3BYDA

Crystal structure of beta-lactamase oxy-1-1 from klebsiella oxytoca
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
DAIQQKLADLEKRSGGRLGVALINTADDSQTLYRGDERFAMCSTGKVMAAAAVLKQSESNPEVVNKRLEIKKSDLVVWSPITEKHLQSGMTLAELSAAALQYSDNTAMNKMISYLGGPEKVTAFAQSIGDVTFRLDRTEPALNSAIPGDKRDTTTPLAMAESLRKLTLGNALGEQQRAQLVTWLKGNTTGGQSIRAGLPASWAVGDKTGAGDYGTTNDIAVIWPENHAPLVLVTYFTQPQQDAKSRKEVLAAAAKIVTEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the broadened substrate profile of the extended-spectrum beta-lactamase OXY-1-1 from Klebsiella oxytoca
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Hydrolase
molecule keywords Beta-lactamase OXY-1
total genus 88
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3bydA00
2WAFA 5HAIA 1IYPA 2OLUA 1PW1A 4WM9A 1KGFA 3ZG5A 3QNCA 4E3LA 4N92A 3HLGA 1EROA 1PI5A 2WGVA 4R23A 5DTSA 2B5RA 1XP4A 5F1FA 1YQSA 2EX6A 3ZCZA 1L0EA 4NK3A 2Y2GA 3QHYA 2H5SA 4CJNA 5FASA 3Q7ZA 1JWVA 3M6HA 3OZHA 3UPNA 2ZC6B 5GLDA 4RX2A 2EXBA 3E2KA 1BLPA 3PBOA 3CJMA 5A90A 4PM8A 3I7JA 4RX3A 3LCEA 1TEMA 3IXGA 4UAAA 3OPLA 2XD1A 1XPBA 4IVIA 5BOHA 1CEFA 3HREA 4OOYA 2I72A 4P0MA 3W4PA 4Z9QA 2WZXA 2ZC7A 3V5MA 4X56A 3VOZA 5HW3A 3ZVWA 4ZTKA 4A5RA 1K55A 4MNRA 1K57A 4KZ3A 4OVDA 1K56D 1H5XA 4R1GA 4ZBEA 3SH8A 4E3MA 1IKGA 5EUAA 3PBQA 4EBLA 3IH9A 1CI8A 4GB7A 3VP3A 3ZFZA 3DWKA 4JPMA 3SS3A 1BLHA 4EBNA 3AGFA 2XH9A 2ZM0A 1GHMA 5GHXA 3Q7VA 2Y2PA 3C7UA 4KZ7A 5J8XA 5CGWA 2OSUA 5EVLA 5HARA 3LO7A 5FI2A 4OOMA 3N7WA 3N8RA 3PAGA 4GKUA 4WZ5A 1SDEA 1MKIA 4M3KA 2WGWB 4Y0TA 3IWOA 3FKWA 4EQIA 4LV0A 4RVAA 1L0GA 2Y59A 3IHAA 3JYIA 5CRFA 2ZM2A 1GHPA 4OLGA 5I94A 1PYYA 4OKPA 1BTLA 2FFYA 4X69A 3B3XA 2ZQ9A 3ZNYA 1CEGA 1H8ZA 1IEMA 3RXWA 2ZC5B 3E2LA 2OV5A 1C3BA 4PM5A 1VQQA 1IYQA 1ERMA 3P09A 1W8YA 4IVKA 2ZQDA 1KE4A 1O07A 2EFUA 3PBTA 3G2ZA 5CGSA 1HD8A 5GL9A 4BL3A 1NZUA 1NY0A 3W4OA 4MBFA 3O3VA 4NETA 4U3TA 3NBLA 3NC8A 5L2FA 1BSGA 1FSWA 1ONHA 2WUQA 3OC2A 1ALQA 4JF4A 3GV9A 1XX2A 3GR2A 3IXDA 4OPRA 3FWLA 2CC1A 3FZCA 2Q9MA 3OCLA 3ITAA 4CPKA 4DE0A 5KSHA 3VP0A 4IBRA 2J8YA 3LY4A 3SH9A 2V1ZA 3LY3A 4HBTA 4UHUA 3HLCA 3ZDJA 5JYOA 1CK3A 5FQJA 5CGXA 1K57C 2JC7A 3PBNA 3V50A 4QB8A 3PBRA 1MY8A 2WK0A 3M6BA 4S2OA 1WE4A 2EFXA 3IWIA 1NYMA 5E43A 5HL1A 4MBKA 1E3UA 2X01A 5CHJA 4DE3A 1KE0A 2Z2MB 4HESA 3BFCA 2BLSA 1ES3A 1K54A 1E4DA 1O7EA 3UPOA 4H8RA 2ZC4B 4UA6A 1TDLA 3NIAA 4Y0OA 1NYYA 5F1GA 3WS0A 3C5AA 4JXSA 1MWTA 3W8KA 5JYPA 3BFGA 1K6RA 1NRFA 3MZFA 1K6SA 3ZG7B 1KGEA 1BLCA 1RCJA 4KZ5A 1J9MA 5FAOA 4OQHA 4BLMA 3G2YA 1M40A 5DVAA 3C4PA 4OQ0A 5FQMA 2X02A 1ES4A 5KMWA 2P9VA 1XXMA 2XFSA 1YLTA 3AGEA 4S2NC 4DE1A 5E2HA 1W5DA 4DDYA 5TGFA 3BFDA 5IHVA 3ZNTA 1SCWA 5CTMA 5A92A 3IF5A 4PM9A 3DTMA 3GSGA 4ZDXA 4E6WA 1Z6FA 1IYSA 3VSKA 3VFHA 1KDWA 2DCFA 1YM1A 4YINA 1SDNA 3VOYA 5EE8A 3TOIA 1DJAA 2XDMA 1ES5A 1JWPA 1DY6A 3UNWA 1S6RA 5TR7A 5DTKA 4PM7A 4FH2A 1GA0A 4OP8A 1BT5A 4QD4A 1YLJA 1WYBA 2Y2HA 1FQGA 5EVID 3UE1A 3VP2A 4B4XA 2Y91A 1XA1A 3V3RA 3WWXA 1KVMA 1GHIA 4Y0UA 3BECA 3HUOA 1SHVA 3NI9A 1PIOA 1I5QA 1XGIA 1ZG4A 4FCFA 5GLCA 5EVIB 4E3OA 3MZEA 2A49A 5E2FA 4ZAMA 2GDNA 4OH0A 4N1HA 4R3JA 5GHZA 5CECA 1E3UD 2ZQ7A 1LL9A 1K38A 4B88A 2J9OA 3SS5A 3S4XA 1PZOA 5GLAA 5FAPA 2HDRA 2WGWA 3VP4A 1K4FA 4OONA 1VM1A 4S2JA 4LV3A 3DWZA 5HX9A 3IWQA 4MEZA 3V3SA 4EUZA 4KZ6A 2ZC3B 1WYCA 3NDEA 2JE5A 1PI4A 3BYDA 2OLVA 4MBHA 5HAPA 1KDSA 1YLYA 3HBRA 5GLBA 2XD5A 4QY6A 2E8IA 2XR0A 3G31A 1G68A 5U47A 2ZJ9A 3C7VA 5DF7A 3S22A 1GA9A 2G2UA 4BQMA 2Y55A 3D4FA 2XK1A 3W4QA 5FI6A 4C75A 4KZ9A 2P9VB 4IBXA 3BFFA 4QU3A 1SKFA 1RP5A 4KG6A 4XUZA 1YLZA 3O87A 3C4OA 2EX8A 3BEBA 3UDFA 2C6WB 5M1AA 3RJUA 2IWCA 4JBFA 1JTGA 5CTNA 4WBGA 3Q7VB 2WKHA 1U60A 3VSLA 1TVFA 2P74A 2WYXA 1JVJA 1K25A 4DDSA 4KENB 1JWZA 2V20A 5M18A 3OPHA 4XUXA 5AQ9A 3UE3A 3MZDA 1PWCA 3FYZA 3OPRA 4KG5A 4UA9A 4DXCA 1YLPA 3HLFA 5GHYA 4OPZA 3IT9A 3ZG0A 1K54C 3Q1FA 5FQIA 5E2GA 3ZGAB 2QMIA 3HVFA 4JLFA 5DTTA 1L2SA 1TDGA 5M19A 5FA7A 2V2FF 3DW0A 5TFQA 2PBYA 3MXSA 4Y7PA 4E3IA 4U0TA 3S1YA 2R9WA 2IWDA 3BM6A 5FQQA 2DNSA 4EBPA 4OQGA 4P6BA 3WS2A 2Q9NA 3UY6A 2Y4AA 5FATA 1GCEA 3N8SA 3M2KA 3UO9A 4L0LA 1YMSA 1BUEA 2FFFB 3CMZA 3WRZA 4GD6A 4OOLA 2R9XA 4C6YA 1RGYA 1W7FA 3GTCA 1YMXA 4BD0A 1K56A 4FSFA 1LI9A 4JXGA 5FQKA 4F94A 5CEDA 4X6TA 2A3UA 1K55C 5FDHA 5A93A 1CI9A 1LL5A 1PWGA 4ZJ2A 2RL3A 5CEBA 3G35A 5EVIC 3FV7A 4EV4A 4IEDA 3P98A 2ZQ8A 1L0FA 5CHMA 4N9KA 5CERA 1ZKJA 4PPRA 1RGZA 5AQAA 3SS4A 2C5WB 4WEJA 3NDGA 4WMCD 2J7VA 3O86A 3HUNA 1PWDA 1IYOA 3EQVA 4DRTA 3V39A 3HLEA 1FOFA 3PBSA 5CXWA 1FCMA 1BZAA 4OLDA 1YLWA 1KGGA 3Q81A 3BLSA 3IXBA 3G32A 4LENA 4PM6A 1W79A 2XFTA 1EWZA 2JCHA 1K4EA 2PU4A 2XEPA 4KQQA 4GDNA 3N6IA 1H8YA 3IF6A 3SOIA 1N9BA 4S2IA 1MWRA 4MLLA 4JKTA 1YT4A 1FR6A 1DJBA 5EECA 3O88A 1Y54A 1XGJA 4ZJ3A 1ESIA 1ZG6A 3A3JA 3MBZA 3ZG9B 3QNBA 3WS4A 4S2LA 3CZDA 4GN2A 4ZJ1A 1OMEA 1M6KA 1ONGA 4LV1A 4OPYA 1HVBA 4KQOA 4R4SA 4XXRA 1QMFA 1Q2QA 4LV2A 3IQAA 3OPPA 2Y2QA 2VGJA 4JXWA 2XLNA 1ESUA 5F83A 2HP9A 1NJ4A 2XQZA 1KE3A 4DXBA 1MXOA 4HEFA 3AGDA 2WKIA 4RYEA 3Q07A 2ZQCA 1FCOA 2H10A 3GQZA 5E2EA 2Y2MA 3N4IA 2ZLYA 1PW8A 3GRJA 5EOEA 1NXYA 3EQUA 1BLSA 1G6AA 2BG1A 4QY5A 1I2SA 4K91A 3G4PA 3VMAA 1LI0A 3ZHHA 2Y2KA 4DKIA 4C3QA 4R4RA 5F82A 3IF6B 4X55A 2Y2NA 3IF6C 3G34A 4B4ZA 4DF6A 2PU2A 4E3NA 1HTZA 5KSCA 2QPNA 2EXAA 4X53A 4E3KA 3HLBA 3UPPA 2QZ6A 2XGNA 4BD1A 1FCNA 2HDSA 4X68A 4GNUA 4WYYA 3N8LA 4BJPA 1FR1A 5FSRA 1N4OA 2VGKA 3LEZA 3MKFA 4E3JA 4QJGA 1Q2PA 1MBLA 4FD8A 5HFOA 5DF9A 1MWUA 2HDQA 4JXVA 4R3BA 3TSGA 5EOOA 2HP6A 4UA7A 3VFFA 3IH8A 3PTEA 2Z2LB 1IELA 3M2JA 3IXHA 1XA7A 1EI5A 3UE0A 1ERQA 5EPHA 3BFEA 4S2NA 3WS5A 3ZVTA 3MXRA 1ZC2A 2Y2OA 2EX2A 5HAQA 4R0QA 4KQRA 3CG5A 3MKEA 4N9LA 4S2MA 4OQIA 5DF8A 4OPQA 4EWFA 4O7DA 3HLWA 1FSYA 4YFMA 4GD8A 5KZHA 2HPBA 4BL2A 1BULA 1LLBA 1DJCA 1ES2A 4S2KA 2Y2JA 3A3DA 3GVBA 5D3OA 1E25A 4DE2A 4WMCA 2IWBA 2ZQAA 4U0XA 4KZBA 2WADA 4P85A 5FAQA 5G18A 4GDBA 4FH4A 2HDUA 2WKEA 2Y2LA 4KG2A 3GMWA 4KZ8A 5A91A 3NY4A 5AQBA 3PAEA 2UWXA 4JF6A 2Y2IA 1PZPA 3HLDA 1JTDA 2WGIA 2EX9A 2X71A 3MFDA 5EVIA 4S2PA 2ZM8A 3G30A 4WZ5C 3WS1A 2ZMAA 3ITBA 4KZAA 2WAEA 5FI7A 3TG9A 2DRWA 2WZZA 2HP5A 4LCMA 1KVLA 2H0TA 4K0WA 1IKIA 1QMEA 2H0YA 4KZ4A 4QHCA 1XKZA 1I2WA 4K0XA 1AXBA 4PMAA 2XF3A 4JF5A 1HZOA 4WZ4A 3WRTA 3BLMA 5CHUA 3A3EA 4Q8IA 4P87A 4D2OA 5AQ7A 3FKVA 4OP5A 3ISGA 1S0WA 1W8QA 2J9PA 3UDXA 4E6XA 3OCNA 3A3IA 4GOGA 2ZD8A 1L0DA 1NZOA 1MPLA 3NCKA 4GZBA 4ID4A 2RCXA 5FQ9A 1LHYA 4HBUA 3ZG8B 4WELA 1MWSA 3IHBA 3SH7A 3UDIA 4BENA 3BRMA 2G2WA 3RXXA 3Q82A 3HL9A 4LCLA 2JBFA 4RA7A 3VP1A 4N1XA 3UN7A 3A3FA 3HUMA 4WEKA
chains in the Genus database with same CATH superfamily
