3BYDA

Crystal structure of beta-lactamase oxy-1-1 from klebsiella oxytoca
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
DAIQQKLADLEKRSGGRLGVALINTADDSQTLYRGDERFAMCSTGKVMAAAAVLKQSESNPEVVNKRLEIKKSDLVVWSPITEKHLQSGMTLAELSAAALQYSDNTAMNKMISYLGGPEKVTAFAQSIGDVTFRLDRTEPALNSAIPGDKRDTTTPLAMAESLRKLTLGNALGEQQRAQLVTWLKGNTTGGQSIRAGLPASWAVGDKTGAGDYGTTNDIAVIWPENHAPLVLVTYFTQPQQDAKSRKEVLAAAAKIVTEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase OXY-1
publication title Structural insights into the broadened substrate profile of the extended-spectrum beta-lactamase OXY-1-1 from Klebsiella oxytoca
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Hydrolase
total genus 88
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3bydA00
3VSLA 3N6IA 4OKPA 1BTLA 1BUEA 3IXBA 3JYIA 2H0YA 4RX3A 5FQQA 4BD1A 1IKIA 4OP8A 5DVAA 2XEPA 3FV7A 5FAPA 5FI2A 2ZQ9A 4B88A 1KGEA 1Y54A 3OC2A 2GDNA 3IF6B 1W8YA 2Y2NA 4OPZA 4FD8A 3D4FA 3NC8A 4JXVA 3ZG9B 2QZ6A 1EROA 4D2OA 3MXSA 3Q7VA 5IHVA 5DF7A 4M3KA 3PBRA 3LEZA 1SCWA 2EFUA 4Y0UA 1FSWA 4ID4A 1YM1A 1ONGA 2ZJ9A 5EOEA 1H8YA 3W4OA 3P09A 3S22A 2XQZA 1CK3A 4PM8A 3M6HA 1GCEA 1DJBA 3LY4A 3MKFA 1XKZA 3FYZA 4JXWA 1IYSA 4N92A 1K25A 4XUXA 1K56A 5CGXA 3N7WA 5TFQA 2XD5A 1KVMA 4OQHA 4DRTA 4WEJA 4IBRA 4OONA 4WZ4A 4EBLA 1NZUA 3BEBA 3PBSA 3ZGAB 1FCNA 4KZAA 4P6BA 1YLZA 1YQSA 4OOLA 1N4OA 2G2WA 1WYBA 3PBTA 2Z2LB 4MBKA 1OMEA 1CEGA 1YMSA 3S1YA 4DDSA 1AXBA 4EBPA 3BYDA 1IKGA 1KE0A 1BULA 1YLYA 3W4PA 2ZMAA 3OPPA 5EVID 4OPQA 1S0WA 2WKHA 5DTTA 5L2FA 3IF6C 4PMAA 3WS4A 1W79A 3SS4A 4EWFA 1BT5A 4IVKA 1E3UA 4FH4A 5GHXA 5EVLA 4EBNA 1L0FA 2Y59A 3VP4A 3C5AA 5HL1A 3G2ZA 1NYMA 2EX9A 3A3JA 3O86A 5AQ7A 5F1GA 4BJPA 1MY8A 2UWXA 3E2KA 5HW3A 2R9XA 3ZVWA 4LV2A 1NYYA 4ZDXA 3I7JA 3NIAA 4LCLA 3IXHA 3ZNYA 2WYXA 2Y2MA 1O07A 4LV3A 5HARA 4BL2A 5KSHA 4JF5A 4PPRA 4HESA 4Y0TA 1G6AA 3VOZA 3ZG0A 3IWOA 1MBLA 3OPHA 4NK3A 4S2OA 5A90A 2ZC6B 1L0GA 5GLBA 3G2YA 5FATA 3WRTA 3MXRA 3EQVA 2WAEA 5GLAA 4QB8A 3UPPA 4JKTA 2ZM0A 4OVDA 2I72A 5HAPA 3HLDA 3IF6A 2EXBA 4X6TA 1PI5A 4UHUA 3VP1A 5JYPA 2XLNA 3HUOA 2A3UA 3G35A 1JWVA 2XK1A 3A3FA 4S2LA 4BD0A 3BFEA 3G34A 4JPMA 1K56D 4KQRA 3UE0A 1FR1A 2FFYA 3TG9A 3RXXA 2HP5A 4R0QA 3TOIA 1KDSA 2V20A 5E43A 3SH7A 5FASA 4DXBA 4E3OA 1YMXA 4GDNA 4GB7A 3IH9A 4HEFA 5GLCA 4DE3A 4UA9A 2DRWA 1H8ZA 5J8XA 3QHYA 3VOYA 2ZD8A 5FSRA 4DF6A 3SH9A 2WZZA 3GVBA 5E2FA 1NZOA 5FQIA 5BOHA 1YLWA 3A3IA 1BLPA 3DWZA 1EWZA 4UA6A 4LCMA 2WGVA 5D3OA 4LENA 4GDBA 1NJ4A 4IVIA 4K91A 3OCLA 3MFDA 5GLDA 3IT9A 3OCNA 2IWCA 4KG5A 4GOGA 4N9KA 4EV4A 1E3UD 2WK0A 4MEZA 3C4PA 1IEMA 3UPNA 3CZDA 4S2PA 2Y2QA 3OZHA 5DTKA 2J9OA 3GR2A 5HX9A 4B4ZA 4OPYA 5JYOA 5KSCA 2IWBA 3SOIA 2Y55A 3HLFA 1WYCA 2ZC7A 1Q2QA 1TDLA 3IF5A 3VFHA 1K57C 3IQAA 3IWIA 3N8SA 4XXRA 1LI9A 3HUMA 2J8YA 4FCFA 1PWGA 5DTSA 3O87A 4FSFA 2VGJA 2WGWB 3WRZA 5CHUA 4WYYA 3C4OA 4UAAA 4KZ6A 4JF6A 3PBOA 5CGSA 5GL9A 4XUZA 4X69A 3FWLA 3GRJA 3G30A 5CGWA 4C6YA 3ITBA 1M6KA 4MBFA 1MPLA 4KG2A 4HBTA 4RX2A 3O3VA 4DE0A 4KG6A 2EX6A 4WZ5A 3PBNA 3ZVTA 2V2FF 3LCEA 4X56A 2HDUA 1QMEA 4K0XA 5M18A 3BFCA 2EFXA 3UDXA 3ZCZA 5F1FA 4KQQA 4OOYA 2JCHA 5FQ9A 1PZOA 2H10A 4WMCA 3WWXA 3NDEA 4LV0A 5A91A 2ZQAA 1K6RA 2ZQ7A 1KGGA 3N8RA 1NXYA 5CERA 4EQIA 1I2WA 3LY3A 2XGNA 5E2GA 4CJNA 5FQMA 1JTDA 1YLPA 2ZQ8A 4PM6A 1XX2A 4DDYA 3ZG8B 1ZG6A 3A3EA 1DY6A 2J9PA 5HAIA 4DXCA 2Q9NA 2WADA 1ZC2A 1GHMA 2HDQA 3E2LA 2WZXA 3G31A 3Q82A 3FKVA 4MBHA 4E6WA 4OP5A 4S2NC 5M1AA 3GQZA 1ERQA 2XDMA 4JF4A 5CTNA 1HTZA 2E8IA 5F83A 4X53A 4P0MA 4ZTKA 2Y4AA 4R1GA 2V1ZA 3IHBA 2JBFA 2Z2MB 4ZJ1A 3W8KA 4HBUA 2Y2PA 2XR0A 5F82A 1L2SA 3V50A 5A92A 4DE2A 4BL3A 3BRMA 1CI9A 1W8QA 3BFFA 4GD6A 1HVBA 1ONHA 4OOMA 2Y2JA 2B5RA 1E4DA 2FFFB 4E3IA 3DWKA 5FAOA 1Q2PA 3PAGA 3HLWA 1L0EA 3M6BA 1ES4A 1FR6A 3BECA 1FQGA 1MKIA 3MZEA 4C75A 1MXOA 2Y2HA 2XFSA 4PM7A 2HPBA 3V3SA 3S4XA 3W4QA 3ITAA 2J7VA 4GNUA 4RA7A 4QJGA 2P74A 3Q07A 5DF8A 3IWQA 4X68A 5CECA 1SHVA 2C5WB 1IYPA 2P9VB 1U60A 4QHCA 4R3JA 3VSKA 1HZOA 1BLCA 1M40A 3OPRA 2WGWA 1FCOA 2EXAA 1K54C 3N8LA 3HUNA 4JXSA 1LL9A 4PM5A 4U0TA 3M2KA 2RCXA 3HLGA 1YLJA 2OV5A 1JVJA 3VP3A 2PU4A 1IYQA 2A49A 4KZBA 3HBRA 3MZFA 4R4SA 4UA7A 2PBYA 4WMCD 1K6SA 1MWTA 2G2UA 5A93A 3VP0A 2JC7A 4NETA 3IXDA 2RL3A 3NI9A 4R4RA 3SS5A 3UE3A 4BENA 1ES3A 2QMIA 1PW1A 5GHZA 5EPHA 3V3RA 5CEBA 1ESIA 1VQQA 1KE4A 3HL9A 1KVLA 1KGFA 1VM1A 2ZC5B 5EVIC 1TDGA 4S2KA 2DNSA 3BFDA 3PTEA 5CHMA 1RP5A 4ZJ3A 3ZHHA 4X55A 2EX2A 3C7VA 2C6WB 4E3MA 1K54A 1KDWA 1BSGA 1GHIA 3CMZA 1CI8A 1DJAA 4KZ7A 3HLBA 5EUAA 4E3JA 1XPBA 1XXMA 1J9MA 1GA0A 1TVFA 5FA7A 1YLTA 5FQJA 1ES2A 4KZ4A 2HP9A 2OLUA 1XA1A 1NRFA 5AQAA 1ESUA 2XD1A 2Y2KA 4P85A 3ZNTA 4R23A 4KZ3A 4E3NA 4N9LA 3BFGA 4OLGA 3ZDJA 2QPNA 3ISGA 3CG5A 5CHJA 4JLFA 2ZM2A 3O88A 1S6RA 3G4PA 4CPKA 4OQIA 2H5SA 2WKEA 1JWZA 1PIOA 3IH8A 4WELA 3UE1A 4P87A 4QD4A 1ES5A 3EQUA 3NDGA 3PBQA 4QU3A 2P9VA 3MZDA 4OPRA 4PM9A 2VGKA 4OQ0A 3UY6A 1PW8A 4GN2A 5TR7A 4RYEA 4ZAMA 1FSYA 3IXGA 4KZ9A 1GHPA 4Y0OA 2Y2GA 4S2IA 5KZHA 1K57A 2Q9MA 2Y2LA 4S2MA 3Q1FA 4N1HA 1LL5A 3V39A 4KQOA 1Z6FA 4QY6A 5CEDA 2H0TA 1PI4A 5DF9A 3M2JA 1ALQA 2WGIA 2PU2A 1BLSA 4GZBA 1DJCA 1EI5A 3ZFZA 3WS5A 3GV9A 4IBXA 5M19A 1PZPA 2CC1A 1BLHA 1BZAA 4EUZA 3GSGA 5E2EA 4QY5A 5KMWA 5CTMA 4E6XA 2Y2OA 1RGZA 4U3TA 1PWCA 1FCMA 3HLCA 3UNWA 4F94A 3OPLA 3IHAA 1H5XA 1IELA 5FI6A 2X01A 1NY0A 5CXWA 3ZG5A 4C3QA 5EVIB 1SKFA 1ERMA 1XA7A 1XGJA 5FAQA 1ZKJA 1SDEA 3FKWA 3B3XA 1FOFA 4ZBEA 5HFOA 5FI7A 1RGYA 1I5QA 1PYYA 1W5DA 4GD8A 4ZJ2A 1L0DA 3RJUA 1XP4A 2X71A 4WM9A 2HP6A 1JWPA 1O7EA 1MWSA 2Y2IA 1WE4A 3BM6A 3UDFA 3UDIA 3VMAA 4S2NA 4FH2A 1I2SA 1MWUA 2OSUA 4N1XA 2HDRA 2WAFA 3WS2A 1PWDA 3P98A 3TSGA 4H8RA 4O7DA 1K38A 4OH0A 3VP2A 4S2JA 4DE1A 4YINA 2BLSA 3Q81A 4OLDA 1XGIA 3MBZA 3UO9A 2XH9A 3WS0A 4Q8IA 3Q7VB 2ZQDA 1K4FA 4BQMA 3V5MA 4RVAA 4MLLA 1CEFA 4MNRA 1RCJA 3CJMA 1QMFA 5G18A 1LLBA 3SH8A 1HD8A 4WBGA 4DKIA 1K55C 3DW0A 3ZG7B 3NY4A 2ZC3B 1LI0A 5AQ9A 2XFTA 4KZ5A 5I94A 4B4XA 3DTMA 4IEDA 3A3DA 3HREA 3NCKA 4OQGA 3AGEA 4Z9QA 2WUQA 4GKUA 4JBFA 5CRFA 5EE8A 4WEKA 2OLVA 5GHYA 4Y7PA 3RXWA 4K0WA 5AQBA 2ZLYA 4YFMA 1C3BA 4E3KA 3LO7A 4E3LA 4L0LA 3FZCA 5TGFA 2ZQCA 3NBLA 4A5RA 3UPOA 3PAEA 3AGDA 1MWRA 2XF3A 3C7UA 2IWDA 2DCFA 3QNBA 5E2HA 2HDSA 5EECA 5FQKA 1ZG4A 2EX8A 4KENB 5U47A 4BLMA 2R9WA 2WKIA 3AGFA 2JE5A 1LHYA 4R3BA 5HAQA 2X02A 3MKEA 4JXGA 3VFFA 1SDNA 1K55A 1TEMA 3HVFA 3HLEA 3G32A 1E25A 1YT4A 3SS3A 1GA9A 1JTGA 1KE3A 5EOOA 4LV1A 2BG1A 3BLSA 3N4IA 1N9BA 5EVIA 1G68A 3Q7ZA 4KZ8A 5FDHA 3QNCA 3WS1A 1IYOA 2ZM8A 2ZC4B 3UN7A 3GMWA 4WZ5C 4U0XA 1W7FA 3BLMA 1K4EA 2Y91A 3GTCA
chains in the Genus database with same CATH superfamily
