA 1S0WA 4FH4A 2V2FF 1VETA 5TFQA 4H6JB 4X1LA 4PM9A 3EEAA 3EQVA 4C6YA 1E25A 5CTMA 1MKIA 3FKWA 5A91A 4FOFA 2WADA 2FFYA 3V3RA 3NOUC 3MXRA 1BZAA 4IUKA 4NG2A 2PBDP 5F69A 4Y0OA 1LL8A 1S6RA 4X69A 2B95A 5J7EA 4KQDA 5DKKA 2WZZA 1W8QA 1PW8A 1Y28A 3E0YA 1UGUA 2O99A 5L8MA 3LO7A 2XGNA 3ZG7B 2Z2MB 2Y2NA 1OTAA 2C5WB 5KSCA 2ZJ9A 4OLDA 2V0UA 1XP4A 3C8CA 4GNUA 4I5SA 2OSUA 3MBZA 5CHMA 3VMAA 3CHWP 1W63Q 3RXWA 3AGDA 1SKOA 1K55C 2E8JA 1W5DA 3PAGA 1UWPX 2V1ZA 5AJGA 3T1SA 2ZD8A 2ZQAA 4OLGA 1LL9A 1K56D 2QWSA 4L9GA 2B18A 4KQQA 5G4ZA 5DTTA 3W8KA 1WYBA 4JPMA 4MEZA 3MZDA 1TDLA 3QP4A 2WKQA 1IELA 5FAPA 1A0KA 2HP9A 5F5YA 3C2WA 1N9BA 3I7JA 4O0PA 4Y13A 5I5LA 5FDHA 3UN7A 1XXMA 3QHYA 5FA7A 2A24B 5EVEA 2H0YA 3SS3A 3BFEA 4Y17A 4KG2A 1L2SA 1LLBA 1K54C 3DWKA 2L1MA 5EM0A 1J9MA 3FV7A 4GHIA 3EEHA 3UDIA 2WUQA 1KE0A 3N8RA 2X01A 4ZDXA 1I2SA 3LY4A 1AXBA 3B47A 2OV5A 3F1NB 3LFVA 2ZQ9A 1I5QA 5HWVA 4WF0A 1EW0A 2VV7A 4BBVA 4OOLA 3S7PA 2IWCA 4PPRA 4R4RA 1YLZA 5FQQA 3O3VA 4KZAA 2ZC5B 4LRYC 3LYXA 1VEUA 4DJ2A 4HH2A 3FPWA 1CEGA 4JGOA 1H8MA 5HD5A 2ZM8A 2R78A 4PKYA 3BWLA 1I2WA 4Y3IA 2CC1A 1XFQA 1CEFA 1PZOA 5EOOA 5HDDA 4MN7A 1YPRA 5FQ9A 1K57C 2HPBA 3CLOA 1DJCA 4BQMA 3TRCA 1NLZA 1BYWA 5F68A 3IF6A 1H5XA 3GTCA 1HVBA 4ARZB 1XX2A 2HDRA 3IH8A 1JWPA 4N9LA 5GHYA 2Y4AA 2HDSA 3FYZA 3MQ0A 4JBFA 1CI8A 3HLEA 4LFUA 3IQAA 1T1AA 1OJ5A 3PBQA 4XXRA 1MY8A 1D06A 1OTDA 4QB8A 4S2NC 1JWVA 3MZEA 5EPHA 4OH0A 4PMAA 3D4FA 2H5SA 2Y79A 1BT5A 1T1BA 2FZ0A 1IYSA 1DP8A 4BLMA 1NZOA 1ERMA 2KX6A
chains in the Genus database with same CATH topology
2VGKA 5M19A 1BUEA 1TEMA 5JYPA 4HESA 2BG1A 4MBFA 2A49A 3GR2A 1BLCA 3BECA 2XF3A 4JXWA 5GLCA 1SHVA 3IHBA 3ZG0A 1Z6FA 1YLJA 4PM5A 5EOEA 3HUNA 4PM7A 5EECA 2ZMAA 4IVKA 1MWSA 1KE4A 2ZQDA 3IXHA 4UA6A 1XGIA 3GVBA 3VP3A 3A3FA 5KZHA 2Y59A 3VSKA 5AQ7A 5EE8A 3CZDA 4DXCA 1XA7A 1JVJA 2XH9A 1ESIA 4KG5A 2Q9NA 2BLSA 2Y2HA 4Q8IA 1PIOA 3ZHHA 4B4ZA 3HBRA 1DY6A 2PU4A 2HP5A 3IWQA 2WK0A 3VP1A 5EVIA 4JF4A 1EWZA 4C75A 3G2ZA 3Q07A 4OPYA 2QPNA 2XQZA 1FCOA 3ISGA 4KZ3A 3VSLA 1QMEA 1L0DA 4FH2A 4RVAA 4K0WA 3UO9A 1MWTA 3WS1A 4GB7A 4WM9A 3TSGA 1NXYA 2XEPA 3PBOA 4S2NA 4WBGA 3WWXA 4LCMA 1JWZA 1MXOA 5IHVA 3SS5A 2EX6A 3GMWA 3CG5A 1XPBA 5JYOA 5L2FA 4KENB 3Q7VA 4UA9A 5KMWA 3ZG8B 2G2UA 4WEJA 1FCNA 1H8ZA 5GHZA 1K4EA 3W4OA 3NIAA 1PI5A 2XLNA 3O86A 2OLUA 5HX9A 3G2YA 4N1HA 3JYIA 1ZG4A 4CPKA 3NCKA 5F1GA 1NRFA 4ZAMA 4BL3A 1K54A 4DDSA 4OKPA 4PM8A 4F94A 3DTMA 3UDFA 4KZ8A 5E2HA 3FZCA 1Q2PA 5F82A 3S1YA 4EQIA 4UAAA 3Q7VB 2E8IA 4OQ0A 3ZNYA 1M6KA 2G2WA 4DRTA 3ZNTA 4DE0A 5FI7A 3SS4A 3NY4A 3BFDA 1LI0A 3ZG5A 5CXWA 3UNWA 4U0TA 5CGSA 1SDNA 3BEBA 4HEFA 4A5RA 1U60A 5CTNA 5FAQA 1MWRA 2Y2MA 3UPNA 4OPRA 3ZFZA 3GSGA 4ZJ2A 2WGWA 4IVIA 4QU3A 4OP5A 4E3NA 2EXBA 1GA0A 3IWIA 4LCLA 3G4PA 4R4SA 3OCNA 2JC7A 1LI9A 3HLFA 3MKFA 2JCHA 3P98A 3QNBA 1NYMA 4GD6A 1ALQA 4OQIA 1W79A 4RX3A 5AQAA 4R1GA 2EFXA 2HDQA 3GV9A 4XUZA 3FWLA 1K4FA 3W4PA 1K38A 1HTZA 3BFCA 1NYYA 2B5RA 3IWOA 4EUZA 4RX2A 3G30A 4E6XA 4PM6A 5GL9A 4FSFA 1YQSA 2P74A 2WGVA 1JTDA 2IWDA 3HLDA 1CK3A 1SCWA 4BD1A 4DE3A 1LL5A 3VOZA 3BLMA 1IEMA 3PTEA 3HUOA 4P6BA 4QY5A 4R0QA 2Z2LB 4BD0A 4NETA 3NBLA 3HREA 1PWGA 3ZCZA 4KZ9A 2ZC6B 3A3EA 2EX2A 4DF6A 4B88A 1NZUA 5E43A 2R9XA 4JLFA 4E3KA 2H10A 3PBSA 3WS2A 2EFUA 1ES2A 1GA9A 4QD4A 4KQRA 1K6SA 1CI9A 2HP6A 3QNCA 5A90A 3HLWA 4OOYA 4E3JA 1ZG6A 1ZKJA 1FOFA 4WZ5A 4U3TA 1K57A 4GOGA 4KZ7A 4XUXA 5J8XA 2ZM0A 4S2MA 4E3OA 5EVID 1ONHA 1PWCA 5CGXA 4BL2A 2Y2QA 3IF5A 3SOIA 5GHXA 5M1AA 4HBTA 3V50A 1FCMA 4GZBA 3E2LA 2EX9A 4M3KA 1ES4A 1YLWA 3N8LA 3N8SA 4N9KA 4QY6A 3RJUA 5DTKA 3WRTA 1K56A 5GLBA 4WZ4A 4OVDA 2FFFB 2Y2IA 3VP2A 4L0LA 1BSGA 1GHMA 2EXAA 1BLHA 3G34A 1OMEA 1S0WA 4GN2A 4FH4A 3C5AA 3CJMA 3OPPA 2Y91A 2V2FF 5TFQA 1E3UA 1PZPA 3VP4A 3PBRA 3FKVA 4PM9A 2A3UA 3C4PA 3IXGA 4X55A 4X6TA 3UE3A 3EQVA 4C6YA 2Y2PA 1KGGA 4S2OA 5TGFA 1E25A 5CTMA 1K25A 2IWBA 1MKIA 4MBHA 4DKIA 3BFGA 3FKWA 3IH9A 5A91A 2WADA 5F83A 2FFYA 3V3RA 2XD1A 3G31A 5FSRA 2DRWA 5HFOA 3N4IA 3N7WA 4KQOA 3MXRA 2Y2GA 1FR6A 4K0XA 1BZAA 5CHUA 2WKHA 2J8YA 3TG9A 4HBUA 4ZTKA 3PBTA 3OPLA 4GD8A 5FQIA 5CEDA 2R9WA 2ZQCA 1YLTA 3OC2A 5CERA 5FQJA 4UHUA 1YLPA 3BRMA 5FQKA 3WS5A 5HL1A 4Y0OA 3MXSA 1S6RA 2QMIA 1K6RA 4X69A 1YMXA 4LV1A 4OONA 5HAPA 5M18A 5TR7A 4E6WA 2WAEA 5FI6A 5DVAA 2ZC3B 4LV3A 3BYDA 3HLGA 4GDNA 4WYYA 1RP5A 3UPOA 4YINA 3AGFA 4C3QA 1ES3A 2WZZA 1W8QA 4E3LA 1PW8A 4K91A 1WE4A 2Y2OA 5I94A 3WRZA 2XR0A 3NC8A 4S2PA 2I72A 1DJBA 3LO7A 2XGNA 1MPLA 1YLYA 3OPRA 3ZG7B 1E4DA 1ESUA 3GQZA 1GHPA 3IT9A 2Z2MB 4KG6A 2Y2NA 4D2OA 2XD5A 3DW0A 4P0MA 2C5WB 5KSCA 5KSHA 2J9OA 2ZJ9A 4DDYA 4OLDA 3ZG9B 4Y0UA 1XP4A 3Q81A 4EWFA 5HW3A 4GNUA 1PW1A 2OSUA 3MBZA 5CHMA 3VMAA 3B3XA 3SH9A 1ES5A 4FD8A 5FQMA 1FR1A 2JE5A 1IYPA 1YMSA 4MBKA 1GHIA 3LEZA 4OQGA 5G18A 1MBLA 3AGDA 3RXWA 3UPPA 1K55C 3ZGAB 1XA1A 1EROA 3UDXA 1KGEA 1W5DA 3PAGA 3C7UA 2ZQ7A 3M2JA 5AQBA 2V1ZA 4LV0A 3WS4A 3NI9A 3PBNA 5HAIA 2ZD8A 4DXBA 2ZQAA 1RCJA 4OLGA 4DE1A 3MZFA 4YFMA 1LL9A 5CEBA 1K56D 3HLBA 4S2KA 4NK3A 1KDWA 1L0FA 