3BYDA

Crystal structure of beta-lactamase oxy-1-1 from klebsiella oxytoca
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
DAIQQKLADLEKRSGGRLGVALINTADDSQTLYRGDERFAMCSTGKVMAAAAVLKQSESNPEVVNKRLEIKKSDLVVWSPITEKHLQSGMTLAELSAAALQYSDNTAMNKMISYLGGPEKVTAFAQSIGDVTFRLDRTEPALNSAIPGDKRDTTTPLAMAESLRKLTLGNALGEQQRAQLVTWLKGNTTGGQSIRAGLPASWAVGDKTGAGDYGTTNDIAVIWPENHAPLVLVTYFTQPQQDAKSRKEVLAAAAKIVTEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase OXY-1
publication title Structural insights into the broadened substrate profile of the extended-spectrum beta-lactamase OXY-1-1 from Klebsiella oxytoca
pubmed doi rcsb
source organism Klebsiella oxytoca
total genus 88
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3bydA00
4CJNA 1GA0A 2P9VB 3A3FA 4R1GA 3DW0A 2OSUA 3FYZA 3Q07A 5CGXA 2XFSA 1TDGA 4KZ8A 2WKEA 3HLWA 3C4PA 3W8KA 2EFUA 3BFDA 2X01A 3LCEA 4WZ5A 4DXCA 2V20A 3A3JA 3LO7A 1JTDA 1ONGA 4HBTA 5HAIA 1FSYA 4OP8A 3ISGA 1K54C 1GA9A 1BZAA 1CEFA 4X53A 4QJGA 3WS1A 4EBNA 1J9MA 2Q9NA 1BUEA 4DRTA 4E3JA 1K57A 1FR6A 3SH7A 3P09A 4HESA 4M3KA 1U60A 3PBNA 4KZBA 2J7VA 3FKVA 4OOYA 3PBQA 1FCMA 3N4IA 3W4QA 3ZGAB 4OKPA 1BLSA 3BRMA 3OZHA 4OP5A 1KGFA 4WELA 3VSKA 1VQQA 5FQJA 1FCOA 5DTKA 4P85A 3G30A 1IEMA 2WZXA 3G31A 4BJPA 4K0WA 3O88A 4UHUA 4EBLA 4N1XA 5GL9A 5A92A 4U0XA 3MZDA 4KG2A 1BLCA 3IHBA 4MBKA 5EVIB 2H10A 4RYEA 5CERA 3M6BA 1JWZA 5CHMA 3ZG7B 3HLDA 1SCWA 3MZFA 3V3RA 1K6RA 2EX9A 4DDSA 5FA7A 5F1FA 4X68A 4QHCA 5FQIA 3N6IA 1KE0A 1IELA 4WEJA 1CEGA 1WYBA 3QHYA 4OQHA 4ZJ3A 4OOLA 1IKGA 1K56D 1W79A 5GLAA 5TGFA 3SH8A 3IWIA 5U47A 4OPYA 3TOIA 2RL3A 3OPLA 1K4EA 3HLGA 3MKFA 3WS2A 1MWUA 4QU3A 4LCMA 5KSCA 2WYXA 1NY0A 3G34A 2Y2GA 3OCLA 3GVBA 2WKHA 4KZ7A 3UDFA 3Q82A 1K38A 5J8XA 1KE4A 4S2NA 5HW3A 1RGYA 3BM6A 4GB7A 1EROA 3EQUA 3MZEA 3B3XA 4R3JA 1LL9A 4OQ0A 4GDNA 4E3LA 4XUXA 5HAQA 5E2GA 2ZC5B 1YT4A 1QMFA 4QD4A 1IYPA 3M6HA 1IYOA 1E3UA 5FQQA 1PW8A 3WS4A 3N8SA 1BULA 3FWLA 3QNBA 4KQOA 4RX2A 4E3IA 4PPRA 4S2JA 4S2MA 1YQSA 3NY4A 3MKEA 2XQZA 4E3KA 3GSGA 3O86A 1XA1A 2WAEA 3BFCA 4IEDA 4UA7A 5AQ9A 3V39A 3VP0A 1L2SA 5FI2A 2IWCA 1NRFA 5HARA 3NI9A 3CG5A 5GLCA 1NJ4A 2IWDA 3HVFA 4DXBA 1S0WA 5HX9A 4C3QA 2XDMA 1M40A 3UE3A 4GD8A 2PBYA 3NC8A 4IVIA 3MFDA 5EE8A 2OLUA 3VOYA 3HUMA 3UPPA 4P87A 4EWFA 4FCFA 1Q2PA 1YLJA 3BLSA 3C5AA 4UAAA 2WGWA 2ZC7A 5EOOA 2V2FF 1YMSA 2Y2NA 2HDRA 3PAEA 3UNWA 4DKIA 3G2ZA 1KVLA 4FH2A 4WMCD 5A91A 4E3MA 4GN2A 4LENA 2WK0A 4CPKA 4Y0OA 3AGDA 5DTSA 3IH9A 5D3OA 1K55A 2WAFA 3GR2A 4KZ3A 4EUZA 3Q7VA 4K91A 1IKIA 1W7FA 3LY4A 2ZJ9A 2FFFB 4B4XA 5EVLA 4R0QA 1XA7A 4OVDA 3VP1A 3LY3A 3FKWA 4KZ6A 5BOHA 2P9VA 3OCNA 2CC1A 5GHYA 2DCFA 1JTGA 4LV3A 5FQKA 1PW1A 2E8IA 4OQGA 3UPNA 4NK3A 4RA7A 4X55A 2QPNA 3ZG0A 4B4ZA 2EFXA 5HFOA 2H0YA 4S2OA 3UDXA 3VP3A 2VGKA 4MBHA 1JVJA 4EBPA 1PZPA 1ERQA 4KZAA 2HDUA 2XFTA 1K25A 2WGVA 2Z2MB 1O7EA 3IF6B 3HREA 5GHZA 4BQMA 2H0TA 4OPRA 3P98A 4BL2A 1BSGA 1YLPA 3ITAA 2Y2IA 1XX2A 4D2OA 1PWGA 3N8RA 3OPRA 4NETA 5EOEA 3S22A 3SOIA 3EQVA 4FSFA 1DJBA 2XEPA 3VP4A 4N1HA 2Y2MA 3G35A 4OONA 3SS3A 3WRZA 3WS0A 2JCHA 4Y0UA 5I94A 3NCKA 1ALQA 3TG9A 2XH9A 4EQIA 1W8YA 1LI0A 3V3SA 5E2HA 4JXVA 4JF6A 3IHAA 1PIOA 4JXWA 5FQMA 1L0GA 5CHUA 3VFFA 5EVIA 3UO9A 4Y0TA 4JBFA 1RCJA 1PWCA 5DF7A 2EXAA 4OPQA 1NYYA 2Y4AA 4OH0A 4R4SA 4WYYA 2QMIA 1XKZA 4R4RA 3BLMA 4C6YA 4A5RA 4OQIA 2ZM2A 1TEMA 3N8LA 1K54A 5M19A 1ONHA 4JKTA 1FSWA 1YLWA 1YLZA 4S2IA 3HL9A 3ZG9B 2PU2A 4N92A 1VM1A 5EPHA 1XP4A 3N7WA 4U3TA 4DDYA 2PU4A 4BL3A 3DWZA 5KSHA 3NBLA 2JE5A 3JYIA 5HAPA 3WRTA 1EWZA 1YLTA 2P74A 5CGWA 2XGNA 3IXGA 3M2JA 1QMEA 5EUAA 1DY6A 1XGJA 4UA6A 2ZM8A 3PBRA 4UA9A 5GLBA 2IWBA 1KVMA 1H8YA 1KGEA 3HLCA 4KZ5A 3W4OA 4DE1A 1ESUA 5E2EA 1IYQA 4DE0A 1CI9A 1MPLA 3HLEA 4E3OA 5CXWA 4JLFA 4QY6A 4E3NA 4LV0A 2VGJA 4WEKA 1ZC2A 1HD8A 3GMWA 3HLFA 4GOGA 3IXBA 5DF9A 4R3BA 3PTEA 4S2LA 3UN7A 5FASA 2Y55A 2X71A 1ZG6A 5AQ7A 4WMCA 3G32A 3PAGA 4PM8A 4IVKA 4RX3A 5M18A 1W5DA 1L0FA 1TDLA 1WE4A 4OOMA 2Y2PA 4IBRA 5F1GA 4P6BA 1XPBA 3E2KA 5JYPA 3ZVWA 2I72A 3IH8A 2Y2HA 4KG5A 1MWSA 3IT9A 1ES5A 1ZG4A 5HL1A 2Y2QA 2HDQA 3IXDA 5A93A 1FR1A 4U0TA 5CRFA 5FQ9A 2DRWA 3V5MA 4KZ9A 1WYCA 3WS5A 2G2UA 1YLYA 3A3IA 2H5SA 4PMAA 1S6RA 4ID4A 1SDEA 3UPOA 4WZ5C 2A49A 2B5RA 1Y54A 1AXBA 2WUQA 4JF5A 4DE3A 5DVAA 5FAQA 4LV1A 3BFGA 1SKFA 3S4XA 4JF4A 5CGSA 2WADA 3PBTA 4GNUA 4YFMA 5FSRA 3TSGA 2WZZA 4N9KA 4F94A 3SH9A 5CECA 3HBRA 2ZLYA 1NYMA 2ZQDA 4GD6A 2JBFA 1K57C 4JXGA 3BEBA 5G18A 3SS5A 1W8QA 1MWTA 2ZQAA 1DJAA 4PM9A 1C3BA 5DF8A 5GHXA 5IHVA 1KDSA 4BENA 5FATA 3IWQA 3ZDJA 2HDSA 1E3UD 1ERMA 3GTCA 4X69A 1I5QA 2C6WB 2EX2A 3HUNA 3RXXA 2WKIA 3GRJA 5A90A 1BLHA 2XD1A 5CTNA 2EXBA 5GLDA 1MWRA 3S1YA 1BLPA 4S2PA 1H5XA 3V50A 2XK1A 5CEDA 2HP5A 4JXSA 2HP6A 5TFQA 4P0MA 5FI6A 1L0EA 1K56A 3VSLA 3VP2A 5EVIC 4ZJ1A 3IF6A 4ZAMA 4OPZA 3A3DA 2C5WB 1Z6FA 1XXMA 3UE0A 1KE3A 4R23A 4BD1A 1SDNA 3RJUA 3ZNTA 3UY6A 4BD0A 2EX6A 1EI5A 1ES3A 3ZCZA 4C75A 4OLDA 3UE1A 2R9WA 3VOZA 3IXHA 1I2SA 1CK3A 3DTMA 3FV7A 2Q9MA 3C7VA 1HTZA 1XGIA 1H8ZA 4IBXA 5FAPA 1JWPA 1ES2A 1MKIA 1ES4A 2OLVA 3GV9A 3IQAA 3Q1FA 4H8RA 3GQZA 4WBGA 3ZFZA 1KGGA 5KMWA 1RP5A 3Q81A 1MXOA 1OMEA 2JC7A 3VMAA 4OLGA 1MBLA 1ZKJA 3CJMA 4S2NC 1FOFA 5DTTA 4O7DA 2UWXA 2ZMAA 4E6WA 5KZHA 1BT5A 1N4OA 1IYSA 1GCEA 2G2WA 2XF3A 3NIAA 5FAOA 5E43A 4ZTKA 1GHMA 3HLBA 3M2KA 5TR7A 3D4FA 2ZQ7A 3PBOA 2ZC4B 3CZDA 2Y91A 2DNSA 2ZQ9A 4QY5A 1YM1A 1JWVA 2XD5A 3AGEA 3MBZA 1YMXA 2ZD8A 2BLSA 3ITBA 3BFEA 1BTLA 1RGZA 2EX8A 4ZDXA 1KDWA 2J9OA 2Z2LB 4RVAA 3G2YA 2ZQ8A 2ZQCA 3I7JA 5E2FA 4KQQA 4XUZA 3HUOA 1DJCA 4PM6A 1LI9A 1PI4A 2OV5A 4MEZA 3E2LA 3VFHA 2ZM0A 2ZC3B 2Y59A 3DWKA 4KENB 4ZJ2A 2ZC6B 2Y2LA 2QZ6A 2WGIA 4E6XA 1SHVA 2XR0A 4FH4A 4GZBA 2XLNA 1G68A 1FCNA 1K6SA 5FI7A 3OC2A 3AGFA 3O87A 4GKUA 2FFYA 5F82A 2J9PA 1E25A 1NXYA 3Q7ZA 1TVFA 4HEFA 5L2FA 3LEZA 3ZG5A 4JPMA 2A3UA 4LCLA 1MY8A 5AQBA 3C7UA 4DE2A 4HBUA 4EV4A 3ZHHA 5EVID 3RXWA 3W4PA 3SS4A 1Q2QA 4X56A 3BYDA 1K55C 3IF5A 3PBSA 4MBFA 4WZ4A 5F83A 3ZVTA 1PYYA 3ZNYA 2HP9A 4PM5A 1NZOA 4KZ4A 3BECA 1M6KA 1G6AA 3NDEA 4PM7A 1LLBA 3C4OA 4GDBA 4ZBEA 4X6TA 4DF6A 3UDIA 1L0DA 1GHIA 5CHJA 4KG6A 3FZCA 1HZOA 2R9XA 2GDNA 2V1ZA 3BFFA 5EECA 3O3VA 4FD8A 4Y7PA 5AQAA 4Q8IA 2X02A 5FDHA 3A3EA 1N9BA 4B88A 1FQGA 4Z9QA 1PWDA 4K0XA 4QB8A 1HVBA 3MXRA 1GHPA 4MLLA 3IWOA 5M1AA 1ESIA 3WWXA 1LL5A 1I2WA 4N9LA 1E4DA 5CTMA 4BLMA 1O07A 2HPBA 1PZOA 3OPPA 4MNRA 2Y2JA 5CEBA 3OPHA 3G4PA 2WGWB 1PI5A 4S2KA 3ZG8B 3QNCA 3NDGA 4L0LA 3IF6C 4KQRA 4WM9A 1K4FA 4XXRA 2Y2OA 1LHYA 3MXSA 3Q7VB 5JYOA 2Y2KA 4LV2A 2RCXA 1NZUA 4YINA 1CI8A 3CMZA 2BG1A 2J8YA
chains in the Genus database with same CATH superfamily