4FUWA 2WAFA 1PW1A 3QNCA 4E3LA 3HLGA 5DTSA 1W63M 1VEUA 2PYRA 2H5SA 3UPNA 4Y13A 2ZC6B 3E2KA 5DKKA 1BLPA 3PBOA 3CJMA 4PM8A 4L9EA 3VV4A 4CLCE 4FTXA 3W4PA 2ZC7A 2VV7A 2MJ6A 3S7PA 5AVFA 1BLHA 2ZM0A 2CMNA 5GHXA 3Q7VA 3C7UA 4KZ7A 3UB6A 5FI2A 3N7WA 3E4QA 4Q0JA 1PRQA 4M3KA 4GLQA 3UE6A 4RVAA 5CRFA 2ZM2A 1GHPA 5I94A 1PYYA 4ETZA 3BY9A 2JHEA 1BTLA 2JKTI 2FFYA 3B3XA 1IEMA 3E2LA 4PM5A 3MR0A 3P09A 3JVVA 4KUKA 2HV1A 3PBTA 3G2ZA 3SZTA 1NZUA 1NY0A 4U3TA 2WUQA 4JF4A 1XX2A 3GR2A 3FWLA 3FZCA 2Q9MA 3ITAA 4DE0A 4IBRA 4WL9A 2J8YA 2V1ZA 4HBTA 5JYOA 1CK3A 5FQJA 2JC7A 5FDSA 4YWZA 5HSQA 2WK0A 1WE4A 5HL1A 5MC7A 2J3TC 3FC7A 4HESA 5IU1A 3UPOA 4MDZA 2ZC4B 3NIAA 3UMEA 3C5AA 1NRFA 1KGEA 4KZ5A 1J9MA 5FAOA 4OQHA 4BLMA 1M40A 4O01A 4OQ0A 2P9VA 3IX4A 2Y79A 1YLTA 1VEUB 4S2NC 2PD8A 4DDYA 2VZWA 5A92A 2EWWA 3DTMA 2GZAA 3CPTA 1S4SA 3EWKA 1MC0A 5HDSA 3TOIA 3A0SA 1ES5A 1VB6A 3UNWA 4FH2A 5J4EA 4Y3IA 2O0YA 3UE1A 3F1OA 1XA1A 3WWXA 3CI6A 4HQAA 4Y0UA 5GLCA 4NG2A 3BW6A 3KSIA 3B47A 5E2FA 4ZAMA 4OH0A 2ACGA 1N9LA 2ZQ7A 1K38A 4B88A 2J9OA 5FAPA 1Y4OA 2WGWA 1VM1A 5HX9A 1NLYA 2W3GA 3DWZA 4LV3A 4MEZA 3V3SA 4EUZA 2JE5A 1PI4A 3L7HA 3BYDA 2W0NA 2XD5A 1OTEA 2HGVA 5U47A 1OJGA 1H8MA 3OLOA 4H6JB 3UB9A 1GA9A 4BQMA 2Y55A 2XK1A 2PRFA 1SKFA 4KG6A 4XUZA 3O87A 2C6WB 1JTGA 2KOIA 4EUVA 3Q7VB 1A0KA 2PR5A 1SKOB 5M18A 2V20A 1D06A 1YLPA 3HLFA 5GHYA 3Q1FA 5FQIA 3HVFA 1TDGA 4D60A 4E3IA 3S1YA 4I38A 3BM6A 4EBPA 4OQGA 3WS2A 2Q9NA 2Y4AA 3UO9A 3VE3A 2A24B 3WRZA 4DMZA 1W7FA 1YMXA 1K56A 3HCYA 4JXGA 4MMNA 4ZRRA 4F94A 5CEDA 2A3UA 1K55C 5FDHA 1CI9A 4ESPA 2RL3A 3FV7A 4EV4A 4IEDA 2ZOIA 1L0FA 5CHMA 4HP9A 3LFVA 3SS4A 4PPRA 2HJEA 1LSVA 1PWDA 1IYOA 3LICA 4OLDA 1KGGA 5EFWA 2VX8A 3IXBA 4LENA 4PM6A 1LSXA 2XFTA 2JCHA 4KQQA 3N6IA 4X1LA 5EVEA 2QJ5A 1Y54A 2O9BA 4GCZA 1ONGA 1HVBA 4HP4A 1ESUA 2HP9A 2XQZA 2V0WA 4EEPA 2ZQCA 3GQZA 3CLOA 5E2EA 3N4IA 1NRJA 1PW8A 1S1YA 4HJ3A 3ZHHA 4MN6A 2QKPA 1XJ3A 4Z1WA 4C3QA 3MMHA 4L9GA 3NULA 4X55A 3IF6C 4B4ZA 2PU2A 5KSCA 2EXAA 4X53A 3HLBA 2QZ6A 4BD1A 1N4OA 3LEZA 4QJGA 2M7UA 2B18A 5DF9A 3SW1A 3NECA 2HDQA 3QP2A 3S7OA 5EOOA 5I5LA 1MKMA 1IELA 4PKYA 3UE0A 1ERQA 3WS5A 3ZVTA 4S2NA 3MXRA 1KOUA 2VGLM 3TE8A 5HAQA 4WLAA 2JN7A 4KQRA 3MKEA 5DF8A 4EERA 4UQIM 5KZHA 4LFUA 1ES2A 4I5SA 1ACFA 1WA9A 4GDBA 4GJ4A 1ZHHB 4FH4A 2WKEA 1TS0A 3PAEA 2UWXA 2Y2IA 3H9WA 3BJNA 1JTDA 2WGIA 2W3FA 5EVIA 3WS1A 3T4SA 3ITBA 3TG9A 3BQ8A 4IJGA 3LGOA 1LSWA 1QMEA 2OAP1 1I2WA 2ZMFA 1AXBA 2E8JA 2BASA 5CHUA 1P9WA 3C38A 4P87A 5AQ7A 3RH8B 3ISGA 3PYPA 4E6XA 4GOGA 3JPUA 1L0DA 3NCKA 5FQ9A 3SH7A 2G2WA 4LCLA 2JBFA 4N1XA 5HAIA 1KGFA 3ZG5A 1LT0A 4CLCC 1PI5A 5TBMB 4X25A 4R23A 5F1FA 2EX6A 1L0EA 2V8FA 2Y2GA 2EXBA 5A90A 3CAXA 4RX3A 1TEMA 3OPLA 3W2ZA 4IVIA 4OOYA 2I72A 4Z9QA 4IUKA 2K7SA 3VOZA 1H0MA 4A5RA 3B33A 3GECA 4KZ3A 4ZBEA 4R1GA 5EUAA 3PBQA 3QP8A 4BBTA 5J7EA 1CI8A 1PNEA 3DWKA 2XA7S 3AGFA 2XH9A 3P7NA 4DN0A 1GHMA 1TS8A 2Y2PA 3PXPA 5J8XA 5CGWA 2OSUA 5EVLA 5HARA 2PYPA 4OOMA 3N8RA 4WZ5A 3F1NB 3RFBA 4Y0TA 4EQIA 3IHAA 3LI8A 4OLGA 1OTDA 5FEGA 4BWIA 5DJTA 3ZNYA 3RXWA 4CQHA 2ZC5B 2D02A 1C3BA 2ZMVA 3MQOA 1KE4A 1MZUA 3D72A 2H28A 4MBFA 2L4RA 3O3VA 5DKLA 3OC2A 1ALQA 1YPRA 3IXDA 2XA7M 4CPKA 3LY4A 3SH9A 2Z6DA 3HLCA 2W3EA 1K57C 3MS6A 4QWOA 3V50A 4QB8A 1MY8A 3IX8A 3M6BA 4AFIA 2PAVP 3IWIA 1NYMA 5E43A 4MBKA 5CHJA 4X1MA 4WN5A 4UA6A 5HWVA 4Y0OA 5F1GA 3A0RA 3BFGA 1K6RA 1K6SA 4JGOA 1BLCA 2V1AA 1ES4A 5KMWA 2XFSA 3AGEA 4P6ZM 5F6AA 1W5DA 2XROA 5IHVA 4ZDXA 1IYSA 3VSKA 2DCFA 4YINA 3VOYA 5F5YA 1DY6A 5G4ZA 3FG8A 3MJQA 3NHQA 3R4KA 4PM7A 4OP8A 4QD4A 3UB8A 4B4XA 3BECA 3NI9A 1PIOA 1XGIA 4Y2FA 3MZEA 2A49A 2GDNA 1P9RA 4R3JA 3TW8A 1DP8A 1OJ5A 2L0WA 3S4XA 1PZOA 5GLAA 2M7VA 4S2JA 3IWQA 5L07A 2OWJA 2E8IA 4NEED 2XR0A 3G31A 1G68A 3C7VA 3S22A 3D4FA 3KO6A 3W4QA 4C75A 3T50A 3KYZA 3LIAA 3BEBA 2W3DA 3S7NA 3UDFA 1G5UA 2WKHA 1H3QA 1U60A 3VSLA 1TVFA 2P74A 1JVJA 4YNRA 2Z6CA 4KENB 4HIAA 1JWZA 1AWIA 4XUXA 3UE3A 3MZDA 4UA9A 3IT9A 5E2GA 3K3CA 1JNUA 5TFQA 3MXSA 4U0TA 5FQQA 2JKGA 4HOIA 5FATA 3N8SA 2WKQA 4L0LA 4O8GA 3FPWA 3VOLA 5HWWA 4BD0A 4FSFA 2B95A 3T4OA 1OT9A 3QP4A 4X6TA 3UB7A 5CEBA 4DJ2A 3P98A 2ZQ8A 3LIEA 3C2WA 1ZKJA 3T1SA 1TS6A 1YAXA 3ZQ5A 2PT7A 4IUHA 2Q0OA 4DRTA 1FOFA 1YLWA 3Q81A 1W79A 2XEPA 2VV6A 3SOIA 3IF6A 1N9BA 5HD5A 4PHTA 4LRYC 4MLLA 2A24A 1CF0A 4CLCB 2QJ7A 3O88A 1EW0A 3A3JA 4CLCD 4KQOA 1CJFA 4R4SA 4LV2A 3IQAA 2VGJA 5F83A 1KE3A 3AGDA 1FCOA 2ZLYA 1NXYA 2BG1A 3VMAA 3DBAA 4LGWA 4UEYA 3IF6B 3IS2B 1V9YA 3G34A 4E3NA 3ZYTA 3DTIA 4E3KA 3E4OA 3UPPA 2XGNA 2HDSA 3H7WB 4X68A 3N8LA 4E3JA 2AVXA 2KDKA 5HFOA 4EQ1A 1BYWA 5HPFA 2HP6A 2Z2LB 3U4LP 2WKPA 3BFEA 4EWFA 3HLWA 4YFMA 4GD8A 4KUOA 3T4KA 1BULA 2W3HA 3A3DA 3GVBA 2ZQAA 2WADA 5FAQA 2HDUA 4KZ8A 5AQBA 4IHQA 4ETXA 2O9AA 3F1OB 3MQ0A 2VV8A 3T12B 2ZMAA 1KVLA 2H0TA 4Y17A 4K0WA 4KZ4A 4QHCA 4K0XA 1HZOA 4WZ4A 1NWZA 3WRTA 3BLMA 3A3EA 3FKVA 5G4YA 5C5KA 2OOLA 3DTKA 1NZOA 4ID4A 4HBUA 1DP9A 1MWSA 3UN7A 3A3FA 3HUMA 4WEKA 2OLUA 4WM9A 1XJ4A 3MF0A 1YSPA 4XT2A 3U2AA 1EROA 2B5RA 1YQSA 3ZCZA 4NK3A 4CJNA 3Q7ZA 1JWVA 1OTAA 5GLDA 1GSWA 3I7JA 3LCEA 2XD1A 5HDDA 1CEFA 3HREA 1IOUA 2UV0E 3V5MA 4MNRA 4GS9A 1GSVA 2I9VA 2P08A 4O0PA 3SH8A 2OAQ1 4E3MA 1IKGA 2R78A 4EBLA 3VP3A 4JPMA 2V8CA 4PAUA 2G7UA 3PAGA 4GKUA 3LR3A 1T18A 2WGWB 3IWOA 2W27A 1T1BA 3NOPC 4LV0A 5EV0A 1L0GA 4DJ3A 1OTBA 3EGDC 4OKPA 4X69A 3IBRA 2ZQ9A 1CEGA 1H8ZA 1VQQA 4LLOB 1YSQA 4IVKA 2ZQDA 1TF1A 5CGSA 3W4OA 4NETA 4UQIS 3NBLA 1ONHA 4I3AA 3GV9A 4OPRA 2CC1A 2VGLS 3OCLA 2QWSA 4II7A 3LY3A 4HJ4A 5AJGA 1P0ZA 4UHUA 3ZDJA 5EM0A 4YOFA 2VJWA 3PBNA 4EU0A 3PBRA 1PFLA 4S2OA 2V1BA 1E3UA 3F1PB 1KE0A 3V67A 3BFCA 1ES3A 1K54A 4R6LA 1E4DA 1LL8A 1TDLA 5DJUA 1NYYA 3WS0A 5JYPA 3MZFA 3ZG7B 1W63Q 1RCJA 3G2YA 3C4PA 2JKFA 4DE1A 4I3IA 3QP6A 5L10A 5TGFA 2ZOHA 3BFDA 3ZNTA 2XSSA 5CTMA 5HZHA 4PM9A 2B02A 4E6WA 1Z6FA 2KX6A 1KDWA 1SDNA 3T4LA 2O99A 2XDMA 1S6RA 5TR7A 5DTKA 2JKRI 1GA0A 1BT5A 1F5MA 1WYBA 5EVID 4HI4A 2Y91A 3V3RA 2IA2A 1GHIA 3CWFA 3HUOA 1I5QA 1ZG4A 4E3OA 5EVIB 4JGRA 3H82B 4N1HA 4MN5A 3SS5A 2VLGA 4OONA 4Y5FA 5HD3A 1OT6A 3CUEA 2ZC3B 3QP5A 2FH5A 2OLVA 1F2KA 3C30A 5HAPA 5GLBA 3D3OA 4QY6A 5DFXA 4B93A 5DF7A 4QPRA 3MXQA 5FI6A 4H6JA 2P9VB 3L9KA 4IBXA 1UWPX 3BFFA 4P6ZS 3TJZC 1YLZA 3C4OA 4GW9A 5IS1A 5CTNA 1S66L 2LB5A 3O5YA 5AQ9A 1TD5A 4HH2A 1PWCA 4DXCA 1VHMA 4OPZA 3ZG0A 2EA9A 3MFXA 5M19A 5FA7A 2V2FF 3IS2A 2PBYA 3E0YA 2R9WA 1V9ZA 4P6BA 4WUJA 1IFQA 1GCEA 1BUEA 3CMZA 4ARZB 5F68A 3LR4A 4C6YA 2Y8HA 1G28A 3RTYA 3GTCA 2GJ3A 1VETA 4EW7A 5A93A 1LL5A 4ZJ2A 5EVIC 5EM1A 4N9KA 5CERA 1RGZA 3TRCA 3KSHA 3NDGA 4RQ9A 1G6OA 4WMCD 3O86A 1N9NA 3EQVA 3ULFA 3V39A 3PBSA 5CXWA 1J3WA 1FCMA 3BQAA 3BLSA 1H8YA 4L9FA 1Y28A 2HJ9C 1YT4A 1DJBA 5EECA 1ESIA 1ZG6A 3MBZA 3PHYA 3WS4A 4S2LA 3CZDA 4GN2A 4ZJ1A 1OMEA 1M6KA 4LV1A 2GNXA 4OPYA 4XXRA 1QMFA 2Y2QA 2XLNA 2VKSA 4DXBA 1MXOA 4HEFA 4RYEA 3Q07A 2Y2MA 2HZ5A 5EOEA 3EQUA 1BLSA 1G6AA 4QY5A 1I2SA 1S67L 2Y2KA 4DKIA 4M4XA 5HL6A 4R4RA 5F82A 4DF6A 2QPNA 3LIBA 1FCNA 4BJPA 4GNUA 2VGKA 4CLCA 1MBLA 3KYEA 5HWTA 3T1RA 2W1RA 2K31A 4GHIB 4JXVA 3TSGA 2YKFA 2WKRA 4UA7A 3VFFA 3IH8A 2VA0A 1XA7A 3K2NA 1EI5A 4XT2B 1DP6A 5A8BA 4R0QA 3GDIA 3CG5A 4N9LA 4S2MA 1F98A 1ZTUA 4OQIA 4O7DA 3JVUA 4BL2A 1LLBA 2OWHA 1DJCA 4S2KA 