4FTXA

Crystal structure of ego3 homodimer
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
158
Chain Sequence
HSKNVKGFLENTLKPYDLHSVDFKTSSLQSSMIITATNGGILSYATSNNDVPKNSINEINSVNNLKMMSLLIKDKWSEDENDTEEQHSNSCYPVEIDSFKTKIYTYEMEDLHTCVAQIPNSDLLLLFIAEGSFPYGLLVIKIERAMRELTDLFGYKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SLM4
publication title Ego3 functions as a homodimer to mediate the interaction between Gtr1-Gtr2 and Ego1 in the ego complex to activate TORC1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 42
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16818 SLM4 Protein SLM4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4ftxA01
2V8CA 4D60A 1HLUP 2PBDP 4FTXA 1YPRA 3T1RA 1PNEA 1AWIA 2E8JA 5FEGA 4QWOA 1CF0A 5FEFA 3CPTA 2PAVP 2PRFA 3LEQA 5FDSA 1J3WA 5EM1A 1F2KA 3CPTB 2ACGA 3NECA 1Y4OA 3L7HA 2VK3A 3LGOA 3CHWP 1PFLA 3KYEA 1VEUA 4X1LA 2JKFA 3T1QB 3L9KA 1VEUB 1CQAA 4X25A 1A0KA 3MS6A 1Z09A 4X1MA 1D1JA 1SKOA 4ESPA 1SKOB 3UB5P 3T1XA 1K0KA 1CJFA 1VETA 3T1SA 5EM0A 3MSHA 1SZVA 2V8FA 5EV0A 1VETB 1PRQA 3U4LP 1ACFA 3NULA 2HZ5A 4FUWA 2BTFP 3DAVA 3T12B 1FILA 1FIKA 2ZL1A 1G5UA 2ZL1B 3D9YA 5EVEA 2B95A 2JKGA
chains in the Genus database with same CATH superfamily
4MLLA 1I2WA 2W1RA 4EETB 1RGYA 3IF6B 2L1MA 5MC7A 5AVFA 2QMIA 3AGEA 1PZOA 5FQ9A 3K3CA 5GLBA 4GNUA 4GJ4A 4B93A 3BM6A 2WKRA 3OOVA 4BMWA 4IJGA 1XPBA 3CPTA 5TFQA 4LCMA 3C5AA 3F1PA 4CLCC 1J3WA 2ACGA 3AGDA 2A49A 4EUZA 4C6YA 4HJ4A 5CERA 2JKTI 3H7WB 4JXGA 4PM6A 3CZDA 1TS7A 3PAEA 3KSFA 5GHXA 4DJ3A 2O9AA 1IOUA 5FA7A 1YLPA 2EWVA 2BLSA 2PR6A 3MMHA 3MFDA 5CX7A 3FYZA 4H8RA 4KG5A 2WKQA 3IQAA 2O99A 3PBOA 4MN5A 4N9LA 3KSIA 4KQQA 4JXSA 5HWVA 1VETA 3KSHA 3QP8A 2IWDA 4R0QA 3MSHA 1SZVA 4QY5A 1H0MA 3R4KA 2Y59A 4RX2A 2ZMFA 2ZM0A 3UPNA 5K5BA 4P0MA 5F1FA 2Z6DA 1NXYA 3S1YA 2OWJA 3T12B 2EXAA 1T1AA 3UDXA 4KG6A 5BOHA 3JYIA 2KDKA 3UE0A 2WUQA 1OPXA 3K2NA 3S7PA 4CLCA 5F82A 4DDYA 2XD1A 1PI4A 3LFVA 2ZQ7A 1JWZA 2R78A 3CI6A 2PBDP 2WADA 3NJAA 2Y2MA 2GX5A 3B47A 5HPFA 2G7UA 4ZBEA 4D2OA 4GHIA 3LO7A 4OLDA 3NOTC 1GSXA 3BQ8A 1MWSA 1RGZA 1WYCA 4XUXA 2QZ6A 4E6WA 2K7SA 3P7NA 2PAVP 3SS3A 3S22A 3FPVA 3CLOA 4H6JB 3K3DA 1YQSA 1W63Q 2XD5A 1SDNA 1W8YA 2ZC5B 2H0YA 2JBFA 3BEBA 2P9VB 3MQQA 3CJMA 3V39A 5FQKA 1YLWA 1YT4A 4IUHA 3T4OA 2O9BA 3FV7A 5GLCA 3PBRA 5DFYA 3H82B 1CQAA 4UAAA 4EEPA 4Y3IA 5DTSA 3IS2A 4UQIM 2PYRA 2WK0A 3ITAA 1L3LA 2IWBA 1QMEA 3D4FA 1Q2QA 2JN7A 4EERA 2Y4AA 1P9RA 2GNXA 3UE3A 3SS4A 1WA9A 4ZAMA 2W3HA 2HGVA 1XX2A 4OVDA 2J3TC 3IX4A 5IHVA 3UB8A 3GRJA 4LRXC 1MKMA 2XLNA 1TDLA 1TS6A 2YKHA 1G6OA 1FILA 2VGLS 4KQOA 1FSWA 1FR1A 3WRZA 1OTAA 2ZC4B 3N8LA 2HDSA 2HF6A 3C7VA 3T4KA 4XT2B 3MR0A 4OOMA 4K91A 2QJ7A 5KMWA 4F3LA 5FSRA 1YLJA 1ES5A 2YKFA 3BW6A 3NBLA 5EPHA 3UB6A 3ULFA 1KOUA 4MCWA 4OQHA 1T1BA 3A3DA 2QPNA 3HUOA 1NZUA 1MKIA 4KUOA 5TGFA 3IX3A 4K0WA 3VV4A 4I3JA 2IA2A 1CK3A 2ZQCA 3KYEA 3HVFA 5DTTA 3RXXA 1V9YA 3N7WA 3LIEA 5HFOA 4WMCA 5L10A 5A90A 5TBMA 4KQRA 3UDFA 2WGIA 2VEAA 4S2JA 2JKRI 4RQ9A 4ESPA 1N4OA 4KZBA 4R1GA 4HY8A 2XR0A 2WKHA 2EX2A 2R9WA 4R4SA 2PBYA 2WZXA 2W0NA 1PRQA 1SDEA 4OPRA 3VP2A 4LRZE 3WS1A 4KUKA 3ZDJA 5AQBA 3UB7A 1LT0A 3TOIA 3DAVA 3ZG9B 2GDNA 3EWKA 1TEMA 3Q82A 5U47A 4UA7A 2XFTA 1GHPA 5F5YA 2PYPA 3ZG8B 4WLAA 3N8RA 5HAQA 4PM9A 1JWPA 4EW7A 5A91A 3HBRA 2ZQDA 4KZ4A 3LUQA 1NRFA 1LL9A 1XP4A 4EBNA 2PDRA 3DWKA 1F2KA 2J3WA 4BENA 1NLZA 3B42A 4BD1A 4B4XA 1RP5A 1K4EA 1JWVA 3LIDA 4R70A 4R3JA 4JF5A 3IHBA 3WS0A 1N9LA 1X0OA 1IYOA 2ZM2A 4Y0OA 3A0SA 3CMZA 4CLCD 4MN7A 3MZDA 4OPZA 1EI5A 2HDQA 3TE8A 1BLSA 1XJ4A 4ETXA 2HPBA 3Q1FA 