4R1GA 3CLOA 3CUEC 4HNBA 1YSQA 3U4LP 2QKPA 4MN5A 5F5YA 2X01A 3EGDC 4WZ5A 1ONGA 4Z1WA 5HAIA 2VV7A 5I5LA 4P6ZM 1K54C 4QJGA 1P9WA 4NXBA 4EBNA 4M3KA 1U60A 4KZBA 4OOYA 2O9CA 3W4QA 4ETXA 3LR5A 1BLSA 3BRMA 4WELA 1FCOA 5DTKA 3E4QA 4ARZB 1UWNX 3G31A 4Q0JA 4EBLA 3LEQA 1JNUA 3MZDA 3IHBA 3JPUA 5EVIB 5CHMA 3HLDA 3V3RA 4QHCA 1LSXA 4WEJA 1CEGA 3K2NA 4XT2A 3F1NB 1F2KA 4NXFA 3R7WB 1H0MA 3IBJA 1K4EA 3WS2A 2HJ9C 5KSCA 2WYXA 1NY0A 3OCLA 3GVBA 1G5UA 1KE4A 2XA7S 4S2NA 4GB7A 3EQUA 4R3JA 4E3LA 4XUXA 5HAQA 3B33A 1E3UA 4IJGA 1TS8A 4D60A 2QJ5A 4KQOA 4PPRA 4S2MA 1YQSA 3NOUC 4E3KA 3BFCA 4UA7A 4IEDA 3VP0A 1L2SA 5HARA 2A2LA 3S7PA 1OTDA 2IWDA 2PBYA 5EE8A 3HUMA 4JGOA 4EWFA 2W3EA 1OT9A 2WGWA 2ZC7A 1YMSA 2BASA 3PAEA 4DKIA 3O5YA 4K91A 5LBRA 2FFFB 4B4XA 4JGQA 3LY3A 1DP9A 3CI6A 5GHYA 1PW1A 4HH3A 1G6OA 3UB6A 3PYPA 2QPNA 3UB9A 1T1AA 2VGKA 1WA9A 1K25A 3HREA 4BQMA 4OPRA 1XX2A 1T18A 2D01A 3TRCA 4FUWA 4D2OA 1PWGA 4LRXC 3QP8A 3NCKA 1OTBA 4K08A 4EQIA 3F1PA 5E2HA 1T1BA 3CUEA 1L0GA 2HV1A 1RCJA 5HD3A 5DF7A 4WN5A 1D06A 4A5RA 1TEMA 1K54A 4JKTA 1YLWA 5HDSA 4S2IA 3GDIA 3K3DA 4R38A 3T50A 3N7WA 4HP4A 4GHIB 2J80A 3JYIA 1YLTA 5MC7A 5EUAA 4HHDA 1XGJA 3W4OA 1KGEA 4KZ5A 4DE1A 1OJ5A 1IYQA 2J3TC 4LV0A 1S4RA 2VA0A 1HD8A 3GMWA 4GOGA 3IXBA 5DF9A 5FASA 4RQ9A 1ZG6A 3MR0A 2FZ0A 3DTIA 1L0FA 1TDLA 1WE4A 3BWLA 4OOMA 2NUPC 5L09A 3NECA 3IH8A 1MWSA 2JKTI 1ODVA 1ES5A 1ZG4A 2HDQA 3IXDA 5A93A 1LSVA 2DRWA 3V5MA 3LI8A 1S6RA 2W3DA 1T19A 2B5RA 1Y54A 4KUKA 4JF5A 1PFLA 1SKFA 4BBVA 5FSRA 4GNUA 4F94A 2ZLYA 1NYMA 4GD6A 1XJ6A 1K57C 2QWSA 5G18A 5KIZA 3DAVA 1DP8A 2KLIA 1E3UD 3HUNA 3R4KA 1BLHA 3KYEA 2VK3A 2EXBA 1MWRA 1BLPA 4CLCD 5HDCA 4JXSA 5FI6A 4X25A 3NHQA 1H3QA 4ZJ1A 4ZAMA 1VHMA 4OPZA 3UE0A 4BD1A 1SDNA 4IHQA 1CQAA 1N9NA 1EI5A 3ZCZA 3S7OA 1I2SA 1FIKA 4UQIS 3FV7A 4LGWA 1W63Q 1HTZA 4DJ3A 1CF0A 4IBXA 3IQAA 4H8RA 3GQZA 3JVUA 1KGGA 5KMWA 3Q81A 2JC7A 3B42A 4OLGA 3CJMA 1FOFA 1BT5A 3QP4A 2E8JA 2G2WA 4ZTKA 1GHMA 5TR7A 3D4FA 3CZDA 4QY5A 1YM1A 4HP9A 1YMXA 2ZD8A 4L9FA 3ITBA 2EX8A 4ZDXA 1KDWA 3G2YA 4ME4A 2Y8HA 1YSPA 4XUZA 3HUOA 1DJCA 2VGLS 4PM6A 4XT2B 4MEZA 2VZWA 2MJ6A 3T4KA 2O99A 3LR4A 5HWVA 5J7EA 2QZ6A 2XR0A 4FH4A 2WKRA 2XLNA 1G68A 4GKUA 1NXYA 5L2FA 4DE2A 3BYDA 3ZVTA 5F83A 3NOTC 2HP9A 3H82A 1VETA 4CLCB 3C4OA 3D72A 4DF6A 4KG6A 4FD8A 5AQAA 4MN7A 4B88A 1FQGA 4Z9QA 4MMNA 3IWOA 1ESIA 3WWXA 1I2WA 4N9LA 4BLMA 1PZOA 2Y2JA 2WGWB 5IS1A 3H7WA 2LB5A 3ICYA 3EWKA 1D7EA 4GCZA 2Y2OA 3MXSA 1TS6A 2Y2KA 4Y2FA 1NZUA 3CMZA 2BG1A 4QY6A 1GA0A 4BBUA 2OSUA 1F9IA 3Q07A 2PT7A 3HLWA 2EFUA 3LCEA 2V20A 1XFNA 3LO7A 1JTDA 5A8BA 1GA9A 4KUOA 1J9MA 3IX8A 1K57A 1FR6A 3SH7A 4PKYG 3MQOA 4HESA 1LSWA 2M7UA 3PBNA 3PBQA 5DJTA 2K2NA 3ZGAB 3LYXA 3OZHA 4EESA 3O88A 3F1PB 4UHUA 5F68A 5GL9A 5A92A 4U0XA 4MBKA 2H10A 3HJIA 3ZG7B 1K6RA 2DMWA 3BQAA 3QHYA 4ZJ3A 1W79A 3EGXC 4I3IA 5GLAA 3TOIA 3HLGA 1F98A 4I3JA 1PNEA 4HQAA 3LIFA 3P01A 3UDFA 3Q82A 2CMNA 3BM6A 1EROA 4X1MA 5E2GA 4G3KA 5FQQA 5FL3A 3N8SA 3FWLA 1KOUA 4S2JA 3O86A 3NJAA 3T4JA 3NI9A 2ZMFA 2PAVP 4C3QA 1M40A 3GECA 1GSVA 3C30A 3NC8A 1S1YA 2OLUA 3VOYA 2KDKA 1NWZA 3A0VA 1Q2PA 3BLSA 4UAAA 2G7UA 3G2ZA 4WMCD 4E3MA 3ULFA 3AGDA 2WAFA 3GR2A 4EUZA 3Q7VA 3MQ0A 1W7FA 4I3AA 3BW6A 3V67A 3OCNA 1JTGA 1VB6A 4EXOA 4R3AA 2Q0OA 2GJ3A 4S2OA 3VP3A 4EBPA 2XSSA 1ACFA 1ERQA 1PZPA 4KZAA 2HDUA 4BMWA 2WGVA 1O7EA 4BL2A 1YLPA 4I39A 4LRYC 3N8RA 3OPRA 4NETA 3S22A 3SOIA 3L9KA 1MZUA 3UB7A 3CITA 5HD5A 1DP6A 4N1HA 2Y2MA 4OONA 3C2WA 3WS0A 3H9WA 3FG8A 1LI0A 3V3SA 1K0KA 4JF6A 1W63M 3IS2B 2EA9A 4OPQA 4EQ1A 1NYYA 4WYYA 5EM0A 1AWIA 1BYWA 4BBTA 2P08A 4LLOB 5DKKA 4BL3A 3SZTA 1EWZA 2BTFP 1DY6A 3PBRA 4WUJA 3EOIA 4HJ4A 1NLYA 1STZA 5E2EA 3HLEA 1ZTUA 3MMHA 2WKPA 4WEKA 5J4EA 3K3CA 1OTEA 4R3BA 3PTEA 4L9GA 2X71A 2V0UA 3G32A 3PAGA 2V1AA 5M18A 1W5DA 3T12B 4P6BA 5JYPA 3ZVWA 2I72A 2Y2HA 3LI9A 3VOLA 4U0TA 1VETB 3MQQA 3WS5A 1YLYA 4ID4A 1SDEA 3W2ZA 1OTIA 1V9ZA 2WUQA 3S4XA 4JF4A 5CGSA 2WADA 3PBTA 2VV8A 5CECA 2WZZA 4N9KA 2ZQDA 3H7WB 2JBFA 3SS5A 3TJZC 4GW9A 2ZQAA 5IHVA 4DJ2A 3BQ8A 5TBMB 3TW8A 4BENA 3ZDJA 4GS9A 1I5QA 3RXXA 5A90A 2JKRI 2EWVA 5GLDA 1UWPX 4HIAA 2XK1A 4M4XA 4P0MA 5EVIC 2O9BA 3IF6A 4R70A 3A3DA 2ZL1B 1KE3A 3UY6A 5DJUA 2EX6A 5DFXA 1ES3A 4C75A 4OLDA 3B47A 2R78A 4NXEA 3IXHA 1TS0A 3DTMA 2Q9MA 3C7VA 4Y0OA 1JWPA 1ES2A 1GSWA 3E4OA 3TE8A 1OMEA 3VMAA 1MBLA 4O7DA 5KZHA 1GCEA 2LB9A 1F5MA 5E43A 3HLBA 2HGVA 2VX8A 3PBOA 2ZQ7A 4EERA 2YKHA 3T4TA 2GZAA 2J9OA 3T4QA 4RVAA 1HLUP 3I7JA 4KQQA 2GNXA 2QYBA 5HDDA 4Y15A 1SKOB 4MN6A 3T1XA 3S7QA 2PD7A 4ZJ2A 2QJ7A 1K6SA 1FCNA 5FI7A 4NKPA 3O87A 1TF1A 3Q7ZA 4EETB 4G3VA 4HEFA 3LEZA 1P9RA 3T1SA 2A3UA 1XJ4A 2A24A 4HBUA 4EV4A 3ZHHA 5DKLA 3W4PA 3PBSA 4WZ4A 1PYYA 2Z6DA 4F3LA 4KZ4A 3BECA 3NDEA 4GDBA 4WLAA 1D1JA 5CHJA 2V1ZA 4Q8IA 1N9BA 3DTKA 3EEAA 4K0XA 4QB8A 3D3OA 1HVBA 3MXRA 1GHPA 4MLLA 5CTMA 1O07A 2J3WA 3OPHA 4L9EA 3CWFA 2PBDP 3NDGA 4O01A 3Q7VB 1LHYA 4DMZA 5EM1A 2PHYA 4YINA 1CI8A 2ACGA 5CGXA 2XFSA 3FC7A 5EFWA 4KZ8A 2PD8A 4DXCA 4HBTA 4X53A 2JKTM 3WS1A 4DRTA 5FEGA 2J7VA 3FKVA 3UB8A 3KYZA 4OKPA 1SZVA 4OP5A 1TD5A 2Y79A 1VQQA 5FQJA 3MFXA 4P85A 2O0YA 2WZXA 4K0WA 4EW7A 4CLCE 4N1XA 3E0YA 4RYEA 5CERA 4NEED 1JWZA 3MZFA 5FA7A 5EVEA 5F1FA 4X68A 5FQIA 3N6IA 1KE0A 4OOLA 5TGFA 5F6AA 5U47A 4OPYA 3OPLA 4QU3A 4LCMA 3F1NA 3R7WA 3G34A 1XFQA 2Y2GA 3HCYA 1YKDA 1VEUA 2WKHA 3KYQA 4LRZE 4KZ7A 2PR6A 3KSFA 1K38A 2L0WA 5HW3A 1RGYA 3MZEA 1LL9A 4OQ0A 4GDNA 3QP5A 1IYPA 3M6HA 2V8FA 1IYOA 3WS4A 1DRMA 3QNBA 4RX2A 3GSGA 2WAEA 3FPWA 3V39A 2VJWA 2L1MA 2IWCA 1NRFA 1NJ4A 3HVFA 1S0WA 4IUHA 2W1RA 4Y5FA 5HWTA 4IVIA 3MFDA 4KQDA 4FCFA 1YLJA 3C5AA 2V2FF 2Y2NA 4PKYA 4FH2A 4GN2A 4LENA 4CPKA 1OTAA 4KZ3A 2XRNA 1IKIA 5K5BA 2ZJ9A 4Q0IA 3RTYA 4R0QA 4OVDA 4KZ6A 2P9VA 2CC1A 4GS9B 4LV3A 3LIBA 1YAXA 2E8IA 3UPNA 4QWOA 4RA7A 4B4ZA 5HFOA 3UB5P 2QHKA 1JVJA 2JN7A 4HJ3A 2Z2MB 3IF6B 4P6ZS 5GHZA 3P98A 1Y4OA 5EOEA 4UQIM 3LICA 2HJEA 3VP4A 3G35A 3SS3A 2JCHA 3IX4A 1ALQA 3TG9A 3IX3A 1W8YA 2OWHA 1IOUA 3IHAA 1PIOA 4JXWA 5CHUA 3VFFA 4Y0TA 3UO9A 2V8CA 2EXAA 2B18A 2Y4AA 1XKZA 4YNRA 3BLMA 2W3GA 2ZM2A 3RH8B 4MCWA 5M19A 1FSWA 1YLZA 4N92A 1VM1A 5EPHA 4DDYA 4ESPA 1OPXA 2VGLM 3NBLA 2JE5A 4I38A 5HAPA 3WRTA 5CGWA 2XGNA 3M2JA 1QMEA 2P04A 4UA6A 2IWBA 2ZM8A 4O8GA 1KVMA 4CLCC 1PRQA 1CI9A 1MPLA 3CAXA 5CXWA 2VGJA 1Z09A 3HLFA 2VKSA 3ZYTA 4S2LA 3NOPC 3UN7A 2Y55A 3OBFA 5AQ7A 5HWWA 2XROA 2A24B 4IBRA 4B9OA 3T1QB 2Y2QA 1FR1A 1XJ2A 5CRFA 3LIDA 4KZ9A 3LIAA 3LIEA 3A3IA 2H5SA 2PR5A 1GSXA 2B95A 3E4PA 2V9AA 5DVAA 4LV1A 3TSGA 3SH9A 3BY8A 3HBRA 3QP1A 3BEBA 1W8QA 1MWTA 5DF8A 1DJAA 5GHXA 3F1OA 1CJFA 5FATA 1Y28A 4DN0A 3ZQ5A 3GTCA 4X69A 2EX2A 3GRJA 2XD1A 3VV4A 5CTNA 3HJKA 5HPIA 4S2PA 3V50A 3C8CA 2J3TD 2HP6A 2FH5A 5TFQA 1YPRA 1K56A 1X0OA 3PHYA 2L4RA 4R23A 2V0WA 3RJUA 3ZNTA 4BD0A 3EEHA 3UE1A 2R9WA 4G3WA 3L7HA 1OT6A 3PR6A 2VV6A 1XGIA 2KX6A 1ES4A 3GV9A 1P0ZA 3OOVA 2JKGA 4H6JA 2M1CA 2EWWA 2UWXA 2ZMAA 3RFBA 4E6WA 1IYSA 3NIAA 2ZC4B 2ZQ9A 1JWVA 3AGEA 2K7SA 4JGRA 2ZOIA 3KSGA 1BTLA 1RGZA 3KSHA 2Z2LB 3U2AA 2ZQCA 5E2FA 3D9YA 2OAQ1 1P97A 5IU1A 2OV5A 3E2LA 5G4YA 1S1ZA 2IA2A 2ZC6B 2O9AA 2Y2LA 2WGIA 1S4SA 4JGPA 2P7JA 1VEUB 2FFYA 3NULA 5F82A 2J9PA 1E25A 1TVFA 4JPMA 4LCLA 4R6LA 5AQBA 3SS4A 1Q2QA 3H82B 1K55C 3IF5A 