2XRNA 1X0OA 4DE2A 4EESA 2IWBA 4KZBA 5G18A 3LYXA 1VETB 5A91A 4KQDA 4S2PA 2ZM8A 3G30A 4WZ5C 5FI7A 2WAEA 2KLIA 2DRWA 2HP5A 5F69A 2H0YA 5TJJA 3T1XA 1XKZA 3PR6A 2NUTC 2QYBA 3D9YA 3R7WA 4D2OA 4OP5A 2J9PA 3OCNA 3A3IA 5LBRA 2ZD8A 2RCXA 4BENA 3BRMA 5L8MA 3RXXA 1HLUP 1XJ6A 2J3WA 4RA7A 3VP1A 3H82A 1S4RA 4F3LA 3SS3A 1IYPA 5FL3A 4N92A 1OTIA 2W1TA 3LR0A 2WGVA 1XP4A 3QHYA 5FASA 3IBJA 3M6HA 3OZHA 4RX2A 4B9OA 3IXGA 4UAAA 4BBVA 3DTEA 3KSFA 1XPBA 5BOHA 3MSHA 3KYQA 4P0MA 4EEUA 2WZXA 4X56A 4G3KA 5HW3A 3ZVWA 4ZTKA 1K55A 1K57A 4OVDA 1K56D 1H5XA 4EETB 3IH9A 4GB7A 3ZFZA 3T1QB 4EBNA 4R70A 3UB5P 3LO7A 3ICYA 1SDEA 1MKIA 2YKHA 3FKWA 2Y59A 3JYIA 2JKRM 1CQAA 3T4QA 1STZA 4K08A 1F9IA 2OV5A 1IYQA 1ERMA 1W8YA 3HJIA 5HPIA 1O07A 2JKTM 2EFUA 2FZ0A 1T1AA 1HD8A 5GL9A 4BL3A 1P97A 5L2FA 3NC8A 1BSGA 1FSWA 3LIFA 4Q0HA 3OOVA 5KSHA 3VP0A 5FEFA 3LUQA 4GHIA 2DMWA 2HF6A 4HH3A 5CGXA 3B42A 3F1PA 4NXFA 2VEAA 3CPTB 2EFXA 1S1ZA 3FPVA 2X01A 4DE3A 2Z2MB 4LRZE 2BLSA 3VE4A 1O7EA 3LR5A 4H8RA 4JXSA 1MWTA 3W8KA 4G3VA 1XFNA 2W1TB 3K3DA 5DVAA 4BBUA 1FIKA 5FQMA 2X02A 3UMDA 1XXMA 4FOFA 2NUPC 5E2HA 5L09A 3MQQA 1SCWA 3IF5A 3GSGA 5IT5A 3VFHA 3EEAA 1YM1A 3P01A 5EE8A 1DJAA 4LPZA 1JWPA 1YLJA 2Y2HA 1FQGA 3VP2A 1KVMA 1SHVA 4FCFA 4MN7A 4F3LB 5GHZA 2ZBBA 5CECA 1E3UD 4R38A 1LL9A 1NLZA 3NOUC 4NXEA 4PKYG 2HDRA 4G3WA 3VP4A 1K4FA 4KZ6A 1WYCA 3NDEA 3R7WB 4MBHA 3DAVA 1KDSA 1YLYA 3HBRA 4NXGA 4ME4A 1T1CA 2ZJ9A 3CHWP 2PD7A 2G2UA 3QP1A 4KZ9A 4QU3A 1RP5A 2EX8A 3NOTC 5M1AA 3RJUA 2IWCA 4JBFA 4WBGA 2WYXA 1K25A 1K0KA 5J3WA 4DDSA 3OPHA 4HHDA 3FYZA 3OPRA 4KG5A 4HJ6A 3T4TA 1K54C 3ZGAB 2QMIA 4JLFA 5DTTA 1L2SA 3DW0A 4Y7PA 2IWDA 1D7EA 2BTFP 2DNSA 2PHYA 3UY6A 3S7QA 3M2KA 1YMSA 2FFFB 3HJKA 4GD6A 4OOLA 2R9XA 3CUEC 2EWVA 1RGYA 4HNBA 2P04A 1LI9A 4BMWA 2L1MA 5FQKA 3F1NA 1YKDA 2O9CA 1PWGA 3G35A 2A2LA 5HDCA 5CX7A 3LI9A 5AQAA 2P7JA 2C5WB 4WEJA 1T19A 3A0VA 2J7VA 3HUNA 3HLEA 4Y15A 1BZAA 1FILA 3G32A 4LRXC 1EWZA 1K4EA 2PU4A 4GDNA 1D1JA 4S2IA 1MWRA 4JKTA 1FR6A 4ZJ3A 1XGJA 3ZG9B 3QNBA 2V0UA 4JGPA 4NKPA 3EOIA 1Q2QA 3OPPA 3T4JA 2VK3A 4JXWA 5TBMA 1NJ4A 2WKIA 2H10A 1DRMA 3GRJA 1OPXA 3G6OA 1ODVA 3EEHA 3G4PA 4K91A 1LI0A 1UGUA 3KX0X 1SZVA 2Y2NA 3EGXC 1HTZA 5K5BA 4WYYA 1FR1A 5FSRA 3E4PA 3MKFA 2PBDP 5AVEA 1Q2PA 3LIDA 4FD8A 2K2NA 3OBFA 4ARZA 1MWUA 4WF0A 3E98A 4EXOA 4R3BA 1SKOA 4I39A 3PTEA 5KIZA 3M2JA 1L3LA 3IXHA 3LEQA 5EPHA 2QHKA 1ZC2A 2Y2OA 2EX2A 2J80A 1XFQA 3KSGA 4OPQA 2D01A 1FSYA 1GSXA 2J3TD 1Z09A 2HPBA 2Y2JA 5D3OA 1E25A 4WMCA 2ZL1B 4U0XA 4P85A 2Y2LA 1XJ2A 4KG2A 3GMWA 3NY4A 4MCWA 4JF6A 1PZPA 3HLDA 2EX9A 2X71A 3MFDA 4KZAA 2WZZA 4LCMA 2INWA 3BY8A 1IKIA 2GX5A 3IX3A 4Q0IA 1UWNX 2V9AA 4PMAA 2XF3A 4JF5A 1TS7A 2M1CA 2PDRA 2PR6A 4Q8IA 3BWLA 1S0WA 1W8QA 3H7WA 3UDXA 4JGQA 4NXBA 4GS9B 1MPLA 2ZL1A 4GZBA 1LHYA 3ZG8B 3C8CA 4WELA 3IHBA 4HY8A 5DFYA 3UDIA 4I3JA 3Q82A 3HL9A 4R3AA 4E04A 3CITA 1N9OA 3NJAA 2LB9A
chains in the Genus database with same CATH topology
2WAFA 5HAIA 1IYPA 2OLUA 1PW1A 4WM9A 1KGFA 3ZG5A 3QNCA 4E3LA 4N92A 3HLGA 1EROA 1PI5A 2WGVA 4R23A 5DTSA 2B5RA 1XP4A 5F1FA 1YQSA 2EX6A 3ZCZA 1L0EA 4NK3A 2Y2GA 3QHYA 2H5SA 4CJNA 5FASA 3Q7ZA 1JWVA 3M6HA 3OZHA 3UPNA 2ZC6B 5GLDA 4RX2A 2EXBA 3E2KA 1BLPA 3PBOA 3CJMA 5A90A 4PM8A 3I7JA 4RX3A 3LCEA 1TEMA 3IXGA 4UAAA 3OPLA 2XD1A 1XPBA 4IVIA 5BOHA 1CEFA 3HREA 4OOYA 2I72A 4P0MA 3W4PA 4Z9QA 2WZXA 2ZC7A 3V5MA 4X56A 3VOZA 5HW3A 3ZVWA 4ZTKA 4A5RA 1K55A 4MNRA 1K57A 4KZ3A 4OVDA 1K56D 1H5XA 4R1GA 4ZBEA 3SH8A 4E3MA 1IKGA 5EUAA 3PBQA 4EBLA 3IH9A 1CI8A 4GB7A 3VP3A 3ZFZA 3DWKA 4JPMA 3SS3A 1BLHA 4EBNA 3AGFA 2XH9A 2ZM0A 1GHMA 5GHXA 3Q7VA 2Y2PA 3C7UA 4KZ7A 5J8XA 5CGWA 2OSUA 5EVLA 5HARA 3LO7A 5FI2A 4OOMA 3N7WA 3N8RA 3PAGA 4GKUA 4WZ5A 1SDEA 1MKIA 4M3KA 2WGWB 4Y0TA 3IWOA 3FKWA 4EQIA 4LV0A 4RVAA 1L0GA 2Y59A 3IHAA 3JYIA 5CRFA 2ZM2A 1GHPA 4OLGA 5I94A 1PYYA 4OKPA 1BTLA 2FFYA 4X69A 3B3XA 2ZQ9A 3ZNYA 1CEGA 1H8ZA 1IEMA 3RXWA 2ZC5B 3E2LA 2OV5A 1C3BA 4PM5A 1VQQA 1IYQA 1ERMA 3P09A 1W8YA 4IVKA 2ZQDA 1KE4A 1O07A 2EFUA 3PBTA 3G2ZA 5CGSA 1HD8A 5GL9A 4BL3A 1NZUA 1NY0A 3W4OA 4MBFA 3O3VA 4NETA 4U3TA 3NBLA 3NC8A 5L2FA 1BSGA 1FSWA 1ONHA 2WUQA 3OC2A 1ALQA 4JF4A 3GV9A 1XX2A 3GR2A 3IXDA 4OPRA 3FWLA 2CC1A 3FZCA 2Q9MA 3OCLA 3ITAA 4CPKA 4DE0A 5KSHA 3VP0A 4IBRA 2J8YA 3LY4A 3SH9A 2V1ZA 3LY3A 4HBTA 4UHUA 3HLCA 3ZDJA 5JYOA 1CK3A 5FQJA 5CGXA 1K57C 2JC7A 3PBNA 3V50A 4QB8A 3PBRA 1MY8A 2WK0A 3M6BA 4S2OA 1WE4A 2EFXA 3IWIA 1NYMA 5E43A 5HL1A 4MBKA 1E3UA 2X01A 5CHJA 4DE3A 1KE0A 2Z2MB 4HESA 3BFCA 2BLSA 1ES3A 1K54A 1E4DA 1O7EA 3UPOA 4H8RA 2ZC4B 4UA6A 1TDLA 3NIAA 4Y0OA 1NYYA 5F1GA 3WS0A 3C5AA 4JXSA 1MWTA 3W8KA 5JYPA 3BFGA 1K6RA 1NRFA 3MZFA 1K6SA 3ZG7B 1KGEA 1BLCA 1RCJA 4KZ5A 1J9MA 5FAOA 4OQHA 4BLMA 3G2YA 1M40A 5DVAA 3C4PA 4OQ0A 5FQMA 2X02A 1ES4A 5KMWA 2P9VA 1XXMA 2XFSA 1YLTA 3AGEA 4S2NC 4DE1A 5E2HA 1W5DA 4DDYA 5TGFA 3BFDA 5IHVA 3ZNTA 1SCWA 5CTMA 5A92A 3IF5A 4PM9A 3DTMA 3GSGA 4ZDXA 4E6WA 1Z6FA 1IYSA 3VSKA 3VFHA 1KDWA 2DCFA 1YM1A 4YINA 1SDNA 3VOYA 5EE8A 3TOIA 1DJAA 2XDMA 1ES5A 1JWPA 1DY6A 3UNWA 1S6RA 5TR7A 5DTKA 4PM7A 4FH2A 1GA0A 4OP8A 1BT5A 4QD4A 1YLJA 1WYBA 2Y2HA 1FQGA 5EVID 3UE1A 3VP2A 4B4XA 2Y91A 1XA1A 3V3RA 3WWXA 1KVMA 1GHIA 4Y0UA 3BECA 3HUOA 1SHVA 3NI9A 1PIOA 1I5QA 1XGIA 1ZG4A 4FCFA 5GLCA 5EVIB 4E3OA 3MZEA 2A49A 5E2FA 4ZAMA 2GDNA 4OH0A 4N1HA 4R3JA 5GHZA 5CECA 1E3UD 2ZQ7A 1LL9A 1K38A 4B88A 2J9OA 3SS5A 3S4XA 1PZOA 5GLAA 5FAPA 2HDRA 2WGWA 3VP4A 1K4FA 4OONA 1VM1A 4S2JA 4LV3A 3DWZA 5HX9A 3IWQA 4MEZA 3V3SA 4EUZA 4KZ6A 2ZC3B 1WYCA 3NDEA 2JE5A 1PI4A 3BYDA 2OLVA 4MBHA 5HAPA 1KDSA 1YLYA 3HBRA 5GLBA 2XD5A 4QY6A 2E8IA 2XR0A 3G31A 1G68A 5U47A 2ZJ9A 3C7VA 5DF7A 3S22A 1GA9A 2G2UA 4BQMA 2Y55A 3D4FA 2XK1A 3W4QA 5FI6A 4C75A 4KZ9A 2P9VB 4IBXA 3BFFA 4QU3A 1SKFA 1RP5A 4KG6A 4XUZA 1YLZA 3O87A 3C4OA 2EX8A 3BEBA 3UDFA 2C6WB 5M1AA 3RJUA 2IWCA 4JBFA 1JTGA 5CTNA 4WBGA 3Q7VB 2WKHA 1U60A 3VSLA 1TVFA 2P74A 2WYXA 1JVJA 1K25A 4DDSA 4KENB 1JWZA 2V20A 5M18A 3OPHA 4XUXA 5AQ9A 3UE3A 3MZDA 1PWCA 3FYZA 3OPRA 4KG5A 4UA9A 4DXCA 1YLPA 3HLFA 5GHYA 4OPZA 3IT9A 3ZG0A 1K54C 3Q1FA 5FQIA 5E2GA 3ZGAB 2QMIA 3HVFA 4JLFA 5DTTA 1L2SA 1TDGA 5M19A 5FA7A 2V2FF 3DW0A 5TFQA 2PBYA 3MXSA 4Y7PA 4E3IA 4U0TA 3S1YA 2R9WA 2IWDA 3BM6A 5FQQA 2DNSA 4EBPA 4OQGA 4P6BA 3WS2A 2Q9NA 3UY6A 2Y4AA 5FATA 1GCEA 3N8SA 3M2KA 3UO9A 4L0LA 1YMSA 1BUEA 2FFFB 3CMZA 3WRZA 4GD6A 4OOLA 2R9XA 4C6YA 1RGYA 1W7FA 3GTCA 1YMXA 4BD0A 1K56A 4FSFA 1LI9A 4JXGA 5FQKA 4F94A 5CEDA 4X6TA 2A3UA 1K55C 5FDHA 5A93A 1CI9A 1LL5A 1PWGA 4ZJ2A 2RL3A 5CEBA 3G35A 5EVIC 3FV7A 4EV4A 4IEDA 3P98A 2ZQ8A 1L0FA 5CHMA 4N9KA 5CERA 1ZKJA 4PPRA 1RGZA 5AQAA 3SS4A 2C5WB 4WEJA 3NDGA 4WMCD 2J7VA 3O86A 3HUNA 1PWDA 1IYOA 3EQVA 4DRTA 3V39A 3HLEA 1FOFA 3PBSA 5CXWA 1FCMA 1BZAA 4OLDA 1YLWA 1KGGA 3Q81A 3BLSA 3IXBA 3G32A 4LENA 4PM6A 1W79A 2XFTA 1EWZA 2JCHA 1K4EA 2PU4A 2XEPA 4KQQA 4GDNA 3N6IA 1H8YA 3IF6A 3SOIA 1N9BA 4S2IA 1MWRA 4MLLA 4JKTA 1YT4A 1FR6A 1DJBA 5EECA 3O88A 