3A3JA

Crystal structures of penicillin binding protein 5 from haemophilus influenzae
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
344
structure length
344
Chain Sequence
GVTPPQITAQTYVLMDYNSGAILTALNPDQRQYPASLTKMMTSYVVGVALKQGKIHNTDMVTIGESAWGRNFPDSSKMFLDLNTQVSVADLNRGVIVVSGNDATVALAEHISGNVPNFVETMNKYVQQFGLKNTNFTTPHGLDDPNQYSSARDMAIIGAHIIRDLPEEYKIYSEKDFTFNKIKQPNRNGLLWDKTINVDGMKTGHTSQAGYNLVASATTSNNMRLISVVMGVPTYKGREVESKKLLQWGFANFETFKTLEAGKEISEQRVYYGDKNSVKLGAFMDHFITIPKGKQSEVKARYELADKNLQAPLAKGQVIGKVVYALDGKDIASANLQVMNDVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PBP5
publication title Crystal structures of penicillin-binding proteins 4 and 5 from Haemophilus influenzae
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
total genus 106
structure length 344
sequence length 344
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2009-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07943 PBP5_C Penicillin-binding protein 5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.410.10 Mainly Beta Sandwich Peptidoglycan synthesis regulatory factor (PBP3), Domain 2 D-Ala-D-Ala carboxypeptidase, C-terminal domain 3a3jA02
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3a3jA01
3GR2A 4WMCD 3TG9A 2WZXA 1S0WA 3UE0A 1TEMA 3S4XA 3IWIA 2Y2OA 3UE3A 1QMEA 3O86A 4OQ0A 3BLMA 2P9VA 4RX3A 1PWDA 2HP9A 1IYOA 3IHAA 4K91A 1CEFA 4CJNA 1CI9A 3WS2A 4LCMA 1AXBA 1LI0A 2ZM2A 1SKFA 1TDGA 4QHCA 2ZD8A 3IHBA 2EX6A 1K57A 1YMXA 2HDRA 4GDNA 5EVIB 4FSFA 3Q7VA 2WGWA 3Q7ZA 3QHYA 1KE0A 4C75A 1I2WA 5BOHA 4PM7A 4EBNA 3LY4A 1MY8A 4E3OA 5KSCA 1Q2QA 3MFDA 2ZQAA 2E8IA 3IXBA 4OPZA 4WZ4A 4DKIA 1LHYA 2Q9NA 3W8KA 2XD1A 4OVDA 4S2OA 4OQIA 1NZUA 1W7FA 1H8YA 1QMFA 1WE4A 1IELA 3G34A 2WYXA 3N8RA 2WADA 3AGFA 4OPYA 3G32A 4DXCA 5EECA 1KVLA 1YQSA 4ZJ1A 3S1YA 3ZG8B 4ZJ3A 3RXWA 2Y2KA 5CEDA 2CC1A 2GDNA 2JBFA 4QU3A 1YLJA 1O07A 1ZC2A 3BLSA 1JWZA 1FSWA 3G30A 4DRTA 1JTDA 1LLBA 3G4PA 2JC7A 4RX2A 1L0GA 3DW0A 4OONA 5HFOA 4BL2A 1H8ZA 5KZHA 2QZ6A 3ZNTA 5CECA 2EXAA 1XKZA 3PAGA 3HVFA 4ID4A 5GHYA 1NYYA 5D3OA 3VP4A 2J9OA 1SHVA 4WEJA 4D2OA 5EPHA 1BLCA 5HAQA 1PI5A 4S2PA 2QMIA 1L0DA 1W5DA 2P9VB 2XH9A 4Z9QA 4KZ6A 4WMCA 3BFCA 3IF5A 4E3MA 3UDIA 2B5RA 5FATA 1JVJA 1RGYA 3BM6A 3OPLA 3FKWA 2EX2A 2Y2LA 4OPRA 1K54A 3A3FA 1BTLA 2JE5A 5EE8A 5EVLA 4JPMA 1PW8A 5EOOA 3WS5A 3Q7VB 2WGWB 3IXDA 1MBLA 5AQ9A 4KZ7A 5CGXA 2Y2JA 1G6AA 1C3BA 4RVAA 3AGEA 5J8XA 3ZGAB 5FQMA 3D4FA 4IBRA 1K56D 5GHXA 1XP4A 2IWCA 5F83A 1JTGA 2EX8A 3UE1A 3IXHA 3OZHA 5KMWA 3GRJA 3NY4A 2WZZA 3GSGA 5E43A 3VP0A 3W4QA 2XFSA 4BENA 4YFMA 1GCEA 4XUZA 3IXGA 4GB7A 4X6TA 3ZG0A 2WUQA 1YLYA 1O7EA 2ZQDA 3ZCZA 1IKIA 5G18A 1LI9A 4OPQA 5E2FA 2BLSA 5FQ9A 2FFYA 4GZBA 4KZ8A 5GHZA 2J7VA 4UAAA 4R23A 1CK3A 3A3IA 3GV9A 3I7JA 1FCNA 2G2WA 4S2LA 4Y0OA 4YINA 3VSKA 5JYPA 3PBSA 4WZ5A 2ZQ7A 2Y2HA 4N1HA 4E3JA 3V39A 3W4OA 4B4ZA 2EFXA 2PBYA 2H0TA 4GDBA 5CGWA 4U0XA 1ZKJA 2RCXA 1L0FA 3SS4A 1J9MA 4NK3A 1W8YA 3HLFA 2XEPA 5FI2A 3ZVWA 4MEZA 5FI7A 3VSLA 4GOGA 2ZC3B 4JLFA 4OOLA 1BLHA 2Y2QA 4WBGA 1YLPA 3SOIA 4BQMA 1M6KA 4P87A 2H10A 3SH7A 2XDMA 1ES3A 5CEBA 4R3JA 4IEDA 3NDEA 3UDXA 3C4OA 3OCNA 4KQQA 4R4SA 5IHVA 3IWQA 4BLMA 3BFDA 3CMZA 5CHMA 3EQUA 2WKHA 1ES4A 1VM1A 5HAPA 5GLCA 5FAQA 4LENA 3O87A 5GLBA 1HVBA 4HESA 1ERQA 2XF3A 5AQAA 5DVAA 4DDSA 3N6IA 1PYYA 2VGKA 4BD1A 3UDFA 1NJ4A 1M40A 5E2GA 4DE0A 4GKUA 3EQVA 3GTCA 4JXWA 5GLAA 1NZOA 4P0MA 3TOIA 4B4XA 1BLSA 3DWZA 4OP5A 1EWZA 4QJGA 1ESIA 1ONHA 2WAEA 4LV0A 4O7DA 4GD6A 5EVIC 3IF6B 1NXYA 4DF6A 4JBFA 4KQRA 4R4RA 4EWFA 4WELA 3NDGA 1MWSA 1MPLA 4X55A 1EROA 1GHIA 1YT4A 3W4PA 1K56A 2HDUA 5CTNA 1K4FA 4BL3A 3ITBA 3G2YA 3MZEA 2IWBA 4DE1A 4L0LA 4Y0TA 3N7WA 1HZOA 4ZDXA 4Y0UA 5M1AA 3NC8A 3M6HA 3TSGA 3B3XA 3JYIA 3QNCA 4KZ5A 3G2ZA 3HUOA 4S2MA 4JF4A 4WM9A 3QNBA 4RA7A 2Y2MA 5DF9A 3S22A 1XA7A 1K55C 2V1ZA 2Z2MB 5E2HA 3V3SA 4PM5A 2ZQ9A 2X71A 3DWKA 4B88A 3E2KA 1FCMA 1BSGA 4KQOA 1H5XA 3BFFA 1IEMA 5CXWA 4U0TA 2OLUA 1JWVA 4PM9A 2HDSA 2R9XA 2OV5A 2XQZA 2Y55A 3NIAA 4S2NA 4BD0A 3FWLA 4LV1A 4UA9A 2ZC5B 3LO7A 3LY3A 1N9BA 4E3IA 1N4OA 2XR0A 4KZ4A 3HREA 5A91A 5FQIA 3WWXA 5CGSA 3Q07A 4XUXA 2ZC4B 2BG1A 1SDEA 3A3EA 3LEZA 3G35A 1MWUA 5E2EA 2ZLYA 1RGZA 3PBNA 3CG5A 1BLPA 3PBTA 2RL3A 1PWCA 5F1GA 3SS5A 4NETA 3GMWA 1IYQA 5FQKA 3M2JA 3WRZA 3VP1A 3V3RA 3M6BA 1U60A 1LL5A 4QY5A 4N92A 1K57C 4XXRA 1KE4A 2XLNA 3SS3A 1MXOA 2WK0A 5FSRA 2WKIA 4N1XA 4WYYA 3MKEA 4JXSA 4P85A 3ZG7B 3WS0A 1KDWA 3BFGA 4OH0A 3CJMA 1ZG4A 4IBXA 3PBQA 1YMSA 2DNSA 4OP8A 4KZBA 1PWGA 1YLZA 3RXXA 2C6WB 3V5MA 4K0WA 4HBTA 1SCWA 3ZDJA 5DF8A 5EVIA 3A3DA 2ZJ9A 4PM8A 4R3BA 4UHUA 4BJPA 5FASA 1XXMA 3SH8A 2Q9MA 4JKTA 5TR7A 2PU4A 1WYCA 2EX9A 3NI9A 3DTMA 4Q8IA 3VFFA 5DF7A 3IWOA 5HX9A 2R9WA 4KZ9A 4JF5A 1E25A 4KG6A 4N9LA 4S2KA 1GHPA 1PIOA 4FD8A 1BULA 3BRMA 1YLTA 2A3UA 1KDSA 3C7VA 4DXBA 3HLCA 3IQAA 4FH4A 4LV2A 3UPPA 4C3QA 5CHUA 3OC2A 4C6YA 1W79A 4JF6A 5F82A 3C5AA 3M2KA 4MBFA 4OQHA 1JWPA 4FCFA 2Y2PA 5F1FA 4Y7PA 3N8SA 2A49A 4IVKA 1K55A 2X02A 2X01A 2WKEA 4MNRA 1K4EA 1VQQA 5AQ7A 3ZNYA 1BUEA 1KGGA 1TDLA 3OPRA 3MBZA 3Q82A 3VP2A 5CRFA 4HEFA 4U3TA 1ONGA 4GNUA 4X68A 3MXRA 2Y2IA 3OPPA 4OKPA 2FFFB 4K0XA 1IYSA 2V2FF 1G68A 3FYZA 2C5WB 3GQZA 2DRWA 1GA0A 5FAPA 2VGJA 1ALQA 2ZM8A 3MXSA 3BECA 4S2JA 3NCKA 4E3NA 3C4PA 1K6SA 1K38A 3UN7A 2Y91A 3BEBA 3N8LA 4KZ3A 2ZMAA 1K54C 1MWRA 5DTSA 3ZG5A 2Y4AA 4JXGA 5A93A 3HBRA 1GHMA 2DCFA 5FA7A 3VOZA 1PW1A 1E3UD 5AQBA 4P6BA 5FQJA 3FZCA 3ISGA 5L2FA 5EVID 2ZQ8A 1RP5A 3UPNA 4M3KA 4UA6A 4CPKA 3HLWA 1BT5A 1DJBA 3MZDA 5GL9A 5A90A 4EBLA 4A5RA 3IF6C 5HAIA 5TFQA 4JXVA 5DTTA 1KVMA 1I2SA 1XA1A 4X53A 1IYPA 4OQGA 3P09A 3O3VA 5EOEA 1IKGA 1FQGA 1NRFA 2WGVA 2ZC6B 3LCEA 1MKIA 3FKVA 3NBLA 2HP5A 3Q1FA 5CHJA 4EQIA 3IH8A 1BZAA 5M19A 2PU2A 3AGDA 4HBUA 2Y2GA 1DJAA 1FR6A 1K6RA 3UPOA 1PZPA 1ES5A 4GN2A 2WGIA 4UA7A 4DDYA 5M18A 1EI5A 3BFEA 3GVBA 4WZ5C 2J9PA 1L2SA 4LV3A 3UY6A 5HL1A 3N4IA 3PBRA 5FQQA 3Q81A 3P98A 5HW3A 5FAOA 2XK1A 4F94A 1FR1A 1I5QA 3FV7A 3UO9A 4ZTKA 3UNWA 1FSYA 4KZAA 4PM6A 5CTMA 1MWTA 3OPHA 2J8YA 1ESUA 1E4DA 3HLGA 2IWDA 2HP6A 2ZC7A 1S6RA 5I94A 3VP3A 2QPNA 2I72A 5FDHA 3IH9A 4FH2A 5CERA 3SH9A 1XGIA 3VFHA 1FCOA 4KG5A 4KG2A 2ZM0A 1CI8A 2Z2LB 4OLGA 1HD8A 3ZG9B 4KENB 2Y59A 5A92A 1RCJA 3PBOA 4OOMA 1XX2A 3E2LA 3HLBA 1OMEA 1Q2PA 3ITAA 1W8QA 4MBHA 4R1GA 5HARA 2HPBA 3OCLA 4R0QA 4X69A 4PMAA 1DJCA 2EFUA 1NYMA 3O88A 1L0EA 1WYBA 2OLVA 4EV4A 3A3JA 5DTKA 1ES2A 5FI6A 4E6WA 1HTZA 3HL9A 4PPRA 2WAFA 1DY6A 1Y54A 2XGNA 3PAEA 4IVIA 1E3UA 1KGFA 2H5SA 4MLLA 3HLDA 1KE3A 3HUNA 4OOYA 1ZG6A 4X56A 3V50A 2ZQCA 3PTEA 5U47A 1XGJA 1FOFA 3IT9A 4OLDA 4RYEA 1ERMA 1PZOA 3MZFA 4ZJ2A 5GLDA 3IF6A 3ZFZA 3VOYA 2G2UA 5JYOA 4E3KA 1K25A 1LL9A 4QD4A 3ZHHA 3BYDA 5EUAA 4DE3A 1PI4A 1Z6FA 4E3LA 5KSHA 2XFTA 3HUMA 2Y2NA 4N9KA 4LCLA 2P74A 3HLEA 4MBKA 4S2IA 3C7UA 3WRTA 2XD5A 4EUZA 2HDQA 1YLWA 1KGEA 1GA9A 2JCHA 3G31A 4WEKA 2EXBA 1TVFA 4H8RA 1SDNA 2OSUA 4QY6A 3WS1A 3RJUA 3MKFA 4S2NC 4QB8A 1XPBA 1CEGA 4DE2A 2V20A 5TGFA 1YM1A 4GD8A 4ZBEA 4EBPA 4E6XA 3WS4A 3VMAA 3ZVTA 2UWXA 1NY0A 2H0YA 4ZAMA 3CZDA
