4FTXA

Crystal structure of ego3 homodimer
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
158
Chain Sequence
HSKNVKGFLENTLKPYDLHSVDFKTSSLQSSMIITATNGGILSYATSNNDVPKNSINEINSVNNLKMMSLLIKDKWSEDENDTEEQHSNSCYPVEIDSFKTKIYTYEMEDLHTCVAQIPNSDLLLLFIAEGSFPYGLLVIKIERAMRELTDLFGYKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Protein SLM4
publication title Ego3 functions as a homodimer to mediate the interaction between Gtr1-Gtr2 and Ego1 in the ego complex to activate TORC1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 42
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16818 SLM4 Protein SLM4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4ftxA01
4QWOA 3CPTB 1SKOB 1SZVA 1VETB 1CQAA 1D1JA 2ZL1A 3DAVA 1VEUA 4X25A 2HZ5A 2VK3A 3T1QB 2B95A 5EM0A 1CF0A 1K0KA 1FILA 1Z09A 2BTFP 2PAVP 4X1MA 3MS6A 3CPTA 1PNEA 3T1RA 1SKOA 1VETA 3LEQA 1F2KA 2ACGA 1FIKA 5EVEA 5EV0A 3U4LP 3T1XA 2V8FA 1HLUP 3KYEA 3L7HA 5FEFA 4FUWA 4ESPA 3MSHA 4X1LA 1ACFA 3D9YA 2JKGA 2PBDP 2JKFA 3T12B 5EM1A 3T1SA 1Y4OA 5FEGA 4FTXA 1CJFA 1G5UA 1PRQA 3LGOA 1J3WA 3NECA 2PRFA 1PFLA 2ZL1B 3L9KA 4D60A 1AWIA 1VEUB 3CHWP 5FDSA 2E8JA 3UB5P 1YPRA 3NULA 2V8CA 1A0KA
chains in the Genus database with same CATH superfamily
2QHKA 3MXRA 2I72A 4R0QA 4E3MA 1S66L 3RJUA 3A3EA 3O5YA 1K4EA 3T4QA 3NC8A 4I3JA 2FH5A 1GHIA 4CLCD 4G3VA 3SS3A 3D3OA 4X56A 5DFXA 5CHUA 3WRZA 5HARA 3ZG8B 4C75A 4CLCA 3UE3A 4EUZA 4HH2A 4JF4A 2VKSA 4O01A 3WS1A 5HL6A 3B3XA 3VMAA 3UPOA 3V39A 2EXAA 3EWKA 2A24B 3Q1FA 3IBJA 1LT0A 2XA7M 2XFTA 1MC0A 2VA0A 1P97A 2WKIA 4MEZA 3M6BA 2RCXA 4UA9A 1K38A 2LB5A 5EM1A 2WKPA 4WN5A 4S2KA 4I38A 3MFXA 1Y28A 1ZTUA 2OLVA 2J3TD 3MMHA 3E4QA 3UE1A 4E3JA 1W5DA 3PBSA 3R7WB 4H6JB 1TVFA 2ZOIA 3DTEA 1K55C 3E4PA 3L9KA 4C3QA 4ETZA 3UDXA 1XJ3A 4GJ4A 1U60A 2OAP1 2P04A 5F68A 2Y2NA 3R4KA 4LCLA 2WYXA 3UB7A 1Y54A 2X71A 4B4ZA 3F1NB 4IUHA 5IU1A 3ZG5A 3ULFA 3HBRA 3SS4A 2DMWA 2HDQA 4Y17A 3WWXA 3MQ0A 3OC2A 1TEMA 1L3LA 4U0XA 