1Y54A 1XGJA 4ZJ3A 1ESIA 1ZG6A 3A3JA 3MBZA 3ZG9B 3QNBA 3WS4A 4S2LA 3CZDA 4GN2A 4ZJ1A 1OMEA 1M6KA 1ONGA 4LV1A 4OPYA 1HVBA 4KQOA 4R4SA 4XXRA 1QMFA 1Q2QA 4LV2A 3IQAA 3OPPA 2Y2QA 2VGJA 4JXWA 2XLNA 1ESUA 5F83A 2HP9A 1NJ4A 2XQZA 1KE3A 4DXBA 1MXOA 4HEFA 3AGDA 2WKIA 4RYEA 3Q07A 2ZQCA 1FCOA 2H10A 3GQZA 5E2EA 2Y2MA 3N4IA 2ZLYA 1PW8A 3GRJA 5EOEA 1NXYA 3EQUA 1BLSA 1G6AA 2BG1A 4QY5A 1I2SA 4K91A 3G4PA 3VMAA 1LI0A 3ZHHA 2Y2KA 4DKIA 4C3QA 4R4RA 5F82A 3IF6B 4X55A 2Y2NA 3IF6C 3G34A 4B4ZA 4DF6A 2PU2A 4E3NA 1HTZA 5KSCA 2QPNA 2EXAA 4X53A 4E3KA 3HLBA 3UPPA 2QZ6A 2XGNA 4BD1A 1FCNA 2HDSA 4X68A 4GNUA 4WYYA 3N8LA 4BJPA 1FR1A 5FSRA 1N4OA 2VGKA 3LEZA 3MKFA 4E3JA 4QJGA 1Q2PA 1MBLA 4FD8A 5HFOA 5DF9A 1MWUA 2HDQA 4JXVA 4R3BA 3TSGA 5EOOA 2HP6A 4UA7A 3VFFA 3IH8A 3PTEA 2Z2LB 1IELA 3M2JA 3IXHA 1XA7A 1EI5A 3UE0A 1ERQA 5EPHA 3BFEA 4S2NA 3WS5A 3ZVTA 3MXRA 1ZC2A 2Y2OA 2EX2A 5HAQA 4R0QA 4KQRA 3CG5A 3MKEA 4N9LA 4S2MA 4OQIA 5DF8A 4OPQA 4EWFA 4O7DA 3HLWA 1FSYA 4YFMA 4GD8A 5KZHA 2HPBA 4BL2A 1BULA 1LLBA 1DJCA 1ES2A 4S2KA 2Y2JA 3A3DA 3GVBA 5D3OA 1E25A 4DE2A 4WMCA 2IWBA 2ZQAA 4U0XA 4KZBA 2WADA 4P85A 5FAQA 5G18A 4GDBA 4FH4A 2HDUA 2WKEA 2Y2LA 4KG2A 3GMWA 4KZ8A 5A91A 3NY4A 5AQBA 3PAEA 2UWXA 4JF6A 2Y2IA 1PZPA 3HLDA 1JTDA 2WGIA 2EX9A 2X71A 3MFDA 5EVIA 4S2PA 2ZM8A 3G30A 4WZ5C 3WS1A 2ZMAA 3ITBA 4KZAA 2WAEA 5FI7A 3TG9A 2DRWA 2WZZA 2HP5A 4LCMA 1KVLA 2H0TA 4K0WA 1IKIA 1QMEA 2H0YA 4KZ4A 4QHCA 1XKZA 1I2WA 4K0XA 1AXBA 4PMAA 2XF3A 4JF5A 1HZOA 4WZ4A 3WRTA 3BLMA 5CHUA 3A3EA 4Q8IA 4P87A 4D2OA 5AQ7A 3FKVA 4OP5A 3ISGA 1S0WA 1W8QA 2J9PA 3UDXA 4E6XA 3OCNA 3A3IA 4GOGA 2ZD8A 1L0DA 1NZOA 1MPLA 3NCKA 4GZBA 4ID4A 2RCXA 5FQ9A 1LHYA 4HBUA 3ZG8B 4WELA 1MWSA 3IHBA 3SH7A 3UDIA 4BENA 3BRMA 2G2WA 3RXXA 3Q82A 3HL9A 4LCLA 2JBFA 4RA7A 3VP1A 4N1XA 3UN7A 3A3FA 3HUMA 4WEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAF A;  5HAI A;  1IYP A;  2OLU A;  1PW1 A;  4WM9 A;  1KGF A;  3ZG5 A;  3QNC A;  4E3L A;  4N92 A;  3HLG A;  1ERO A;  1PI5 A;  2WGV A;  4R23 A;  5DTS A;  2B5R A;  1XP4 A;  5F1F A;  1YQS A;  2EX6 A;  3ZCZ A;  1L0E A;  4NK3 A;  2Y2G A;  3QHY A;  2H5S A;  4CJN A;  5FAS A;  3Q7Z A;  1JWV A;  3M6H A;  3OZH A;  3UPN A;  2ZC6 B;  5GLD A;  4RX2 A;  2EXB A;  3E2K A;  1BLP A;  3PBO A;  3CJM A;  5A90 A;  4PM8 A;  3I7J A;  4RX3 A;  3LCE A;  1TEM A;  3IXG A;  4UAA A;  3OPL A;  2XD1 A;  1XPB A;  4IVI A;  5BOH A;  1CEF A;  3HRE A;  4OOY A;  2I72 A;  4P0M A;  3W4P A;  4Z9Q A;  2WZX A;  2ZC7 A;  3V5M A;  4X56 A;  3VOZ A;  5HW3 A;  3ZVW A;  4ZTK A;  4A5R A;  1K55 A;  4MNR A;  1K57 A;  4KZ3 A;  4OVD A;  1K56 D;  1H5X A;  4R1G A;  4ZBE A;  3SH8 A;  4E3M A;  1IKG A;  5EUA A;  3PBQ A;  4EBL A;  3IH9 A;  1CI8 A;  4GB7 A;  3VP3 A;  3ZFZ A;  3DWK A;  4JPM A;  3SS3 A;  1BLH A;  4EBN A;  3AGF A;  2XH9 A;  2ZM0 A;  1GHM A;  5GHX A;  3Q7V A;  2Y2P A;  3C7U A;  4KZ7 A;  5J8X A;  5CGW A;  2OSU A;  5EVL A;  5HAR A;  3LO7 A;  5FI2 A;  4OOM A;  3N7W A;  3N8R A;  3PAG A;  4GKU A;  4WZ5 A;  1SDE A;  1MKI A;  4M3K A;  2WGW B;  4Y0T A;  3IWO A;  3FKW A;  4EQI A;  4LV0 A;  4RVA A;  1L0G A;  2Y59 A;  3IHA A;  3JYI A;  5CRF A;  2ZM2 A;  1GHP A;  4OLG A;  5I94 A;  1PYY A;  4OKP A;  1BTL A;  2FFY A;  4X69 A;  3B3X A;  2ZQ9 A;  3ZNY A;  1CEG A;  1H8Z A;  1IEM A;  3RXW A;  2ZC5 B;  3E2L A;  2OV5 A;  1C3B A;  4PM5 A;  1VQQ A;  1IYQ A;  1ERM A;  3P09 A;  1W8Y A;  4IVK A;  2ZQD A;  1KE4 A;  1O07 A;  2EFU A;  3PBT A;  3G2Z A;  5CGS A;  1HD8 A;  5GL9 A;  4BL3 A;  1NZU A;  1NY0 A;  3W4O A;  4MBF A;  3O3V A;  4NET A;  4U3T A;  3NBL A;  3NC8 A;  5L2F A;  1BSG A;  1FSW A;  1ONH A;  2WUQ A;  3OC2 A;  1ALQ A;  4JF4 A;  3GV9 A;  1XX2 A;  3GR2 A;  3IXD A;  4OPR A;  3FWL A;  2CC1 A;  3FZC A;  2Q9M A;  3OCL A;  3ITA A;  4CPK A;  4DE0 A;  5KSH A;  3VP0 A;  4IBR A;  2J8Y A;  3LY4 A;  3SH9 A;  2V1Z A;  3LY3 A;  4HBT A;  4UHU A;  3HLC A;  3ZDJ A;  5JYO A;  1CK3 A;  5FQJ A;  5CGX A;  1K57 C;  2JC7 A;  3PBN A;  3V50 A;  4QB8 A;  3PBR A;  1MY8 A;  2WK0 A;  3M6B A;  4S2O A;  1WE4 A;  2EFX A;  3IWI A;  1NYM A;  5E43 A;  5HL1 A;  4MBK A;  1E3U A;  2X01 A;  5CHJ A;  4DE3 A;  1KE0 A;  2Z2M B;  4HES A;  3BFC A;  2BLS A;  1ES3 A;  1K54 A;  1E4D A;  1O7E A;  3UPO A;  4H8R A;  2ZC4 B;  4UA6 A;  1TDL A;  3NIA A;  4Y0O A;  1NYY A;  5F1G A;  3WS0 A;  3C5A A;  4JXS A;  1MWT A;  3W8K A;  5JYP A;  3BFG A;  1K6R A;  1NRF A;  3MZF A;  1K6S A;  3ZG7 B;  1KGE A;  1BLC A;  1RCJ A;  4KZ5 A;  1J9M A;  5FAO A;  4OQH A;  4BLM A;  3G2Y A;  1M40 A;  5DVA A;  3C4P A;  4OQ0 A;  5FQM A;  2X02 A;  1ES4 A;  5KMW A;  2P9V A;  1XXM A;  2XFS A;  1YLT A;  3AGE A;  4S2N C;  4DE1 A;  5E2H A;  1W5D A;  4DDY A;  5TGF A;  3BFD A;  5IHV A;  3ZNT A;  1SCW A;  5CTM A;  5A92 A;  3IF5 A;  4PM9 A;  3DTM A;  3GSG A;  4ZDX A;  4E6W A;  1Z6F A;  1IYS A;  3VSK A;  3VFH A;  1KDW A;  2DCF A;  1YM1 A;  4YIN A;  1SDN A;  3VOY A;  5EE8 A;  3TOI A;  1DJA A;  2XDM A;  1ES5 A;  1JWP A;  1DY6 A;  3UNW A;  1S6R A;  5TR7 A;  5DTK A;  4PM7 A;  4FH2 A;  1GA0 A;  4OP8 A;  1BT5 A;  4QD4 A;  1YLJ A;  1WYB A;  2Y2H A;  1FQG A;  5EVI D;  3UE1 A;  3VP2 A;  4B4X A;  2Y91 A;  1XA1 A;  3V3R A;  3WWX A;  1KVM A;  1GHI A;  4Y0U A;  3BEC A;  3HUO A;  1SHV A;  3NI9 A;  1PIO A;  1I5Q A;  1XGI A;  1ZG4 A;  4FCF A;  5GLC A;  5EVI B;  4E3O A;  3MZE A;  2A49 A;  5E2F A;  4ZAM A;  2GDN A;  4OH0 A;  4N1H A;  4R3J A;  5GHZ A;  5CEC A;  1E3U D;  2ZQ7 A;  1LL9 A;  1K38 A;  4B88 A;  2J9O A;  3SS5 A;  3S4X A;  1PZO A;  5GLA A;  5FAP A;  2HDR A;  2WGW A;  3VP4 A;  1K4F A;  4OON A;  1VM1 A;  4S2J A;  4LV3 A;  3DWZ A;  5HX9 A;  3IWQ A;  4MEZ A;  3V3S A;  4EUZ A;  4KZ6 A;  2ZC3 B;  1WYC A;  3NDE A;  2JE5 A;  1PI4 A;  3BYD A;  2OLV A;  4MBH A;  5HAP A;  1KDS A;  1YLY A;  3HBR A;  5GLB A;  2XD5 A;  4QY6 A;  2E8I A;  2XR0 A;  3G31 A;  1G68 A;  5U47 A;  2ZJ9 A;  3C7V A;  5DF7 A;  3S22 A;  1GA9 A;  2G2U A;  4BQM A;  2Y55 A;  3D4F A;  2XK1 A;  3W4Q A;  5FI6 A;  4C75 A;  4KZ9 A;  2P9V B;  4IBX A;  3BFF A;  4QU3 A;  1SKF A;  1RP5 A;  4KG6 A;  4XUZ A;  1YLZ A;  3O87 A;  3C4O A;  2EX8 A;  3BEB A;  3UDF A;  2C6W B;  5M1A A;  3RJU A;  2IWC A;  4JBF A;  1JTG A;  5CTN A;  4WBG A;  3Q7V B;  2WKH A;  1U60 A;  3VSL A;  1TVF A;  2P74 A;  2WYX A;  1JVJ A;  1K25 A;  4DDS A;  4KEN B;  1JWZ A;  2V20 A;  5M18 A;  3OPH A;  4XUX A;  5AQ9 A;  3UE3 A;  3MZD A;  1PWC A;  3FYZ A;  3OPR A;  4KG5 A;  4UA9 A;  4DXC A;  1YLP A;  3HLF A;  5GHY A;  4OPZ A;  3IT9 A;  3ZG0 A;  1K54 C;  3Q1F A;  5FQI A;  5E2G A;  3ZGA B;  2QMI A;  3HVF A;  4JLF A;  5DTT A;  1L2S A;  1TDG A;  5M19 A;  5FA7 A;  2V2F F;  3DW0 A;  5TFQ A;  2PBY A;  3MXS A;  4Y7P A;  4E3I A;  4U0T A;  3S1Y A;  2R9W A;  2IWD A;  3BM6 A;  5FQQ A;  2DNS A;  4EBP A;  4OQG A;  4P6B A;  3WS2 A;  2Q9N A;  3UY6 A;  2Y4A A;  5FAT A;  1GCE A;  3N8S A;  3M2K A;  3UO9 A;  4L0L A;  1YMS A;  1BUE A;  