3VFHA 2PBYA 3A3DA 3HLCA 4GKUA 4KQQA 5DTTA 1GCEA 1E3UD 1RGYA 3BM6A 5A93A 3W8KA 1WYBA 4JPMA 4X53A 1G68A 2DNSA 2RL3A 4MEZA 2WZXA 3ZVTA 1ZC2A 2EX8A 2XFSA 3MZDA 4KZ5A 3GRJA 5GLDA 1TDLA 4ID4A 4X68A 5DTSA 1ONGA 1PWDA 4JXVA 1IELA 3G35A 2X71A 1RGZA 5E2FA 3VP0A 4P85A 5FAPA 4OPZA 1XGJA 2HP9A 5CGWA 1L0GA 3HVFA 3Q7ZA 1N9BA 3I7JA 4Z9QA 5FDHA 1ERQA 1NY0A 3A3IA 2Y2LA 3UN7A 1XXMA 3QHYA 4EBPA 3LCEA 5AQ9A 1IYOA 5FA7A 2WKIA 4OPQA 3HUMA 4N92A 1G6AA 4CJNA 4R3BA 1VM1A 2H0YA 3SH8A 3SS3A 5CHJA 3BFEA 1KGFA 4WELA 2P9VB 1K55A 4KG2A 1FSYA 1L2SA 1LLBA 1K54C 3DWKA 2XK1A 1IKIA 1FQGA 3EQUA 1J9MA 3FV7A 3ITAA 2WAFA 4U0XA 5F1FA 4OQHA 2V20A 3TOIA 1W7FA 4ZJ3A 2WUQA 3S4XA 3UDIA 1KE0A 5DF7A 1M40A 3N8RA 2X01A 4ZDXA 5HARA 4ZJ1A 1QMFA 1I2SA 3BLSA 3LY4A 4O7DA 3C7VA 1AXBA 3NDGA 2OV5A 4QHCA 1EI5A 4MNRA 3ZDJA 5EUAA 5FI2A 5BOHA 3A3JA 2PU2A 4JKTA 2ZQ9A 1I5QA 4WMCA 1LHYA 2X02A 3ZVWA 4X56A 4E3MA 4QJGA 1Q2QA 4EBNA 4OOLA 3IF6C 4IBRA 3M6HA 2IWCA 1MWUA 4KZ6A 4S2IA 1C3BA 4KZBA 3AGEA 5CRFA 4PPRA 5DF9A 4R4RA 3IXDA 5U47A 2ZM2A 1YLZA 5FQQA 1O07A 3O3VA 1DJAA 2OLVA 4KZAA 4E3IA 2XDMA 2ZC5B 1JTGA 3ITBA 1KDSA 1YM1A 2WYXA 1CEGA 3CMZA 1KVLA 2ZM8A 4H8RA 1PYYA 5EVIB 3HL9A 3G32A 1VQQA 4RA7A 5EVLA 4JF5A 3O88A 1H8YA 3OZHA 3V3SA 4BJPA 1KVMA 3MFDA 5D3OA 2ZLYA 1I2WA 2QZ6A 4JXGA 4N1XA 4OOMA 4S2LA 3WS0A 3RXXA 3SH7A 2Y2JA 2CC1A 5DF8A 3P09A 3UY6A 1CEFA 1PZOA 3LY3A 4JXSA 5EOOA 4RYEA 3UE0A 1IYQA 1L0EA 3Q1FA 2UWXA 3V5MA 4WZ5C 1SDEA 1K57C 2HPBA 5FQ9A 3M6BA 4FCFA 1DJCA 5FASA 2J9PA 1PI4A 1TDGA 5CECA 4BQMA 4BENA 2DCFA 2JBFA 3C4OA 5A92A 2HDUA 2Y55A 4R23A 4IBXA 4UA7A 4LV2A 5GLAA 4KZ4A 3W4QA 3N6IA 4MLLA 2RCXA 3IXBA 3V39A 3IF6A 1H5XA 4Y7PA 3GTCA 1HVBA 4EBLA 1XX2A 2HDRA 4P87A 3IH8A 4OP8A 1JWPA 3OPHA 3DWZA 3VOYA 1NJ4A 4N9LA 5GHYA 2XFTA 2Y2KA 2Y4AA 3Q82A 1IKGA 2HDSA 3MKEA 3OCLA 4GDBA 3FYZA 4JBFA 1CI8A 2GDNA 4IEDA 4DE2A 2WGWB 3HLEA 5E2EA 1O7EA 3IQAA 2VGJA 4WEKA 1KE3A 5EVIC 3O87A 4LENA 4ZBEA 1BTLA 3IF6B 5FAOA 2ZC7A 3S22A 1SKFA 2P9VA 4S2JA 1XKZA 1YT4A 3PBQA 4XXRA 1MY8A 1Y54A 2C6WB 5E2GA 1BLSA 3E2KA 5FATA 4QB8A 4S2NC 4R3JA 1TVFA 3M2KA 5HAQA 2ZQ8A 1JWVA 3MZEA 2J7VA 2Q9MA 3IHAA 5EPHA 4OH0A 4EV4A 1W8YA 4Y0TA 4JF6A 4PMAA 1BULA 3VFFA 1FSWA 3PAEA 3D4FA 2ZC4B 1N4OA 2H5SA 3UE1A 1BT5A 1HZOA 2WKEA 1HD8A 1IYSA 1BLPA 3NDEA 4WMCD 4BLMA 1NZOA 1WYCA 4B4XA 2WGIA 1ERMA 3BFFA 2H0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VGK A;  5M19 A;  1BUE A;  1TEM A;  5JYP A;  4HES A;  2BG1 A;  4MBF A;  2A49 A;  3GR2 A;  1BLC A;  3BEC A;  2XF3 A;  4JXW A;  5GLC A;  1SHV A;  3IHB A;  3ZG0 A;  1Z6F A;  1YLJ A;  4PM5 A;  5EOE A;  3HUN A;  4PM7 A;  5EEC A;  2ZMA A;  4IVK A;  1MWS A;  1KE4 A;  2ZQD A;  3IXH A;  4UA6 A;  1XGI A;  3GVB A;  3VP3 A;  3A3F A;  5KZH A;  2Y59 A;  3VSK A;  5AQ7 A;  5EE8 A;  3CZD A;  4DXC A;  1XA7 A;  1JVJ A;  2XH9 A;  1ESI A;  4KG5 A;  2Q9N A;  2BLS A;  2Y2H A;  4Q8I A;  1PIO A;  3ZHH A;  4B4Z A;  3HBR A;  1DY6 A;  2PU4 A;  2HP5 A;  3IWQ A;  2WK0 A;  3VP1 A;  5EVI A;  4JF4 A;  1EWZ A;  4C75 A;  3G2Z A;  3Q07 A;  4OPY A;  2QPN A;  2XQZ A;  1FCO A;  3ISG A;  4KZ3 A;  3VSL A;  1QME A;  1L0D A;  4FH2 A;  4RVA A;  4K0W A;  3UO9 A;  1MWT A;  3WS1 A;  4GB7 A;  4WM9 A;  3TSG A;  1NXY A;  2XEP A;  3PBO A;  4S2N A;  4WBG A;  3WWX A;  4LCM A;  1JWZ A;  1MXO A;  5IHV A;  3SS5 A;  2EX6 A;  3GMW A;  3CG5 A;  1XPB A;  5JYO A;  5L2F A;  4KEN B;  3Q7V A;  4UA9 A;  5KMW A;  3ZG8 B;  2G2U A;  4WEJ A;  1FCN A;  1H8Z A;  5GHZ A;  1K4E A;  3W4O A;  3NIA A;  1PI5 A;  2XLN A;  3O86 A;  2OLU A;  5HX9 A;  3G2Y A;  4N1H A;  3JYI A;  1ZG4 A;  4CPK A;  3NCK A;  5F1G A;  1NRF A;  4ZAM A;  4BL3 A;  1K54 A;  4DDS A;  4OKP A;  4PM8 A;  4F94 A;  3DTM A;  3UDF A;  4KZ8 A;  5E2H A;  3FZC A;  1Q2P A;  5F82 A;  3S1Y A;  4EQI A;  4UAA A;  3Q7V B;  2E8I A;  4OQ0 A;  3ZNY A;  1M6K A;  2G2W A;  4DRT A;  3ZNT A;  4DE0 A;  5FI7 A;  3SS4 A;  3NY4 A;  3BFD A;  1LI0 A;  3ZG5 A;  5CXW A;  3UNW A;  4U0T A;  5CGS A;  1SDN A;  3BEB A;  4HEF A;  4A5R A;  1U60 A;  5CTN A;  5FAQ A;  1MWR A;  2Y2M A;  3UPN A;  4OPR A;  3ZFZ A;  3GSG A;  4ZJ2 A;  2WGW A;  4IVI A;  4QU3 A;  4OP5 A;  4E3N A;  2EXB A;  1GA0 A;  3IWI A;  4LCL A;  3G4P A;  4R4S A;  3OCN A;  2JC7 A;  1LI9 A;  3HLF A;  3MKF A;  2JCH A;  3P98 A;  3QNB A;  1NYM A;  4GD6 A;  1ALQ A;  4OQI A;  1W79 A;  4RX3 A;  5AQA A;  4R1G A;  2EFX A;  2HDQ A;  3GV9 A;  4XUZ A;  3FWL A;  1K4F A;  3W4P A;  1K38 A;  1HTZ A;  3BFC A;  1NYY A;  2B5R A;  3IWO A;  4EUZ A;  4RX2 A;  3G30 A;  4E6X A;  4PM6 A;  5GL9 A;  4FSF A;  1YQS A;  2P74 A;  2WGV A;  1JTD A;  2IWD A;  3HLD A;  1CK3 A;  1SCW A;  4BD1 A;  4DE3 A;  1LL5 A;  3VOZ A;  3BLM A;  1IEM A;  3PTE A;  3HUO A;  4P6B A;  4QY5 A;  4R0Q A;  2Z2L B;  4BD0 A;  4NET A;  3NBL A;  3HRE A;  1PWG A;  3ZCZ A;  4KZ9 A;  2ZC6 B;  3A3E A;  2EX2 A;  4DF6 A;  4B88 A;  1NZU A;  5E43 A;  2R9X A;  4JLF A;  4E3K A;  2H10 A;  3PBS A;  3WS2 A;  2EFU A;  1ES2 A;  1GA9 A;  4QD4 A;  4KQR A;  1K6S A;  1CI9 A;  2HP6 