chains in the Genus database with same CATH superfamily
5TBMB 5KIZA 1S0WA 2Y2OA 1NWZA 5DJUA 3KYEA 3ULFA 4RX3A 2HP9A 1IYOA 3IHAA 1SKOA 3LIDA 1AXBA 2ZM2A 3NOUC 3T1SA 4Y2FA 3FG8A 1MY8A 1SZVA 1Q2QA 1OTBA 1LHYA 4NXFA 4OVDA 3JVUA 1MZUA 2LB9A 1H8YA 3NOPC 3G34A 5L10A 3MR0A 2WADA 2V1BA 4OPYA 4YNRA 2VV6A 3RXWA 3F1OB 4MCWA 2PYRA 2Y2KA 5CEDA 3V67A 1ACFA 4F3LB 1LT0A 3BLSA 4DRTA 4RX2A 4YOFA 4OONA 1H8ZA 5KZHA 3ZNTA 2PD7A 3GDIA 1XKZA 2I9VA 4EXOA 4P6ZS 3E98A 3VP4A 3T50A 2QMIA 1L0DA 5I5LA 3H7WB 3PHYA 3BFCA 3UDIA 3FKWA 3F1PB 5EE8A 4JPMA 5CGXA 1C3BA 2O9AA 3AGEA 3ZGAB 4B9OA 3T4TA 1F2KA 2L1MA 1XJ4A 1P0ZA 3IXHA 3OZHA 4HH3A 4KUOA 4NEED 3NY4A 4DMZA 1P9RA 2P08A 1VETB 2WUQA 3ZCZA 1XJ6A 5E2FA 2V1AA 2FFYA 4H6JB 3B33A 1FCNA 4S2LA 2PD8A 4Y0OA 4YINA 3VSKA 5JYPA 3TW8A 2Y2HA 4N1HA 3H82A 1D7EA 2PBDP 4B4ZA 2J80A 2RCXA 3SS4A 3S7QA 4HOIA 5FI7A 1ZTUA 2ZC3B 4OOLA 1OJGA 2O0YA 3SOIA 4I3IA 1YSQA 2H10A 2CMNA 1ES3A 3VV4A 4IEDA 4LPZA 2B95A 2A24A 4K08A 4HY8A 5HZHA 3N6IA 1M40A 3VE3A 3GTCA 3TOIA 3SZTA 1Y4OA 5J3WA 5DKKA 4EESA 5DFXA 3IF6B 4DF6A 4R4RA 3T4OA 4XT2A 4DN0A 1EROA 3MZEA 4DE1A 4L0LA 3N7WA 1Z09A 5M1AA 3SW1A 3NC8A 3M6HA 3D3OA 2VGLM 4S2MA 5DF9A 1XA7A 1K55C 2QJ7A 3IX4A 3V3SA 1X0OA 2X71A 2G7UA 3DWKA 4B88A 4DJ2A 1H5XA 4U0TA 2OLUA 3LEQA 2WKQA 2HDSA 2R9XA 1PNEA 3FWLA 1T19A 4KQDA 5MC7A 3BJNA 3T12B 4KZ4A 1SKOB 5FL3A 5FQIA 3BWLA 5CGSA 4LRXC 5CX7A 3A3EA 3LEZA 3G35A 2ZLYA 1RGZA 3UB8A 1HLUP 3PBTA 3RFBA 4HHDA 2Z6CA 4NETA 2PR6A 3LGOA 4X25A 3VP1A 3V3RA 3FC7A 4PKYG 1KE4A 1J3WA 2WKIA 4P85A 3WS0A 3BFGA 3CJMA 3V5MA 4KZBA 1YLZA 2C6WB 1CF0A 4GJ4A 2VX8A 5DF8A 4UHUA 4BJPA 5FASA 5TR7A 3MQOA 4O01A 2EX9A 1LSWA 3NI9A 4Q8IA 3QP5A 5HX9A 2VZWA 4JF5A 1E25A 4KG6A 4N9LA 4S2KA 4ESPA 1KDSA 3IQAA 2QJ5A 3UPPA 4C3QA 3OC2A 4C6YA 3C5AA 4MBFA 1JWPA 4IVKA 2W3GA 1K55A 2X02A 2WKEA 1VQQA 2PT7A 3ZNYA 1TDLA 4HIAA 3VP2A 5CRFA 4HEFA 3OLOA 4X68A 5HDDA 3BY9A 3OPPA 1DP8A 3GQZA 4BBVA 5FAPA 3C4PA 3DTIA 5F6AA 4I3JA 1VEUA 1XJ3A 4JXGA 3K3DA 3VOZA 5DFYA 2M7VA 1BT5A 5HAIA 5DTTA 1NLZA 1XA1A 4X53A 3P09A 3CAXA 5EOEA 2ZC6B 3LI8A 3NBLA 1MKIA 5CHJA 4BBTA 2GNXA 2PU2A 4ETZA 1DJAA 1FR6A 3UPOA 1PZPA 4UA7A 5M18A 3BFEA 2J9PA 2V0UA 2UV0E 2W3FA 4F94A 1OT6A 3UO9A 4ZTKA 3UE6A 2INWA 1A0KA 2M1CA 1ESUA 1E4DA 3KYZA 3GECA 2ZM0A 4OLGA 1AWIA 5TBMA 3CWFA 2PYPA 1W8QA 2W1RA 4MBHA 2M7UA 4R0QA 3O88A 1WYBA 2OLVA 3QP1A 4XT2B 2P7JA 5DTKA 5HWVA 4E6WA 3HL9A 1Y54A 2XA7M 3V50A 1XGJA 5EM0A 3IT9A 2QKPA 4OLDA 3MZFA 4ZJ2A 3MSHA 2QYBA 4QD4A 3ZHHA 3BYDA 5HWTA 2Y2NA 2PHYA 3C7UA 4GS9A 1OPXA 3F1OA 3G31A 2EXBA 1TVFA 4X1LA 1SDNA 2K7SA 4F3LA 3MKFA 4S2NC 4EW7A 1JNUA 1CEGA 4ETXA 4EBPA 4E6XA 5J4EA 3ZVTA 1NY0A 3FPVA 3IWIA 4GW9A 3UMEA 2VEAA 3UE3A 1QMEA 1PWDA 1CEFA 1XFQA 3VE4A 3HJIA 3WS2A 3CHWP 1LI0A 4QHCA 3F1PA 4YWZA 4FSFA 3EEAA 4UQIM 5BOHA 2Q0OA 3BQAA 1G6OA 3BW6A 5KSCA 3IXBA 3DBAA 3W8KA 2Q9NA 3S7OA 4B93A 2K31A 1QMFA 5IS1A 1IELA 2WYXA 1VETA 1S4SA 3T1RA 3ZG8B 4ZJ3A 1DP9A 2JKRI 1YLJA 3ZYTA 1ZC2A 2O9BA 1FSWA 3G30A 4NXBA 3G4PA 1STZA 1L0GA 4BL2A 2QZ6A 3UB9A 2J3TD 3PAGA 4ID4A 3HVFA 5GHYA 1NYYA 3IBRA 5D3OA 2J9OA 1SHVA 4WEJA 3QP4A 1UGUA 5HAQA 1W5DA 2XH9A 2ZOIA 3IF5A 2W3HA 1JVJA 1RGYA 3OPLA 3UB6A 4GLQA 2EX2A 5F5YA 5EVLA 5EOOA 2WGWB 1MBLA 5AQ9A 2Y2JA 3NULA 5J8XA 5FQMA 1XP4A 2IWCA 3T4SA 1JTGA 2EX8A 4PHTA 5E43A 3VP0A 3W4QA 3EGXC 2ZQDA 3CITA 4WUJA 5GHZA 2J7VA 3OBFA 4NG2A 1F9IA 4Z1WA 2KDKA 3V39A 3W4OA 3TE8A 4BBUA 4GDBA 5CGWA 3HLFA 4MEZA 3NJAA 2JKFA 1YLPA 3T4LA 3LYXA 2ZOHA 4I5SA 5FDSA 2XDMA 5CEBA 3NDEA 4LGWA 3C4OA 3OCNA 4KQQA 4BLMA 3BFDA 3CUEC 2WKHA 4HJ3A 4CLCC 3TJZC 5GLCA 5FAQA 4Y5FA 1ERQA 2XF3A 1LL8A 1PYYA 4BD1A 5E2GA 4M4XA 4GKUA 2Y79A 5GLAA 1NZOA 2V8FA 1ONHA 4LV0A 1EW0A 4JBFA 3D72A 4X55A 2PR5A 2JKGA 3D9YA 2HDUA 5CTNA 4GS9B 4BL3A 3G2YA 3IS2B 2IWBA 4EUVA 4Y0UA 3TSGA 2W1TB 2Y2MA 3U4LP 3KSGA 2ZQ9A 3BFFA 1T18A 5CXWA 1IFQA 4MN7A 1JWVA 4PM9A 2OV5A 4IUHA 2XQZA 3B47A 2ZC5B 2JHEA 3LO7A 5HSQA 5DKLA 4E3IA 1N4OA 2Y8HA 4XUXA 2ZC4B 3CPTB 5E2EA 1FILA 2KLIA 1PWCA 2JN7A 5F1GA 2VKSA 3UB7A 3WRZA 2ACGA 3M6BA 1U60A 4QY5A 3PXPA 1K57C 3H9WA 3SS3A 1G5UA 4IHQA 3MKEA 3ZG7B 5A8BA 1KDWA 4OH0A 4IBXA 3PBQA 4K0WA 4Y3IA 4HI4A 3A3DA 4R3BA 3SH8A 3VFFA 2R9WA 1PIOA 1YLTA 2P04A 3HLCA 4FH4A 4LV2A 5CHUA 4JF6A 2V8CA 3M2KA 3L9KA 2EA9A 4Y7PA 3N8SA 5HD3A 1BUEA 3Q82A 3MXRA 2D02A 2FFFB 1IYSA 1G68A 2V2FF 4WN5A 2C5WB 3FYZA 3E0YA 1ALQA 3BECA 3LIBA 3OOVA 5G4YA 1K38A 4GHIB 2Y91A 3N8LA 4KZ3A 1K54C 3ZG5A 2Y4AA 5A93A 1GHMA 4NKPA 1PW1A 3T4QA 1L3LA 5HDCA 1DJBA 2BTFP 3MZDA 4EBLA 1IYPA 1FQGA 3Q1FA 3LCEA 5M19A 2Y2GA 1K6RA 4HP9A 3S7PA 1EI5A 4WZ5C 3UY6A 1L2SA 3N4IA 2J3WA 5HW3A 2Z6DA 5EFWA 4PM6A 5CTMA 1P97A 1YSPA 1MWTA 4EETB 2J8YA 5G4ZA 1S66L 4NXGA 2VV7A 5FDHA 1HD8A 2LB5A 5A92A 4OOMA 5EV0A 3C38A 3E2LA 1OMEA 4CQHA 4R1GA 5HPFA 5HARA 3OCLA 3VOLA 2AVXA 3C2WA 4EV4A 5FI6A 3JVVA 4PPRA 2WAFA 2XGNA 2OWHA 4RQ9A 4Q0JA 1KGFA 2H5SA 4OOYA 1ZG6A 4X56A 2EWWA 3U2AA 5HL6A 2E8JA 3PTEA 2XSSA 3EWKA 1FOFA 5EM1A 2GZAA 5GLDA 3T1XA 3MMHA 3ZFZA 2G2UA 5JYOA 4JGRA 1LL9A 5EUAA 4E3LA 4GCZA 2P74A 4EUZA 2JCHA 1V9ZA 3NECA 2VV8A 4LRYC 2OSUA 4QY6A 2QHKA 1XPBA 4DE2A 2V20A 5TGFA 4GD8A 4ZBEA 2VA0A 5AVFA 3HCYA 2WZXA 1TEMA 3S4XA 2NUTC 2QWSA 3MJQA 4CLCB 3O86A 4OQ0A 3BLMA 1N9NA 1CI9A 3K3CA 4LCMA 1SKFA 1FIKA 4WL9A 2EX6A 2ZMVA 4GDNA 2WGWA 3TRCA 5C5KA 2L0WA 1KE0A 1I2WA 2W3DA 4PM7A 5AJGA 5F68A 4E3OA 4P6ZM 2ZQAA 2E8IA 4OPZA 4DKIA 1NZUA 2EWVA 1WE4A 2PAVP 3FPWA 4DXCA 1KVLA 4ZJ1A 3S1YA 3JPUA 3LI9A 2B02A 1Y28A 2JBFA 4JGPA 2HJEA 3MF0A 2XROA 1JTDA 5LBRA 2JC7A 3DW0A 1F98A 4EEPA 1MC0A 3R4KA 3NHQA 1K0KA 1BLCA 1PI5A 4S2PA 2P9VB 4KZ6A 4E3MA 3LR3A 2B5RA 5FATA 3BM6A 5DJTA 2JE5A 1PW8A 3WS5A 3Q7VB 2K2NA 4RVAA 3D4FA 4IBRA 5F83A 3RTYA 4G3KA 2WZZA 3GSGA 2XFSA 4XUZA 3IXGA 4GB7A 2JKRM 5G18A 4GZBA 4R23A 3IS2A 3A3IA 1S67L 5IT5A 2ZQ7A 3F1NB 4E3JA 2W1TA 2EFXA 2PBYA 2H0TA 4U0XA 1ZKJA 4NK3A 1W8YA 2XEPA 2L4RA 3VSLA 4JLFA 1BLHA 4BWIA 2Y2QA 4WBGA 2ZL1B 4BQMA 1M6KA 5FEGA 4R4SA 5IHVA 2VLGA 5CHMA 3EQUA 3MXQA 5HAPA 3CPTA 5L8MA 5GLBA 3KSFA 4DDSA 4L9FA 2VGKA 3UDFA 4I3AA 3LIAA 4DE0A 3EQVA 1OTEA 3DWZA 4OP5A 1EWZA 4QJGA 1ESIA 3RH8B 4GD6A 5EVIC 1NXYA 2V9AA 5FEFA 4WELA 1S4RA 2W0NA 1H0MA 1K4FA 1KOUA 5HD5A 4Y0TA 3B3XA 4JF4A 4WM9A 3QNBA 4RA7A 3S22A 5E2HA 1IEMA 3MS6A 3NOTC 1YKDA 4S2NA 4LV1A 1WA9A 3LY3A 1N9BA 2XR0A 4ARZB 4O0PA 3HREA 3WWXA 1P9WA 1IOUA 2BG1A 3PBNA 4D60A 3GMWA 3T4KA 3M2JA 4GHIA 2OAP1 1LL5A 4N92A 2XLNA 1D06A 2WK0A 5FSRA 4MN5A 4N1XA 1LSXA 3O5YA 2D01A 4IUKA 5L07A 1S1YA 1YMSA 2DNSA 3RXXA 1H3QA 4HBTA 1SCWA 3ZDJA 5EVIA 4PM8A 4KUKA 2PU4A 3LIFA 5DF7A 3IWOA 1W63M 1GHPA 1BULA 2PRFA 3BRMA 4HNBA 2A3UA 3LR4A 4JGQA 2JKTM 5F82A 2A49A 2O9CA 2X01A 5AQ7A 4R3AA 1TD5A 3MBZA 4U3TA 4GNUA 3EOIA 2Y2IA 3IX8A 1OJ5A 2DRWA 1GA0A 4CLCD 3NCKA 1K6SA 3BEBA 3BY8A 5DTSA 3UB5P 5F69A 2O99A 4DJ3A 1E3UD 4P6BA 2KOIA 3DTKA 5L2FA 1XFNA 2ZQ8A 4UA6A 3HLWA 5A90A 4A5RA 4QWOA 5TFQA 3IX3A 1I2SA 3MQQA 4OQGA 