4R4RA 2C5WB 3SS5A 1VETA 5CGXA 1FSWA 5M19A 4GDBA 5TFQA 2P9VB 3Q7VA 3S7OA 2K31A 4EUVA 1YLPA 2EX8A 3HCYA 1EW0A 4OVDA 1UWNX 4GN2A 4UAAA 2HPBA 3EOIA 4FTXA 4ZJ3A 1YLYA 3C4PA 4X68A 5TBMA 2VGLS 3FC7A 5HAIA 1E25A 2B18A 3GV9A 3ZNTA 3BRMA 4OQGA 3W4QA 2J9OA 5FASA 1ONHA 1PFLA 3FV7A 3NDEA 4NXEA 4DJ2A 2ZM2A 4OPZA 1GA0A 3FPWA 2G7UA 4KZ5A 3KSGA 3UMDA 1NYYA 2Q9MA 2WAEA 2A49A 4KZAA 1A0KA 2WGVA 2WZZA 2J8YA 4BJPA 1M40A 2CC1A 1AXBA 4CLCB 1DP9A 3BFGA 3B33A 3QP8A 2K2NA 3T1QB 3UNWA 3MZFA 4RVAA 1PZPA 3S1YA 3HLDA 3WS0A 3EQVA 3NIAA 3JPUA 1SHVA 1H8MA 4ZJ2A 4QHCA 3PR6A 5DF7A 4L9EA 4HHDA 1XA7A 3LI9A 5EVEA 4OPYA 5HAPA 1Z6FA 5J4EA 1NXYA 4EBNA 2GZAA 2QYBA 1IYQA 5KZHA 1K56A 2EWVA 3M2JA 2PD7A 3MZEA 1YLZA 3TOIA 1W79A 2XQZA 3W2ZA 2Y2LA 5F5YA 3OCNA 1XP4A 2BG1A 1YSPA 1L2SA 5A8BA 4BL3A 4GOGA 3UE6A 5CTNA 1BLSA 4QY5A 3NECA 2HP6A 4PKYA 5FL3A 4OOMA 1T1BA 3QHYA 3IX3A 5DKLA 1LL8A 2LB9A 4BD1A 4BWIA 2WKHA 2VV7A 5EVID 4WF0A 1ALQA 1WE4A 1MWUA 3RFBA 3WRTA 3V67A 1OTAA 4X69A 4S2IA 4F3LA 1VETB 2Y4AA 1CQAA 5CECA 3C2WA 2Z6CA 1EWZA 5EVIA 4I3IA 1IYSA 3ZQ5A 2ZC4B 3Q7VB 2HJ9C 2W0NA 3NBLA 1MWSA 2W3GA 4K08A 4O8GA 1OTEA 3V3SA 2QKPA 1IKIA 1P9RA 1GA9A 5M18A 1YMSA 2WADA 1BYWA 1SKFA 1C3BA 4HBTA 3PAEA 1WA9A 5FI6A 2X02A 2ZMAA 2AVXA 2VJWA 5TBMB 1QMEA 2R9WA 3DWZA 3SH9A 3IF5A 3VFFA 1TS7A 1X0OA 2DRWA 4D2OA 4EERA 5A90A 2W1RA 2JKGA 3QP4A 3LR5A 4R38A 5L2FA 2XFSA 5F1FA 4ZAMA 4UHUA 2VGJA 3QP5A 2JCHA 4WZ4A 3RXWA 2B02A 1K54C 4N9KA 1G5UA 4RX2A 5HAQA 2M7UA 2A2LA 3DTIA 2EXBA 5HWVA 3ZG7B 1L0DA 3FWLA 3HJIA 4LV0A 4IHQA 4Q8IA 1OT9A 5HPIA 1BLHA 3BJNA 3G2YA 2HGVA 3I7JA 2A24A 3LIAA 3E4OA 2ZC3B 2ZQAA 5AQAA 3O87A 3O88A 4L0LA 2JBFA 1H3QA 3FYZA 1D06A 1E3UD 4NXFA 3MBZA 2GJ3A 5DVAA 3N8SA 1FCMA 2B95A 4K91A 1VM1A 3ITAA 5J7EA 1OTBA 4GDNA 2MJ6A 4S2OA 4X1MA 2H0TA 2VZWA 4H6JA 3SZTA 1SKOA 1E3UA 3O3VA 5CRFA 1YQSA 5IS1A 3K3CA 3LEQA 4CLCC 1KGFA 5HD3A 5JYOA 3AGEA 4XT2A 4Q0JA 3MF0A 4WBGA 2WGIA 1S4SA 3LY3A 5GL9A 5FDHA 5FQMA 2EX2A 3LEZA 2V8FA 4KZ6A 2Y2KA 