A;  3QNC A;  5A90 A;  3HLW A;  4OOY A;  4E3J A;  1ZG6 A;  1ZKJ A;  1FOF A;  4WZ5 A;  4U3T A;  1K57 A;  4GOG A;  4KZ7 A;  4XUX A;  5J8X A;  2ZM0 A;  4S2M A;  4E3O A;  5EVI D;  1ONH A;  1PWC A;  5CGX A;  4BL2 A;  2Y2Q A;  3IF5 A;  3SOI A;  5GHX A;  5M1A A;  4HBT A;  3V50 A;  1FCM A;  4GZB A;  3E2L A;  2EX9 A;  4M3K A;  1ES4 A;  1YLW A;  3N8L A;  3N8S A;  4N9K A;  4QY6 A;  3RJU A;  5DTK A;  3WRT A;  1K56 A;  5GLB A;  4WZ4 A;  4OVD A;  2FFF B;  2Y2I A;  3VP2 A;  4L0L A;  1BSG A;  1GHM A;  2EXA A;  1BLH A;  3G34 A;  1OME A;  1S0W A;  4GN2 A;  4FH4 A;  3C5A A;  3CJM A;  3OPP A;  2Y91 A;  2V2F F;  5TFQ A;  1E3U A;  1PZP A;  3VP4 A;  3PBR A;  3FKV A;  4PM9 A;  2A3U A;  3C4P A;  3IXG A;  4X55 A;  4X6T A;  3UE3 A;  3EQV A;  4C6Y A;  2Y2P A;  1KGG A;  4S2O A;  5TGF A;  1E25 A;  5CTM A;  1K25 A;  2IWB A;  1MKI A;  4MBH A;  4DKI A;  3BFG A;  3FKW A;  3IH9 A;  5A91 A;  2WAD A;  5F83 A;  2FFY A;  3V3R A;  2XD1 A;  3G31 A;  5FSR A;  2DRW A;  5HFO A;  3N4I A;  3N7W A;  4KQO A;  3MXR A;  2Y2G A;  1FR6 A;  4K0X A;  1BZA A;  5CHU A;  2WKH A;  2J8Y A;  3TG9 A;  4HBU A;  4ZTK A;  3PBT A;  3OPL A;  4GD8 A;  5FQI A;  5CED A;  2R9W A;  2ZQC A;  1YLT A;  3OC2 A;  5CER A;  5FQJ A;  4UHU A;  1YLP A;  3BRM A;  5FQK A;  3WS5 A;  5HL1 A;  4Y0O A;  3MXS A;  1S6R A;  2QMI A;  1K6R A;  4X69 A;  1YMX A;  4LV1 A;  4OON A;  5HAP A;  5M18 A;  5TR7 A;  4E6W A;  2WAE A;  5FI6 A;  5DVA A;  2ZC3 B;  4LV3 A;  3BYD A;  3HLG A;  4GDN A;  4WYY A;  1RP5 A;  3UPO A;  4YIN A;  3AGF A;  4C3Q A;  1ES3 A;  2WZZ A;  1W8Q A;  4E3L A;  1PW8 A;  4K91 A;  1WE4 A;  2Y2O A;  5I94 A;  3WRZ A;  2XR0 A;  3NC8 A;  4S2P A;  2I72 A;  1DJB A;  3LO7 A;  2XGN A;  1MPL A;  1YLY A;  3OPR A;  3ZG7 B;  1E4D A;  1ESU A;  3GQZ A;  1GHP A;  3IT9 A;  2Z2M B;  4KG6 A;  2Y2N A;  4D2O A;  2XD5 A;  3DW0 A;  4P0M A;  2C5W B;  5KSC A;  5KSH A;  2J9O A;  2ZJ9 A;  4DDY A;  4OLD A;  3ZG9 B;  4Y0U A;  1XP4 A;  3Q81 A;  4EWF A;  5HW3 A;  4GNU A;  1PW1 A;  2OSU A;  3MBZ A;  5CHM A;  3VMA A;  3B3X A;  3SH9 A;  1ES5 A;  4FD8 A;  5FQM A;  1FR1 A;  2JE5 A;  1IYP A;  1YMS A;  4MBK A;  1GHI A;  3LEZ A;  4OQG A;  5G18 A;  1MBL A;  3AGD A;  3RXW A;  3UPP A;  1K55 C;  3ZGA B;  1XA1 A;  1ERO A;  3UDX A;  1KGE A;  1W5D A;  3PAG A;  3C7U A;  2ZQ7 A;  3M2J A;  5AQB A;  2V1Z A;  4LV0 A;  3WS4 A;  3NI9 A;  3PBN A;  5HAI A;  2ZD8 A;  4DXB A;  2ZQA A;  1RCJ A;  4OLG A;  4DE1 A;  3MZF A;  4YFM A;  1LL9 A;  5CEB A;  1K56 D;  3HLB A;  4S2K A;  4NK3 A;  1KDW A;  1L0F A;  3VFH A;  2PBY A;  3A3D A;  3HLC A;  4GKU A;  4KQQ A;  5DTT A;  1GCE A;  1E3U D;  1RGY A;  3BM6 A;  5A93 A;  3W8K A;  1WYB A;  4JPM A;  4X53 A;  1G68 A;  2DNS A;  2RL3 A;  4MEZ A;  2WZX A;  3ZVT A;  1ZC2 A;  2EX8 A;  2XFS A;  3MZD A;  4KZ5 A;  3GRJ A;  5GLD A;  1TDL A;  4ID4 A;  4X68 A;  5DTS A;  1ONG A;  1PWD A;  4JXV A;  1IEL A;  3G35 A;  2X71 A;  1RGZ A;  5E2F A;  3VP0 A;  4P85 A;  5FAP A;  4OPZ A;  1XGJ A;  2HP9 A;  5CGW A;  1L0G A;  3HVF A;  3Q7Z A;  1N9B A;  3I7J A;  4Z9Q A;  5FDH A;  1ERQ A;  1NY0 A;  3A3I A;  2Y2L A;  3UN7 A;  1XXM A;  3QHY A;  4EBP A;  3LCE A;  5AQ9 A;  1IYO A;  5FA7 A;  2WKI A;  4OPQ A;  3HUM A;  4N92 A;  1G6A A;  4CJN A;  4R3B A;  1VM1 A;  2H0Y A;  3SH8 A;  3SS3 A;  5CHJ A;  3BFE A;  1KGF A;  4WEL A;  2P9V B;  1K55 A;  4KG2 A;  1FSY A;  1L2S A;  1LLB A;  1K54 C;  3DWK A;  2XK1 A;  1IKI A;  1FQG A;  3EQU A;  1J9M A;  3FV7 A;  3ITA A;  2WAF A;  4U0X A;  5F1F A;  4OQH A;  2V20 A;  3TOI A;  1W7F A;  4ZJ3 A;  2WUQ A;  3S4X A;  3UDI A;  1KE0 A;  5DF7 A;  1M40 A;  3N8R A;  2X01 A;  4ZDX A;  5HAR A;  4ZJ1 A;  1QMF A;  1I2S A;  3BLS A;  3LY4 A;  4O7D A;  3C7V A;  1AXB A;  3NDG A;  2OV5 A;  4QHC A;  1EI5 A;  4MNR A;  3ZDJ A;  5EUA A;  5FI2 A;  5BOH A;  3A3J A;  2PU2 A;  4JKT A;  2ZQ9 A;  1I5Q A;  4WMC A;  1LHY A;  2X02 A;  3ZVW A;  4X56 A;  4E3M A;  4QJG A;  1Q2Q A;  4EBN A;  4OOL A;  3IF6 C;  4IBR A;  3M6H A;  2IWC A;  1MWU A;  4KZ6 A;  4S2I A;  1C3B A;  4KZB A;  3AGE A;  5CRF A;  4PPR A;  5DF9 A;  4R4R A;  3IXD A;  5U47 A;  2ZM2 A;  1YLZ A;  5FQQ A;  1O07 A;  3O3V A;  1DJA A;  2OLV A;  4KZA A;  4E3I A;  2XDM A;  2ZC5 B;  1JTG A;  3ITB A;  1KDS A;  1YM1 A;  2WYX A;  1CEG A;  3CMZ A;  1KVL A;  2ZM8 A;  4H8R A;  1PYY A;  5EVI B;  3HL9 A;  3G32 A;  1VQQ A;  4RA7 A;  5EVL A;  4JF5 A;  3O88 A;  1H8Y A;  3OZH A;  3V3S A;  4BJP A;  1KVM A;  3MFD A;  5D3O A;  2ZLY A;  1I2W A;  2QZ6 A;  4JXG A;  4N1X A;  4OOM A;  4S2L A;  3WS0 A;  3RXX A;  3SH7 A;  2Y2J A;  2CC1 A;  5DF8 A;  3P09 A;  3UY6 A;  1CEF A;  1PZO A;  3LY3 A;  4JXS A;  5EOO A;  4RYE A;  3UE0 A;  1IYQ A;  1L0E A;  3Q1F A;  2UWX A;  3V5M A;  4WZ5 C;  1SDE A;  1K57 C;  2HPB A;  5FQ9 A;  3M6B A;  4FCF A;  1DJC A;  5FAS A;  2J9P A;  1PI4 A;  1TDG A;  5CEC A;  4BQM A;  4BEN A;  2DCF A;  2JBF A;  3C4O A;  5A92 A;  2HDU A;  2Y55 A;  4R23 A;  4IBX A;  4UA7 A;  4LV2 A;  5GLA A;  4KZ4 A;  3W4Q A;  3N6I A;  4MLL A;  