3O3VA 4NXEA 5K5BA 3FKVA 2HP5A 4EQIA 1BZAA 3AGDA 4HBUA 1OTIA 2H28A 4GN2A 2WGIA 2V0WA 1TS7A 4WLAA 5HL1A 4LV3A 1T1AA 3P98A 5FAOA 1I5QA 4ME4A 3UNWA 1T1CA 2JKTI 4Y17A 3OPHA 1NRJA 3HLGA 2IWDA 2HP6A 1S6RA 3VP3A 3IH9A 4FH2A 3SH9A 3C30A 3VFHA 4KG5A 4KG2A 4LLOB 1CI8A 5TJJA 2Z2LB 3ZG9B 2OOLA 4KENB 2Y59A 1RCJA 4Q0IA 1XX2A 3B42A 3HLBA 3CUEA 3S7NA 2HPBA 4X69A 4CLCA 1DJCA 2EFUA 2ZBBA 1ES2A 1DY6A 3PAEA 4UEYA 1E3UA 3HUNA 4CLCE 1CQAA 2ZQCA 5U47A 1PZOA 2MJ6A 4O8GA 3QP2A 3LICA 5HDSA 5HWWA 5KSHA 1Z6FA 3HUMA 4N9KA 4LCLA 1NLYA 3WRTA 2XD5A 1XJ2A 4MDZA 1KGEA 2W27A 3PYPA 4H8RA 3WS1A 3T1QB 4R38A 3RJUA 2XA7S 3HJKA 4QB8A 3G6OA 1YM1A 3VMAA 2UWXA 5FA7A 2ZJ9A 2H0YA 4ZAMA 3CZDA 3GR2A 4WMCD 3TG9A 3UE0A 5L09A 1TS8A 2P9VA 3EEHA 4K91A 4CJNA 4MN6A 1TDGA 2ZD8A 3IHBA 3LR0A 1K57A 1YMXA 2HDRA 5EVIB 3Q7VA 3R7WA 3Q7ZA 3QHYA 4C75A 1TS0A 4EBNA 3LY4A 4I38A 5J7EA 3MFDA 4WZ4A 2XD1A 4S2OA 4OQIA 1W7FA 1V9YA 2KX6A 3N8RA 3AGFA 4EQ1A 3G32A 5EECA 1YQSA 2GDNA 4QU3A 1O07A 4LRZE 1JWZA 1LLBA 3F1NA 3IBJA 4UQIS 5HFOA 5CECA 2EXAA 4FTXA 4D2OA 5EPHA 2ZL1A 2HJ9C 4Z9QA 4WMCA 2WKPA 3E4OA 2Y2LA 4OPRA 1K54A 3A3FA 1BTLA 3IXDA 4KZ7A 1D1JA 1G6AA 4EERA 1K56D 5GHXA 3UE1A 5KMWA 3GRJA 4BENA 4YFMA 1GCEA 1ODVA 4X6TA 3ZG0A 3QP8A 1YLYA 1O7EA 3KO6A 1IKIA 1LI9A 3A0SA 4OPQA 2BLSA 5FQ9A 4KZ8A 4UAAA 1CK3A 3GV9A 3I7JA 2G2WA 3PBSA 4WZ5A 2BASA 4HJ6A 1N9LA 4HH2A 1L0FA 1J9MA 3CI6A 1DP6A 5FI2A 3ZVWA 4IJGA 4GOGA 3QP6A 5HPIA 1PFLA 4P87A 3SH7A 4R3JA 3UDXA 4ARZA 3IWQA 3CMZA 3KYQA 1GSWA 1ES4A 1VM1A 4EU0A 4LENA 3O87A 2XRNA 1HVBA 4HESA 5AQAA 1TF1A 5DVAA 4G3VA 3A0RA 1NJ4A 4Q0HA 4JXWA 4B4XA 4P0MA 1N9OA 1BLSA 2A2LA 3K2NA 2WAEA 2HF6A 4O7DA 4KQRA 4EWFA 4R6LA 3NDGA 1MWSA 1MPLA 1GHIA 1YT4A 3W4PA 1K56A 3ZQ5A 1T1BA 4X1MA 3ITBA 3MQ0A 1HZOA 4ZDXA 3DTEA 1LSVA 3H82B 3LUQA 4KZ5A 3JYIA 3QNCA 3G2ZA 3HUOA 4LFUA 2V1ZA 5AVEA 1VB6A 2Z2MB 4PM5A 3E2KA 1YPRA 1FCMA 1BSGA 3P01A 4KQOA 2Y55A 3NIAA 4BD0A 1GSVA 4UA9A 4MMNA 3LIEA 1G28A 5A91A 3Q07A 2A24B 1SDEA 1MWUA 2W3EA 3CG5A 1BLPA 2RL3A 3SS5A 3R7WB 1IYQA 5FQKA 2HGVA 1H8MA 3W2ZA 4XXRA 1MXOA 1S1ZA 2YKFA 3DAVA 4WYYA 4JXSA 1MKMA 4II7A 4ZRRA 1ZG4A 4OP8A 1PWGA 3LFVA 2VJWA 2HV1A 4R70A 3EGDC 4PKYA 1XXMA 2Q9MA 4JKTA 4FOFA 1WYCA 3DTMA 3MFXA 5IU1A 2GX5A 3P7NA 4KZ9A 4FD8A 3T4JA 2DMWA 3C7VA 4HJ4A 4EEUA 4DXBA 4G3WA 1W79A 3PR6A 4OQHA 4FCFA 2Y2PA 5F1FA 1ZHHB 2HZ5A 2PDRA 1F5MA 4MNRA 1K4EA 1KGGA 3OPRA 3E4QA 1ONGA 4OKPA 4K0XA 1TS6A 3CLOA 1YAXA 2VGJA 2ZM8A 3MXSA 4S2JA 4E3NA 3UN7A 3ICYA 4JGOA 2ZMAA 1BYWA 1MWRA 4QPRA 4FUWA 3HBRA 2DCFA 4L9GA 3BQ8A 2OAQ1 5FQJA 3H7WA 5AQBA 3FZCA 3ISGA 5EVID 1RP5A 3UPNA 4M3KA 4CPKA 4BMWA 2ZMFA 5GL9A 3IF6C 4JXVA 2VK3A 1KVMA 3E4PA 1IKGA 3WS4A 1NRFA 2WGVA 3KSHA 4HQAA 3IH8A 2B18A 1VHMA 1ES5A 4DDYA 3GVBA 3PBRA 5FQQA 1PRQA 3Q81A 2XK1A 5EVEA 1FR1A 1CJFA 3FV7A 1FSYA 3A0VA 4KZAA 4L9EA 4H6JA 2OWJA 3UMDA 2ZC7A 5I94A 4E04A 2QPNA 2I72A 2IA2A 2J3TC 1OT9A 5CERA 1XGIA 3LR5A 1FCOA 1DRMA 1W63Q 3KX0X 2VGLS 1VEUB 2FZ0A 3PBOA 3C8CA 2YKHA 1Q2PA 3ITAA 2WKRA 4PMAA 1NYMA 1L0EA 3A3JA 4AFIA 1HTZA 2R78A 4IVIA 4MLLA 3HLDA 1KE3A 1OTAA 4HP4A 1OTDA 1GSXA 4RYEA 1ERMA 1UWPX 3IF6A 3VOYA 4Y13A 3L7HA 4E3KA 2NUPC 1K25A 4DE3A 1PI4A 4PAUA 2XFTA 3HLEA 2GJ3A 4MBKA 4S2IA 3KSIA 2HDQA 1YLWA 1GA9A 4WF0A 4WEKA 2FH5A 4I39A 4Y15A 1UWNX 2CC1A
chains in the Genus database with same CATH topology
3GR2A 4WMCD 3TG9A 2WZXA 1S0WA 3UE0A 1TEMA 3S4XA 3IWIA 2Y2OA 3UE3A 1QMEA 3O86A 4OQ0A 3BLMA 2P9VA 4RX3A 1PWDA 2HP9A 1IYOA 3IHAA 4K91A 1CEFA 4CJNA 1CI9A 3WS2A 4LCMA 1AXBA 1LI0A 2ZM2A 1SKFA 1TDGA 4QHCA 2ZD8A 3IHBA 2EX6A 1K57A 1YMXA 2HDRA 4GDNA 5EVIB 4FSFA 3Q7VA 2WGWA 3Q7ZA 3QHYA 1KE0A 4C75A 1I2WA 5BOHA 4PM7A 4EBNA 3LY4A 1MY8A 4E3OA 5KSCA 1Q2QA 3MFDA 2ZQAA 2E8IA 3IXBA 4OPZA 4WZ4A 4DKIA 1LHYA 2Q9NA 3W8KA 2XD1A 4OVDA 4S2OA 4OQIA 1NZUA 1W7FA 1H8YA 1QMFA 1WE4A 1IELA 3G34A 2WYXA 3N8RA 2WADA 3AGFA 4OPYA 3G32A 4DXCA 5EECA 1KVLA 1YQSA 4ZJ1A 3S1YA 3ZG8B 4ZJ3A 3RXWA 2Y2KA 5CEDA 2CC1A 2GDNA 2JBFA 4QU3A 1YLJA 1O07A 1ZC2A 3BLSA 1JWZA 1FSWA 3G30A 4DRTA 1JTDA 1LLBA 3G4PA 2JC7A 4RX2A 1L0GA 3DW0A 4OONA 5HFOA 4BL2A 1H8ZA 5KZHA 2QZ6A 3ZNTA 5CECA 2EXAA 1XKZA 3PAGA 3HVFA 4ID4A 5GHYA 1NYYA 5D3OA 3VP4A 2J9OA 1SHVA 4WEJA 4D2OA 5EPHA 1BLCA 5HAQA 1PI5A 4S2PA 2QMIA 1L0DA 1W5DA 2P9VB 2XH9A 4Z9QA 4KZ6A 4WMCA 3BFCA 3IF5A 4E3MA 3UDIA 2B5RA 5FATA 1JVJA 1RGYA 3BM6A 3OPLA 3FKWA 2EX2A 2Y2LA 4OPRA 1K54A 3A3FA 1BTLA 2JE5A 5EE8A 5EVLA 4JPMA 1PW8A 5EOOA 3WS5A 3Q7VB 2WGWB 3IXDA 1MBLA 5AQ9A 4KZ7A 5CGXA 2Y2JA 1G6AA 1C3BA 4RVAA 3AGEA 5J8XA 3ZGAB 5FQMA 3D4FA 4IBRA 1K56D 5GHXA 1XP4A 2IWCA 5F83A 1JTGA 2EX8A 3UE1A 3IXHA 3OZHA 5KMWA 3GRJA 3NY4A 2WZZA 3GSGA 5E43A 3VP0A 3W4QA 2XFSA 4BENA 4YFMA 1GCEA 4XUZA 3IXGA 4GB7A 4X6TA 3ZG0A 2WUQA 1YLYA 1O7EA 2ZQDA 3ZCZA 1IKIA 5G18A 1LI9A 4OPQA 5E2FA 2BLSA 5FQ9A 2FFYA 4GZBA 4KZ8A 5GHZA 2J7VA 4UAAA 4R23A 1CK3A 3A3IA 3GV9A 3I7JA 1FCNA 2G2WA 4S2LA 4Y0OA 4YINA 3VSKA 5JYPA 3PBSA 4WZ5A 2ZQ7A 2Y2HA 4N1HA 4E3JA 3V39A 3W4OA 4B4ZA 2EFXA 2PBYA 2H0TA 4GDBA 5CGWA 4U0XA 1ZKJA 2RCXA 1L0FA 3SS4A 1J9MA 4NK3A 1W8YA 3HLFA 2XEPA 5FI2A 3ZVWA 4MEZA 5FI7A 3VSLA 4GOGA 2ZC3B 4JLFA 4OOLA 1BLHA 2Y2QA 4WBGA 1YLPA 3SOIA 4BQMA 1M6KA 4P87A 2H10A 3SH7A 2XDMA 1ES3A 5CEBA 4R3JA 4IEDA 3NDEA 3UDXA 3C4OA 3OCNA 4KQQA 4R4SA 5IHVA 3IWQA 4BLMA 3BFDA 3CMZA 5CHMA 3EQUA 2WKHA 1ES4A 1VM1A 5HAPA 5GLCA 5FAQA 4LENA 3O87A 5GLBA 1HVBA 4HESA 1ERQA 2XF3A 5AQAA 5DVAA 4DDSA 3N6IA 1PYYA 2VGKA 4BD1A 3UDFA 1NJ4A 1M40A 5E2GA 4DE0A 4GKUA 3EQVA 3GTCA 4JXWA 5GLAA 1NZOA 4P0MA 3TOIA 4B4XA 1BLSA 3DWZA 4OP5A 1EWZA 4QJGA 1ESIA 1ONHA 2WAEA 4LV0A 4O7DA 4GD6A 5EVIC 3IF6B 1NXYA 4DF6A 4JBFA 4KQRA 4R4RA 4EWFA 4WELA 3NDGA 1MWSA 1MPLA 4X55A 1EROA 1GHIA 1YT4A 3W4PA 1K56A 2HDUA 5CTNA 1K4FA 4BL3A 3ITBA 3G2YA 3MZEA 2IWBA 4DE1A 4L0LA 4Y0TA 3N7WA 1HZOA 4ZDXA 4Y0UA 5M1AA 3NC8A 3M6HA 3TSGA 3B3XA 3JYIA 3QNCA 4KZ5A 3G2ZA 3HUOA 4S2MA 4JF4A 4WM9A 3QNBA 4RA7A 2Y2MA 5DF9A 3S22A 1XA7A 1K55C 2V1ZA 2Z2MB 5E2HA 3V3SA 4PM5A 2ZQ9A 2X71A 3DWKA 4B88A 3E2KA 1FCMA 1BSGA 4KQOA 1H5XA 3BFFA 1IEMA 5CXWA 4U0TA 2OLUA 1JWVA 4PM9A 2HDSA 2R9XA 2OV5A 2XQZA 2Y55A 3NIAA 4S2NA 4BD0A 3FWLA 4LV1A 4UA9A 2ZC5B 3LO7A 3LY3A 1N9BA 4E3IA 1N4OA 2XR0A 4KZ4A 3HREA 5A91A 5FQIA 3WWXA 5CGSA 3Q07A 4XUXA 2ZC4B 2BG1A 1SDEA 3A3EA 3LEZA 3G35A 1MWUA 5E2EA 2ZLYA 1RGZA 3PBNA 3CG5A 1BLPA 3PBTA 2RL3A 1PWCA 5F1GA 3SS5A 4NETA 3GMWA 1IYQA 5FQKA 3M2JA 3WRZA 3VP1A 3V3RA 3M6BA 1U60A 1LL5A 4QY5A 4N92A 1K57C 4XXRA 1KE4A 2XLNA 3SS3A 1MXOA 2WK0A 5FSRA 2WKIA 4N1XA 4WYYA 3MKEA 4JXSA 4P85A 3ZG7B 3WS0A 1KDWA 3BFGA 4OH0A 3CJMA 1ZG4A 4IBXA 3PBQA 1YMSA 2DNSA 4OP8A 4KZBA 1PWGA 1YLZA 3RXXA 2C6WB 3V5MA 4K0WA 4HBTA 1SCWA 3ZDJA 5DF8A 5EVIA 3A3DA 2ZJ9A 4PM8A 4R3BA 4UHUA 4BJPA 5FASA 1XXMA 3SH8A 2Q9MA 4JKTA 5TR7A 2PU4A 1WYCA 2EX9A 3NI9A 3DTMA 4Q8IA 3VFFA 5DF7A 3IWOA 5HX9A 2R9WA 4KZ9A 4JF5A 1E25A 4KG6A 4N9LA 4S2KA 1GHPA 1PIOA 4FD8A 1BULA 3BRMA 1YLTA 2A3UA 1KDSA 3C7VA 4DXBA 3HLCA 3IQAA 4FH4A 4LV2A 3UPPA 4C3QA 5CHUA 3OC2A 4C6YA 1W79A 4JF6A 5F82A 