2FFF B;  3CMZ A;  3WRZ A;  4GD6 A;  4OOL A;  2R9X A;  4C6Y A;  1RGY A;  1W7F A;  3GTC A;  1YMX A;  4BD0 A;  1K56 A;  4FSF A;  1LI9 A;  4JXG A;  5FQK A;  4F94 A;  5CED A;  4X6T A;  2A3U A;  1K55 C;  5FDH A;  5A93 A;  1CI9 A;  1LL5 A;  1PWG A;  4ZJ2 A;  2RL3 A;  5CEB A;  3G35 A;  5EVI C;  3FV7 A;  4EV4 A;  4IED A;  3P98 A;  2ZQ8 A;  1L0F A;  5CHM A;  4N9K A;  5CER A;  1ZKJ A;  4PPR A;  1RGZ A;  5AQA A;  3SS4 A;  2C5W B;  4WEJ A;  3NDG A;  4WMC D;  2J7V A;  3O86 A;  3HUN A;  1PWD A;  1IYO A;  3EQV A;  4DRT A;  3V39 A;  3HLE A;  1FOF A;  3PBS A;  5CXW A;  1FCM A;  1BZA A;  4OLD A;  1YLW A;  1KGG A;  3Q81 A;  3BLS A;  3IXB A;  3G32 A;  4LEN A;  4PM6 A;  1W79 A;  2XFT A;  1EWZ A;  2JCH A;  1K4E A;  2PU4 A;  2XEP A;  4KQQ A;  4GDN A;  3N6I A;  1H8Y A;  3IF6 A;  3SOI A;  1N9B A;  4S2I A;  1MWR A;  4MLL A;  4JKT A;  1YT4 A;  1FR6 A;  1DJB A;  5EEC A;  3O88 A;  1Y54 A;  1XGJ A;  4ZJ3 A;  1ESI A;  1ZG6 A;  3A3J A;  3MBZ A;  3ZG9 B;  3QNB A;  3WS4 A;  4S2L A;  3CZD A;  4GN2 A;  4ZJ1 A;  1OME A;  1M6K A;  1ONG A;  4LV1 A;  4OPY A;  1HVB A;  4KQO A;  4R4S A;  4XXR A;  1QMF A;  1Q2Q A;  4LV2 A;  3IQA A;  3OPP A;  2Y2Q A;  2VGJ A;  4JXW A;  2XLN A;  1ESU A;  5F83 A;  2HP9 A;  1NJ4 A;  2XQZ A;  1KE3 A;  4DXB A;  1MXO A;  4HEF A;  3AGD A;  2WKI A;  4RYE A;  3Q07 A;  2ZQC A;  1FCO A;  2H10 A;  3GQZ A;  5E2E A;  2Y2M A;  3N4I A;  2ZLY A;  1PW8 A;  3GRJ A;  5EOE A;  1NXY A;  3EQU A;  1BLS A;  1G6A A;  2BG1 A;  4QY5 A;  1I2S A;  4K91 A;  3G4P A;  3VMA A;  1LI0 A;  3ZHH A;  2Y2K A;  4DKI A;  4C3Q A;  4R4R A;  5F82 A;  3IF6 B;  4X55 A;  2Y2N A;  3IF6 C;  3G34 A;  4B4Z A;  4DF6 A;  2PU2 A;  4E3N A;  1HTZ A;  5KSC A;  2QPN A;  2EXA A;  4X53 A;  4E3K A;  3HLB A;  3UPP A;  2QZ6 A;  2XGN A;  4BD1 A;  1FCN A;  2HDS A;  4X68 A;  4GNU A;  4WYY A;  3N8L A;  4BJP A;  1FR1 A;  5FSR A;  1N4O A;  2VGK A;  3LEZ A;  3MKF A;  4E3J A;  4QJG A;  1Q2P A;  1MBL A;  4FD8 A;  5HFO A;  5DF9 A;  1MWU A;  2HDQ A;  4JXV A;  4R3B A;  3TSG A;  5EOO A;  2HP6 A;  4UA7 A;  3VFF A;  3IH8 A;  3PTE A;  2Z2L B;  1IEL A;  3M2J A;  3IXH A;  1XA7 A;  1EI5 A;  3UE0 A;  1ERQ A;  5EPH A;  3BFE A;  4S2N A;  3WS5 A;  3ZVT A;  3MXR A;  1ZC2 A;  2Y2O A;  2EX2 A;  5HAQ A;  4R0Q A;  4KQR A;  3CG5 A;  3MKE A;  4N9L A;  4S2M A;  4OQI A;  5DF8 A;  4OPQ A;  4EWF A;  4O7D A;  3HLW A;  1FSY A;  4YFM A;  4GD8 A;  5KZH A;  2HPB A;  4BL2 A;  1BUL A;  1LLB A;  1DJC A;  1ES2 A;  4S2K A;  2Y2J A;  3A3D A;  3GVB A;  5D3O A;  1E25 A;  4DE2 A;  4WMC A;  2IWB A;  2ZQA A;  4U0X A;  4KZB A;  2WAD A;  4P85 A;  5FAQ A;  5G18 A;  4GDB A;  4FH4 A;  2HDU A;  2WKE A;  2Y2L A;  4KG2 A;  3GMW A;  4KZ8 A;  5A91 A;  3NY4 A;  5AQB A;  3PAE A;  2UWX A;  4JF6 A;  2Y2I A;  1PZP A;  3HLD A;  1JTD A;  2WGI A;  2EX9 A;  2X71 A;  3MFD A;  5EVI A;  4S2P A;  2ZM8 A;  3G30 A;  4WZ5 C;  3WS1 A;  2ZMA A;  3ITB A;  4KZA A;  2WAE A;  5FI7 A;  3TG9 A;  2DRW A;  2WZZ A;  2HP5 A;  4LCM A;  1KVL A;  2H0T A;  4K0W A;  1IKI A;  1QME A;  2H0Y A;  4KZ4 A;  4QHC A;  1XKZ A;  1I2W A;  4K0X A;  1AXB A;  4PMA A;  2XF3 A;  4JF5 A;  1HZO A;  4WZ4 A;  3WRT A;  3BLM A;  5CHU A;  3A3E A;  4Q8I A;  4P87 A;  4D2O A;  5AQ7 A;  3FKV A;  4OP5 A;  3ISG A;  1S0W A;  1W8Q A;  2J9P A;  3UDX A;  4E6X A;  3OCN A;  3A3I A;  4GOG A;  2ZD8 A;  1L0D A;  1NZO A;  1MPL A;  3NCK A;  4GZB A;  4ID4 A;  2RCX A;  5FQ9 A;  1LHY A;  4HBU A;  3ZG8 B;  4WEL A;  1MWS A;  3IHB A;  3SH7 A;  3UDI A;  4BEN A;  3BRM A;  2G2W A;  3RXX A;  3Q82 A;  3HL9 A;  4LCL A;  2JBF A;  4RA7 A;  3VP1 A;  4N1X A;  3UN7 A;  3A3F A;  3HUM A;  4WEK A; 
#chains in the Genus database with same CATH topology
 4FUW A;  2WAF A;  1PW1 A;  3QNC A;  4E3L A;  3HLG A;  5DTS A;  1W63 M;  1VEU A;  2PYR A;  2H5S A;  3UPN A;  4Y13 A;  2ZC6 B;  3E2K A;  5DKK A;  1BLP A;  3PBO A;  3CJM A;  4PM8 A;  4L9E A;  3VV4 A;  4CLC E;  4FTX A;  3W4P A;  2ZC7 A;  2VV7 A;  2MJ6 A;  3S7P A;  5AVF A;  1BLH A;  2ZM0 A;  2CMN A;  5GHX A;  3Q7V A;  3C7U A;  4KZ7 A;  3UB6 A;  5FI2 A;  3N7W A;  3E4Q A;  4Q0J A;  1PRQ A;  4M3K A;  4GLQ A;  3UE6 A;  4RVA A;  5CRF A;  2ZM2 A;  1GHP A;  5I94 A;  1PYY A;  4ETZ A;  3BY9 A;  2JHE A;  1BTL A;  2JKT I;  2FFY A;  3B3X A;  1IEM A;  3E2L A;  4PM5 A;  3MR0 A;  3P09 A;  3JVV A;  4KUK A;  2HV1 A;  3PBT A;  3G2Z A;  3SZT A;  1NZU A;  1NY0 A;  4U3T A;  2WUQ A;  4JF4 A;  1XX2 A;  3GR2 A;  3FWL A;  3FZC A;  2Q9M A;  3ITA A;  4DE0 A;  4IBR A;  4WL9 A;  2J8Y A;  2V1Z A;  4HBT A;  5JYO A;  1CK3 A;  5FQJ A;  2JC7 A;  5FDS A;  4YWZ A;  5HSQ A;  2WK0 A;  1WE4 A;  5HL1 A;  5MC7 A;  2J3T C;  3FC7 A;  4HES A;  5IU1 A;  3UPO A;  4MDZ A;  2ZC4 B;  3NIA A;  3UME A;  3C5A A;  1NRF A;  1KGE A;  4KZ5 A;  1J9M A;  5FAO A;  4OQH A;  4BLM A;  1M40 A;  4O01 A;  4OQ0 A;  2P9V A;  3IX4 A;  2Y79 A;  1YLT A;  1VEU B;  4S2N C;  2PD8 A;  4DDY A;  2VZW A;  5A92 A;  2EWW A;  3DTM A;  2GZA A;  3CPT A;  1S4S A;  3EWK A;  1MC0 A;  5HDS A;  3TOI A;  3A0S A;  1ES5 A;  1VB6 A;  3UNW A;  4FH2 A;  5J4E A;  4Y3I A;  2O0Y A;  3UE1 A;  3F1O A;  1XA1 A;  3WWX A;  3CI6 A;  4HQA A;  4Y0U A;  5GLC A;  4NG2 A;  3BW6 A;  3KSI A;  3B47 A;  5E2F A;  4ZAM A;  4OH0 A;  2ACG A;  1N9L A;  2ZQ7 A;  1K38 A;  4B88 A;  2J9O A;  5FAP A;  1Y4O A;  2WGW A;  1VM1 A;  5HX9 A;  1NLY A;  2W3G A;  3DWZ A;  4LV3 A;  4MEZ A;  3V3S A;  4EUZ A;  2JE5 A;  1PI4 A;  3L7H A;  3BYD A;  2W0N A;  2XD5 A;  1OTE A;  2HGV A;  5U47 A;  1OJG A;  1H8M A;  3OLO A;  4H6J B;  3UB9 A;  1GA9 A;  4BQM A;  2Y55 A;  2XK1 A;  2PRF A;  1SKF A;  4KG6 A;  4XUZ A;  3O87 A;  2C6W B;  1JTG A;  2KOI A;  4EUV A;  3Q7V B;  1A0K A;  2PR5 A;  1SKO B;  5M18 A;  2V20 A;  1D06 A;  1YLP A;  3HLF A;  5GHY A;  3Q1F A;  5FQI A;  3HVF A;  1TDG A;  4D60 A;  4E3I A;  3S1Y A;  4I38 A;  3BM6 A;  4EBP A;  4OQG A;  3WS2 A;  2Q9N A;  2Y4A A;  3UO9 A;  3VE3 A;  2A24 B;  3WRZ A;  4DMZ A;  1W7F A;  1YMX A;  1K56 A;  3HCY A;  4JXG A;  4MMN A;  4ZRR A;  4F94 A;  5CED A;  2A3U A;  1K55 C;  5FDH A;  1CI9 A;  4ESP A;  2RL3 A;  3FV7 A;  4EV4 A;  4IED A;  2ZOI A;  1L0F A;  5CHM A;  4HP9 A;  3LFV A;  3SS4 A;  4PPR A;  2HJE A;  1LSV A;  1PWD A;  1IYO A;  3LIC A;  4OLD A;  1KGG A;  5EFW A;  2VX8 A;  3IXB A;  4LEN A;  4PM6 A;  1LSX A;  2XFT A;  2JCH A;  4KQQ A;  3N6I A;  4X1L A;  5EVE A;  2QJ5 A;  1Y54 A;  2O9B A;  4GCZ A;  1ONG A;  1HVB A;  4HP4 A;  1ESU A;  2HP9 A;  2XQZ A;  2V0W A;  4EEP A;  2ZQC A;  3GQZ A;  3CLO A;  5E2E A;  3N4I A;  1NRJ A;  1PW8 A;  1S1Y A;  4HJ3 A;  3ZHH A;  4MN6 A;  2QKP A;  1XJ3 A;  4Z1W A;  4C3Q A;  3MMH A;  4L9G A;  3NUL A;  4X55 A;  3IF6 C;  4B4Z A;  2PU2 A;  5KSC A;  2EXA A;  4X53 A;  3HLB A;  2QZ6 A;  4BD1 A;  1N4O A;  3LEZ A;  4QJG A;  2M7U A;  2B18 A;  5DF9 A;  3SW1 A;  3NEC A;  2HDQ A;  3QP2 A;  3S7O A;  5EOO A;  5I5L A;  1MKM A;  1IEL A;  4PKY A;  3UE0 A;  1ERQ A;  3WS5 A;  3ZVT A;  4S2N A;  3MXR A;  1KOU A;  2VGL M;  3TE8 A;  5HAQ A;  4WLA A;  2JN7 A;  4KQR A;  3MKE A;  5DF8 A;  4EER A;  4UQI M;  5KZH A;  4LFU A;  1ES2 A;  4I5S A;  1ACF A;  1WA9 A;  4GDB A;  4GJ4 A;  1ZHH B;  4FH4 A;  2WKE A;  1TS0 A;  3PAE A;  2UWX A;  2Y2I A;  3H9W A;  3BJN A;  1JTD A;  2WGI A;  2W3F A;  5EVI A;  3WS1 A;  3T4S A;  3ITB A;  3TG9 A;  3BQ8 A;  4IJG A;  3LGO A;  1LSW A;  1QME A;  2OAP 1;  1I2W A;  2ZMF A;  1AXB A;  2E8J A;  2BAS A;  5CHU A;  1P9W A;  3C38 A;  4P87 A;  5AQ7 A;  3RH8 B;  3ISG A;  3PYP A;  4E6X A;  4GOG A;  3JPU A;  1L0D A;  3NCK A;  5FQ9 A;  3SH7 A;  2G2W A;  4LCL A;  2JBF A;  4N1X A;  5HAI A;  1KGF A;  3ZG5 A;  1LT0 A;  4CLC C;  1PI5 A;  5TBM B;  4X25 A;  4R23 A;  5F1F A;  2EX6 A;  1L0E A;  2V8F A;  2Y2G A;  2EXB A;  5A90 A;  3CAX A;  4RX3 A;  1TEM A;  3OPL A;  3W2Z A;  4IVI A;  4OOY A;  2I72 A;  4Z9Q A;  4IUK A;  2K7S A;  3VOZ A;  1H0M A;  4A5R A;  3B33 A;  3GEC A;  4KZ3 A;  4ZBE A;  4R1G A;  5EUA A;  3PBQ A;  3QP8 A;  4BBT A;  5J7E A;  1CI8 A;  1PNE A;  3DWK A;  2XA7 S;  3AGF A;  2XH9 A;  3P7N A;  4DN0 A;  1GHM A;  1TS8 A;  2Y2P A;  3PXP A;  5J8X A;  5CGW A;  2OSU A;  5EVL A;  5HAR A;  2PYP A;  4OOM A;  3N8R A;  4WZ5 A;  3F1N B;  3RFB A;  4Y0T A;  4EQI A;  3IHA A;  3LI8 A;  4OLG A;  1OTD A;  5FEG A;  4BWI A;  5DJT A;  3ZNY A;  3RXW A;  4CQH A;  2ZC5 B;  2D02 A;  1C3B A;  2ZMV A;  3MQO A;  1KE4 A;  1MZU A;  3D72 A;  2H28 A;  4MBF A;  2L4R A;  3O3V A;  5DKL A;  3OC2 A;  1ALQ A;  1YPR A;  3IXD A;  2XA7 M;  4CPK A;  3LY4 A;  3SH9 A;  2Z6D A;  3HLC A;  2W3E A;  1K57 C;  3MS6 A;  4QWO A;  3V50 A;  4QB8 A;  1MY8 A;  3IX8 A;  3M6B A;  4AFI A;  2PAV P;  3IWI A;  1NYM A;  5E43 A;  4MBK A;  5CHJ A;  4X1M A;  4WN5 A;  4UA6 A;  5HWV A;  4Y0O A;  5F1G A;  3A0R A;  3BFG A;  1K6R A;  1K6S A;  4JGO A;  1BLC A;  2V1A A;  1ES4 A;  5KMW A;  2XFS A;  3AGE A;  4P6Z M;  5F6A A;  1W5D A;  2XRO A;  5IHV A;  4ZDX A;  1IYS A;  3VSK A;  2DCF A;  4YIN A;  3VOY A;  5F5Y A;  1DY6 A;  5G4Z A;  3FG8 A;  3MJQ A;  3NHQ A;  3R4K A;  4PM7 A;  4OP8 A;  4QD4 A;  3UB8 A;  4B4X A;  3BEC A;  3NI9 A;  1PIO A;  1XGI A;  4Y2F A;  3MZE A;  2A49 A;  2GDN A;  1P9R A;  4R3J A;  3TW8 A;  1DP8 A;  1OJ5 A;  2L0W A;  3S4X A;  1PZO A;  5GLA A;  2M7V A;  4S2J A;  3IWQ A;  5L07 A;  2OWJ A;  2E8I A;  4NEE D;  2XR0 A;  3G31 A;  1G68 A;  3C7V A;  3S22 A;  3D4F A;  3KO6 A;  3W4Q A;  4C75 A;  3T50 A;  3KYZ A;  3LIA A;  3BEB A;  2W3D A;  3S7N A;  3UDF A;  1G5U A;  2WKH A;  1H3Q A;  1U60 A;  3VSL A;  1TVF A;  2P74 A;  1JVJ A;  4YNR A;  2Z6C A;  4KEN B;  4HIA A;  1JWZ A;  1AWI A;  4XUX A;  3UE3 A;  3MZD A;  4UA9 A;  3IT9 A;  5E2G A;  3K3C A;  1JNU A;  5TFQ A;  3MXS A;  4U0T A;  5FQQ A;  2JKG A;  4HOI A;  5FAT A;  3N8S A;  2WKQ A;  4L0L A;  4O8G A;  3FPW A;  3VOL A;  5HWW A;  4BD0 A;  4FSF A;  2B95 A;  3T4O A;  1OT9 A;  3QP4 A;  4X6T A;  3UB7 A;  5CEB A;  4DJ2 A;  3P98 A;  2ZQ8 A;  3LIE A;  3C2W A;  1ZKJ A;  3T1S A;  1TS6 A;  1YAX A;  3ZQ5 A;  2PT7 A;  4IUH A;  2Q0O A;  4DRT A;  1FOF A;  1YLW A;  3Q81 A;  1W79 A;  2XEP A;  2VV6 A;  3SOI A;  3IF6 A;  1N9B A;  5HD5 A;  4PHT A;  4LRY C;  4MLL A;  2A24 A;  1CF0 A;  4CLC B;  2QJ7 A;  3O88 A;  1EW0 A;  3A3J A;  4CLC D;  4KQO A;  1CJF A;  4R4S A;  4LV2 A;  3IQA A;  2VGJ A;  5F83 A;  1KE3 A;  3AGD A;  1FCO A;  2ZLY A;  1NXY A;  2BG1 A;  3VMA A;  3DBA A;  4LGW A;  4UEY A;  3IF6 B;  3IS2 B;  1V9Y A;  3G34 A;  4E3N A;  3ZYT A;  3DTI A;  4E3K A;  3E4O A;  3UPP A;  2XGN A;  2HDS A;  3H7W B;  4X68 A;  3N8L A;  4E3J A;  2AVX A;  2KDK A;  5HFO A;  4EQ1 A;  1BYW A;  5HPF A;  2HP6 A;  2Z2L B;  3U4L P;  2WKP A;  3BFE A;  4EWF A;  3HLW A;  4YFM A;  4GD8 A;  4KUO A;  3T4K A;  1BUL A;  2W3H A;  3A3D A;  3GVB A;  2ZQA A;  2WAD A;  5FAQ A;  2HDU A;  4KZ8 A;  5AQB A;  4IHQ A;  4ETX A;  2O9A A;  3F1O B;  3MQ0 A;  2VV8 A;  3T12 B;  2ZMA A;  1KVL A;  2H0T A;  4Y17 A;  4K0W A;  4KZ4 A;  4QHC A;  4K0X A;  1HZO A;  4WZ4 A;  1NWZ A;  3WRT A;  3BLM A;  3A3E A;  3FKV A;  5G4Y A;  5C5K A;  2OOL A;  3DTK A;  1NZO A;  4ID4 A;  4HBU A;  1DP9 A;  1MWS A;  3UN7 A;  3A3F A;  3HUM A;  4WEK A;  2OLU A;  4WM9 A;  1XJ4 A;  3MF0 A;  1YSP A;  4XT2 A;  3U2A A;  1ERO A;  2B5R A;  1YQS A;  3ZCZ A;  4NK3 A;  4CJN A;  3Q7Z A;  1JWV A;  1OTA A;  5GLD A;  1GSW A;  3I7J A;  3LCE A;  2XD1 A;  5HDD A;  1CEF A;  3HRE A;  1IOU A;  2UV0 E;  3V5M A;  4MNR A;  4GS9 A;  1GSV A;  2I9V A;  2P08 A;  4O0P A;  3SH8 A;  2OAQ 1;  4E3M A;  1IKG A;  2R78 A;  4EBL A;  3VP3 A;  4JPM A;  2V8C A;  4PAU A;  2G7U A;  3PAG A;  4GKU A;  3LR3 A;  1T18 A;  2WGW B;  3IWO A;  2W27 A;  1T1B A;  3NOP C;  4LV0 A;  5EV0 A;  1L0G A;  4DJ3 A;  1OTB A;  3EGD C;  4OKP A;  4X69 A;  3IBR A;  2ZQ9 A;  1CEG A;  1H8Z A;  1VQQ A;  4LLO B;  1YSQ A;  4IVK A;  2ZQD A;  1TF1 A;  5CGS A;  3W4O A;  4NET A;  4UQI S;  3NBL A;  1ONH A;  4I3A A;  3GV9 A;  4OPR A;  2CC1 A;  2VGL S;  3OCL A;  2QWS A;  4II7 A;  3LY3 A;  4HJ4 A;  5AJG A;  1P0Z A;  4UHU A;  3ZDJ A;  5EM0 A;  4YOF A;  2VJW A;  3PBN A;  4EU0 A;  3PBR A;  1PFL A;  4S2O A;  2V1B A;  1E3U A;  3F1P B;  1KE0 A;  3V67 A;  3BFC A;  1ES3 A;  1K54 A;  4R6L A;  1E4D A;  1LL8 A;  1TDL A;  5DJU A;  1NYY A;  3WS0 A;  5JYP A;  3MZF A;  3ZG7 B;  1W63 Q;  1RCJ A;  3G2Y A;  3C4P A;  2JKF A;  4DE1 A;  4I3I A;  3QP6 A;  5L10 A;  5TGF A;  2ZOH A;  3BFD A;  3ZNT A;  2XSS A;  5CTM A;  5HZH A;  4PM9 A;  2B02 A;  4E6W A;  1Z6F A;  2KX6 A;  1KDW A;  1SDN A;  3T4L A;  2O99 A;  2XDM A;  1S6R A;  5TR7 A;  5DTK A;  2JKR I;  1GA0 A;  1BT5 A;  1F5M A;  1WYB A;  5EVI D;  4HI4 A;  2Y91 A;  3V3R A;  2IA2 A;  1GHI A;  3CWF A;  3HUO A;  1I5Q A;  1ZG4 A;  4E3O A;  5EVI B;  4JGR A;  3H82 B;  4N1H A;  4MN5 A;  3SS5 A;  2VLG A;  4OON A;  4Y5F A;  5HD3 A;  1OT6 A;  3CUE A;  2ZC3 B;  3QP5 A;  2FH5 A;  2OLV A;  1F2K A;  3C30 A;  5HAP A;  5GLB A;  3D3O A;  4QY6 A;  5DFX A;  4B93 A;  5DF7 A;  4QPR A;  3MXQ A;  5FI6 A;  4H6J A;  2P9V B;  3L9K A;  4IBX A;  1UWP X;  3BFF A;  4P6Z S;  3TJZ C;  1YLZ A;  3C4O A;  4GW9 A;  5IS1 A;  5CTN A;  1S66 L;  2LB5 A;  3O5Y A;  5AQ9 A;  1TD5 A;  4HH2 A;  1PWC A;  4DXC A;  1VHM A;  4OPZ A;  3ZG0 A;  2EA9 A;  3MFX A;  5M19 A;  5FA7 A;  2V2F F;  3IS2 A;  2PBY A;  3E0Y A;  2R9W A;  1V9Z A;  4P6B A;  4WUJ A;  1IFQ A;  1GCE A;  1BUE A;  3CMZ A;  4ARZ B;  5F68 A;  3LR4 A;  4C6Y A;  2Y8H A;  1G28 A;  3RTY A;  3GTC A;  2GJ3 A;  1VET A;  4EW7 A;  5A93 A;  1LL5 A;  4ZJ2 A;  5EVI C;  5EM1 A;  4N9K A;  5CER A;  1RGZ A;  3TRC A;  3KSH A;  3NDG A;  4RQ9 A;  1G6O A;  4WMC D;  3O86 A;  1N9N A;  3EQV A;  3ULF A;  3V39 A;  3PBS A;  5CXW A;  1J3W A;  1FCM A;  3BQA A;  3BLS A;  1H8Y A;  4L9F A;  1Y28 A;  2HJ9 C;  1YT4 A;  1DJB A;  5EEC A;  1ESI A;  1ZG6 A;  3MBZ A;  3PHY A;  3WS4 A;  4S2L A;  3CZD A;  4GN2 A;  4ZJ1 A;  1OME A;  1M6K A;  