4HJ6A 2V1AA 1MC0A 3N6IA 2H0YA 5FQQA 4OP8A 4B9OA 2Y2NA 4OPZA 3D4FA 2QZ6A 1EROA 3RH8B 3MXSA 3Q7VA 3CUEA 2EFUA 4DMZA 5J3WA 4HH2A 1H8YA 1CK3A 4PM8A 4JGPA 1Y28A 1GCEA 3FYZA 4JXWA 2GNXA 1K25A 5HPFA 1KVMA 4UQIM 4WEJA 4OONA 4WZ4A 2W0NA 2V0UA 3ZGAB 4I3AA 1FCNA 4OOLA 1CEGA 3QP8A 4EBPA 3W4PA 1TS6A 3OPPA 4OPQA 3LI9A 2WKHA 5L2FA 2OWJA 1W79A 4EWFA 1BT5A 4EBNA 3VP4A 5HL1A 2EX9A 2E8JA 4Z1WA 5F1GA 3PR6A 2UWXA 3E2KA 3BQ8A 2R9XA 3ZVWA 3NOPC 4ZDXA 3NIAA 2WYXA 1O07A 1OTBA 5KSHA 2W27A 4Y0TA 1G6AA 3VOZA 5A90A 3G2YA 3LGOA 3WRTA 5GLAA 5HAPA 3HLDA 1PI5A 2A3UA 4HIAA 1JWVA 3T1SA 3KSGA 4X1LA 3A3FA 1K56D 3R7WA 5HDDA 1KDSA 5E43A 2PYPA 4HEFA 1SKOB 4UA9A 5J8XA 3T4TA 3G6OA 3DTEA 1NZOA 3E4QA 1NLZA 4LCMA 5TBMA 4K91A 3MJQA 3OCLA 3LUQA 5AVEA 3OCNA 2JKGA 2ZOIA 2WK0A 3CZDA 4OPYA 5JYOA 1WYCA 1Q2QA 4RQ9A 5F69A 4WF0A 3VFHA 3IWIA 3N8SA 4XXRA 1LI9A 1XJ2A 3O87A 2WGWB 2OOLA 3C4OA 4KZ6A 3PBOA 3BW6A 3G30A 4LGWA 3LIBA 2HDUA 4ARZA 5F1FA 4KQQA 4EXOA 4LV0A 3MQ0A 1GSWA 2XGNA 3L9KA 4CJNA 3MQQA 1YLPA 4PM6A 1IOUA 1ZG6A 2J9PA 4DXCA 4IBRA 2WADA 2YKFA 3E2LA 4GN2A 2BTFP 1S4SA 3BQAA 1ERQA 2XDMA 4G3VA 1HTZA 2E8IA 4EESA 4X53A 5G4YA 2W1RA 2P08A 3ZYTA 3F1OA 4R1GA 2JBFA 4HBUA 2XR0A 5F82A 3V50A 5G4ZA 4DE2A 3BRMA 5HPIA 2K2NA 1HVBA 1ONHA 3DWKA 4X25A 1L0EA 4C75A 3MZEA 4WLAA 1V9ZA 2VV7A 4GNUA 4QJGA 2P74A 2C5WB 2V1BA 2P9VB 4NG2A 3N8LA 4JXSA 3P7NA 3H82A 2RCXA 2OV5A 1JVJA 5FEFA 3MZFA 4UA7A 1K6SA 2PR6A 3VP0A 3IXDA 1DRMA 5EM1A 1ES3A 2QMIA 2W3GA 5EPHA 1KVLA 1KGFA 1VM1A 4GHIB 5EVIC 3TJZC 2QKPA 3E0YA 3BFDA 1RP5A 4O01A 4ZJ3A 2EX2A 3C7VA 2C6WB 3HCYA 1OJ5A 1OT9A 3PYPA 1CI8A 3UB5P 3CWFA 1YAXA 2VKSA 4KZ7A 3HLBA 5EUAA 1OPXA 1XPBA 1J9MA 1TVFA 5FA7A 1YLTA 2A2LA 2J80A 1XA1A 1ESUA 2XD1A 2Y2KA 4P85A 5FL3A 3B47A 3IS2B 3CUEC 3BFGA 3GECA 2A24A 2HF6A 4KQDA 1K0KA 3CG5A 5CHJA 1LSVA 4CPKA 2H5SA 2WKEA 1PIOA 5HWTA 3MZDA 3UY6A 1PW8A 5TR7A 4RYEA 4ZAMA 1FSYA 4Y0OA 1GHPA 4S2IA 4MN5A 3Q1FA 4S2MA 1LL5A 3V39A 2Z6DA 1PI4A 3FG8A 5L07A 2O9CA 3GV9A 5M19A 1BLHA 4EUZA 3GSGA 3CI6A 4NXFA 1H8MA 4U3TA 4F94A 3OPLA 3QP5A 5FI6A 4DJ3A 3TRCA 2O9AA 2HV1A 5CXWA 1N9LA 1XGJA 2W1TA 2ZL1B 3K3DA 1SDEA 3FKWA 4ZBEA 4ZJ2A 1XP4A 4WM9A 1GSXA 2VGLS 3TE8A 1F9IA 2Y2IA 3D9YA 1WE4A 3VMAA 4L9GA 4I3JA 2OAQ1 5DFXA 1MWUA 4N1XA 2WAFA 4H8RA 4OH0A 4KUOA 1XGIA 3UO9A 4Q8IA 2JKTM 1K4FA 4IUHA 4MNRA 1D7EA 4G3WA 5G18A 5LBRA 3DW0A 4HH3A 2DMWA 5HWVA 2ZC3B 1N9NA 3A3DA 4Z9QA 5CRFA 3F1NB 5EE8A 2OLVA 1P9RA 2VGLM 2ZLYA 4YFMA 3LO7A 2ZQCA 3S7PA 4CLCB 4MN7A 1UWPX 3NBLA 5FQKA 3QNBA 2EX8A 3V67A 4BLMA 4GS9A 3AGFA 4D60A 2JE5A 1L3LA 4JXGA 1VB6A 3G32A 2R78A 1LT0A 3LIDA 1JTGA 5EOOA 4EU0A 2FH5A 5AVFA 2GX5A 1G68A 3QNCA 4Y17A 3UN7A 1W7FA 3VSLA 4Q0JA 3IXBA 4BD1A 5DVAA 3B42A 2XEPA 2ZQ9A 1KGEA 1XJ3A 1Y54A 2KOIA 1W8YA 2XSSA 4HOIA 3NC8A 3L7HA 4M3KA 3PBRA 1OTAA 4ID4A 1YM1A 2HJEA 2ZJ9A 3P09A 5L09A 3S22A 2XQZA 3MQOA 3M6HA 2WKRA 4XUXA 1K56A 2M1CA 4HHDA 1NZUA 3BEBA 3PBSA 4KZAA 4P6BA 1N4OA 1WYBA 3PBTA 3S7OA 1OMEA 1YMSA 1AXBA 3BYDA 1KE0A 2XRNA 1YLYA 4MMNA 3EGXC 5DTTA 3LEQA 3IF6C 4PMAA 3WS4A 3NECA 3C8CA 5EVLA 3G2ZA 1NWZA 4DJ2A 5HW3A 4LV2A 3I7JA 3ZNYA 2EA9A 4LV3A 4JF5A 4HESA 3ULFA 3IWOA 5EV0A 3T1QB 4NK3A 2KLIA 5EM0A 5GLBA 3MXRA 3EQVA 3ICYA 4OVDA 2EXBA 3VP1A 5JYPA 2XK1A 3EWKA 4S2LA 2FFYA 3TG9A 4R0QA 2QJ7A 3TOIA 5FASA 1YMXA 3IH9A 4DE3A 2Q0OA 3LR3A 1STZA 2ZD8A 5FSRA 3KSFA 4L9EA 4CLCD 5FQIA 1YLWA 3A3IA 2PHYA 2VV8A 4UA6A 5D3OA 3MFDA 2V8FA 5GLDA 3DBAA 4KG5A 4EV4A 1E3UD 4MEZA 1UGUA 4PAUA 1IEMA 3UPNA 3OZHA 4UQIS 4B4ZA 3KYQA 5KSCA 3HLFA 4YOFA 3FPWA 4LPZA 1H0MA 3C30A 4MDZA 4NXGA 3HUMA 4O8GA 1PWGA 2PBDP 5HDCA 3UE6A 3EEHA 4WYYA 4GCZA 3GRJA 4C6YA 2D02A 2EX6A 4WZ5A 3LCEA 4K0XA 3BFCA 2EFXA 4OOYA 3HJKA 1PZOA 2K7SA 1K6RA 1KGGA 2ZMVA 4P6ZS 1I2WA 2O0YA 4HQAA 1JTDA 2ZQ8A 3A0SA 1XX2A 3ZG8B 1SKOA 3A3EA 3Q82A 3G31A 2VZWA 3KYZA 3GQZA 3KSHA 4JF4A 5CTNA 1T1BA 2ZOHA 5F83A 4PKYA 4BBVA 4P0MA 3U4LP 2KX6A 2B02A 4G3KA 3IHBA 1P0ZA 2FFFB 3MSHA 5FAOA 4E3IA 3H9WA 4XT2B 1MKIA 2Y2HA 4PM7A 2XFSA 3W4QA 3S4XA 4IHQA 4P6ZM 3D72A 2D01A 4ETXA 2P7JA 2VLGA 5DF8A 1W63M 5CECA 4FUWA 4ME4A 2ACGA 1U60A 4R3JA 4GW9A 2XROA 3OPRA 2WGWA 3NOTC 1LL9A 4PM5A 3HLGA 4CLCE 3VP3A 1IYQA 4R4SA 3R4KA 4PHTA 4R4RA 3NI9A 2EWWA 3V3RA 1VQQA 2ZC5B 5HSQA 1S1YA 2DNSA 5CHMA 2W3DA 1X0OA 5TJJA 1K54A 5F5YA 1SZVA 1KDWA 1DJAA 2WKQA 1OTDA 1GA0A 2W3FA 4KZ4A 2OLUA 3EGDC 4R23A 5CX7A 5FDSA 2V0WA 4PKYG 5DFYA 1YKDA 3IH8A 4QD4A 3EQUA 2G7UA 4QU3A 2P9VA 5HZHA 3SZTA 3A0VA 3S7QA 1T1CA 2Y2GA 5DKLA 1K57A 2QHKA 1G5UA 3IX4A 1Z6FA 2PD7A 5CEDA 2H0TA 2IA2A 1ALQA 3M2JA 2PU2A 1BLSA 3EOIA 1TF1A 3UMEA 4R3AA 1BZAA 4GHIA 2Y2OA 2INWA 3UNWA 2CMNA 2X01A 1ZTUA 1ERMA 1ZKJA 3B3XA 4IUKA 4GD8A 1W5DA 2ZMFA 1L0DA 3RJUA 2X71A 4EEUA 3QP2A 2HP6A 1JWPA 1O7EA 3UDFA 3UDIA 3LR0A 1KOUA 2JN7A 2PYRA 3IS2A 4Q0HA 4EUVA 2OSUA 3WS2A 1PWDA 1S4RA 4O7DA 1YPRA 4DE1A 4YINA 2BLSA 3BY8A 1YSPA 3CJMA 1QMFA 2H28A 3SH8A 3E4OA 4DKIA 1K55C 2J3WA 3DTMA 3HREA 4OQGA 4GKUA 1CQAA 5GHYA 3RXWA 5K5BA 4UEYA 2HJ9C 3PAEA 1MWRA 2XF3A 2DCFA 2J3TC 2WKIA 4R3BA 4BMWA 3D3OA 3E98A 3JVVA 3MKEA 1XFQA 4WL9A 1ACFA 1E25A 3U2AA 3EEAA 5F6AA 3CHWP 4EERA 4R70A 3N4IA 4EETB 5FDHA 1DP9A 2ZL1A 2ZM8A 1LSXA 4WZ5C 4U0XA 4HJ3A 3GTCA 2VA0A 3JYIA 1VETB 4RX3A 1IKIA 3FPVA 4EQ1A 2PT7A 5FAPA 4ESPA 1TS7A 1UWNX 3OC2A 2GDNA 3IF6B 1AWIA 4JXVA 5DF7A 1ODVA 1SCWA 3LYXA 1FSWA 4Y5FA 1ONGA 5EOEA 4F3LB 3W4OA 1GSVA 4L9FA 1XKZA 1IYSA 4N92A 3N7WA 2Z6CA 1T1AA 4YWZA 3F1NA 2HZ5A 2VX8A 4NKPA 2PR5A 3T1XA 4NXEA 4K08A 1YLZA 4CLCA 4MBKA 4BBUA 4DDSA 4BBTA 1IKGA 4LRZE 1BULA 2ZMAA 4JGRA 3LI8A 2K31A 1E3UA 5GHXA 1L0FA 3C5AA 1NYMA 4HP4A 3O86A 5AQ7A 1MY8A 2P04A 1NYYA 3IXHA 4BL2A 5HARA 4PPRA 5I5LA 1T18A 3ZG0A 1MBLA 3JVUA 1L0GA 2XA7M 5FEGA 4QB8A 3LIAA 4JKTA 3UPPA 2I72A 2NUTC 4UHUA 3G35A 3BFEA 3G34A 5DJUA 3F1PB 2I9VA 4H6JB 3RXXA 2V20A 4GB7A 5GLCA 1H8ZA 4NXBA 3QHYA 3VOYA 3SW1A 2WZZA 3GVBA 5E2FA 2QYBA 2JHEA 4IJGA 3DWZA 1A0KA 2WGVA 2B18A 4LENA 1NJ4A 4Y15A 3IT9A 3RFBA 1PNEA 3C4PA 4I3IA 4S2PA 5DTKA 3GR2A 5HX9A 4HP9A 3BWLA 3SOIA 2JKRM 2Y55A 3T1RA 1K57C 3IQAA 4Y3IA 1H3QA 4FSFA 4GLQA 3WRZA 4XUZA 4X69A 4FOFA 5CGWA 3ITBA 4MBFA 4HBTA 3MS6A 3O3VA 4DE0A 3PBNA 3ZVTA 2V2FF 1QMEA 5M18A 2WKPA 5HWWA 1TS8A 5A91A 1NXYA 4EQIA 2Y79A 5E2GA 5FQMA 4DDYA 1DY6A 2Q9NA 1GHMA 2HDQA 3FKVA 1EW0A 5DJTA 2Y4AA 4X1MA 2V1ZA 2Z2MB 3W8KA 5A92A 3KSIA 3VOLA 1CI9A 1W8QA 4OOMA 2Y2JA 2B5RA 3IX3A 4NEED 1Q2PA 3PAGA 3HLWA 3FC7A 3NOUC 1FR6A 1MXOA 3ZQ5A 3ITAA 1YSQA 2OAP1 1JNUA 3MF0A 1DP8A 4X68A 1BLCA 1FCOA 2EXAA 3HUNA 2YKHA 3S7NA 1YLJA 2PU4A 3A0RA 5HD5A 4WMCD 2G2UA 5A93A 2JC7A 4NETA 3SS5A 3UE3A 4BENA 4WUJA 3C38A 5CEBA 3HL9A 1KE4A 4Q0IA 4E04A 1DP6A 1TDGA 4YNRA 4S2KA 3PTEA 2LB9A 3ZHHA 3GDIA 4X55A 4E3MA 1BSGA 1GHIA 3CMZA 4E3JA 1XXMA 2LB5A 1VEUB 2AVXA 3ZNTA 1VHMA 2VJWA 4N9LA 3OLOA 3ZDJA 2QPNA 3ISGA 4XT2A 2PRFA 2ZM2A 1S6RA 3G4PA 4OQIA 1G28A 4WELA 3QP1A 1ES5A 3PBQA 4PM9A 2VGKA 3IXGA 4KUKA 4CLCC 2MJ6A 2Y2LA 4N1HA 4QY6A 4QPRA 2WGIA 4GZBA 2VEAA 1DJCA 1EI5A 3ZFZA 1PZPA 1F98A 5MC7A 5E2EA 4QY5A 5KMWA 5CTMA 4E6XA 1RGZA 3HLCA 1FCMA 3CPTB 3UB7A 1P97A 1IELA 5HL6A 1NY0A 3T12B 3ZG5A 2Y8HA 3H7WB 5EVIB 4CQHA 5HFOA 2L4RA 3CITA 3MR0A 1RGYA 1I5QA 1MWSA 1T19A 3BM6A 3LFVA 4S2NA 1TS0A 4FH2A 1I2SA 2HDRA 4HY8A 3P98A 3TSGA 