3C5AA 3M2KA 4MBFA 4OQHA 1JWPA 4FCFA 2Y2PA 5F1FA 4Y7PA 3N8SA 2A49A 4IVKA 1K55A 2X02A 2X01A 2WKEA 4MNRA 1K4EA 1VQQA 5AQ7A 3ZNYA 1BUEA 1KGGA 1TDLA 3OPRA 3MBZA 3Q82A 3VP2A 5CRFA 4HEFA 4U3TA 1ONGA 4GNUA 4X68A 3MXRA 2Y2IA 3OPPA 4OKPA 2FFFB 4K0XA 1IYSA 2V2FF 1G68A 3FYZA 2C5WB 3GQZA 2DRWA 1GA0A 5FAPA 2VGJA 1ALQA 2ZM8A 3MXSA 3BECA 4S2JA 3NCKA 4E3NA 3C4PA 1K6SA 1K38A 3UN7A 2Y91A 3BEBA 3N8LA 4KZ3A 2ZMAA 1K54C 1MWRA 5DTSA 3ZG5A 2Y4AA 4JXGA 5A93A 3HBRA 1GHMA 2DCFA 5FA7A 3VOZA 1PW1A 1E3UD 5AQBA 4P6BA 5FQJA 3FZCA 3ISGA 5L2FA 5EVID 2ZQ8A 1RP5A 3UPNA 4M3KA 4UA6A 4CPKA 3HLWA 1BT5A 1DJBA 3MZDA 5GL9A 5A90A 4EBLA 4A5RA 3IF6C 5HAIA 5TFQA 4JXVA 5DTTA 1KVMA 1I2SA 1XA1A 4X53A 1IYPA 4OQGA 3P09A 3O3VA 5EOEA 1IKGA 1FQGA 1NRFA 2WGVA 2ZC6B 3LCEA 1MKIA 3FKVA 3NBLA 2HP5A 3Q1FA 5CHJA 4EQIA 3IH8A 1BZAA 5M19A 2PU2A 3AGDA 4HBUA 2Y2GA 1DJAA 1FR6A 1K6RA 3UPOA 1PZPA 1ES5A 4GN2A 2WGIA 4UA7A 4DDYA 5M18A 1EI5A 3BFEA 3GVBA 4WZ5C 2J9PA 1L2SA 4LV3A 3UY6A 5HL1A 3N4IA 3PBRA 5FQQA 3Q81A 3P98A 5HW3A 5FAOA 2XK1A 4F94A 1FR1A 1I5QA 3FV7A 3UO9A 4ZTKA 3UNWA 1FSYA 4KZAA 4PM6A 5CTMA 1MWTA 3OPHA 2J8YA 1ESUA 1E4DA 3HLGA 2IWDA 2HP6A 2ZC7A 1S6RA 5I94A 3VP3A 2QPNA 2I72A 5FDHA 3IH9A 4FH2A 5CERA 3SH9A 1XGIA 3VFHA 1FCOA 4KG5A 4KG2A 2ZM0A 1CI8A 2Z2LB 4OLGA 1HD8A 3ZG9B 4KENB 2Y59A 5A92A 1RCJA 3PBOA 4OOMA 1XX2A 3E2LA 3HLBA 1OMEA 1Q2PA 3ITAA 1W8QA 4MBHA 4R1GA 5HARA 2HPBA 3OCLA 4R0QA 4X69A 4PMAA 1DJCA 2EFUA 1NYMA 3O88A 1L0EA 1WYBA 2OLVA 4EV4A 3A3JA 5DTKA 1ES2A 5FI6A 4E6WA 1HTZA 3HL9A 4PPRA 2WAFA 1DY6A 1Y54A 2XGNA 3PAEA 4IVIA 1E3UA 1KGFA 2H5SA 4MLLA 3HLDA 1KE3A 3HUNA 4OOYA 1ZG6A 4X56A 3V50A 2ZQCA 3PTEA 5U47A 1XGJA 1FOFA 3IT9A 4OLDA 4RYEA 1ERMA 1PZOA 3MZFA 4ZJ2A 5GLDA 3IF6A 3ZFZA 3VOYA 2G2UA 5JYOA 4E3KA 1K25A 1LL9A 4QD4A 3ZHHA 3BYDA 5EUAA 4DE3A 1PI4A 1Z6FA 4E3LA 5KSHA 2XFTA 3HUMA 2Y2NA 4N9KA 4LCLA 2P74A 3HLEA 4MBKA 4S2IA 3C7UA 3WRTA 2XD5A 4EUZA 2HDQA 1YLWA 1KGEA 1GA9A 2JCHA 3G31A 4WEKA 2EXBA 1TVFA 4H8RA 1SDNA 2OSUA 4QY6A 3WS1A 3RJUA 3MKFA 4S2NC 4QB8A 1XPBA 1CEGA 4DE2A 2V20A 5TGFA 1YM1A 4GD8A 4ZBEA 4EBPA 4E6XA 3WS4A 3VMAA 3ZVTA 2UWXA 1NY0A 2H0YA 4ZAMA 3CZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GR2 A;  4WMC D;  3TG9 A;  2WZX A;  1S0W A;  3UE0 A;  1TEM A;  3S4X A;  3IWI A;  2Y2O A;  3UE3 A;  1QME A;  3O86 A;  4OQ0 A;  3BLM A;  2P9V A;  4RX3 A;  1PWD A;  2HP9 A;  1IYO A;  3IHA A;  4K91 A;  1CEF A;  4CJN A;  1CI9 A;  3WS2 A;  4LCM A;  1AXB A;  1LI0 A;  2ZM2 A;  1SKF A;  1TDG A;  4QHC A;  2ZD8 A;  3IHB A;  2EX6 A;  1K57 A;  1YMX A;  2HDR A;  4GDN A;  5EVI B;  4FSF A;  3Q7V A;  2WGW A;  3Q7Z A;  3QHY A;  1KE0 A;  4C75 A;  1I2W A;  5BOH A;  4PM7 A;  4EBN A;  3LY4 A;  1MY8 A;  4E3O A;  5KSC A;  1Q2Q A;  3MFD A;  2ZQA A;  2E8I A;  3IXB A;  4OPZ A;  4WZ4 A;  4DKI A;  1LHY A;  2Q9N A;  3W8K A;  2XD1 A;  4OVD A;  4S2O A;  4OQI A;  1NZU A;  1W7F A;  1H8Y A;  1QMF A;  1WE4 A;  1IEL A;  3G34 A;  2WYX A;  3N8R A;  2WAD A;  3AGF A;  4OPY A;  3G32 A;  4DXC A;  5EEC A;  1KVL A;  1YQS A;  4ZJ1 A;  3S1Y A;  3ZG8 B;  4ZJ3 A;  3RXW A;  2Y2K A;  5CED A;  2CC1 A;  2GDN A;  2JBF A;  4QU3 A;  1YLJ A;  1O07 A;  1ZC2 A;  3BLS A;  1JWZ A;  1FSW A;  3G30 A;  4DRT A;  1JTD A;  1LLB A;  3G4P A;  2JC7 A;  4RX2 A;  1L0G A;  3DW0 A;  4OON A;  5HFO A;  4BL2 A;  1H8Z A;  5KZH A;  2QZ6 A;  3ZNT A;  5CEC A;  2EXA A;  1XKZ A;  3PAG A;  3HVF A;  4ID4 A;  5GHY A;  1NYY A;  5D3O A;  3VP4 A;  2J9O A;  1SHV A;  4WEJ A;  4D2O A;  5EPH A;  1BLC A;  5HAQ A;  1PI5 A;  4S2P A;  2QMI A;  1L0D A;  1W5D A;  2P9V B;  2XH9 A;  4Z9Q A;  4KZ6 A;  4WMC A;  3BFC A;  3IF5 A;  4E3M A;  3UDI A;  2B5R A;  5FAT A;  1JVJ A;  1RGY A;  3BM6 A;  3OPL A;  3FKW A;  2EX2 A;  2Y2L A;  4OPR A;  1K54 A;  3A3F A;  1BTL A;  2JE5 A;  5EE8 A;  5EVL A;  4JPM A;  1PW8 A;  5EOO A;  3WS5 A;  3Q7V B;  2WGW B;  3IXD A;  1MBL A;  5AQ9 A;  4KZ7 A;  5CGX A;  2Y2J A;  1G6A A;  1C3B A;  4RVA A;  3AGE A;  5J8X A;  3ZGA B;  5FQM A;  3D4F A;  4IBR A;  1K56 D;  5GHX A;  1XP4 A;  2IWC A;  5F83 A;  1JTG A;  2EX8 A;  3UE1 A;  3IXH A;  3OZH A;  5KMW A;  3GRJ A;  3NY4 A;  2WZZ A;  3GSG A;  5E43 A;  3VP0 A;  3W4Q A;  2XFS A;  4BEN A;  4YFM A;  1GCE A;  4XUZ A;  3IXG A;  4GB7 A;  4X6T A;  3ZG0 A;  2WUQ A;  1YLY A;  1O7E A;  2ZQD A;  3ZCZ A;  1IKI A;  5G18 A;  1LI9 A;  4OPQ A;  5E2F A;  2BLS A;  5FQ9 A;  2FFY A;  4GZB A;  4KZ8 A;  5GHZ A;  2J7V A;  4UAA A;  4R23 A;  1CK3 A;  3A3I A;  3GV9 A;  3I7J A;  1FCN A;  2G2W A;  4S2L A;  4Y0O A;  4YIN A;  3VSK A;  5JYP A;  3PBS A;  4WZ5 A;  2ZQ7 A;  2Y2H A;  4N1H A;  4E3J A;  3V39 A;  3W4O A;  4B4Z A;  2EFX A;  2PBY A;  2H0T A;  4GDB A;  5CGW A;  4U0X A;  1ZKJ A;  2RCX A;  1L0F A;  3SS4 A;  1J9M A;  4NK3 A;  1W8Y A;  3HLF A;  2XEP A;  5FI2 A;  3ZVW A;  4MEZ A;  5FI7 A;  3VSL A;  4GOG A;  2ZC3 B;  4JLF A;  4OOL A;  1BLH A;  2Y2Q A;  4WBG A;  1YLP A;  3SOI A;  4BQM A;  1M6K A;  4P87 A;  2H10 A;  3SH7 A;  2XDM A;  1ES3 A;  5CEB A;  4R3J A;  4IED A;  3NDE A;  3UDX A;  3C4O A;  3OCN A;  4KQQ A;  4R4S A;  5IHV A;  3IWQ A;  4BLM A;  3BFD A;  3CMZ A;  5CHM A;  3EQU A;  2WKH A;  1ES4 A;  1VM1 A;  5HAP A;  5GLC A;  5FAQ A;  4LEN A;  3O87 A;  5GLB A;  1HVB A;  4HES A;  1ERQ A;  2XF3 A;  5AQA A;  5DVA A;  4DDS A;  3N6I A;  1PYY A;  2VGK A;  4BD1 A;  3UDF A;  1NJ4 A;  1M40 A;  5E2G A;  4DE0 A;  4GKU A;  3EQV A;  3GTC A;  4JXW A;  5GLA A;  1NZO A;  4P0M A;  3TOI A;  4B4X A;  1BLS A;  3DWZ A;  4OP5 A;  1EWZ A;  4QJG A;  1ESI A;  1ONH A;  2WAE A;  4LV0 A;  4O7D A;  4GD6 A;  5EVI C;  3IF6 B;  1NXY A;  4DF6 A;  4JBF A;  4KQR A;  4R4R A;  4EWF A;  4WEL A;  3NDG A;  1MWS A;  1MPL A;  4X55 A;  1ERO A;  1GHI A;  1YT4 A;  3W4P A;  1K56 A;  2HDU A;  5CTN A;  1K4F A;  4BL3 A;  3ITB A;  3G2Y A;  3MZE A;  2IWB A;  4DE1 A;  4L0L A;  4Y0T A;  3N7W A;  1HZO A;  4ZDX A;  4Y0U A;  5M1A A;  3NC8 A;  3M6H A;  3TSG A;  3B3X A;  3JYI A;  3QNC A;  4KZ5 A;  3G2Z A;  3HUO A;  4S2M A;  4JF4 A;  4WM9 A;  3QNB A;  4RA7 A;  2Y2M A;  5DF9 A;  3S22 A;  1XA7 A;  1K55 C;  2V1Z A;  2Z2M B;  5E2H A;  3V3S A;  4PM5 A;  2ZQ9 A;  2X71 A;  3DWK A;  4B88 A;  3E2K A;  1FCM A;  1BSG A;  4KQO A;  1H5X A;  3BFF A;  1IEM A;  5CXW A;  4U0T A;  2OLU A;  1JWV A;  4PM9 A;  2HDS A;  2R9X A;  2OV5 A;  2XQZ A;  2Y55 A;  3NIA A;  4S2N A;  4BD0 A;  3FWL A;  4LV1 A;  4UA9 A;  2ZC5 B;  3LO7 A;  3LY3 A;  1N9B A;  4E3I A;  1N4O A;  2XR0 A;  4KZ4 A;  3HRE A;  5A91 A;  5FQI A;  3WWX A;  5CGS A;  3Q07 A;  4XUX A;  2ZC4 B;  2BG1 A;  1SDE A;  3A3E A;  3LEZ A;  3G35 A;  1MWU A;  5E2E A;  2ZLY A;  1RGZ A;  3PBN A;  3CG5 A;  1BLP A;  3PBT A;  2RL3 A;  1PWC A;  5F1G A;  3SS5 A;  4NET A;  3GMW A;  1IYQ A;  5FQK A;  3M2J A;  3WRZ A;  3VP1 A;  3V3R A;  3M6B A;  1U60 A;  1LL5 A;  4QY5 A;  4N92 A;  1K57 C;  4XXR A;  1KE4 A;  2XLN A;  3SS3 A;  1MXO A;  2WK0 A;  5FSR A;  2WKI A;  4N1X A;  4WYY A;  3MKE A;  4JXS A;  4P85 A;  3ZG7 B;  3WS0 A;  1KDW A;  3BFG