4UQIM 2J7VA 4S2JA 4JXWA 2GX5A 1KE4A 1PIOA 1I2WA 2HDUA 3O86A 2ZQ7A 2HF6A 5CTMA 1CJFA 1KDSA 2H10A 4WZ5A 5EUAA 2HP9A 5F6AA 3KYQA 1JNUA 4QB8A 5EVLA 4LV1A 1BT5A 4PHTA 5FQKA 2XF3A 4DMZA 3T4SA 3OOVA 5EVIB 2J3TC 4Y2FA 1GSVA 2KOIA 3WS4A 1J9MA 3S7QA 4X6TA 4E6WA 4KZBA 1KVLA 2P74A 1ZKJA 4NXGA 2Y2GA 3AGDA 4HH3A 2HDRA 3DAVA 4LCMA 4KUKA 4X25A 1RCJA 1PWCA 4R3JA 1VHMA 3ZG9B 2O9AA 1TDGA 1FR1A 3OPRA 3BW6A 2ZM8A 3N8RA 4P6ZS 3KO6A 3G30A 4S2PA 3A3FA 3VP3A 4LPZA 1YT4A 3S4XA 3MZDA 3Q7ZA 2EX9A 4JF6A 1FIKA 1TF1A 3T4TA 1ERMA 4BBVA 3LY4A 1KDWA 4HQAA 3U2AA 3BWLA 3IH8A 5FI7A 3LCEA 4O7DA 5FEFA 3A0RA 3ZFZA 2HV1A 3LR3A 4DE2A 4HJ6A 2PR5A 3T12B 1I2SA 2ZMFA 1ES2A 2XK1A 2M1CA 4LGWA 2O99A 5CHJA 2XGNA 4N1XA 4P85A 3VOLA 4EETB 3LIFA 5TJJA 3LGOA 3ZVTA 4L9GA 2IA2A 4MMNA 3IHAA 4PAUA 1OTIA 3ZNYA 3CITA 1DP6A 3ZCZA 3N7WA 3HLGA 1LL9A 3UY6A 5DTTA 4WELA 3ZYTA 3BYDA 3IF6C 1IOUA 3P09A 4GKUA 5BOHA 1PWDA 1K25A 1T19A 4KG2A 4P6ZM 1SKOB 4IEDA 5CERA 4DKIA 3N6IA 3QNBA 4MN5A 2EX6A 4XT2B 2Y55A 1UGUA 3IX4A 1T1CA 1NRJA 1MKMA 3VE3A 5DTSA 1O07A 5FI2A 4QPRA 4ZBEA 3MS6A 4EW7A 2O9BA 5JYPA 3T1RA 2WKRA 5GLAA 1LL5A 5HDDA 4R23A 1V9ZA 4GZBA 3IWQA 1PI4A 2KLIA 3U4LP 3A0SA 3UB6A 4R70A 3GQZA 3DTMA 3C7UA 4S2LA 3PTEA 4JGOA 4FUWA 1JTGA 4WMCD 1VB6A 4MLLA 2QWSA 5HD5A 3Q81A 4IJGA 1PWGA 5AJGA 2A3UA 1ERQA 1NY0A 4A5RA 3C30A 3BY9A 3GECA 4N9LA 4OLDA 4S2MA 2VGKA 4F94A 3BFFA 4PM7A 4JPMA 1L0GA 4JKTA 4JGQA 2PRFA 4E3OA 3BFEA 1P9WA 5IT5A 5HPFA 1M6KA 3GR2A 1L0FA 3S22A 1UWPX 3UPNA 3VOYA 4JXGA 3PHYA 4HEFA 4K0WA 2ZQCA 5DJTA 1EI5A 4OQIA 3LO7A 2VEAA 3KSFA 5AQ7A 1VEUA 4JXSA 3M6HA 3HREA 5EVIC 1CEGA 2M7VA 3LYXA 4P6BA 3ZG0A 5I94A 4DE3A 5LBRA 5MC7A 4WL9A 4HNBA 2QJ5A 3JYIA 4EQIA 2ZLYA 1MBLA 5TGFA 4YFMA 2WK0A 4EV4A 3LI8A 1GHPA 1MWTA 4K0XA 1FSYA 3D4FA 5GHZA 3QNCA 4OKPA 4PM5A 1DJAA 2E8IA 5HSQA 1OJGA 4UEYA 5EECA 1V9YA 3IS2B 3GDIA 3NJAA 3P7NA 3BECA 2Y59A 2EWWA 4MN6A 3G35A 3QP1A 1N4OA 1HVBA 5DF8A 3T1SA 2ZJ9A 4RX3A 1W63M 3IX8A 2PYRA 3T4OA 4Y15A 5D3OA 1RGZA 4WUJA 