2V8CA 3VP2A 4S2JA 4OLDA 3K2NA 2XH9A 3KYEA 3Q7VB 2ZQDA 4BQMA 4MLLA 1CEFA 5F68A 1RCJA 1LLBA 1HD8A 4WBGA 1D1JA 3ZG7B 3NY4A 3HJIA 5L8MA 5I94A 4MN6A 3NCKA 4I39A 3LR5A 3DTKA 1BYWA 4K0WA 1C3BA 2KDKA 4E3KA 4L0LA 4A5RA 4ETZA 3C7UA 5EECA 5E2HA 2HDSA 3C2WA 3B33A 1LHYA 4R38A 4R6LA 2PAVP 2BG1A 4M4XA 3T4LA 3LR4A 4KZ8A 1IYOA 2JKFA 1XJ4A 1Y4OA 1CF0A 2BASA 1NLYA 3IX8A 4OKPA 1BTLA 1BUEA 5IU1A 1F5MA 1OTIA 3MMHA 3FV7A 5FI2A 4B88A 2EWVA 4FD8A 3ZG9B 4D2OA 4WN5A 1Z09A 5IHVA 3LEZA 4Y0UA 3R7WB 3LY4A 1DJBA 3MKFA 5C5KA 3CAXA 5CGXA 5TFQA 2XD5A 4OQHA 4DRTA 3TW8A 1V9YA 4EBLA 1D06A 2L1MA 1YQSA 2G2WA 5TBMB 2Z2LB 3S1YA 1MZUA 1FIKA 5EVID 1S0WA 3SS4A 3O5YA 4IVKA 4FH4A 2Y59A 4LRYC 4MCWA 3A3JA 2W3EA 4BJPA 2O99A 5IT5A 3RTYA 2J3TD 4LCLA 2Y2MA 3QP6A 3OPHA 1VETA 5J7EA 4S2OA 2ZC6B 1CJFA 5FATA 2WAEA 4ARZB 4EEPA 2ZM0A 3IF6A 4X6TA 2ZBBA 2B95A 2XLNA 3HUOA 4BD0A 4JPMA 1N9OA 4KQRA 5EFWA 3UE0A 1FR1A 4F3LA 1TD5A 2HP5A 3SH7A 4DXBA 4AFIA 4II7A 4E3OA 4GDNA 2DRWA 2OWHA 3VV4A 3PXPA 4DF6A 3SH9A 5BOHA 3LIEA 5IS1A 1S67L 3OOVA 1BLPA 1EWZA 3F1OB 4GDBA 4IVIA 4FTXA 2PDRA 1S66L 2IWCA 4EW7A 4GOGA 4N9KA 2HGVA 2Y2QA 2J9OA 2IWBA 4JGOA 2ZC7A 1TDLA 3IF5A 3IBRA 2J8YA 4FCFA 5DTSA 3UB8A 2VGJA 5CHUA 3T4KA 4UAAA 1S1ZA 4JF6A 1W63Q 3H82B 5CGSA 5GL9A 3FWLA 5KIZA 1M6KA 5HDSA 3T50A 1MPLA 4KG2A 4RX2A 4KG6A 4X56A 4Y2FA 3UDXA 3ZCZA 2JCHA 5FQ9A 2H10A 4WMCA 3WWXA 3NDEA 2ZQAA 2ZQ7A 3N8RA 3P01A 3F1PA 5CERA 4H6JA 3LY3A 3OBFA 2XA7S 3VE4A 3T4JA 3BJNA 4HJ4A 3UB6A 5HAIA 1ZC2A 4E6WA 4MBHA 2WZXA 4OP5A 4S2NC 5M1AA 1PFLA 2V9AA 4BWIA 4ZTKA 4ZJ1A 2Y2PA 1L2SA 1P9WA 4BL3A 3KX0X 3BFFA 4GD6A 1E4DA 2A24B 4GJ4A 3M6BA 1ES4A 3BECA 1FQGA 1MKMA 3VE3A 2HPBA 3V3SA 3JPUA 2J7VA 5DKKA 4RA7A 3Q07A 3T4QA 3IWQA 1SHVA 1IYPA 2M7UA 3NJAA 4QHCA 3VSKA 4HI4A 1HZOA 1G6OA 1M40A 5L10A 1K54C 5AJGA 4U0TA 3M2KA 3PHYA 4LLOB 1NRJA 2QJ5A 2A49A 4KZBA 3UMDA 3HBRA 2QWSA 2FZ0A 3MFXA 2PBYA 1MWTA 2RL3A 3DTIA 2UV0E 1PW1A 5GHZA 4LFUA 1ESIA 3CLOA 1LSWA 1LL8A 4I38A 2W1TB 1XJ6A 5FQJA 1ES2A 4LRXC 2HP9A 1NRFA 5AQAA 4KZ3A 4E3NA 4OLGA 5A8BA 1PRQA 2W3HA 4JLFA 3O88A 1JWZA 3IBJA 3UE1A 4P87A 3NDGA 2VK3A 4OPRA 4OQ0A 4DN0A 2VV6A 4KZ9A 5KZHA 2NUPC 2JKTI 2Q9MA 1HLUP 4KQOA 5DF9A 3W2ZA 5EVEA 3WS5A 4IBXA 2CC1A 3LICA 4QWOA 4GS9B 5J4EA 3KO6A 1PWCA 3IHAA 1H5XA 1F2KA 1WA9A 4B93A 4I5SA 1ZHHB 2L0WA 4C3QA 1SKFA 2GJ3A 1XA7A 3K3CA 5FAQA 1FOFA 5FI7A 1PYYA 1VEUA 2GZAA 3LIFA 3QP4A 4O0PA 3E4PA 1K38A 1XFNA 3Q81A 3MBZA 5HD3A 2JKRI 3WS0A 1J3WA 3V5MA 3BY9A 2O9BA 4RVAA 1OTEA 4HNBA 3T4OA 5AQ9A 1LI0A 2XFTA 3T4SA 3DAVA 4KZ5A 4B4XA 1IFQA 4IEDA 3AGEA 2WUQA 4JBFA 4WEKA 2PD8A 4Y7PA 1FILA 5AQBA 4E3LA 3FZCA 5TGFA 1OT6A 4ZRRA 3UPOA 3AGDA 2M7VA 2IWDA 3NULA 1ZG4A 4KENB 5U47A 2R9WA 4Y13A 5HAQA 2X02A 3VFFA 1SDNA 3CPTA 1K55A 1TEMA 3HVFA 3HLEA 1YT4A 3NHQA 3SS3A 1GA9A 1KE3A 4LV1A 1OJGA 3BLSA 3MXQA 1N9BA 3H7WA 5EVIA 3Q7ZA 3WS1A 3UB9A 2ZC4B 4JGQA 3GMWA 3BLMA 1K4EA 2Y91A
chains in the Genus database with same CATH topology
3VSLA 3N6IA 4OKPA 1BTLA 1BUEA 3IXBA 3JYIA 2H0YA 4RX3A 5FQQA 4BD1A 1IKIA 4OP8A 5DVAA 2XEPA 3FV7A 5FAPA 5FI2A 2ZQ9A 4B88A 1KGEA 1Y54A 3OC2A 2GDNA 3IF6B 1W8YA 2Y2NA 4OPZA 4FD8A 3D4FA 3NC8A 4JXVA 3ZG9B 2QZ6A 1EROA 4D2OA 3MXSA 3Q7VA 5IHVA 5DF7A 4M3KA 3PBRA 3LEZA 1SCWA 2EFUA 4Y0UA 1FSWA 4ID4A 1YM1A 1ONGA 2ZJ9A 5EOEA 1H8YA 3W4OA 3P09A 3S22A 2XQZA 1CK3A 4PM8A 3M6HA 1GCEA 1DJBA 3LY4A 3MKFA 1XKZA 3FYZA 4JXWA 1IYSA 4N92A 1K25A 4XUXA 1K56A 5CGXA 3N7WA 5TFQA 2XD5A 1KVMA 4OQHA 4DRTA 4WEJA 4IBRA 4OONA 4WZ4A 4EBLA 1NZUA 3BEBA 3PBSA 3ZGAB 1FCNA 4KZAA 4P6BA 1YLZA 1YQSA 4OOLA 1N4OA 2G2WA 1WYBA 3PBTA 2Z2LB 4MBKA 1OMEA 1CEGA 1YMSA 3S1YA 4DDSA 1AXBA 4EBPA 3BYDA 1IKGA 1KE0A 1BULA 1YLYA 3W4PA 2ZMAA 3OPPA 5EVID 4OPQA 1S0WA 2WKHA 5DTTA 5L2FA 3IF6C 4PMAA 3WS4A 1W79A 3SS4A 4EWFA 1BT5A 4IVKA 1E3UA 4FH4A 5GHXA 5EVLA 4EBNA 1L0FA 2Y59A 3VP4A 3C5AA 5HL1A 3G2ZA 1NYMA 2EX9A 3A3JA 3O86A 5AQ7A 5F1GA 4BJPA 1MY8A 2UWXA 3E2KA 5HW3A 2R9XA 3ZVWA 4LV2A 1NYYA 4ZDXA 3I7JA 3NIAA 4LCLA 3IXHA 3ZNYA 2WYXA 2Y2MA 1O07A 4LV3A 5HARA 4BL2A 5KSHA 4JF5A 4PPRA 4HESA 4Y0TA 1G6AA 3VOZA 3ZG0A 3IWOA 1MBLA 3OPHA 4NK3A 4S2OA 5A90A 2ZC6B 1L0GA 5GLBA 3G2YA 5FATA 3WRTA 3MXRA 3EQVA 2WAEA 5GLAA 4QB8A 3UPPA 4JKTA 2ZM0A 4OVDA 2I72A 5HAPA 3HLDA 3IF6A 2EXBA 4X6TA 1PI5A 4UHUA 3VP1A 5JYPA 2XLNA 3HUOA 2A3UA 3G35A 1JWVA 2XK1A 3A3FA 4S2LA 4BD0A 3BFEA 3G34A 4JPMA 1K56D 4KQRA 3UE0A 1FR1A 2FFYA 3TG9A 3RXXA 2HP5A 4R0QA 3TOIA 1KDSA 2V20A 5E43A 3SH7A 5FASA 4DXBA 4E3OA 1YMXA 4GDNA 4GB7A 3IH9A 4HEFA 5GLCA 4DE3A 4UA9A 2DRWA 1H8ZA 5J8XA 3QHYA 3VOYA 2ZD8A 5FSRA 4DF6A 3SH9A 2WZZA 3GVBA 5E2FA 1NZOA 5FQIA 5BOHA 1YLWA 3A3IA 1BLPA 3DWZA 1EWZA 4UA6A 4LCMA 2WGVA 5D3OA 4LENA 4GDBA 1NJ4A 4IVIA 4K91A 3OCLA 3MFDA 5GLDA 3IT9A 3OCNA 2IWCA 4KG5A 4GOGA 4N9KA 4EV4A 1E3UD 2WK0A 4MEZA 3C4PA 1IEMA 3UPNA 3CZDA 4S2PA 2Y2QA 3OZHA 5DTKA 2J9OA 3GR2A 5HX9A 4B4ZA 4OPYA 5JYOA 5KSCA 2IWBA 3SOIA 2Y55A 3HLFA 1WYCA 2ZC7A 1Q2QA 1TDLA 3IF5A 3VFHA 1K57C 3IQAA 3IWIA 3N8SA 4XXRA 1LI9A 3HUMA 2J8YA 4FCFA 1PWGA 5DTSA 3O87A 4FSFA 2VGJA 2WGWB 3WRZA 5CHUA 4WYYA 3C4OA 4UAAA 4KZ6A 4JF6A 3PBOA 5CGSA 5GL9A 4XUZA 4X69A 3FWLA 3GRJA 3G30A 5CGWA 4C6YA 3ITBA 1M6KA 4MBFA 1MPLA 4KG2A 4HBTA 4RX2A 3O3VA 4DE0A 4KG6A 2EX6A 4WZ5A 3PBNA 3ZVTA 2V2FF 3LCEA 4X56A 2HDUA 1QMEA 4K0XA 5M18A 3BFCA 2EFXA 3UDXA 3ZCZA 5F1FA 4KQQA 4OOYA 2JCHA 5FQ9A 1PZOA 2H10A 4WMCA 3WWXA 3NDEA 4LV0A 5A91A 2ZQAA 1K6RA 2ZQ7A 1KGGA 3N8RA 1NXYA 5CERA 4EQIA 1I2WA 3LY3A 2XGNA 5E2GA 4CJNA 5FQMA 1JTDA 1YLPA 2ZQ8A 4PM6A 1XX2A 4DDYA 3ZG8B 1ZG6A 3A3EA 1DY6A 2J9PA 5HAIA 4DXCA 2Q9NA 2WADA 1ZC2A 1GHMA 2HDQA 3E2LA 2WZXA 3G31A 3Q82A 3FKVA 4MBHA 4E6WA 4OP5A 4S2NC 5M1AA 3GQZA 1ERQA 2XDMA 4JF4A 5CTNA 1HTZA 2E8IA 5F83A 4X53A 4P0MA 4ZTKA 2Y4AA 4R1GA 2V1ZA 3IHBA 2JBFA 2Z2MB 4ZJ1A 3W8KA 4HBUA 2Y2PA 2XR0A 5F82A 1L2SA 3V50A 5A92A 4DE2A 4BL3A 3BRMA 1CI9A 1W8QA 3BFFA 4GD6A 1HVBA 1ONHA 4OOMA 2Y2JA 2B5RA 1E4DA 2FFFB 4E3IA 3DWKA 5FAOA 1Q2PA 3PAGA 3HLWA 1L0EA 3M6BA 1ES4A 1FR6A 3BECA 1FQGA 1MKIA 3MZEA 4C75A 1MXOA 2Y2HA 2XFSA 4PM7A 2HPBA 3V3SA 3S4XA 3W4QA 3ITAA 2J7VA 4GNUA 4RA7A 4QJGA 2P74A 3Q07A 5DF8A 3IWQA 4X68A 5CECA 1SHVA 2C5WB 1IYPA 2P9VB 1U60A 4QHCA 4R3JA 3VSKA 1HZOA 1BLCA 1M40A 3OPRA 2WGWA 1FCOA 2EXAA 1K54C 3N8LA 3HUNA 4JXSA 1LL9A 4PM5A 4U0TA 3M2KA 2RCXA 3HLGA 1YLJA 2OV5A 1JVJA 3VP3A 2PU4A 1IYQA 2A49A 4KZBA 3HBRA 3MZFA 4R4SA 4UA7A 2PBYA 4WMCD 1K6SA 1MWTA 2G2UA 5A93A 3VP0A 2JC7A 4NETA 3IXDA 2RL3A 3NI9A 4R4RA 3SS5A 3UE3A 4BENA 1ES3A 2QMIA 1PW1A 5GHZA 5EPHA 3V3RA 5CEBA 1ESIA 1VQQA 1KE4A 3HL9A 1KVLA 1KGFA 1VM1A 2ZC5B 5EVIC 1TDGA 4S2KA 2DNSA 3BFDA 3PTEA 5CHMA 1RP5A 4ZJ3A 3ZHHA 4X55A 2EX2A 3C7VA 2C6WB 4E3MA 1K54A 1KDWA 1BSGA 1GHIA 3CMZA 1CI8A 1DJAA 4KZ7A 3HLBA 5EUAA 4E3JA 1XPBA 1XXMA 1J9MA 1GA0A 1TVFA 5FA7A 1YLTA 5FQJA 1ES2A 4KZ4A 2HP9A 2OLUA 1XA1A 1NRFA 5AQAA 1ESUA 2XD1A 2Y2KA 4P85A 3ZNTA 4R23A 4KZ3A 4E3NA 4N9LA 3BFGA 4OLGA 3ZDJA 2QPNA 3ISGA 3CG5A 5CHJA 4JLFA 