A;  4OH0 A;  3CJM A;  1ZG4 A;  4IBX A;  3PBQ A;  1YMS A;  2DNS A;  4OP8 A;  4KZB A;  1PWG A;  1YLZ A;  3RXX A;  2C6W B;  3V5M A;  4K0W A;  4HBT A;  1SCW A;  3ZDJ A;  5DF8 A;  5EVI A;  3A3D A;  2ZJ9 A;  4PM8 A;  4R3B A;  4UHU A;  4BJP A;  5FAS A;  1XXM A;  3SH8 A;  2Q9M A;  4JKT A;  5TR7 A;  2PU4 A;  1WYC A;  2EX9 A;  3NI9 A;  3DTM A;  4Q8I A;  3VFF A;  5DF7 A;  3IWO A;  5HX9 A;  2R9W A;  4KZ9 A;  4JF5 A;  1E25 A;  4KG6 A;  4N9L A;  4S2K A;  1GHP A;  1PIO A;  4FD8 A;  1BUL A;  3BRM A;  1YLT A;  2A3U A;  1KDS A;  3C7V A;  4DXB A;  3HLC A;  3IQA A;  4FH4 A;  4LV2 A;  3UPP A;  4C3Q A;  5CHU A;  3OC2 A;  4C6Y A;  1W79 A;  4JF6 A;  5F82 A;  3C5A A;  3M2K A;  4MBF A;  4OQH A;  1JWP A;  4FCF A;  2Y2P A;  5F1F A;  4Y7P A;  3N8S A;  2A49 A;  4IVK A;  1K55 A;  2X02 A;  2X01 A;  2WKE A;  4MNR A;  1K4E A;  1VQQ A;  5AQ7 A;  3ZNY A;  1BUE A;  1KGG A;  1TDL A;  3OPR A;  3MBZ A;  3Q82 A;  3VP2 A;  5CRF A;  4HEF A;  4U3T A;  1ONG A;  4GNU A;  4X68 A;  3MXR A;  2Y2I A;  3OPP A;  4OKP A;  2FFF B;  4K0X A;  1IYS A;  2V2F F;  1G68 A;  3FYZ A;  2C5W B;  3GQZ A;  2DRW A;  1GA0 A;  5FAP A;  2VGJ A;  1ALQ A;  2ZM8 A;  3MXS A;  3BEC A;  4S2J A;  3NCK A;  4E3N A;  3C4P A;  1K6S A;  1K38 A;  3UN7 A;  2Y91 A;  3BEB A;  3N8L A;  4KZ3 A;  2ZMA A;  1K54 C;  1MWR A;  5DTS A;  3ZG5 A;  2Y4A A;  4JXG A;  5A93 A;  3HBR A;  1GHM A;  2DCF A;  5FA7 A;  3VOZ A;  1PW1 A;  1E3U D;  5AQB A;  4P6B A;  5FQJ A;  3FZC A;  3ISG A;  5L2F A;  5EVI D;  2ZQ8 A;  1RP5 A;  3UPN A;  4M3K A;  4UA6 A;  4CPK A;  3HLW A;  1BT5 A;  1DJB A;  3MZD A;  5GL9 A;  5A90 A;  4EBL A;  4A5R A;  3IF6 C;  5HAI A;  5TFQ A;  4JXV A;  5DTT A;  1KVM A;  1I2S A;  1XA1 A;  4X53 A;  1IYP A;  4OQG A;  3P09 A;  3O3V A;  5EOE A;  1IKG A;  1FQG A;  1NRF A;  2WGV A;  2ZC6 B;  3LCE A;  1MKI A;  3FKV A;  3NBL A;  2HP5 A;  3Q1F A;  5CHJ A;  4EQI A;  3IH8 A;  1BZA A;  5M19 A;  2PU2 A;  3AGD A;  4HBU A;  2Y2G A;  1DJA A;  1FR6 A;  1K6R A;  3UPO A;  1PZP A;  1ES5 A;  4GN2 A;  2WGI A;  4UA7 A;  4DDY A;  5M18 A;  1EI5 A;  3BFE A;  3GVB A;  4WZ5 C;  2J9P A;  1L2S A;  4LV3 A;  3UY6 A;  5HL1 A;  3N4I A;  3PBR A;  5FQQ A;  3Q81 A;  3P98 A;  5HW3 A;  5FAO A;  2XK1 A;  4F94 A;  1FR1 A;  1I5Q A;  3FV7 A;  3UO9 A;  4ZTK A;  3UNW A;  1FSY A;  4KZA A;  4PM6 A;  5CTM A;  1MWT A;  3OPH A;  2J8Y A;  1ESU A;  1E4D A;  3HLG A;  2IWD A;  2HP6 A;  2ZC7 A;  1S6R A;  5I94 A;  3VP3 A;  2QPN A;  2I72 A;  5FDH A;  3IH9 A;  4FH2 A;  5CER A;  3SH9 A;  1XGI A;  3VFH A;  1FCO A;  4KG5 A;  4KG2 A;  2ZM0 A;  1CI8 A;  2Z2L B;  4OLG A;  1HD8 A;  3ZG9 B;  4KEN B;  2Y59 A;  5A92 A;  1RCJ A;  3PBO A;  4OOM A;  1XX2 A;  3E2L A;  3HLB A;  1OME A;  1Q2P A;  3ITA A;  1W8Q A;  4MBH A;  4R1G A;  5HAR A;  2HPB A;  3OCL A;  4R0Q A;  4X69 A;  4PMA A;  1DJC A;  2EFU A;  1NYM A;  3O88 A;  1L0E A;  1WYB A;  2OLV A;  4EV4 A;  3A3J A;  5DTK A;  1ES2 A;  5FI6 A;  4E6W A;  1HTZ A;  3HL9 A;  4PPR A;  2WAF A;  1DY6 A;  1Y54 A;  2XGN A;  3PAE A;  4IVI A;  1E3U A;  1KGF A;  2H5S A;  4MLL A;  3HLD A;  1KE3 A;  3HUN A;  4OOY A;  1ZG6 A;  4X56 A;  3V50 A;  2ZQC A;  3PTE A;  5U47 A;  1XGJ A;  1FOF A;  3IT9 A;  4OLD A;  4RYE A;  1ERM A;  1PZO A;  3MZF A;  4ZJ2 A;  5GLD A;  3IF6 A;  3ZFZ A;  3VOY A;  2G2U A;  5JYO A;  4E3K A;  1K25 A;  1LL9 A;  4QD4 A;  3ZHH A;  3BYD A;  5EUA A;  4DE3 A;  1PI4 A;  1Z6F A;  4E3L A;  5KSH A;  2XFT A;  3HUM A;  2Y2N A;  4N9K A;  4LCL A;  2P74 A;  3HLE A;  4MBK A;  4S2I A;  3C7U A;  3WRT A;  2XD5 A;  4EUZ A;  2HDQ A;  1YLW A;  1KGE A;  1GA9 A;  2JCH A;  3G31 A;  4WEK A;  2EXB A;  1TVF A;  4H8R A;  1SDN A;  2OSU A;  4QY6 A;  3WS1 A;  3RJU A;  3MKF A;  4S2N C;  4QB8 A;  1XPB A;  1CEG A;  4DE2 A;  2V20 A;  5TGF A;  1YM1 A;  4GD8 A;  4ZBE A;  4EBP A;  4E6X A;  3WS4 A;  3VMA A;  3ZVT A;  2UWX A;  1NY0 A;  2H0Y A;  4ZAM A;  3CZD A; 
#chains in the Genus database with same CATH topology
 5TBM B;  5KIZ A;  1S0W A;  2Y2O A;  1NWZ A;  5DJU A;  3KYE A;  3ULF A;  4RX3 A;  2HP9 A;  1IYO A;  3IHA A;  1SKO A;  3LID A;  1AXB A;  2ZM2 A;  3NOU C;  3T1S A;  4Y2F A;  3FG8 A;  1MY8 A;  1SZV A;  1Q2Q A;  1OTB A;  1LHY A;  4NXF A;  4OVD A;  3JVU A;  1MZU A;  2LB9 A;  1H8Y A;  3NOP C;  3G34 A;  5L10 A;  3MR0 A;  2WAD A;  2V1B A;  4OPY A;  4YNR A;  2VV6 A;  3RXW A;  3F1O B;  4MCW A;  2PYR A;  2Y2K A;  5CED A;  3V67 A;  1ACF A;  4F3L B;  1LT0 A;  3BLS A;  4DRT A;  4RX2 A;  4YOF A;  4OON A;  1H8Z A;  5KZH A;  3ZNT A;  2PD7 A;  3GDI A;  1XKZ A;  2I9V A;  4EXO A;  4P6Z S;  3E98 A;  3VP4 A;  3T50 A;  2QMI A;  1L0D A;  5I5L A;  3H7W B;  3PHY A;  3BFC A;  3UDI A;  3FKW A;  3F1P B;  5EE8 A;  4JPM A;  5CGX A;  1C3B A;  2O9A A;  3AGE A;  3ZGA B;  4B9O A;  3T4T A;  1F2K A;  2L1M A;  1XJ4 A;  1P0Z A;  3IXH A;  3OZH A;  4HH3 A;  4KUO A;  4NEE D;  3NY4 A;  4DMZ A;  1P9R A;  2P08 A;  1VET B;  2WUQ A;  3ZCZ A;  1XJ6 A;  5E2F A;  2V1A A;  2FFY A;  4H6J B;  3B33 A;  1FCN A;  4S2L A;  2PD8 A;  4Y0O A;  4YIN A;  3VSK A;  5JYP A;  3TW8 A;  2Y2H A;  4N1H A;  3H82 A;  1D7E A;  2PBD P;  4B4Z A;  2J80 A;  2RCX A;  3SS4 A;  3S7Q A;  4HOI A;  5FI7 A;  1ZTU A;  2ZC3 B;  4OOL A;  1OJG A;  2O0Y A;  3SOI A;  4I3I A;  1YSQ A;  2H10 A;  2CMN A;  1ES3 A;  3VV4 A;  4IED A;  4LPZ A;  2B95 A;  2A24 A;  4K08 A;  4HY8 A;  5HZH A;  3N6I A;  1M40 A;  3VE3 A;  3GTC A;  3TOI A;  3SZT A;  1Y4O A;  5J3W A;  5DKK A;  4EES A;  5DFX A;  3IF6 B;  4DF6 A;  4R4R A;  3T4O A;  4XT2 A;  4DN0 A;  1ERO A;  3MZE A;  4DE1 A;  4L0L A;  3N7W A;  1Z09 A;  5M1A A;  3SW1 A;  3NC8 A;  3M6H A;  3D3O A;  2VGL M;  4S2M A;  5DF9 A;  1XA7 A;  1K55 C;  2QJ7 A;  3IX4 A;  3V3S A;  1X0O A;  2X71 A;  2G7U A;  3DWK A;  4B88 A;  4DJ2 A;  1H5X A;  4U0T A;  2OLU A;  3LEQ A;  2WKQ A;  2HDS A;  2R9X A;  1PNE A;  3FWL A;  1T19 A;  4KQD A;  5MC7 A;  3BJN A;  3T12 B;  4KZ4 A;  1SKO B;  5FL3 A;  5FQI A;  3BWL A;  5CGS A;  4LRX C;  5CX7 A;  3A3E A;  3LEZ A;  3G35 A;  2ZLY A;  1RGZ A;  3UB8 A;  1HLU P;  3PBT A;  3RFB A;  4HHD A;  2Z6C A;  4NET A;  2PR6 A;  3LGO A;  4X25 A;  3VP1 A;  3V3R A;  3FC7 A;  4PKY G;  1KE4 A;  1J3W A;  2WKI A;  4P85 A;  3WS0 A;  3BFG A;  3CJM A;  3V5M A;  4KZB A;  1YLZ A;  2C6W B;  1CF0 A;  4GJ4 A;  2VX8 A;  5DF8 A;  4UHU A;  4BJP A;  5FAS A;  5TR7 A;  3MQO A;  4O01 A;  2EX9 A;  1LSW A;  3NI9 A;  4Q8I A;  3QP5 A;  5HX9 A;  2VZW A;  4JF5 A;  1E25 A;  4KG6 A;  4N9L A;  4S2K A;  4ESP A;  1KDS A;  3IQA A;  2QJ5 A;  3UPP A;  4C3Q A;  3OC2 A;  4C6Y A;  3C5A A;  4MBF A;  1JWP A;  4IVK A;  2W3G A;  1K55 A;  2X02 A;  2WKE A;  1VQQ A;  2PT7 A;  3ZNY A;  1TDL A;  4HIA A;  3VP2 A;  5CRF A;  4HEF A;  3OLO A;  4X68 A;  5HDD A;  3BY9 A;  3OPP A;  1DP8 A;  3GQZ A;  4BBV A;  5FAP A;  3C4P A;  3DTI A;  5F6A A;  4I3J A;  1VEU A;  1XJ3 A;  4JXG A;  3K3D A;  3VOZ A;  5DFY A;  2M7V A;  1BT5 A;  5HAI A;  5DTT A;  1NLZ A;  1XA1 A;  4X53 A;  3P09 A;  3CAX A;  5EOE A;  2ZC6 