4LV1 A;  2GNX A;  4OPY A;  4XXR A;  1QMF A;  2Y2Q A;  2XLN A;  2VKS A;  4DXB A;  1MXO A;  4HEF A;  4RYE A;  3Q07 A;  2Y2M A;  2HZ5 A;  5EOE A;  3EQU A;  1BLS A;  1G6A A;  4QY5 A;  1I2S A;  1S67 L;  2Y2K A;  4DKI A;  4M4X A;  5HL6 A;  4R4R A;  5F82 A;  4DF6 A;  2QPN A;  3LIB A;  1FCN A;  4BJP A;  4GNU A;  2VGK A;  4CLC A;  1MBL A;  3KYE A;  5HWT A;  3T1R A;  2W1R A;  2K31 A;  4GHI B;  4JXV A;  3TSG A;  2YKF A;  2WKR A;  4UA7 A;  3VFF A;  3IH8 A;  2VA0 A;  1XA7 A;  3K2N A;  1EI5 A;  4XT2 B;  1DP6 A;  5A8B A;  4R0Q A;  3GDI A;  3CG5 A;  4N9L A;  4S2M A;  1F98 A;  1ZTU A;  4OQI A;  4O7D A;  3JVU A;  4BL2 A;  1LLB A;  2OWH A;  1DJC A;  4S2K A;  2XRN A;  1X0O A;  4DE2 A;  4EES A;  2IWB A;  4KZB A;  5G18 A;  3LYX A;  1VET B;  5A91 A;  4KQD A;  4S2P A;  2ZM8 A;  3G30 A;  4WZ5 C;  5FI7 A;  2WAE A;  2KLI A;  2DRW A;  2HP5 A;  5F69 A;  2H0Y A;  5TJJ A;  3T1X A;  1XKZ A;  3PR6 A;  2NUT C;  2QYB A;  3D9Y A;  3R7W A;  4D2O A;  4OP5 A;  2J9P A;  3OCN A;  3A3I A;  5LBR A;  2ZD8 A;  2RCX A;  4BEN A;  3BRM A;  5L8M A;  3RXX A;  1HLU P;  1XJ6 A;  2J3W A;  4RA7 A;  3VP1 A;  3H82 A;  1S4R A;  4F3L A;  3SS3 A;  1IYP A;  5FL3 A;  4N92 A;  1OTI A;  2W1T A;  3LR0 A;  2WGV A;  1XP4 A;  3QHY A;  5FAS A;  3IBJ A;  3M6H A;  3OZH A;  4RX2 A;  4B9O A;  3IXG A;  4UAA A;  4BBV A;  3DTE A;  3KSF A;  1XPB A;  5BOH A;  3MSH A;  3KYQ A;  4P0M A;  4EEU A;  2WZX A;  4X56 A;  4G3K A;  5HW3 A;  3ZVW A;  4ZTK A;  1K55 A;  1K57 A;  4OVD A;  1K56 D;  1H5X A;  4EET B;  3IH9 A;  4GB7 A;  3ZFZ A;  3T1Q B;  4EBN A;  4R70 A;  3UB5 P;  3LO7 A;  3ICY A;  1SDE A;  1MKI A;  2YKH A;  3FKW A;  2Y59 A;  3JYI A;  2JKR M;  1CQA A;  3T4Q A;  1STZ A;  4K08 A;  1F9I A;  2OV5 A;  1IYQ A;  1ERM A;  1W8Y A;  3HJI A;  5HPI A;  1O07 A;  2JKT M;  2EFU A;  2FZ0 A;  1T1A A;  1HD8 A;  5GL9 A;  4BL3 A;  1P97 A;  5L2F A;  3NC8 A;  1BSG A;  1FSW A;  3LIF A;  4Q0H A;  3OOV A;  5KSH A;  3VP0 A;  5FEF A;  3LUQ A;  4GHI A;  2DMW A;  2HF6 A;  4HH3 A;  5CGX A;  3B42 A;  3F1P A;  4NXF A;  2VEA A;  3CPT B;  2EFX A;  1S1Z A;  3FPV A;  2X01 A;  4DE3 A;  2Z2M B;  4LRZ E;  2BLS A;  3VE4 A;  1O7E A;  3LR5 A;  4H8R A;  4JXS A;  1MWT A;  3W8K A;  4G3V A;  1XFN A;  2W1T B;  3K3D A;  5DVA A;  4BBU A;  1FIK A;  5FQM A;  2X02 A;  3UMD A;  1XXM A;  4FOF A;  2NUP C;  5E2H A;  5L09 A;  3MQQ A;  1SCW A;  3IF5 A;  3GSG A;  5IT5 A;  3VFH A;  3EEA A;  1YM1 A;  3P01 A;  5EE8 A;  1DJA A;  4LPZ A;  1JWP A;  1YLJ A;  2Y2H A;  1FQG A;  3VP2 A;  1KVM A;  1SHV A;  4FCF A;  4MN7 A;  4F3L B;  5GHZ A;  2ZBB A;  5CEC A;  1E3U D;  4R38 A;  1LL9 A;  1NLZ A;  3NOU C;  4NXE A;  4PKY G;  2HDR A;  4G3W A;  3VP4 A;  1K4F A;  4KZ6 A;  1WYC A;  3NDE A;  3R7W B;  4MBH A;  3DAV A;  1KDS A;  1YLY A;  3HBR A;  4NXG A;  4ME4 A;  1T1C A;  2ZJ9 A;  3CHW P;  2PD7 A;  2G2U A;  3QP1 A;  4KZ9 A;  4QU3 A;  1RP5 A;  2EX8 A;  3NOT C;  5M1A A;  3RJU A;  2IWC A;  4JBF A;  4WBG A;  2WYX A;  1K25 A;  1K0K A;  5J3W A;  4DDS A;  3OPH A;  4HHD A;  3FYZ A;  3OPR A;  4KG5 A;  4HJ6 A;  3T4T A;  1K54 C;  3ZGA B;  2QMI A;  4JLF A;  5DTT A;  1L2S A;  3DW0 A;  4Y7P A;  2IWD A;  1D7E A;  2BTF P;  2DNS A;  2PHY A;  3UY6 A;  3S7Q A;  3M2K A;  1YMS A;  2FFF B;  3HJK A;  4GD6 A;  4OOL A;  2R9X A;  3CUE C;  2EWV A;  1RGY A;  4HNB A;  2P04 A;  1LI9 A;  4BMW A;  2L1M A;  5FQK A;  3F1N A;  1YKD A;  2O9C A;  1PWG A;  3G35 A;  2A2L A;  5HDC A;  5CX7 A;  3LI9 A;  5AQA A;  2P7J A;  2C5W B;  4WEJ A;  1T19 A;  3A0V A;  2J7V A;  3HUN A;  3HLE A;  4Y15 A;  1BZA A;  1FIL A;  3G32 A;  4LRX C;  1EWZ A;  1K4E A;  2PU4 A;  4GDN A;  1D1J A;  4S2I A;  1MWR A;  4JKT A;  1FR6 A;  4ZJ3 A;  1XGJ A;  3ZG9 B;  3QNB A;  2V0U A;  4JGP A;  4NKP A;  3EOI A;  1Q2Q A;  3OPP A;  3T4J A;  2VK3 A;  4JXW A;  5TBM A;  1NJ4 A;  2WKI A;  2H10 A;  1DRM A;  3GRJ A;  1OPX A;  3G6O A;  1ODV A;  3EEH A;  3G4P A;  4K91 A;  1LI0 A;  1UGU A;  3KX0 X;  1SZV A;  2Y2N A;  3EGX C;  1HTZ A;  5K5B A;  4WYY A;  1FR1 A;  5FSR A;  3E4P A;  3MKF A;  2PBD P;  5AVE A;  1Q2P A;  3LID A;  4FD8 A;  2K2N A;  3OBF A;  4ARZ A;  1MWU A;  4WF0 A;  3E98 A;  4EXO A;  4R3B A;  1SKO A;  4I39 A;  3PTE A;  5KIZ A;  3M2J A;  1L3L A;  3IXH A;  3LEQ A;  5EPH A;  2QHK A;  1ZC2 A;  2Y2O A;  2EX2 A;  2J80 A;  1XFQ A;  3KSG A;  4OPQ A;  2D01 A;  1FSY A;  1GSX A;  2J3T D;  1Z09 A;  2HPB A;  2Y2J A;  5D3O A;  1E25 A;  4WMC A;  2ZL1 B;  4U0X A;  4P85 A;  2Y2L A;  1XJ2 A;  4KG2 A;  3GMW A;  3NY4 A;  4MCW A;  4JF6 A;  1PZP A;  3HLD A;  2EX9 A;  2X71 A;  3MFD A;  4KZA A;  2WZZ A;  4LCM A;  2INW A;  3BY8 A;  1IKI A;  2GX5 A;  3IX3 A;  4Q0I A;  1UWN X;  2V9A A;  4PMA A;  2XF3 A;  4JF5 A;  1TS7 A;  2M1C A;  2PDR A;  2PR6 A;  4Q8I A;  3BWL A;  1S0W A;  1W8Q A;  3H7W A;  3UDX A;  4JGQ A;  4NXB A;  4GS9 B;  1MPL A;  2ZL1 A;  4GZB A;  1LHY A;  3ZG8 B;  3C8C A;  4WEL A;  3IHB A;  4HY8 A;  5DFY A;  3UDI A;  4I3J A;  3Q82 A;  3HL9 A;  4R3A A;  4E04 A;  3CIT A;  1N9O A;  3NJA A;  2LB9 A; 
#chains in the Genus database with same CATH homology
 2WAF A;  5HAI A;  1IYP A;  2OLU A;  1PW1 A;  4WM9 A;  1KGF A;  3ZG5 A;  3QNC A;  4E3L A;  4N92 A;  3HLG A;  1ERO A;  1PI5 A;  2WGV A;  4R23 A;  5DTS A;  2B5R A;  1XP4 A;  5F1F A;  1YQS A;  2EX6 A;  3ZCZ A;  1L0E A;  4NK3 A;  2Y2G A;  3QHY A;  2H5S A;  4CJN A;  5FAS A;  3Q7Z A;  1JWV A;  3M6H A;  3OZH A;  3UPN A;  2ZC6 B;  5GLD A;  4RX2 A;  2EXB A;  3E2K A;  1BLP A;  3PBO A;  3CJM A;  5A90 A;  4PM8 A;  3I7J A;  4RX3 A;  3LCE A;  1TEM A;  3IXG A;  4UAA A;  3OPL A;  2XD1 A;  1XPB A;  4IVI A;  5BOH A;  1CEF A;  3HRE A;  4OOY A;  2I72 A;  4P0M A;  3W4P A;  4Z9Q A;  2WZX A;  2ZC7 A;  3V5M A;  4X56 A;  3VOZ A;  5HW3 A;  3ZVW A;  4ZTK A;  4A5R A;  1K55 A;  4MNR A;  1K57 A;  4KZ3 A;  4OVD A;  1K56 D;  1H5X A;  4R1G A;  4ZBE A;  3SH8 A;  4E3M A;  1IKG A;  5EUA A;  3PBQ A;  4EBL A;  3IH9 A;  1CI8 A;  4GB7 A;  3VP3 A;  3ZFZ A;  3DWK A;  4JPM A;  3SS3 A;  1BLH A;  4EBN A;  3AGF A;  2XH9 A;  2ZM0 A;  1GHM A;  5GHX A;  3Q7V A;  2Y2P A;  3C7U A;  4KZ7 A;  5J8X A;  5CGW A;  2OSU A;  5EVL A;  5HAR A;  3LO7 A;  5FI2 A;  4OOM A;  3N7W A;  3N8R A;  3PAG A;  4GKU A;  4WZ5 A;  1SDE A;  1MKI A;  4M3K A;  2WGW B;  4Y0T A;  3IWO A;  3FKW A;  4EQI A;  4LV0 A;  4RVA A;  1L0G A;  2Y59 A;  3IHA A;  3JYI A;  5CRF A;  2ZM2 A;  1GHP A;  4OLG A;  5I94 A;  1PYY A;  4OKP A;  1BTL A;  2FFY A;  4X69 A;  3B3X A;  2ZQ9 A;  3ZNY A;  1CEG A;  1H8Z A;  1IEM A;  3RXW A;  2ZC5 B;  3E2L A;  2OV5 A;  1C3B A;  4PM5 A;  1VQQ A;  1IYQ A;  1ERM A;  3P09 A;  1W8Y A;  4IVK A;  2ZQD A;  1KE4 A;  1O07 A;  2EFU A;  3PBT A;  3G2Z A;  5CGS A;  1HD8 A;  5GL9 A;  4BL3 A;  1NZU A;  1NY0 A;  3W4O A;  4MBF A;  3O3V A;  4NET A;  4U3T A;  3NBL A;  3NC8 A;  5L2F A;  1BSG A;  1FSW A;  1ONH A;  2WUQ A;  3OC2 A;  1ALQ A;  4JF4 A;  3GV9 A;  1XX2 A;  3GR2 A;  