2RCX A;  3IXB A;  3V39 A;  3IF6 A;  1H5X A;  4Y7P A;  3GTC A;  1HVB A;  4EBL A;  1XX2 A;  2HDR A;  4P87 A;  3IH8 A;  4OP8 A;  1JWP A;  3OPH A;  3DWZ A;  3VOY A;  1NJ4 A;  4N9L A;  5GHY A;  2XFT A;  2Y2K A;  2Y4A A;  3Q82 A;  1IKG A;  2HDS A;  3MKE A;  3OCL A;  4GDB A;  3FYZ A;  4JBF A;  1CI8 A;  2GDN A;  4IED A;  4DE2 A;  2WGW B;  3HLE A;  5E2E A;  1O7E A;  3IQA A;  2VGJ A;  4WEK A;  1KE3 A;  5EVI C;  3O87 A;  4LEN A;  4ZBE A;  1BTL A;  3IF6 B;  5FAO A;  2ZC7 A;  3S22 A;  1SKF A;  2P9V A;  4S2J A;  1XKZ A;  1YT4 A;  3PBQ A;  4XXR A;  1MY8 A;  1Y54 A;  2C6W B;  5E2G A;  1BLS A;  3E2K A;  5FAT A;  4QB8 A;  4S2N C;  4R3J A;  1TVF A;  3M2K A;  5HAQ A;  2ZQ8 A;  1JWV A;  3MZE A;  2J7V A;  2Q9M A;  3IHA A;  5EPH A;  4OH0 A;  4EV4 A;  1W8Y A;  4Y0T A;  4JF6 A;  4PMA A;  1BUL A;  3VFF A;  1FSW A;  3PAE A;  3D4F A;  2ZC4 B;  1N4O A;  2H5S A;  3UE1 A;  1BT5 A;  1HZO A;  2WKE A;  1HD8 A;  1IYS A;  1BLP A;  3NDE A;  4WMC D;  4BLM A;  1NZO A;  1WYC A;  4B4X A;  2WGI A;  1ERM A;  3BFF A;  2H0T A; 
#chains in the Genus database with same CATH topology
 1X0O A;  2Z6D A;  1BUE A;  4FUW A;  2A49 A;  5GLC A;  4JXW A;  1SHV A;  3TJZ C;  4Q0I A;  2M1C A;  4IVK A;  2K2N A;  2ZQD A;  3A0V A;  4O01 A;  3EWK A;  1XJ2 A;  2Y2H A;  2HV1 A;  2K7S A;  2PU4 A;  3IWQ A;  4HP4 A;  4JF4 A;  1EWZ A;  5HPF A;  4C75 A;  4K08 A;  4OPY A;  4FTX A;  4LLO B;  1L0D A;  4RVA A;  3UO9 A;  1VET B;  3WS1 A;  4GB7 A;  2V8C A;  4LCM A;  3SS5 A;  5HWW A;  5L2F A;  1NRJ A;  2H28 A;  4UQI S;  5GHZ A;  3W4O A;  2XLN A;  3O86 A;  2OLU A;  3NCK A;  4ZAM A;  4BL3 A;  1K54 A;  4F94 A;  5E2H A;  5F82 A;  2GZA A;  4EQI A;  3KSI A;  2W1R A;  3ZNT A;  3SS4 A;  1LI0 A;  2PYP A;  5CXW A;  5CGS A;  2W3D A;  1TS6 A;  4ZJ2 A;  4IVI A;  3LR0 A;  2OAP 1;  4LCL A;  3HLF A;  2QJ5 A;  2JCH A;  3HCY A;  4GD6 A;  2K31 A;  1HTZ A;  2B5R A;  3IWO A;  4RX2 A;  4E6X A;  4PM6 A;  2QHK A;  3HLD A;  1F98 A;  1SCW A;  3NJA A;  3MSH A;  3NBL A;  1PWG A;  2EX2 A;  1NZU A;  3T4K A;  3JPU A;  1SKO B;  1ACF A;  1ES2 A;  3HLW A;  4E3J A;  1ZKJ A;  3NHQ A;  4U3T A;  1K57 A;  4KZ7 A;  4XUX A;  4E3O A;  5EVI D;  2YKF A;  3SOI A;  4I3A A;  5CX7 A;  4GZB A;  3N8S A;  4QY6 A;  3RJU A;  1GSV A;  2V9A A;  2FFF B;  3LR3 A;  3MMH A;  3T4Q A;  1BLH A;  3G34 A;  3R4K A;  1F5M A;  1E3U A;  1PZP A;  2A3U A;  4X55 A;  2D02 A;  4Y2F A;  4MBH A;  3UE6 A;  3F1P A;  5LBR A;  3G31 A;  3MFX A;  3N7W A;  1FR6 A;  4K0X A;  5CHU A;  2WKH A;  3TG9 A;  3O5Y A;  3OPL A;  5FQI A;  5CED A;  2ZQC A;  3OC2 A;  3LEQ A;  1AWI A;  5FQJ A;  4UQI M;  5FQK A;  3WS5 A;  3MXS A;  1YMX A;  4OON A;  3F1O A;  4GHI B;  3P7N A;  5HAP A;  4DMZ A;  5K5B A;  5M18 A;  3CUE C;  5DVA A;  4LV3 A;  3BYD A;  4WYY A;  3UPO A;  4C3Q A;  2EA9 A;  1WE4 A;  2Y2O A;  1F9I A;  3KX0 X;  4BMW A;  3GQZ A;  1GHP A;  3UB6 A;  2XD5 A;  5TBM B;  4E04 A;  5KSH A;  3IS2 A;  1S4S A;  1PNE A;  1VEU B;  4BBU A;  5IU1 A;  1FIK A;  4WL9 A;  5FQM A;  5HD3 A;  1FR1 A;  2JE5 A;  1IYP A;  4MBK A;  1GHI A;  5FEF A;  3C7U A;  2W0N A;  5HAI A;  3MZF A;  4HJ6 A;  3HLB A;  3RH8 B;  4S2K A;  4NK3 A;  1KDW A;  4GLQ A;  4II7 A;  2PBY A;  3HLC A;  1RGY A;  3KO6 A;  4ESP A;  1G68 A;  2DNS A;  2WZX A;  2XFS A;  1K0K A;  1NWZ A;  2W3F A;  3GRJ A;  1ONG A;  3LUQ A;  2W1T A;  1RGZ A;  4OPZ A;  3MXQ A;  3P01 A;  5CGW A;  1L0G A;  4L9E A;  1ERQ A;  3A3I A;  1IYO A;  2XA7 S;  1TS0 A;  1YSP A;  2WKI A;  3HUM A;  4OPQ A;  2HJ9 C;  4N92 A;  5HL6 A;  4CJN A;  4R3B A;  2PT7 A;  3UB9 A;  2ZMF A;  4KUK A;  5CHJ A;  3LI9 A;  1FQG A;  3MQQ A;  3EQU A;  3ITA A;  1D1J A;  3B42 A;  3H9W A;  4PAU A;  3S4X A;  3UB8 A;  1ZHH B;  4X25 A;  4ZJ1 A;  4O8G A;  3C7V A;  5HSQ A;  3CI6 A;  3MS6 A;  4QHC A;  1EI5 A;  5EUA A;  5FI2 A;  5BOH A;  4JKT A;  4F3L A;  1LHY A;  4X56 A;  4E3M A;  4HIA A;  3IF6 C;  2J80 A;  2L0W A;  3IXD A;  5FL3 A;  1O07 A;  4E3I A;  2XDM A;  1KDS A;  1YM1 A;  1CQA A;  3CMZ A;  4HJ3 A;  4H8R A;  4ETX A;  1VQQ A;  5EVL A;  4YOF A;  2W3E A;  3OZH A;  3A0R A;  3V3S A;  4BJP A;  3MFD A;  5D3O A;  2HF6 A;  2AVX A;  2ZLY A;  2QZ6 A;  4N1X A;  1DP6 A;  4OOM A;  1LSX A;  3SH7 A;  3VE3 A;  3S7Q A;  3E4P A;  3LY3 A;  4GCZ A;  4JXS A;  3UE0 A;  4WZ5 C;  5FAS A;  4FCF A;  1TDG A;  1GSW A;  2JBF A;  3H7W A;  3C4O A;  4HNB A;  3NEC A;  2Y55 A;  3K3D A;  5GLA A;  4KZ4 A;  3IXB A;  2PR5 A;  4P87 A;  3CUE A;  3DWZ A;  3VOY A;  4WUJ A;  3IX4 A;  1MC0 A;  2KOI A;  4IED A;  5DFY A;  5E2E A;  2MJ6 A;  3DTE A;  4LEN A;  3KSH A;  4HH3 A;  5F6A A;  1G6O A;  3CAX A;  2P9V A;  3D72 A;  4HOI A;  1Y54 A;  5FAT A;  3E2K A;  1YAX A;  1OJG A;  2Q9M A;  2M7U A;  1W8Y A;  3K2N A;  4ZRR A;  4Y0T A;  2XA7 M;  3VFF A;  2ZC4 B;  2WKE A;  1LSV A;  5IT5 A;  3NDE A;  4WMC D;  1WYC A;  4B4X A;  3IX8 A;  3BFF A;  2VGK A;  1TEM A;  2BG1 A;  3GR2 A;  1BLC A;  3BEC A;  3E4O A;  4DJ3 A;  1MKM A;  3DAV A;  4PM5 A;  3HUN A;  4PM7 A;  3BQ8 A;  4HHD A;  3IXH