B;  3LI8 A;  3NBL A;  1MKI A;  5CHJ A;  4BBT A;  2GNX A;  2PU2 A;  4ETZ A;  1DJA A;  1FR6 A;  3UPO A;  1PZP A;  4UA7 A;  5M18 A;  3BFE A;  2J9P A;  2V0U A;  2UV0 E;  2W3F A;  4F94 A;  1OT6 A;  3UO9 A;  4ZTK A;  3UE6 A;  2INW A;  1A0K A;  2M1C A;  1ESU A;  1E4D A;  3KYZ A;  3GEC A;  2ZM0 A;  4OLG A;  1AWI A;  5TBM A;  3CWF A;  2PYP A;  1W8Q A;  2W1R A;  4MBH A;  2M7U A;  4R0Q A;  3O88 A;  1WYB A;  2OLV A;  3QP1 A;  4XT2 B;  2P7J A;  5DTK A;  5HWV A;  4E6W A;  3HL9 A;  1Y54 A;  2XA7 M;  3V50 A;  1XGJ A;  5EM0 A;  3IT9 A;  2QKP A;  4OLD A;  3MZF A;  4ZJ2 A;  3MSH A;  2QYB A;  4QD4 A;  3ZHH A;  3BYD A;  5HWT A;  2Y2N A;  2PHY A;  3C7U A;  4GS9 A;  1OPX A;  3F1O A;  3G31 A;  2EXB A;  1TVF A;  4X1L A;  1SDN A;  2K7S A;  4F3L A;  3MKF A;  4S2N C;  4EW7 A;  1JNU A;  1CEG A;  4ETX A;  4EBP A;  4E6X A;  5J4E A;  3ZVT A;  1NY0 A;  3FPV A;  3IWI A;  4GW9 A;  3UME A;  2VEA A;  3UE3 A;  1QME A;  1PWD A;  1CEF A;  1XFQ A;  3VE4 A;  3HJI A;  3WS2 A;  3CHW P;  1LI0 A;  4QHC A;  3F1P A;  4YWZ A;  4FSF A;  3EEA A;  4UQI M;  5BOH A;  2Q0O A;  3BQA A;  1G6O A;  3BW6 A;  5KSC A;  3IXB A;  3DBA A;  3W8K A;  2Q9N A;  3S7O A;  4B93 A;  2K31 A;  1QMF A;  5IS1 A;  1IEL A;  2WYX A;  1VET A;  1S4S A;  3T1R A;  3ZG8 B;  4ZJ3 A;  1DP9 A;  2JKR I;  1YLJ A;  3ZYT A;  1ZC2 A;  2O9B A;  1FSW A;  3G30 A;  4NXB A;  3G4P A;  1STZ A;  1L0G A;  4BL2 A;  2QZ6 A;  3UB9 A;  2J3T D;  3PAG A;  4ID4 A;  3HVF A;  5GHY A;  1NYY A;  3IBR A;  5D3O A;  2J9O A;  1SHV A;  4WEJ A;  3QP4 A;  1UGU A;  5HAQ A;  1W5D A;  2XH9 A;  2ZOI A;  3IF5 A;  2W3H A;  1JVJ A;  1RGY A;  3OPL A;  3UB6 A;  4GLQ A;  2EX2 A;  5F5Y A;  5EVL A;  5EOO A;  2WGW B;  1MBL A;  5AQ9 A;  2Y2J A;  3NUL A;  5J8X A;  5FQM A;  1XP4 A;  2IWC A;  3T4S A;  1JTG A;  2EX8 A;  4PHT A;  5E43 A;  3VP0 A;  3W4Q A;  3EGX C;  2ZQD A;  3CIT A;  4WUJ A;  5GHZ A;  2J7V A;  3OBF A;  4NG2 A;  1F9I A;  4Z1W A;  2KDK A;  3V39 A;  3W4O A;  3TE8 A;  4BBU A;  4GDB A;  5CGW A;  3HLF A;  4MEZ A;  3NJA A;  2JKF A;  1YLP A;  3T4L A;  3LYX A;  2ZOH A;  4I5S A;  5FDS A;  2XDM A;  5CEB A;  3NDE A;  4LGW A;  3C4O A;  3OCN A;  4KQQ A;  4BLM A;  3BFD A;  3CUE C;  2WKH A;  4HJ3 A;  4CLC C;  3TJZ C;  5GLC A;  5FAQ A;  4Y5F A;  1ERQ A;  2XF3 A;  1LL8 A;  1PYY A;  4BD1 A;  5E2G A;  4M4X A;  4GKU A;  2Y79 A;  5GLA A;  1NZO A;  2V8F A;  1ONH A;  4LV0 A;  1EW0 A;  4JBF A;  3D72 A;  4X55 A;  2PR5 A;  2JKG A;  3D9Y A;  2HDU A;  5CTN A;  4GS9 B;  4BL3 A;  3G2Y A;  3IS2 B;  2IWB A;  4EUV A;  4Y0U A;  3TSG A;  2W1T B;  2Y2M A;  3U4L P;  3KSG A;  2ZQ9 A;  3BFF A;  1T18 A;  5CXW A;  1IFQ A;  4MN7 A;  1JWV A;  4PM9 A;  2OV5 A;  4IUH A;  2XQZ A;  3B47 A;  2ZC5 B;  2JHE A;  3LO7 A;  5HSQ A;  5DKL A;  4E3I A;  1N4O A;  2Y8H A;  4XUX A;  2ZC4 B;  3CPT B;  5E2E A;  1FIL A;  2KLI A;  1PWC A;  2JN7 A;  5F1G A;  2VKS A;  3UB7 A;  3WRZ A;  2ACG A;  3M6B A;  1U60 A;  4QY5 A;  3PXP A;  1K57 C;  3H9W A;  3SS3 A;  1G5U A;  4IHQ A;  3MKE A;  3ZG7 B;  5A8B A;  1KDW A;  4OH0 A;  4IBX A;  3PBQ A;  4K0W A;  4Y3I A;  4HI4 A;  3A3D A;  4R3B A;  3SH8 A;  3VFF A;  2R9W A;  1PIO A;  1YLT A;  2P04 A;  3HLC A;  4FH4 A;  4LV2 A;  5CHU A;  4JF6 A;  2V8C A;  3M2K A;  3L9K A;  2EA9 A;  4Y7P A;  3N8S A;  5HD3 A;  1BUE A;  3Q82 A;  3MXR A;  2D02 A;  2FFF B;  1IYS A;  1G68 A;  2V2F F;  4WN5 A;  2C5W B;  3FYZ A;  3E0Y A;  1ALQ A;  3BEC A;  3LIB A;  3OOV A;  5G4Y A;  1K38 A;  4GHI B;  2Y91 A;  3N8L A;  4KZ3 A;  1K54 C;  3ZG5 A;  2Y4A A;  5A93 A;  1GHM A;  4NKP A;  1PW1 A;  3T4Q A;  1L3L A;  5HDC A;  1DJB A;  2BTF P;  3MZD A;  4EBL A;  1IYP A;  1FQG A;  3Q1F A;  3LCE A;  5M19 A;  2Y2G A;  1K6R A;  4HP9 A;  3S7P A;  1EI5 A;  4WZ5 C;  3UY6 A;  1L2S A;  3N4I A;  2J3W A;  5HW3 A;  2Z6D A;  5EFW A;  4PM6 A;  5CTM A;  1P97 A;  1YSP A;  1MWT A;  4EET B;  2J8Y A;  5G4Z A;  1S66 L;  4NXG A;  2VV7 A;  5FDH A;  1HD8 A;  2LB5 A;  5A92 A;  4OOM A;  5EV0 A;  3C38 A;  3E2L A;  1OME A;  4CQH A;  4R1G A;  5HPF A;  5HAR A;  3OCL A;  3VOL A;  2AVX A;  3C2W A;  4EV4 A;  5FI6 A;  3JVV A;  4PPR A;  2WAF A;  2XGN A;  2OWH A;  4RQ9 A;  4Q0J A;  1KGF A;  2H5S A;  4OOY A;  1ZG6 A;  4X56 A;  2EWW A;  3U2A A;  5HL6 A;  2E8J A;  3PTE A;  2XSS A;  3EWK A;  1FOF A;  5EM1 A;  2GZA A;  5GLD A;  3T1X A;  3MMH A;  3ZFZ A;  2G2U A;  5JYO A;  4JGR A;  1LL9 A;  5EUA A;  4E3L A;  4GCZ A;  2P74 A;  4EUZ A;  2JCH A;  1V9Z A;  3NEC A;  2VV8 A;  4LRY C;  2OSU A;  4QY6 A;  2QHK A;  1XPB A;  4DE2 A;  2V20 A;  5TGF A;  4GD8 A;  4ZBE A;  2VA0 A;  5AVF A;  3HCY A;  2WZX A;  1TEM A;  3S4X A;  2NUT C;  2QWS A;  3MJQ A;  4CLC B;  3O86 A;  4OQ0 A;  3BLM A;  1N9N A;  1CI9 A;  3K3C A;  4LCM A;  1SKF A;  1FIK A;  4WL9 A;  2EX6 A;  2ZMV A;  4GDN A;  2WGW A;  3TRC A;  5C5K A;  2L0W A;  1KE0 A;  1I2W A;  2W3D A;  4PM7 A;  5AJG A;  5F68 A;  4E3O A;  4P6Z M;  2ZQA A;  2E8I A;  4OPZ A;  4DKI A;  1NZU A;  2EWV A;  1WE4 A;  2PAV P;  3FPW A;  4DXC A;  1KVL A;  4ZJ1 A;  3S1Y A;  3JPU A;  3LI9 A;  2B02 A;  1Y28 A;  2JBF A;  4JGP A;  2HJE A;  3MF0 A;  2XRO A;  1JTD A;  5LBR A;  2JC7 A;  3DW0 A;  1F98 A;  4EEP A;  1MC0 A;  3R4K A;  3NHQ A;  1K0K A;  1BLC A;  1PI5 A;  4S2P A;  2P9V B;  4KZ6 A;  4E3M A;  3LR3 A;  2B5R A;  5FAT A;  3BM6 A;  5DJT A;  2JE5 A;  1PW8 A;  3WS5 A;  3Q7V B;  2K2N A;  4RVA A;  3D4F A;  4IBR A;  5F83 A;  3RTY A;  4G3K A;  2WZZ A;  3GSG A;  2XFS A;  4XUZ A;  3IXG A;  4GB7 A;  2JKR M;  5G18 A;  4GZB A;  4R23 A;  3IS2 A;  3A3I A;  1S67 L;  5IT5 A;  2ZQ7 A;  3F1N B;  4E3J A;  2W1T A;  2EFX A;  2PBY A;  2H0T A;  4U0X A;  1ZKJ A;  4NK3 A;  1W8Y A;  2XEP A;  2L4R A;  3VSL A;  4JLF A;  1BLH A;  4BWI A;  2Y2Q A;  4WBG A;  2ZL1 B;  4BQM A;  1M6K A;  5FEG A;  4R4S A;  5IHV A;  2VLG A;  5CHM A;  3EQU A;  3MXQ A;  5HAP A;  3CPT A;  5L8M A;  5GLB A;  3KSF A;  4DDS A;  4L9F A;  2VGK A;  3UDF A;  4I3A A;  3LIA A;  4DE0 A;  3EQV A;  1OTE A;  3DWZ A;  4OP5 A;  1EWZ A;  4QJG A;  1ESI A;  3RH8 B;  4GD6 A;  5EVI C;  1NXY A;  2V9A A;  5FEF A;  4WEL A;  1S4R A;  2W0N A;  1H0M A;  1K4F A;  1KOU A;  5HD5 A;  4Y0T A;  3B3X A;  4JF4 A;  4WM9 A;  3QNB A;  4RA7 A;  3S22 A;  5E2H A;  1IEM A;  3MS6 A;  3NOT C;  1YKD A;  4S2N A;  4LV1 A;  1WA9 A;  3LY3 A;  1N9B A;  2XR0 A;  4ARZ B;  4O0P A;  3HRE A;  3WWX A;  1P9W A;  1IOU A;  2BG1 A;  3PBN A;  4D60 A;  3GMW A;  3T4K A;  3M2J A;  4GHI A;  2OAP 1;  1LL5 A;  4N92 A;  2XLN A;  1D06 A;  2WK0 A;  5FSR A;  4MN5 A;  4N1X A;  1LSX A;  3O5Y A;  2D01 A;  4IUK A;  5L07 A;  1S1Y A;  1YMS A;  2DNS A;  3RXX A;  1H3Q A;  4HBT A;  1SCW A;  3ZDJ A;  5EVI A;  4PM8 A;  4KUK A;  2PU4 A;  3LIF A;  5DF7 A;  3IWO A;  1W63 M;  1GHP A;  1BUL A;  2PRF A;  3BRM A;  4HNB A;  2A3U A;  3LR4 A;  4JGQ A;  2JKT M;  5F82 A;  2A49 A;  2O9C A;  2X01 A;  5AQ7 A;  4R3A A;  1TD5 A;  3MBZ A;  4U3T A;  4GNU A;  3EOI A;  2Y2I A;  3IX8 A;  1OJ5 A;  2DRW A;  1GA0 A;  4CLC D;  3NCK