3BYDA

Crystal structure of beta-lactamase oxy-1-1 from klebsiella oxytoca
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
DAIQQKLADLEKRSGGRLGVALINTADDSQTLYRGDERFAMCSTGKVMAAAAVLKQSESNPEVVNKRLEIKKSDLVVWSPITEKHLQSGMTLAELSAAALQYSDNTAMNKMISYLGGPEKVTAFAQSIGDVTFRLDRTEPALNSAIPGDKRDTTTPLAMAESLRKLTLGNALGEQQRAQLVTWLKGNTTGGQSIRAGLPASWAVGDKTGAGDYGTTNDIAVIWPENHAPLVLVTYFTQPQQDAKSRKEVLAAAAKIVTEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the broadened substrate profile of the extended-spectrum beta-lactamase OXY-1-1 from Klebsiella oxytoca
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Hydrolase
molecule keywords Beta-lactamase OXY-1
total genus 88
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3bydA00
4IVIA 2ZQAA 2V1ZA 4BQMA 4X53A 1O7EA 3E2KA 1PI4A 2XH9A 2WUQA 2XD5A 3RXXA 3BFFA 4GDBA 4P0MA 3HUMA 1IYQA 3UPOA 1SHVA 2BLSA 2WKIA 3C5AA 4RVAA 3SH9A 4DRTA 4X6TA 4E6XA 4P87A 4BD0A 3ISGA 1I5QA 3O88A 2ZLYA 4JXGA 5M1AA 3PBNA 5M19A 1K56A 2DRWA 1L0GA 3MZDA 5CECA 1LL5A 5GL9A 5HAIA 5U47A 1E25A 1FQGA 3PBQA 5AQAA 3ZCZA 3IHBA 5CTMA 1OMEA 4JXSA 3Q7VA 2H0YA 2P9VA 3PBSA 4JBFA 5FSRA 3SS4A 4OH0A 4OPZA 3DWKA 3G4PA 4YFMA 1ONGA 4KZ9A 1ZC2A 1BSGA 4KZ4A 3UE3A 4DE1A 5TR7A 5JYPA 1K6SA 2DCFA 3PBOA 3QNBA 3HBRA 2GDNA 1VQQA 5AQ9A 1PWGA 3G31A 5EUAA 4ZJ1A 1BLCA 1NRFA 4GDNA 3PBRA 5GLDA 3S4XA 3G2ZA 5A90A 5FAPA 4JLFA 2Q9MA 4NK3A 1TDGA 4WMCA 4JPMA 5IHVA 4B88A 3HLEA 1XXMA 3LO7A 3GVBA 3EQUA 4DXCA 3HLFA 2ZC6B 2XD1A 5CXWA 3VP0A 4ZTKA 3WS4A 1YT4A 5CHJA 1Q2PA 1LI0A 3ZG7B 1KVMA 3NY4A 5FI7A 4C6YA 2EX9A 4WELA 3P98A 3BFEA 1W8YA 1RGZA 3A3EA 3OCLA 4MBKA 3OZHA 3FV7A 3WRTA 1DJAA 3ZFZA 2WZXA 5FASA 5HW3A 3PAGA 1FSWA 1XPBA 3GV9A 3V3RA 1KVLA 3WS0A 2XF3A 3ZG8B 4E3JA 2XEPA 1KGEA 4GNUA 2V20A 5TGFA 2Y2IA 2A3UA 3MZEA 5FATA 1H8YA 3SS3A 2XQZA 3NDEA 3ZNYA 4KG5A 5KMWA 5EOEA 3MFDA 1JTGA 3JYIA 4P85A 3CMZA 5EVLA 4WEJA 4EUZA 1FCNA 4OLDA 4WMCD 4K91A 2EX2A 3W4QA 4DXBA 1YMXA 2Y4AA 2ZC4B 5FQQA 1NYYA 1K54A 4GZBA 4E3NA 4PM8A 4KZ6A 3HREA 3NI9A 3VFFA 4C3QA 2VGJA 1ESIA 2EXBA 3BRMA 4WYYA 3V5MA 3MXRA 1ALQA 4QB8A 4ZDXA 2OSUA 3ZVWA 4OQHA 4F94A 1I2WA 4YINA 4MBHA 5F82A 2Y2GA 5FQIA 3MKFA 2EXAA 4PM5A 1C3BA 3VMAA 1SCWA 3EQVA 4PM7A 1XA7A 4C75A 4DF6A 2G2UA 1LL9A 5CHUA 3IXDA 3A3DA 1N4OA 5DTKA 4UAAA 5DVAA 4S2OA 4N1XA 1NZUA 1JVJA 3QNCA 1MXOA 2P74A 3PAEA 4LCLA 4N1HA 1DJBA 3M6BA 4E3MA 3OC2A 4S2IA 2XFSA 4HESA 5EVIA 3ITBA 4S2MA 1HZOA 5EVIB 4X56A 3SH7A 3NCKA 2ZQ8A 1JWVA 4KZ3A 1QMEA 3CG5A 4ZBEA 2P9VB 3BFDA 2PBYA 4JXWA 1PW1A 3BLSA 1YLYA 4WZ5A 3ZDJA 1TDLA 5A91A 4FCFA 2WK0A 1AXBA 4KG2A 2DNSA 4EBNA 1O07A 4RA7A 4XUXA 2JC7A 4DE3A 1K38A 1LHYA 1E3UD 1IEMA 4X69A 4D2OA 3CJMA 1K55C 1L0DA 3W4OA 4BL2A 3IWOA 1NZOA 1ZG4A 2Y2MA 4NETA 3TSGA 1BLHA 3BLMA 4S2JA 4EV4A 3IF6C 4LCMA 4OONA 4BENA 2XFTA 1SDEA 2FFFB 2J7VA 3BEBA 3RXWA 1M6KA 1FCMA 4X55A 2WGIA 1FOFA 1S6RA 3Q7ZA 2WAFA 3HLCA 3ZNTA 4Z9QA 2H5SA 2HPBA 1XP4A 4WEKA 3GMWA 2FFYA 3TG9A 1MKIA 4M3KA 4A5RA 4DE0A 1MWTA 5E2HA 5HFOA 4ID4A 5HX9A 3IXGA 3C7VA 2H0TA 1XKZA 1RGYA 3GRJA 5EOOA 5GHZA 3V3SA 1MY8A 4MBFA 3BYDA 3LY3A 1EI5A 3OPLA 2XK1A 4S2NA 5TFQA 2ZM2A 1WYBA 2R9WA 2ZQ9A 1XGIA 1HTZA 3NC8A 4UA9A 5D3OA 3W8KA 1E4DA 1KE0A 2HP9A 4U0TA 3ZG5A 4BD1A 4QY5A 3B3XA 4BL3A 2IWBA 3IWQA 4JXVA 1HD8A 3MZFA 5FAQA 4JF4A 3LY4A 2Y2KA 3VP1A 3FKWA 1ZG6A 1KDSA 1YLJA 5F1GA 2RL3A 3IWIA 5JYOA 2ZC3B 2XGNA 1MPLA 3FWLA 2IWDA 4KZ5A 4KZ8A 3ZG9B 4GN2A 2XLNA 3SH8A 5GHXA 1YMSA 3VOZA 1W5DA 1Z6FA 4R3JA 3VOYA 3SS5A 3HLWA 3ZHHA 2J9PA 2WYXA 1SDNA 2HDRA 1PI5A 3UN7A 2C5WB 3GTCA 4DDYA 1GHMA 4LV0A 3IF6A 1ZKJA 3WS2A 2WAEA 3UO9A 4QD4A 1QMFA 4X68A 1Q2QA 3WS5A 5DF8A 5KZHA 1XX2A 5EE8A 2Y2OA 2VGKA 3DWZA 1S0WA 3LCEA 3UDFA 3IF5A 2RCXA 5AQBA 3S1YA 3AGEA 1ESUA 3UY6A 3ITAA 1PZOA 3HL9A 4IVKA 2CC1A 3IQAA 5DF7A 2R9XA 5FI6A 3UE1A 4MLLA 2Y2LA 4GKUA 3FYZA 4OVDA 3GQZA 5FI2A 1JWPA 3IT9A 4KQRA 4Y7PA 5E2FA 3D4FA 4N92A 1GA9A 2WADA 2X71A 3Q1FA 1ONHA 1U60A 2Y2PA 4FSFA 3UNWA 2XR0A 1K4FA 1W7FA 3VP2A 4XXRA 4QHCA 4S2LA 3UDXA 3N6IA 3G35A 1G6AA 4N9LA 4OPQA 1WE4A 4KG6A 4LV2A 4IBXA 2Y2JA 3IH9A 2EX6A 3Q7VB 3UPNA 2B5RA 3HUOA 4IBRA 2QZ6A 2OLUA 4JF6A 4U0XA 3OPPA 1K25A 1YLPA 2E8IA 4E6WA 4GD8A 1CEGA 1Y54A 4R4SA 4KQOA 3FKVA 4R1GA 1BUEA 4PM6A 2Y2NA 3HLDA 1ES2A 5DTSA 3A3JA 1JTDA 1FSYA 3OPHA 4FD8A 3O86A 3QHYA 2ZQDA 4BJPA 1VM1A 4UA7A 3HLGA 1H8ZA 3M6HA 3RJUA 1W8QA 5FAOA 4B4XA 1NXYA 5BOHA 3GSGA 3PTEA 1KDWA 1H5XA 2OV5A 3G2YA 3Q82A 1ES4A 2WGWA 4UHUA 4EQIA 1K4EA 1MWRA 3DW0A 3OCNA 1ES5A 3N8SA 5E2GA 1K57A 1YQSA 4FH4A 4FH2A 5CEBA 1DJCA 1K57C 3ZVTA 4KQQA 4L0LA 4DKIA 5GHYA 1NY0A 1ERQA 4OOLA 4JF5A 4E3KA 3DTMA 3G34A 4S2KA 1EWZA 4DE2A 1M40A 4E3IA 3IHAA 1JWZA 2Y91A 1CI8A 4QU3A 3WS1A 2WGVA 2ZC5B 3OPRA 4OOMA 4HBTA 3HUNA 4R0QA 4UA6A 5CRFA 1BLSA 3P09A 4DDSA 5FQKA 3MXSA 3NIAA 2WGWB 3Q81A 5G18A 4MNRA 4CJNA 2Y2HA 1MBLA 3BFGA 2H10A 5EECA 4OQ0A 1N9BA 1PIOA 4Y0TA 5F1FA 1GCEA 2I72A 1K56D 5A93A 1MWSA 2X02A 1LLBA 1KE4A 3VSKA 4OP5A 5J8XA 4R3BA 5FA7A 1NYMA 3G32A 1KGGA 4OPYA 4IEDA 1IELA 3GR2A 4P6BA 2X01A 4PPRA 4ZJ2A 5DF9A 5E2EA 3ZG0A 3CZDA 3UE0A 5HL1A 1BLPA 1ES3A 1E3UA 2Z2LB 1BT5A 3IXBA 3IXHA 3LEZA 2Y55A 2ZQCA 2UWXA 2EFUA 2PU2A 3BFCA 4EBPA 2BG1A 3N8RA 5FQ9A 5CGXA 3VSLA 1HVBA 4U3TA 5HAPA 5L2FA 5CHMA 2EFXA 3N7WA 4HEFA 1FR6A 4H8RA 3VP4A 2HP5A 3MKEA 1PZPA 1IKIA 2Z2MB 5F83A 4OLGA 5EVID 3M2KA 5GLAA 4ZJ3A 1L0EA 5CGSA 4K0WA 4OKPA 4S2PA 1PYYA 4WZ5C 5CERA 2HDUA 4PMAA 1GHPA 4KZAA 4GD6A 4RX3A 2ZD8A 2ZJ9A 5AQ7A 2XDMA 1BULA 3BM6A 1BZAA 3W4PA 4XUZA 3V50A 1YLTA 4O7DA 1CK3A 2ZC7A 3Q07A 1YLWA 4JKTA 3G30A 1L2SA 3C7UA 5HARA 2Y59A 1KGFA 4N9KA 1PWDA 4MEZA 3A3FA 2ZQ7A 1ERMA 2WKEA 2QMIA 1K54C 2WKHA 4OQGA 3IF6B 5FQJA 3UDIA 1TEMA 4PM9A 5I94A 2EX8A 5CGWA 3I7JA 4E3OA 3AGDA 3HLBA 1CI9A 1TVFA 4OP8A 2C6WB 2JBFA 1IYPA 5DTTA 1SKFA 1KE3A 4RX2A 1K6RA 4K0XA 3A3IA 4LV1A 3V39A 4KZBA 1G68A 3HVFA 3WWXA 2Y2QA 1J9MA 4HBUA 1YM1A 2J9OA 2OLVA 4KENB 5HAQA 2WZZA 3S22A 4S2NC 1GHIA 5KSCA 3VFHA 1LI9A 2JCHA 4GB7A 1MWUA 3N8LA 2HP6A 3E2LA 4B4ZA 4RYEA 3M2JA 1W79A 1IYOA 1RP5A 3O3VA 3N4IA 3WRZA 4KZ7A 4QJGA 2J8YA 5A92A 2A49A 1EROA 4QY6A 5GLCA 4ZAMA 3AGFA 3NBLA 4EBLA 1NJ4A 3ZGAB 2HDQA 2IWCA 4Y0OA 1IYSA 1FCOA 4Y0UA 4EWFA 4Q8IA 1GA0A 2ZM0A 1BTLA 3C4PA 4E3LA 5KSHA 1XGJA 4GOGA 1IKGA 2ZMAA 3O87A 3C4OA 5E43A 1PWCA 4R4RA 3IH8A 2G2WA 4CPKA 1K55A 1RCJA 3TOIA 2HDSA 1L0FA 3VP3A 1XA1A 1WYCA 5FDHA 4WM9A 4OPRA 1I2SA 2Q9NA 4WBGA 4LENA 5M18A 1YLZA 3SOIA 5FQMA 3UPPA 4WZ4A 3NDGA 1DY6A 3FZCA 4OOYA 5GLBA 5CEDA 3PBTA 4LV3A 3MBZA 1FR1A 3BECA 2PU4A 1PW8A 2JE5A 5EVIC 4OQIA 4BLMA 4R23A 5CTNA 2QPNA 1CEFA 5EPHA 2V2FF 2ZM8A
chains in the Genus database with same CATH superfamily