4MBFA 2INWA 3C38A 1S67L 1G6AA 4PM7A 3QP2A 2M7VA 3UDIA 1L0DA 1GHIA 1MKMA 3FZCA 5AJGA 5FDSA 1T1CA 1L3LA 5EECA 4CLCA 4Y7PA 3JVVA 3A3EA 4HY8A 3UMDA 4I5SA 3UMEA 2HPBA 3OPPA 2ZMVA 3G4PA 3DTEA 5HSQA 3ZG8B 3OLOA 2YKFA 5L8MA 4X1LA 4L0LA 4KQRA 1K4FA 5JYOA 2RCXA 5FQ9A 4CJNA 2P9VB 3A3FA 3DW0A 3FYZA 1TDGA 2WKEA 3C4PA 3W8KA 3FPVA 3BFDA 3UE6A 3LFVA 3A3JA 5TJJA 1FSYA 4OP8A 3ISGA 3CHWP 1BZAA 1CEFA 2Q9NA 5C5KA 1BUEA 4E3JA 3P09A 2PRFA 1FCMA 3N4IA 4Y13A 1KGFA 3VSKA 2VEAA 3G30A 1IEMA 4BJPA 4IUKA 3A0RA 4KG2A 1BLCA 2JHEA 3M6BA 1SCWA 4O0PA 3IBRA 4DDSA 2EX9A 3VE3A 1IELA 1WYBA 3LR3A 4OQHA 1IKGA 1K56D 4LFUA 1OJGA 3SH8A 3IWIA 2JKRM 2RL3A 4UEYA 1LL8A 3QP6A 3MKFA 1MWUA 2XA7M 3KO6A 4Q0HA 2HF6A 2UV0E 5J8XA 3B3XA 2ZC5B 2OWJA 1YT4A 1QMFA 2W1TA 4QD4A 5G4ZA 4EEPA 3MSHA 1PW8A 1BULA 4E3IA 1EW0A 4WL9A 3NY4A 3T4SA 3MKEA 2XQZA 1XA1A 5AQ9A 4EU0A 5FI2A 3CG5A 5GLCA 3T4LA 4DXBA 5HX9A 2XDMA 4HOIA 1H8MA 3UE3A 3SW1A 3LR0A 4GD8A 3LGOA 4FTXA 5L07A 3UPPA 4P87A 3T1RA 4GLQA 5FEFA 5EOOA 3UNWA 2HDRA 4Y3IA 1KVLA 5A91A 2KOIA 2WK0A 5DTSA 1G28A 3CPTA 1K55A 3IH9A 5D3OA 3LY4A 3F1OB 5EVLA 1XA7A 3VP1A 3FKWA 5BOHA 3A0SA 2DCFA 5FQKA 4OQGA 3T4OA 4NK3A 1MC0A 3BJNA 4X55A 3ZG0A 4BWIA 2EFXA 2H0YA 3UDXA 3BY9A 4MBHA 2XFTA 2H0TA 1BSGA 3ITAA 2Y2IA 1J3WA 5AVFA 2Z6CA 3EQVA 4FSFA 1DJBA 2XEPA 3WRZA 4ARZA 4Y0UA 5I94A 2XH9A 4JXVA 4H6JB 5FQMA 3MF0A 2B02A 5EVIA 4B93A 4JBFA 1PWCA 4PAUA 4OH0A 4R4SA 3IS2A 2QMIA 4R4RA 2NUTC 4C6YA 4OQIA 3N8LA 1ONHA 4HI4A 3ZG9B 3HL9A 2PU2A 1XP4A 4U3TA 4YWZA 2PU4A 3DWZA 5KSHA 3MS6A 3LUQA 2P74A 3IXGA 5CX7A 5GLBA 4UA9A 1H8YA 3HLCA 1ESUA 4DE0A 4E3OA 2W27A 2K31A 4JLFA 4E3NA 4HH2A 1ZC2A 5DFYA 2AVXA 4AFIA 4WMCA 4PM8A 4IVKA 4RX3A 2HZ5A 4GJ4A 2Y2PA 1ZHHB 5F1GA 1XPBA 3E2KA 4KG5A 2WKQA 3IT9A 5F69A 5HL1A 4PHTA 1WYCA 2G2UA 3G6OA 1TS7A 4PMAA 3UPOA 4WZ5C 4MDZA 4FOFA 2A49A 1AXBA 4DE3A 5FAQA 5L10A 3BFGA 4YFMA 2D02A 2VLGA 5HPFA 1XJ3A 4Y17A 4JXGA 4PM9A 2W3FA 1C3BA 2JKFA 1KDSA 3IWQA 2HDSA 2OOLA 1NLZA 1ERMA 2C6WB 5TBMA 2WKIA 4HJ6A 2W0NA 4CQHA 3S1YA 1H5XA 3S7NA 2PDRA 5CEDA 2HP5A 1IFQA 1L0EA 3PXPA 4LPZA 3VSLA 3VP2A 1N9LA 4E04A 2C5WB 1Z6FA 1XXMA 4ETZA 4II7A 2ZL1A 3VOZA 1LT0A 1CK3A 1H8ZA 5HZHA 5FAPA 2OLVA 1MKIA 4WBGA 3ZFZA 3Q1FA 3VE4A 1UGUA 1RP5A 1MXOA 1N9OA 1ZKJA 2I9VA 4S2NC 5DTTA 1N4OA 1NRJA 2XF3A 5FAOA 1V9YA 3M2KA 1A0KA 2Y91A 2DNSA 3MBZA 2XD5A 2BLSA 3MJQA 3BFEA 4GHIA 2ZQ8A 1LI9A 1PI4A 3P7NA 3VFHA 2ZM0A 2W3HA 2ZC3B 2Y59A 3DWKA 4KENB 1SKOA 5IT5A 4E6XA 1SHVA 3DBAA 4YOFA 3OC2A 3AGFA 4EUVA 4NG2A 3KX0X 2H28A 2PYPA 3ZG5A 1MY8A 3C7UA 4QPRA 5HL6A 2W1TB 5EVID 3RXWA 4F3LB 4X56A 2V1BA 3ZNYA 4PM5A 5J3WA 1NZOA 1M6KA 1LLBA 4ZBEA 4X6TA 2ZBBA 2OAP1 1HZOA 2R9XA 2GDNA 3BFFA 3O3VA 2X02A 5FDHA 4EEUA 1PWDA 1S66L 1FILA 2ZOHA 5M1AA 3KSIA 3E98A 1LL5A 1E4DA 5CEBA 4MNRA 1PI5A 4S2KA 4WF0A 5EV0A 2GX5A 3QNCA 3MXQA 4WM9A 3IF6C 3CPTB 4XXRA 4LV2A 2PYRA 5AVEA 4NXGA 4GZBA 2J8YA 4ZRRA
chains in the Genus database with same CATH topology
4CJNA 1GA0A 2P9VB 3A3FA 4R1GA 3DW0A 2OSUA 3FYZA 3Q07A 5CGXA 2XFSA 1TDGA 4KZ8A 2WKEA 3HLWA 3C4PA 3W8KA 2EFUA 3BFDA 2X01A 3LCEA 4WZ5A 4DXCA 2V20A 3A3JA 3LO7A 1JTDA 1ONGA 4HBTA 5HAIA 1FSYA 4OP8A 3ISGA 1K54C 1GA9A 1BZAA 1CEFA 4X53A 4QJGA 3WS1A 4EBNA 1J9MA 2Q9NA 1BUEA 4DRTA 4E3JA 1K57A 1FR6A 3SH7A 3P09A 4HESA 4M3KA 1U60A 3PBNA 4KZBA 2J7VA 3FKVA 4OOYA 3PBQA 1FCMA 3N4IA 3W4QA 3ZGAB 4OKPA 1BLSA 3BRMA 3OZHA 4OP5A 1KGFA 4WELA 3VSKA 1VQQA 5FQJA 1FCOA 5DTKA 4P85A 3G30A 1IEMA 2WZXA 3G31A 4BJPA 4K0WA 3O88A 4UHUA 4EBLA 4N1XA 5GL9A 5A92A 4U0XA 3MZDA 4KG2A 1BLCA 3IHBA 4MBKA 5EVIB 2H10A 4RYEA 5CERA 3M6BA 1JWZA 5CHMA 3ZG7B 3HLDA 1SCWA 3MZFA 3V3RA 1K6RA 2EX9A 4DDSA 5FA7A 5F1FA 4X68A 4QHCA 5FQIA 3N6IA 1KE0A 1IELA 4WEJA 1CEGA 1WYBA 3QHYA 4OQHA 4ZJ3A 4OOLA 1IKGA 1K56D 1W79A 5GLAA 5TGFA 3SH8A 3IWIA 5U47A 4OPYA 3TOIA 2RL3A 3OPLA 1K4EA 3HLGA 3MKFA 3WS2A 1MWUA 4QU3A 4LCMA 5KSCA 2WYXA 1NY0A 3G34A 2Y2GA 3OCLA 3GVBA 2WKHA 4KZ7A 3UDFA 3Q82A 1K38A 5J8XA 1KE4A 4S2NA 5HW3A 1RGYA 3BM6A 4GB7A 1EROA 3EQUA 3MZEA 3B3XA 4R3JA 1LL9A 4OQ0A 4GDNA 4E3LA 4XUXA 5HAQA 5E2GA 2ZC5B 1YT4A 1QMFA 4QD4A 1IYPA 3M6HA 1IYOA 1E3UA 5FQQA 1PW8A 3WS4A 3N8SA 1BULA 3FWLA 3QNBA 4KQOA 4RX2A 4E3IA 4PPRA 4S2JA 4S2MA 1YQSA 3NY4A 3MKEA 2XQZA 4E3KA 3GSGA 3O86A 1XA1A 2WAEA 3BFCA 4IEDA 4UA7A 5AQ9A 3V39A 3VP0A 1L2SA 5FI2A 2IWCA 1NRFA 5HARA 3NI9A 3CG5A 5GLCA 1NJ4A 2IWDA 3HVFA 4DXBA 1S0WA 5HX9A 4C3QA 2XDMA 1M40A 3UE3A 4GD8A 2PBYA 3NC8A 4IVIA 3MFDA 5EE8A 2OLUA 3VOYA 3HUMA 3UPPA 4P87A 4EWFA 4FCFA 1Q2PA 1YLJA 3BLSA 3C5AA 4UAAA 2WGWA 2ZC7A 5EOOA 2V2FF 1YMSA 2Y2NA 2HDRA 3PAEA 3UNWA 4DKIA 3G2ZA 1KVLA 4FH2A 4WMCD 5A91A 4E3MA 4GN2A 4LENA 2WK0A 4CPKA 4Y0OA 3AGDA 5DTSA 3IH9A 5D3OA 1K55A 2WAFA 3GR2A 4KZ3A 4EUZA 3Q7VA 4K91A 1IKIA 1W7FA 3LY4A 2ZJ9A 2FFFB 4B4XA 5EVLA 4R0QA 1XA7A 4OVDA 3VP1A 3LY3A 3FKWA 4KZ6A 5BOHA 2P9VA 3OCNA 2CC1A 5GHYA 2DCFA 1JTGA 4LV3A 5FQKA 1PW1A 2E8IA 4OQGA 3UPNA 4NK3A 4RA7A 4X55A 2QPNA 3ZG0A 4B4ZA 2EFXA 5HFOA 2H0YA 4S2OA 3UDXA 3VP3A 2VGKA 4MBHA 1JVJA 4EBPA 1PZPA 1ERQA 4KZAA 2HDUA 2XFTA 1K25A 2WGVA 2Z2MB 1O7EA 3IF6B 3HREA 5GHZA 4BQMA 2H0TA 4OPRA 3P98A 4BL2A 1BSGA 1YLPA 3ITAA 2Y2IA 1XX2A 4D2OA 1PWGA 3N8RA 3OPRA 4NETA 5EOEA 3S22A 3SOIA 3EQVA 4FSFA 1DJBA 2XEPA 3VP4A 4N1HA 2Y2MA 3G35A 4OONA 3SS3A 3WRZA 3WS0A 2JCHA 4Y0UA 5I94A 3NCKA 1ALQA 3TG9A 2XH9A 4EQIA 1W8YA 1LI0A 3V3SA 5E2HA 4JXVA 4JF6A 3IHAA 1PIOA 4JXWA 5FQMA 1L0GA 5CHUA 3VFFA 5EVIA 3UO9A 4Y0TA 4JBFA 1RCJA 1PWCA 5DF7A 2EXAA 4OPQA 1NYYA 2Y4AA 4OH0A 4R4SA 4WYYA 2QMIA 1XKZA 4R4RA 3BLMA 4C6YA 4A5RA 4OQIA 2ZM2A 1TEMA 3N8LA 1K54A 5M19A 1ONHA 4JKTA 1FSWA 1YLWA 1YLZA 4S2IA 3HL9A 3ZG9B 2PU2A 4N92A 1VM1A 5EPHA 1XP4A 3N7WA 4U3TA 4DDYA 2PU4A 4BL3A 3DWZA 5KSHA 3NBLA 2JE5A 3JYIA 5HAPA 3WRTA 1EWZA 1YLTA 2P74A 5CGWA 2XGNA 3IXGA 3M2JA 1QMEA 5EUAA 1DY6A 1XGJA 4UA6A 2ZM8A 3PBRA 4UA9A 5GLBA 2IWBA 1KVMA 1H8YA 1KGEA 3HLCA 4KZ5A 3W4OA 4DE1A 1ESUA 5E2EA 1IYQA 4DE0A 1CI9A 1MPLA 3HLEA 4E3OA 5CXWA 4JLFA 4QY6A 4E3NA 4LV0A 2VGJA 4WEKA 1ZC2A 1HD8A 3GMWA 3HLFA 4GOGA 3IXBA 5DF9A 4R3BA 3PTEA 4S2LA 3UN7A 5FASA 2Y55A 2X71A 1ZG6A 5AQ7A 4WMCA 3G32A 3PAGA 4PM8A 4IVKA 4RX3A 5M18A 1W5DA 1L0FA 1TDLA 1WE4A 4OOMA 2Y2PA 4IBRA 5F1GA 4P6BA 1XPBA 3E2KA 5JYPA 3ZVWA 2I72A 3IH8A 2Y2HA 4KG5A 1MWSA 3IT9A 1ES5A 1ZG4A 5HL1A 2Y2QA 2HDQA 3IXDA 5A93A 1FR1A 4U0TA 5CRFA 5FQ9A 2DRWA 3V5MA 4KZ9A 1WYCA 3WS5A 2G2UA 1YLYA 3A3IA 2H5SA 4PMAA 1S6RA 4ID4A 1SDEA 3UPOA 4WZ5C 2A49A 2B5RA 1Y54A 1AXBA 2WUQA 4JF5A 4DE3A 5DVAA 5FAQA 4LV1A 3BFGA 1SKFA 3S4XA 4JF4A 5CGSA 2WADA 3PBTA 4GNUA 4YFMA 5FSRA 3TSGA 2WZZA 4N9KA 4F94A 3SH9A 5CECA 3HBRA 2ZLYA 1NYMA 2ZQDA 4GD6A 2JBFA 1K57C 4JXGA 3BEBA 5G18A 3SS5A 1W8QA 1MWTA 2ZQAA 1DJAA 4PM9A 1C3BA 5DF8A 5GHXA 5IHVA 1KDSA 4BENA 5FATA 3IWQA 3ZDJA 2HDSA 1E3UD 1ERMA 3GTCA 4X69A 1I5QA 2C6WB 2EX2A 3HUNA 3RXXA 2WKIA 3GRJA 5A90A 1BLHA 2XD1A 5CTNA 2EXBA 5GLDA 1MWRA 3S1YA 1BLPA 4S2PA 1H5XA 3V50A 2XK1A 5CEDA 2HP5A 4JXSA 2HP6A 