5HWWA 4L9GA 4LRYC 3IWOA 2D02A 1FQGA 1MY8A 4OH0A 1NLYA 4BD0A 4GDNA 3VSLA 4CPKA 3LI9A 1DY6A 4OQGA 3WS2A 3RXWA 3LR4A 5HL6A 4FCFA 1DP6A 1BULA 3NOUC 3VSKA 3VFHA 3CG5A 4DRTA 4PKYA 3MZFA 1KDSA 2PR5A 3GTCA 4X69A 2C5WB 2DMWA 5AVEA 4Q8IA 2ZQ8A 4JF4A 3MF0A 2D01A 3TRCA 2B95A 2HJEA 5KSHA 1YMSA 4EU0A 3EQUA 2I9VA 1UWNX 2I72A 5FAOA 2HP6A 1OJGA 1SKFA 4HBTA 5E43A 5L2FA 5EVLA 3M2JA 1F5MA 1ERQA 4R4RA 2P74A 5L09A 3LI8A 1NY0A 3LEQA 5AQ7A 3CWFA 1PW8A 2LB9A 5GL9A 1LI0A 4IEDA 2XH9A 5L8MA 5CXWA 5DF8A 3A3FA 3SS5A 4HH3A 3MQ0A 4IVIA 1LI9A 3BY8A 5F83A 1E25A 1GSVA 3A3EA 1E3UA 1IKIA 3EEAA 2HJ9C 1ODVA 3PAGA 2Y2KA 4X6TA 1PW1A 4DF6A 1V9ZA 4GCZA 3IWQA 1BLCA 5GHYA 3UB5P 1ZKJA 1XXMA 4BL3A 2VZWA 2QHKA 2Y79A 3SW1A 2ZLYA 5M1AA 4NXGA 3ZG5A 2XA7S 1DP8A 5E2EA 3DTEA 4GN2A 2OAQ1 3R7WA 4E3MA 1LHYA 3S7OA 2J3TD 3VOLA 1I5QA 2XK1A 4WMCD 1W5DA 3FWLA 3VOYA 3G32A 4NETA 3UB9A 4S2PA 1LLBA 1IYQA 1H5XA 1PYYA 4D60A 1H8MA 2Y91A 2HV1A 1FSYA 3SH7A 3T1RA 5EOEA 1FCOA 5G4YA 4QB8A 4JF6A 3LR5A 1IYPA 4JXWA 3B33A 1VM1A 4ID4A 2L0WA 2PRFA 5TR7A 3G35A 3OBFA 2UWXA 3EQVA 3ZG7B 5EVIC 3IXGA 2VK3A 2ZC3B 3IH8A 5IS1A 3HCYA 4GS9B 4I39A 5IT5A 4BL2A 5HDSA 3ZHHA 2J7VA 4B88A 4BLMA 1U60A 2KOIA 3ZYTA 5DJUA 1KE0A 3WS4A 4E3IA 5M18A 3IHAA 1D1JA 3TSGA 1MWTA 1TS0A 4GDBA 5I5LA 3PXPA 4XXRA 3VE3A 3OZHA 5DF7A 4NKPA 1BUEA 3T4LA 2W27A 4PMAA 2ZMAA 5CHJA 3NULA 2A24B 3BY9A 4JGOA 1BSGA 4KZ6A 1XA1A 4GW9A 3B3XA 2ZM8A 4ARZA 2ZL1B 5EVEA 3F1NA 2WAFA 1TVFA 5DVAA 2INWA 5CHMA 3W4QA 3C7UA 3DTIA 4KZ9A 5EVIA 3DW0A 3PBTA 1P0ZA 3F1OA 2Q9NA 1XGJA 4PM8A 1YLZA 5DFXA 4B9OA 4ZRRA 3ICYA 4HJ3A 3BQAA 1J9MA 3T4QA 3ZFZA 2E8IA 4FSFA 2JE5A 3CPTB 3F1PB 4PPRA 1LSVA 2DRWA 1GSWA 5FI2A 2XQZA 4O0PA 3MXRA 1PIOA 4LCLA 4X53A 1ERMA 2HP5A 2XF3A 2Q9MA 3MJQA 4E3KA 3VP3A 2V1ZA 5HPIA 3QP1A 3ITBA 1KVMA 5CTMA 3O86A 2QKPA 1G28A 3KX0X 1JTDA 1BYWA 4IVKA 2Y2JA 2P04A 2VV6A 4GLQA 4DDSA 1OTDA 1XKZA 3C4PA 5E2FA 2Y55A 2QYBA 1STZA 4Y15A 3NDEA 4FH2A 2V8FA 1VETB 4A5RA 3E0YA 4QHCA 1S0WA 2V1BA 4FH4A 3HJIA 1ONHA 3DBAA 4K0XA 5FQIA 4P6BA 4GOGA 1FIKA 1DJAA 5D3OA 1MPLA 4KZ7A 1E3UD 1IKGA 3BJNA 4ZJ2A 1YAXA 4RVAA 3HLWA 4CLCB 4P87A 5LBRA 2M1CA 2XSSA 4P85A 2EX6A 1KVLA 5EFWA 1YPRA 1XFQA 3ZQ5A 1W63M 3C4OA 4CJNA 2PD8A 4QWOA 4Q0JA 4GHIB 4KG2A 3QHYA 5FDHA 1FOFA 3ZVTA 4ZJ1A 3AGFA 5HSQA 3A3JA 3D72A 4II7A 1IELA 4KZAA 1OT6A 3ZGAB 2LB5A 3O3VA 4E04A 4E3NA 3CHWP 2FH5A 4ZJ3A 1PWDA 1CI9A 3WS5A 1OJ5A 3C30A 3E4PA 4RYEA 3HJKA 5EOOA 2Z2MB 3IS2B 4MBHA 2VX8A 3IX8A 5FI7A 3N6IA 5EUAA 3RFBA 2VGLM 2VLGA 3FZCA 3T1XA 1TS8A 3P09A 4OP8A 1LL8A 4DXCA 5EM0A 2V0WA 5CGXA 4DN0A 4QPRA 1NZOA 4BWIA 4OOYA 4L9EA 5DKKA 4S2OA 2RCXA 1Z6FA 3FC7A 3BFCA 4MNRA 4HH2A 5FQMA 2H28A 3UPOA 4CLCE 4WF0A 1IFQA 3LY4A 3VP0A 4HESA 1SCWA 4RX3A 4LFUA 3UN7A 2JKGA 3OPLA 1JVJA 3M6HA 5M19A 1HD8A 1ZG6A 3G30A 4P6ZS 1F9IA 1GCEA 2CMNA 3Q7VA 1ALQA 5HAPA 1H8ZA 1LSXA 4WM9A 4JGPA 1BTLA 3W2ZA 3IXBA 4F3LB 5FEGA 1K4FA 2O9CA 1SHVA 3S7QA 3UY6A 4ME4A 2Y2NA 3N4IA 3HLFA 4WBGA 1S6RA 4HHDA 3NOPC 5CTNA 1NWZA 3PHYA 4O7DA 3EEHA 2Z6CA 3LR3A 4L0LA 4DXBA 4MBKA 1Q2PA 3NY4A 4OPQA 5J3WA 3FG8A 1MC0A 3UMDA 1ES4A 5EVID 4WZ5C 1YKDA 4X55A 4LV3A 1C3BA 3BLMA 1Z09A 3HLDA 5HDDA 1NJ4A 4LGWA 4B4ZA 5TBMB 3S7NA 4QU3A 3UNWA 3PR6A 1SKOA 4R23A 2W1TA 1I2SA 5KSCA 1DP9A 3SOIA 3KYQA 4IUKA 2PU4A 1CJFA 1WYBA 2G2UA 1GHIA 4E6XA 3Q07A 5I94A 1L0EA 3W4PA 2KX6A 2KLIA 3MQOA 3MXSA 3TJZC 2J80A 3N8SA 2OV5A 3HLGA 3IXDA 5E2HA 2C6WB 4PM7A 3W8KA 1VHMA 2HP9A 3O88A 1MBLA 4S2MA 3EOIA 2EFUA 2VGJA 2Q0OA 3OCLA 2QWSA 3E4QA 2O0YA 1VQQA 4OKPA 5L07A 2K2NA 4HEFA 3ZNTA 5DKLA 3UE6A 2HDRA 3BFFA 5DF9A 3BFEA 4U0XA 3UMEA 1YMXA 