A;  4UA6 A;  3GVB A;  3A3F A;  5AQ7 A;  1XA7 A;  4KG5 A;  1ESI A;  2Q9N A;  3ZHH A;  2O9C A;  1DY6 A;  2HP5 A;  2GJ3 A;  3VP1 A;  3LIF A;  2QYB A;  2QPN A;  1FCO A;  3HJI A;  4WBG A;  5IHV A;  2EX6 A;  3LR4 A;  3LIC A;  4GS9 A;  3KSF A;  2HZ5 A;  3F1P B;  1PI5 A;  4HQA A;  5HX9 A;  3G2Y A;  1LT0 A;  4N1H A;  4NXB A;  4DDS A;  4PM8 A;  3BW6 A;  3FZC A;  2YKH A;  4WN5 A;  4UAA A;  3Q7V B;  2GNX A;  2E8I A;  2G2W A;  4DE0 A;  5FI7 A;  1WA9 A;  3NY4 A;  4DN0 A;  3F1O B;  3BEB A;  4HEF A;  4BBT A;  5CTN A;  2WGW A;  1HLU P;  2PYR A;  4E3N A;  1GA0 A;  3OCN A;  1LI9 A;  3QNB A;  1ALQ A;  4OQI A;  4IUH A;  1P97 A;  3GDI A;  5AQA A;  2HDQ A;  3GV9 A;  1K4F A;  3QP2 A;  1NYY A;  2PRF A;  4EUZ A;  5GL9 A;  2WGV A;  1LL5 A;  3IS2 B;  3BLM A;  4P6B A;  3TE8 A;  4R0Q A;  2ZC6 B;  4DF6 A;  3T1Q B;  4B88 A;  2WKP A;  2R9X A;  3PBS A;  4PHT A;  3WS2 A;  3LIB A;  1GA9 A;  4QD4 A;  2HP6 A;  3QNC A;  5A90 A;  4M4X A;  1XJ6 A;  4WZ5 A;  3BQA A;  5J8X A;  1PWC A;  5G4Y A;  5J3W A;  2JKT M;  1P0Z A;  5M1A A;  4M3K A;  3SW1 A;  3LIE A;  3N8L A;  4N9K A;  3WRT A;  1K56 A;  2VK3 A;  1OTB A;  3VP2 A;  3R7W A;  1OME A;  3C5A A;  3OPP A;  2PDR A;  3VP4 A;  3E98 A;  4X6T A;  3C4P A;  2Y2P A;  4S2O A;  5TGF A;  5HWT A;  3BFG A;  3QP1 A;  5F83 A;  2XD1 A;  3UMD A;  5EM1 A;  5FSR A;  1ODV A;  2DRW A;  5HFO A;  4KQO A;  2Y2G A;  4R70 A;  2J8Y A;  4HBU A;  4ZTK A;  3PBT A;  2INW A;  4JGR A;  3T1R A;  2R9W A;  1YLT A;  5CER A;  3D9Y A;  4UHU A;  1YLP A;  3BRM A;  2QMI A;  4LV1 A;  4EW7 A;  4CLC E;  5TR7 A;  2WAE A;  5FI6 A;  2ZC3 B;  1KOU A;  4GDN A;  1RP5 A;  1S1Z A;  3AGF A;  3G6O A;  5AVE A;  4E3L A;  1V9Z A;  4K91 A;  2XR0 A;  2I72 A;  1DJB A;  3S7O A;  5A8B A;  1YLY A;  2WKR A;  3OPR A;  4KG6 A;  2V1A A;  3DW0 A;  2J9O A;  2W3H A;  4DDY A;  3ZG9 B;  3Q81 A;  4EWF A;  4B93 A;  5HW3 A;  5FEG A;  3SH9 A;  2JKF A;  1ES5 A;  4FD8 A;  5DJT A;  4OQG A;  1YMS A;  4GW9 A;  3LEZ A;  1MBL A;  1XA1 A;  1ERO A;  1KGE A;  5AQB A;  4LV0 A;  4QWO A;  3NI9 A;  1F2K A;  4DXB A;  1RCJ A;  2GX5 A;  4DE1 A;  5CEB A;  1D7E A;  5L07 A;  2LB5 A;  3VFH A;  4GKU A;  1GCE A;  4EES A;  3SZT A;  3ZVT A;  5L09 A;  4ID4 A;  4X68 A;  4JXV A;  4Q0H A;  3G35 A;  2X71 A;  4P85 A;  1XJ4 A;  1XGJ A;  1NY0 A;  1VHM A;  4EBP A;  3LCE A;  1H3Q A;  5AQ9 A;  3T4S A;  1NLY A;  4UEY A;  3TW8 A;  1KGF A;  2P9V B;  3VV4 A;  5HDS A;  3DTI A;  1IKI A;  3C38 A;  2WAF A;  4U0X A;  2O9B A;  5F1F A;  2V20 A;  3TOI A;  1W7F A;  3H82 A;  1M40 A;  5HAR A;  1QMF A;  4O7D A;  4G3W A;  3NDG A;  4MNR A;  2P7J A;  5J4E A;  3A3J A;  3PXP A;  2X02 A;  2ZMV A;  4QJG A;  4IBR A;  3M6H A;  5C5K A;  4KZ6 A;  1MWU A;  2JKT I;  4D60 A;  1C3B A;  4KZB A;  3AGE A;  3BY8 A;  5CRF A;  4CQH A;  5DF9 A;  2ZM2 A;  1DJA A;  2OLV A;  1JTG A;  5MC7 A;  3HL9 A;  3G32 A;  3B33 A;  3O88 A;  2J3T C;  3U4L P;  4JXG A;  4S2L A;  3RXX A;  3V67 A;  3EGX C;  4GS9 B;  2LB9 A;  3W2Z A;  1CJF A;  1IYQ A;  1L0E A;  2VZW A;  2UWX A;  3KYQ A;  3V5M A;  1N9N A;  1SDE A;  2J9P A;  2DCF A;  5KIZ A;  2HDU A;  4IBX A;  2CMN A;  2JKG A;  3C30 A;  4MLL A;  2P08 A;  4Y7P A;  5IS1 A;  4EBL A;  1T1C A;  1NJ4 A;  3GEC A;  2XFT A;  3Q82 A;  1IKG A;  3MKE A;  3D3O A;  3PHY A;  4GDB A;  4HJ4 A;  4DE2 A;  2WGW B;  1O7E A;  3MF0 A;  1KE3 A;  3O87 A;  4ZBE A;  2VA0 A;  2M7V A;  5TJJ A;  4XT2 A;  3IF6 B;  4MN5 A;  1SKF A;  4Z1W A;  2KDK A;  1XKZ A;  1Z09 A;  4EXO A;  1TVF A;  4CLC C;  3IBJ A;  5HAQ A;  3T1X A;  3RFB A;  4JF6 A;  1BUL A;  3CPT A;  1HD8 A;  1JNU A;  2NUT C;  1BLP A;  2NUP C;  2WGI A;  3T4O A;  2H0T A;  1N9L A;  5HL1 A;  5M19 A;  1ZTU A;  2L4R A;  4MBF A;  1G28 A;  1YLJ A;  3VOL A;  4I3I A;  2J3W A;  4EQ1 A;  1KE4 A;  3ULF A;  1XGI A;  4BWI A;  5KZH A;  2Y59 A;  5EE8 A;  3CZD A;  4DXC A;  4B9O A;  4GJ4 A;  4Q8I A;  2VX8 A;  4AFI A;  2WK0 A;  2VV6 A;  5EVI A;  3G2Z A;  3Q07 A;  3FG8 A;  4KZ3 A;  3ISG A;  3LIA A;  2OOL A;  3R7W B;  3RTY A;  3VSL A;  1P9R A;  1QME A;  4FH2 A;  1OT6 A;  4K0W A;  1MWT A;  4WM9 A;  3LR5 A;  2XEP A;  3JVU A;  1JWZ A;  3CG5 A;  5JYO A;  4KEN B;  1VB6 A;  5KMW A;  1P9W A;  3ZG8 B;  2G2U A;  4WEJ A;  1FCN A;  1K4E A;  3NIA A;  2EWW A;  2ZBB A;  1CF0 A;  4CPK A;  3JYI A;  1ZG4 A;  4ETZ A;  5F1G A;  1NRF A;  4OKP A;  3DTM A;  5HZH A;  3UDF A;  4KZ8 A;  1J3W A;  4EEP A;  2JHE A;  4OQ0 A;  2ZL1 A;  1M6K A;  3ZNY A;  1OTE A;  2V1B A;  2OWJ A;  3QP8 A;  3UNW A;  1U60 A;  1MWR A;  2Y2M A;  3ZFZ A;  1XFN A;  3GSG A;  3IWI A;  4YNR A;  4R4S A;  2JC7 A;  4EET B;  3MKF A;  1NYM A;  5AVF A;  4MCW A;  1W79 A;  4ME4 A;  2EFX A;  3FWL A;  3W4P A;  3NUL A;  2VGL S;  3BFC A;  3G30 A;  4FSF A;  1YQS A;  2P74 A;  3VOZ A;  1IEM A;  3PTE A;  4QY5 A;  2Z2L B;  3HRE A;  4KZ9 A;  4E3K A;  4IJG A;  3ZYT A;  1CI9 A;  2HJE A;  3K3C A;  4OOY A;  1FOF A;  4HY8 A;  4S2M A;  2Q0O A;  1ONH A;  4BL2 A;  2Y2Q A;  3A0S A;  1YSQ A;  3E2L A;  2EX9 A;  1ES4 A;  3FPV A;  