4IVIA 1O7EA 2JKTI 4LRYC 3RXXA 5L8MA 2BTFP 2WKIA 4X6TA 4E6XA 2ZLYA 3PBNA 4UQIM 1LL5A 1E25A 1FQGA 3P7NA 1F9IA 2H0YA 2P9VA 4EUVA 4OH0A 3DWKA 1ONGA 4KZ4A 5JYPA 4II7A 1K6SA 2DCFA 3PBOA 5EUAA 3G31A 1ZTUA 4GDNA 3PBRA 3BQAA 2XROA 3PXPA 5KIZA 4EQ1A 2ZC6B 1YT4A 5CHJA 1LI0A 5FI7A 1LSXA 1RGZA 3OCLA 3OZHA 5HWWA 3T4SA 2V0UA 2OAQ1 4NXBA 4LRZE 2XF3A 2XEPA 2VJWA 5TGFA 1VB6A 3C38A 4Y13A 1CF0A 2XQZA 3NDEA 2ZL1A 3ZNYA 5KMWA 4K91A 3W4QA 3F1NB 3NHQA 3T1XA 3HREA 4C3QA 4EESA 2EXBA 3BRMA 2QYBA 4PKYA 4GS9B 1I2WA 2K7SA 5L07A 1C3BA 1K0KA 4ARZB 1T19A 2PT7A 3EQVA 4BBVA 3CWFA 1MXOA 3PAEA 5EVIA 1XJ4A 1ACFA 4S2MA 1HZOA 1SKOB 4X56A 3JPUA 1S1YA 2ZQ8A 4ZBEA 3CG5A 3HJIA 2PBYA 4HH2A 4JXWA 4WZ5A 5A91A 2D02A 4ETZA 2DNSA 1G5UA 4DE3A 3CJMA 3UB6A 4BL2A 2LB9A 2Y2MA 1W63M 4EV4A 1M6KA 1FCMA 4X55A 2WGIA 5HPFA 3Q7ZA 3ZNTA 4P6ZM 3TG9A 2JKRM 5E2HA 5EOOA 3CPTB 5TFQA 4S2NA 1T1BA 2HP9A 4U0TA 3ZG5A 1GSWA 4QY5A 4BL3A 3IX8A 5FAQA 3VP1A 1ZG6A 5JYOA 3DTEA 2W3HA 1MPLA 3FWLA 2IWDA 4GN2A 2XLNA 3F1PA 1YMSA 4UEYA 3SS5A 2WYXA 3E4OA 3GTCA 3UO9A 4X68A 1Q2QA 3WS5A 5DF8A 3DWZA 4JGOA 3IF5A 5FEGA 3AGEA 4Y15A 3UY6A 1PZOA 5DF7A 4IVKA 3IQAA 2R9XA 3UE1A 2Y2LA 1J3WA 4IJGA 4N92A 4FSFA 1W7FA 4S2LA 1G6AA 1WE4A 4QWOA 4IBXA 2B5RA 3HUOA 2QZ6A 4JF6A 3HCYA 4ME4A 3VE3A 2E8IA 5A8BA 1CEGA 4KQOA 4PHTA 2Y2NA 1ES2A 4X1LA 1FSYA 3OPHA 3FPWA 2VEAA 3QHYA 1LSVA 1KDWA 4UHUA 1MWRA 4FTXA 2ZL1B 2PD7A 3RH8B 4FH2A 3IX3A 5GHYA 2JN7A 1NY0A 3TE8A 4OOLA 4JF5A 1T1AA 4S2KA 1M40A 4QU3A 5AVEA 5HDDA 2ZC5B 1L3LA 3HUNA 1YAXA 1BLSA 4KQDA 4MNRA 1MBLA 2VZWA 3BFGA 2H10A 2VGLS 3DBAA 1GCEA 2M7VA 4LGWA 2X02A 2VV8A 1N9NA 5FA7A 1NYMA 3GR2A 4ZJ2A 5DF9A 5HL1A 1BLPA 4G3KA 1BT5A 2Y8HA 3U2AA 5MC7A 5J7EA 1TF1A 3CUEA 2H28A 4FUWA 2BG1A 3VSLA 1HVBA 3N7WA 4DJ2A 3DTIA 2JKRI 3MKEA 1IKIA 4OLGA 5EVID 3M2KA 1L0EA 5CGSA 4OKPA 1PYYA 2OWHA 1NRJA 4KZAA 4EERA 3MMHA 4HIAA 2ZD8A 2ZJ9A 3BM6A 4ESPA 1L2SA 3NULA 1KGFA 4N9KA 4UQIS 4OQGA 1ERMA 1K54C 2WKHA 2QKPA 5I94A 2EX8A 4GW9A 3HLBA 4OP8A 2C6WB 1IYPA 1GSVA 4RX2A 3A0RA 3WWXA 2Y2QA 1T1CA 2EWWA 2FZ0A 1XJ2A 5KSCA 2GNXA 5EM0A 5CX7A 4RYEA 5FL3A 3LFVA 4HJ6A 3L7HA 1W79A 3T4KA 5HSQA 3O3VA 4HJ4A 3N4IA 4KZ7A 4HOIA 2J8YA 4QY6A 4H6JB 3ZGAB 4Y0OA 1OJ5A 2HDQA 2IWCA 4EU0A 4EWFA 3JVUA 2KLIA 4GOGA 1PWCA 4R4RA 4CPKA 3LEQA 1RCJA 2HDSA 1L0FA 1WYCA 1I2SA 2YKHA 4WZ4A 3FZCA 4OOYA 3PBTA 3MBZA 1FR1A 3B33A 3BY8A 1CEFA 2B18A 2V1ZA 2XH9A 2WUQA 2XD5A 3BFFA 3T12B 3OBFA 3ISGA 4L9EA 3O88A 4JXGA 4DMZA 5M19A 1XJ3A 1K56A 2DRWA 2EA9A 4CLCD 3MZDA 2W3DA 5AQAA 5CTMA 4JXSA 3Q7VA 2O99A 5FSRA 3SS4A 3G4PA 4DE1A 1BSGA 5TR7A 3ULFA 1OT6A 3HBRA 4ZJ1A 1BLCA 1PFLA 1NRFA 3HJKA 3S4XA 1YSPA 3CI6A 4NK3A 1NLYA 3LO7A 3GVBA 4IUKA 2XD1A 5CXWA 3WS4A 3ZG7B 1Q2PA 3NY4A 4WELA 3P98A 3BFEA 3A3EA 3FV7A 3LIBA 3UB9A 1D06A 1DJAA 5FASA 3V3RA 3MQ0A 4I3JA 1KVLA 3ZG8B 2EWVA 1KGEA 1SKOA 2V20A 2A3UA 3MZEA 3SS3A 2QWSA 5EOEA 1JTGA 3CMZA 4WF0A 4WEJA 1FCNA 4WLAA 3LICA 1YMXA 2Y4AA 2ZC4B 1VEUB 1F2KA 2W27A 4GZBA 2V9AA 4PM8A 1TS7A 3V5MA 4NXFA 3E4PA 3ZVWA 4YINA 4MBHA 3ZQ5A 4WL9A 4C75A 2G2UA 4B93A 2ACGA 5DTKA 4UAAA 5DVAA 3KO6A 4N1XA 1NZUA 3QNCA 4N1HA 4QPRA 1DJBA 5IT5A 2W1TB 2VKSA 2B95A 3R4KA 4KZ3A 1Y28A 4B9OA 2P04A 1TDLA 1AXBA 4EBNA 4RA7A 4XUXA 1K38A 1IEMA 3KSIA 1K55C 4NETA 3TSGA 4S2JA 4I3AA 4LCMA 4NXEA 2FFFB 3NECA 1FOFA 3HLCA 4Z9QA 1XP4A 4DE0A 5HFOA 3LR5A 4ID4A 3S7OA 5HX9A 2H0TA 1XFNA 1XKZA 3K3CA 1MY8A 4ZRRA 1OT9A 1EI5A 1WYBA 1XGIA 3W8KA 4UA9A 3ZYTA 4G3VA 5HD3A 2J3TC 3QP4A 4I5SA 4BD1A 1OTBA 4JXVA 1HD8A 3MZFA 5K5BA 3LY4A 4JGPA 1KDSA 1YSQA 3IWIA 4HJ3A 2ZC3B 1FIKA 5GHXA 3VOZA 1W5DA 1Z6FA 4K08A 3HLWA 1S4SA 1SDNA 2HDRA 2Y79A 4DDYA 4I3IA 2VGKA 2ZOHA 1TS8A 1ESUA 3HL9A 5FI6A 1MZUA 3ICYA 4O8GA 4DN0A 1P0ZA 5FI2A 3UMDA 3IS2B 1P97A 1GA9A 2WADA 1YPRA 1DP6A 1UGUA 1ONHA 2P7JA 2XR0A 4GCZA 4XXRA 4QHCA 3N6IA 3G35A 4KG6A 4LV2A 1T18A 3QP5A 2Y2JA 2EX6A 3Q7VB 3EGXC 3QP1A 4IBRA 1YLPA 4E6WA 3CAXA 4GD8A 1H0MA 5DJTA 1S66L 4R1GA 4G3WA 2VV7A 3UB5P 3A3JA 1JTDA 3KYZA 4MN7A 3TJZC 2ZQDA 3HLGA 3DTKA 3RJUA 5FAOA 1NXYA 3GSGA 3PTEA 1OTDA 2OV5A 3U4LP 3L9KA 5E2GA 1YQSA 1K57C 4L0LA 4FOFA 3DAVA 2Y91A 4R6LA 1P9RA 3WS1A 1N9OA 1H8MA 2WGVA 4OOMA 4HBTA 4R0QA 5FQKA 3MXSA 3KSGA 2I9VA 5EECA 4BWIA 3EEHA 4Y0TA 2I72A 1K56D 1MWSA 1KE4A 3VSKA 2XSSA 4HNBA 4OP5A 4R3BA 1KGGA 1IELA 3BY9A 3UB8A 1ES3A 3IXBA 3PYPA 3LEZA 2Y55A 4LRXC 3BFCA 3C8CA 3NJAA 2L4RA 5L2FA 4H8RA 1PZPA 5DJUA 3S7NA 2V1AA 5F83A 4Q0IA 5GLAA 4ZJ3A 4K0WA 4WZ5C 4S2PA 3BWLA 2HDUA 4CLCE 3MS6A 4ARZA 1V9ZA 1BULA 1BZAA 4XUZA 3V50A 1G6OA 1CK3A 2ZC7A 3O5YA 3KSFA 2PR5A 3QP8A 4E04A 2WKEA 2QMIA 3UDIA 1TEMA 4CLCC 2OAP1 1IOUA 2QHKA 4Y5FA 5DTTA 3A3IA 4LV1A 2W3GA 3LIAA 3V39A 1YM1A 2J9OA 2OLVA 2WZZA 4S2NC 1GHIA 2HP6A 1S67L 1IYOA 4GHIA 4QJGA 5A92A 3H82B 2DMWA 5GLCA 4ZAMA 3CITA 3NOPC 4XT2A 3QP2A 1IYSA 4KUKA 4Y17A 3C4PA 5KSHA 1XGJA 2O9CA 4HY8A 2L1MA 4YNRA 3EGDC 3IH8A 2G2WA 1K55A 3VP3A 1S1ZA 4MCWA 4WM9A 2Q9NA 4HHDA 1YLZA 3SOIA 3NDGA 4LFUA 4LPZA 1W63Q 2JE5A 4OQIA 2R78A 4XT2B 4JGRA 2QPNA 3LIEA 2V2FF 4BQMA 4HQAA 1UWPX 4ETXA 4MDZA 4GDBA 2O9BA 4P0MA 3HUMA 1IYQA 3UPOA 1SHVA 2A2LA 2BLSA 3C5AA 3SH9A 4DRTA 1DP9A 5M1AA 1A0KA 1OTEA 3LR0A 5CECA 5GL9A 5HAIA 5U47A 3ZCZA 1V9YA 3IHBA 4NEED 1TD5A 3UB7A 1OMEA 1ZHHB 3PBSA 4HP4A 5FDSA 2Q0OA 4YFMA 4KZ9A 3CHWP 2GDNA 1VQQA 1PWGA 5GLDA 3G2ZA 2ZMFA 5FAPA 4JLFA 2XA7S 3T4LA 4WMCA 4JPMA 5IHVA 1XXMA 4DXCA 3HLFA 4RQ9A 2NUPC 3VP0A 4ZTKA 3E98A 1KVMA 3UMEA 4HI4A 3B47A 4MBKA 2WZXA 4LLOB 1XPBA 3GV9A 4Y3IA 4GNUA 2Y2IA 5FATA 3S7QA 3H9WA 3D3OA 2WKQA 3T50A 2LB5A 3MFDA 4P85A 2ZOIA 2JKFA 4EUZA 4WMCD 2EX2A 3T4QA 4DXBA 1BYWA 3MR0A 2QJ5A 3KYEA 3LI9A 2KDKA 4KZ6A 3VFFA 2VGJA 1ESIA 4QB8A 4F94A 2JKGA 2G7UA 5F82A 5FQIA 1VETA 1AWIA 4PM5A 3VMAA 1SCWA 5HD5A 3TW8A 3IXDA 1N4OA 4R70A 1JVJA 4LCLA 4BMWA 4EXOA 3M6BA 4E3MA 2V1BA 3OC2A 2GX5A 2XFSA 4S2IA 4X25A 3LYXA 5EVIB 3SH7A 1QMEA 3BFDA 3ZDJA 3BLSA 1TS6A 2P08A 5LBRA 4KG2A 1O07A 1UWNX 2JC7A 1E3UD 4X69A 3H7WB 5TBMA 3LI8A 4O0PA 1L0DA 4YOFA 1NZOA 1ZG4A 2O9AA 4WN5A 3W2ZA 1BLHA 3BLMA 4OONA 3BEBA 3RXWA 3BJNA 1DRMA 2JHEA 2H5SA 3GMWA 4A5RA 1MKIA 3E4QA 3C7VA 1RGYA 3BW6A 3V3SA 5G4YA 3LY3A 2V8FA 3NOTC 5F5YA 2ZQ9A 3NC8A 1SZVA 1E4DA 1KE0A 5EM1A 3B3XA 3D72A 2IWBA 4JGQA 4JF4A 2Y2KA 1F5MA 1YLJA 2RL3A 2XGNA 4KZ5A 3ZG9B 4DJ3A 2Z6CA 2J3WA 3SH8A 3QP6A 1TS0A 2XRNA 4R3JA 3VOYA 3ZHHA 2J9PA 1HLUP 3VV4A 2C5WB 3IF6A 1LT0A 4QD4A 1QMFA 5KZHA 1XX2A 3EEAA 4EW7A 4WUJA 5EE8A 2PBDP 1S0WA 3UDFA 1Z09A 2RCXA 5AQBA 3S1YA 3ITAA 4MLLA 4GKUA 4OVDA 5HZHA 1JWPA 4KQRA 4Y7PA 3KX0X 3D4FA 2X71A 1U60A 3UNWA 1K4FA 1IFQA 3VP2A 4N9LA 4U0XA 3SZTA 2W3EA 1OJGA 3FKVA 2J80A 3UE6A 1BUEA 4PM6A 5DTSA 4FD8A 4BJPA 3M6HA 1VEUA 4B4XA 5G4ZA 1H5XA 3EWKA 2ZMVA 3G2YA 4YWZA 2WGWA 3DW0A 5I5LA 1N9LA 2GZAA 1ES5A 3PR6A 5CEBA 4FH4A 2PAVP 3ZVTA 4KQQA 4DKIA 3DTMA 1EWZA 3IHAA 1JWZA 1S4RA 5TJJA 5CRFA 4NXGA 3MJQA 3NIAA 2WGWB 3Q81A 5G18A 2W1RA 4OQ0A 5J3WA 4PKYG 1PIOA 2O0YA 5A93A 3R7WA 5DFYA 1LLBA 3G32A 1WA9A 1DP8A 3H7WA 5E2EA 5TBMB 3ZG0A 3UE0A 5AVFA 1E3UA 5HDSA 2Z2LB 3IXHA 4KUOA 2UWXA 3LR3A 4EBPA 4HP9A 5FQ9A 5CGXA 4HEFA 1FR6A 3VP4A 3MQQA 1FILA 2Z2MB 5L10A 4PMAA 3TRCA 4RX3A 1D7EA 5AJGA 2XDMA 3W4PA 1CJFA 1YLWA 3C7UA 3MQOA 5EFWA 4MEZA 3A3FA 4B88A 4Z1WA 2PYPA 3LR4A 3I7JA 2OOLA 4E3OA 