2B18A 4WZ5A 4HJ6A 3IF6C 4PKYG 5FQJA 2EXBA 1OTBA 3U2AA 5GHZA 3W4OA 2ZD8A 1XJ2A 2J8YA 1YSQA 4UEYA 1K6SA 1Y28A 2X02A 1VEUA 1HVBA 3T1QB 5HARA 4X68A 3P98A 1ONGA 4LPZA 1N9BA 4QY6A 4Q0IA 4Z1WA 3PTEA 1EROA 3D3OA 4RA7A 4EESA 1TDGA 5IU1A 4EEUA 3V67A 4NG2A 4GB7A 5F6AA 2V1AA 4X56A 1EWZA 1KE4A 2G2WA 1TD5A 1YM1A 1ACFA 3NHQA 4JLFA 1UGUA 3JPUA 3TW8A 1G5UA 1JNUA 5HD5A 5CEDA 2XRNA 3D9YA 3IF6A 4Y13A 1UWPX 1LL5A 5HAIA 1K6RA 3EGXC 5KIZA 1HLUP 3QP5A 3Q81A 2EX8A 4C75A 4NXFA 3HUNA 3C38A 4S2KA 2OLUA 1W7FA 5KZHA 2WKEA 3KSGA 4JKTA 2J9OA 3V3SA 5FEFA 4I38A 1F98A 1K38A 5CRFA 5FL3A 2Y2LA 1K57C 3NC8A 4YFMA 1HZOA 4HNBA 4GD8A 4DE1A 3JVUA 2WAEA 1W79A 1D06A 3OC2A 3FKVA 4HP9A 3WRTA 3H7WA 4R38A 4KZ5A 1EW0A 3A0VA 3OPRA 1IYSA 1PFLA 2J9PA 5HW3A 3QP2A 3GDIA 2X01A 2W3GA 2V2FF 3E4OA 3MXQA 2JKFA 2VKSA 4DJ2A 5AJGA 5F68A 3V50A 2VV8A 2XA7M 1YLYA 3G6OA 4PHTA 2EX9A 2W3DA 3T4JA 2IWCA 3LEZA 4DKIA 1N9NA 3EGDC 3PYPA 4HOIA 3RH8B 3HLEA 3VP4A 5G18A 3RTYA 4S2NC 3M2KA 5HZHA 4DE2A 1NYMA 3RJUA 3LICA 4N1XA 3UO9A 2FFFB 5F1GA 1K57A 1K25A 3LIFA 3R7WB 1KGGA 5EECA 1Y54A 4NXEA 2ZJ9A 4IBRA 4I5SA 1XFNA 2Y2QA 3TG9A 2BASA 3IXHA 5AQAA 3NIAA 1TF1A 1OT9A 3Q7ZA 4BBUA 3VP1A 2WGWA 4I3IA 1HTZA 1ZG4A 4FTXA 1PNEA 3S4XA 2E8JA 1MZUA 4E3OA 3BFGA 4LV0A 4U0TA 5A93A 3G34A 2Y8HA 1H8YA 4N1HA 1ES3A 3PBNA 4H6JA 2GZAA 3SH8A 1PWGA 2VJWA 3FPWA 3GVBA 5FDSA 2P9VA 3H9WA 1VB6A 3GV9A 1ES2A 2ZBBA 4EBPA 2Y2IA 2JKTM 2K31A 5G4ZA 3OPHA 2QJ5A 1ZC2A 4EV4A 2PT7A 4WEJA 4M3KA 3ZCZA 4NXBA 3H82A 1IEMA 5FAQA 1W8QA 1JTGA 2CC1A 2VV7A 3O5YA 4X1MA 5DJTA 4S2NA 3LCEA 2XFSA 3IT9A 4EQIA 1S1YA 2FFYA 1K55C 5CGWA 4OQ0A 5CEBA 4GZBA 1BT5A 3VMAA 1BZAA 1D7EA 4N92A 4UQIS 2V9AA 1L0GA 1AXBA 1RCJA 2WGWB 2MJ6A 4FUWA 4O01A 2XEPA 2H0TA 4YNRA 3NDGA 5GLAA 2A3UA 2L4RA 3GECA 4XT2A 4ARZB 4HP4A 3F1NB 2X71A 4Y0TA 2Y2GA 1YLTA 2JCHA 5EVIB 3M6BA 1ESUA 4YWZA 3C2WA 3PBQA 4JGRA 4UHUA 1NYYA 4IBXA 5GLDA 3F1OB 1CF0A 2XDMA 4LENA 3G4PA 4O8GA 4GKUA 2P7JA 1P97A 5EM1A 2H5SA 4R6LA 1P9WA 4S2IA 1KE3A 2W3FA 2JC7A 2OWHA 5A8BA 3L7HA 4EQ1A 1K55A 1M40A 1E4DA 5TJJA 1CI8A 2ZC7A 2PD7A 5HDCA 4F94A 3IWIA 2WZZA 3ZVWA 2NUPC 3KO6A 4X25A 1A0KA 1T19A 1ESIA 3DTMA 3T4SA 5C5KA 1S1ZA 3VE4A 2ZOIA 3MKEA 4OONA 4G3KA 3GMWA 2EFXA 3T1SA 3MZEA 4YINA 1K56A 3HUMA 3V5MA 3T4TA 3LIAA 2WKIA 5J8XA 4MEZA 2M7VA 1ZTUA 4GD6A 5DTKA 4CQHA 4WUJA 4IHQA 1DRMA 3HLCA 1T1CA 3CITA 1GA9A 4AFIA 4Y7PA 3E98A 4JPMA 2WGVA 4FD8A 1LSWA 2PHYA 5FATA 4JGQA 5J4EA 1PZPA 2V8CA 4R3AA 1XJ6A 4OP5A 2JHEA 3P01A 1S4SA 1AWIA 1GA0A 3LY3A 4DE0A 3A3IA 1GHMA 3MKFA 2ZOHA 4N9KA 4WN5A 5F69A 3HLBA 3NECA 1CEGA 4KQDA 3BECA 3ISGA 4BBTA 3VFFA 4EUVA 3A0RA 1O07A 1MWRA 5HL1A 1K54C 1G68A 2OSUA 4WL9A 5HWTA 1MXOA 1DJBA 4L9FA 1O7EA 3GSGA 3MFXA 4Y0UA 4HQAA 2JKRM 1NRJA 2DNSA 4C3QA 4LLOB 1KGEA 2WYXA 3BYDA 2UV0E 2XGNA 1K0KA 3IBJA 2Y2HA 4DMZA 1L2SA 4KENB 1S66L 5EV0A 4P6ZM 1OTIA 4WEKA 2RL3A 3DWZA 4UA6A 4BJPA 4E3JA 5E2GA 5CECA 4MMNA 4OOLA 1MWUA 3HL9A 4Y5FA 4NK3A 4M4XA 3SZTA 3E2KA 1XA7A 3OLOA 3WWXA 4OQIA 4EXOA 4Y17A 3BLSA 2ZQAA 5FI6A 3BFDA 1BLPA 3Q7VB 3G31A 4QD4A 1XGIA 1KDWA 2V0UA 4OPYA 1K54A 1PI5A 5CHUA 3O87A 2VGKA 1FR6A 3QNCA 3CAXA 3ZG0A 1Y4OA 3LR0A 5JYOA 4E3LA 4PAUA 2ZC6B 5JYPA 1L0DA 3GQZA 3LGOA 2A2LA 4BQMA 5FASA 3IF5A 3KYZA 4R3BA 1N9OA 4LV2A 1S4RA 2EWWA 4ZDXA 4G3VA 3IBRA 4QJGA 1H3QA 1BLHA 5AQ9A 3MS6A 4MBFA 4KZ3A 2B5RA 3T50A 5CGSA 1SKOB 4WZ4A 3MBZA 1OMEA 2W1TB 3QNBA 2XROA 4JXVA 2M7UA 3ZNYA 1FCMA 1CEFA 4MN6A 3LYXA 2V20A 2HDUA 3U4LP 4Q0HA 4G3WA 1QMFA 2BTFP 3IH9A 1L0FA 1WE4A 1YSPA 5FAPA 3G2ZA 5HD3A 3NI9A 4PM5A 2B02A 1OTEA 4HBUA 4JBFA 5EE8A 3UDIA 1DJCA 4EBLA 3HREA 3GR2A 5FQQA 3OCNA 2ZQ9A 1ZHHB 4MDZA 4OLGA 2GJ3A 1M6KA 2OAP1 5HX9A 2PU2A 3JVVA 3G2YA 1G6AA 2ZMVA 1K56D 3CUEC 2W3EA 2R9XA 3LIBA 2DCFA 4Z9QA 2AVXA 3SH9A 4GS9A 1PWCA 1T18A 4WELA 4U3TA 4YOFA 3NCKA 4LV1A 1FCNA 4WYYA 2H10A 4Y2FA 4EWFA 4X1LA 4FOFA 4BBVA 3L9KA 4KZ8A 1VEUB 2FZ0A 3FKWA 2Z2LB 2WKPA 2OLVA 4HI4A 2OOLA 3BWLA 2NUTC 3QP6A 4ZTKA 3I7JA 1XJ3A 3DTKA 3UE1A 4XUZA 3UPPA 3V3RA 2VA0A 3OPPA 4UA9A 3PBSA 3VOZA 5J7EA 4ETZA 2Y2PA 5A92A 2A24A 3C8CA 2Y2OA 4HIAA 4DE3A 2HZ5A 1S67L 4S2LA 3BRMA 3E2LA 2P08A 4I3AA 3QP4A 2ZL1A 1KGFA 2BG1A 3CUEA 4NEED 4K08A 2EA9A
chains in the Genus database with same CATH topology
2V8CA 4D60A 1HLUP 2PBDP 4FTXA 1YPRA 3T1RA 1PNEA 1AWIA 2E8JA 5FEGA 4QWOA 1CF0A 5FEFA 3CPTA 2PAVP 2PRFA 3LEQA 5FDSA 1J3WA 5EM1A 1F2KA 3CPTB 2ACGA 3NECA 1Y4OA 3L7HA 2VK3A 3LGOA 3CHWP 1PFLA 3KYEA 1VEUA 4X1LA 2JKFA 3T1QB 3L9KA 1VEUB 1CQAA 4X25A 1A0KA 3MS6A 1Z09A 4X1MA 1D1JA 1SKOA 4ESPA 1SKOB 3UB5P 3T1XA 1K0KA 1CJFA 1VETA 3T1SA 5EM0A 3MSHA 1SZVA 2V8FA 5EV0A 1VETB 1PRQA 3U4LP 1ACFA 3NULA 2HZ5A 4FUWA 2BTFP 3DAVA 3T12B 1FILA 1FIKA 2ZL1A 1G5UA 2ZL1B 3D9YA 5EVEA 2B95A 2JKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8C A;  4D60 A;  1HLU P;  2PBD P;  4FTX A;  1YPR A;  3T1R A;  1PNE A;  1AWI A;  2E8J A;  5FEG A;  4QWO A;  1CF0 A;  5FEF A;  3CPT A;  2PAV P;  2PRF A;  3LEQ A;  5FDS A;  1J3W A;  5EM1 A;  1F2K A;  3CPT B;  2ACG A;  3NEC A;  1Y4O A;  3L7H A;  2VK3 A;  3LGO A;  3CHW P;  1PFL A;  3KYE A;  1VEU A;  4X1L A;  2JKF A;  3T1Q B;  3L9K A;  1VEU B;  1CQA A;  4X25 A;  1A0K A;  3MS6 A;  1Z09 A;  4X1M A;  1D1J A;  1SKO A;  4ESP A;  1SKO B;  3UB5 P;  3T1X A;  1K0K A;  1CJF A;  1VET A;  3T1S A;  5EM0 A;  3MSH A;  1SZV A;  2V8F A;  5EV0 A;  1VET B;  1PRQ A;  3U4L P;  1ACF A;  3NUL A;  2HZ5 A;  4FUW A;  2BTF P;  3DAV A;  3T12 B;  1FIL A;  1FIK A;  2ZL1 A;  1G5U A;  2ZL1 B;  3D9Y A;  5EVE A;  2B95 A;  2JKG A; 
#chains in the Genus database with same CATH topology
 4MLL A;  1I2W A;  2W1R A;  4EET B;  1RGY A;  3IF6 B;  2L1M A;  5MC7 A;  5AVF A;  2QMI A;  3AGE A;  1PZO A;  5FQ9 A;  3K3C A;  5GLB A;  4GNU A;  4GJ4 A;  4B93 A;  3BM6 A;  2WKR A;  3OOV A;  4BMW A;  4IJG A;  1XPB A;  3CPT A;  5TFQ A;  4LCM A;  3C5A A;  3F1P A;  4CLC C;  1J3W A;  2ACG A;  3AGD A;  2A49 A;  4EUZ A;  4C6Y A;  4HJ4 A;  5CER A;  2JKT I;  3H7W B;  4JXG A;  4PM6 A;  3CZD A;  1TS7 A;  3PAE A;  3KSF A;  5GHX A;  4DJ3 A;  2O9A A;  1IOU A;  5FA7 A;  1YLP A;  2EWV A;  2BLS A;  2PR6 A;  3MMH A;  3MFD A;  5CX7 A;  3FYZ A;  4H8R A;  4KG5 A;  2WKQ A;  3IQA A;  2O99 A;  3PBO A;  4MN5 A;  4N9L A;  3KSI A;  4KQQ A;  4JXS A;  5HWV A;  1VET A;  3KSH A;  3QP8 A;  2IWD A;  4R0Q A;  3MSH A;  1SZV A;  4QY5 A;  1H0M A;  3R4K A;  2Y59 A;  4RX2 A;  2ZMF A;  2ZM0 A;  3UPN A;  5K5B A;  4P0M A;  5F1F A;  2Z6D A;  1NXY A;  3S1Y A;  2OWJ A;  3T12 B;  2EXA A;  1T1A A;  3UDX A;  4KG6 A;  5BOH A;  3JYI A;  2KDK A;  3UE0 A;  2WUQ A;  1OPX A;  3K2N A;  3S7P A;  4CLC A;  5F82 A;  4DDY A;  2XD1 A;  1PI4 A;  3LFV A;  2ZQ7 A;  1JWZ A;  2R78 A;  3CI6 A;  2PBD P;  2WAD A;  3NJA A;  2Y2M A;  2GX5 A;  3B47 A;  5HPF A;  2G7U A;  4ZBE A;  4D2O A;  4GHI A;  3LO7 A;  4OLD A;  3NOT C;  1GSX A;  3BQ8 A;  1MWS A;  1RGZ A;  1WYC A;  4XUX A;  2QZ6 A;  4E6W A;  2K7S A;  3P7N A;  2PAV P;  3SS3 A;  3S22 A;  3FPV A;  3CLO A;  4H6J B;  3K3D A;  1YQS A;  1W63 Q;  2XD5 A;  1SDN A;  1W8Y A;  2ZC5 B;  2H0Y A;  2JBF A;  3BEB A;  2P9V B;  3MQQ A;  3CJM A;  3V39 A;  5FQK A;  1YLW A;  1YT4 A;  4IUH A;  3T4O A;  2O9B A;  3FV7 A;  5GLC A;  3PBR A;  5DFY