2ZM2A 3O88A 1S6RA 3G4PA 4CPKA 4OQIA 2H5SA 2WKEA 1JWZA 1PIOA 3IH8A 4WELA 3UE1A 4P87A 4QD4A 1ES5A 3EQUA 3NDGA 3PBQA 4QU3A 2P9VA 3MZDA 4OPRA 4PM9A 2VGKA 4OQ0A 3UY6A 1PW8A 4GN2A 5TR7A 4RYEA 4ZAMA 1FSYA 3IXGA 4KZ9A 1GHPA 4Y0OA 2Y2GA 4S2IA 5KZHA 1K57A 2Q9MA 2Y2LA 4S2MA 3Q1FA 4N1HA 1LL5A 3V39A 4KQOA 1Z6FA 4QY6A 5CEDA 2H0TA 1PI4A 5DF9A 3M2JA 1ALQA 2WGIA 2PU2A 1BLSA 4GZBA 1DJCA 1EI5A 3ZFZA 3WS5A 3GV9A 4IBXA 5M19A 1PZPA 2CC1A 1BLHA 1BZAA 4EUZA 3GSGA 5E2EA 4QY5A 5KMWA 5CTMA 4E6XA 2Y2OA 1RGZA 4U3TA 1PWCA 1FCMA 3HLCA 3UNWA 4F94A 3OPLA 3IHAA 1H5XA 1IELA 5FI6A 2X01A 1NY0A 5CXWA 3ZG5A 4C3QA 5EVIB 1SKFA 1ERMA 1XA7A 1XGJA 5FAQA 1ZKJA 1SDEA 3FKWA 3B3XA 1FOFA 4ZBEA 5HFOA 5FI7A 1RGYA 1I5QA 1PYYA 1W5DA 4GD8A 4ZJ2A 1L0DA 3RJUA 1XP4A 2X71A 4WM9A 2HP6A 1JWPA 1O7EA 1MWSA 2Y2IA 1WE4A 3BM6A 3UDFA 3UDIA 3VMAA 4S2NA 4FH2A 1I2SA 1MWUA 2OSUA 4N1XA 2HDRA 2WAFA 3WS2A 1PWDA 3P98A 3TSGA 4H8RA 4O7DA 1K38A 4OH0A 3VP2A 4S2JA 4DE1A 4YINA 2BLSA 3Q81A 4OLDA 1XGIA 3MBZA 3UO9A 2XH9A 3WS0A 4Q8IA 3Q7VB 2ZQDA 1K4FA 4BQMA 3V5MA 4RVAA 4MLLA 1CEFA 4MNRA 1RCJA 3CJMA 1QMFA 5G18A 1LLBA 3SH8A 1HD8A 4WBGA 4DKIA 1K55C 3DW0A 3ZG7B 3NY4A 2ZC3B 1LI0A 5AQ9A 2XFTA 4KZ5A 5I94A 4B4XA 3DTMA 4IEDA 3A3DA 3HREA 3NCKA 4OQGA 3AGEA 4Z9QA 2WUQA 4GKUA 4JBFA 5CRFA 5EE8A 4WEKA 2OLVA 5GHYA 4Y7PA 3RXWA 4K0WA 5AQBA 2ZLYA 4YFMA 1C3BA 4E3KA 3LO7A 4E3LA 4L0LA 3FZCA 5TGFA 2ZQCA 3NBLA 4A5RA 3UPOA 3PAEA 3AGDA 1MWRA 2XF3A 3C7UA 2IWDA 2DCFA 3QNBA 5E2HA 2HDSA 5EECA 5FQKA 1ZG4A 2EX8A 4KENB 5U47A 4BLMA 2R9WA 2WKIA 3AGFA 2JE5A 1LHYA 4R3BA 5HAQA 2X02A 3MKEA 4JXGA 3VFFA 1SDNA 1K55A 1TEMA 3HVFA 3HLEA 3G32A 1E25A 1YT4A 3SS3A 1GA9A 1JTGA 1KE3A 5EOOA 4LV1A 2BG1A 3BLSA 3N4IA 1N9BA 5EVIA 1G68A 3Q7ZA 4KZ8A 5FDHA 3QNCA 3WS1A 1IYOA 2ZM8A 2ZC4B 3UN7A 3GMWA 4WZ5C 4U0XA 1W7FA 3BLMA 1K4EA 2Y91A 3GTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VSL A;  3N6I A;  4OKP A;  1BTL A;  1BUE A;  3IXB A;  3JYI A;  2H0Y A;  4RX3 A;  5FQQ A;  4BD1 A;  1IKI A;  4OP8 A;  5DVA A;  2XEP A;  3FV7 A;  5FAP A;  5FI2 A;  2ZQ9 A;  4B88 A;  1KGE A;  1Y54 A;  3OC2 A;  2GDN A;  3IF6 B;  1W8Y A;  2Y2N A;  4OPZ A;  4FD8 A;  3D4F A;  3NC8 A;  4JXV A;  3ZG9 B;  2QZ6 A;  1ERO A;  4D2O A;  3MXS A;  3Q7V A;  5IHV A;  5DF7 A;  4M3K A;  3PBR A;  3LEZ A;  1SCW A;  2EFU A;  4Y0U A;  1FSW A;  4ID4 A;  1YM1 A;  1ONG A;  2ZJ9 A;  5EOE A;  1H8Y A;  3W4O A;  3P09 A;  3S22 A;  2XQZ A;  1CK3 A;  4PM8 A;  3M6H A;  1GCE A;  1DJB A;  3LY4 A;  3MKF A;  1XKZ A;  3FYZ A;  4JXW A;  1IYS A;  4N92 A;  1K25 A;  4XUX A;  1K56 A;  5CGX A;  3N7W A;  5TFQ A;  2XD5 A;  1KVM A;  4OQH A;  4DRT A;  4WEJ A;  4IBR A;  4OON A;  4WZ4 A;  4EBL A;  1NZU A;  3BEB A;  3PBS A;  3ZGA B;  1FCN A;  4KZA A;  4P6B A;  1YLZ A;  1YQS A;  4OOL A;  1N4O A;  2G2W A;  1WYB A;  3PBT A;  2Z2L B;  4MBK A;  1OME A;  1CEG A;  1YMS A;  3S1Y A;  4DDS A;  1AXB A;  4EBP A;  3BYD A;  1IKG A;  1KE0 A;  1BUL A;  1YLY A;  3W4P A;  2ZMA A;  3OPP A;  5EVI D;  4OPQ A;  1S0W A;  2WKH A;  5DTT A;  5L2F A;  3IF6 C;  4PMA A;  3WS4 A;  1W79 A;  3SS4 A;  4EWF A;  1BT5 A;  4IVK A;  1E3U A;  4FH4 A;  5GHX A;  5EVL A;  4EBN A;  1L0F A;  2Y59 A;  3VP4 A;  3C5A A;  5HL1 A;  3G2Z A;  1NYM A;  2EX9 A;  3A3J A;  3O86 A;  5AQ7 A;  5F1G A;  4BJP A;  1MY8 A;  2UWX A;  3E2K A;  5HW3 A;  2R9X A;  3ZVW A;  4LV2 A;  1NYY A;  4ZDX A;  3I7J A;  3NIA A;  4LCL A;  3IXH A;  3ZNY A;  2WYX A;  2Y2M A;  1O07 A;  4LV3 A;  5HAR A;  4BL2 A;  5KSH A;  4JF5 A;  4PPR A;  4HES A;  4Y0T A;  1G6A A;  3VOZ A;  3ZG0 A;  3IWO A;  1MBL A;  3OPH A;  4NK3 A;  4S2O A;  5A90 A;  2ZC6 B;  1L0G A;  5GLB A;  3G2Y A;  5FAT A;  3WRT A;  3MXR A;  3EQV A;  2WAE A;  5GLA A;  4QB8 A;  3UPP A;  4JKT A;  2ZM0 A;  4OVD A;  2I72 A;  5HAP A;  3HLD A;  3IF6 A;  2EXB A;  4X6T A;  1PI5 A;  4UHU A;  3VP1 A;  5JYP A;  2XLN A;  3HUO A;  2A3U A;  3G35 A;  1JWV A;  2XK1 A;  3A3F A;  4S2L A;  4BD0 A;  3BFE A;  3G34 A;  4JPM A;  1K56 D;  4KQR A;  3UE0 A;  1FR1 A;  2FFY A;  3TG9 A;  3RXX A;  2HP5 A;  4R0Q A;  3TOI A;  1KDS A;  2V20 A;  5E43 A;  3SH7 A;  5FAS A;  4DXB A;  4E3O A;  1YMX A;  4GDN A;  4GB7 A;  3IH9 A;  4HEF A;  5GLC A;  4DE3 A;  4UA9 A;  2DRW A;  1H8Z A;  5J8X A;  3QHY A;  3VOY A;  2ZD8 A;  5FSR A;  4DF6 A;  3SH9 A;  2WZZ A;  3GVB A;  5E2F A;  1NZO A;  5FQI A;  5BOH A;  1YLW A;  3A3I A;  1BLP A;  3DWZ A;  1EWZ A;  4UA6 A;  4LCM A;  2WGV A;  5D3O A;  4LEN A;  4GDB A;  1NJ4 A;  4IVI A;  4K91 A;  3OCL A;  3MFD A;  5GLD A;  3IT9 A;  3OCN A;  2IWC A;  4KG5 A;  4GOG A;  4N9K A;  4EV4 A;  1E3U D;  2WK0 A;  4MEZ A;  3C4P A;  1IEM A;  3UPN A;  3CZD A;  4S2P A;  2Y2Q A;  3OZH A;  5DTK A;  2J9O A;  3GR2 A;  5HX9 A;  4B4Z A;  4OPY A;  5JYO A;  5KSC A;  2IWB A;  3SOI A;  2Y55 A;  3HLF A;  1WYC A;  2ZC7 A;  1Q2Q A;  1TDL A;  3IF5 A;  3VFH A;  1K57 C;  3IQA A;  3IWI A;  3N8S A;  4XXR A;  1LI9 A;  3HUM A;  2J8Y A;  4FCF A;  1PWG A;  5DTS A;  3O87 A;  4FSF A;  2VGJ A;  2WGW B;  3WRZ A;  5CHU A;  4WYY A;  3C4O A;  4UAA A;  4KZ6 A;  4JF6 A;  3PBO A;  5CGS A;  5GL9 A;  4XUZ A;  4X69 A;  3FWL A;  3GRJ A;  3G30 A;  5CGW A;  4C6Y A;  3ITB A;  1M6K A;  4MBF A;  1MPL A;  4KG2 A;  4HBT A;  4RX2 A;  3O3V A;  4DE0 A;  4KG6 A;  2EX6 A;  4WZ5 A;  3PBN A;  3ZVT A;  2V2F F;  3LCE A;  4X56 A;  2HDU A;  1QME A;  4K0X A;  5M18 A;  3BFC A;  2EFX A;  3UDX A;  3ZCZ A;  5F1F A;  4KQQ A;  4OOY A;  2JCH A;  5FQ9 A;  1PZO A;  2H10 A;  4WMC A;  3WWX A;  3NDE A;  4LV0 A;  5A91 A;  2ZQA A;  1K6R A;  2ZQ7 A;  1KGG A;  3N8R A;  1NXY A;  5CER A;  4EQI A;  1I2W A;  3LY3 A;  2XGN A;  5E2G A;  4CJN A;  5FQM A;  1JTD A;  1YLP A;  2ZQ8 A;  4PM6 A;  1XX2 A;  4DDY A;  3ZG8 B;  1ZG6 A;  3A3E A;  1DY6 A;  2J9P A;  5HAI A;  4DXC A;  2Q9N A;  2WAD A;  1ZC2 A;  1GHM A;  2HDQ A;  3E2L A;  2WZX A;  3G31 A;  3Q82 A;  3FKV A;  4MBH A;  4E6W A;  4OP5 A;  4S2N C;  5M1A A;  3GQZ A;  1ERQ A;  2XDM A;  4JF4 A;  5CTN A;  1HTZ A;  2E8I A;  5F83 A;  4X53 A;  4P0M A;  4ZTK A;  2Y4A A;  4R1G A;  2V1Z A;  3IHB A;  2JBF A;  2Z2M B;  4ZJ1 A;  3W8K A;  4HBU A;  2Y2P A;  2XR0 A;  5F82 A;  1L2S A;  3V50 A;  5A92 A;  4DE2 A;  4BL3 A;  3BRM A;  1CI9 A;  1W8Q A;  3BFF A;  4GD6 A;  1HVB A;  1ONH A;  4OOM A;  2Y2J A;  2B5R A;  1E4D A;  2FFF B;  4E3I A;  3DWK A;  5FAO A;  1Q2P A;  3PAG A;  3HLW A;  1L0E A;  3M6B A;  1ES4 A;  1FR6 A;  3BEC A;  1FQG A;  1MKI A;  3MZE A;  4C75 A;  1MXO A;  2Y2H A;  2XFS A;  4PM7 A;  2HPB A;  3V3S A;  3S4X A;  3W4Q A;  3ITA A;  2J7V A;  4GNU A;  4RA7 A;  4QJG A;  2P74 A;  3Q07 A;  5DF8 A;  3IWQ A;  4X68 A;  5CEC A;  1SHV A;  2C5W B;  1IYP A;  2P9V B;  1U60 A;  4QHC A;  4R3J A;  3VSK A;  1HZO A;  1BLC A;  1M40 A;  3OPR A;  2WGW A;  1FCO A;  2EXA A;  1K54 C;  3N8L A;  3HUN A;  4JXS A;  1LL9 A;  4PM5 A;  4U0T A;  3M2K A;  2RCX A;  3HLG A;  1YLJ A;  2OV5 A;  1JVJ A;  3VP3 A;  2PU4 A;  1IYQ A;  2A49 