2INWA 4L9FA 1CI9A 1TVFA 3A0SA 1KE3A 1K6RA 4HBUA 4KENB 5HAQA 5IU1A 1LI9A 4GB7A 4B4ZA 1OTAA 1RP5A 3WRZA 2A49A 5F69A 4MN6A 3NBLA 3G6OA 1GA0A 2HV1A 2ZM0A 1BTLA 4E3LA 3LUQA 1STZA 3EOIA 1IKGA 2ZMAA 5E43A 3TOIA 1XA1A 2VLGA 3OOVA 4WBGA 4I38A 4LENA 4O01A 5FQMA 1CQAA 1DY6A 5CEDA 2M7UA 3BECA 3NOUC 3VE4A 4BLMA 5CTNA 5EPHA 1VETB 2ZM8A 3T1RA 2ZQAA 4X53A 3E2KA 1PI4A 2HGVA 2PR6A 2B02A 4PAUA 3JVVA 2W3FA 4RVAA 3S7PA 4P87A 4BD0A 1I5QA 3OLOA 3KYQA 1L0GA 2L0WA 5FEFA 3PBQA 3C30A 4JBFA 4OPZA 3UE3A 1ZC2A 3T1SA 3QNBA 5AQ9A 5A90A 2Q9MA 1TDGA 1H3QA 3HLEA 3FC7A 3EQUA 4C6YA 2EX9A 3H82A 3VOLA 1W8YA 4AFIA 3WRTA 3ZFZA 2KX6A 5HW3A 3PAGA 1FSWA 3WS0A 1VHMA 2AVXA 1EW0A 2YKFA 4E3JA 1PRQA 1ODVA 1LL8A 1H8YA 4KG5A 2IA2A 3JYIA 4CLCB 5EVLA 3E0YA 5HL6A 4OLDA 4P6ZS 1OTIA 5FQQA 3SW1A 1NYYA 1K54A 3LIDA 4GHIB 4E3NA 2PDRA 3NI9A 2HJ9C 4WYYA 3MXRA 1ALQA 4ZDXA 2OSUA 4OQHA 2Y2GA 1G28A 3MKFA 5EVEA 2EXAA 4EEPA 4PM7A 1XA7A 4CLCA 4DF6A 1LL9A 5CHUA 3A3DA 4S2OA 2P74A 4HESA 3ITBA 5F68A 3NCKA 3BQ8A 5IS1A 1JWVA 2P9VB 2JKTM 3IBRA 1PW1A 5HDCA 1YLYA 4IHQA 2BASA 4FCFA 2WK0A 5HWVA 1LHYA 4D2OA 3F1OB 2VX8A 3W4OA 4Y2FA 2V0WA 3IWOA 3IF6C 4BENA 2XFTA 1SDEA 2J7VA 4NKPA 1S6RA 3GECA 4MN5A 2M1CA 2WAFA 2HPBA 4WEKA 2FFYA 4M3KA 1MWTA 4IUHA 3IXGA 3B42A 3V67A 3GRJA 5GHZA 4MBFA 4GS9A 5DKKA 3BYDA 4F3LA 1PNEA 3OPLA 2XK1A 2WKRA 2ZM2A 2R9WA 1MKMA 1HTZA 5D3OA 2VGLM 5HWTA 4I39A 3F1OA 3IWQA 2PD8A 3FKWA 2HJEA 5F1GA 4KZ8A 1YKDA 2WKPA 1PI5A 3UN7A 2A24B 4D60A 1GHMA 4LV0A 3MFXA 1GSXA 1ZKJA 2WAEA 3WS2A 3IS2A 2Y2OA 3LCEA 2ZBBA 4MMNA 2CC1A 3FYZA 4HH3A 3GQZA 4H6JA 2FH5A 3IT9A 5E2FA 2PRFA 1P9WA 3CUEC 3Q1FA 2Y2PA 4NG2A 3UDXA 5HPIA 3CPTA 4OPQA 3D9YA 3IH9A 2OWJA 3UPNA 5DKLA 2OLUA 4L9GA 3OPPA 1K25A 1XFQA 1LSWA 3LIFA 1Y54A 4R4SA 2VK3A 3HLDA 3O86A 1D1JA 3R7WB 1VM1A 4UA7A 3MF0A 1H8ZA 3F1PB 4BBTA 1W8QA 4BBUA 5BOHA 1NWZA 2J3TD 3Q82A 1ES4A 4EQIA 1K4EA 3IX4A 3OCNA 1KOUA 2HF6A 5C5KA 3N8SA 3MSHA 1K57A 1JNUA 2VA0A 1DJCA 3A0VA 2CMNA 1ERQA 4E3KA 4DE2A 3G34A 4E3IA 2NUTC 2PHYA 3FPVA 2W1TA 1CI8A 2D01A 3OPRA 3RFBA 4UA6A 3T1QB 3P09A 4DDSA 4CJNA 2Y2HA 3K2NA 3T4JA 3P01A 3T4TA 1N9BA 3KSHA 5F1FA 1F98A 3F1NA 5J8XA 2MJ6A 4GJ4A 4OPYA 4IEDA 4P6BA 2X01A 3FG8A 4F3LB 4PPRA 3CZDA 3K3DA 2Z6DA 2QJ7A 3LGOA 2E8JA 2ZQCA 2EFUA 2PU2A 3CLOA 4Q0JA 3N8RA 2PYRA 5HAPA 4U3TA 5CHMA 2EFXA 2XA7M 2HZ5A 5F6AA 1XJ6A 2HP5A 1OPXA 4EETB 5CERA 1GHPA 3GDIA 4CQHA 4GD6A 2V8CA 5AQ7A 1YLTA 4O7DA 3Q07A 4JKTA 3G30A 5HARA 2Y59A 1PWDA 2ZQ7A 5FQJA 3IF6B 4PM9A 5CGWA 2GJ3A 3AGDA 4M4XA 3IBJA 3PHYA 2JBFA 2VV6A 1NLZA 5J4EA 1SKFA 4Q0HA 1Y4OA 4R3AA 4K0XA 4KZBA 1G68A 3HVFA 1J9MA 5DFXA 4GLQA 1X0OA 3S22A 4R38A 3RTYA 3VFHA 2JCHA 4EEUA 1MWUA 3N8LA 3E2LA 3M2JA 5EV0A 1EROA 3AGFA 4EBLA 1NJ4A 3MXQA 1FCOA 2KOIA 4Y0UA 4Q8IA 3O87A 3C4OA 4X1MA 5L09A 3C2WA 2A24A 5FDHA 2K31A 4OPRA 3T4OA 5M18A 2UV0E 1MC0A 3UPPA 2W0NA 5GLBA 4LV3A 2K2NA 2PU4A 1PW8A 5EVIC 4R23A
chains in the Genus database with same CATH topology
4IVIA 2ZQAA 2V1ZA 4BQMA 4X53A 1O7EA 3E2KA 1PI4A 2XH9A 2WUQA 2XD5A 3RXXA 3BFFA 4GDBA 4P0MA 3HUMA 1IYQA 3UPOA 1SHVA 2BLSA 2WKIA 3C5AA 4RVAA 3SH9A 4DRTA 4X6TA 4E6XA 4P87A 4BD0A 3ISGA 1I5QA 3O88A 2ZLYA 4JXGA 5M1AA 3PBNA 5M19A 1K56A 2DRWA 1L0GA 3MZDA 5CECA 1LL5A 5GL9A 5HAIA 5U47A 1E25A 1FQGA 3PBQA 5AQAA 3ZCZA 3IHBA 5CTMA 1OMEA 4JXSA 3Q7VA 2H0YA 2P9VA 3PBSA 4JBFA 5FSRA 3SS4A 4OH0A 4OPZA 3DWKA 3G4PA 4YFMA 1ONGA 4KZ9A 1ZC2A 1BSGA 4KZ4A 3UE3A 4DE1A 5TR7A 5JYPA 1K6SA 2DCFA 3PBOA 3QNBA 3HBRA 2GDNA 1VQQA 5AQ9A 1PWGA 3G31A 5EUAA 4ZJ1A 1BLCA 1NRFA 4GDNA 3PBRA 5GLDA 3S4XA 3G2ZA 5A90A 5FAPA 4JLFA 2Q9MA 4NK3A 1TDGA 4WMCA 4JPMA 5IHVA 4B88A 3HLEA 1XXMA 3LO7A 3GVBA 3EQUA 4DXCA 3HLFA 2ZC6B 2XD1A 5CXWA 3VP0A 4ZTKA 3WS4A 1YT4A 5CHJA 1Q2PA 1LI0A 3ZG7B 1KVMA 3NY4A 5FI7A 4C6YA 2EX9A 4WELA 3P98A 3BFEA 1W8YA 1RGZA 3A3EA 3OCLA 4MBKA 3OZHA 3FV7A 3WRTA 1DJAA 3ZFZA 2WZXA 5FASA 5HW3A 3PAGA 1FSWA 1XPBA 3GV9A 3V3RA 1KVLA 3WS0A 2XF3A 3ZG8B 4E3JA 2XEPA 1KGEA 4GNUA 2V20A 5TGFA 2Y2IA 2A3UA 3MZEA 5FATA 1H8YA 3SS3A 2XQZA 3NDEA 3ZNYA 4KG5A 5KMWA 5EOEA 3MFDA 1JTGA 3JYIA 4P85A 3CMZA 5EVLA 4WEJA 4EUZA 1FCNA 4OLDA 4WMCD 4K91A 2EX2A 3W4QA 4DXBA 1YMXA 2Y4AA 2ZC4B 5FQQA 1NYYA 1K54A 4GZBA 4E3NA 4PM8A 4KZ6A 3HREA 3NI9A 3VFFA 4C3QA 2VGJA 1ESIA 2EXBA 3BRMA 4WYYA 3V5MA 3MXRA 1ALQA 4QB8A 4ZDXA 2OSUA 3ZVWA 4OQHA 4F94A 1I2WA 4YINA 4MBHA 5F82A 2Y2GA 5FQIA 3MKFA 2EXAA 4PM5A 1C3BA 3VMAA 1SCWA 3EQVA 4PM7A 1XA7A 4C75A 4DF6A 2G2UA 1LL9A 5CHUA 3IXDA 3A3DA 1N4OA 5DTKA 4UAAA 5DVAA 4S2OA 4N1XA 1NZUA 1JVJA 3QNCA 1MXOA 2P74A 3PAEA 4LCLA 4N1HA 1DJBA 3M6BA 4E3MA 3OC2A 4S2IA 2XFSA 4HESA 5EVIA 3ITBA 4S2MA 1HZOA 5EVIB 4X56A 3SH7A 3NCKA 2ZQ8A 1JWVA 4KZ3A 1QMEA 3CG5A 4ZBEA 2P9VB 3BFDA 2PBYA 4JXWA 1PW1A 3BLSA 1YLYA 4WZ5A 3ZDJA 1TDLA 5A91A 4FCFA 2WK0A 1AXBA 4KG2A 2DNSA 4EBNA 1O07A 4RA7A 4XUXA 2JC7A 4DE3A 1K38A 1LHYA 1E3UD 1IEMA 4X69A 4D2OA 3CJMA 1K55C 1L0DA 3W4OA 4BL2A 3IWOA 1NZOA 1ZG4A 2Y2MA 4NETA 3TSGA 1BLHA 3BLMA 4S2JA 4EV4A 3IF6C 4LCMA 4OONA 4BENA 2XFTA 1SDEA 2FFFB 2J7VA 3BEBA 3RXWA 1M6KA 1FCMA 4X55A 2WGIA 1FOFA 1S6RA 3Q7ZA 2WAFA 3HLCA 3ZNTA 4Z9QA 2H5SA 2HPBA 1XP4A 4WEKA 3GMWA 2FFYA 3TG9A 1MKIA 4M3KA 4A5RA 4DE0A 1MWTA 5E2HA 5HFOA 4ID4A 5HX9A 3IXGA 3C7VA 2H0TA 1XKZA 1RGYA 3GRJA 5EOOA 5GHZA 3V3SA 1MY8A 4MBFA 3BYDA 3LY3A 1EI5A 3OPLA 2XK1A 4S2NA 5TFQA 2ZM2A 1WYBA 2R9WA 2ZQ9A 1XGIA 1HTZA 3NC8A 4UA9A 5D3OA 3W8KA 1E4DA 1KE0A 2HP9A 4U0TA 3ZG5A 4BD1A 4QY5A 3B3XA 4BL3A 2IWBA 3IWQA 4JXVA 1HD8A 3MZFA 5FAQA 4JF4A 3LY4A 2Y2KA 3VP1A 3FKWA 1ZG6A 1KDSA 1YLJA 5F1GA 2RL3A 3IWIA 5JYOA 2ZC3B 2XGNA 1MPLA 3FWLA 2IWDA 4KZ5A 4KZ8A 3ZG9B 4GN2A 2XLNA 3SH8A 5GHXA 1YMSA 3VOZA 1W5DA 1Z6FA 4R3JA 3VOYA 3SS5A 3HLWA 3ZHHA 2J9PA 2WYXA 1SDNA 2HDRA 1PI5A 3UN7A 2C5WB 3GTCA 4DDYA 1GHMA 4LV0A 3IF6A 1ZKJA 3WS2A 2WAEA 3UO9A 4QD4A 1QMFA 4X68A 1Q2QA 3WS5A 5DF8A 5KZHA 1XX2A 5EE8A 2Y2OA 2VGKA 3DWZA 1S0WA 3LCEA 3UDFA 3IF5A 2RCXA 5AQBA 3S1YA 3AGEA 1ESUA 3UY6A 3ITAA 1PZOA 3HL9A 4IVKA 2CC1A 3IQAA 5DF7A 2R9XA 5FI6A 3UE1A 4MLLA 2Y2LA 4GKUA 3FYZA 4OVDA 3GQZA 5FI2A 1JWPA 3IT9A 4KQRA 4Y7PA 5E2FA 3D4FA 4N92A 1GA9A 2WADA 2X71A 3Q1FA 1ONHA 1U60A 2Y2PA 4FSFA 3UNWA 2XR0A 1K4FA 1W7FA 3VP2A 4XXRA 4QHCA 4S2LA 3UDXA 3N6IA 3G35A 1G6AA 4N9LA 4OPQA 1WE4A 4KG6A 4LV2A 4IBXA 2Y2JA 3IH9A 2EX6A 3Q7VB 3UPNA 2B5RA 3HUOA 4IBRA 2QZ6A 2OLUA 4JF6A 4U0XA 3OPPA 1K25A 1YLPA 2E8IA 4E6WA 4GD8A 1CEGA 1Y54A 4R4SA 4KQOA 3FKVA 4R1GA 1BUEA 4PM6A 2Y2NA 3HLDA 1ES2A 5DTSA 3A3JA 1JTDA 1FSYA 3OPHA 4FD8A 3O86A 3QHYA 2ZQDA 4BJPA 1VM1A 4UA7A 3HLGA 1H8ZA 3M6HA 3RJUA 1W8QA 5FAOA 4B4XA 1NXYA 5BOHA 3GSGA 3PTEA 1KDWA 1H5XA 2OV5A 3G2YA 3Q82A 1ES4A 2WGWA 4UHUA 4EQIA 1K4EA 1MWRA 3DW0A 3OCNA 1ES5A 3N8SA 5E2GA 1K57A 1YQSA 4FH4A 4FH2A 5CEBA 1DJCA 1K57C 3ZVTA 4KQQA 4L0LA 4DKIA 5GHYA 1NY0A 1ERQA 4OOLA 4JF5A 4E3KA 3DTMA 3G34A 4S2KA 1EWZA 4DE2A 1M40A 4E3IA 3IHAA 1JWZA 2Y91A 1CI8A 4QU3A 3WS1A 2WGVA 2ZC5B 3OPRA 4OOMA 4HBTA 3HUNA 4R0QA 4UA6A 5CRFA 1BLSA 