A;  3H82 B;  1CQA A;  4UAA A;  4EEP A;  4Y3I A;  5DTS A;  3IS2 A;  4UQI M;  2PYR A;  2WK0 A;  3ITA A;  1L3L A;  2IWB A;  1QME A;  3D4F A;  1Q2Q A;  2JN7 A;  4EER A;  2Y4A A;  1P9R A;  2GNX A;  3UE3 A;  3SS4 A;  1WA9 A;  4ZAM A;  2W3H A;  2HGV A;  1XX2 A;  4OVD A;  2J3T C;  3IX4 A;  5IHV A;  3UB8 A;  3GRJ A;  4LRX C;  1MKM A;  2XLN A;  1TDL A;  1TS6 A;  2YKH A;  1G6O A;  1FIL A;  2VGL S;  4KQO A;  1FSW A;  1FR1 A;  3WRZ A;  1OTA A;  2ZC4 B;  3N8L A;  2HDS A;  2HF6 A;  3C7V A;  3T4K A;  4XT2 B;  3MR0 A;  4OOM A;  4K91 A;  2QJ7 A;  5KMW A;  4F3L A;  5FSR A;  1YLJ A;  1ES5 A;  2YKF A;  3BW6 A;  3NBL A;  5EPH A;  3UB6 A;  3ULF A;  1KOU A;  4MCW A;  4OQH A;  1T1B A;  3A3D A;  2QPN A;  3HUO A;  1NZU A;  1MKI A;  4KUO A;  5TGF A;  3IX3 A;  4K0W A;  3VV4 A;  4I3J A;  2IA2 A;  1CK3 A;  2ZQC A;  3KYE A;  3HVF A;  5DTT A;  3RXX A;  1V9Y A;  3N7W A;  3LIE A;  5HFO A;  4WMC A;  5L10 A;  5A90 A;  5TBM A;  4KQR A;  3UDF A;  2WGI A;  2VEA A;  4S2J A;  2JKR I;  4RQ9 A;  4ESP A;  1N4O A;  4KZB A;  4R1G A;  4HY8 A;  2XR0 A;  2WKH A;  2EX2 A;  2R9W A;  4R4S A;  2PBY A;  2WZX A;  2W0N A;  1PRQ A;  1SDE A;  4OPR A;  3VP2 A;  4LRZ E;  3WS1 A;  4KUK A;  3ZDJ A;  5AQB A;  3UB7 A;  1LT0 A;  3TOI A;  3DAV A;  3ZG9 B;  2GDN A;  3EWK A;  1TEM A;  3Q82 A;  5U47 A;  4UA7 A;  2XFT A;  1GHP A;  5F5Y A;  2PYP A;  3ZG8 B;  4WLA A;  3N8R A;  5HAQ A;  4PM9 A;  1JWP A;  4EW7 A;  5A91 A;  3HBR A;  2ZQD A;  4KZ4 A;  3LUQ A;  1NRF A;  1LL9 A;  1XP4 A;  4EBN A;  2PDR A;  3DWK A;  1F2K A;  2J3W A;  4BEN A;  1NLZ A;  3B42 A;  4BD1 A;  4B4X A;  1RP5 A;  1K4E A;  1JWV A;  3LID A;  4R70 A;  4R3J A;  4JF5 A;  3IHB A;  3WS0 A;  1N9L A;  1X0O A;  1IYO A;  2ZM2 A;  4Y0O A;  3A0S A;  3CMZ A;  4CLC D;  4MN7 A;  3MZD A;  4OPZ A;  1EI5 A;  2HDQ A;  3TE8 A;  1BLS A;  1XJ4 A;  4ETX A;  2HPB A;  3Q1F A;  5HWW A;  4L9G A;  4LRY C;  3IWO A;  2D02 A;  1FQG A;  1MY8 A;  4OH0 A;  1NLY A;  4BD0 A;  4GDN A;  3VSL A;  4CPK A;  3LI9 A;  1DY6 A;  4OQG A;  3WS2 A;  3RXW A;  3LR4 A;  5HL6 A;  4FCF A;  1DP6 A;  1BUL A;  3NOU C;  3VSK A;  3VFH A;  3CG5 A;  4DRT A;  4PKY A;  3MZF A;  1KDS A;  2PR5 A;  3GTC A;  4X69 A;  2C5W B;  2DMW A;  5AVE A;  4Q8I A;  2ZQ8 A;  4JF4 A;  3MF0 A;  2D01 A;  3TRC A;  2B95 A;  2HJE A;  5KSH A;  1YMS A;  4EU0 A;  3EQU A;  2I9V A;  1UWN X;  2I72 A;  5FAO A;  2HP6 A;  1OJG A;  1SKF A;  4HBT A;  5E43 A;  5L2F A;  5EVL A;  3M2J A;  1F5M A;  1ERQ A;  4R4R A;  2P74 A;  5L09 A;  3LI8 A;  1NY0 A;  3LEQ A;  5AQ7 A;  3CWF A;  1PW8 A;  2LB9 A;  5GL9 A;  1LI0 A;  4IED A;  2XH9 A;  5L8M A;  5CXW A;  5DF8 A;  3A3F A;  3SS5 A;  4HH3 A;  3MQ0 A;  4IVI A;  1LI9 A;  3BY8 A;  5F83 A;  1E25 A;  1GSV A;  3A3E A;  1E3U A;  1IKI A;  3EEA A;  2HJ9 C;  1ODV A;  3PAG A;  2Y2K A;  4X6T A;  1PW1 A;  4DF6 A;  1V9Z A;  4GCZ A;  3IWQ A;  1BLC A;  5GHY A;  3UB5 P;  1ZKJ A;  1XXM A;  4BL3 A;  2VZW A;  2QHK A;  2Y79 A;  3SW1 A;  2ZLY A;  5M1A A;  4NXG A;  3ZG5 A;  2XA7 S;  1DP8 A;  5E2E A;  3DTE A;  4GN2 A;  2OAQ 1;  3R7W A;  4E3M A;  1LHY A;  3S7O A;  2J3T D;  3VOL A;  1I5Q A;  2XK1 A;  4WMC D;  1W5D A;  3FWL A;  3VOY A;  3G32 A;  4NET A;  3UB9 A;  4S2P A;  1LLB A;  1IYQ A;  1H5X A;  1PYY A;  4D60 A;  1H8M A;  2Y91 A;  2HV1 A;  1FSY A;  3SH7 A;  3T1R A;  5EOE A;  1FCO A;  5G4Y A;  4QB8 A;  4JF6 A;  3LR5 A;  1IYP A;  4JXW A;  3B33 A;  1VM1 A;  4ID4 A;  2L0W A;  2PRF A;  5TR7 A;  3G35 A;  3OBF A;  2UWX A;  3EQV A;  3ZG7 B;  5EVI C;  3IXG A;  2VK3 A;  2ZC3 B;  3IH8 A;  5IS1 A;  3HCY A;  4GS9 B;  4I39 