3IXD A;  4OPR A;  3FWL A;  2CC1 A;  3FZC A;  2Q9M A;  3OCL A;  3ITA A;  4CPK A;  4DE0 A;  5KSH A;  3VP0 A;  4IBR A;  2J8Y A;  3LY4 A;  3SH9 A;  2V1Z A;  3LY3 A;  4HBT A;  4UHU A;  3HLC A;  3ZDJ A;  5JYO A;  1CK3 A;  5FQJ A;  5CGX A;  1K57 C;  2JC7 A;  3PBN A;  3V50 A;  4QB8 A;  3PBR A;  1MY8 A;  2WK0 A;  3M6B A;  4S2O A;  1WE4 A;  2EFX A;  3IWI A;  1NYM A;  5E43 A;  5HL1 A;  4MBK A;  1E3U A;  2X01 A;  5CHJ A;  4DE3 A;  1KE0 A;  2Z2M B;  4HES A;  3BFC A;  2BLS A;  1ES3 A;  1K54 A;  1E4D A;  1O7E A;  3UPO A;  4H8R A;  2ZC4 B;  4UA6 A;  1TDL A;  3NIA A;  4Y0O A;  1NYY A;  5F1G A;  3WS0 A;  3C5A A;  4JXS A;  1MWT A;  3W8K A;  5JYP A;  3BFG A;  1K6R A;  1NRF A;  3MZF A;  1K6S A;  3ZG7 B;  1KGE A;  1BLC A;  1RCJ A;  4KZ5 A;  1J9M A;  5FAO A;  4OQH A;  4BLM A;  3G2Y A;  1M40 A;  5DVA A;  3C4P A;  4OQ0 A;  5FQM A;  2X02 A;  1ES4 A;  5KMW A;  2P9V A;  1XXM A;  2XFS A;  1YLT A;  3AGE A;  4S2N C;  4DE1 A;  5E2H A;  1W5D A;  4DDY A;  5TGF A;  3BFD A;  5IHV A;  3ZNT A;  1SCW A;  5CTM A;  5A92 A;  3IF5 A;  4PM9 A;  3DTM A;  3GSG A;  4ZDX A;  4E6W A;  1Z6F A;  1IYS A;  3VSK A;  3VFH A;  1KDW A;  2DCF A;  1YM1 A;  4YIN A;  1SDN A;  3VOY A;  5EE8 A;  3TOI A;  1DJA A;  2XDM A;  1ES5 A;  1JWP A;  1DY6 A;  3UNW A;  1S6R A;  5TR7 A;  5DTK A;  4PM7 A;  4FH2 A;  1GA0 A;  4OP8 A;  1BT5 A;  4QD4 A;  1YLJ A;  1WYB A;  2Y2H A;  1FQG A;  5EVI D;  3UE1 A;  3VP2 A;  4B4X A;  2Y91 A;  1XA1 A;  3V3R A;  3WWX A;  1KVM A;  1GHI A;  4Y0U A;  3BEC A;  3HUO A;  1SHV A;  3NI9 A;  1PIO A;  1I5Q A;  1XGI A;  1ZG4 A;  4FCF A;  5GLC A;  5EVI B;  4E3O A;  3MZE A;  2A49 A;  5E2F A;  4ZAM A;  2GDN A;  4OH0 A;  4N1H A;  4R3J A;  5GHZ A;  5CEC A;  1E3U D;  2ZQ7 A;  1LL9 A;  1K38 A;  4B88 A;  2J9O A;  3SS5 A;  3S4X A;  1PZO A;  5GLA A;  5FAP A;  2HDR A;  2WGW A;  3VP4 A;  1K4F A;  4OON A;  1VM1 A;  4S2J A;  4LV3 A;  3DWZ A;  5HX9 A;  3IWQ A;  4MEZ A;  3V3S A;  4EUZ A;  4KZ6 A;  2ZC3 B;  1WYC A;  3NDE A;  2JE5 A;  1PI4 A;  3BYD A;  2OLV A;  4MBH A;  5HAP A;  1KDS A;  1YLY A;  3HBR A;  5GLB A;  2XD5 A;  4QY6 A;  2E8I A;  2XR0 A;  3G31 A;  1G68 A;  5U47 A;  2ZJ9 A;  3C7V A;  5DF7 A;  3S22 A;  1GA9 A;  2G2U A;  4BQM A;  2Y55 A;  3D4F A;  2XK1 A;  3W4Q A;  5FI6 A;  4C75 A;  4KZ9 A;  2P9V B;  4IBX A;  3BFF A;  4QU3 A;  1SKF A;  1RP5 A;  4KG6 A;  4XUZ A;  1YLZ A;  3O87 A;  3C4O A;  2EX8 A;  3BEB A;  3UDF A;  2C6W B;  5M1A A;  3RJU A;  2IWC A;  4JBF A;  1JTG A;  5CTN A;  4WBG A;  3Q7V B;  2WKH A;  1U60 A;  3VSL A;  1TVF A;  2P74 A;  2WYX A;  1JVJ A;  1K25 A;  4DDS A;  4KEN B;  1JWZ A;  2V20 A;  5M18 A;  3OPH A;  4XUX A;  5AQ9 A;  3UE3 A;  3MZD A;  1PWC A;  3FYZ A;  3OPR A;  4KG5 A;  4UA9 A;  4DXC A;  1YLP A;  3HLF A;  5GHY A;  4OPZ A;  3IT9 A;  3ZG0 A;  1K54 C;  3Q1F A;  5FQI A;  5E2G A;  3ZGA B;  2QMI A;  3HVF A;  4JLF A;  5DTT A;  1L2S A;  1TDG A;  5M19 A;  5FA7 A;  2V2F F;  3DW0 A;  5TFQ A;  2PBY A;  3MXS A;  4Y7P A;  4E3I A;  4U0T A;  3S1Y A;  2R9W A;  2IWD A;  3BM6 A;  5FQQ A;  2DNS A;  4EBP A;  4OQG A;  4P6B A;  3WS2 A;  2Q9N A;  3UY6 A;  2Y4A A;  5FAT A;  1GCE A;  3N8S A;  3M2K A;  3UO9 A;  4L0L A;  1YMS A;  1BUE A;  2FFF B;  3CMZ A;  3WRZ A;  4GD6 A;  4OOL A;  2R9X A;  4C6Y A;  1RGY A;  1W7F A;  3GTC A;  1YMX A;  4BD0 A;  1K56 A;  4FSF A;  1LI9 A;  4JXG A;  5FQK A;  4F94 A;  5CED A;  4X6T A;  2A3U A;  1K55 C;  5FDH A;  5A93 A;  1CI9 A;  1LL5 A;  1PWG A;  4ZJ2 A;  2RL3 A;  5CEB A;  3G35 A;  5EVI C;  3FV7 A;  4EV4 A;  4IED A;  3P98 A;  2ZQ8 A;  1L0F A;  5CHM A;  4N9K A;  5CER A;  1ZKJ A;  4PPR A;  1RGZ A;  5AQA A;  3SS4 A;  2C5W B;  4WEJ A;  3NDG A;  4WMC D;  2J7V A;  3O86 A;  3HUN A;  1PWD A;  1IYO A;  3EQV A;  4DRT A;  3V39 A;  3HLE A;  1FOF A;  3PBS A;  5CXW A;  1FCM A;  1BZA A;  4OLD A;  1YLW A;  1KGG A;  3Q81 A;  3BLS A;  3IXB A;  3G32 A;  4LEN A;  4PM6 A;  1W79 A;  2XFT A;  1EWZ A;  2JCH A;  1K4E A;  2PU4 A;  2XEP A;  4KQQ A;  4GDN A;  3N6I A;  1H8Y A;  3IF6 A;  3SOI A;  1N9B A;  4S2I A;  1MWR A;  4MLL A;  4JKT A;  1YT4 A;  1FR6 A;  1DJB A;  5EEC A;  3O88 A;  1Y54 A;  1XGJ A;  4ZJ3 A;  1ESI A;  1ZG6 A;  3A3J A;  3MBZ A;  3ZG9 B;  3QNB A;  3WS4 A;  4S2L A;  3CZD A;  4GN2 A;  4ZJ1 A;  1OME A;  1M6K A;  1ONG A;  4LV1 A;  4OPY A;  1HVB A;  4KQO A;  4R4S A;  4XXR A;  1QMF A;  1Q2Q A;  4LV2 A;  3IQA A;  3OPP A;  2Y2Q A;  2VGJ A;  4JXW A;  2XLN A;  1ESU A;  5F83 A;  2HP9 A;  1NJ4 A;  2XQZ A;  1KE3 A;  4DXB A;  1MXO A;  4HEF A;  3AGD A;  2WKI A;  4RYE A;  3Q07 A;  2ZQC A;  1FCO A;  2H10 A;  3GQZ A;  5E2E A;  2Y2M A;  3N4I A;  2ZLY A;  1PW8 A;  3GRJ A;  5EOE A;  1NXY A;  3EQU A;  1BLS A;  1G6A A;  2BG1 A;  4QY5 A;  1I2S A;  4K91 A;  3G4P A;  3VMA A;  1LI0 A;  3ZHH A;  2Y2K A;  4DKI A;  4C3Q A;  4R4R A;  5F82 A;  3IF6 B;  4X55 A;  2Y2N A;  3IF6 C;  3G34 A;  4B4Z A;  4DF6 A;  2PU2 A;  4E3N A;  1HTZ A;  5KSC A;  2QPN A;  2EXA A;  4X53 A;  4E3K A;  3HLB A;  3UPP A;  2QZ6 A;  2XGN A;  4BD1 A;  1FCN A;  2HDS A;  4X68 A;  4GNU A;  4WYY A;  3N8L A;  4BJP A;  1FR1 A;  5FSR A;  1N4O A;  2VGK A;  3LEZ A;  3MKF A;  4E3J A;  4QJG A;  1Q2P A;  1MBL A;  4FD8 A;  5HFO A;  5DF9 A;  1MWU A;  2HDQ A;  4JXV A;  4R3B A;  3TSG A;  5EOO A;  2HP6 A;  4UA7 A;  3VFF A;  3IH8 A;  3PTE A;  2Z2L B;  1IEL A;  3M2J A;  3IXH A;  1XA7 A;  1EI5 A;  3UE0 A;  1ERQ A;  5EPH A;  3BFE A;  4S2N A;  3WS5 A;  3ZVT A;  3MXR A;  1ZC2 A;  2Y2O A;  2EX2 A;  5HAQ A;  4R0Q A;  4KQR A;  3CG5 A;  3MKE A;  4N9L A;  4S2M A;  4OQI A;  5DF8 A;  4OPQ A;  4EWF A;  4O7D A;  3HLW A;  1FSY A;  4YFM A;  4GD8 A;  5KZH A;  2HPB A;  4BL2 A;  1BUL A;  1LLB A;  1DJC A;  1ES2 A;  4S2K A;  2Y2J A;  3A3D A;  3GVB A;  5D3O A;  1E25 A;  4DE2 A;  4WMC A;  2IWB A;  2ZQA A;  4U0X A;  4KZB A;  2WAD A;  4P85 A;  5FAQ A;  5G18 A;  4GDB A;  4FH4 A;  2HDU A;  2WKE A;  2Y2L A;  4KG2 A;  3GMW A;  4KZ8 A;  5A91 A;  3NY4 A;  5AQB A;  3PAE A;  2UWX A;  4JF6 A;  2Y2I A;  1PZP A;  3HLD A;  1JTD A;  2WGI A;  2EX9 A;  2X71 A;  3MFD A;  5EVI A;  4S2P A;  2ZM8 A;  3G30 A;  4WZ5 C;  3WS1 A;  2ZMA A;  3ITB A;  4KZA A;  2WAE A;  5FI7 A;  3TG9 A;  2DRW A;  2WZZ A;  2HP5 A;  4LCM A;  1KVL A;  2H0T A;  4K0W A;  1IKI A;  1QME A;  2H0Y A;  4KZ4 A;  4QHC A;  1XKZ A;  1I2W A;  4K0X A;  1AXB A;  4PMA A;  2XF3 A;  4JF5 A;  1HZO A;  4WZ4 A;  3WRT A;  3BLM A;  5CHU A;  3A3E A;  4Q8I A;  4P87 A;  4D2O A;  5AQ7 A;  3FKV A;  4OP5 A;  3ISG A;  1S0W A;  1W8Q A;  2J9P A;  3UDX A;  4E6X A;  3OCN A;  3A3I A;  4GOG A;  2ZD8 A;  1L0D A;  1NZO A;  1MPL A;  3NCK A;  4GZB A;  4ID4 A;  2RCX A;  5FQ9 A;  1LHY A;  4HBU A;  3ZG8 B;  4WEL A;  1MWS A;  3IHB A;  3SH7 A;  3UDI A;  4BEN A;  3BRM A;  2G2W A;  3RXX A;  3Q82 A;  3HL9 A;  4LCL A;  2JBF A;  4RA7 A;  3VP1 A;  4N1X A;  3UN7 A;  3A3F A;  3HUM A;  4WEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...