5TFQA 4P0MA 5FI6A 1L0EA 1K56A 3VSLA 3VP2A 5EVIC 4ZJ1A 3IF6A 4ZAMA 4OPZA 3A3DA 2C5WB 1Z6FA 1XXMA 3UE0A 1KE3A 4R23A 4BD1A 1SDNA 3RJUA 3ZNTA 3UY6A 4BD0A 2EX6A 1EI5A 1ES3A 3ZCZA 4C75A 4OLDA 3UE1A 2R9WA 3VOZA 3IXHA 1I2SA 1CK3A 3DTMA 3FV7A 2Q9MA 3C7VA 1HTZA 1XGIA 1H8ZA 4IBXA 5FAPA 1JWPA 1ES2A 1MKIA 1ES4A 2OLVA 3GV9A 3IQAA 3Q1FA 4H8RA 3GQZA 4WBGA 3ZFZA 1KGGA 5KMWA 1RP5A 3Q81A 1MXOA 1OMEA 2JC7A 3VMAA 4OLGA 1MBLA 1ZKJA 3CJMA 4S2NC 1FOFA 5DTTA 4O7DA 2UWXA 2ZMAA 4E6WA 5KZHA 1BT5A 1N4OA 1IYSA 1GCEA 2G2WA 2XF3A 3NIAA 5FAOA 5E43A 4ZTKA 1GHMA 3HLBA 3M2KA 5TR7A 3D4FA 2ZQ7A 3PBOA 2ZC4B 3CZDA 2Y91A 2DNSA 2ZQ9A 4QY5A 1YM1A 1JWVA 2XD5A 3AGEA 3MBZA 1YMXA 2ZD8A 2BLSA 3ITBA 3BFEA 1BTLA 1RGZA 2EX8A 4ZDXA 1KDWA 2J9OA 2Z2LB 4RVAA 3G2YA 2ZQ8A 2ZQCA 3I7JA 5E2FA 4KQQA 4XUZA 3HUOA 1DJCA 4PM6A 1LI9A 1PI4A 2OV5A 4MEZA 3E2LA 3VFHA 2ZM0A 2ZC3B 2Y59A 3DWKA 4KENB 4ZJ2A 2ZC6B 2Y2LA 2QZ6A 2WGIA 4E6XA 1SHVA 2XR0A 4FH4A 4GZBA 2XLNA 1G68A 1FCNA 1K6SA 5FI7A 3OC2A 3AGFA 3O87A 4GKUA 2FFYA 5F82A 2J9PA 1E25A 1NXYA 3Q7ZA 1TVFA 4HEFA 5L2FA 3LEZA 3ZG5A 4JPMA 2A3UA 4LCLA 1MY8A 5AQBA 3C7UA 4DE2A 4HBUA 4EV4A 3ZHHA 5EVID 3RXWA 3W4PA 3SS4A 1Q2QA 4X56A 3BYDA 1K55C 3IF5A 3PBSA 4MBFA 4WZ4A 5F83A 3ZVTA 1PYYA 3ZNYA 2HP9A 4PM5A 1NZOA 4KZ4A 3BECA 1M6KA 1G6AA 3NDEA 4PM7A 1LLBA 3C4OA 4GDBA 4ZBEA 4X6TA 4DF6A 3UDIA 1L0DA 1GHIA 5CHJA 4KG6A 3FZCA 1HZOA 2R9XA 2GDNA 2V1ZA 3BFFA 5EECA 3O3VA 4FD8A 4Y7PA 5AQAA 4Q8IA 2X02A 5FDHA 3A3EA 1N9BA 4B88A 1FQGA 4Z9QA 1PWDA 4K0XA 4QB8A 1HVBA 3MXRA 1GHPA 4MLLA 3IWOA 5M1AA 1ESIA 3WWXA 1LL5A 1I2WA 4N9LA 1E4DA 5CTMA 4BLMA 1O07A 2HPBA 1PZOA 3OPPA 4MNRA 2Y2JA 5CEBA 3OPHA 3G4PA 2WGWB 1PI5A 4S2KA 3ZG8B 3QNCA 3NDGA 4L0LA 3IF6C 4KQRA 4WM9A 1K4FA 4XXRA 2Y2OA 1LHYA 3MXSA 3Q7VB 5JYOA 2Y2KA 4LV2A 2RCXA 1NZUA 4YINA 1CI8A 3CMZA 2BG1A 2J8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJN A;  1GA0 A;  2P9V B;  3A3F A;  4R1G A;  3DW0 A;  2OSU A;  3FYZ A;  3Q07 A;  5CGX A;  2XFS A;  1TDG A;  4KZ8 A;  2WKE A;  3HLW A;  3C4P A;  3W8K A;  2EFU A;  3BFD A;  2X01 A;  3LCE A;  4WZ5 A;  4DXC A;  2V20 A;  3A3J A;  3LO7 A;  1JTD A;  1ONG A;  4HBT A;  5HAI A;  1FSY A;  4OP8 A;  3ISG A;  1K54 C;  1GA9 A;  1BZA A;  1CEF A;  4X53 A;  4QJG A;  3WS1 A;  4EBN A;  1J9M A;  2Q9N A;  1BUE A;  4DRT A;  4E3J A;  1K57 A;  1FR6 A;  3SH7 A;  3P09 A;  4HES A;  4M3K A;  1U60 A;  3PBN A;  4KZB A;  2J7V A;  3FKV A;  4OOY A;  3PBQ A;  1FCM A;  3N4I A;  3W4Q A;  3ZGA B;  4OKP A;  1BLS A;  3BRM A;  3OZH A;  4OP5 A;  1KGF A;  4WEL A;  3VSK A;  1VQQ A;  5FQJ A;  1FCO A;  5DTK A;  4P85 A;  3G30 A;  1IEM A;  2WZX A;  3G31 A;  4BJP A;  4K0W A;  3O88 A;  4UHU A;  4EBL A;  4N1X A;  5GL9 A;  5A92 A;  4U0X A;  3MZD A;  4KG2 A;  1BLC A;  3IHB A;  4MBK A;  5EVI B;  2H10 A;  4RYE A;  5CER A;  3M6B A;  1JWZ A;  5CHM A;  3ZG7 B;  3HLD A;  1SCW A;  3MZF A;  3V3R A;  1K6R A;  2EX9 A;  4DDS A;  5FA7 A;  5F1F A;  4X68 A;  4QHC A;  5FQI A;  3N6I A;  1KE0 A;  1IEL A;  4WEJ A;  1CEG A;  1WYB A;  3QHY A;  4OQH A;  4ZJ3 A;  4OOL A;  1IKG A;  1K56 D;  1W79 A;  5GLA A;  5TGF A;  3SH8 A;  3IWI A;  5U47 A;  4OPY A;  3TOI A;  2RL3 A;  3OPL A;  1K4E A;  3HLG A;  3MKF A;  3WS2 A;  1MWU A;  4QU3 A;  4LCM A;  5KSC A;  2WYX A;  1NY0 A;  3G34 A;  2Y2G A;  3OCL A;  3GVB A;  2WKH A;  4KZ7 A;  3UDF A;  3Q82 A;  1K38 A;  5J8X A;  1KE4 A;  4S2N A;  5HW3 A;  1RGY A;  3BM6 A;  4GB7 A;  1ERO A;  3EQU A;  3MZE A;  3B3X A;  4R3J A;  1LL9 A;  4OQ0 A;  4GDN A;  4E3L A;  4XUX A;  5HAQ A;  5E2G A;  2ZC5 B;  1YT4 A;  1QMF A;  4QD4 A;  1IYP A;  3M6H A;  1IYO A;  1E3U A;  5FQQ A;  1PW8 A;  3WS4 A;  3N8S A;  1BUL A;  3FWL A;  3QNB A;  4KQO A;  4RX2 A;  4E3I A;  4PPR A;  4S2J A;  4S2M A;  1YQS A;  3NY4 A;  3MKE A;  2XQZ A;  4E3K A;  3GSG A;  3O86 A;  1XA1 A;  2WAE A;  3BFC A;  4IED A;  4UA7 A;  5AQ9 A;  3V39 A;  3VP0 A;  1L2S A;  5FI2 A;  2IWC A;  1NRF A;  5HAR A;  3NI9 A;  3CG5 A;  5GLC A;  1NJ4 A;  2IWD A;  3HVF A;  4DXB A;  1S0W A;  5HX9 A;  4C3Q A;  2XDM A;  1M40 A;  3UE3 A;  4GD8 A;  2PBY A;  3NC8 A;  4IVI A;  3MFD A;  5EE8 A;  2OLU A;  3VOY A;  3HUM A;  3UPP A;  4P87 A;  4EWF A;  4FCF A;  1Q2P A;  1YLJ A;  3BLS A;  3C5A A;  4UAA A;  2WGW A;  2ZC7 A;  5EOO A;  2V2F F;  1YMS A;  2Y2N A;  2HDR A;  3PAE A;  3UNW A;  4DKI A;  3G2Z A;  1KVL A;  4FH2 A;  4WMC D;  5A91 A;  4E3M A;  4GN2 A;  4LEN A;  2WK0 A;  4CPK A;  4Y0O A;  3AGD A;  5DTS A;  3IH9 A;  5D3O A;  1K55 A;  2WAF A;  3GR2 A;  4KZ3 A;  4EUZ A;  3Q7V A;  4K91 A;  1IKI A;  1W7F A;  3LY4 A;  2ZJ9 A;  2FFF B;  4B4X A;  5EVL A;  4R0Q A;  1XA7 A;  4OVD A;  3VP1 A;  3LY3 A;  3FKW A;  4KZ6 A;  5BOH A;  2P9V A;  3OCN A;  2CC1 A;  5GHY A;  2DCF A;  1JTG A;  4LV3 A;  5FQK A;  1PW1 A;  2E8I A;  4OQG A;  3UPN A;  4NK3 A;  4RA7 A;  4X55 A;  2QPN A;  3ZG0 A;  4B4Z A;  2EFX A;  5HFO A;  2H0Y A;  4S2O A;  3UDX A;  3VP3 A;  2VGK A;  4MBH A;  1JVJ A;  4EBP A;  1PZP A;  1ERQ A;  4KZA A;  2HDU A;  2XFT A;  1K25 A;  2WGV A;  2Z2M B;  1O7E A;  3IF6 B;  3HRE A;  5GHZ A;  4BQM A;  2H0T A;  4OPR A;  3P98 A;  4BL2 A;  1BSG A;  1YLP A;  3ITA A;  2Y2I A;  1XX2 A;  4D2O A;  1PWG A;  3N8R A;  3OPR A;  4NET A;  5EOE A;  3S22 A;  3SOI A;  3EQV A;  4FSF A;  1DJB A;  2XEP A;  3VP4 A;  4N1H A;  2Y2M A;  3G35 A;  4OON A;  3SS3 A;  3WRZ A;  3WS0 A;  2JCH A;  4Y0U A;  5I94 A;  3NCK A;  1ALQ A;  3TG9 A;  2XH9 A;  4EQI A;  1W8Y A;  1LI0 A;  3V3S A;  5E2H A;  4JXV A;  4JF6 A;  3IHA A;  1PIO A;  4JXW A;  5FQM A;  1L0G A;  5CHU A;  3VFF A;  5EVI A;  3UO9 A;  4Y0T A;  4JBF A;  1RCJ A;  1PWC A;  5DF7 A;  2EXA A;  4OPQ A;  1NYY A;  2Y4A A;  4OH0 A;  4R4S A;  4WYY A;  2QMI A;  1XKZ A;  4R4R A;  3BLM A;  4C6Y A;  4A5R A;  4OQI A;  2ZM2 A;  1TEM A;  3N8L A;  1K54 A;  5M19 A;  1ONH A;  4JKT A;  1FSW A;  1YLW A;  1YLZ A;  4S2I A;  3HL9 A;  3ZG9 B;  2PU2 A;  4N92 A;  1VM1 A;  5EPH A;  1XP4 A;  3N7W A;  4U3T A;  4DDY A;  2PU4 A;  4BL3 A;  3DWZ A;  5KSH A;  3NBL A;  2JE5 A;  3JYI A;  5HAP A;  3WRT A;  1EWZ A;  1YLT A;  2P74 A;  5CGW A;  2XGN A;  3IXG A;  3M2J A;  1QME A;  5EUA A;  1DY6 A;  1XGJ A;  4UA6 A;  2ZM8 A;  3PBR A;  4UA9 A;  5GLB A;  2IWB A;  1KVM A;  1H8Y A;  1KGE A;  3HLC A;  4KZ5 A;  3W4O A;  4DE1 A;  1ESU A;  5E2E A;  1IYQ A;  4DE0 A;  1CI9 A;  1MPL A;  3HLE A;  4E3O A;  5CXW A;  4JLF A;  4QY6 A;  4E3N A;  4LV0 A;  2VGJ A;  4WEK A;  1ZC2 A;  1HD8 A;  3GMW A;  3HLF A;  4GOG A;  3IXB A;  5DF9 A;  4R3B A;  3PTE A;  4S2L A;  3UN7 A;  5FAS A;  2Y55 A;  2X71 A;  1ZG6 A;  5AQ7 A;  4WMC A;  3G32 A;  3PAG A;  4PM8 A;  4IVK A;  4RX3 A;  5M18 A;  1W5D A;  1L0F A;  1TDL A;  1WE4 A;  4OOM A;  2Y2P A;  4IBR A;  5F1G A;  4P6B A;  1XPB A;  3E2K A;  5JYP A;  3ZVW A;  2I72 A;  3IH8 A;  2Y2H A;  4KG5 A;  1MWS A;  3IT9 A;  1ES5 A;  1ZG4 A;  5HL1 A;  2Y2Q A;  2HDQ A;  3IXD A;  5A93 A;  1FR1 A;  4U0T A;  5CRF A;  5FQ9 A;  