A;  5IT5 A;  4BL2 A;  5HDS A;  3ZHH A;  2J7V A;  4B88 A;  4BLM A;  1U60 A;  2KOI A;  3ZYT A;  5DJU A;  1KE0 A;  3WS4 A;  4E3I A;  5M18 A;  3IHA A;  1D1J A;  3TSG A;  1MWT A;  1TS0 A;  4GDB A;  5I5L A;  3PXP A;  4XXR A;  3VE3 A;  3OZH A;  5DF7 A;  4NKP A;  1BUE A;  3T4L A;  2W27 A;  4PMA A;  2ZMA A;  5CHJ A;  3NUL A;  2A24 B;  3BY9 A;  4JGO A;  1BSG A;  4KZ6 A;  1XA1 A;  4GW9 A;  3B3X A;  2ZM8 A;  4ARZ A;  2ZL1 B;  5EVE A;  3F1N A;  2WAF A;  1TVF A;  5DVA A;  2INW A;  5CHM A;  3W4Q A;  3C7U A;  3DTI A;  4KZ9 A;  5EVI A;  3DW0 A;  3PBT A;  1P0Z A;  3F1O A;  2Q9N A;  1XGJ A;  4PM8 A;  1YLZ A;  5DFX A;  4B9O A;  4ZRR A;  3ICY A;  4HJ3 A;  3BQA A;  1J9M A;  3T4Q A;  3ZFZ A;  2E8I A;  4FSF A;  2JE5 A;  3CPT B;  3F1P B;  4PPR A;  1LSV A;  2DRW A;  1GSW A;  5FI2 A;  2XQZ A;  4O0P A;  3MXR A;  1PIO A;  4LCL A;  4X53 A;  1ERM A;  2HP5 A;  2XF3 A;  2Q9M A;  3MJQ A;  4E3K A;  3VP3 A;  2V1Z A;  5HPI A;  3QP1 A;  3ITB A;  1KVM A;  5CTM A;  3O86 A;  2QKP A;  1G28 A;  3KX0 X;  1JTD A;  1BYW A;  4IVK A;  2Y2J A;  2P04 A;  2VV6 A;  4GLQ A;  4DDS A;  1OTD A;  1XKZ A;  3C4P A;  5E2F A;  2Y55 A;  2QYB A;  1STZ A;  4Y15 A;  3NDE A;  4FH2 A;  2V8F A;  1VET B;  4A5R A;  3E0Y A;  4QHC A;  1S0W A;  2V1B A;  4FH4 A;  3HJI A;  1ONH A;  3DBA A;  4K0X A;  5FQI A;  4P6B A;  4GOG A;  1FIK A;  1DJA A;  5D3O A;  1MPL A;  4KZ7 A;  1E3U D;  1IKG A;  3BJN A;  4ZJ2 A;  1YAX A;  4RVA A;  3HLW A;  4CLC B;  4P87 A;  5LBR A;  2M1C A;  2XSS A;  4P85 A;  2EX6 A;  1KVL A;  5EFW A;  1YPR A;  1XFQ A;  3ZQ5 A;  1W63 M;  3C4O A;  4CJN A;  2PD8 A;  4QWO A;  4Q0J A;  4GHI B;  4KG2 A;  3QHY A;  5FDH A;  1FOF A;  3ZVT A;  4ZJ1 A;  3AGF A;  5HSQ A;  3A3J A;  3D72 A;  4II7 A;  1IEL A;  4KZA A;  1OT6 A;  3ZGA B;  2LB5 A;  3O3V A;  4E04 A;  4E3N A;  3CHW P;  2FH5 A;  4ZJ3 A;  1PWD A;  1CI9 A;  3WS5 A;  1OJ5 A;  3C30 A;  3E4P A;  4RYE A;  3HJK A;  5EOO A;  2Z2M B;  3IS2 B;  4MBH A;  2VX8 A;  3IX8 A;  5FI7 A;  3N6I A;  5EUA A;  3RFB A;  2VGL M;  2VLG A;  3FZC A;  3T1X A;  1TS8 A;  3P09 A;  4OP8 A;  1LL8 A;  4DXC A;  5EM0 A;  2V0W A;  5CGX A;  4DN0 A;  4QPR A;  1NZO A;  4BWI A;  4OOY A;  4L9E A;  5DKK A;  4S2O A;  2RCX A;  1Z6F A;  3FC7 A;  3BFC A;  4MNR A;  4HH2 A;  5FQM A;  2H28 A;  3UPO A;  4CLC E;  4WF0 A;  1IFQ A;  3LY4 A;  3VP0 A;  4HES A;  1SCW A;  4RX3 A;  4LFU A;  3UN7 A;  2JKG A;  3OPL A;  1JVJ A;  3M6H A;  5M19 A;  1HD8 A;  1ZG6 A;  3G30 A;  4P6Z S;  1F9I A;  1GCE A;  2CMN A;  3Q7V A;  1ALQ A;  5HAP A;  1H8Z A;  1LSX A;  4WM9 A;  4JGP A;  1BTL A;  3W2Z A;  3IXB A;  4F3L B;  5FEG A;  1K4F A;  2O9C A;  1SHV A;  3S7Q A;  3UY6 A;  4ME4 A;  2Y2N A;  3N4I A;  3HLF A;  4WBG A;  1S6R A;  4HHD A;  3NOP C;  5CTN A;  1NWZ A;  3PHY A;  4O7D A;  3EEH A;  2Z6C A;  3LR3 A;  4L0L A;  4DXB A;  4MBK A;  1Q2P A;  3NY4 A;  4OPQ A;  5J3W A;  3FG8 A;  1MC0 A;  3UMD A;  1ES4 A;  5EVI D;  4WZ5 C;  1YKD A;  4X55 A;  4LV3 A;  1C3B A;  3BLM A;  1Z09 A;  3HLD A;  5HDD A;  1NJ4 A;  4LGW A;  4B4Z A;  5TBM B;  3S7N A;  4QU3 A;  3UNW A;  3PR6 A;  1SKO A;  4R23 A;  2W1T A;  1I2S A;  5KSC A;  1DP9 A;  3SOI A;  3KYQ A;  4IUK A;  2PU4 A;  1CJF A;  1WYB A;  2G2U A;  1GHI A;  4E6X A;  3Q07 A;  5I94 A;  1L0E A;  3W4P A;  2KX6 A;  2KLI A;  3MQO A;  3MXS A;  3TJZ C;  2J80 A;  3N8S A;  2OV5 A;  3HLG A;  3IXD A;  5E2H A;  2C6W B;  4PM7 A;  3W8K A;  1VHM A;  2HP9 A;  3O88 A;  1MBL A;  4S2M A;  3EOI A;  2EFU A;  2VGJ A;  2Q0O A;  3OCL A;  2QWS A;  3E4Q A;  2O0Y A;  1VQQ A;  4OKP A;  5L07 A;  2K2N A;  4HEF A;  3ZNT A;  