A;  4KZB A;  3HBR A;  3MZF A;  4R4S A;  4UA7 A;  2PBY A;  4WMC D;  1K6S A;  1MWT A;  2G2U A;  5A93 A;  3VP0 A;  2JC7 A;  4NET A;  3IXD A;  2RL3 A;  3NI9 A;  4R4R A;  3SS5 A;  3UE3 A;  4BEN A;  1ES3 A;  2QMI A;  1PW1 A;  5GHZ A;  5EPH A;  3V3R A;  5CEB A;  1ESI A;  1VQQ A;  1KE4 A;  3HL9 A;  1KVL A;  1KGF A;  1VM1 A;  2ZC5 B;  5EVI C;  1TDG A;  4S2K A;  2DNS A;  3BFD A;  3PTE A;  5CHM A;  1RP5 A;  4ZJ3 A;  3ZHH A;  4X55 A;  2EX2 A;  3C7V A;  2C6W B;  4E3M A;  1K54 A;  1KDW A;  1BSG A;  1GHI A;  3CMZ A;  1CI8 A;  1DJA A;  4KZ7 A;  3HLB A;  5EUA A;  4E3J A;  1XPB A;  1XXM A;  1J9M A;  1GA0 A;  1TVF A;  5FA7 A;  1YLT A;  5FQJ A;  1ES2 A;  4KZ4 A;  2HP9 A;  2OLU A;  1XA1 A;  1NRF A;  5AQA A;  1ESU A;  2XD1 A;  2Y2K A;  4P85 A;  3ZNT A;  4R23 A;  4KZ3 A;  4E3N A;  4N9L A;  3BFG A;  4OLG A;  3ZDJ A;  2QPN A;  3ISG A;  3CG5 A;  5CHJ A;  4JLF A;  2ZM2 A;  3O88 A;  1S6R A;  3G4P A;  4CPK A;  4OQI A;  2H5S A;  2WKE A;  1JWZ A;  1PIO A;  3IH8 A;  4WEL A;  3UE1 A;  4P87 A;  4QD4 A;  1ES5 A;  3EQU A;  3NDG A;  3PBQ A;  4QU3 A;  2P9V A;  3MZD A;  4OPR A;  4PM9 A;  2VGK A;  4OQ0 A;  3UY6 A;  1PW8 A;  4GN2 A;  5TR7 A;  4RYE A;  4ZAM A;  1FSY A;  3IXG A;  4KZ9 A;  1GHP A;  4Y0O A;  2Y2G A;  4S2I A;  5KZH A;  1K57 A;  2Q9M A;  2Y2L A;  4S2M A;  3Q1F A;  4N1H A;  1LL5 A;  3V39 A;  4KQO A;  1Z6F A;  4QY6 A;  5CED A;  2H0T A;  1PI4 A;  5DF9 A;  3M2J A;  1ALQ A;  2WGI A;  2PU2 A;  1BLS A;  4GZB A;  1DJC A;  1EI5 A;  3ZFZ A;  3WS5 A;  3GV9 A;  4IBX A;  5M19 A;  1PZP A;  2CC1 A;  1BLH A;  1BZA A;  4EUZ A;  3GSG A;  5E2E A;  4QY5 A;  5KMW A;  5CTM A;  4E6X A;  2Y2O A;  1RGZ A;  4U3T A;  1PWC A;  1FCM A;  3HLC A;  3UNW A;  4F94 A;  3OPL A;  3IHA A;  1H5X A;  1IEL A;  5FI6 A;  2X01 A;  1NY0 A;  5CXW A;  3ZG5 A;  4C3Q A;  5EVI B;  1SKF A;  1ERM A;  1XA7 A;  1XGJ A;  5FAQ A;  1ZKJ A;  1SDE A;  3FKW A;  3B3X A;  1FOF A;  4ZBE A;  5HFO A;  5FI7 A;  1RGY A;  1I5Q A;  1PYY A;  1W5D A;  4GD8 A;  4ZJ2 A;  1L0D A;  3RJU A;  1XP4 A;  2X71 A;  4WM9 A;  2HP6 A;  1JWP A;  1O7E A;  1MWS A;  2Y2I A;  1WE4 A;  3BM6 A;  3UDF A;  3UDI A;  3VMA A;  4S2N A;  4FH2 A;  1I2S A;  1MWU A;  2OSU A;  4N1X A;  2HDR A;  2WAF A;  3WS2 A;  1PWD A;  3P98 A;  3TSG A;  4H8R A;  4O7D A;  1K38 A;  4OH0 A;  3VP2 A;  4S2J A;  4DE1 A;  4YIN A;  2BLS A;  3Q81 A;  4OLD A;  1XGI A;  3MBZ A;  3UO9 A;  2XH9 A;  3WS0 A;  4Q8I A;  3Q7V B;  2ZQD A;  1K4F A;  4BQM A;  3V5M A;  4RVA A;  4MLL A;  1CEF A;  4MNR A;  1RCJ A;  3CJM A;  1QMF A;  5G18 A;  1LLB A;  3SH8 A;  1HD8 A;  4WBG A;  4DKI A;  1K55 C;  3DW0 A;  3ZG7 B;  3NY4 A;  2ZC3 B;  1LI0 A;  5AQ9 A;  2XFT A;  4KZ5 A;  5I94 A;  4B4X A;  3DTM A;  4IED A;  3A3D A;  3HRE A;  3NCK A;  4OQG A;  3AGE A;  4Z9Q A;  2WUQ A;  4GKU A;  4JBF A;  5CRF A;  5EE8 A;  4WEK A;  2OLV A;  5GHY A;  4Y7P A;  3RXW A;  4K0W A;  5AQB A;  2ZLY A;  4YFM A;  1C3B A;  4E3K A;  3LO7 A;  4E3L A;  4L0L A;  3FZC A;  5TGF A;  2ZQC A;  3NBL A;  4A5R A;  3UPO A;  3PAE A;  3AGD A;  1MWR A;  2XF3 A;  3C7U A;  2IWD A;  2DCF A;  3QNB A;  5E2H A;  2HDS A;  5EEC A;  5FQK A;  1ZG4 A;  2EX8 A;  4KEN B;  5U47 A;  4BLM A;  2R9W A;  2WKI A;  3AGF A;  2JE5 A;  1LHY A;  4R3B A;  5HAQ A;  2X02 A;  3MKE A;  4JXG A;  3VFF A;  1SDN A;  1K55 A;  1TEM A;  3HVF A;  3HLE A;  3G32 A;  1E25 A;  1YT4 A;  3SS3 A;  1GA9 A;  1JTG A;  1KE3 A;  5EOO A;  4LV1 A;  2BG1 A;  3BLS A;  3N4I A;  1N9B A;  5EVI A;  1G68 A;  3Q7Z A;  4KZ8 A;  5FDH A;  3QNC A;  3WS1 A;  1IYO A;  2ZM8 A;  2ZC4 B;  3UN7 A;  3GMW A;  4WZ5 C;  4U0X A;  1W7F A;  3BLM A;  1K4E A;  2Y91 A;  3GTC A; 
#chains in the Genus database with same CATH topology
 4HJ6 A;  2V1A A;  1MC0 A;  3N6I A;  2H0Y A;  5FQQ A;  4OP8 A;  4B9O A;  2Y2N A;  4OPZ A;  3D4F A;  2QZ6 A;  1ERO A;  3RH8 B;  3MXS A;  3Q7V A;  3CUE A;  2EFU A;  4DMZ A;  5J3W A;  4HH2 A;  1H8Y A;  1CK3 A;  4PM8 A;  4JGP A;  1Y28 A;  1GCE A;  3FYZ A;  4JXW A;  2GNX A;  1K25 A;  5HPF A;  1KVM A;  4UQI M;  4WEJ A;  4OON A;  4WZ4 A;  2W0N A;  2V0U A;  3ZGA B;  4I3A A;  1FCN A;  4OOL A;  1CEG A;  3QP8 A;  4EBP A;  3W4P A;  1TS6 A;  3OPP A;  4OPQ A;  3LI9 A;  2WKH A;  5L2F A;  2OWJ A;  1W79 A;  4EWF A;  1BT5 A;  4EBN A;  3VP4 A;  5HL1 A;  2EX9 A;  2E8J A;  4Z1W A;  5F1G A;  3PR6 A;  2UWX A;  3E2K A;  3BQ8 A;  2R9X A;  3ZVW A;  3NOP C;  4ZDX A;  3NIA A;  2WYX A;  1O07 A;  1OTB A;  5KSH A;  2W27 A;  4Y0T A;  1G6A A;  3VOZ A;  5A90 A;  3G2Y A;  3LGO A;  3WRT A;  5GLA A;  5HAP A;  3HLD A;  1PI5 A;  2A3U A;  4HIA A;  1JWV A;  3T1S A;  3KSG A;  4X1L A;  3A3F A;  1K56 D;  3R7W A;  5HDD A;  1KDS A;  5E43 A;  2PYP A;  4HEF A;  1SKO B;  4UA9 A;  5J8X A;  3T4T A;  3G6O A;  3DTE A;  1NZO A;  3E4Q A;  1NLZ A;  4LCM A;  5TBM A;  4K91 A;  3MJQ A;  3OCL A;  3LUQ A;  5AVE A;  3OCN A;  2JKG A;  2ZOI A;  2WK0 A;  3CZD A;  4OPY A;  5JYO A;  1WYC A;  1Q2Q A;  4RQ9 A;  5F69 A;  4WF0 A;  3VFH A;  3IWI A;  3N8S A;  4XXR A;  1LI9 A;  1XJ2 A;  3O87 A;  2WGW B;  2OOL A;  3C4O A;  4KZ6 A;  3PBO A;  3BW6 A;  3G30 A;  4LGW A;  3LIB A;  2HDU A;  4ARZ A;  5F1F A;  4KQQ A;  4EXO A;  4LV0 A;  3MQ0 A;  1GSW A;  2XGN A;  3L9K A;  4CJN A;  3MQQ A;  1YLP A;  4PM6 A;  1IOU A;  1ZG6 A;  2J9P A;  4DXC A;  4IBR A;  2WAD A;  2YKF A;  3E2L A;  4GN2 A;  2BTF P;  1S4S A;  3BQA A;  1ERQ A;  2XDM A;  4G3V A;  1HTZ A;  2E8I A;  4EES A;  4X53 A;  5G4Y A;  2W1R A;  2P08 A;  3ZYT A;  3F1O A;  4R1G A;  2JBF A;  4HBU A;  2XR0 A;  5F82 A;  3V50 A;  5G4Z A;  4DE2 A;  3BRM A;  5HPI A;  2K2N A;  1HVB A;  1ONH A;  3DWK A;  4X25 A;  1L0E A;  4C75 A;  3MZE A;  4WLA A;  1V9Z A;  2VV7 A;  4GNU A;  4QJG A;  2P74 A;  2C5W B;  2V1B A;  2P9V B;  4NG2 A;  3N8L A;  4JXS A;  3P7N A;  3H82 A;  2RCX A;  2OV5 A;  1JVJ A;  5FEF A;  3MZF A;  4UA7 A;  1K6S A;  2PR6 A;  3VP0 A;  3IXD A;  1DRM A;  5EM1 A;  1ES3 A;  2QMI A;  2W3G A;  5EPH A;  1KVL A;  1KGF A;  1VM1 A;  4GHI B;  5EVI C;  3TJZ C;  2QKP A;  3E0Y A;  3BFD A;  1RP5 A;  4O01 A;  4ZJ3 A;  2EX2 A;  3C7V A;  2C6W B;  3HCY A;  1OJ5 A;  1OT9 A;  3PYP A;  1CI8 A;  3UB5 P;  3CWF A;  1YAX A;  2VKS A;  4KZ7 A;  3HLB A;  5EUA A;  1OPX A;  1XPB A;  1J9M A;  1TVF A;  5FA7 A;  1YLT A;  2A2L A;  2J80 A;  1XA1 A;  1ESU A;  2XD1 A;  2Y2K A;  4P85 A;  5FL3 A;  3B47 A;  3IS2 B;  3CUE C;  3BFG A;  3GEC A;  2A24 A;  2HF6 A;  4KQD A;  1K0K A;  3CG5 A;  5CHJ A;  1LSV A;  4CPK A;  2H5S A;  2WKE A;  1PIO A;  5HWT A;  3MZD A;  3UY6 A;  1PW8 A;  5TR7 A;  4RYE A;  4ZAM A;  1FSY A;  4Y0O A;  1GHP A;  4S2I A;  4MN5 A;  3Q1F A;  4S2M A;  1LL5 A;  3V39 A;  2Z6D A;  1PI4 A;  3FG8 A;  5L07 A;  2O9C A;  3GV9 A;  5M19 A;  1BLH A;  4EUZ A;  3GSG A;  3CI6 A;  4NXF A;  1H8M A;  4U3T A;  4F94 A;  3OPL A;  3QP5 A;  5FI6 A;  4DJ3 A;  3TRC A;  2O9A A;  2HV1 A;  5CXW A;  1N9L A;  1XGJ A;  2W1T A;  2ZL1 B;  3K3D A;  1SDE A;  