A;  1K6S A;  3BEB A;  3BY8 A;  5DTS A;  3UB5 P;  5F69 A;  2O99 A;  4DJ3 A;  1E3U D;  4P6B A;  2KOI A;  3DTK A;  5L2F A;  1XFN A;  2ZQ8 A;  4UA6 A;  3HLW A;  5A90 A;  4A5R A;  4QWO A;  5TFQ A;  3IX3 A;  1I2S A;  3MQQ A;  4OQG A;  3O3V A;  4NXE A;  5K5B A;  3FKV A;  2HP5 A;  4EQI A;  1BZA A;  3AGD A;  4HBU A;  1OTI A;  2H28 A;  4GN2 A;  2WGI A;  2V0W A;  1TS7 A;  4WLA A;  5HL1 A;  4LV3 A;  1T1A A;  3P98 A;  5FAO A;  1I5Q A;  4ME4 A;  3UNW A;  1T1C A;  2JKT I;  4Y17 A;  3OPH A;  1NRJ A;  3HLG A;  2IWD A;  2HP6 A;  1S6R A;  3VP3 A;  3IH9 A;  4FH2 A;  3SH9 A;  3C30 A;  3VFH A;  4KG5 A;  4KG2 A;  4LLO B;  1CI8 A;  5TJJ A;  2Z2L B;  3ZG9 B;  2OOL A;  4KEN B;  2Y59 A;  1RCJ A;  4Q0I A;  1XX2 A;  3B42 A;  3HLB A;  3CUE A;  3S7N A;  2HPB A;  4X69 A;  4CLC A;  1DJC A;  2EFU A;  2ZBB A;  1ES2 A;  1DY6 A;  3PAE A;  4UEY A;  1E3U A;  3HUN A;  4CLC E;  1CQA A;  2ZQC A;  5U47 A;  1PZO A;  2MJ6 A;  4O8G A;  3QP2 A;  3LIC A;  5HDS A;  5HWW A;  5KSH A;  1Z6F A;  3HUM A;  4N9K A;  4LCL A;  1NLY A;  3WRT A;  2XD5 A;  1XJ2 A;  4MDZ A;  1KGE A;  2W27 A;  3PYP A;  4H8R A;  3WS1 A;  3T1Q B;  4R38 A;  3RJU A;  2XA7 S;  3HJK A;  4QB8 A;  3G6O A;  1YM1 A;  3VMA A;  2UWX A;  5FA7 A;  2ZJ9 A;  2H0Y A;  4ZAM A;  3CZD A;  3GR2 A;  4WMC D;  3TG9 A;  3UE0 A;  5L09 A;  1TS8 A;  2P9V A;  3EEH A;  4K91 A;  4CJN A;  4MN6 A;  1TDG A;  2ZD8 A;  3IHB A;  3LR0 A;  1K57 A;  1YMX A;  2HDR A;  5EVI B;  3Q7V A;  3R7W A;  3Q7Z A;  3QHY A;  4C75 A;  1TS0 A;  4EBN A;  3LY4 A;  4I38 A;  5J7E A;  3MFD A;  4WZ4 A;  2XD1 A;  4S2O A;  4OQI A;  1W7F A;  1V9Y A;  2KX6 A;  3N8R A;  3AGF A;  4EQ1 A;  3G32 A;  5EEC A;  1YQS A;  2GDN A;  4QU3 A;  1O07 A;  4LRZ E;  1JWZ A;  1LLB A;  3F1N A;  3IBJ A;  4UQI S;  5HFO A;  5CEC A;  2EXA A;  4FTX A;  4D2O A;  5EPH A;  2ZL1 A;  2HJ9 C;  4Z9Q A;  4WMC A;  2WKP A;  3E4O A;  2Y2L A;  4OPR A;  1K54 A;  3A3F A;  1BTL A;  3IXD A;  4KZ7 A;  1D1J A;  1G6A A;  4EER A;  1K56 D;  5GHX A;  3UE1 A;  5KMW A;  3GRJ A;  4BEN A;  4YFM A;  1GCE A;  1ODV A;  4X6T A;  3ZG0 A;  3QP8 A;  1YLY A;  1O7E A;  3KO6 A;  1IKI A;  1LI9 A;  3A0S A;  4OPQ A;  2BLS A;  5FQ9 A;  4KZ8 A;  4UAA A;  1CK3 A;  3GV9 A;  3I7J A;  2G2W A;  3PBS A;  4WZ5 A;  2BAS A;  4HJ6 A;  1N9L A;  4HH2 A;  1L0F A;  1J9M A;  3CI6 A;  1DP6 A;  5FI2 A;  3ZVW A;  4IJG A;  4GOG A;  3QP6 A;  5HPI A;  1PFL A;  4P87 A;  3SH7 A;  4R3J A;  3UDX A;  4ARZ A;  3IWQ A;  3CMZ A;  3KYQ A;  1GSW A;  1ES4 A;  1VM1 A;  4EU0 A;  4LEN A;  3O87 A;  2XRN A;  1HVB A;  4HES A;  5AQA A;  1TF1 A;  5DVA A;  4G3V A;  3A0R A;  1NJ4 A;  4Q0H A;  4JXW A;  4B4X A;  4P0M A;  1N9O A;  1BLS A;  2A2L A;  3K2N A;  2WAE A;  2HF6 A;  4O7D A;  4KQR A;  4EWF A;  4R6L A;  3NDG A;  1MWS A;  1MPL A;  1GHI A;  1YT4 A;  3W4P A;  1K56 A;  3ZQ5 A;  1T1B A;  4X1M A;  3ITB A;  3MQ0 A;  1HZO A;  4ZDX A;  3DTE A;  1LSV A;  3H82 B;  3LUQ A;  4KZ5 A;  3JYI A;  3QNC A;  3G2Z A;  3HUO A;  4LFU A;  2V1Z A;  5AVE A;  1VB6 A;  2Z2M B;  4PM5 A;  3E2K A;  1YPR A;  1FCM A;  1BSG A;  3P01 A;  4KQO A;  2Y55 A;  3NIA A;  4BD0 A;  1GSV A;  4UA9 A;  4MMN A;  3LIE A;  1G28 A;  5A91 A;  3Q07 A;  2A24 B;  1SDE A;  1MWU A;  2W3E A;  3CG5 A;  1BLP A;  2RL3 A;  3SS5 A;  3R7W B;  1IYQ A;  5FQK A;  2HGV A;  1H8M A;  3W2Z A;  4XXR A;  1MXO A;  1S1Z A;  2YKF A;  3DAV A;  4WYY A;  4JXS A;  1MKM A;  4II7 A;  4ZRR A;  1ZG4 A;  4OP8 A;  1PWG A;  3LFV A;  2VJW A;  2HV1 A;  4R70 A;  3EGD C;  4PKY A;  1XXM A;  2Q9M A;  4JKT A;  4FOF A;  1WYC A;  3DTM A;  3MFX A;  5IU1 A;  2GX5 A;  3P7N A;  4KZ9 A;  4FD8 A;  3T4J A;  2DMW A;  3C7V A;  4HJ4 A;  4EEU A;  4DXB A;  4G3W A;  1W79 A;  3PR6 A;  4OQH A;  4FCF A;  2Y2P A;  5F1F A;  1ZHH B;  2HZ5 A;  2PDR A;  1F5M A;  4MNR A;  1K4E A;  1KGG A;  3OPR A;  3E4Q A;  1ONG A;  4OKP A;  4K0X A;  1TS6 A;  3CLO A;  1YAX A;  2VGJ A;  2ZM8 A;  3MXS A;  4S2J A;  4E3N A;  3UN7 A;  3ICY A;  4JGO A;  2ZMA A;  1BYW A;  1MWR A;  4QPR A;  4FUW A;  3HBR A;  2DCF A;  4L9G A;  3BQ8 A;  2OAQ 1;  5FQJ A;  3H7W A;  5AQB A;  3FZC A;  3ISG A;  5EVI D;  1RP5 A;  3UPN A;  4M3K A;  4CPK A;  4BMW A;  2ZMF A;  5GL9 A;  3IF6 C;  4JXV A;  2VK3 A;  1KVM A;  3E4P A;  1IKG A;  3WS4 A;  1NRF A;  2WGV A;  3KSH A;  4HQA A;  3IH8 A;  2B18 A;  1VHM A;  1ES5 A;  4DDY A;  3GVB A;  3PBR A;  5FQQ A;  1PRQ A;  3Q81 A;  2XK1 A;  5EVE A;  1FR1 A;  1CJF A;  3FV7 A;  1FSY A;  3A0V A;  4KZA A;  4L9E A;  4H6J A;  2OWJ A;  3UMD A;  2ZC7 A;  5I94 A;  4E04 A;  2QPN A;  2I72 A;  2IA2 A;  2J3T C;  1OT9 A;  5CER A;  1XGI A;  3LR5 A;  1FCO A;  1DRM A;  1W63 Q;  3KX0 X;  2VGL S;  1VEU B;  2FZ0 A;  3PBO A;  3C8C A;  2YKH A;  1Q2P A;  3ITA A;  2WKR A;  4PMA A;  1NYM A;  1L0E A;  3A3J A;  4AFI A;  1HTZ A;  2R78 A;  4IVI A;  4MLL A;  3HLD A;  1KE3 A;  1OTA A;  4HP4 A;  1OTD A;  1GSX A;  4RYE A;  1ERM A;  1UWP X;  3IF6 A;  3VOY A;  4Y13 A;  3L7H A;  4E3K A;  2NUP C;  1K25 A;  4DE3 A;  1PI4 A;  4PAU A;  2XFT A;  3HLE A;  2GJ3 A;  4MBK A;  4S2I A;  3KSI A;  2HDQ A;  1YLW A;  1GA9 A;  4WF0 A;  4WEK A;  2FH5 A;  4I39 A;  4Y15 A;  1UWN X;  2CC1 A; 
#chains in the Genus database with same CATH homology
 3GR2 A;  4WMC D;  3TG9 A;  2WZX A;  1S0W A;  3UE0 A;  1TEM A;  3S4X A;  3IWI A;  2Y2O A;  3UE3 A;  1QME A;  3O86 A;  4OQ0 A;  3BLM A;  2P9V A;  4RX3 A;  1PWD A;  2HP9 A;  1IYO A;  3IHA A;  4K91 A;  1CEF A;  4CJN A;  1CI9 A;  3WS2 A;  4LCM A;  1AXB A;  1LI0 A;  2ZM2 A;  1SKF A;  1TDG A;  4QHC A;  2ZD8 A;  3IHB A;  2EX6 A;  1K57 A;  1YMX A;  2HDR A;  4GDN A;  5EVI B;  4FSF A;  3Q7V A;  2WGW A;  3Q7Z A;  3QHY A;  1KE0 A;  4C75 A;  1I2W A;  5BOH A;  4PM7 A;  4EBN A;  3LY4 A;  1MY8 A;  4E3O A;  5KSC A;  1Q2Q A;  3MFD A;  2ZQA A;  2E8I A;  3IXB A;  4OPZ A;  4WZ4 A;  4DKI A;  1LHY A;  2Q9N A;  3W8K A;  2XD1 A;  4OVD A;  4S2O A;  4OQI A;  1NZU A;  1W7F A;  1H8Y A;  1QMF A;  1WE4 A;  1IEL A;  3G34 A;  2WYX A;  3N8R A;  2WAD A;  3AGF A;  4OPY A;  3G32 A;  4DXC A;  5EEC A;  1KVL A;  1YQS A;  4ZJ1 A;  3S1Y A;  3ZG8 B;  4ZJ3 A;  3RXW A;  2Y2K A;  5CED A;  2CC1 A;  2GDN A;  2JBF A;  4QU3 A;  1YLJ A;  1O07 A;  1ZC2 A;  3BLS A;  1JWZ A;  1FSW A;  3G30 A;  4DRT A;  1JTD A;  1LLB A;  3G4P A;  2JC7 A;  4RX2 A;  1L0G A;  3DW0 A;  4OON A;  5HFO A;  4BL2 A;  1H8Z A;  5KZH A;  2QZ6 A;  3ZNT A;  5CEC A;  2EXA A;  1XKZ A;  3PAG A;  3HVF A;  4ID4 A;  5GHY A;  1NYY A;  5D3O A;  3VP4 A;  2J9O A;  1SHV A;  4WEJ A;  4D2O A;  5EPH A;  1BLC A;  5HAQ A;  1PI5 A;  4S2P A;  2QMI A;  1L0D A;  1W5D A;  2P9V B;  2XH9 A;  4Z9Q A;  4KZ6 A;  4WMC A;  3BFC A;  3IF5 A;  4E3M A;  3UDI A;  2B5R A;  5FAT A;  1JVJ A;  1RGY A;  3BM6 A;  3OPL A;  3FKW A;  2EX2 A;  2Y2L A;  4OPR A;  1K54 A;  3A3F A;  1BTL A;  2JE5 A;  5EE8 A;  5EVL A;  4JPM A;  1PW8 A;  5EOO A;  3WS5 A;  3Q7V B;  2WGW B;  3IXD A;  1MBL A;  5AQ9 A;  4KZ7 A;  5CGX A;  2Y2J A;  1G6A A;  1C3B A;  4RVA A;  3AGE A;  5J8X