3P09A 4DDSA 5FQKA 3MXSA 3NIAA 2WGWB 3Q81A 5G18A 4MNRA 4CJNA 2Y2HA 1MBLA 3BFGA 2H10A 5EECA 4OQ0A 1N9BA 1PIOA 4Y0TA 5F1FA 1GCEA 2I72A 1K56D 5A93A 1MWSA 2X02A 1LLBA 1KE4A 3VSKA 4OP5A 5J8XA 4R3BA 5FA7A 1NYMA 3G32A 1KGGA 4OPYA 4IEDA 1IELA 3GR2A 4P6BA 2X01A 4PPRA 4ZJ2A 5DF9A 5E2EA 3ZG0A 3CZDA 3UE0A 5HL1A 1BLPA 1ES3A 1E3UA 2Z2LB 1BT5A 3IXBA 3IXHA 3LEZA 2Y55A 2ZQCA 2UWXA 2EFUA 2PU2A 3BFCA 4EBPA 2BG1A 3N8RA 5FQ9A 5CGXA 3VSLA 1HVBA 4U3TA 5HAPA 5L2FA 5CHMA 2EFXA 3N7WA 4HEFA 1FR6A 4H8RA 3VP4A 2HP5A 3MKEA 1PZPA 1IKIA 2Z2MB 5F83A 4OLGA 5EVID 3M2KA 5GLAA 4ZJ3A 1L0EA 5CGSA 4K0WA 4OKPA 4S2PA 1PYYA 4WZ5C 5CERA 2HDUA 4PMAA 1GHPA 4KZAA 4GD6A 4RX3A 2ZD8A 2ZJ9A 5AQ7A 2XDMA 1BULA 3BM6A 1BZAA 3W4PA 4XUZA 3V50A 1YLTA 4O7DA 1CK3A 2ZC7A 3Q07A 1YLWA 4JKTA 3G30A 1L2SA 3C7UA 5HARA 2Y59A 1KGFA 4N9KA 1PWDA 4MEZA 3A3FA 2ZQ7A 1ERMA 2WKEA 2QMIA 1K54C 2WKHA 4OQGA 3IF6B 5FQJA 3UDIA 1TEMA 4PM9A 5I94A 2EX8A 5CGWA 3I7JA 4E3OA 3AGDA 3HLBA 1CI9A 1TVFA 4OP8A 2C6WB 2JBFA 1IYPA 5DTTA 1SKFA 1KE3A 4RX2A 1K6RA 4K0XA 3A3IA 4LV1A 3V39A 4KZBA 1G68A 3HVFA 3WWXA 2Y2QA 1J9MA 4HBUA 1YM1A 2J9OA 2OLVA 4KENB 5HAQA 2WZZA 3S22A 4S2NC 1GHIA 5KSCA 3VFHA 1LI9A 2JCHA 4GB7A 1MWUA 3N8LA 2HP6A 3E2LA 4B4ZA 4RYEA 3M2JA 1W79A 1IYOA 1RP5A 3O3VA 3N4IA 3WRZA 4KZ7A 4QJGA 2J8YA 5A92A 2A49A 1EROA 4QY6A 5GLCA 4ZAMA 3AGFA 3NBLA 4EBLA 1NJ4A 3ZGAB 2HDQA 2IWCA 4Y0OA 1IYSA 1FCOA 4Y0UA 4EWFA 4Q8IA 1GA0A 2ZM0A 1BTLA 3C4PA 4E3LA 5KSHA 1XGJA 4GOGA 1IKGA 2ZMAA 3O87A 3C4OA 5E43A 1PWCA 4R4RA 3IH8A 2G2WA 4CPKA 1K55A 1RCJA 3TOIA 2HDSA 1L0FA 3VP3A 1XA1A 1WYCA 5FDHA 4WM9A 4OPRA 1I2SA 2Q9NA 4WBGA 4LENA 5M18A 1YLZA 3SOIA 5FQMA 3UPPA 4WZ4A 3NDGA 1DY6A 3FZCA 4OOYA 5GLBA 5CEDA 3PBTA 4LV3A 3MBZA 1FR1A 3BECA 2PU4A 1PW8A 2JE5A 5EVIC 4OQIA 4BLMA 4R23A 5CTNA 2QPNA 1CEFA 5EPHA 2V2FF 2ZM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IVI A;  2ZQA A;  2V1Z A;  4BQM A;  4X53 A;  1O7E A;  3E2K A;  1PI4 A;  2XH9 A;  2WUQ A;  2XD5 A;  3RXX A;  3BFF A;  4GDB A;  4P0M A;  3HUM A;  1IYQ A;  3UPO A;  1SHV A;  2BLS A;  2WKI A;  3C5A A;  4RVA A;  3SH9 A;  4DRT A;  4X6T A;  4E6X A;  4P87 A;  4BD0 A;  3ISG A;  1I5Q A;  3O88 A;  2ZLY A;  4JXG A;  5M1A A;  3PBN A;  5M19 A;  1K56 A;  2DRW A;  1L0G A;  3MZD A;  5CEC A;  1LL5 A;  5GL9 A;  5HAI A;  5U47 A;  1E25 A;  1FQG A;  3PBQ A;  5AQA A;  3ZCZ A;  3IHB A;  5CTM A;  1OME A;  4JXS A;  3Q7V A;  2H0Y A;  2P9V A;  3PBS A;  4JBF A;  5FSR A;  3SS4 A;  4OH0 A;  4OPZ A;  3DWK A;  3G4P A;  4YFM A;  1ONG A;  4KZ9 A;  1ZC2 A;  1BSG A;  4KZ4 A;  3UE3 A;  4DE1 A;  5TR7 A;  5JYP A;  1K6S A;  2DCF A;  3PBO A;  3QNB A;  3HBR A;  2GDN A;  1VQQ A;  5AQ9 A;  1PWG A;  3G31 A;  5EUA A;  4ZJ1 A;  1BLC A;  1NRF A;  4GDN A;  3PBR A;  5GLD A;  3S4X A;  3G2Z A;  5A90 A;  5FAP A;  4JLF A;  2Q9M A;  4NK3 A;  1TDG A;  4WMC A;  4JPM A;  5IHV A;  4B88 A;  3HLE A;  1XXM A;  3LO7 A;  3GVB A;  3EQU A;  4DXC A;  3HLF A;  2ZC6 B;  2XD1 A;  5CXW A;  3VP0 A;  4ZTK A;  3WS4 A;  1YT4 A;  5CHJ A;  1Q2P A;  1LI0 A;  3ZG7 B;  1KVM A;  3NY4 A;  5FI7 A;  4C6Y A;  2EX9 A;  4WEL A;  3P98 A;  3BFE A;  1W8Y A;  1RGZ A;  3A3E A;  3OCL A;  4MBK A;  3OZH A;  3FV7 A;  3WRT A;  1DJA A;  3ZFZ A;  2WZX A;  5FAS A;  5HW3 A;  3PAG A;  1FSW A;  1XPB A;  3GV9 A;  3V3R A;  1KVL A;  3WS0 A;  2XF3 A;  3ZG8 B;  4E3J A;  2XEP A;  1KGE A;  4GNU A;  2V20 A;  5TGF A;  2Y2I A;  2A3U A;  3MZE A;  5FAT A;  1H8Y A;  3SS3 A;  2XQZ A;  3NDE A;  3ZNY A;  4KG5 A;  5KMW A;  5EOE A;  3MFD A;  1JTG A;  3JYI A;  4P85 A;  3CMZ A;  5EVL A;  4WEJ A;  4EUZ A;  1FCN A;  4OLD A;  4WMC D;  4K91 A;  2EX2 A;  3W4Q A;  4DXB A;  1YMX A;  2Y4A A;  2ZC4 B;  5FQQ A;  1NYY A;  1K54 A;  4GZB A;  4E3N A;  4PM8 A;  4KZ6 A;  3HRE A;  3NI9 A;  3VFF A;  4C3Q A;  2VGJ A;  1ESI A;  2EXB A;  3BRM A;  4WYY A;  3V5M A;  3MXR A;  1ALQ A;  4QB8 A;  4ZDX A;  2OSU A;  3ZVW A;  4OQH A;  4F94 A;  1I2W A;  4YIN A;  4MBH A;  5F82 A;  2Y2G A;  5FQI A;  3MKF A;  2EXA A;  4PM5 A;  1C3B A;  3VMA A;  1SCW A;  3EQV A;  4PM7 A;  1XA7 A;  4C75 A;  4DF6 A;  2G2U A;  1LL9 A;  5CHU A;  3IXD A;  3A3D A;  1N4O A;  5DTK A;  4UAA A;  5DVA A;  4S2O A;  4N1X A;  1NZU A;  1JVJ A;  3QNC A;  1MXO A;  2P74 A;  3PAE A;  4LCL A;  4N1H A;  1DJB A;  3M6B A;  4E3M A;  3OC2 A;  4S2I A;  2XFS A;  4HES A;  5EVI A;  3ITB A;  4S2M A;  1HZO A;  5EVI B;  4X56 A;  3SH7 A;  3NCK A;  2ZQ8 A;  1JWV A;  4KZ3 A;  1QME A;  3CG5 A;  4ZBE A;  2P9V B;  3BFD A;  2PBY A;  4JXW A;  1PW1 A;  3BLS A;  1YLY A;  4WZ5 A;  3ZDJ A;  1TDL A;  5A91 A;  4FCF A;  2WK0 A;  1AXB A;  4KG2 A;  2DNS A;  4EBN A;  1O07 A;  4RA7 A;  4XUX A;  2JC7 A;  4DE3 A;  1K38 A;  1LHY A;  1E3U D;  1IEM A;  4X69 A;  4D2O A;  3CJM A;  1K55 C;  1L0D A;  3W4O A;  4BL2 A;  3IWO A;  1NZO A;  1ZG4 A;  2Y2M A;  4NET A;  3TSG A;  1BLH A;  3BLM A;  4S2J A;  4EV4 A;  3IF6 C;  4LCM A;  4OON A;  4BEN A;  2XFT A;  1SDE A;  2FFF B;  2J7V A;  3BEB A;  3RXW A;  1M6K A;  1FCM A;  4X55 A;  2WGI A;  1FOF A;  1S6R A;  3Q7Z A;  2WAF A;  3HLC A;  3ZNT A;  4Z9Q A;  2H5S A;  2HPB A;  1XP4 A;  4WEK A;  3GMW A;  2FFY A;  3TG9 A;  1MKI A;  4M3K A;  4A5R A;  4DE0 A;  1MWT A;  5E2H A;  5HFO A;  4ID4 A;  5HX9 A;  3IXG A;  3C7V A;  2H0T A;  1XKZ A;  1RGY A;  3GRJ A;  5EOO A;  5GHZ A;  3V3S A;  1MY8 A;  4MBF A;  3BYD A;  3LY3 A;  1EI5 A;  3OPL A;  2XK1 A;  4S2N A;  5TFQ A;  2ZM2 A;  1WYB A;  2R9W A;  2ZQ9 A;  1XGI A;  1HTZ A;  3NC8 A;  4UA9 A;  5D3O A;  3W8K A;  1E4D A;  1KE0 A;  2HP9 A;  4U0T A;  3ZG5 A;  4BD1 A;  4QY5 A;  3B3X A;  4BL3 A;  2IWB A;  3IWQ A;  4JXV A;  1HD8 A;  3MZF A;  5FAQ A;  4JF4 A;  3LY4 A;  2Y2K A;  3VP1 A;  3FKW A;  1ZG6 A;  1KDS A;  1YLJ A;  5F1G A;  2RL3 A;  3IWI A;  5JYO A;  2ZC3 B;  2XGN A;  1MPL A;  3FWL A;  2IWD A;  4KZ5 A;  4KZ8 A;  3ZG9 B;  4GN2 A;  2XLN A;  3SH8 A;  5GHX A;  1YMS A;  3VOZ A;  1W5D A;  1Z6F A;  4R3J A;  3VOY A;  3SS5 A;  3HLW A;  3ZHH A;  2J9P A;  2WYX A;  1SDN A;  2HDR A;  1PI5 A;  3UN7 A;  2C5W B;  3GTC A;  4DDY A;  1GHM A;  4LV0 A;  3IF6 A;  1ZKJ A;  3WS2 A;  2WAE A;  3UO9 A;  4QD4 A;  1QMF A;  4X68 A;  1Q2Q A;  3WS5 A;  5DF8 A;  5KZH A;  1XX2 A;  5EE8 A;  2Y2O A;  2VGK A;  3DWZ A;  1S0W A;  3LCE A;  3UDF A;  3IF5 A;  2RCX A;  5AQB A;  3S1Y A;  3AGE A;  1ESU A;  3UY6 A;  3ITA A;  1PZO A;  3HL9 A;  4IVK A;  2CC1 A;  3IQA A;  5DF7 A;  2R9X A;  5FI6 A;  3UE1 A;  4MLL A;  2Y2L A;  4GKU A;  3FYZ A;  4OVD A;  3GQZ A;  5FI2 A;  1JWP A;  3IT9 A;  4KQR A;  4Y7P A;  5E2F A;  3D4F A;  4N92 A;  1GA9 A;  2WAD A;  2X71 A;  3Q1F A;  1ONH A;  1U60 A;  2Y2P A;  4FSF A;  3UNW A;  2XR0 A;  1K4F A;  1W7F A;  3VP2 A;  4XXR A;  4QHC A;  4S2L A;  3UDX A;  3N6I A;  3G35 A;  1G6A A;  4N9L A;  4OPQ A;  1WE4 A;  4KG6 A;  4LV2 A;  4IBX A;  2Y2J A;  3IH9 A;  2EX6 A;  3Q7V B;  3UPN A;  2B5R A;  3HUO A;  4IBR A;  2QZ6 A;  2OLU A;  4JF6 A;  4U0X A;  