3S7N A;  5GLB A;  3NOP C;  2Y2I A;  3U2A A;  4L0L A;  3KSG A;  1BSG A;  1GHM A;  2EXA A;  4JGQ A;  4GN2 A;  3CJM A;  2Y91 A;  5DKL A;  3PBR A;  3FKV A;  3IXG A;  2IA2 A;  3UE3 A;  1KGG A;  1K25 A;  2IWB A;  4DKI A;  3IH9 A;  3BY9 A;  1GSX A;  1LSW A;  5DFX A;  2W3G A;  3N4I A;  2BAS A;  4LRX C;  1OTI A;  4GD8 A;  4CLC A;  1IFQ A;  3MR0 A;  3OOV A;  1K6R A;  3BJN A;  3T4J A;  4Y15 A;  4E6W A;  3H82 B;  5TBM A;  3EGD C;  3HLG A;  2JN7 A;  4YIN A;  1ES3 A;  1S67 L;  1OT9 A;  5I94 A;  3WRZ A;  3NC8 A;  4S2P A;  1DRM A;  1MPL A;  1PRQ A;  1E4D A;  1ESU A;  3PR6 A;  2B02 A;  4LGW A;  3IT9 A;  4D2O A;  4P0M A;  2JKR M;  4Y0U A;  1PW1 A;  3B3X A;  2VGL M;  5G18 A;  3UPP A;  3ZGA B;  3UDX A;  2ZQ7 A;  3M2J A;  3WS4 A;  3PBN A;  5DJU A;  2OAQ 1;  4YFM A;  2EWV A;  1L0F A;  3A3D A;  1TF1 A;  1E3U D;  3BM6 A;  1TS8 A;  5A93 A;  4X53 A;  2RL3 A;  4R3A A;  1ZC2 A;  2EX8 A;  4KZ5 A;  5GLD A;  3IX3 A;  4H6J A;  5DTS A;  4NXG A;  1PWD A;  5E2F A;  3VP0 A;  2P04 A;  3KYE A;  3HVF A;  2Y8H A;  3Q7Z A;  2ACG A;  4X1M A;  4Z9Q A;  2Y2L A;  2XRO A;  4QPR A;  1T18 A;  1G6A A;  1VM1 A;  1W63 M;  2W1T B;  3SH8 A;  4XT2 B;  1DP9 A;  4WEL A;  2BTF P;  4EU0 A;  1K55 A;  1FSY A;  3UB5 P;  1T19 A;  2XK1 A;  2HGV A;  2O9A A;  4OQH A;  4R38 A;  4ZJ3 A;  3CPT B;  5DF7 A;  1XJ3 A;  4EER A;  3BLS A;  4Q0J A;  3ZDJ A;  2A2L A;  2PU2 A;  4WMC A;  2O0Y A;  4HI4 A;  3ZVW A;  1IOU A;  1Q2Q A;  1G5U A;  3T4L A;  4EBN A;  4S2I A;  4HP9 A;  4G3V A;  5U47 A;  3MQO A;  5EV0 A;  2Z6C A;  4JGP A;  3ITB A;  2WYX A;  4F3L B;  1KVL A;  3E4Q A;  1PYY A;  5EVI B;  4RA7 A;  2UV0 E;  4JF5 A;  1H8Y A;  2DMW A;  1KVM A;  3DTK A;  3ZQ5 A;  3WS0 A;  1Y4O A;  2QJ7 A;  2Y2J A;  4EUV A;  5DF8 A;  3P09 A;  3UY6 A;  2QKP A;  4RYE A;  4I38 A;  3Q1F A;  3M6B A;  1PI4 A;  5CEC A;  2PD7 A;  4BEN A;  5A92 A;  4R23 A;  3L9K A;  4UA7 A;  4LV2 A;  2ZOH A;  3W4Q A;  3N6I A;  3V39 A;  2RCX A;  2ZL1 B;  4OP8 A;  1S66 L;  3OPH A;  4PKY G;  2VKS A;  1STZ A;  2Y2K A;  1FIL A;  1PFL A;  3OCL A;  2GDN A;  3H7W B;  4I39 A;  4NEE D;  2A24 A;  3HJK A;  2VGJ A;  4WEK A;  5EVI C;  1BTL A;  5FAO A;  2ZC7 A;  3S22 A;  5EFW A;  4S2J A;  4MN6 A;  1YT4 A;  2C6W B;  5E2G A;  2VV8 A;  1BLS A;  2JKR I;  1S1Y A;  4R3J A;  3M2K A;  2ZQ8 A;  3IHA A;  2J7V A;  4EV4 A;  3LGO A;  3LID A;  1FSW A;  3PAE A;  3UE1 A;  1N4O A;  1HZO A;  2D01 A;  4MMN A;  2FH5 A;  1MZU A;  4P6Z S;  3VE4 A;  4NXE A;  5JYP A;  4HES A;  1YKD A;  3ICY A;  3F1N A;  2XF3 A;  3IHB A;  3ZG0 A;  1Z6F A;  5HDC A;  5FDS A;  5EOE A;  5EEC A;  2ZMA A;  1MWS A;  1H0M A;  3VP3 A;  3JVV A;  3UB7 A;  3VSK A;  3OBF A;  1JVJ A;  2XH9 A;  2BLS A;  1PIO A;  4B4Z A;  3HBR A;  4LPZ A;  2XQZ A;  4L9F A;  2PD8 A;  3PYP A;  4NKP A;  3CWF A;  3TSG A;  1NXY A;  3PBO A;  4S2N A;  3WWX A;  1MXO A;  1N9O A;  2V8F A;  2ZOI A;  3GMW A;  1XPB A;  4YWZ A;  3Q7V A;  4UA9 A;  2PR6 A;  2I9V A;  1H8Z A;  1L3L A;  3T4T A;  2W27 A;  2OWH A;  4CLC B;  4IHQ A;  1Q2P A;  3S1Y A;  4ARZ A;  3CIT A;  4WLA A;  4MDZ A;  4NXF A;  4DRT A;  1TS7 A;  3BFD A;  1S4R A;  3T12 B;  3ZG5 A;  3DBA A;  2G7U A;  4U0T A;  1SDN A;  4A5R A;  4LRZ E;  3QP6 A;  5FAQ A;  3UPN A;  4OPR A;  2J3T D;  4QU3 A;  4OP5 A;  2EXB A;  3FC7 A;  3G4P A;  3QP5 A;  3P98 A;  4G3K A;  2VLG A;  4RQ9 A;  4RX3 A;  4R1G A;  3OLO A;  4XUZ A;  1K38 A;  1UWN X;  3IBR A;  4EEU A;  1JTD A;  2IWD A;  3KYZ A;  1CK3 A;  5L10 A;  3UME A;  4BD1 A;  4DE3 A;  2V0W A;  3HUO A;  4BD0 A;  4NET A;  3T50 A;  3ZCZ A;  3A3E A;  2XSS A;  4Y5F A;  4I3J A;  5E43 A;  3EOI A;  4JLF A;  2H10 A;  2EFU A;  2PAV P;  1TD5 A;  5HPI A;  4KQR A;  1K6S A;  2KLI A;  3MJQ A;  3L7H A;  4P6Z M;  1ZG6 A;  3NOT C;  4GOG A;  4KUO A;  1V9Y A;  2ZM0 A;  5CGX A;  3LI8 A;  3IF5 A;  5GHX A;  4HBT A;  4R6L A;  3V50 A;  1FCM A;  1YLW A;  2XRN A;  1SZV A;  5DTK A;  1OPX A;  4WZ4 A;  2VJW A;  4OVD A;  4CLC D;  2PHY A;  2VEA A;  1S0W A;  4FH4 A;  2V2F F;  1VET A;  5TFQ A;  4H6J B;  4X1L A;  4PM9 A;  3EEA A;  3EQV A;  4C6Y A;  1E25 A;  5CTM A;  1MKI A;  3FKW A;  5A91 A;  4FOF A;  2WAD A;  2FFY A;  3V3R A;  3NOU C;  3MXR A;  1BZA A;  4IUK A;  4NG2 A;  2PBD P;  5F69 A;  4Y0O A;  1LL8 A;  1S6R A;  4X69 A;  2B95 A;  5J7E A;  4KQD A;  5DKK A;  2WZZ A;  1W8Q A;  1PW8 A;  1Y28 A;  3E0Y A;  1UGU A;  2O99 A;  5L8M A;  3LO7 A;  2XGN A;  3ZG7 B;  2Z2M B;  2Y2N A;  1OTA A;  2C5W B;  5KSC A;  2ZJ9 A;  4OLD A;  2V0U A;  1XP4 A;  3C8C A;  4GNU A;  4I5S A;  2OSU A;  3MBZ A;  5CHM A;  3VMA A;  3CHW P;  1W63 Q;  3RXW A;  3AGD A;  1SKO A;  1K55 C;  2E8J A;  1W5D A;  3PAG A;  1UWP X;  2V1Z A;  5AJG A;  3T1S A;  2ZD8 A;  2ZQA A;  4OLG A;  1LL9 A;  1K56 D;  2QWS A;  4L9G A;  2B18 A;  4KQQ A;  5G4Z A;  5DTT A;  3W8K A;  1WYB A;  4JPM A;  4MEZ A;  3MZD A;  1TDL A;  3QP4 A;  2WKQ A;  1IEL A;  5FAP A;  1A0K A;  2HP9 A;  5F5Y A;  3C2W A;  1N9B A;  3I7J A;  4O0P A;  4Y13 A;  5I5L A;  5FDH A;  3UN7 A;  1XXM A;  3QHY A;  5FA7 A;  2A24 B;  5EVE A;  2H0Y A;  3SS3 A;  3BFE A;  4Y17 A;  4KG2 A;  1L2S A;  1LLB A;  1K54 C;  3DWK A;  2L1M A;  5EM0 A;  1J9M A;  3FV7 A;  4GHI A;  3EEH A;  3UDI A;  2WUQ A;  1KE0 A;  3N8R A;  2X01 A;  4ZDX A;  1I2S A;  3LY4 A;  1AXB A;  3B47 A;  2OV5 A;  3F1N B;  3LFV A;  2ZQ9 A;  1I5Q A;  5HWV A;  4WF0 A;  1EW0 A;  2VV7 A;  4BBV A;  4OOL A;  3S7P A;  2IWC A;  4PPR A;  4R4R A;  1YLZ A;  5FQQ A;  3O3V A;  4KZA A;  2ZC5 B;  4LRY C;  3LYX A;  1VEU A;  4DJ2 A;  4HH2 A;  3FPW A;  1CEG A;  4JGO A;  1H8M A;  5HD5 A;  2ZM8 A;  2R78 A;  4PKY A;  3BWL A;  1I2W A;  4Y3I A;  2CC1 A;  1XFQ A;  1CEF A;  1PZO A;  5EOO A;  5HDD A;  4MN7 A;  1YPR A;  5FQ9 A;  1K57 C;  2HPB A;  3CLO A;  1DJC A;  4BQM A;  3TRC A;  1NLZ A;  1BYW A;  5F68 A;  3IF6 A;  1H5X A;  3GTC A;  1HVB A;  4ARZ B;  1XX2 A;  2HDR A;  3IH8 A;  1JWP A;  4N9L A;  5GHY A;  2Y4A A;  2HDS A;  3FYZ A;  3MQ0 A;  4JBF A;  1CI8 A;  3HLE A;  4LFU A;  3IQA A;  1T1A A;  1OJ5 A;  3PBQ A;  4XXR A;  1MY8 A;  1D06 A;  1OTD A;  4QB8 A;  4S2N C;  1JWV A;  3MZE A;  5EPH A;  4OH0 A;  4PMA A;  3D4F A;  2H5S A;  2Y79 A;  1BT5 A;  1T1B A;  2FZ0 A;  1IYS A;  1DP8 A;  4BLM A;  1NZO A;  1ERM A;  2KX6 A; 
#chains in the Genus database with same CATH homology
 2VGK A;  5M19 A;  1BUE A;  1TEM A;  5JYP A;  4HES A;  2BG1 A;  4MBF A;  2A49 A;  3GR2 A;  1BLC A;  3BEC A;  2XF3 A;  4JXW A;  5GLC A;  1SHV A;  3IHB A;  3ZG0 A;  1Z6F A;  1YLJ A;  4PM5 A;  5EOE A;  3HUN A;  4PM7 A;  5EEC A;  2ZMA A;  4IVK A;  1MWS A;  1KE4 A;  2ZQD A;  3IXH A;  4UA6 A;  1XGI A;  3GVB A;  3VP3 A;  3A3F A;  5KZH A;  2Y59 A;  3VSK A;  5AQ7 A;  5EE8 A;  3CZD A;  4DXC A;  1XA7 A;  1JVJ A;  2XH9 A;  1ESI A;  4KG5 A;  2Q9N A;  2BLS A;  2Y2H A;  4Q8I A;  1PIO A;  3ZHH A;  4B4Z A;  3HBR A;  1DY6 A;  2PU4 A;  2HP5 A;  3IWQ A;  2WK0 A;  3VP1 A;  5EVI A;  4JF4 A;  1EWZ A;  4C75 A;  3G2Z A;  3Q07 A;  4OPY A;  2QPN A;  2XQZ A;  1FCO A;  3ISG A;  4KZ3 A;  3VSL A;  1QME A;  1L0D A;  4FH2 A;  4RVA A;  4K0W A;  3UO9 A;  1MWT A;  3WS1 A;  4GB7 A;  4WM9 A;  3TSG A;  1NXY A;  2XEP A;  3PBO A;  4S2N A;  4WBG A;  3WWX A;  4LCM A;  1JWZ A;  1MXO A;  5IHV A;  3SS5 A;  2EX6 A;  3GMW A;  3CG5 A;  1XPB A;  5JYO A;  5L2F A;  4KEN B;  3Q7V A;  4UA9 A;  5KMW A;  3ZG8 B;  2G2U A;  4WEJ A;  1FCN A;  1H8Z A;  5GHZ A;  1K4E A;  3W4O A;  3NIA A;  1PI5 A;  2XLN A;  3O86 A;  2OLU A;  5HX9 A;  3G2Y A;  4N1H A;  3JYI A;  1ZG4 A;  4CPK A;  3NCK A;  5F1G A;  1NRF A;  4ZAM A;  4BL3 A;  1K54 A;  4DDS A;  4OKP A;  4PM8 A;  4F94 A;  3DTM A;  3UDF A;  4KZ8 A;  5E2H A;  3FZC A;  1Q2P A;  5F82 A;  3S1Y A;  4EQI A;  4UAA A;  3Q7V B;  2E8I A;  4OQ0 A;  3ZNY A;  1M6K A;  2G2W A;  4DRT A;  3ZNT A;  4DE0 A;  5FI7 A;  3SS4 A;  3NY4 A;  3BFD A;  1LI0 A;  3ZG5 A;  5CXW A;  3UNW A;  4U0T A;  5CGS A;  1SDN A;  3BEB A;  4HEF A;  4A5R A;  1U60 A;  5CTN A;  5FAQ A;  1MWR A;  2Y2M A;  3UPN A;  4OPR A;  3ZFZ A;  3GSG A;  4ZJ2 A;  2WGW A;  4IVI A;  4QU3 A;  4OP5 A;  4E3N A;  2EXB A;  1GA0 A;  3IWI A;  4LCL A;  3G4P A;  4R4S A;  3OCN A;  2JC7 A;  1LI9 A;  3HLF A;  3MKF A;  2JCH A;  3P98 A;  3QNB A;  1NYM A;  4GD6 A;  1ALQ A;  4OQI A;  1W79 A;  4RX3 A;  5AQA A;  4R1G A;  2EFX A;  2HDQ A;  3GV9 A;  4XUZ A;  3FWL A;  1K4F A;  3W4P A;  1K38 A;  1HTZ A;  3BFC A;  1NYY A;  2B5R A;  3IWO A;  4EUZ A;  4RX2 A;  3G30 A;  4E6X A;  4PM6 A;  5GL9 A;  4FSF A;  1YQS A;  2P74 A;  2WGV A;  1JTD A;  2IWD A;  3HLD A;  1CK3 A;  1SCW A;  4BD1 A;  4DE3 A;  1LL5 A;  3VOZ A;  3BLM A;  1IEM A;  3PTE A;  3HUO A;  4P6B A;  4QY5 A;  4R0Q A;  2Z2L B;  4BD0 A;  4NET A;  3NBL A;  3HRE A;  1PWG A;  3ZCZ A;  4KZ9 A;  2ZC6 B;  3A3E A;  2EX2 A;  4DF6 A;  4B88 A;  1NZU A;  5E43 A;  2R9X A;  4JLF A;  4E3K A;  2H10 A;  3PBS A;  3WS2 A;  2EFU A;  1ES2 A;  1GA9 A;  4QD4 A;  4KQR A;  1K6S A;  1CI9 A;  2HP6 A;  3QNC A;  5A90 A;  3HLW A;  4OOY A;  4E3J A;  1ZG6 A;  1ZKJ A;  1FOF A;  4WZ5 A;  4U3T A;  1K57 A;  4GOG A;  4KZ7 A;  4XUX A;  5J8X A;  2ZM0 A;  4S2M A;  4E3O A;  5EVI D;  1ONH A;  1PWC A;  5CGX A;  4BL2 A;  2Y2Q A;  3IF5 A;  3SOI A;  5GHX A;  5M1A A;  4HBT A;  3V50 A;  1FCM A;  4GZB A;  3E2L A;  2EX9 A;  4M3K A;  1ES4 A;  1YLW A;  3N8L A;  3N8S A;  4N9K A;  4QY6 A;  3RJU A;  5DTK A;  3WRT A;  1K56 A;  5GLB A;  4WZ4 A;  4OVD A;  2FFF B;  2Y2I A;  3VP2 A;  4L0L A;  1BSG A;  1GHM A;  2EXA A;  1BLH A;  3G34 A;  1OME A;  1S0W A;  4GN2 A;  4FH4 A;  3C5A A;  3CJM A;  3OPP A;  2Y91 A;  2V2F F;  5TFQ A;  1E3U A;  1PZP A;  3VP4 A;  3PBR A;  3FKV A;  4PM9 A;  2A3U A;  3C4P A;  3IXG A;  4X55 A;  4X6T A;  3UE3 A;  3EQV A;  4C6Y A;  2Y2P A;  1KGG A;  4S2O A;  5TGF A;  1E25 A;  5CTM A;  1K25 A;  2IWB A;  1MKI A;  4MBH A;  4DKI A;  3BFG A;  3FKW A;  3IH9 A;  5A91 A;  2WAD A;  5F83 A;  2FFY A;  3V3R A;  2XD1 A;  3G31 A;  5FSR A;  2DRW A;  5HFO A;  3N4I A;  3N7W A;  4KQO A;  3MXR A;  2Y2G A;  1FR6 A;  4K0X A;  1BZA A;  5CHU A;  2WKH A;  2J8Y A;  