3FKW A;  4ZBE A;  4ZJ2 A;  1XP4 A;  4WM9 A;  1GSX A;  2VGL S;  3TE8 A;  1F9I A;  2Y2I A;  3D9Y A;  1WE4 A;  3VMA A;  4L9G A;  4I3J A;  2OAQ 1;  5DFX A;  1MWU A;  4N1X A;  2WAF A;  4H8R A;  4OH0 A;  4KUO A;  1XGI A;  3UO9 A;  4Q8I A;  2JKT M;  1K4F A;  4IUH A;  4MNR A;  1D7E A;  4G3W A;  5G18 A;  5LBR A;  3DW0 A;  4HH3 A;  2DMW A;  5HWV A;  2ZC3 B;  1N9N A;  3A3D A;  4Z9Q A;  5CRF A;  3F1N B;  5EE8 A;  2OLV A;  1P9R A;  2VGL M;  2ZLY A;  4YFM A;  3LO7 A;  2ZQC A;  3S7P A;  4CLC B;  4MN7 A;  1UWP X;  3NBL A;  5FQK A;  3QNB A;  2EX8 A;  3V67 A;  4BLM A;  4GS9 A;  3AGF A;  4D60 A;  2JE5 A;  1L3L A;  4JXG A;  1VB6 A;  3G32 A;  2R78 A;  1LT0 A;  3LID A;  1JTG A;  5EOO A;  4EU0 A;  2FH5 A;  5AVF A;  2GX5 A;  1G68 A;  3QNC A;  4Y17 A;  3UN7 A;  1W7F A;  3VSL A;  4Q0J A;  3IXB A;  4BD1 A;  5DVA A;  3B42 A;  2XEP A;  2ZQ9 A;  1KGE A;  1XJ3 A;  1Y54 A;  2KOI A;  1W8Y A;  2XSS A;  4HOI A;  3NC8 A;  3L7H A;  4M3K A;  3PBR A;  1OTA A;  4ID4 A;  1YM1 A;  2HJE A;  2ZJ9 A;  3P09 A;  5L09 A;  3S22 A;  2XQZ A;  3MQO A;  3M6H A;  2WKR A;  4XUX A;  1K56 A;  2M1C A;  4HHD A;  1NZU A;  3BEB A;  3PBS A;  4KZA A;  4P6B A;  1N4O A;  1WYB A;  3PBT A;  3S7O A;  1OME A;  1YMS A;  1AXB A;  3BYD A;  1KE0 A;  2XRN A;  1YLY A;  4MMN A;  3EGX C;  5DTT A;  3LEQ A;  3IF6 C;  4PMA A;  3WS4 A;  3NEC A;  3C8C A;  5EVL A;  3G2Z A;  1NWZ A;  4DJ2 A;  5HW3 A;  4LV2 A;  3I7J A;  3ZNY A;  2EA9 A;  4LV3 A;  4JF5 A;  4HES A;  3ULF A;  3IWO A;  5EV0 A;  3T1Q B;  4NK3 A;  2KLI A;  5EM0 A;  5GLB A;  3MXR A;  3EQV A;  3ICY A;  4OVD A;  2EXB A;  3VP1 A;  5JYP A;  2XK1 A;  3EWK A;  4S2L A;  2FFY A;  3TG9 A;  4R0Q A;  2QJ7 A;  3TOI A;  5FAS A;  1YMX A;  3IH9 A;  4DE3 A;  2Q0O A;  3LR3 A;  1STZ A;  2ZD8 A;  5FSR A;  3KSF A;  4L9E A;  4CLC D;  5FQI A;  1YLW A;  3A3I A;  2PHY A;  2VV8 A;  4UA6 A;  5D3O A;  3MFD A;  2V8F A;  5GLD A;  3DBA A;  4KG5 A;  4EV4 A;  1E3U D;  4MEZ A;  1UGU A;  4PAU A;  1IEM A;  3UPN A;  3OZH A;  4UQI S;  4B4Z A;  3KYQ A;  5KSC A;  3HLF A;  4YOF A;  3FPW A;  4LPZ A;  1H0M A;  3C30 A;  4MDZ A;  4NXG A;  3HUM A;  4O8G A;  1PWG A;  2PBD P;  5HDC A;  3UE6 A;  3EEH A;  4WYY A;  4GCZ A;  3GRJ A;  4C6Y A;  2D02 A;  2EX6 A;  4WZ5 A;  3LCE A;  4K0X A;  3BFC A;  2EFX A;  4OOY A;  3HJK A;  1PZO A;  2K7S A;  1K6R A;  1KGG A;  2ZMV A;  4P6Z S;  1I2W A;  2O0Y A;  4HQA A;  1JTD A;  2ZQ8 A;  3A0S A;  1XX2 A;  3ZG8 B;  1SKO A;  3A3E A;  3Q82 A;  3G31 A;  2VZW A;  3KYZ A;  3GQZ A;  3KSH A;  4JF4 A;  5CTN A;  1T1B A;  2ZOH A;  5F83 A;  4PKY A;  4BBV A;  4P0M A;  3U4L P;  2KX6 A;  2B02 A;  4G3K A;  3IHB A;  1P0Z A;  2FFF B;  3MSH A;  5FAO A;  4E3I A;  3H9W A;  4XT2 B;  1MKI A;  2Y2H A;  4PM7 A;  2XFS A;  3W4Q A;  3S4X A;  4IHQ A;  4P6Z M;  3D72 A;  2D01 A;  4ETX A;  2P7J A;  2VLG A;  5DF8 A;  1W63 M;  5CEC A;  4FUW A;  4ME4 A;  2ACG A;  1U60 A;  4R3J A;  4GW9 A;  2XRO A;  3OPR A;  2WGW A;  3NOT C;  1LL9 A;  4PM5 A;  3HLG A;  4CLC E;  3VP3 A;  1IYQ A;  4R4S A;  3R4K A;  4PHT A;  4R4R A;  3NI9 A;  2EWW A;  3V3R A;  1VQQ A;  2ZC5 B;  5HSQ A;  1S1Y A;  2DNS A;  5CHM A;  2W3D A;  1X0O A;  5TJJ A;  1K54 A;  5F5Y A;  1SZV A;  1KDW A;  1DJA A;  2WKQ A;  1OTD A;  1GA0 A;  2W3F A;  4KZ4 A;  2OLU A;  3EGD C;  4R23 A;  5CX7 A;  5FDS A;  2V0W A;  4PKY G;  5DFY A;  1YKD A;  3IH8 A;  4QD4 A;  3EQU A;  2G7U A;  4QU3 A;  2P9V A;  5HZH A;  3SZT A;  3A0V A;  3S7Q A;  1T1C A;  2Y2G A;  5DKL A;  1K57 A;  2QHK A;  1G5U A;  3IX4 A;  1Z6F A;  2PD7 A;  5CED A;  2H0T A;  2IA2 A;  1ALQ A;  3M2J A;  2PU2 A;  1BLS A;  3EOI A;  1TF1 A;  3UME A;  4R3A A;  1BZA A;  4GHI A;  2Y2O A;  2INW A;  3UNW A;  2CMN A;  2X01 A;  1ZTU A;  1ERM A;  1ZKJ A;  3B3X A;  4IUK A;  4GD8 A;  1W5D A;  2ZMF A;  1L0D A;  3RJU A;  2X71 A;  4EEU A;  3QP2 A;  2HP6 A;  1JWP A;  1O7E A;  3UDF A;  3UDI A;  3LR0 A;  1KOU A;  2JN7 A;  2PYR A;  3IS2 A;  4Q0H A;  4EUV A;  2OSU A;  3WS2 A;  1PWD A;  1S4R A;  4O7D A;  1YPR A;  4DE1 A;  4YIN A;  2BLS A;  3BY8 A;  1YSP A;  3CJM A;  1QMF A;  2H28 A;  3SH8 A;  3E4O A;  4DKI A;  1K55 C;  2J3W A;  3DTM A;  3HRE A;  4OQG A;  4GKU A;  1CQA A;  5GHY A;  3RXW A;  5K5B A;  4UEY A;  2HJ9 C;  3PAE A;  1MWR A;  2XF3 A;  2DCF A;  2J3T C;  2WKI A;  4R3B A;  4BMW A;  3D3O A;  3E98 A;  3JVV A;  3MKE A;  1XFQ A;  4WL9 A;  1ACF A;  1E25 A;  3U2A A;  3EEA A;  5F6A A;  3CHW P;  4EER A;  4R70 A;  3N4I A;  4EET B;  5FDH A;  1DP9 A;  2ZL1 A;  2ZM8 A;  1LSX A;  4WZ5 C;  4U0X A;  4HJ3 A;  3GTC A;  2VA0 A;  3JYI A;  1VET B;  4RX3 A;  1IKI A;  3FPV A;  4EQ1 A;  2PT7 A;  5FAP A;  4ESP A;  1TS7 A;  1UWN X;  3OC2 A;  2GDN A;  3IF6 B;  1AWI A;  4JXV A;  5DF7 A;  1ODV A;  1SCW A;  3LYX A;  1FSW A;  4Y5F A;  1ONG A;  5EOE A;  4F3L B;  3W4O A;  1GSV A;  4L9F A;  1XKZ A;  1IYS A;  4N92 A;  3N7W A;  2Z6C A;  1T1A A;  4YWZ A;  3F1N A;  2HZ5 A;  2VX8 A;  4NKP A;  2PR5 A;  3T1X A;  4NXE A;  4K08 A;  1YLZ A;  4CLC A;  4MBK A;  4BBU A;  4DDS A;  4BBT A;  1IKG A;  4LRZ E;  1BUL A;  2ZMA A;  4JGR A;  3LI8 A;  2K31 A;  1E3U A;  5GHX A;  1L0F A;  3C5A A;  1NYM A;  4HP4 A;  3O86 A;  5AQ7 A;  1MY8 A;  2P04 A;  1NYY A;  3IXH A;  4BL2 A;  5HAR A;  4PPR A;  5I5L A;  1T18 A;  3ZG0 A;  1MBL A;  3JVU A;  1L0G A;  2XA7 M;  5FEG A;  4QB8 A;  3LIA A;  4JKT A;  3UPP A;  2I72 A;  2NUT C;  4UHU A;  3G35 A;  3BFE A;  3G34 A;  5DJU A;  3F1P B;  2I9V A;  4H6J B;  3RXX A;  2V20 A;  4GB7 A;  5GLC A;  1H8Z A;  4NXB A;  3QHY A;  3VOY A;  3SW1 A;  2WZZ A;  3GVB A;  5E2F A;  2QYB A;  2JHE A;  4IJG A;  3DWZ A;  1A0K A;  2WGV A;  2B18 A;  4LEN A;  1NJ4 A;  4Y15 A;  3IT9 A;  3RFB A;  1PNE A;  3C4P A;  4I3I A;  4S2P A;  5DTK A;  3GR2 A;  5HX9 A;  4HP9 A;  3BWL A;  3SOI A;  2JKR M;  2Y55 A;  3T1R A;  1K57 C;  3IQA A;  4Y3I A;  1H3Q A;  4FSF A;  4GLQ A;  3WRZ A;  4XUZ A;  4X69 A;  4FOF A;  5CGW A;  3ITB A;  4MBF A;  4HBT A;  3MS6 A;  3O3V A;  4DE0 A;  3PBN A;  3ZVT A;  2V2F F;  1QME A;  5M18 A;  2WKP A;  5HWW A;  1TS8 A;  5A91 A;  1NXY A;  4EQI A;  2Y79 A;  5E2G A;  5FQM A;  4DDY A;  1DY6 A;  2Q9N A;  1GHM A;  2HDQ A;  3FKV A;  1EW0 A;  5DJT A;  2Y4A A;  4X1M A;  2V1Z A;  2Z2M B;  3W8K A;  5A92 A;  3KSI A;  3VOL A;  1CI9 A;  1W8Q A;  4OOM A;  2Y2J A;  2B5R A;  3IX3 A;  4NEE D;  1Q2P A;  3PAG A;  3HLW A;  3FC7 A;  3NOU C;  1FR6 A;  1MXO A;  3ZQ5 A;  3ITA A;  1YSQ A;  2OAP 1;  1JNU A;  3MF0 A;  1DP8 A;  4X68 A;  1BLC A;  1FCO A;  2EXA A;  3HUN A;  2YKH A;  3S7N A;  1YLJ A;  2PU4 A;  3A0R A;  5HD5 A;  4WMC D;  2G2U A;  5A93 A;  2JC7 A;  4NET A;  3SS5 A;  3UE3 A;  4BEN A;  4WUJ A;  3C38 A;  5CEB A;  3HL9 A;  1KE4 A;  4Q0I A;  4E04 A;  1DP6 A;  1TDG A;  4YNR A;  4S2K A;  3PTE A;  2LB9 A;  3ZHH A;  3GDI A;  4X55 A;  4E3M A;  1BSG A;  1GHI A;  3CMZ A;  4E3J A;  1XXM A;  2LB5 A;  1VEU B;  2AVX A;  3ZNT A;  1VHM A;  2VJW A;  4N9L A;  3OLO