1K6RA 4E3KA 2ZC6B 3KSIA 1ODVA 1OTDA 2B5RA 4KZ7A 5HFOA 4IUKA 5EPHA 3NOTC 2XEPA 2JN7A 3OLOA 4Y3IA 1BULA 1LI9A 1XKZA 4HI4A 4QD4A 3DTKA 5AVEA 4HESA 1XGJA 2Y2IA 2Y91A 3H9WA 5CEBA 5DFYA 4ZJ1A 4R1GA 3H7WA 2XH9A 1D7EA 4LRYC 2HP5A 5TR7A 4CLCE 3NHQA 1MKIA 5EFWA 1FQGA 2EFXA 3PBQA 4HJ3A 3FG8A 1CI9A 1T1AA 1KE0A 2ZOHA 3NOUC 4B93A 3VFHA 4DXBA 3TE8A 1XJ2A 4GS9A 4EBLA 5L8MA 4O0PA 4AFIA 1NZUA 3NDGA 1CF0A 1FILA 4MN7A 1JVJA 4EESA 1MXOA 4LENA 3HL9A 1FCNA 1Q2QA 3F1PA 5DTKA 4HBUA 1ZG4A 3MJQA 4UA7A 3W4OA 4P87A 2IWBA 1F5MA 3H82A 4WEJA 5CXWA 5GLBA 4DDSA 3TRCA 5CEDA 4E3IA 2PBDP 4G3KA 3A3JA 4KENB 1YMXA 5HX9A 5J8XA 3MR0A 1G28A 2K7SA 3F1OB 3DBAA 5GHXA 3NI9A 2D01A 4G3WA 2Z6DA 2Y8HA 4NEED 3HLBA 5CHMA 1KE3A 5E2EA 4LLOB 1J3WA 3JVVA 1FR6A 5HDCA 1ESIA 1HTZA 3CUEA 3QP6A 2ZD8A 4DE1A 4E6XA 5FA7A 2PHYA 2PBYA 1YLTA 1VEUB 3G4PA 4QY6A 1TS0A 1CEFA 1NLZA 3HVFA 2FZ0A 4UQIS 4PPRA 1I5QA 2V2FF 1S6RA 5DF9A 1N9NA 3VP4A 1N9OA 1DJCA 1OPXA 3FPVA 3WS2A 5L09A 1SZVA 4U3TA 4ZDXA 1YLJA 1N9LA 3EEAA 4KQRA 4KQDA 3AGFA 4HOIA 3BEBA 2ZBBA 1JWZA 1XXMA 4FH2A 4RA7A 3C7VA 4MCWA 3CPTA 5FATA 1H5XA 5HZHA 4PKYG 1K57A 1BLCA 4H8RA 2XLNA 3Q82A 2ZC7A 1S1ZA 2QJ7A 3CAXA 3PXPA 4JLFA 3G6OA 1NLYA 1DRMA 4ESPA 4Y7PA 3CZDA 3D9YA 3BM6A 4OQHA 3UB9A 2JKFA 1W7FA 3T4JA 1ES4A 1TD5A 2EA9A 4KQQA 4N92A 1IFQA 2L0WA 3LR4A 3C8CA 2Y2MA 3H7WB 2Y2JA 3C38A 2C6WB 5AQBA 1W8QA 3LR0A 1K6SA 2YKFA 1BSGA 2JC7A 2YKHA 4OH0A 4UA6A 3B47A 1FOFA 4GS9B 5K5BA 5FDSA 5G4ZA 3WS5A 5FQQA 5A93A 2FFFB 1S67L 2PR6A 2V9AA 3OPLA 4ZTKA 4YINA 3HUMA 3V5MA 2Y79A 5I5LA 4E04A 2QMIA 1JTDA 3F1PB 2XROA 4WEKA 3A3IA 5G18A 1CI8A 4HJ4A 5FSRA 3MQOA 4PM9A 1T18A 3H82B 4Z9QA 4DXCA 4MBKA 1WYBA 1LLBA 3G32A 4X53A 4ID4A 1IEMA 2ZM0A 1WYCA 4IVIA 3CMZA 4LV3A 2PDRA 1F2KA 3PBTA 4WM9A 4P0MA 3OCLA 3S7NA 2OSUA 2ZMVA 1W8YA 2VLGA 4ME4A 3B42A 3BY8A 1PW1A 1GSXA 4KZ8A 4E3NA 2QZ6A 4M4XA 1K4FA 4YNRA 4EEUA 4MBFA 1YM1A 2XD5A 5F82A 4DN0A 4B9OA 3UE0A 4KUOA 2CMNA 2RL3A 3LIEA 2ZQDA 3BFCA 4R6LA 3TG9A 1HD8A 4PMAA 