2DRW A;  3V5M A;  4KZ9 A;  1WYC A;  3WS5 A;  2G2U A;  1YLY A;  3A3I A;  2H5S A;  4PMA A;  1S6R A;  4ID4 A;  1SDE A;  3UPO A;  4WZ5 C;  2A49 A;  2B5R A;  1Y54 A;  1AXB A;  2WUQ A;  4JF5 A;  4DE3 A;  5DVA A;  5FAQ A;  4LV1 A;  3BFG A;  1SKF A;  3S4X A;  4JF4 A;  5CGS A;  2WAD A;  3PBT A;  4GNU A;  4YFM A;  5FSR A;  3TSG A;  2WZZ A;  4N9K A;  4F94 A;  3SH9 A;  5CEC A;  3HBR A;  2ZLY A;  1NYM A;  2ZQD A;  4GD6 A;  2JBF A;  1K57 C;  4JXG A;  3BEB A;  5G18 A;  3SS5 A;  1W8Q A;  1MWT A;  2ZQA A;  1DJA A;  4PM9 A;  1C3B A;  5DF8 A;  5GHX A;  5IHV A;  1KDS A;  4BEN A;  5FAT A;  3IWQ A;  3ZDJ A;  2HDS A;  1E3U D;  1ERM A;  3GTC A;  4X69 A;  1I5Q A;  2C6W B;  2EX2 A;  3HUN A;  3RXX A;  2WKI A;  3GRJ A;  5A90 A;  1BLH A;  2XD1 A;  5CTN A;  2EXB A;  5GLD A;  1MWR A;  3S1Y A;  1BLP A;  4S2P A;  1H5X A;  3V50 A;  2XK1 A;  5CED A;  2HP5 A;  4JXS A;  2HP6 A;  5TFQ A;  4P0M A;  5FI6 A;  1L0E A;  1K56 A;  3VSL A;  3VP2 A;  5EVI C;  4ZJ1 A;  3IF6 A;  4ZAM A;  4OPZ A;  3A3D A;  2C5W B;  1Z6F A;  1XXM A;  3UE0 A;  1KE3 A;  4R23 A;  4BD1 A;  1SDN A;  3RJU A;  3ZNT A;  3UY6 A;  4BD0 A;  2EX6 A;  1EI5 A;  1ES3 A;  3ZCZ A;  4C75 A;  4OLD A;  3UE1 A;  2R9W A;  3VOZ A;  3IXH A;  1I2S A;  1CK3 A;  3DTM A;  3FV7 A;  2Q9M A;  3C7V A;  1HTZ A;  1XGI A;  1H8Z A;  4IBX A;  5FAP A;  1JWP A;  1ES2 A;  1MKI A;  1ES4 A;  2OLV A;  3GV9 A;  3IQA A;  3Q1F A;  4H8R A;  3GQZ A;  4WBG A;  3ZFZ A;  1KGG A;  5KMW A;  1RP5 A;  3Q81 A;  1MXO A;  1OME A;  2JC7 A;  3VMA A;  4OLG A;  1MBL A;  1ZKJ A;  3CJM A;  4S2N C;  1FOF A;  5DTT A;  4O7D A;  2UWX A;  2ZMA A;  4E6W A;  5KZH A;  1BT5 A;  1N4O A;  1IYS A;  1GCE A;  2G2W A;  2XF3 A;  3NIA A;  5FAO A;  5E43 A;  4ZTK A;  1GHM A;  3HLB A;  3M2K A;  5TR7 A;  3D4F A;  2ZQ7 A;  3PBO A;  2ZC4 B;  3CZD A;  2Y91 A;  2DNS A;  2ZQ9 A;  4QY5 A;  1YM1 A;  1JWV A;  2XD5 A;  3AGE A;  3MBZ A;  1YMX A;  2ZD8 A;  2BLS A;  3ITB A;  3BFE A;  1BTL A;  1RGZ A;  2EX8 A;  4ZDX A;  1KDW A;  2J9O A;  2Z2L B;  4RVA A;  3G2Y A;  2ZQ8 A;  2ZQC A;  3I7J A;  5E2F A;  4KQQ A;  4XUZ A;  3HUO A;  1DJC A;  4PM6 A;  1LI9 A;  1PI4 A;  2OV5 A;  4MEZ A;  3E2L A;  3VFH A;  2ZM0 A;  2ZC3 B;  2Y59 A;  3DWK A;  4KEN B;  4ZJ2 A;  2ZC6 B;  2Y2L A;  2QZ6 A;  2WGI A;  4E6X A;  1SHV A;  2XR0 A;  4FH4 A;  4GZB A;  2XLN A;  1G68 A;  1FCN A;  1K6S A;  5FI7 A;  3OC2 A;  3AGF A;  3O87 A;  4GKU A;  2FFY A;  5F82 A;  2J9P A;  1E25 A;  1NXY A;  3Q7Z A;  1TVF A;  4HEF A;  5L2F A;  3LEZ A;  3ZG5 A;  4JPM A;  2A3U A;  4LCL A;  1MY8 A;  5AQB A;  3C7U A;  4DE2 A;  4HBU A;  4EV4 A;  3ZHH A;  5EVI D;  3RXW A;  3W4P A;  3SS4 A;  1Q2Q A;  4X56 A;  3BYD A;  1K55 C;  3IF5 A;  3PBS A;  4MBF A;  4WZ4 A;  5F83 A;  3ZVT A;  1PYY A;  3ZNY A;  2HP9 A;  4PM5 A;  1NZO A;  4KZ4 A;  3BEC A;  1M6K A;  1G6A A;  3NDE A;  4PM7 A;  1LLB A;  3C4O A;  4GDB A;  4ZBE A;  4X6T A;  4DF6 A;  3UDI A;  1L0D A;  1GHI A;  5CHJ A;  4KG6 A;  3FZC A;  1HZO A;  2R9X A;  2GDN A;  2V1Z A;  3BFF A;  5EEC A;  3O3V A;  4FD8 A;  4Y7P A;  5AQA A;  4Q8I A;  2X02 A;  5FDH A;  3A3E A;  1N9B A;  4B88 A;  1FQG A;  4Z9Q A;  1PWD A;  4K0X A;  4QB8 A;  1HVB A;  3MXR A;  1GHP A;  4MLL A;  3IWO A;  5M1A A;  1ESI A;  3WWX A;  1LL5 A;  1I2W A;  4N9L A;  1E4D A;  5CTM A;  4BLM A;  1O07 A;  2HPB A;  1PZO A;  3OPP A;  4MNR A;  2Y2J A;  5CEB A;  3OPH A;  3G4P A;  2WGW B;  1PI5 A;  4S2K A;  3ZG8 B;  3QNC A;  3NDG A;  4L0L A;  3IF6 C;  4KQR A;  4WM9 A;  1K4F A;  4XXR A;  2Y2O A;  1LHY A;  3MXS A;  3Q7V B;  5JYO A;  2Y2K A;  4LV2 A;  2RCX A;  1NZU A;  4YIN A;  1CI8 A;  3CMZ A;  2BG1 A;  2J8Y A; 
#chains in the Genus database with same CATH topology
 4R1G A;  3CLO A;  3CUE C;  4HNB A;  1YSQ A;  3U4L P;  2QKP A;  4MN5 A;  5F5Y A;  2X01 A;  3EGD C;  4WZ5 A;  1ONG A;  4Z1W A;  5HAI A;  2VV7 A;  5I5L A;  4P6Z M;  1K54 C;  4QJG A;  1P9W A;  4NXB A;  4EBN A;  4M3K A;  1U60 A;  4KZB A;  4OOY A;  2O9C A;  3W4Q A;  4ETX A;  3LR5 A;  1BLS A;  3BRM A;  4WEL A;  1FCO A;  5DTK A;  3E4Q A;  4ARZ B;  1UWN X;  3G31 A;  4Q0J A;  4EBL A;  3LEQ A;  1JNU A;  3MZD A;  3IHB A;  3JPU A;  5EVI B;  5CHM A;  3HLD A;  3V3R A;  4QHC A;  1LSX A;  4WEJ A;  1CEG A;  3K2N A;  4XT2 A;  3F1N B;  1F2K A;  4NXF A;  3R7W B;  1H0M A;  3IBJ A;  1K4E A;  3WS2 A;  2HJ9 C;  5KSC A;  2WYX A;  1NY0 A;  3OCL A;  3GVB A;  1G5U A;  1KE4 A;  2XA7 S;  4S2N A;  4GB7 A;  3EQU A;  4R3J A;  4E3L A;  4XUX A;  5HAQ A;  3B33 A;  1E3U A;  4IJG A;  1TS8 A;  4D60 A;  2QJ5 A;  4KQO A;  4PPR A;  4S2M A;  1YQS A;  3NOU C;  4E3K A;  3BFC A;  4UA7 A;  4IED A;  3VP0 A;  1L2S A;  5HAR A;  2A2L A;  3S7P A;  1OTD A;  2IWD A;  2PBY A;  5EE8 A;  3HUM A;  4JGO A;  4EWF A;  2W3E A;  1OT9 A;  2WGW A;  2ZC7 A;  1YMS A;  2BAS A;  3PAE A;  4DKI A;  3O5Y A;  4K91 A;  5LBR A;  2FFF B;  4B4X A;  4JGQ A;  3LY3 A;  1DP9 A;  3CI6 A;  5GHY A;  1PW1 A;  4HH3 A;  1G6O A;  3UB6 A;  3PYP A;  2QPN A;  3UB9 A;  1T1A A;  2VGK A;  1WA9 A;  1K25 A;  3HRE A;  4BQM A;  4OPR A;  1XX2 A;  1T18 A;  2D01 A;  3TRC A;  4FUW A;  4D2O A;  1PWG A;  4LRX C;  3QP8 A;  3NCK A;  1OTB A;  4K08 A;  4EQI A;  3F1P A;  5E2H A;  1T1B A;  3CUE A;  1L0G A;  2HV1 A;  1RCJ A;  5HD3 A;  5DF7 A;  4WN5 A;  1D06 A;  4A5R A;  1TEM A;  1K54 A;  4JKT A;  1YLW A;  5HDS A;  4S2I A;  3GDI A;  3K3D A;  4R38 A;  3T50 A;  3N7W A;  4HP4 A;  4GHI B;  2J80 A;  3JYI A;  1YLT A;  5MC7 A;  5EUA A;  4HHD A;  1XGJ A;  3W4O A;  1KGE A;  4KZ5 A;  4DE1 A;  1OJ5 A;  1IYQ A;  2J3T C;  4LV0 A;  1S4R A;  2VA0 A;  1HD8 A;  3GMW A;  4GOG A;  3IXB A;  5DF9 A;  5FAS A;  4RQ9 A;  1ZG6 A;  3MR0 A;  2FZ0 A;  3DTI A;  1L0F A;  1TDL A;  1WE4 A;  3BWL A;  4OOM A;  2NUP C;  5L09 A;  3NEC A;  3IH8 A;  1MWS A;  2JKT I;  1ODV A;  1ES5 A;  1ZG4 A;  2HDQ A;  3IXD A;  5A93 A;  1LSV A;  2DRW A;  3V5M A;  3LI8 A;  1S6R A;  2W3D A;  1T19 A;  2B5R A;  1Y54 A;  4KUK A;  4JF5 A;  1PFL A;  1SKF A;  4BBV A;  5FSR A;  4GNU A;  4F94 A;  2ZLY A;  1NYM A;  4GD6 A;  1XJ6 A;  1K57 C;  2QWS A;  5G18 A;  5KIZ A;  3DAV A;  1DP8 A;  2KLI A;  1E3U D;  3HUN A;  3R4K A;  1BLH A;  3KYE A;  2VK3 A;  2EXB A;  1MWR A;  1BLP A;  4CLC D;  5HDC A;  4JXS A;  5FI6 A;  4X25 A;  3NHQ A;  1H3Q A;  4ZJ1 A;  4ZAM A;  1VHM A;  4OPZ A;  3UE0 A;  4BD1 A;  1SDN A;  4IHQ A;  1CQA A;  1N9N A;  1EI5 A;  3ZCZ A;  3S7O A;  1I2S A;  1FIK A;  4UQI S;  3FV7 A;  4LGW A;  1W63 Q;  1HTZ A;  4DJ3 A;  1CF0 A;  4IBX A;  3IQA A;  4H8R A;  3GQZ A;  3JVU A;  1KGG A;  5KMW A;  3Q81 A;  2JC7 A;  3B42 A;  4OLG A;  3CJM A;  1FOF A;  1BT5 A;  3QP4 A;  2E8J A;  2G2W A;  4ZTK A;  1GHM A;  5TR7 A;  3D4F A;  3CZD A;  4QY5 A;  1YM1 A;  4HP9 A;  1YMX A;  2ZD8 A;  4L9F A;  3ITB A;  2EX8 A;  4ZDX A;  1KDW A;  3G2Y A;  4ME4 A;  2Y8H A;  1YSP A;  4XUZ A;  3HUO A;  1DJC A;  2VGL S;  4PM6 A;  4XT2 B;  4MEZ A;  2VZW A;  2MJ6 A;  3T4K A;  2O99 