3OPP A;  1K25 A;  1YLP A;  2E8I A;  4E6W A;  4GD8 A;  1CEG A;  1Y54 A;  4R4S A;  4KQO A;  3FKV A;  4R1G A;  1BUE A;  4PM6 A;  2Y2N A;  3HLD A;  1ES2 A;  5DTS A;  3A3J A;  1JTD A;  1FSY A;  3OPH A;  4FD8 A;  3O86 A;  3QHY A;  2ZQD A;  4BJP A;  1VM1 A;  4UA7 A;  3HLG A;  1H8Z A;  3M6H A;  3RJU A;  1W8Q A;  5FAO A;  4B4X A;  1NXY A;  5BOH A;  3GSG A;  3PTE A;  1KDW A;  1H5X A;  2OV5 A;  3G2Y A;  3Q82 A;  1ES4 A;  2WGW A;  4UHU A;  4EQI A;  1K4E A;  1MWR A;  3DW0 A;  3OCN A;  1ES5 A;  3N8S A;  5E2G A;  1K57 A;  1YQS A;  4FH4 A;  4FH2 A;  5CEB A;  1DJC A;  1K57 C;  3ZVT A;  4KQQ A;  4L0L A;  4DKI A;  5GHY A;  1NY0 A;  1ERQ A;  4OOL A;  4JF5 A;  4E3K A;  3DTM A;  3G34 A;  4S2K A;  1EWZ A;  4DE2 A;  1M40 A;  4E3I A;  3IHA A;  1JWZ A;  2Y91 A;  1CI8 A;  4QU3 A;  3WS1 A;  2WGV A;  2ZC5 B;  3OPR A;  4OOM A;  4HBT A;  3HUN A;  4R0Q A;  4UA6 A;  5CRF A;  1BLS A;  3P09 A;  4DDS A;  5FQK A;  3MXS A;  3NIA A;  2WGW B;  3Q81 A;  5G18 A;  4MNR A;  4CJN A;  2Y2H A;  1MBL A;  3BFG A;  2H10 A;  5EEC A;  4OQ0 A;  1N9B A;  1PIO A;  4Y0T A;  5F1F A;  1GCE A;  2I72 A;  1K56 D;  5A93 A;  1MWS A;  2X02 A;  1LLB A;  1KE4 A;  3VSK A;  4OP5 A;  5J8X A;  4R3B A;  5FA7 A;  1NYM A;  3G32 A;  1KGG A;  4OPY A;  4IED A;  1IEL A;  3GR2 A;  4P6B A;  2X01 A;  4PPR A;  4ZJ2 A;  5DF9 A;  5E2E A;  3ZG0 A;  3CZD A;  3UE0 A;  5HL1 A;  1BLP A;  1ES3 A;  1E3U A;  2Z2L B;  1BT5 A;  3IXB A;  3IXH A;  3LEZ A;  2Y55 A;  2ZQC A;  2UWX A;  2EFU A;  2PU2 A;  3BFC A;  4EBP A;  2BG1 A;  3N8R A;  5FQ9 A;  5CGX A;  3VSL A;  1HVB A;  4U3T A;  5HAP A;  5L2F A;  5CHM A;  2EFX A;  3N7W A;  4HEF A;  1FR6 A;  4H8R A;  3VP4 A;  2HP5 A;  3MKE A;  1PZP A;  1IKI A;  2Z2M B;  5F83 A;  4OLG A;  5EVI D;  3M2K A;  5GLA A;  4ZJ3 A;  1L0E A;  5CGS A;  4K0W A;  4OKP A;  4S2P A;  1PYY A;  4WZ5 C;  5CER A;  2HDU A;  4PMA A;  1GHP A;  4KZA A;  4GD6 A;  4RX3 A;  2ZD8 A;  2ZJ9 A;  5AQ7 A;  2XDM A;  1BUL A;  3BM6 A;  1BZA A;  3W4P A;  4XUZ A;  3V50 A;  1YLT A;  4O7D A;  1CK3 A;  2ZC7 A;  3Q07 A;  1YLW A;  4JKT A;  3G30 A;  1L2S A;  3C7U A;  5HAR A;  2Y59 A;  1KGF A;  4N9K A;  1PWD A;  4MEZ A;  3A3F A;  2ZQ7 A;  1ERM A;  2WKE A;  2QMI A;  1K54 C;  2WKH A;  4OQG A;  3IF6 B;  5FQJ A;  3UDI A;  1TEM A;  4PM9 A;  5I94 A;  2EX8 A;  5CGW A;  3I7J A;  4E3O A;  3AGD A;  3HLB A;  1CI9 A;  1TVF A;  4OP8 A;  2C6W B;  2JBF A;  1IYP A;  5DTT A;  1SKF A;  1KE3 A;  4RX2 A;  1K6R A;  4K0X A;  3A3I A;  4LV1 A;  3V39 A;  4KZB A;  1G68 A;  3HVF A;  3WWX A;  2Y2Q A;  1J9M A;  4HBU A;  1YM1 A;  2J9O A;  2OLV A;  4KEN B;  5HAQ A;  2WZZ A;  3S22 A;  4S2N C;  1GHI A;  5KSC A;  3VFH A;  1LI9 A;  2JCH A;  4GB7 A;  1MWU A;  3N8L A;  2HP6 A;  3E2L A;  4B4Z A;  4RYE A;  3M2J A;  1W79 A;  1IYO A;  1RP5 A;  3O3V A;  3N4I A;  3WRZ A;  4KZ7 A;  4QJG A;  2J8Y A;  5A92 A;  2A49 A;  1ERO A;  4QY6 A;  5GLC A;  4ZAM A;  3AGF A;  3NBL A;  4EBL A;  1NJ4 A;  3ZGA B;  2HDQ A;  2IWC A;  4Y0O A;  1IYS A;  1FCO A;  4Y0U A;  4EWF A;  4Q8I A;  1GA0 A;  2ZM0 A;  1BTL A;  3C4P A;  4E3L A;  5KSH A;  1XGJ A;  4GOG A;  1IKG A;  2ZMA A;  3O87 A;  3C4O A;  5E43 A;  1PWC A;  4R4R A;  3IH8 A;  2G2W A;  4CPK A;  1K55 A;  1RCJ A;  3TOI A;  2HDS A;  1L0F A;  3VP3 A;  1XA1 A;  1WYC A;  5FDH A;  4WM9 A;  4OPR A;  1I2S A;  2Q9N A;  4WBG A;  4LEN A;  5M18 A;  1YLZ A;  3SOI A;  5FQM A;  3UPP A;  4WZ4 A;  3NDG A;  1DY6 A;  3FZC A;  4OOY A;  5GLB A;  5CED A;  3PBT A;  4LV3 A;  3MBZ A;  1FR1 A;  3BEC A;  2PU4 A;  1PW8 A;  2JE5 A;  5EVI C;  4OQI A;  4BLM A;  4R23 A;  5CTN A;  2QPN A;  1CEF A;  5EPH A;  2V2F F;  2ZM8 A; 
#chains in the Genus database with same CATH topology
 4IVI A;  1O7E A;  2JKT I;  4LRY C;  3RXX A;  5L8M A;  2BTF P;  2WKI A;  4X6T A;  4E6X A;  2ZLY A;  3PBN A;  4UQI M;  1LL5 A;  1E25 A;  1FQG A;  3P7N A;  1F9I A;  2H0Y A;  2P9V A;  4EUV A;  4OH0 A;  3DWK A;  1ONG A;  4KZ4 A;  5JYP A;  4II7 A;  1K6S A;  2DCF A;  3PBO A;  5EUA A;  3G31 A;  1ZTU A;  4GDN A;  3PBR A;  3BQA A;  2XRO A;  3PXP A;  5KIZ A;  4EQ1 A;  2ZC6 B;  1YT4 A;  5CHJ A;  1LI0 A;  5FI7 A;  1LSX A;  1RGZ A;  3OCL A;  3OZH A;  5HWW A;  3T4S A;  2V0U A;  2OAQ 1;  4NXB A;  4LRZ E;  2XF3 A;  2XEP A;  2VJW A;  5TGF A;  1VB6 A;  3C38 A;  4Y13 A;  1CF0 A;  2XQZ A;  3NDE A;  2ZL1 A;  3ZNY A;  5KMW A;  4K91 A;  3W4Q A;  3F1N B;  3NHQ A;  3T1X A;  3HRE A;  4C3Q A;  4EES A;  2EXB A;  3BRM A;  2QYB A;  4PKY A;  4GS9 B;  1I2W A;  2K7S A;  5L07 A;  1C3B A;  1K0K A;  4ARZ B;  1T19 A;  2PT7 A;  3EQV A;  4BBV A;  3CWF A;  1MXO A;  3PAE A;  5EVI A;  1XJ4 A;  1ACF A;  4S2M A;  1HZO A;  1SKO B;  4X56 A;  3JPU A;  1S1Y A;  2ZQ8 A;  4ZBE A;  3CG5 A;  3HJI A;  2PBY A;  4HH2 A;  4JXW A;  4WZ5 A;  5A91 A;  2D02 A;  4ETZ A;  2DNS A;  1G5U A;  4DE3 A;  3CJM A;  3UB6 A;  4BL2 A;  2LB9 A;  2Y2M A;  1W63 M;  4EV4 A;  1M6K A;  1FCM A;  4X55 A;  2WGI A;  5HPF A;  3Q7Z A;  3ZNT A;  4P6Z M;  3TG9 A;  2JKR M;  5E2H A;  5EOO A;  3CPT B;  5TFQ A;  4S2N A;  1T1B A;  2HP9 A;  4U0T A;  3ZG5 A;  1GSW A;  4QY5 A;  4BL3 A;  3IX8 A;  5FAQ A;  3VP1 A;  1ZG6 A;  5JYO A;  3DTE A;  2W3H A;  1MPL A;  3FWL A;  2IWD A;  4GN2 A;  2XLN A;  3F1P A;  1YMS A;  4UEY A;  3SS5 A;  2WYX A;  3E4O A;  3GTC A;  3UO9 A;  4X68 A;  1Q2Q A;  3WS5 A;  5DF8 A;  3DWZ A;  4JGO A;  3IF5 A;  5FEG A;  3AGE A;  4Y15 A;  3UY6 A;  1PZO A;  5DF7 A;  4IVK A;  3IQA A;  2R9X A;  3UE1 A;  2Y2L A;  1J3W A;  4IJG A;  4N92 A;  4FSF A;  1W7F A;  4S2L A;  1G6A A;  1WE4 A;  4QWO A;  4IBX A;  2B5R A;  3HUO A;  2QZ6 A;  4JF6 A;  3HCY A;  4ME4 A;  3VE3 A;  2E8I A;  5A8B A;  1CEG A;  4KQO A;  4PHT A;  2Y2N A;  1ES2 A;  4X1L A;  1FSY A;  3OPH A;  3FPW A;  2VEA A;  3QHY A;  1LSV A;  1KDW A;  4UHU A;  1MWR A;  4FTX A;  2ZL1 B;  2PD7 A;  3RH8 B;  4FH2 A;  3IX3 A;  5GHY A;  2JN7 A;  1NY0 A;  3TE8 A;  4OOL A;  4JF5 A;  1T1A A;  4S2K A;  1M40 A;  4QU3 A;  5AVE A;  5HDD A;  2ZC5 B;  1L3L A;  3HUN A;  1YAX A;  1BLS A;  4KQD A;  4MNR A;  1MBL A;  2VZW A;  3BFG A;  2H10 A;  2VGL S;  3DBA A;  1GCE A;  2M7V A;  4LGW A;  2X02 A;  2VV8 A;  1N9N A;  5FA7 A;  1NYM A;  3GR2 A;  4ZJ2 A;  5DF9 A;  5HL1 A;  1BLP A;  4G3K A;  1BT5 A;  2Y8H A;  3U2A A;  5MC7 A;  5J7E A;  1TF1 A;  3CUE A;  2H28 A;  4FUW A;  2BG1 A;  3VSL A;  1HVB A;  3N7W A;  4DJ2 A;  3DTI A;  2JKR I;  3MKE A;  1IKI A;  4OLG A;  5EVI D;  3M2K A;  1L0E A;  5CGS A;  4OKP A;  1PYY A;  2OWH A;  1NRJ A;  4KZA A;  4EER A;  3MMH A;  4HIA A;  2ZD8 A;  2ZJ9 A;  3BM6 A;  4ESP A;  1L2S A;  3NUL A;  1KGF A;  4N9K A;  4UQI S;  4OQG A;  1ERM A;  1K54 C;  2WKH A;  2QKP A;  5I94 A;  2EX8 A;  4GW9 A;  3HLB A;  4OP8 A;  2C6W B;  1IYP A;  1GSV A;  4RX2 A;  3A0R A;  3WWX A;  2Y2Q A;  1T1C A;  2EWW A;  2FZ0 A;  1XJ2 A;  5KSC A;  2GNX A;  5EM0 A;  5CX7 A;  4RYE A;  5FL3 A;  3LFV A;  4HJ6 A;  3L7H A;  1W79 A;  3T4K A;  5HSQ A;  3O3V A;  4HJ4 A;  3N4I A;  4KZ7 A;  4HOI A;  2J8Y A;  4QY6 A;  4H6J B;  3ZGA B;  4Y0O A;  1OJ5 A;  2HDQ A;  2IWC A;  4EU0 A;  4EWF A;  3JVU A;  2KLI A;  4GOG A;  1PWC A;  4R4R A;  4CPK A;  3LEQ A;  1RCJ A;  2HDS A;  1L0F A;  1WYC A;  1I2S A;  2YKH A;  4WZ4 A;  3FZC A;  4OOY A;  3PBT A;  3MBZ A;  1FR1 A;  3B33 A;  3BY8 A;  1CEF A;  2B18 A;  2V1Z A;  2XH9 A;  2WUQ A;  2XD5 A;  3BFF A;  3T12 B;  3OBF A;  3ISG A;  4L9E A;  3O88 A;  4JXG A;  4DMZ A;  5M19 A;  1XJ3 A;  1K56 A;  2DRW A;  2EA9 A;  4CLC D;  3MZD A;  2W3D A;  5AQA A;  5CTM A;  4JXS A;  3Q7V A;  2O99 A;  5FSR A;  3SS4 A;  3G4P A;  4DE1 A;  1BSG A;  5TR7 A;  3ULF A;  1OT6 A;  3HBR A;  4ZJ1 A;  1BLC A;  1PFL A;  1NRF A;  3HJK A;  3S4X A;  1YSP A;  3CI6 A;  4NK3 A;  1NLY A;  3LO7 A;  3GVB A;  4IUK A;  2XD1 A;  5CXW A;  3WS4 A;  3ZG7 B;  1Q2P A;  3NY4 A;  4WEL A;  3P98 A;  3BFE A;  3A3E A;  3FV7 A;  3LIB A;  3UB9 A;  1D06 A;  1DJA A;  5FAS A;  3V3R A;  3MQ0 A;  4I3J A;  1KVL A;  3ZG8 B;  2EWV A;  1KGE A;  1SKO A;  2V20 A;  2A3U A;  3MZE A;  3SS3 A;  2QWS A;  5EOE A;  1JTG A;  3CMZ A;  4WF0 A;  4WEJ A;  1FCN A;  4WLA A;  3LIC A;  1YMX A;  2Y4A A;  2ZC4 B;  1VEU B;  1F2K A;  2W27 A;  4GZB A;  2V9A A;  4PM8 A;  1TS7 A;  3V5M A;  4NXF A;  3E4P A;  3ZVW A;  4YIN A;  4MBH A;  3ZQ5 A;  4WL9 A;  4C75 A;  2G2U A;  4B93 A;  2ACG A;  5DTK A;  4UAA A;  5DVA A;  3KO6 A;  4N1X A;  1NZU A;  3QNC A;  4N1H A;  4QPR A;  1DJB A;  5IT5 A;  2W1T B;  2VKS A;  2B95 A;  3R4K A;  4KZ3 A;  1Y28 A;  4B9O A;  2P04 A;  1TDL A;  1AXB A;  4EBN A;  4RA7 A;  4XUX A;  1K38 A;  1IEM A;  3KSI A;  1K55 C;  4NET A;  3TSG A;  4S2J A;  4I3A A;  4LCM A;  4NXE A;  2FFF B;  3NEC A;  1FOF A;  3HLC A;  4Z9Q A;  1XP4 A;  4DE0 A;  5HFO A;  3LR5 A;  4ID4 A;  3S7O A;  5HX9 A;  2H0T A;  1XFN A;  1XKZ A;  3K3C A;  1MY8 A;  4ZRR A;  1OT9 A;  1EI5 A;  1WYB A;  1XGI A;  3W8K A;  4UA9 A;  3ZYT A;  4G3V A;  5HD3 A;  2J3T C;  3QP4 A;  4I5S A;  4BD1 A;  1OTB A;  4JXV A;  1HD8 A;  3MZF A;  5K5B A;  3LY4 A;  4JGP A;  1KDS A;  1YSQ A;  3IWI A;  4HJ3 A;  2ZC3 B;  1FIK A;  5GHX A;  3VOZ A;  1W5D A;  1Z6F A;  4K08 A;  3HLW A;  1S4S A;  1SDN A;  2HDR A;  2Y79 A;  4DDY A;  4I3I A;  2VGK A;  2ZOH A;  1TS8 A;  1ESU A;  3HL9 A;  5FI6 A;  1MZU A;  3ICY A;  4O8G A;  4DN0 A;  1P0Z A;  5FI2 A;  3UMD A;  3IS2 B;  1P97 A;  1GA9 A;  2WAD A;  1YPR A;  1DP6 A;  1UGU A;  1ONH A;  2P7J A;  2XR0 A;  4GCZ A;  4XXR A;  4QHC A;  3N6I A;  3G35 A;  4KG6 A;  4LV2 A;  1T18 A;  3QP5 A;  2Y2J A;  2EX6 A;  3Q7V B;  3EGX C;  3QP1 A;  4IBR A;  1YLP A;  4E6W A;  3CAX A;  4GD8 A;  1H0M A;  5DJT A;  1S66 L;  4R1G A;  4G3W A;  2VV7 A;  3UB5 P;  3A3J A;  1JTD A;  3KYZ A;  4MN7 A;  3TJZ C;  2ZQD A;  3HLG A;  3DTK A;  3RJU A;  5FAO A;  1NXY A;  3GSG A;  3PTE A;  1OTD A;  2OV5 A;  3U4L P;  3L9K A;  5E2G A;  1YQS A;  1K57 C;  4L0L A;  4FOF A;  3DAV A;  2Y91 A;  4R6L A;  1P9R A;  3WS1 A;  1N9O A;  1H8M A;  2WGV A;  4OOM A;  4HBT A;  4R0Q A;  5FQK A;  3MXS A;  3KSG A;  2I9V A;  5EEC A;  4BWI A;  3EEH A;  4Y0T A;  2I72 A;  1K56 D;  1MWS A;  1KE4 A;  3VSK A;  2XSS A;  4HNB A;  4OP5 A;  4R3B A;  1KGG A;  1IEL A;  3BY9 A;  3UB8 A;  1ES3 A;  3IXB A;  3PYP A;  3LEZ A;  2Y55 A;  4LRX C;  3BFC A;  3C8C A;  3NJA A;  2L4R A;  5L2F A;  4H8R A;  1PZP A;  5DJU A;  3S7N A;  2V1A A;  5F83 A;  4Q0I A;  5GLA A;  4ZJ3 A;  4K0W A;  4WZ5 C;  4S2P A;  3BWL A;  2HDU A;  4CLC E;  3MS6 A;  4ARZ A;  1V9Z A;  1BUL A;  1BZA A;  4XUZ A;  3V50 A;  1G6O A;  1CK3 A;  2ZC7 A;  3O5Y A;  3KSF A;  2PR5 A;  3QP8 A;  4E04 A;  2WKE A;  2QMI A;  3UDI A;  1TEM A;  4CLC C;  2OAP 1;  1IOU A;  2QHK A;  4Y5F A;  5DTT A;  3A3I A;  4LV1 A;  2W3G A;  3LIA A;  3V39 A;  1YM1 A;  2J9O A;  2OLV A;  2WZZ A;  4S2N C;  1GHI A;  2HP6 A;  1S67 L;  1IYO A;  4GHI A;  4QJG A;  5A92 A;  3H82 B;  2DMW A;  5GLC A;  4ZAM A;  3CIT A;  3NOP C;  4XT2 A;  3QP2 A;  1IYS A;  4KUK A;  4Y17 A;  3C4P A;  5KSH A;  1XGJ A;  2O9C A;  4HY8 A;  2L1M A;  4YNR A;  3EGD C;  3IH8 A;  2G2W A;  1K55 A;  3VP3 A;  1S1Z A;  4MCW A;  4WM9 A;  2Q9N A;  4HHD A;  1YLZ A;  3SOI A;  3NDG A;  4LFU A;  4LPZ A;  1W63 Q;  2JE5 A;  4OQI A;  2R78 A;  4XT2 B;  4JGR A;  2QPN A;  3LIE A;  2V2F F;  4BQM A;  4HQA A;  1UWP X;  4ETX A;  4MDZ A;  4GDB A;  2O9B A;  4P0M A;  3HUM A;  1IYQ A;  3UPO A;  1SHV A;  2A2L A;  2BLS A;  3C5A A;  3SH9 A;  4DRT A;  1DP9 A;  5M1A A;  1A0K A;  1OTE A;  3LR0 A;  5CEC A;  5GL9 A;  5HAI A;  5U47 A;  3ZCZ A;  1V9Y A;  3IHB A;  4NEE D;  1TD5 A;  3UB7 A;  1OME A;  1ZHH B;  3PBS A;  4HP4 A;  5FDS A;  2Q0O A;  4YFM A;  4KZ9 A;  3CHW P;  2GDN A;  1VQQ A;  1PWG A;  5GLD A;  3G2Z A;  2ZMF A;  5FAP A;  4JLF A;  2XA7 S;  3T4L A;  4WMC A;  4JPM A;  5IHV A;  1XXM A;  4DXC A;  3HLF A;  4RQ9 A;  2NUP C;  3VP0 A;  4ZTK A;  3E98 A;  1KVM A;  3UME A;  4HI4 A;  3B47 A;  4MBK A;  2WZX A;  4LLO B;  1XPB A;  3GV9 A;  4Y3I A;  4GNU A;  2Y2I A;  5FAT A;  3S7Q A;  3H9W A;  3D3O A;  2WKQ A;  3T50 A;  2LB5 A;  3MFD A;  4P85 A;  2ZOI A;  2JKF A;  4EUZ A;  4WMC D;  2EX2 A;  3T4Q A;  4DXB A;  1BYW A;  3MR0 A;  2QJ5 A;  3KYE A;  3LI9 A;  2KDK A;  4KZ6 A;  3VFF A;  2VGJ A;  1ESI A;  4QB8 A;  4F94 A;  2JKG A;  2G7U A;  5F82 A;  5FQI A;  1VET A;  1AWI A;  4PM5 A;  3VMA A;  1SCW A;  5HD5 A;  3TW8 A;  3IXD A;  1N4O A;  4R70 A;  1JVJ A;  4LCL A;  4BMW A;  4EXO A;  3M6B A;  4E3M A;  2V1B A;  3OC2 A;  2GX5 A;  2XFS A;  4S2I A;  4X25 A;  3LYX A;  5EVI B;  3SH7 A;  1QME A;  3BFD A;  3ZDJ A;  3BLS A;  1TS6 A;  2P08 A;  5LBR A;  4KG2 A;  1O07 A;  1UWN X;  2JC7 A;  1E3U D;  4X69 A;  3H7W B;  5TBM A;  3LI8 A;  4O0P A;  1L0D A;  4YOF A;  1NZO A;  1ZG4 A;  2O9A A;  4WN5 A;  3W2Z A;  1BLH A;  3BLM A;  4OON A;  3BEB A;  3RXW A;  3BJN A;  1DRM A;  2JHE A;  2H5S A;  3GMW A;  4A5R A;  1MKI A;  3E4Q A;  3C7V A;  1RGY A;  3BW6 A;  3V3S A;  5G4Y A;  3LY3 A;  2V8F A;  3NOT C;  5F5Y A;  2ZQ9 A;  3NC8 A;  1SZV A;  1E4D A;  1KE0 A;  5EM1 A;  3B3X A;  3D72 A;  2IWB A;  4JGQ A;  4JF4 A;  2Y2K A;  1F5M A;  1YLJ A;  2RL3 A;  2XGN A;  4KZ5 A;  3ZG9 B;  4DJ3 A;  2Z6C A;  2J3W A;  3SH8 A;  3QP6 A;  1TS0 A;  2XRN A;  4R3J A;  3VOY A;  3ZHH A;  2J9P A;  1HLU P;  3VV4 A;  2C5W B;  3IF6 A;  1LT0 A;  4QD4 A;  1QMF A;  5KZH A;  1XX2 A;  3EEA A;  4EW7 A;  4WUJ A;  5EE8 A;  2PBD P;  1S0W A;  3UDF A;  1Z09 A;  2RCX A;  5AQB A;  3S1Y A;  3ITA A;  4MLL A;  4GKU A;  4OVD A;  5HZH A;  1JWP A;  4KQR A;  4Y7P A;  3KX0 X;  3D4F A;  2X71 A;  1U60 A;  3UNW A;  1K4F A;  1IFQ A;  3VP2 A;  4N9L A;  4U0X A;  3SZT A;  2W3E A;  1OJG A;  3FKV A;  2J80 A;  3UE6 A;  1BUE A;  4PM6 A;  5DTS A;  4FD8 A;  4BJP A;  3M6H A;  1VEU A;  4B4X A;  5G4Z A;  1H5X A;  3EWK A;  2ZMV A;  3G2Y A;  4YWZ A;  2WGW A;  3DW0 A;  5I5L A;  1N9L A;  2GZA A;  1ES5 A;  3PR6 A;  5CEB A;  4FH4 A;  2PAV P;  3ZVT A;  4KQQ A;  