4OQ0A 1STZA 1IKGA 4BL2A 5U47A 4S2NA 3VP1A 3KX0X 2JKTM 2OWJA 3C4OA 2JHEA 3T4KA 3SH7A 3CLOA 2W3DA 1PYYA 3K2NA 3IQAA 1L0EA 4LV2A 3IS2A 4OP5A 4Y0OA 2WGWB 4E3LA 3QP2A 4QWOA 3CPTB 3MXQA 3DW0A 4MNRA 1XX2A 1G68A 3PBOA 2IWDA 4DE0A 1KGEA 2HZ5A 3E0YA 2VK3A 3W8KA 3OBFA 2Z2MB 1BTLA 5EOOA 4BLMA 2NUTC 3T50A 3HJKA 2QPNA 4I3AA 4Y0UA 3G31A 4ARZB 2V0UA 5HL1A 4GD6A 2JKRM 3CWFA 3ISGA 1DJBA 2ACGA 4HP4A 5EV0A 3RTYA 3IXDA 4BENA 1RP5A 4ZRRA 4FH4A 3MSHA 4C6YA 3OPPA 1TS8A 3T4LA 3UPPA 3SOIA 2J3WA 3IT9A 1ZG6A 4NETA 1G6AA 3HLFA 2OAQ1 1MY8A 2HJEA 2R9XA 4Y13A 4HIAA 1XJ6A 3MKFA 1NWZA 2Z2LB 3PBRA 2Y2PA 1VQQA 3CI6A 2O9CA 2DCFA 4LRXC 1GSWA 4IBXA 3TSGA 4EWFA 4D60A 4MBHA 2Y2QA 5GLDA 4OOYA 2HDSA 1LSXA 2L4RA 3CHWP 1MZUA 4KZ3A 1P0ZA 3NULA 4WMCA 3V3RA 4GNUA 5EOEA 4B4XA 3HLCA 3BFDA 4I5SA 1BZAA 5FAOA 5F69A 4HP9A 2I9VA 2V1BA 2ZQ8A 1TS6A 2XDMA 2ZL1A 1QMFA 1OMEA 5HDSA 3F1OA 3IBRA 2Y2OA 3IXGA 4XUXA 1XA1A 5EM0A 4NXBA 5A91A 4CJNA 1YKDA 1OT6A 1Z09A 3EGXC 2BTFP 4M3KA 3JVUA 5F83A 3UO9A 3HLWA 1H8ZA 2PYPA 2BASA 4KZ4A 3G34A 5A92A 4OONA 4YOFA 5KIZA 5E43A 3KSHA 4IVKA 3LUQA 1TDLA 3RH8B 5M1AA 2W3EA 3RXXA 1YLWA 3EGDC 2H5SA 1BUEA 2J9PA 4NG2A 4JBFA 3UDIA 3ZVWA 2VV6A 3UB8A 1H0MA 4PM6A 3GMWA 3M2KA 3EQUA 1Y4OA 3W4PA 3LIDA 4N1HA 3IF6A 1KGGA 4QJGA 1S4RA 3IXBA 4ETXA 1OJ5A 5GLCA 1KVMA 4NKPA 1K55A 5G4YA 5L10A 2VV8A 5AVFA 4GLQA 2Q9NA 3C5AA 5E2HA 4Y0TA 3CUEC 4DDYA 4DJ3A 3UDFA 3Q07A 4NK3A 4GD8A 2V8CA 2IWCA 2W1TA 4GHIA 1NYMA 1EROA 2WZXA 3N8LA 1IYPA 5C5KA 1K56D 4KG5A 1SDNA 1XFNA 2OOLA 5AQ9A 3MFDA 3NY4A 2VGLM 1K0KA 1PI5A 2PAVP 2XSSA 3HUOA 5GHYA 3FKVA 1PNEA 3GTCA 2H28A 3ZHHA 3IWIA 1Q2PA 4KQOA 4QU3A 2V1ZA 1XJ4A 4RQ9A 3IWOA 4U0TA 4LFUA 3A0VA 5FQJA 2XR0A 2FFYA 1K57C 2JE5A 3OPHA 1IYOA 3TW8A 1NZOA 3MKEA 1SCWA 1MPLA 5DJUA 4OLGA 1G6OA 1JWPA 2W3HA 3VP2A 4X1LA 2PD8A 4LRZE 3K3DA 4I39A 3GRJA 4EXOA 5FEGA 2INWA 2DNSA 3LIBA 4X55A 4FSFA 4R3BA 2V1AA 4BMWA 3ITBA 1W63Q 1PRQA 3IHBA 3GVBA 2UV0E 4EEPA 4YWZA 5FAQA 1N9BA 4DF6A 2ZL1B 1AWIA 1S0WA 