3TG9 A;  4HBU A;  4ZTK A;  3PBT A;  3OPL A;  4GD8 A;  5FQI A;  5CED A;  2R9W A;  2ZQC A;  1YLT A;  3OC2 A;  5CER A;  5FQJ A;  4UHU A;  1YLP A;  3BRM A;  5FQK A;  3WS5 A;  5HL1 A;  4Y0O A;  3MXS A;  1S6R A;  2QMI A;  1K6R A;  4X69 A;  1YMX A;  4LV1 A;  4OON A;  5HAP A;  5M18 A;  5TR7 A;  4E6W A;  2WAE A;  5FI6 A;  5DVA A;  2ZC3 B;  4LV3 A;  3BYD A;  3HLG A;  4GDN A;  4WYY A;  1RP5 A;  3UPO A;  4YIN A;  3AGF A;  4C3Q A;  1ES3 A;  2WZZ A;  1W8Q A;  4E3L A;  1PW8 A;  4K91 A;  1WE4 A;  2Y2O A;  5I94 A;  3WRZ A;  2XR0 A;  3NC8 A;  4S2P A;  2I72 A;  1DJB A;  3LO7 A;  2XGN A;  1MPL A;  1YLY A;  3OPR A;  3ZG7 B;  1E4D A;  1ESU A;  3GQZ A;  1GHP A;  3IT9 A;  2Z2M B;  4KG6 A;  2Y2N A;  4D2O A;  2XD5 A;  3DW0 A;  4P0M A;  2C5W B;  5KSC A;  5KSH A;  2J9O A;  2ZJ9 A;  4DDY A;  4OLD A;  3ZG9 B;  4Y0U A;  1XP4 A;  3Q81 A;  4EWF A;  5HW3 A;  4GNU A;  1PW1 A;  2OSU A;  3MBZ A;  5CHM A;  3VMA A;  3B3X A;  3SH9 A;  1ES5 A;  4FD8 A;  5FQM A;  1FR1 A;  2JE5 A;  1IYP A;  1YMS A;  4MBK A;  1GHI A;  3LEZ A;  4OQG A;  5G18 A;  1MBL A;  3AGD A;  3RXW A;  3UPP A;  1K55 C;  3ZGA B;  1XA1 A;  1ERO A;  3UDX A;  1KGE A;  1W5D A;  3PAG A;  3C7U A;  2ZQ7 A;  3M2J A;  5AQB A;  2V1Z A;  4LV0 A;  3WS4 A;  3NI9 A;  3PBN A;  5HAI A;  2ZD8 A;  4DXB A;  2ZQA A;  1RCJ A;  4OLG A;  4DE1 A;  3MZF A;  4YFM A;  1LL9 A;  5CEB A;  1K56 D;  3HLB A;  4S2K A;  4NK3 A;  1KDW A;  1L0F A;  3VFH A;  2PBY A;  3A3D A;  3HLC A;  4GKU A;  4KQQ A;  5DTT A;  1GCE A;  1E3U D;  1RGY A;  3BM6 A;  5A93 A;  3W8K A;  1WYB A;  4JPM A;  4X53 A;  1G68 A;  2DNS A;  2RL3 A;  4MEZ A;  2WZX A;  3ZVT A;  1ZC2 A;  2EX8 A;  2XFS A;  3MZD A;  4KZ5 A;  3GRJ A;  5GLD A;  1TDL A;  4ID4 A;  4X68 A;  5DTS A;  1ONG A;  1PWD A;  4JXV A;  1IEL A;  3G35 A;  2X71 A;  1RGZ A;  5E2F A;  3VP0 A;  4P85 A;  5FAP A;  4OPZ A;  1XGJ A;  2HP9 A;  5CGW A;  1L0G A;  3HVF A;  3Q7Z A;  1N9B A;  3I7J A;  4Z9Q A;  5FDH A;  1ERQ A;  1NY0 A;  3A3I A;  2Y2L A;  3UN7 A;  1XXM A;  3QHY A;  4EBP A;  3LCE A;  5AQ9 A;  1IYO A;  5FA7 A;  2WKI A;  4OPQ A;  3HUM A;  4N92 A;  1G6A A;  4CJN A;  4R3B A;  1VM1 A;  2H0Y A;  3SH8 A;  3SS3 A;  5CHJ A;  3BFE A;  1KGF A;  4WEL A;  2P9V B;  1K55 A;  4KG2 A;  1FSY A;  1L2S A;  1LLB A;  1K54 C;  3DWK A;  2XK1 A;  1IKI A;  1FQG A;  3EQU A;  1J9M A;  3FV7 A;  3ITA A;  2WAF A;  4U0X A;  5F1F A;  4OQH A;  2V20 A;  3TOI A;  1W7F A;  4ZJ3 A;  2WUQ A;  3S4X A;  3UDI A;  1KE0 A;  5DF7 A;  1M40 A;  3N8R A;  2X01 A;  4ZDX A;  5HAR A;  4ZJ1 A;  1QMF A;  1I2S A;  3BLS A;  3LY4 A;  4O7D A;  3C7V A;  1AXB A;  3NDG A;  2OV5 A;  4QHC A;  1EI5 A;  4MNR A;  3ZDJ A;  5EUA A;  5FI2 A;  5BOH A;  3A3J A;  2PU2 A;  4JKT A;  2ZQ9 A;  1I5Q A;  4WMC A;  1LHY A;  2X02 A;  3ZVW A;  4X56 A;  4E3M A;  4QJG A;  1Q2Q A;  4EBN A;  4OOL A;  3IF6 C;  4IBR A;  3M6H A;  2IWC A;  1MWU A;  4KZ6 A;  4S2I A;  1C3B A;  4KZB A;  3AGE A;  5CRF A;  4PPR A;  5DF9 A;  4R4R A;  3IXD A;  5U47 A;  2ZM2 A;  1YLZ A;  5FQQ A;  1O07 A;  3O3V A;  1DJA A;  2OLV A;  4KZA A;  4E3I A;  2XDM A;  2ZC5 B;  1JTG A;  3ITB A;  1KDS A;  1YM1 A;  2WYX A;  1CEG A;  3CMZ A;  1KVL A;  2ZM8 A;  4H8R A;  1PYY A;  5EVI B;  3HL9 A;  3G32 A;  1VQQ A;  4RA7 A;  5EVL A;  4JF5 A;  3O88 A;  1H8Y A;  3OZH A;  3V3S A;  4BJP A;  1KVM A;  3MFD A;  5D3O A;  2ZLY A;  1I2W A;  2QZ6 A;  4JXG A;  4N1X A;  4OOM A;  4S2L A;  3WS0 A;  3RXX A;  3SH7 A;  2Y2J A;  2CC1 A;  5DF8 A;  3P09 A;  3UY6 A;  1CEF A;  1PZO A;  3LY3 A;  4JXS A;  5EOO A;  4RYE A;  3UE0 A;  1IYQ A;  1L0E A;  3Q1F A;  2UWX A;  3V5M A;  4WZ5 C;  1SDE A;  1K57 C;  2HPB A;  5FQ9 A;  3M6B A;  4FCF A;  1DJC A;  5FAS A;  2J9P A;  1PI4 A;  1TDG A;  5CEC A;  4BQM A;  4BEN A;  2DCF A;  2JBF A;  3C4O A;  5A92 A;  2HDU A;  2Y55 A;  4R23 A;  4IBX A;  4UA7 A;  4LV2 A;  5GLA A;  4KZ4 A;  3W4Q A;  3N6I A;  4MLL A;  2RCX A;  3IXB A;  3V39 A;  3IF6 A;  1H5X A;  4Y7P A;  3GTC A;  1HVB A;  4EBL A;  1XX2 A;  2HDR A;  4P87 A;  3IH8 A;  4OP8 A;  1JWP A;  3OPH A;  3DWZ A;  3VOY A;  1NJ4 A;  4N9L A;  5GHY A;  2XFT A;  2Y2K A;  2Y4A A;  3Q82 A;  1IKG A;  2HDS A;  3MKE A;  3OCL A;  4GDB A;  3FYZ A;  4JBF A;  1CI8 A;  2GDN A;  4IED A;  4DE2 A;  2WGW B;  3HLE A;  5E2E A;  1O7E A;  3IQA A;  2VGJ A;  4WEK A;  1KE3 A;  5EVI C;  3O87 A;  4LEN A;  4ZBE A;  1BTL A;  3IF6 B;  5FAO A;  2ZC7 A;  3S22 A;  1SKF A;  2P9V A;  4S2J A;  1XKZ A;  1YT4 A;  3PBQ A;  4XXR A;  1MY8 A;  1Y54 A;  2C6W B;  5E2G A;  1BLS A;  3E2K A;  5FAT A;  4QB8 A;  4S2N C;  4R3J A;  1TVF A;  3M2K A;  5HAQ A;  2ZQ8 A;  1JWV A;  3MZE A;  2J7V A;  2Q9M A;  3IHA A;  5EPH A;  4OH0 A;  4EV4 A;  1W8Y A;  4Y0T A;  4JF6 A;  4PMA A;  1BUL A;  3VFF A;  1FSW A;  3PAE A;  3D4F A;  2ZC4 B;  1N4O A;  2H5S A;  3UE1 A;  1BT5 A;  1HZO A;  2WKE A;  1HD8 A;  1IYS A;  1BLP A;  3NDE A;  4WMC D;  4BLM A;  1NZO A;  1WYC A;  4B4X A;  2WGI A;  1ERM A;  3BFF A;  2H0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...