4DKI A;  3DTM A;  1EWZ A;  3IHA A;  1JWZ A;  1S4R A;  5TJJ A;  5CRF A;  4NXG A;  3MJQ A;  3NIA A;  2WGW B;  3Q81 A;  5G18 A;  2W1R A;  4OQ0 A;  5J3W A;  4PKY G;  1PIO A;  2O0Y A;  5A93 A;  3R7W A;  5DFY A;  1LLB A;  3G32 A;  1WA9 A;  1DP8 A;  3H7W A;  5E2E A;  5TBM B;  3ZG0 A;  3UE0 A;  5AVF A;  1E3U A;  5HDS A;  2Z2L B;  3IXH A;  4KUO A;  2UWX A;  3LR3 A;  4EBP A;  4HP9 A;  5FQ9 A;  5CGX A;  4HEF A;  1FR6 A;  3VP4 A;  3MQQ A;  1FIL A;  2Z2M B;  5L10 A;  4PMA A;  3TRC A;  4RX3 A;  1D7E A;  5AJG A;  2XDM A;  3W4P A;  1CJF A;  1YLW A;  3C7U A;  3MQO A;  5EFW A;  4MEZ A;  3A3F A;  4B88 A;  4Z1W A;  2PYP A;  3LR4 A;  3I7J A;  2OOL A;  4E3O A;  2INW A;  4L9F A;  1CI9 A;  1TVF A;  3A0S A;  1KE3 A;  1K6R A;  4HBU A;  4KEN B;  5HAQ A;  5IU1 A;  1LI9 A;  4GB7 A;  4B4Z A;  1OTA A;  1RP5 A;  3WRZ A;  2A49 A;  5F69 A;  4MN6 A;  3NBL A;  3G6O A;  1GA0 A;  2HV1 A;  2ZM0 A;  1BTL A;  4E3L A;  3LUQ A;  1STZ A;  3EOI A;  1IKG A;  2ZMA A;  5E43 A;  3TOI A;  1XA1 A;  2VLG A;  3OOV A;  4WBG A;  4I38 A;  4LEN A;  4O01 A;  5FQM A;  1CQA A;  1DY6 A;  5CED A;  2M7U A;  3BEC A;  3NOU C;  3VE4 A;  4BLM A;  5CTN A;  5EPH A;  1VET B;  2ZM8 A;  3T1R A;  2ZQA A;  4X53 A;  3E2K A;  1PI4 A;  2HGV A;  2PR6 A;  2B02 A;  4PAU A;  3JVV A;  2W3F A;  4RVA A;  3S7P A;  4P87 A;  4BD0 A;  1I5Q A;  3OLO A;  3KYQ A;  1L0G A;  2L0W A;  5FEF A;  3PBQ A;  3C30 A;  4JBF A;  4OPZ A;  3UE3 A;  1ZC2 A;  3T1S A;  3QNB A;  5AQ9 A;  5A90 A;  2Q9M A;  1TDG A;  1H3Q A;  3HLE A;  3FC7 A;  3EQU A;  4C6Y A;  2EX9 A;  3H82 A;  3VOL A;  1W8Y A;  4AFI A;  3WRT A;  3ZFZ A;  2KX6 A;  5HW3 A;  3PAG A;  1FSW A;  3WS0 A;  1VHM A;  2AVX A;  1EW0 A;  2YKF A;  4E3J A;  1PRQ A;  1ODV A;  1LL8 A;  1H8Y A;  4KG5 A;  2IA2 A;  3JYI A;  4CLC B;  5EVL A;  3E0Y A;  5HL6 A;  4OLD A;  4P6Z S;  1OTI A;  5FQQ A;  3SW1 A;  1NYY A;  1K54 A;  3LID A;  4GHI B;  4E3N A;  2PDR A;  3NI9 A;  2HJ9 C;  4WYY A;  3MXR A;  1ALQ A;  4ZDX A;  2OSU A;  4OQH A;  2Y2G A;  1G28 A;  3MKF A;  5EVE A;  2EXA A;  4EEP A;  4PM7 A;  1XA7 A;  4CLC A;  4DF6 A;  1LL9 A;  5CHU A;  3A3D A;  4S2O A;  2P74 A;  4HES A;  3ITB A;  5F68 A;  3NCK A;  3BQ8 A;  5IS1 A;  1JWV A;  2P9V B;  2JKT M;  3IBR A;  1PW1 A;  5HDC A;  1YLY A;  4IHQ A;  2BAS A;  4FCF A;  2WK0 A;  5HWV A;  1LHY A;  4D2O A;  3F1O B;  2VX8 A;  3W4O A;  4Y2F A;  2V0W A;  3IWO A;  3IF6 C;  4BEN A;  2XFT A;  1SDE A;  2J7V A;  4NKP A;  1S6R A;  3GEC A;  4MN5 A;  2M1C A;  2WAF A;  2HPB A;  4WEK A;  2FFY A;  4M3K A;  1MWT A;  4IUH A;  3IXG A;  3B42 A;  3V67 A;  3GRJ A;  5GHZ A;  4MBF A;  4GS9 A;  5DKK A;  3BYD A;  4F3L A;  1PNE A;  3OPL A;  2XK1 A;  2WKR A;  2ZM2 A;  2R9W A;  1MKM A;  1HTZ A;  5D3O A;  2VGL M;  5HWT A;  4I39 A;  3F1O A;  3IWQ A;  2PD8 A;  3FKW A;  2HJE A;  5F1G A;  4KZ8 A;  1YKD A;  2WKP A;  1PI5 A;  3UN7 A;  2A24 B;  4D60 A;  1GHM A;  4LV0 A;  3MFX A;  1GSX A;  1ZKJ A;  2WAE A;  3WS2 A;  3IS2 A;  2Y2O A;  3LCE A;  2ZBB A;  4MMN A;  2CC1 A;  3FYZ A;  4HH3 A;  3GQZ A;  4H6J A;  2FH5 A;  3IT9 A;  5E2F A;  2PRF A;  1P9W A;  3CUE C;  3Q1F A;  2Y2P A;  4NG2 A;  3UDX A;  5HPI A;  3CPT A;  4OPQ A;  3D9Y A;  3IH9 A;  2OWJ A;  3UPN A;  5DKL A;  2OLU A;  4L9G A;  3OPP A;  1K25 A;  1XFQ A;  1LSW A;  3LIF A;  1Y54 A;  4R4S A;  2VK3 A;  3HLD A;  3O86 A;  1D1J A;  3R7W B;  1VM1 A;  4UA7 A;  3MF0 A;  1H8Z A;  3F1P B;  4BBT A;  1W8Q A;  4BBU A;  5BOH A;  1NWZ A;  2J3T D;  3Q82 A;  1ES4 A;  4EQI A;  1K4E A;  3IX4 A;  3OCN A;  1KOU A;  2HF6 A;  5C5K A;  3N8S A;  3MSH A;  1K57 A;  1JNU A;  2VA0 A;  1DJC A;  3A0V A;  2CMN A;  1ERQ A;  4E3K A;  4DE2 A;  3G34 A;  4E3I A;  2NUT C;  2PHY A;  3FPV A;  2W1T A;  1CI8 A;  2D01 A;  3OPR A;  3RFB A;  4UA6 A;  3T1Q B;  3P09 A;  4DDS A;  4CJN A;  2Y2H A;  3K2N A;  3T4J A;  3P01 A;  3T4T A;  1N9B A;  3KSH A;  5F1F A;  1F98 A;  3F1N A;  5J8X A;  2MJ6 A;  4GJ4 A;  4OPY A;  4IED A;  4P6B A;  2X01 A;  3FG8 A;  4F3L B;  4PPR A;  3CZD A;  3K3D A;  2Z6D A;  2QJ7 A;  3LGO A;  2E8J A;  2ZQC A;  2EFU A;  2PU2 A;  3CLO A;  4Q0J A;  3N8R A;  2PYR A;  5HAP A;  4U3T A;  5CHM A;  2EFX A;  2XA7 M;  2HZ5 A;  5F6A A;  1XJ6 A;  2HP5 A;  1OPX A;  4EET B;  5CER A;  1GHP A;  3GDI A;  4CQH A;  4GD6 A;  2V8C A;  5AQ7 A;  1YLT A;  4O7D A;  3Q07 A;  4JKT A;  3G30 A;  5HAR A;  2Y59 A;  1PWD A;  2ZQ7 A;  5FQJ A;  3IF6 B;  4PM9 A;  5CGW A;  2GJ3 A;  3AGD A;  4M4X A;  3IBJ A;  3PHY A;  2JBF A;  2VV6 A;  1NLZ A;  5J4E A;  1SKF A;  4Q0H A;  1Y4O A;  4R3A A;  4K0X A;  4KZB A;  1G68 A;  3HVF A;  1J9M A;  5DFX A;  4GLQ A;  1X0O A;  3S22 A;  4R38 A;  3RTY A;  3VFH A;  2JCH A;  4EEU A;  1MWU A;  3N8L A;  3E2L A;  3M2J A;  5EV0 A;  1ERO A;  3AGF A;  4EBL A;  1NJ4 A;  3MXQ A;  1FCO A;  2KOI A;  4Y0U A;  4Q8I A;  3O87 A;  3C4O A;  4X1M A;  5L09 A;  3C2W A;  2A24 A;  5FDH A;  2K31 A;  4OPR A;  3T4O A;  5M18 A;  2UV0 E;  1MC0 A;  3UPP A;  2W0N A;  5GLB A;  4LV3 A;  2K2N A;  2PU4 A;  1PW8 A;  5EVI C;  4R23 A; 
#chains in the Genus database with same CATH homology
 4IVI A;  2ZQA A;  2V1Z A;  4BQM A;  4X53 A;  1O7E A;  3E2K A;  1PI4 A;  2XH9 A;  2WUQ A;  2XD5 A;  3RXX A;  3BFF A;  4GDB A;  4P0M A;  3HUM A;  1IYQ A;  3UPO A;  1SHV A;  2BLS A;  2WKI A;  3C5A A;  4RVA A;  3SH9 A;  4DRT A;  4X6T A;  4E6X A;  4P87 A;  4BD0 A;  3ISG A;  1I5Q A;  3O88 A;  2ZLY A;  4JXG A;  5M1A A;  3PBN A;  5M19 A;  1K56 A;  2DRW A;  1L0G A;  3MZD A;  5CEC A;  1LL5 A;  5GL9 A;  5HAI A;  5U47 A;  1E25 A;  1FQG A;  3PBQ A;  5AQA A;  3ZCZ A;  3IHB A;  5CTM A;  1OME A;  4JXS A;  3Q7V A;  2H0Y A;  2P9V A;  3PBS A;  4JBF A;  5FSR A;  3SS4 A;  4OH0 A;  4OPZ A;  3DWK A;  3G4P A;  4YFM A;  1ONG A;  4KZ9 A;  1ZC2 A;  1BSG A;  4KZ4 A;  3UE3 A;  4DE1 A;  5TR7 A;  5JYP A;  1K6S A;  2DCF A;  3PBO A;  3QNB A;  3HBR A;  2GDN A;  1VQQ A;  5AQ9 A;  1PWG A;  3G31 A;  5EUA A;  4ZJ1 A;  1BLC A;  1NRF A;  4GDN A;  3PBR A;  5GLD A;  3S4X A;  3G2Z A;  5A90 A;  5FAP A;  4JLF A;  2Q9M A;  4NK3 A;  1TDG A;  4WMC A;  4JPM A;  5IHV A;  4B88 A;  3HLE A;  1XXM A;  3LO7 A;  3GVB A;  3EQU A;  4DXC A;  3HLF A;  2ZC6 B;  2XD1 A;  5CXW A;  3VP0 A;  4ZTK A;  3WS4 A;  1YT4 A;  5CHJ A;  1Q2P A;  1LI0 A;  3ZG7 B;  1KVM A;  3NY4 A;  5FI7 A;  4C6Y A;  2EX9 A;  4WEL A;  3P98 A;  3BFE A;  1W8Y A;  1RGZ A;  3A3E A;  3OCL A;  4MBK A;  3OZH A;  3FV7 A;  3WRT A;  1DJA A;  3ZFZ A;  2WZX A;  5FAS A;  5HW3 A;  3PAG A;  1FSW A;  1XPB A;  3GV9 A;  3V3R A;  1KVL A;  3WS0 A;  2XF3 A;  3ZG8 B;  4E3J A;  2XEP A;  1KGE A;  4GNU A;  2V20 A;  5TGF A;  2Y2I A;  2A3U A;  3MZE A;  5FAT A;  1H8Y A;  3SS3 A;  2XQZ A;  3NDE A;  3ZNY A;  4KG5 A;  5KMW A;  5EOE A;  3MFD A;  1JTG A;  3JYI A;  4P85 A;  3CMZ A;  5EVL A;  4WEJ A;  4EUZ A;  1FCN A;  4OLD A;  4WMC D;  4K91 A;  2EX2 A;  3W4Q A;  4DXB A;  1YMX A;  2Y4A A;  2ZC4 B;  5FQQ A;  1NYY A;  