4XXRA 2KX6A 4OPQA 3SW1A 4EQ1A 3UB5P 5HWTA 5E2GA 4WZ5C 1ES5A 3T1XA 2GNXA 4R3AA 2WKEA 3V50A 3VE4A 3BQ8A 4JGRA 2W27A 4Q0IA 2PU2A 1D1JA 3ICYA 2KDKA 5CX7A 4Y5FA 1CK3A 2Q0OA 2PT7A 2OLUA 4OOLA 2VX8A 3MQQA 2P08A 3IXHA 4EU0A 4GW9A 4CQHA 4JGPA 3VOZA 3VP0A 3OZHA 4BQMA 3LFVA 3G2ZA 1XGIA 3P01A 4BBUA 2V20A 3P98A 2WUQA 1JWVA 4OP8A 1NJ4A 4DRTA 3IF6B 1LI0A 1DY6A 3TJZC 3FZCA 1ESUA 3NCKA 4Q0HA 3KYEA 3VV4A 2WGWA 4WLAA 1ES3A 1ACFA 4XUZA 1IELA 3CG5A 3BLMA 5CGSA 4EBPA 4L9FA 4JXVA 5EE8A 1ZC2A 3DWKA 3BLSA 1H8YA 2OV5A 3E98A 2PU4A 2UWXA 1PW8A 2ZQ9A 3UN7A 2R78A 5HW3A 2OWHA 4B88A 1RGYA 4KZ9A 1GCEA 2H0YA 5FQ9A 1YSQA 4R4SA 2W1TB 4HY8A 2W3FA 4GHIB 1BLPA 2JKTI 3FKWA 2Y2HA 5DKKA 3VSLA 2G2UA 4ARZA 3N4IA 1F9IA 4OPRA 2ZC5B 3MXSA 4MDZA 4WYYA 1F98A 2G2WA 1LHYA 4S2NC 3PAGA 2E8JA 2BLSA 3EEHA 3CJMA 1SDEA 1ZHHB 1LSWA 3PBNA 3R7WA 3LICA 2XRNA 5KMWA 4CPKA 5F1GA 3A3DA 3IH9A 5J3WA 3GSGA 5CGWA 4FOFA 4GB7A 2L1MA 2V0WA 3E2KA 4GCZA 1S1YA 4BD0A 2JKRI 3HLEA 5IHVA 1PZOA 2NUPC 2WAFA 3F1NA 4RYEA 5KSHA 4II7A 1MWRA 5HWWA 1KOUA 2P7JA 4FCFA 3NOPC 2GDNA 5E2FA 3ZGAB 1HLUP 2D02A 3L7HA 3ZDJA 4IBRA 2WKQA 3PYPA 4PM8A 3KYZA 1YAXA 4F3LB 5KSCA 5L07A 1ONGA 2X01A 3BQAA 4BBTA 2O0YA 1O7EA 3D72A 2P9VA 2XA7S 1K54A 1LSVA 3UMEA 4FD8A 4KG6A 4JF5A 1XPBA 3VSKA 1XFQA 4Z1WA 2EFUA 1E4DA 1HZOA 3E2LA 1DP8A 3HUNA 1NRFA 3S7PA 3SH8A 1YPRA 2XD1A 5FQIA 2J80A 1GHMA 1FCOA 5FAPA
chains in the Genus database with same CATH topology
4QWOA 3CPTB 1SKOB 1SZVA 1VETB 1CQAA 1D1JA 2ZL1A 3DAVA 1VEUA 4X25A 2HZ5A 2VK3A 3T1QB 2B95A 5EM0A 1CF0A 1K0KA 1FILA 1Z09A 2BTFP 2PAVP 4X1MA 3MS6A 3CPTA 1PNEA 3T1RA 1SKOA 1VETA 3LEQA 1F2KA 2ACGA 1FIKA 5EVEA 5EV0A 3U4LP 3T1XA 2V8FA 1HLUP 3KYEA 3L7HA 5FEFA 4FUWA 4ESPA 3MSHA 4X1LA 1ACFA 3D9YA 2JKGA 2PBDP 2JKFA 3T12B 5EM1A 3T1SA 1Y4OA 5FEGA 4FTXA 1CJFA 1G5UA 1PRQA 3LGOA 1J3WA 3NECA 2PRFA 1PFLA 2ZL1B 3L9KA 4D60A 1AWIA 1VEUB 3CHWP 5FDSA 2E8JA 3UB5P 1YPRA 3NULA 2V8CA 1A0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QWO