A;  3ZDJ A;  2QPN A;  3ISG A;  4XT2 A;  2PRF A;  2ZM2 A;  1S6R A;  3G4P A;  4OQI A;  1G28 A;  4WEL A;  3QP1 A;  1ES5 A;  3PBQ A;  4PM9 A;  2VGK A;  3IXG A;  4KUK A;  4CLC C;  2MJ6 A;  2Y2L A;  4N1H A;  4QY6 A;  4QPR A;  2WGI A;  4GZB A;  2VEA A;  1DJC A;  1EI5 A;  3ZFZ A;  1PZP A;  1F98 A;  5MC7 A;  5E2E A;  4QY5 A;  5KMW A;  5CTM A;  4E6X A;  1RGZ A;  3HLC A;  1FCM A;  3CPT B;  3UB7 A;  1P97 A;  1IEL A;  5HL6 A;  1NY0 A;  3T12 B;  3ZG5 A;  2Y8H A;  3H7W B;  5EVI B;  4CQH A;  5HFO A;  2L4R A;  3CIT A;  3MR0 A;  1RGY A;  1I5Q A;  1MWS A;  1T19 A;  3BM6 A;  3LFV A;  4S2N A;  1TS0 A;  4FH2 A;  1I2S A;  2HDR A;  4HY8 A;  3P98 A;  3TSG A;  2V8C A;  3VP2 A;  4S2J A;  4OLD A;  3K2N A;  2XH9 A;  3KYE A;  3Q7V B;  2ZQD A;  4BQM A;  4MLL A;  1CEF A;  5F68 A;  1RCJ A;  1LLB A;  1HD8 A;  4WBG A;  1D1J A;  3ZG7 B;  3NY4 A;  3HJI A;  5L8M A;  5I94 A;  4MN6 A;  3NCK A;  4I39 A;  3LR5 A;  3DTK A;  1BYW A;  4K0W A;  1C3B A;  2KDK A;  4E3K A;  4L0L A;  4A5R A;  4ETZ A;  3C7U A;  5EEC A;  5E2H A;  2HDS A;  3C2W A;  3B33 A;  1LHY A;  4R38 A;  4R6L A;  2PAV P;  2BG1 A;  4M4X A;  3T4L A;  3LR4 A;  4KZ8 A;  1IYO A;  2JKF A;  1XJ4 A;  1Y4O A;  1CF0 A;  2BAS A;  1NLY A;  3IX8 A;  4OKP A;  1BTL A;  1BUE A;  5IU1 A;  1F5M A;  1OTI A;  3MMH A;  3FV7 A;  5FI2 A;  4B88 A;  2EWV A;  4FD8 A;  3ZG9 B;  4D2O A;  4WN5 A;  1Z09 A;  5IHV A;  3LEZ A;  4Y0U A;  3R7W B;  3LY4 A;  1DJB A;  3MKF A;  5C5K A;  3CAX A;  5CGX A;  5TFQ A;  2XD5 A;  4OQH A;  4DRT A;  3TW8 A;  1V9Y A;  4EBL A;  1D06 A;  2L1M A;  1YQS A;  2G2W A;  5TBM B;  2Z2L B;  3S1Y A;  1MZU A;  1FIK A;  5EVI D;  1S0W A;  3SS4 A;  3O5Y A;  4IVK A;  4FH4 A;  2Y59 A;  4LRY C;  4MCW A;  3A3J A;  2W3E A;  4BJP A;  2O99 A;  5IT5 A;  3RTY A;  2J3T D;  4LCL A;  2Y2M A;  3QP6 A;  3OPH A;  1VET A;  5J7E A;  4S2O A;  2ZC6 B;  1CJF A;  5FAT A;  2WAE A;  4ARZ B;  4EEP A;  2ZM0 A;  3IF6 A;  4X6T A;  2ZBB A;  2B95 A;  2XLN A;  3HUO A;  4BD0 A;  4JPM A;  1N9O A;  4KQR A;  5EFW A;  3UE0 A;  1FR1 A;  4F3L A;  1TD5 A;  2HP5 A;  3SH7 A;  4DXB A;  4AFI A;  4II7 A;  4E3O A;  4GDN A;  2DRW A;  2OWH A;  3VV4 A;  3PXP A;  4DF6 A;  3SH9 A;  5BOH A;  3LIE A;  5IS1 A;  1S67 L;  3OOV A;  1BLP A;  1EWZ A;  3F1O B;  4GDB A;  4IVI A;  4FTX A;  2PDR A;  1S66 L;  2IWC A;  4EW7 A;  4GOG A;  4N9K A;  2HGV A;  2Y2Q A;  2J9O A;  2IWB A;  4JGO A;  2ZC7 A;  1TDL A;  3IF5 A;  3IBR A;  2J8Y A;  4FCF A;  5DTS A;  3UB8 A;  2VGJ A;  5CHU A;  3T4K A;  4UAA A;  1S1Z A;  4JF6 A;  1W63 Q;  3H82 B;  5CGS A;  5GL9 A;  3FWL A;  5KIZ A;  1M6K A;  5HDS A;  3T50 A;  1MPL A;  4KG2 A;  4RX2 A;  4KG6 A;  4X56 A;  4Y2F A;  3UDX A;  3ZCZ A;  2JCH A;  5FQ9 A;  2H10 A;  4WMC A;  3WWX A;  3NDE A;  2ZQA A;  2ZQ7 A;  3N8R A;  3P01 A;  3F1P A;  5CER A;  4H6J A;  3LY3 A;  3OBF A;  2XA7 S;  3VE4 A;  3T4J A;  3BJN A;  4HJ4 A;  3UB6 A;  5HAI A;  1ZC2 A;  4E6W A;  4MBH A;  2WZX A;  4OP5 A;  4S2N C;  5M1A A;  1PFL A;  2V9A A;  4BWI A;  4ZTK A;  4ZJ1 A;  2Y2P A;  1L2S A;  1P9W A;  4BL3 A;  3KX0 X;  3BFF A;  4GD6 A;  1E4D A;  2A24 B;  4GJ4 A;  3M6B A;  1ES4 A;  3BEC A;  1FQG A;  1MKM A;  3VE3 A;  2HPB A;  3V3S A;  3JPU A;  2J7V A;  5DKK A;  4RA7 A;  3Q07 A;  3T4Q A;  3IWQ A;  1SHV A;  1IYP A;  2M7U A;  3NJA A;  4QHC A;  3VSK A;  4HI4 A;  1HZO A;  1G6O A;  1M40 A;  5L10 A;  1K54 C;  5AJG A;  4U0T A;  3M2K A;  3PHY A;  4LLO B;  1NRJ A;  2QJ5 A;  2A49 A;  4KZB A;  3UMD A;  3HBR A;  2QWS A;  2FZ0 A;  3MFX A;  2PBY A;  1MWT A;  2RL3 A;  3DTI A;  2UV0 E;  1PW1 A;  5GHZ A;  4LFU A;  1ESI A;  3CLO A;  1LSW A;  1LL8 A;  4I38 A;  2W1T B;  1XJ6 A;  5FQJ A;  1ES2 A;  4LRX C;  2HP9 A;  1NRF A;  5AQA A;  4KZ3 A;  4E3N A;  4OLG A;  5A8B A;  1PRQ A;  2W3H A;  4JLF A;  3O88 A;  1JWZ A;  3IBJ A;  3UE1 A;  4P87 A;  3NDG A;  2VK3 A;  4OPR A;  4OQ0 A;  4DN0 A;  2VV6 A;  4KZ9 A;  5KZH A;  2NUP C;  2JKT I;  2Q9M A;  1HLU P;  4KQO A;  5DF9 A;  3W2Z A;  5EVE A;  3WS5 A;  4IBX A;  2CC1 A;  3LIC A;  4QWO A;  4GS9 B;  5J4E A;  3KO6 A;  1PWC A;  3IHA A;  1H5X A;  1F2K A;  1WA9 A;  4B93 A;  4I5S A;  1ZHH B;  2L0W A;  4C3Q A;  1SKF A;  2GJ3 A;  1XA7 A;  3K3C A;  5FAQ A;  1FOF A;  5FI7 A;  1PYY A;  1VEU A;  2GZA A;  3LIF A;  3QP4 A;  4O0P A;  3E4P A;  1K38 A;  1XFN A;  3Q81 A;  3MBZ A;  5HD3 A;  2JKR I;  3WS0 A;  1J3W A;  3V5M A;  3BY9 A;  2O9B A;  4RVA A;  1OTE A;  4HNB A;  3T4O A;  5AQ9 A;  1LI0 A;  2XFT A;  3T4S A;  3DAV A;  4KZ5 A;  4B4X A;  1IFQ A;  4IED A;  3AGE A;  2WUQ A;  4JBF A;  4WEK A;  2PD8 A;  4Y7P A;  1FIL A;  5AQB A;  4E3L A;  3FZC A;  5TGF A;  1OT6 A;  4ZRR A;  3UPO A;  3AGD A;  2M7V A;  2IWD A;  3NUL A;  1ZG4 A;  4KEN B;  5U47 A;  2R9W A;  4Y13 A;  5HAQ A;  2X02 A;  3VFF A;  1SDN A;  3CPT A;  1K55 A;  1TEM A;  3HVF A;  3HLE A;  1YT4 A;  3NHQ A;  3SS3 A;  1GA9 A;  1KE3 A;  4LV1 A;  1OJG A;  3BLS A;  3MXQ A;  1N9B A;  3H7W A;  5EVI A;  3Q7Z A;  3WS1 A;  3UB9 A;  2ZC4 B;  4JGQ A;  3GMW A;  3BLM A;  1K4E A;  2Y91 A; 
#chains in the Genus database with same CATH homology
 3VSL A;  3N6I A;  4OKP A;  1BTL A;  1BUE A;  3IXB A;  3JYI A;  2H0Y A;  4RX3 A;  5FQQ A;  4BD1 A;  1IKI A;  4OP8 A;  5DVA A;  2XEP A;  3FV7 A;  5FAP A;  5FI2 A;  2ZQ9 A;  4B88 A;  1KGE A;  1Y54 A;  3OC2 A;  2GDN A;  3IF6 B;  1W8Y A;  2Y2N A;  4OPZ A;  4FD8 A;  3D4F A;  3NC8 A;  4JXV A;  3ZG9 B;  2QZ6 A;  1ERO A;  4D2O A;  3MXS A;  3Q7V A;  5IHV A;  5DF7 A;  4M3K A;  3PBR A;  3LEZ A;  1SCW A;  2EFU A;  4Y0U A;  1FSW A;  4ID4 A;  1YM1 A;  1ONG A;  2ZJ9 A;  5EOE A;  1H8Y A;  3W4O A;  3P09 A;  3S22 A;  2XQZ A;  1CK3 A;  4PM8 A;  3M6H A;  1GCE A;  1DJB A;  3LY4 A;  3MKF A;  1XKZ A;  3FYZ A;  4JXW A;  1IYS A;  4N92 A;  1K25 A;  4XUX A;  1K56 A;  5CGX A;  3N7W A;  5TFQ A;  2XD5 A;  1KVM A;  4OQH A;  4DRT A;  4WEJ A;  4IBR A;  4OON A;  4WZ4 A;  4EBL A;  1NZU A;  3BEB A;  3PBS A;  3ZGA B;  1FCN A;  4KZA A;  4P6B A;  1YLZ A;  1YQS A;  4OOL A;  1N4O A;  2G2W A;  1WYB A;  3PBT A;  2Z2L B;  4MBK A;  1OME A;  1CEG A;  1YMS A;  3S1Y A;  4DDS A;  1AXB A;  4EBP A;  3BYD A;  1IKG A;  1KE0 A;  1BUL A;  1YLY A;  3W4P A;  2ZMA A;  3OPP A;  5EVI D;  4OPQ A;  1S0W A;  2WKH A;  5DTT A;  5L2F A;  3IF6 C;  4PMA A;  3WS4 A;  1W79 A;  3SS4 A;  4EWF A;  1BT5 A;  4IVK A;  1E3U A;  4FH4 A;  5GHX A;  5EVL A;  4EBN A;  1L0F A;  2Y59 A;  3VP4 A;  3C5A A;  5HL1 A;  3G2Z A;  1NYM A;  2EX9 A;  3A3J A;  3O86 A;  5AQ7 A;  5F1G A;  4BJP A;  1MY8 A;  2UWX A;  3E2K A;  5HW3 A;  2R9X A;  3ZVW A;  4LV2 A;  1NYY A;  4ZDX A;  3I7J A;  3NIA A;  4LCL A;  3IXH A;  3ZNY A;  2WYX A;  2Y2M A;  1O07 A;  4LV3 A;  5HAR A;  4BL2 A;  5KSH A;  4JF5 A;  4PPR A;  4HES A;  4Y0T A;  1G6A A;  3VOZ A;  3ZG0 A;  3IWO A;  1MBL A;  3OPH A;  4NK3 A;  4S2O A;  5A90 A;  2ZC6 B;  1L0G A;  5GLB A;  3G2Y A;  5FAT A;  3WRT A;  3MXR A;  3EQV A;  2WAE A;  5GLA A;  