5DKL A;  3UE6 A;  2HDR A;  3BFF A;  5DF9 A;  3BFE A;  4U0X A;  3UME A;  1YMX A;  2B18 A;  4WZ5 A;  4HJ6 A;  3IF6 C;  4PKY G;  5FQJ A;  2EXB A;  1OTB A;  3U2A A;  5GHZ A;  3W4O A;  2ZD8 A;  1XJ2 A;  2J8Y A;  1YSQ A;  4UEY A;  1K6S A;  1Y28 A;  2X02 A;  1VEU A;  1HVB A;  3T1Q B;  5HAR A;  4X68 A;  3P98 A;  1ONG A;  4LPZ A;  1N9B A;  4QY6 A;  4Q0I A;  4Z1W A;  3PTE A;  1ERO A;  3D3O A;  4RA7 A;  4EES A;  1TDG A;  5IU1 A;  4EEU A;  3V67 A;  4NG2 A;  4GB7 A;  5F6A A;  2V1A A;  4X56 A;  1EWZ A;  1KE4 A;  2G2W A;  1TD5 A;  1YM1 A;  1ACF A;  3NHQ A;  4JLF A;  1UGU A;  3JPU A;  3TW8 A;  1G5U A;  1JNU A;  5HD5 A;  5CED A;  2XRN A;  3D9Y A;  3IF6 A;  4Y13 A;  1UWP X;  1LL5 A;  5HAI A;  1K6R A;  3EGX C;  5KIZ A;  1HLU P;  3QP5 A;  3Q81 A;  2EX8 A;  4C75 A;  4NXF A;  3HUN A;  3C38 A;  4S2K A;  2OLU A;  1W7F A;  5KZH A;  2WKE A;  3KSG A;  4JKT A;  2J9O A;  3V3S A;  5FEF A;  4I38 A;  1F98 A;  1K38 A;  5CRF A;  5FL3 A;  2Y2L A;  1K57 C;  3NC8 A;  4YFM A;  1HZO A;  4HNB A;  4GD8 A;  4DE1 A;  3JVU A;  2WAE A;  1W79 A;  1D06 A;  3OC2 A;  3FKV A;  4HP9 A;  3WRT A;  3H7W A;  4R38 A;  4KZ5 A;  1EW0 A;  3A0V A;  3OPR A;  1IYS A;  1PFL A;  2J9P A;  5HW3 A;  3QP2 A;  3GDI A;  2X01 A;  2W3G A;  2V2F F;  3E4O A;  3MXQ A;  2JKF A;  2VKS A;  4DJ2 A;  5AJG A;  5F68 A;  3V50 A;  2VV8 A;  2XA7 M;  1YLY A;  3G6O A;  4PHT A;  2EX9 A;  2W3D A;  3T4J A;  2IWC A;  3LEZ A;  4DKI A;  1N9N A;  3EGD C;  3PYP A;  4HOI A;  3RH8 B;  3HLE A;  3VP4 A;  5G18 A;  3RTY A;  4S2N C;  3M2K A;  5HZH A;  4DE2 A;  1NYM A;  3RJU A;  3LIC A;  4N1X A;  3UO9 A;  2FFF B;  5F1G A;  1K57 A;  1K25 A;  3LIF A;  3R7W B;  1KGG A;  5EEC A;  1Y54 A;  4NXE A;  2ZJ9 A;  4IBR A;  4I5S A;  1XFN A;  2Y2Q A;  3TG9 A;  2BAS A;  3IXH A;  5AQA A;  3NIA A;  1TF1 A;  1OT9 A;  3Q7Z A;  4BBU A;  3VP1 A;  2WGW A;  4I3I A;  1HTZ A;  1ZG4 A;  4FTX A;  1PNE A;  3S4X A;  2E8J A;  1MZU A;  4E3O A;  3BFG A;  4LV0 A;  4U0T A;  5A93 A;  3G34 A;  2Y8H A;  1H8Y A;  4N1H A;  1ES3 A;  3PBN A;  4H6J A;  2GZA A;  3SH8 A;  1PWG A;  2VJW A;  3FPW A;  3GVB A;  5FDS A;  2P9V A;  3H9W A;  1VB6 A;  3GV9 A;  1ES2 A;  2ZBB A;  4EBP A;  2Y2I A;  2JKT M;  2K31 A;  5G4Z A;  3OPH A;  2QJ5 A;  1ZC2 A;  4EV4 A;  2PT7 A;  4WEJ A;  4M3K A;  3ZCZ A;  4NXB A;  3H82 A;  1IEM A;  5FAQ A;  1W8Q A;  1JTG A;  2CC1 A;  2VV7 A;  3O5Y A;  4X1M A;  5DJT A;  4S2N A;  3LCE A;  2XFS A;  3IT9 A;  4EQI A;  1S1Y A;  2FFY A;  1K55 C;  5CGW A;  4OQ0 A;  5CEB A;  4GZB A;  1BT5 A;  3VMA A;  1BZA A;  1D7E A;  4N92 A;  4UQI S;  2V9A A;  1L0G A;  1AXB A;  1RCJ A;  2WGW B;  2MJ6 A;  4FUW A;  4O01 A;  2XEP A;  2H0T A;  4YNR A;  3NDG A;  5GLA A;  2A3U A;  2L4R A;  3GEC A;  4XT2 A;  4ARZ B;  4HP4 A;  3F1N B;  2X71 A;  4Y0T A;  2Y2G A;  1YLT A;  2JCH A;  5EVI B;  3M6B A;  1ESU A;  4YWZ A;  3C2W A;  3PBQ A;  4JGR A;  4UHU A;  1NYY A;  4IBX A;  5GLD A;  3F1O B;  1CF0 A;  2XDM A;  4LEN A;  3G4P A;  4O8G A;  4GKU A;  2P7J A;  1P97 A;  5EM1 A;  2H5S A;  4R6L A;  1P9W A;  4S2I A;  1KE3 A;  2W3F A;  2JC7 A;  2OWH A;  5A8B A;  3L7H A;  4EQ1 A;  1K55 A;  1M40 A;  1E4D A;  5TJJ A;  1CI8 A;  2ZC7 A;  2PD7 A;  5HDC A;  4F94 A;  3IWI A;  2WZZ A;  3ZVW A;  2NUP C;  3KO6 A;  4X25 A;  1A0K A;  1T19 A;  1ESI A;  3DTM A;  3T4S A;  5C5K A;  1S1Z A;  3VE4 A;  2ZOI A;  3MKE A;  4OON A;  4G3K A;  3GMW A;  2EFX A;  3T1S A;  3MZE A;  4YIN A;  1K56 A;  3HUM A;  3V5M A;  3T4T A;  3LIA A;  2WKI A;  5J8X A;  4MEZ A;  2M7V A;  1ZTU A;  4GD6 A;  5DTK A;  4CQH A;  4WUJ A;  4IHQ A;  1DRM A;  3HLC