1K54 A;  4GZB A;  4E3N A;  4PM8 A;  4KZ6 A;  3HRE A;  3NI9 A;  3VFF A;  4C3Q A;  2VGJ A;  1ESI A;  2EXB A;  3BRM A;  4WYY A;  3V5M A;  3MXR A;  1ALQ A;  4QB8 A;  4ZDX A;  2OSU A;  3ZVW A;  4OQH A;  4F94 A;  1I2W A;  4YIN A;  4MBH A;  5F82 A;  2Y2G A;  5FQI A;  3MKF A;  2EXA A;  4PM5 A;  1C3B A;  3VMA A;  1SCW A;  3EQV A;  4PM7 A;  1XA7 A;  4C75 A;  4DF6 A;  2G2U A;  1LL9 A;  5CHU A;  3IXD A;  3A3D A;  1N4O A;  5DTK A;  4UAA A;  5DVA A;  4S2O A;  4N1X A;  1NZU A;  1JVJ A;  3QNC A;  1MXO A;  2P74 A;  3PAE A;  4LCL A;  4N1H A;  1DJB A;  3M6B A;  4E3M A;  3OC2 A;  4S2I A;  2XFS A;  4HES A;  5EVI A;  3ITB A;  4S2M A;  1HZO A;  5EVI B;  4X56 A;  3SH7 A;  3NCK A;  2ZQ8 A;  1JWV A;  4KZ3 A;  1QME A;  3CG5 A;  4ZBE A;  2P9V B;  3BFD A;  2PBY A;  4JXW A;  1PW1 A;  3BLS A;  1YLY A;  4WZ5 A;  3ZDJ A;  1TDL A;  5A91 A;  4FCF A;  2WK0 A;  1AXB A;  4KG2 A;  2DNS A;  4EBN A;  1O07 A;  4RA7 A;  4XUX A;  2JC7 A;  4DE3 A;  1K38 A;  1LHY A;  1E3U D;  1IEM A;  4X69 A;  4D2O A;  3CJM A;  1K55 C;  1L0D A;  3W4O A;  4BL2 A;  3IWO A;  1NZO A;  1ZG4 A;  2Y2M A;  4NET A;  3TSG A;  1BLH A;  3BLM A;  4S2J A;  4EV4 A;  3IF6 C;  4LCM A;  4OON A;  4BEN A;  2XFT A;  1SDE A;  2FFF B;  2J7V A;  3BEB A;  3RXW A;  1M6K A;  1FCM A;  4X55 A;  2WGI A;  1FOF A;  1S6R A;  3Q7Z A;  2WAF A;  3HLC A;  3ZNT A;  4Z9Q A;  2H5S A;  2HPB A;  1XP4 A;  4WEK A;  3GMW A;  2FFY A;  3TG9 A;  1MKI A;  4M3K A;  4A5R A;  4DE0 A;  1MWT A;  5E2H A;  5HFO A;  4ID4 A;  5HX9 A;  3IXG A;  3C7V A;  2H0T A;  1XKZ A;  1RGY A;  3GRJ A;  5EOO A;  5GHZ A;  3V3S A;  1MY8 A;  4MBF A;  3BYD A;  3LY3 A;  1EI5 A;  3OPL A;  2XK1 A;  4S2N A;  5TFQ A;  2ZM2 A;  1WYB A;  2R9W A;  2ZQ9 A;  1XGI A;  1HTZ A;  3NC8 A;  4UA9 A;  5D3O A;  3W8K A;  1E4D A;  1KE0 A;  2HP9 A;  4U0T A;  3ZG5 A;  4BD1 A;  4QY5 A;  3B3X A;  4BL3 A;  2IWB A;  3IWQ A;  4JXV A;  1HD8 A;  3MZF A;  5FAQ A;  4JF4 A;  3LY4 A;  2Y2K A;  3VP1 A;  3FKW A;  1ZG6 A;  1KDS A;  1YLJ A;  5F1G A;  2RL3 A;  3IWI A;  5JYO A;  2ZC3 B;  2XGN A;  1MPL A;  3FWL A;  2IWD A;  4KZ5 A;  4KZ8 A;  3ZG9 B;  4GN2 A;  2XLN A;  3SH8 A;  5GHX A;  1YMS A;  3VOZ A;  1W5D A;  1Z6F A;  4R3J A;  3VOY A;  3SS5 A;  3HLW A;  3ZHH A;  2J9P A;  2WYX A;  1SDN A;  2HDR A;  1PI5 A;  3UN7 A;  2C5W B;  3GTC A;  4DDY A;  1GHM A;  4LV0 A;  3IF6 A;  1ZKJ A;  3WS2 A;  2WAE A;  3UO9 A;  4QD4 A;  1QMF A;  4X68 A;  1Q2Q A;  3WS5 A;  5DF8 A;  5KZH A;  1XX2 A;  5EE8 A;  2Y2O A;  2VGK A;  3DWZ A;  1S0W A;  3LCE A;  3UDF A;  3IF5 A;  2RCX A;  5AQB A;  3S1Y A;  3AGE A;  1ESU A;  3UY6 A;  3ITA A;  1PZO A;  3HL9 A;  4IVK A;  2CC1 A;  3IQA A;  5DF7 A;  2R9X A;  5FI6 A;  3UE1 A;  4MLL A;  2Y2L A;  4GKU A;  3FYZ A;  4OVD A;  3GQZ A;  5FI2 A;  1JWP A;  3IT9 A;  4KQR A;  4Y7P A;  5E2F A;  3D4F A;  4N92 A;  1GA9 A;  2WAD A;  2X71 A;  3Q1F A;  1ONH A;  1U60 A;  2Y2P A;  4FSF A;  3UNW A;  2XR0 A;  1K4F A;  1W7F A;  3VP2 A;  4XXR A;  4QHC A;  4S2L A;  3UDX A;  3N6I A;  3G35 A;  1G6A A;  4N9L A;  4OPQ A;  1WE4 A;  4KG6 A;  4LV2 A;  4IBX A;  2Y2J A;  3IH9 A;  2EX6 A;  3Q7V B;  3UPN A;  2B5R A;  3HUO A;  4IBR A;  2QZ6 A;  2OLU A;  4JF6 A;  4U0X A;  3OPP A;  1K25 A;  1YLP A;  2E8I A;  4E6W A;  4GD8 A;  1CEG A;  1Y54 A;  4R4S A;  4KQO A;  3FKV A;  4R1G A;  1BUE A;  4PM6 A;  2Y2N A;  3HLD A;  1ES2 A;  5DTS A;  3A3J A;  1JTD A;  1FSY A;  3OPH A;  4FD8 A;  3O86 A;  3QHY A;  2ZQD A;  4BJP A;  1VM1 A;  4UA7 A;  3HLG A;  1H8Z A;  3M6H A;  3RJU A;  1W8Q A;  5FAO A;  4B4X A;  1NXY A;  5BOH A;  3GSG A;  3PTE A;  1KDW A;  1H5X A;  2OV5 A;  3G2Y A;  3Q82 A;  1ES4 A;  2WGW A;  4UHU A;  4EQI A;  1K4E A;  1MWR A;  3DW0 A;  3OCN A;  1ES5 A;  3N8S A;  5E2G A;  1K57 A;  1YQS A;  4FH4 A;  4FH2 A;  5CEB A;  1DJC A;  1K57 C;  3ZVT A;  4KQQ A;  4L0L A;  4DKI A;  5GHY A;  1NY0 A;  1ERQ A;  4OOL A;  4JF5 A;  4E3K A;  3DTM A;  3G34 A;  4S2K A;  1EWZ A;  4DE2 A;  1M40 A;  4E3I A;  3IHA A;  1JWZ A;  2Y91 A;  1CI8 A;  4QU3 A;  3WS1 A;  2WGV A;  2ZC5 B;  3OPR A;  4OOM A;  4HBT A;  3HUN A;  4R0Q A;  4UA6 A;  5CRF A;  1BLS A;  3P09 A;  4DDS A;  5FQK A;  3MXS A;  3NIA A;  2WGW B;  3Q81 A;  5G18 A;  4MNR A;  4CJN A;  2Y2H A;  1MBL A;  3BFG A;  2H10 A;  5EEC A;  4OQ0 A;  1N9B A;  1PIO A;  4Y0T A;  5F1F A;  1GCE A;  2I72 A;  1K56 D;  5A93 A;  1MWS A;  2X02 A;  1LLB A;  1KE4 A;  3VSK A;  4OP5 A;  5J8X A;  4R3B A;  5FA7 A;  1NYM A;  3G32 A;  1KGG A;  4OPY A;  4IED A;  1IEL A;  3GR2 A;  4P6B A;  2X01 A;  4PPR A;  4ZJ2 A;  5DF9 A;  5E2E A;  3ZG0 A;  3CZD A;  3UE0 A;  5HL1 A;  1BLP A;  1ES3 A;  1E3U A;  2Z2L B;  1BT5 A;  3IXB A;  3IXH A;  3LEZ A;  2Y55 A;  2ZQC A;  2UWX A;  2EFU A;  2PU2 A;  3BFC A;  4EBP A;  2BG1 A;  3N8R A;  5FQ9 A;  5CGX A;  3VSL A;  1HVB A;  4U3T A;  5HAP A;  5L2F A;  5CHM A;  2EFX A;  3N7W A;  4HEF A;  1FR6 A;  4H8R A;  3VP4 A;  2HP5 A;  3MKE A;  1PZP A;  1IKI A;  2Z2M B;  5F83 A;  4OLG A;  5EVI D;  3M2K A;  5GLA A;  4ZJ3 A;  1L0E A;  5CGS A;  4K0W A;  4OKP A;  4S2P A;  1PYY A;  4WZ5 C;  5CER A;  2HDU A;  4PMA A;  1GHP A;  4KZA A;  4GD6 A;  4RX3 A;  2ZD8 A;  2ZJ9 A;  5AQ7 A;  2XDM A;  1BUL A;  3BM6 A;  1BZA A;  3W4P A;  4XUZ A;  3V50 A;  1YLT A;  4O7D A;  1CK3 A;  2ZC7 A;  3Q07 A;  1YLW A;  4JKT A;  3G30 A;  1L2S A;  3C7U A;  5HAR A;  2Y59 A;  1KGF A;  4N9K A;  1PWD A;  4MEZ A;  3A3F A;  2ZQ7 A;  1ERM A;  2WKE A;  2QMI A;  1K54 C;  2WKH A;  4OQG A;  3IF6 B;  5FQJ A;  3UDI A;  1TEM A;  4PM9 A;  5I94 A;  2EX8 A;  5CGW A;  3I7J A;  4E3O A;  3AGD A;  3HLB A;  1CI9 A;  1TVF A;  4OP8 A;  2C6W B;  2JBF A;  1IYP A;  5DTT A;  1SKF A;  1KE3 A;  4RX2 A;  1K6R A;  4K0X A;  3A3I A;  4LV1 A;  3V39 A;  4KZB A;  1G68 A;  3HVF A;  3WWX A;  2Y2Q A;  1J9M A;  4HBU A;  1YM1 A;  2J9O A;  2OLV A;  4KEN B;  5HAQ A;  2WZZ A;  3S22 A;  4S2N C;  1GHI A;  5KSC A;  3VFH A;  1LI9 A;  2JCH A;  4GB7 A;  1MWU A;  3N8L A;  2HP6 A;  3E2L A;  4B4Z A;  4RYE A;  3M2J A;  1W79 A;  1IYO A;  1RP5 A;  3O3V A;  3N4I A;  3WRZ A;  4KZ7 A;  4QJG A;  2J8Y A;  5A92 A;  2A49 A;  1ERO A;  4QY6 A;  5GLC A;  4ZAM A;  3AGF A;  3NBL A;  4EBL A;  1NJ4 A;  3ZGA B;  2HDQ A;  2IWC A;  4Y0O A;  1IYS A;  1FCO A;  4Y0U A;  4EWF A;  4Q8I A;  1GA0 A;  2ZM0 A;  1BTL A;  3C4P A;  4E3L A;  5KSH A;  1XGJ A;  4GOG A;  1IKG A;  2ZMA A;  3O87 A;  3C4O A;  5E43 A;  1PWC A;  4R4R A;  3IH8 A;  2G2W A;  4CPK A;  1K55 A;  1RCJ A;  3TOI A;  2HDS A;  1L0F A;  3VP3 A;  1XA1 A;  1WYC A;  5FDH A;  4WM9 A;  4OPR A;  1I2S A;  2Q9N A;  4WBG A;  4LEN A;  5M18 A;  1YLZ A;  3SOI A;  5FQM A;  3UPP A;  4WZ4 A;  3NDG A;  1DY6 A;  3FZC A;  4OOY A;  5GLB A;  5CED A;  3PBT A;  4LV3 A;  3MBZ A;  1FR1 A;  3BEC A;  2PU4 A;  1PW8 A;  2JE5 A;  5EVI C;  4OQI A;  4BLM A;  4R23 A;  5CTN A;  2QPN A;  1CEF A;  5EPH A;  2V2F F;  2ZM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...