A;  3LR4 A;  5HWV A;  5J7E A;  2QZ6 A;  2XR0 A;  4FH4 A;  2WKR A;  2XLN A;  1G68 A;  4GKU A;  1NXY A;  5L2F A;  4DE2 A;  3BYD A;  3ZVT A;  5F83 A;  3NOT C;  2HP9 A;  3H82 A;  1VET A;  4CLC B;  3C4O A;  3D72 A;  4DF6 A;  4KG6 A;  4FD8 A;  5AQA A;  4MN7 A;  4B88 A;  1FQG A;  4Z9Q A;  4MMN A;  3IWO A;  1ESI A;  3WWX A;  1I2W A;  4N9L A;  4BLM A;  1PZO A;  2Y2J A;  2WGW B;  5IS1 A;  3H7W A;  2LB5 A;  3ICY A;  3EWK A;  1D7E A;  4GCZ A;  2Y2O A;  3MXS A;  1TS6 A;  2Y2K A;  4Y2F A;  1NZU A;  3CMZ A;  2BG1 A;  4QY6 A;  1GA0 A;  4BBU A;  2OSU A;  1F9I A;  3Q07 A;  2PT7 A;  3HLW A;  2EFU A;  3LCE A;  2V20 A;  1XFN A;  3LO7 A;  1JTD A;  5A8B A;  1GA9 A;  4KUO A;  1J9M A;  3IX8 A;  1K57 A;  1FR6 A;  3SH7 A;  4PKY G;  3MQO A;  4HES A;  1LSW A;  2M7U A;  3PBN A;  3PBQ A;  5DJT A;  2K2N A;  3ZGA B;  3LYX A;  3OZH A;  4EES A;  3O88 A;  3F1P B;  4UHU A;  5F68 A;  5GL9 A;  5A92 A;  4U0X A;  4MBK A;  2H10 A;  3HJI A;  3ZG7 B;  1K6R A;  2DMW A;  3BQA A;  3QHY A;  4ZJ3 A;  1W79 A;  3EGX C;  4I3I A;  5GLA A;  3TOI A;  3HLG A;  1F98 A;  4I3J A;  1PNE A;  4HQA A;  3LIF A;  3P01 A;  3UDF A;  3Q82 A;  2CMN A;  3BM6 A;  1ERO A;  4X1M A;  5E2G A;  4G3K A;  5FQQ A;  5FL3 A;  3N8S A;  3FWL A;  1KOU A;  4S2J A;  3O86 A;  3NJA A;  3T4J A;  3NI9 A;  2ZMF A;  2PAV P;  4C3Q A;  1M40 A;  3GEC A;  1GSV A;  3C30 A;  3NC8 A;  1S1Y A;  2OLU A;  3VOY A;  2KDK A;  1NWZ A;  3A0V A;  1Q2P A;  3BLS A;  4UAA A;  2G7U A;  3G2Z A;  4WMC D;  4E3M A;  3ULF A;  3AGD A;  2WAF A;  3GR2 A;  4EUZ A;  3Q7V A;  3MQ0 A;  1W7F A;  4I3A A;  3BW6 A;  3V67 A;  3OCN A;  1JTG A;  1VB6 A;  4EXO A;  4R3A A;  2Q0O A;  2GJ3 A;  4S2O A;  3VP3 A;  4EBP A;  2XSS A;  1ACF A;  1ERQ A;  1PZP A;  4KZA A;  2HDU A;  4BMW A;  2WGV A;  1O7E A;  4BL2 A;  1YLP A;  4I39 A;  4LRY C;  3N8R A;  3OPR A;  4NET A;  3S22 A;  3SOI A;  3L9K A;  1MZU A;  3UB7 A;  3CIT A;  5HD5 A;  1DP6 A;  4N1H A;  2Y2M A;  4OON A;  3C2W A;  3WS0 A;  3H9W A;  3FG8 A;  1LI0 A;  3V3S A;  1K0K A;  4JF6 A;  1W63 M;  3IS2 B;  2EA9 A;  4OPQ A;  4EQ1 A;  1NYY A;  4WYY A;  5EM0 A;  1AWI A;  1BYW A;  4BBT A;  2P08 A;  4LLO B;  5DKK A;  4BL3 A;  3SZT A;  1EWZ A;  2BTF P;  1DY6 A;  3PBR A;  4WUJ A;  3EOI A;  4HJ4 A;  1NLY A;  1STZ A;  5E2E A;  3HLE A;  1ZTU A;  3MMH A;  2WKP A;  4WEK A;  5J4E A;  3K3C A;  1OTE A;  4R3B A;  3PTE A;  4L9G A;  2X71 A;  2V0U A;  3G32 A;  3PAG A;  2V1A A;  5M18 A;  1W5D A;  3T12 B;  4P6B A;  5JYP A;  3ZVW A;  2I72 A;  2Y2H A;  3LI9 A;  3VOL A;  4U0T A;  1VET B;  3MQQ A;  3WS5 A;  1YLY A;  4ID4 A;  1SDE A;  3W2Z A;  1OTI A;  1V9Z A;  2WUQ A;  3S4X A;  4JF4 A;  5CGS A;  2WAD A;  3PBT A;  2VV8 A;  5CEC A;  2WZZ A;  4N9K A;  2ZQD A;  3H7W B;  2JBF A;  3SS5 A;  3TJZ C;  4GW9 A;  2ZQA A;  5IHV A;  4DJ2 A;  3BQ8 A;  5TBM B;  3TW8 A;  4BEN A;  3ZDJ A;  4GS9 A;  1I5Q A;  3RXX A;  5A90 A;  2JKR I;  2EWV A;  5GLD A;  1UWP X;  4HIA A;  2XK1 A;  4M4X A;  4P0M A;  5EVI C;  2O9B A;  3IF6 A;  4R70 A;  3A3D A;  2ZL1 B;  1KE3 A;  3UY6 A;  5DJU A;  2EX6 A;  5DFX A;  1ES3 A;  4C75 A;  4OLD A;  3B47 A;  2R78 A;  4NXE A;  3IXH A;  1TS0 A;  3DTM A;  2Q9M A;  3C7V A;  4Y0O A;  1JWP A;  1ES2 A;  1GSW A;  3E4O A;  3TE8 A;  1OME A;  3VMA A;  1MBL A;  4O7D A;  5KZH A;  1GCE A;  2LB9 A;  1F5M A;  5E43 A;  3HLB A;  2HGV A;  2VX8 A;  3PBO A;  2ZQ7 A;  4EER A;  2YKH A;  3T4T A;  2GZA A;  2J9O A;  3T4Q A;  4RVA A;  1HLU P;  3I7J A;  4KQQ A;  2GNX A;  2QYB A;  5HDD A;  4Y15 A;  1SKO B;  4MN6 A;  3T1X A;  3S7Q A;  2PD7 A;  4ZJ2 A;  2QJ7 A;  1K6S A;  1FCN A;  5FI7 A;  4NKP A;  3O87 A;  1TF1 A;  3Q7Z A;  4EET B;  4G3V A;  4HEF A;  3LEZ A;  1P9R A;  3T1S A;  2A3U A;  1XJ4 A;  2A24 A;  4HBU A;  4EV4 A;  3ZHH A;  5DKL A;  3W4P A;  3PBS A;  4WZ4 A;  1PYY A;  2Z6D A;  4F3L A;  4KZ4 A;  3BEC A;  3NDE A;  4GDB A;  4WLA A;  1D1J A;  5CHJ A;  2V1Z A;  4Q8I A;  1N9B A;  3DTK A;  3EEA A;  4K0X A;  4QB8 A;  3D3O A;  1HVB A;  3MXR A;  1GHP A;  4MLL A;  5CTM A;  1O07 A;  2J3W A;  3OPH A;  4L9E A;  3CWF A;  2PBD P;  3NDG A;  4O01 A;  3Q7V B;  1LHY A;  4DMZ A;  5EM1 A;  2PHY A;  4YIN A;  1CI8 A;  2ACG A;  5CGX A;  2XFS A;  3FC7 A;  5EFW A;  4KZ8 A;  2PD8 A;  4DXC A;  4HBT A;  4X53 A;  2JKT M;  3WS1 A;  4DRT A;  5FEG A;  2J7V A;  3FKV A;  3UB8 A;  3KYZ A;  4OKP A;  1SZV A;  4OP5 A;  1TD5 A;  2Y79 A;  1VQQ A;  5FQJ A;  3MFX A;  4P85 A;  2O0Y A;  2WZX A;  4K0W A;  4EW7 A;  4CLC E;  4N1X A;  3E0Y A;  4RYE A;  5CER A;  4NEE D;  1JWZ A;  3MZF A;  5FA7 A;  5EVE A;  5F1F A;  4X68 A;  5FQI A;  3N6I A;  1KE0 A;  4OOL A;  5TGF A;  5F6A A;  5U47 A;  4OPY A;  3OPL A;  4QU3 A;  4LCM A;  3F1N A;  3R7W A;  3G34 A;  1XFQ A;  2Y2G A;  3HCY A;  1YKD A;  1VEU A;  2WKH A;  3KYQ A;  4LRZ E;  4KZ7 A;  2PR6 A;  3KSF A;  1K38 A;  2L0W A;  5HW3 A;  1RGY A;  3MZE A;  1LL9 A;  4OQ0 A;  4GDN A;  3QP5 A;  1IYP A;  3M6H A;  2V8F A;  1IYO A;  3WS4 A;  1DRM A;  3QNB A;  4RX2 A;  3GSG A;  2WAE A;  3FPW A;  3V39 A;  2VJW A;  2L1M A;  2IWC A;  1NRF A;  1NJ4 A;  3HVF A;  1S0W A;  4IUH A;  2W1R A;  4Y5F A;  5HWT A;  4IVI A;  3MFD A;  4KQD A;  4FCF A;  1YLJ A;  3C5A A;  2V2F F;  2Y2N A;  4PKY A;  4FH2 A;  4GN2 A;  4LEN A;  4CPK A;  1OTA A;  4KZ3 A;  2XRN A;  1IKI A;  5K5B A;  2ZJ9 A;  4Q0I A;  3RTY A;  4R0Q A;  4OVD A;  4KZ6 A;  2P9V A;  2CC1 A;  4GS9 B;  4LV3 A;  3LIB A;  1YAX A;  2E8I A;  3UPN A;  4QWO A;  4RA7 A;  4B4Z A;  5HFO A;  3UB5 P;  2QHK A;  1JVJ A;  2JN7 A;  4HJ3 A;  2Z2M B;  3IF6 B;  4P6Z S;  5GHZ A;  3P98 A;  1Y4O A;  5EOE A;  4UQI M;  3LIC A;  2HJE A;  3VP4 A;  3G35 A;  3SS3 A;  2JCH A;  3IX4 A;  1ALQ A;  3TG9 A;  3IX3 A;  1W8Y A;  2OWH A;  1IOU A;  3IHA A;  1PIO A;  4JXW A;  5CHU A;  3VFF A;  4Y0T A;  3UO9 A;  2V8C A;  2EXA A;  2B18 A;  2Y4A A;  1XKZ A;  4YNR A;  3BLM A;  2W3G A;  2ZM2 A;  3RH8 B;  4MCW A;  5M19 A;  1FSW A;  1YLZ A;  4N92 A;  1VM1 A;  5EPH A;  4DDY A;  4ESP A;  1OPX A;  2VGL M;  3NBL A;  2JE5 A;  4I38 A;  5HAP A;  3WRT A;  5CGW A;  2XGN A;  3M2J A;  1QME A;  2P04 A;  4UA6 A;  2IWB A;  2ZM8 A;  4O8G A;  1KVM A;  4CLC C;  1PRQ A;  1CI9 A;  1MPL A;  3CAX A;  5CXW A;  2VGJ A;  1Z09 A;  3HLF A;  2VKS A;  3ZYT A;  4S2L A;  3NOP C;  3UN7 A;  2Y55 A;  3OBF A;  5AQ7 A;  5HWW A;  2XRO A;  2A24 B;  4IBR A;  4B9O A;  3T1Q B;  2Y2Q A;  1FR1 A;  1XJ2 A;  5CRF A;  3LID A;  4KZ9 A;  3LIA A;  3LIE A;  3A3I A;  2H5S A;  2PR5 A;  1GSX A;  2B95 A;  3E4P A;  2V9A A;  5DVA A;  4LV1 A;  3TSG A;  3SH9 A;  3BY8 A;  3HBR A;  3QP1 A;  3BEB A;  1W8Q A;  1MWT A;  5DF8 A;  1DJA A;  5GHX A;  3F1O A;  1CJF A;  5FAT A;  1Y28 A;  4DN0 A;  3ZQ5 A;  3GTC A;  4X69 A;  2EX2 A;  3GRJ A;  2XD1 A;  3VV4 A;  5CTN A;  3HJK A;  5HPI A;  4S2P A;  3V50 A;  3C8C A;  2J3T D;  2HP6 A;  2FH5 A;  5TFQ A;  1YPR A;  1K56 A;  1X0O A;  3PHY A;  2L4R A;  4R23 A;  2V0W A;  3RJU A;  3ZNT A;  