A;  3ZGA B;  5FQM A;  3D4F A;  4IBR A;  1K56 D;  5GHX A;  1XP4 A;  2IWC A;  5F83 A;  1JTG A;  2EX8 A;  3UE1 A;  3IXH A;  3OZH A;  5KMW A;  3GRJ A;  3NY4 A;  2WZZ A;  3GSG A;  5E43 A;  3VP0 A;  3W4Q A;  2XFS A;  4BEN A;  4YFM A;  1GCE A;  4XUZ A;  3IXG A;  4GB7 A;  4X6T A;  3ZG0 A;  2WUQ A;  1YLY A;  1O7E A;  2ZQD A;  3ZCZ A;  1IKI A;  5G18 A;  1LI9 A;  4OPQ A;  5E2F A;  2BLS A;  5FQ9 A;  2FFY A;  4GZB A;  4KZ8 A;  5GHZ A;  2J7V A;  4UAA A;  4R23 A;  1CK3 A;  3A3I A;  3GV9 A;  3I7J A;  1FCN A;  2G2W A;  4S2L A;  4Y0O A;  4YIN A;  3VSK A;  5JYP A;  3PBS A;  4WZ5 A;  2ZQ7 A;  2Y2H A;  4N1H A;  4E3J A;  3V39 A;  3W4O A;  4B4Z A;  2EFX A;  2PBY A;  2H0T A;  4GDB A;  5CGW A;  4U0X A;  1ZKJ A;  2RCX A;  1L0F A;  3SS4 A;  1J9M A;  4NK3 A;  1W8Y A;  3HLF A;  2XEP A;  5FI2 A;  3ZVW A;  4MEZ A;  5FI7 A;  3VSL A;  4GOG A;  2ZC3 B;  4JLF A;  4OOL A;  1BLH A;  2Y2Q A;  4WBG A;  1YLP A;  3SOI A;  4BQM A;  1M6K A;  4P87 A;  2H10 A;  3SH7 A;  2XDM A;  1ES3 A;  5CEB A;  4R3J A;  4IED A;  3NDE A;  3UDX A;  3C4O A;  3OCN A;  4KQQ A;  4R4S A;  5IHV A;  3IWQ A;  4BLM A;  3BFD A;  3CMZ A;  5CHM A;  3EQU A;  2WKH A;  1ES4 A;  1VM1 A;  5HAP A;  5GLC A;  5FAQ A;  4LEN A;  3O87 A;  5GLB A;  1HVB A;  4HES A;  1ERQ A;  2XF3 A;  5AQA A;  5DVA A;  4DDS A;  3N6I A;  1PYY A;  2VGK A;  4BD1 A;  3UDF A;  1NJ4 A;  1M40 A;  5E2G A;  4DE0 A;  4GKU A;  3EQV A;  3GTC A;  4JXW A;  5GLA A;  1NZO A;  4P0M A;  3TOI A;  4B4X A;  1BLS A;  3DWZ A;  4OP5 A;  1EWZ A;  4QJG A;  1ESI A;  1ONH A;  2WAE A;  4LV0 A;  4O7D A;  4GD6 A;  5EVI C;  3IF6 B;  1NXY A;  4DF6 A;  4JBF A;  4KQR A;  4R4R A;  4EWF A;  4WEL A;  3NDG A;  1MWS A;  1MPL A;  4X55 A;  1ERO A;  1GHI A;  1YT4 A;  3W4P A;  1K56 A;  2HDU A;  5CTN A;  1K4F A;  4BL3 A;  3ITB A;  3G2Y A;  3MZE A;  2IWB A;  4DE1 A;  4L0L A;  4Y0T A;  3N7W A;  1HZO A;  4ZDX A;  4Y0U A;  5M1A A;  3NC8 A;  3M6H A;  3TSG A;  3B3X A;  3JYI A;  3QNC A;  4KZ5 A;  3G2Z A;  3HUO A;  4S2M A;  4JF4 A;  4WM9 A;  3QNB A;  4RA7 A;  2Y2M A;  5DF9 A;  3S22 A;  1XA7 A;  1K55 C;  2V1Z A;  2Z2M B;  5E2H A;  3V3S A;  4PM5 A;  2ZQ9 A;  2X71 A;  3DWK A;  4B88 A;  3E2K A;  1FCM A;  1BSG A;  4KQO A;  1H5X A;  3BFF A;  1IEM A;  5CXW A;  4U0T A;  2OLU A;  1JWV A;  4PM9 A;  2HDS A;  2R9X A;  2OV5 A;  2XQZ A;  2Y55 A;  3NIA A;  4S2N A;  4BD0 A;  3FWL A;  4LV1 A;  4UA9 A;  2ZC5 B;  3LO7 A;  3LY3 A;  1N9B A;  4E3I A;  1N4O A;  2XR0 A;  4KZ4 A;  3HRE A;  5A91 A;  5FQI A;  3WWX A;  5CGS A;  3Q07 A;  4XUX A;  2ZC4 B;  2BG1 A;  1SDE A;  3A3E A;  3LEZ A;  3G35 A;  1MWU A;  5E2E A;  2ZLY A;  1RGZ A;  3PBN A;  3CG5 A;  1BLP A;  3PBT A;  2RL3 A;  1PWC A;  5F1G A;  3SS5 A;  4NET A;  3GMW A;  1IYQ A;  5FQK A;  3M2J A;  3WRZ A;  3VP1 A;  3V3R A;  3M6B A;  1U60 A;  1LL5 A;  4QY5 A;  4N92 A;  1K57 C;  4XXR A;  1KE4 A;  2XLN A;  3SS3 A;  1MXO A;  2WK0 A;  5FSR A;  2WKI A;  4N1X A;  4WYY A;  3MKE A;  4JXS A;  4P85 A;  3ZG7 B;  3WS0 A;  1KDW A;  3BFG A;  4OH0 A;  3CJM A;  1ZG4 A;  4IBX A;  3PBQ A;  1YMS A;  2DNS A;  4OP8 A;  4KZB A;  1PWG A;  1YLZ A;  3RXX A;  2C6W B;  3V5M A;  4K0W A;  4HBT A;  1SCW A;  3ZDJ A;  5DF8 A;  5EVI A;  3A3D A;  2ZJ9 A;  4PM8 A;  4R3B A;  4UHU A;  4BJP A;  5FAS A;  1XXM A;  3SH8 A;  2Q9M A;  4JKT A;  5TR7 A;  2PU4 A;  1WYC A;  2EX9 A;  3NI9 A;  3DTM A;  4Q8I A;  3VFF A;  5DF7 A;  3IWO A;  5HX9 A;  2R9W A;  4KZ9 A;  4JF5 A;  1E25 A;  4KG6 A;  4N9L A;  4S2K A;  1GHP A;  1PIO A;  4FD8 A;  1BUL A;  3BRM A;  1YLT A;  2A3U A;  1KDS A;  3C7V A;  4DXB A;  3HLC A;  3IQA A;  4FH4 A;  4LV2 A;  3UPP A;  4C3Q A;  5CHU A;  3OC2 A;  4C6Y A;  1W79 A;  4JF6 A;  5F82 A;  3C5A A;  3M2K A;  4MBF A;  4OQH A;  1JWP A;  4FCF A;  2Y2P A;  5F1F A;  4Y7P A;  3N8S A;  2A49 A;  4IVK A;  1K55 A;  2X02 A;  2X01 A;  2WKE A;  4MNR A;  1K4E A;  1VQQ A;  5AQ7 A;  3ZNY A;  1BUE A;  1KGG A;  1TDL A;  3OPR A;  3MBZ A;  3Q82 A;  3VP2 A;  5CRF A;  4HEF A;  4U3T A;  1ONG A;  4GNU A;  4X68 A;  3MXR A;  2Y2I A;  3OPP A;  4OKP A;  2FFF B;  4K0X A;  1IYS A;  2V2F F;  1G68 A;  3FYZ A;  2C5W B;  3GQZ A;  2DRW A;  1GA0 A;  5FAP A;  2VGJ A;  1ALQ A;  2ZM8 A;  3MXS A;  3BEC A;  4S2J A;  3NCK A;  4E3N A;  3C4P A;  1K6S A;  1K38 A;  3UN7 A;  2Y91 A;  3BEB A;  3N8L A;  4KZ3 A;  2ZMA A;  1K54 C;  1MWR A;  5DTS A;  3ZG5 A;  2Y4A A;  4JXG A;  5A93 A;  3HBR A;  1GHM A;  2DCF A;  5FA7 A;  3VOZ A;  1PW1 A;  1E3U D;  5AQB A;  4P6B A;  5FQJ A;  3FZC A;  3ISG A;  5L2F A;  5EVI D;  2ZQ8 A;  1RP5 A;  3UPN A;  4M3K A;  4UA6 A;  4CPK A;  3HLW A;  1BT5 A;  1DJB A;  3MZD A;  5GL9 A;  5A90 A;  4EBL A;  4A5R A;  3IF6 C;  5HAI A;  5TFQ A;  4JXV A;  5DTT A;  1KVM A;  1I2S A;  1XA1 A;  4X53 A;  1IYP A;  4OQG A;  3P09 A;  3O3V A;  5EOE A;  1IKG A;  1FQG A;  1NRF A;  2WGV A;  2ZC6 B;  3LCE A;  1MKI A;  3FKV A;  3NBL A;  2HP5 A;  3Q1F A;  5CHJ A;  4EQI A;  3IH8 A;  1BZA A;  5M19 A;  2PU2 A;  3AGD A;  4HBU A;  2Y2G A;  1DJA A;  1FR6 A;  1K6R A;  3UPO A;  1PZP A;  1ES5 A;  4GN2 A;  2WGI A;  4UA7 A;  4DDY A;  5M18 A;  1EI5 A;  3BFE A;  3GVB A;  4WZ5 C;  2J9P A;  1L2S A;  4LV3 A;  3UY6 A;  5HL1 A;  3N4I A;  3PBR A;  5FQQ A;  3Q81 A;  3P98 A;  5HW3 A;  5FAO A;  2XK1 A;  4F94 A;  1FR1 A;  1I5Q A;  3FV7 A;  3UO9 A;  4ZTK A;  3UNW A;  1FSY A;  4KZA A;  4PM6 A;  5CTM A;  1MWT A;  3OPH A;  2J8Y A;  1ESU A;  1E4D A;  3HLG A;  2IWD A;  2HP6 A;  2ZC7 A;  1S6R A;  5I94 A;  3VP3 A;  2QPN A;  2I72 A;  5FDH A;  3IH9 A;  4FH2 A;  5CER A;  3SH9 A;  1XGI A;  3VFH A;  1FCO A;  4KG5 A;  4KG2 A;  2ZM0 A;  1CI8 A;  2Z2L B;  4OLG A;  1HD8 A;  3ZG9 B;  4KEN B;  2Y59 A;  5A92 A;  1RCJ A;  3PBO A;  4OOM A;  1XX2 A;  3E2L A;  3HLB A;  1OME A;  1Q2P A;  3ITA A;  1W8Q A;  4MBH A;  4R1G A;  5HAR A;  2HPB A;  3OCL A;  4R0Q A;  4X69 A;  4PMA A;  1DJC A;  2EFU A;  1NYM A;  3O88 A;  1L0E A;  1WYB A;  2OLV A;  4EV4 A;  3A3J A;  5DTK A;  1ES2 A;  5FI6 A;  4E6W A;  1HTZ A;  3HL9 A;  4PPR A;  2WAF A;  1DY6 A;  1Y54 A;  2XGN A;  3PAE A;  4IVI A;  1E3U A;  1KGF A;  2H5S A;  4MLL A;  3HLD A;  1KE3 A;  3HUN A;  4OOY A;  1ZG6 A;  4X56 A;  3V50 A;  2ZQC A;  3PTE A;  5U47 A;  1XGJ A;  1FOF A;  3IT9 A;  4OLD A;  4RYE A;  1ERM A;  1PZO A;  3MZF A;  4ZJ2 A;  5GLD A;  3IF6 A;  3ZFZ A;  3VOY A;  2G2U A;  5JYO A;  4E3K A;  1K25 A;  1LL9 A;  4QD4 A;  3ZHH A;  3BYD A;  5EUA A;  4DE3 A;  1PI4 A;  1Z6F A;  4E3L A;  5KSH A;  2XFT A;  3HUM A;  2Y2N A;  4N9K A;  4LCL A;  2P74 A;  3HLE A;  4MBK A;  4S2I A;  3C7U A;  3WRT A;  2XD5 A;  4EUZ A;  2HDQ A;  1YLW A;  1KGE A;  1GA9 A;  2JCH A;  3G31 A;  4WEK A;  2EXB A;  1TVF A;  4H8R A;  1SDN A;  2OSU A;  4QY6 A;  3WS1 A;  3RJU A;  3MKF A;  4S2N C;  4QB8 A;  1XPB A;  1CEG A;  4DE2 A;  2V20 A;  5TGF A;  1YM1 A;  4GD8 A;  4ZBE A;  4EBP A;  4E6X A;  3WS4 A;  3VMA A;  3ZVT A;  2UWX A;  1NY0 A;  2H0Y A;  4ZAM A;  3CZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...