4QB8 A;  3UPP A;  4JKT A;  2ZM0 A;  4OVD A;  2I72 A;  5HAP A;  3HLD A;  3IF6 A;  2EXB A;  4X6T A;  1PI5 A;  4UHU A;  3VP1 A;  5JYP A;  2XLN A;  3HUO A;  2A3U A;  3G35 A;  1JWV A;  2XK1 A;  3A3F A;  4S2L A;  4BD0 A;  3BFE A;  3G34 A;  4JPM A;  1K56 D;  4KQR A;  3UE0 A;  1FR1 A;  2FFY A;  3TG9 A;  3RXX A;  2HP5 A;  4R0Q A;  3TOI A;  1KDS A;  2V20 A;  5E43 A;  3SH7 A;  5FAS A;  4DXB A;  4E3O A;  1YMX A;  4GDN A;  4GB7 A;  3IH9 A;  4HEF A;  5GLC A;  4DE3 A;  4UA9 A;  2DRW A;  1H8Z A;  5J8X A;  3QHY A;  3VOY A;  2ZD8 A;  5FSR A;  4DF6 A;  3SH9 A;  2WZZ A;  3GVB A;  5E2F A;  1NZO A;  5FQI A;  5BOH A;  1YLW A;  3A3I A;  1BLP A;  3DWZ A;  1EWZ A;  4UA6 A;  4LCM A;  2WGV A;  5D3O A;  4LEN A;  4GDB A;  1NJ4 A;  4IVI A;  4K91 A;  3OCL A;  3MFD A;  5GLD A;  3IT9 A;  3OCN A;  2IWC A;  4KG5 A;  4GOG A;  4N9K A;  4EV4 A;  1E3U D;  2WK0 A;  4MEZ A;  3C4P A;  1IEM A;  3UPN A;  3CZD A;  4S2P A;  2Y2Q A;  3OZH A;  5DTK A;  2J9O A;  3GR2 A;  5HX9 A;  4B4Z A;  4OPY A;  5JYO A;  5KSC A;  2IWB A;  3SOI A;  2Y55 A;  3HLF A;  1WYC A;  2ZC7 A;  1Q2Q A;  1TDL A;  3IF5 A;  3VFH A;  1K57 C;  3IQA A;  3IWI A;  3N8S A;  4XXR A;  1LI9 A;  3HUM A;  2J8Y A;  4FCF A;  1PWG A;  5DTS A;  3O87 A;  4FSF A;  2VGJ A;  2WGW B;  3WRZ A;  5CHU A;  4WYY A;  3C4O A;  4UAA A;  4KZ6 A;  4JF6 A;  3PBO A;  5CGS A;  5GL9 A;  4XUZ A;  4X69 A;  3FWL A;  3GRJ A;  3G30 A;  5CGW A;  4C6Y A;  3ITB A;  1M6K A;  4MBF A;  1MPL A;  4KG2 A;  4HBT A;  4RX2 A;  3O3V A;  4DE0 A;  4KG6 A;  2EX6 A;  4WZ5 A;  3PBN A;  3ZVT A;  2V2F F;  3LCE A;  4X56 A;  2HDU A;  1QME A;  4K0X A;  5M18 A;  3BFC A;  2EFX A;  3UDX A;  3ZCZ A;  5F1F A;  4KQQ A;  4OOY A;  2JCH A;  5FQ9 A;  1PZO A;  2H10 A;  4WMC A;  3WWX A;  3NDE A;  4LV0 A;  5A91 A;  2ZQA A;  1K6R A;  2ZQ7 A;  1KGG A;  3N8R A;  1NXY A;  5CER A;  4EQI A;  1I2W A;  3LY3 A;  2XGN A;  5E2G A;  4CJN A;  5FQM A;  1JTD A;  1YLP A;  2ZQ8 A;  4PM6 A;  1XX2 A;  4DDY A;  3ZG8 B;  1ZG6 A;  3A3E A;  1DY6 A;  2J9P A;  5HAI A;  4DXC A;  2Q9N A;  2WAD A;  1ZC2 A;  1GHM A;  2HDQ A;  3E2L A;  2WZX A;  3G31 A;  3Q82 A;  3FKV A;  4MBH A;  4E6W A;  4OP5 A;  4S2N C;  5M1A A;  3GQZ A;  1ERQ A;  2XDM A;  4JF4 A;  5CTN A;  1HTZ A;  2E8I A;  5F83 A;  4X53 A;  4P0M A;  4ZTK A;  2Y4A A;  4R1G A;  2V1Z A;  3IHB A;  2JBF A;  2Z2M B;  4ZJ1 A;  3W8K A;  4HBU A;  2Y2P A;  2XR0 A;  5F82 A;  1L2S A;  3V50 A;  5A92 A;  4DE2 A;  4BL3 A;  3BRM A;  1CI9 A;  1W8Q A;  3BFF A;  4GD6 A;  1HVB A;  1ONH A;  4OOM A;  2Y2J A;  2B5R A;  1E4D A;  2FFF B;  4E3I A;  3DWK A;  5FAO A;  1Q2P A;  3PAG A;  3HLW A;  1L0E A;  3M6B A;  1ES4 A;  1FR6 A;  3BEC A;  1FQG A;  1MKI A;  3MZE A;  4C75 A;  1MXO A;  2Y2H A;  2XFS A;  4PM7 A;  2HPB A;  3V3S A;  3S4X A;  3W4Q A;  3ITA A;  2J7V A;  4GNU A;  4RA7 A;  4QJG A;  2P74 A;  3Q07 A;  5DF8 A;  3IWQ A;  4X68 A;  5CEC A;  1SHV A;  2C5W B;  1IYP A;  2P9V B;  1U60 A;  4QHC A;  4R3J A;  3VSK A;  1HZO A;  1BLC A;  1M40 A;  3OPR A;  2WGW A;  1FCO A;  2EXA A;  1K54 C;  3N8L A;  3HUN A;  4JXS A;  1LL9 A;  4PM5 A;  4U0T A;  3M2K A;  2RCX A;  3HLG A;  1YLJ A;  2OV5 A;  1JVJ A;  3VP3 A;  2PU4 A;  1IYQ A;  2A49 A;  4KZB A;  3HBR A;  3MZF A;  4R4S A;  4UA7 A;  2PBY A;  4WMC D;  1K6S A;  1MWT A;  2G2U A;  5A93 A;  3VP0 A;  2JC7 A;  4NET A;  3IXD A;  2RL3 A;  3NI9 A;  4R4R A;  3SS5 A;  3UE3 A;  4BEN A;  1ES3 A;  2QMI A;  1PW1 A;  5GHZ A;  5EPH A;  3V3R A;  5CEB A;  1ESI A;  1VQQ A;  1KE4 A;  3HL9 A;  1KVL A;  1KGF A;  1VM1 A;  2ZC5 B;  5EVI C;  1TDG A;  4S2K A;  2DNS A;  3BFD A;  3PTE A;  5CHM A;  1RP5 A;  4ZJ3 A;  3ZHH A;  4X55 A;  2EX2 A;  3C7V A;  2C6W B;  4E3M A;  1K54 A;  1KDW A;  1BSG A;  1GHI A;  3CMZ A;  1CI8 A;  1DJA A;  4KZ7 A;  3HLB A;  5EUA A;  4E3J A;  1XPB A;  1XXM A;  1J9M A;  1GA0 A;  1TVF A;  5FA7 A;  1YLT A;  5FQJ A;  1ES2 A;  4KZ4 A;  2HP9 A;  2OLU A;  1XA1 A;  1NRF A;  5AQA A;  1ESU A;  2XD1 A;  2Y2K A;  4P85 A;  3ZNT A;  4R23 A;  4KZ3 A;  4E3N A;  4N9L A;  3BFG A;  4OLG A;  3ZDJ A;  2QPN A;  3ISG A;  3CG5 A;  5CHJ A;  4JLF A;  2ZM2 A;  3O88 A;  1S6R A;  3G4P A;  4CPK A;  4OQI A;  2H5S A;  2WKE A;  1JWZ A;  1PIO A;  3IH8 A;  4WEL A;  3UE1 A;  4P87 A;  4QD4 A;  1ES5 A;  3EQU A;  3NDG A;  3PBQ A;  4QU3 A;  2P9V A;  3MZD A;  4OPR A;  4PM9 A;  2VGK A;  4OQ0 A;  3UY6 A;  1PW8 A;  4GN2 A;  5TR7 A;  4RYE A;  4ZAM A;  1FSY A;  3IXG A;  4KZ9 A;  1GHP A;  4Y0O A;  2Y2G A;  4S2I A;  5KZH A;  1K57 A;  2Q9M A;  2Y2L A;  4S2M A;  3Q1F A;  4N1H A;  1LL5 A;  3V39 A;  4KQO A;  1Z6F A;  4QY6 A;  5CED A;  2H0T A;  1PI4 A;  5DF9 A;  3M2J A;  1ALQ A;  2WGI A;  2PU2 A;  1BLS A;  4GZB A;  1DJC A;  1EI5 A;  3ZFZ A;  3WS5 A;  3GV9 A;  4IBX A;  5M19 A;  1PZP A;  2CC1 A;  1BLH A;  1BZA A;  4EUZ A;  3GSG A;  5E2E A;  4QY5 A;  5KMW A;  5CTM A;  4E6X A;  2Y2O A;  1RGZ A;  4U3T A;  1PWC A;  1FCM A;  3HLC A;  3UNW A;  4F94 A;  3OPL A;  3IHA A;  1H5X A;  1IEL A;  5FI6 A;  2X01 A;  1NY0 A;  5CXW A;  3ZG5 A;  4C3Q A;  5EVI B;  1SKF A;  1ERM A;  1XA7 A;  1XGJ A;  5FAQ A;  1ZKJ A;  1SDE A;  3FKW A;  3B3X A;  1FOF A;  4ZBE A;  5HFO A;  5FI7 A;  1RGY A;  1I5Q A;  1PYY A;  1W5D A;  4GD8 A;  4ZJ2 A;  1L0D A;  3RJU A;  1XP4 A;  2X71 A;  4WM9 A;  2HP6 A;  1JWP A;  1O7E A;  1MWS A;  2Y2I A;  1WE4 A;  3BM6 A;  3UDF A;  3UDI A;  3VMA A;  4S2N A;  4FH2 A;  1I2S A;  1MWU A;  2OSU A;  4N1X A;  2HDR A;  2WAF A;  3WS2 A;  1PWD A;  3P98 A;  3TSG A;  4H8R A;  4O7D A;  1K38 A;  4OH0 A;  3VP2 A;  4S2J A;  4DE1 A;  4YIN A;  2BLS A;  3Q81 A;  4OLD A;  1XGI A;  3MBZ A;  3UO9 A;  2XH9 A;  3WS0 A;  4Q8I A;  3Q7V B;  2ZQD A;  1K4F A;  4BQM A;  3V5M A;  4RVA A;  4MLL A;  1CEF A;  4MNR A;  1RCJ A;  3CJM A;  1QMF A;  5G18 A;  1LLB A;  3SH8 A;  1HD8 A;  4WBG A;  4DKI A;  1K55 C;  3DW0 A;  3ZG7 B;  3NY4 A;  2ZC3 B;  1LI0 A;  5AQ9 A;  2XFT A;  4KZ5 A;  5I94 A;  4B4X A;  3DTM A;  4IED A;  3A3D A;  3HRE A;  3NCK A;  4OQG A;  3AGE A;  4Z9Q A;  2WUQ A;  4GKU A;  4JBF A;  5CRF A;  5EE8 A;  4WEK A;  2OLV A;  5GHY A;  4Y7P A;  3RXW A;  4K0W A;  5AQB A;  2ZLY A;  4YFM A;  1C3B A;  4E3K A;  3LO7 A;  4E3L A;  4L0L A;  3FZC A;  5TGF A;  2ZQC A;  3NBL A;  4A5R A;  3UPO A;  3PAE A;  3AGD A;  1MWR A;  2XF3 A;  3C7U A;  2IWD A;  2DCF A;  3QNB A;  5E2H A;  2HDS A;  5EEC A;  5FQK A;  1ZG4 A;  2EX8 A;  4KEN B;  5U47 A;  4BLM A;  2R9W A;  2WKI A;  3AGF A;  2JE5 A;  1LHY A;  4R3B A;  5HAQ A;  2X02 A;  3MKE A;  4JXG A;  3VFF A;  1SDN A;  1K55 A;  1TEM A;  3HVF A;  3HLE A;  3G32 A;  1E25 A;  1YT4 A;  3SS3 A;  1GA9 A;  1JTG A;  1KE3 A;  5EOO A;  4LV1 A;  2BG1 A;  3BLS A;  3N4I A;  1N9B A;  5EVI A;  1G68 A;  3Q7Z A;  4KZ8 A;  5FDH A;  3QNC A;  3WS1 A;  1IYO A;  2ZM8 A;  2ZC4 B;  3UN7 A;  3GMW A;  4WZ5 C;  4U0X A;  1W7F A;  3BLM A;  1K4E A;  2Y91 A;  3GTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...