4BD0 A;  3EEH A;  3UE1 A;  2R9W A;  4G3W A;  3L7H A;  1OT6 A;  3PR6 A;  2VV6 A;  1XGI A;  2KX6 A;  1ES4 A;  3GV9 A;  1P0Z A;  3OOV A;  2JKG A;  4H6J A;  2M1C A;  2EWW A;  2UWX A;  2ZMA A;  3RFB A;  4E6W A;  1IYS A;  3NIA A;  2ZC4 B;  2ZQ9 A;  1JWV A;  3AGE A;  2K7S A;  4JGR A;  2ZOI A;  3KSG A;  1BTL A;  1RGZ A;  3KSH A;  2Z2L B;  3U2A A;  2ZQC A;  5E2F A;  3D9Y A;  2OAQ 1;  1P97 A;  5IU1 A;  2OV5 A;  3E2L A;  5G4Y A;  1S1Z A;  2IA2 A;  2ZC6 B;  2O9A A;  2Y2L A;  2WGI A;  1S4S A;  4JGP A;  2P7J A;  1VEU B;  2FFY A;  3NUL A;  5F82 A;  2J9P A;  1E25 A;  1TVF A;  4JPM A;  4LCL A;  4R6L A;  5AQB A;  3SS4 A;  1Q2Q A;  3H82 B;  1K55 C;  3IF5 A;  4MBF A;  2INW A;  3C38 A;  1S67 L;  1G6A A;  4PM7 A;  3QP2 A;  2M7V A;  3UDI A;  1L0D A;  1GHI A;  1MKM A;  3FZC A;  5AJG A;  5FDS A;  1T1C A;  1L3L A;  5EEC A;  4CLC A;  4Y7P A;  3JVV A;  3A3E A;  4HY8 A;  3UMD A;  4I5S A;  3UME A;  2HPB A;  3OPP A;  2ZMV A;  3G4P A;  3DTE A;  5HSQ A;  3ZG8 B;  3OLO A;  2YKF A;  5L8M A;  4X1L A;  4L0L A;  4KQR A;  1K4F A;  5JYO A;  2RCX A;  5FQ9 A;  4CJN A;  2P9V B;  3A3F A;  3DW0 A;  3FYZ A;  1TDG A;  2WKE A;  3C4P A;  3W8K A;  3FPV A;  3BFD A;  3UE6 A;  3LFV A;  3A3J A;  5TJJ A;  1FSY A;  4OP8 A;  3ISG A;  3CHW P;  1BZA A;  1CEF A;  2Q9N A;  5C5K A;  1BUE A;  4E3J A;  3P09 A;  2PRF A;  1FCM A;  3N4I A;  4Y13 A;  1KGF A;  3VSK A;  2VEA A;  3G30 A;  1IEM A;  4BJP A;  4IUK A;  3A0R A;  4KG2 A;  1BLC A;  2JHE A;  3M6B A;  1SCW A;  4O0P A;  3IBR A;  4DDS A;  2EX9 A;  3VE3 A;  1IEL A;  1WYB A;  3LR3 A;  4OQH A;  1IKG A;  1K56 D;  4LFU A;  1OJG A;  3SH8 A;  3IWI A;  2JKR M;  2RL3 A;  4UEY A;  1LL8 A;  3QP6 A;  3MKF A;  1MWU A;  2XA7 M;  3KO6 A;  4Q0H A;  2HF6 A;  2UV0 E;  5J8X A;  3B3X A;  2ZC5 B;  2OWJ A;  1YT4 A;  1QMF A;  2W1T A;  4QD4 A;  5G4Z A;  4EEP A;  3MSH A;  1PW8 A;  1BUL A;  4E3I A;  1EW0 A;  4WL9 A;  3NY4 A;  3T4S A;  3MKE A;  2XQZ A;  1XA1 A;  5AQ9 A;  4EU0 A;  5FI2 A;  3CG5 A;  5GLC A;  3T4L A;  4DXB A;  5HX9 A;  2XDM A;  4HOI A;  1H8M A;  3UE3 A;  3SW1 A;  3LR0 A;  4GD8 A;  3LGO A;  4FTX A;  5L07 A;  3UPP A;  4P87 A;  3T1R A;  4GLQ A;  5FEF A;  5EOO A;  3UNW A;  2HDR A;  4Y3I A;  1KVL A;  5A91 A;  2KOI A;  2WK0 A;  5DTS A;  1G28 A;  3CPT A;  1K55 A;  3IH9 A;  5D3O A;  3LY4 A;  3F1O B;  5EVL A;  1XA7 A;  3VP1 A;  3FKW A;  5BOH A;  3A0S A;  2DCF A;  5FQK A;  4OQG A;  3T4O A;  4NK3 A;  1MC0 A;  3BJN A;  4X55 A;  3ZG0 A;  4BWI A;  2EFX A;  2H0Y A;  3UDX A;  3BY9 A;  4MBH A;  2XFT A;  2H0T A;  1BSG A;  3ITA A;  2Y2I A;  1J3W A;  5AVF A;  2Z6C A;  3EQV A;  4FSF A;  1DJB A;  2XEP A;  3WRZ A;  4ARZ A;  4Y0U A;  5I94 A;  2XH9 A;  4JXV A;  4H6J B;  5FQM A;  3MF0 A;  2B02 A;  5EVI A;  4B93 A;  4JBF A;  1PWC A;  4PAU A;  4OH0 A;  4R4S A;  3IS2 A;  2QMI A;  4R4R A;  2NUT C;  4C6Y A;  4OQI A;  3N8L A;  1ONH A;  4HI4 A;  3ZG9 B;  3HL9 A;  2PU2 A;  1XP4 A;  4U3T A;  4YWZ A;  2PU4 A;  3DWZ A;  5KSH A;  3MS6 A;  3LUQ A;  2P74 A;  3IXG A;  5CX7 A;  5GLB A;  4UA9 A;  1H8Y A;  3HLC A;  1ESU A;  4DE0 A;  4E3O A;  2W27 A;  2K31 A;  4JLF A;  4E3N A;  4HH2 A;  1ZC2 A;  5DFY A;  2AVX A;  4AFI A;  4WMC A;  4PM8 A;  4IVK A;  4RX3 A;  2HZ5 A;  4GJ4 A;  2Y2P A;  1ZHH B;  5F1G A;  1XPB A;  3E2K A;  4KG5 A;  2WKQ A;  3IT9 A;  5F69 A;  5HL1 A;  4PHT A;  1WYC A;  2G2U A;  3G6O A;  1TS7 A;  4PMA A;  3UPO A;  4WZ5 C;  4MDZ A;  4FOF A;  2A49 A;  1AXB A;  4DE3 A;  5FAQ A;  5L10 A;  3BFG A;  4YFM A;  2D02 A;  2VLG A;  5HPF A;  1XJ3 A;  4Y17 A;  4JXG A;  4PM9 A;  2W3F A;  1C3B A;  2JKF A;  1KDS A;  3IWQ A;  2HDS A;  2OOL A;  1NLZ A;  1ERM A;  2C6W B;  5TBM A;  2WKI A;  4HJ6 A;  2W0N A;  4CQH A;  3S1Y A;  1H5X A;  3S7N A;  2PDR A;  5CED A;  2HP5 A;  1IFQ A;  1L0E A;  3PXP A;  4LPZ A;  3VSL A;  3VP2 A;  1N9L A;  4E04 A;  2C5W B;  1Z6F A;  1XXM A;  4ETZ A;  4II7 A;  2ZL1 A;  3VOZ A;  1LT0 A;  1CK3 A;  1H8Z A;  5HZH A;  5FAP A;  2OLV A;  1MKI A;  4WBG A;  3ZFZ A;  3Q1F A;  3VE4 A;  1UGU A;  1RP5 A;  1MXO A;  1N9O A;  1ZKJ A;  2I9V A;  4S2N C;  5DTT A;  1N4O A;  1NRJ A;  2XF3 A;  5FAO A;  1V9Y A;  3M2K A;  1A0K A;  2Y91 A;  2DNS A;  3MBZ A;  2XD5 A;  2BLS A;  3MJQ A;  3BFE A;  4GHI A;  2ZQ8 A;  1LI9 A;  1PI4 A;  3P7N A;  3VFH A;  2ZM0 A;  2W3H A;  2ZC3 B;  2Y59 A;  3DWK A;  4KEN B;  1SKO A;  5IT5 A;  4E6X A;  1SHV A;  3DBA A;  4YOF A;  3OC2 A;  3AGF A;  4EUV A;  4NG2 A;  3KX0 X;  2H28 A;  2PYP A;  3ZG5 A;  1MY8 A;  3C7U A;  4QPR A;  5HL6 A;  2W1T B;  5EVI D;  3RXW A;  4F3L B;  4X56 A;  2V1B A;  3ZNY A;  4PM5 A;  5J3W A;  1NZO A;  1M6K A;  1LLB A;  4ZBE A;  4X6T A;  2ZBB A;  2OAP 1;  1HZO A;  2R9X A;  2GDN A;  3BFF A;  3O3V A;  2X02 A;  5FDH A;  4EEU A;  1PWD A;  1S66 L;  1FIL A;  2ZOH A;  5M1A A;  3KSI A;  3E98 A;  1LL5 A;  1E4D A;  5CEB A;  4MNR A;  1PI5 A;  4S2K A;  4WF0 A;  5EV0 A;  2GX5 A;  3QNC A;  3MXQ A;  4WM9 A;  3IF6 C;  3CPT B;  4XXR A;  4LV2 A;  2PYR A;  5AVE A;  4NXG A;  4GZB A;  2J8Y A;  4ZRR A; 
#chains in the Genus database with same CATH homology
 4CJN A;  1GA0 A;  2P9V B;  3A3F A;  4R1G A;  3DW0 A;  2OSU A;  3FYZ A;  3Q07 A;  5CGX A;  2XFS A;  1TDG A;  4KZ8 A;  2WKE A;  3HLW A;  3C4P A;  3W8K A;  2EFU A;  3BFD A;  2X01 A;  3LCE A;  4WZ5 A;  4DXC A;  2V20 A;  3A3J A;  3LO7 A;  1JTD A;  1ONG A;  4HBT A;  5HAI A;  1FSY A;  4OP8 A;  3ISG A;  1K54 C;  1GA9 A;  1BZA A;  1CEF A;  4X53 A;  4QJG A;  3WS1 A;  4EBN A;  1J9M A;  2Q9N A;  1BUE A;  4DRT A;  4E3J A;  1K57 A;  1FR6 A;  3SH7 A;  3P09 A;  4HES A;  4M3K A;  1U60 A;  3PBN A;  4KZB A;  2J7V A;  3FKV A;  4OOY A;  3PBQ A;  1FCM A;  3N4I A;  3W4Q A;  3ZGA B;  4OKP A;  1BLS A;  3BRM A;  3OZH A;  4OP5 A;  1KGF A;  4WEL A;  3VSK A;  1VQQ A;  5FQJ A;  1FCO A;  5DTK A;  4P85 A;  3G30 A;  1IEM A;  2WZX A;  3G31 A;  4BJP A;  4K0W A;  3O88 A;  4UHU A;  4EBL A;  4N1X A;  5GL9 A;  5A92 A;  4U0X A;  3MZD A;  4KG2 A;  1BLC A;  3IHB A;  4MBK A;  5EVI B;  2H10 A;  4RYE A;  5CER A;  3M6B A;  1JWZ A;  5CHM A;  3ZG7 B;  3HLD A;  1SCW A;  3MZF A;  3V3R A;  1K6R A;  2EX9 A;  4DDS A;  5FA7 A;  5F1F A;  4X68 A;  4QHC A;  5FQI A;  3N6I A;  1KE0 A;  1IEL A;  4WEJ A;  1CEG A;  1WYB A;  3QHY A;  4OQH A;  4ZJ3 A;  4OOL A;  1IKG A;  1K56 D;  1W79 A;  5GLA A;  5TGF A;  3SH8 A;  3IWI A;  5U47 A;  4OPY A;  3TOI A;  2RL3 A;  3OPL A;  1K4E A;  3HLG A;  3MKF A;  3WS2 A;  1MWU A;  4QU3 A;  4LCM A;  5KSC A;  2WYX A;  1NY0 A;  3G34 A;  2Y2G A;  3OCL A;  3GVB A;  2WKH A;  4KZ7 A;  3UDF A;  3Q82 A;  1K38 A;  5J8X A;  1KE4 A;  4S2N A;  5HW3 A;  1RGY A;  3BM6 A;  4GB7 A;  1ERO A;  3EQU A;  3MZE A;  3B3X A;  4R3J A;  1LL9 A;  4OQ0 A;  4GDN A;  4E3L A;  4XUX A;  5HAQ A;  5E2G A;  2ZC5 B;  1YT4 A;  1QMF A;  4QD4 A;  1IYP A;  3M6H A;  1IYO A;  1E3U A;  5FQQ A;  1PW8 A;  3WS4 A;  3N8S A;  1BUL A;  3FWL A;  3QNB A;  4KQO A;  4RX2 A;  