A;  1T1C A;  3CIT A;  1GA9 A;  4AFI A;  4Y7P A;  3E98 A;  4JPM A;  2WGV A;  4FD8 A;  1LSW A;  2PHY A;  5FAT A;  4JGQ A;  5J4E A;  1PZP A;  2V8C A;  4R3A A;  1XJ6 A;  4OP5 A;  2JHE A;  3P01 A;  1S4S A;  1AWI A;  1GA0 A;  3LY3 A;  4DE0 A;  3A3I A;  1GHM A;  3MKF A;  2ZOH A;  4N9K A;  4WN5 A;  5F69 A;  3HLB A;  3NEC A;  1CEG A;  4KQD A;  3BEC A;  3ISG A;  4BBT A;  3VFF A;  4EUV A;  3A0R A;  1O07 A;  1MWR A;  5HL1 A;  1K54 C;  1G68 A;  2OSU A;  4WL9 A;  5HWT A;  1MXO A;  1DJB A;  4L9F A;  1O7E A;  3GSG A;  3MFX A;  4Y0U A;  4HQA A;  2JKR M;  1NRJ A;  2DNS A;  4C3Q A;  4LLO B;  1KGE A;  2WYX A;  3BYD A;  2UV0 E;  2XGN A;  1K0K A;  3IBJ A;  2Y2H A;  4DMZ A;  1L2S A;  4KEN B;  1S66 L;  5EV0 A;  4P6Z M;  1OTI A;  4WEK A;  2RL3 A;  3DWZ A;  4UA6 A;  4BJP A;  4E3J A;  5E2G A;  5CEC A;  4MMN A;  4OOL A;  1MWU A;  3HL9 A;  4Y5F A;  4NK3 A;  4M4X A;  3SZT A;  3E2K A;  1XA7 A;  3OLO A;  3WWX A;  4OQI A;  4EXO A;  4Y17 A;  3BLS A;  2ZQA A;  5FI6 A;  3BFD A;  1BLP A;  3Q7V B;  3G31 A;  4QD4 A;  1XGI A;  1KDW A;  2V0U A;  4OPY A;  1K54 A;  1PI5 A;  5CHU A;  3O87 A;  2VGK A;  1FR6 A;  3QNC A;  3CAX A;  3ZG0 A;  1Y4O A;  3LR0 A;  5JYO A;  4E3L A;  4PAU A;  2ZC6 B;  5JYP A;  1L0D A;  3GQZ A;  3LGO A;  2A2L A;  4BQM A;  5FAS A;  3IF5 A;  3KYZ A;  4R3B A;  1N9O A;  4LV2 A;  1S4R A;  2EWW A;  4ZDX A;  4G3V A;  3IBR A;  4QJG A;  1H3Q A;  1BLH A;  5AQ9 A;  3MS6 A;  4MBF A;  4KZ3 A;  2B5R A;  3T50 A;  5CGS A;  1SKO B;  4WZ4 A;  3MBZ A;  1OME A;  2W1T B;  3QNB A;  2XRO A;  4JXV A;  2M7U A;  3ZNY A;  1FCM A;  1CEF A;  4MN6 A;  3LYX A;  2V20 A;  2HDU A;  3U4L P;  4Q0H A;  4G3W A;  1QMF A;  2BTF P;  3IH9 A;  1L0F A;  1WE4 A;  1YSP A;  5FAP A;  3G2Z A;  5HD3 A;  3NI9 A;  4PM5 A;  2B02 A;  1OTE A;  4HBU A;  4JBF A;  5EE8 A;  3UDI A;  1DJC A;  4EBL A;  3HRE A;  3GR2 A;  5FQQ A;  3OCN A;  2ZQ9 A;  1ZHH B;  4MDZ A;  4OLG A;  2GJ3 A;  1M6K A;  2OAP 1;  5HX9 A;  2PU2 A;  3JVV A;  3G2Y A;  1G6A A;  2ZMV A;  1K56 D;  3CUE C;  2W3E A;  2R9X A;  3LIB A;  2DCF A;  4Z9Q A;  2AVX A;  3SH9 A;  4GS9 A;  1PWC A;  1T18 A;  4WEL A;  4U3T A;  4YOF A;  3NCK A;  4LV1 A;  1FCN A;  4WYY A;  2H10 A;  4Y2F A;  4EWF A;  4X1L A;  4FOF A;  4BBV A;  3L9K A;  4KZ8 A;  1VEU B;  2FZ0 A;  3FKW A;  2Z2L B;  2WKP A;  2OLV A;  4HI4 A;  2OOL A;  3BWL A;  2NUT C;  3QP6 A;  4ZTK A;  3I7J A;  1XJ3 A;  3DTK A;  3UE1 A;  4XUZ A;  3UPP A;  3V3R A;  2VA0 A;  3OPP A;  4UA9 A;  3PBS A;  3VOZ A;  5J7E A;  4ETZ A;  2Y2P A;  5A92 A;  2A24 A;  3C8C A;  2Y2O A;  4HIA A;  4DE3 A;  2HZ5 A;  1S67 L;  4S2L A;  3BRM A;  3E2L A;  2P08 A;  4I3A A;  3QP4 A;  2ZL1 A;  1KGF A;  2BG1 A;  3CUE A;  4NEE D;  4K08 A;  2EA9 A; 
#chains in the Genus database with same CATH homology
 2V8C A;  4D60 A;  1HLU P;  2PBD P;  4FTX A;  1YPR A;  3T1R A;  1PNE A;  1AWI A;  2E8J A;  5FEG A;  4QWO A;  1CF0 A;  5FEF A;  3CPT A;  2PAV P;  2PRF A;  3LEQ A;  5FDS A;  1J3W A;  5EM1 A;  1F2K A;  3CPT B;  2ACG A;  3NEC A;  1Y4O A;  3L7H A;  2VK3 A;  3LGO A;  3CHW P;  1PFL A;  3KYE A;  1VEU A;  4X1L A;  2JKF A;  3T1Q B;  3L9K A;  1VEU B;  1CQA A;  4X25 A;  1A0K A;  3MS6 A;  1Z09 A;  4X1M A;  1D1J A;  1SKO A;  4ESP A;  1SKO B;  3UB5 P;  3T1X A;  1K0K A;  1CJF A;  1VET A;  3T1S A;  5EM0 A;  3MSH A;  1SZV A;  2V8F A;  5EV0 A;  1VET B;  1PRQ A;  3U4L P;  1ACF A;  3NUL A;  2HZ5 A;  4FUW A;  2BTF P;  3DAV A;  3T12 B;  1FIL A;  1FIK A;  2ZL1 A;  1G5U A;  2ZL1 B;  3D9Y A;  5EVE A;  2B95 A;  2JKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...