4E3I A;  4PPR A;  4S2J A;  4S2M A;  1YQS A;  3NY4 A;  3MKE A;  2XQZ A;  4E3K A;  3GSG A;  3O86 A;  1XA1 A;  2WAE A;  3BFC A;  4IED A;  4UA7 A;  5AQ9 A;  3V39 A;  3VP0 A;  1L2S A;  5FI2 A;  2IWC A;  1NRF A;  5HAR A;  3NI9 A;  3CG5 A;  5GLC A;  1NJ4 A;  2IWD A;  3HVF A;  4DXB A;  1S0W A;  5HX9 A;  4C3Q A;  2XDM A;  1M40 A;  3UE3 A;  4GD8 A;  2PBY A;  3NC8 A;  4IVI A;  3MFD A;  5EE8 A;  2OLU A;  3VOY A;  3HUM A;  3UPP A;  4P87 A;  4EWF A;  4FCF A;  1Q2P A;  1YLJ A;  3BLS A;  3C5A A;  4UAA A;  2WGW A;  2ZC7 A;  5EOO A;  2V2F F;  1YMS A;  2Y2N A;  2HDR A;  3PAE A;  3UNW A;  4DKI A;  3G2Z A;  1KVL A;  4FH2 A;  4WMC D;  5A91 A;  4E3M A;  4GN2 A;  4LEN A;  2WK0 A;  4CPK A;  4Y0O A;  3AGD A;  5DTS A;  3IH9 A;  5D3O A;  1K55 A;  2WAF A;  3GR2 A;  4KZ3 A;  4EUZ A;  3Q7V A;  4K91 A;  1IKI A;  1W7F A;  3LY4 A;  2ZJ9 A;  2FFF B;  4B4X A;  5EVL A;  4R0Q A;  1XA7 A;  4OVD A;  3VP1 A;  3LY3 A;  3FKW A;  4KZ6 A;  5BOH A;  2P9V A;  3OCN A;  2CC1 A;  5GHY A;  2DCF A;  1JTG A;  4LV3 A;  5FQK A;  1PW1 A;  2E8I A;  4OQG A;  3UPN A;  4NK3 A;  4RA7 A;  4X55 A;  2QPN A;  3ZG0 A;  4B4Z A;  2EFX A;  5HFO A;  2H0Y A;  4S2O A;  3UDX A;  3VP3 A;  2VGK A;  4MBH A;  1JVJ A;  4EBP A;  1PZP A;  1ERQ A;  4KZA A;  2HDU A;  2XFT A;  1K25 A;  2WGV A;  2Z2M B;  1O7E A;  3IF6 B;  3HRE A;  5GHZ A;  4BQM A;  2H0T A;  4OPR A;  3P98 A;  4BL2 A;  1BSG A;  1YLP A;  3ITA A;  2Y2I A;  1XX2 A;  4D2O A;  1PWG A;  3N8R A;  3OPR A;  4NET A;  5EOE A;  3S22 A;  3SOI A;  3EQV A;  4FSF A;  1DJB A;  2XEP A;  3VP4 A;  4N1H A;  2Y2M A;  3G35 A;  4OON A;  3SS3 A;  3WRZ A;  3WS0 A;  2JCH A;  4Y0U A;  5I94 A;  3NCK A;  1ALQ A;  3TG9 A;  2XH9 A;  4EQI A;  1W8Y A;  1LI0 A;  3V3S A;  5E2H A;  4JXV A;  4JF6 A;  3IHA A;  1PIO A;  4JXW A;  5FQM A;  1L0G A;  5CHU A;  3VFF A;  5EVI A;  3UO9 A;  4Y0T A;  4JBF A;  1RCJ A;  1PWC A;  5DF7 A;  2EXA A;  4OPQ A;  1NYY A;  2Y4A A;  4OH0 A;  4R4S A;  4WYY A;  2QMI A;  1XKZ A;  4R4R A;  3BLM A;  4C6Y A;  4A5R A;  4OQI A;  2ZM2 A;  1TEM A;  3N8L A;  1K54 A;  5M19 A;  1ONH A;  4JKT A;  1FSW A;  1YLW A;  1YLZ A;  4S2I A;  3HL9 A;  3ZG9 B;  2PU2 A;  4N92 A;  1VM1 A;  5EPH A;  1XP4 A;  3N7W A;  4U3T A;  4DDY A;  2PU4 A;  4BL3 A;  3DWZ A;  5KSH A;  3NBL A;  2JE5 A;  3JYI A;  5HAP A;  3WRT A;  1EWZ A;  1YLT A;  2P74 A;  5CGW A;  2XGN A;  3IXG A;  3M2J A;  1QME A;  5EUA A;  1DY6 A;  1XGJ A;  4UA6 A;  2ZM8 A;  3PBR A;  4UA9 A;  5GLB A;  2IWB A;  1KVM A;  1H8Y A;  1KGE A;  3HLC A;  4KZ5 A;  3W4O A;  4DE1 A;  1ESU A;  5E2E A;  1IYQ A;  4DE0 A;  1CI9 A;  1MPL A;  3HLE A;  4E3O A;  5CXW A;  4JLF A;  4QY6 A;  4E3N A;  4LV0 A;  2VGJ A;  4WEK A;  1ZC2 A;  1HD8 A;  3GMW A;  3HLF A;  4GOG A;  3IXB A;  5DF9 A;  4R3B A;  3PTE A;  4S2L A;  3UN7 A;  5FAS A;  2Y55 A;  2X71 A;  1ZG6 A;  5AQ7 A;  4WMC A;  3G32 A;  3PAG A;  4PM8 A;  4IVK A;  4RX3 A;  5M18 A;  1W5D A;  1L0F A;  1TDL A;  1WE4 A;  4OOM A;  2Y2P A;  4IBR A;  5F1G A;  4P6B A;  1XPB A;  3E2K A;  5JYP A;  3ZVW A;  2I72 A;  3IH8 A;  2Y2H A;  4KG5 A;  1MWS A;  3IT9 A;  1ES5 A;  1ZG4 A;  5HL1 A;  2Y2Q A;  2HDQ A;  3IXD A;  5A93 A;  1FR1 A;  4U0T A;  5CRF A;  5FQ9 A;  2DRW A;  3V5M A;  4KZ9 A;  1WYC A;  3WS5 A;  2G2U A;  1YLY A;  3A3I A;  2H5S A;  4PMA A;  1S6R A;  4ID4 A;  1SDE A;  3UPO A;  4WZ5 C;  2A49 A;  2B5R A;  1Y54 A;  1AXB A;  2WUQ A;  4JF5 A;  4DE3 A;  5DVA A;  5FAQ A;  4LV1 A;  3BFG A;  1SKF A;  3S4X A;  4JF4 A;  5CGS A;  2WAD A;  3PBT A;  4GNU A;  4YFM A;  5FSR A;  3TSG A;  2WZZ A;  4N9K A;  4F94 A;  3SH9 A;  5CEC A;  3HBR A;  2ZLY A;  1NYM A;  2ZQD A;  4GD6 A;  2JBF A;  1K57 C;  4JXG A;  3BEB A;  5G18 A;  3SS5 A;  1W8Q A;  1MWT A;  2ZQA A;  1DJA A;  4PM9 A;  1C3B A;  5DF8 A;  5GHX A;  5IHV A;  1KDS A;  4BEN A;  5FAT A;  3IWQ A;  3ZDJ A;  2HDS A;  1E3U D;  1ERM A;  3GTC A;  4X69 A;  1I5Q A;  2C6W B;  2EX2 A;  3HUN A;  3RXX A;  2WKI A;  3GRJ A;  5A90 A;  1BLH A;  2XD1 A;  5CTN A;  2EXB A;  5GLD A;  1MWR A;  3S1Y A;  1BLP A;  4S2P A;  1H5X A;  3V50 A;  2XK1 A;  5CED A;  2HP5 A;  4JXS A;  2HP6 A;  5TFQ A;  4P0M A;  5FI6 A;  1L0E A;  1K56 A;  3VSL A;  3VP2 A;  5EVI C;  4ZJ1 A;  3IF6 A;  4ZAM A;  4OPZ A;  3A3D A;  2C5W B;  1Z6F A;  1XXM A;  3UE0 A;  1KE3 A;  4R23 A;  4BD1 A;  1SDN A;  3RJU A;  3ZNT A;  3UY6 A;  4BD0 A;  2EX6 A;  1EI5 A;  1ES3 A;  3ZCZ A;  4C75 A;  4OLD A;  3UE1 A;  2R9W A;  3VOZ A;  3IXH A;  1I2S A;  1CK3 A;  3DTM A;  3FV7 A;  2Q9M A;  3C7V A;  1HTZ A;  1XGI A;  1H8Z A;  4IBX A;  5FAP A;  1JWP A;  1ES2 A;  1MKI A;  1ES4 A;  2OLV A;  3GV9 A;  3IQA A;  3Q1F A;  4H8R A;  3GQZ A;  4WBG A;  3ZFZ A;  1KGG A;  5KMW A;  1RP5 A;  3Q81 A;  1MXO A;  1OME A;  2JC7 A;  3VMA A;  4OLG A;  1MBL A;  1ZKJ A;  3CJM A;  4S2N C;  1FOF A;  5DTT A;  4O7D A;  2UWX A;  2ZMA A;  4E6W A;  5KZH A;  1BT5 A;  1N4O A;  1IYS A;  1GCE A;  2G2W A;  2XF3 A;  3NIA A;  5FAO A;  5E43 A;  4ZTK A;  1GHM A;  3HLB A;  3M2K A;  5TR7 A;  3D4F A;  2ZQ7 A;  3PBO A;  2ZC4 B;  3CZD A;  2Y91 A;  2DNS A;  2ZQ9 A;  4QY5 A;  1YM1 A;  1JWV A;  2XD5 A;  3AGE A;  3MBZ A;  1YMX A;  2ZD8 A;  2BLS A;  3ITB A;  3BFE A;  1BTL A;  1RGZ A;  2EX8 A;  4ZDX A;  1KDW A;  2J9O A;  2Z2L B;  4RVA A;  3G2Y A;  2ZQ8 A;  2ZQC A;  3I7J A;  5E2F A;  4KQQ A;  4XUZ A;  3HUO A;  1DJC A;  4PM6 A;  1LI9 A;  1PI4 A;  2OV5 A;  4MEZ A;  3E2L A;  3VFH A;  2ZM0 A;  2ZC3 B;  2Y59 A;  3DWK A;  4KEN B;  4ZJ2 A;  2ZC6 B;  2Y2L A;  2QZ6 A;  2WGI A;  4E6X A;  1SHV A;  2XR0 A;  4FH4 A;  4GZB A;  2XLN A;  1G68 A;  1FCN A;  1K6S A;  5FI7 A;  3OC2 A;  3AGF A;  3O87 A;  4GKU A;  2FFY A;  5F82 A;  2J9P A;  1E25 A;  1NXY A;  3Q7Z A;  1TVF A;  4HEF A;  5L2F A;  3LEZ A;  3ZG5 A;  4JPM A;  2A3U A;  4LCL A;  1MY8 A;  5AQB A;  3C7U A;  4DE2 A;  4HBU A;  4EV4 A;  3ZHH A;  5EVI D;  3RXW A;  3W4P A;  3SS4 A;  1Q2Q A;  4X56 A;  3BYD A;  1K55 C;  3IF5 A;  3PBS A;  4MBF A;  4WZ4 A;  5F83 A;  3ZVT A;  1PYY A;  3ZNY A;  2HP9 A;  4PM5 A;  1NZO A;  4KZ4 A;  3BEC A;  1M6K A;  1G6A A;  3NDE A;  4PM7 A;  1LLB A;  3C4O A;  4GDB A;  4ZBE A;  4X6T A;  4DF6 A;  3UDI A;  1L0D A;  1GHI A;  5CHJ A;  4KG6 A;  3FZC A;  1HZO A;  2R9X A;  2GDN A;  2V1Z A;  3BFF A;  5EEC A;  3O3V A;  4FD8 A;  4Y7P A;  5AQA A;  4Q8I A;  2X02 A;  5FDH A;  3A3E A;  1N9B A;  4B88 A;  1FQG A;  4Z9Q A;  1PWD A;  4K0X A;  4QB8 A;  1HVB A;  3MXR A;  1GHP A;  4MLL A;  3IWO A;  5M1A A;  1ESI A;  3WWX A;  1LL5 A;  1I2W A;  4N9L A;  1E4D A;  5CTM A;  4BLM A;  1O07 A;  2HPB A;  1PZO A;  3OPP A;  4MNR A;  2Y2J A;  5CEB A;  3OPH A;  3G4P A;  2WGW B;  1PI5 A;  4S2K A;  3ZG8 B;  3QNC A;  3NDG A;  4L0L A;  3IF6 C;  4KQR A;  4WM9 A;  1K4F A;  4XXR A;  2Y2O A;  1LHY A;  3MXS A;  3Q7V B;  5JYO A;  2Y2K A;  4LV2 A;  2RCX A;  1NZU A;  4YIN A;  1CI8 A;  3CMZ A;  2BG1 A;  2J8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...