A;  3CPT B;  1SKO B;  1SZV A;  1VET B;  1CQA A;  1D1J A;  2ZL1 A;  3DAV A;  1VEU A;  4X25 A;  2HZ5 A;  2VK3 A;  3T1Q B;  2B95 A;  5EM0 A;  1CF0 A;  1K0K A;  1FIL A;  1Z09 A;  2BTF P;  2PAV P;  4X1M A;  3MS6 A;  3CPT A;  1PNE A;  3T1R A;  1SKO A;  1VET A;  3LEQ A;  1F2K A;  2ACG A;  1FIK A;  5EVE A;  5EV0 A;  3U4L P;  3T1X A;  2V8F A;  1HLU P;  3KYE A;  3L7H A;  5FEF A;  4FUW A;  4ESP A;  3MSH A;  4X1L A;  1ACF A;  3D9Y A;  2JKG A;  2PBD P;  2JKF A;  3T12 B;  5EM1 A;  3T1S A;  1Y4O A;  5FEG A;  4FTX A;  1CJF A;  1G5U A;  1PRQ A;  3LGO A;  1J3W A;  3NEC A;  2PRF A;  1PFL A;  2ZL1 B;  3L9K A;  4D60 A;  1AWI A;  1VEU B;  3CHW P;  5FDS A;  2E8J A;  3UB5 P;  1YPR A;  3NUL A;  2V8C A;  1A0K A; 
#chains in the Genus database with same CATH topology
 2QHK A;  3MXR A;  2I72 A;  4R0Q A;  4E3M A;  1S66 L;  3RJU A;  3A3E A;  3O5Y A;  1K4E A;  3T4Q A;  3NC8 A;  4I3J A;  2FH5 A;  1GHI A;  4CLC D;  4G3V A;  3SS3 A;  3D3O A;  4X56 A;  5DFX A;  5CHU A;  3WRZ A;  5HAR A;  3ZG8 B;  4C75 A;  4CLC A;  3UE3 A;  4EUZ A;  4HH2 A;  4JF4 A;  2VKS A;  4O01 A;  3WS1 A;  5HL6 A;  3B3X A;  3VMA A;  3UPO A;  3V39 A;  2EXA A;  3EWK A;  2A24 B;  3Q1F A;  3IBJ A;  1LT0 A;  2XA7 M;  2XFT A;  1MC0 A;  2VA0 A;  1P97 A;  2WKI A;  4MEZ A;  3M6B A;  2RCX A;  4UA9 A;  1K38 A;  2LB5 A;  5EM1 A;  2WKP A;  4WN5 A;  4S2K A;  4I38 A;  3MFX A;  1Y28 A;  1ZTU A;  2OLV A;  2J3T D;  3MMH A;  3E4Q A;  3UE1 A;  4E3J A;  1W5D A;  3PBS A;  3R7W B;  4H6J B;  1TVF A;  2ZOI A;  3DTE A;  1K55 C;  3E4P A;  3L9K A;  4C3Q A;  4ETZ A;  3UDX A;  1XJ3 A;  4GJ4 A;  1U60 A;  2OAP 1;  2P04 A;  5F68 A;  2Y2N A;  3R4K A;  4LCL A;  2WYX A;  3UB7 A;  1Y54 A;  2X71 A;  4B4Z A;  3F1N B;  4IUH A;  5IU1 A;  3ZG5 A;  3ULF A;  3HBR A;  3SS4 A;  2DMW A;  2HDQ A;  4Y17 A;  3WWX A;  3MQ0 A;  3OC2 A;  1TEM A;  1L3L A;  4U0X A;  4R4R A;  2C5W B;  3SS5 A;  1VET A;  5CGX A;  1FSW A;  5M19 A;  4GDB A;  5TFQ A;  2P9V B;  3Q7V A;  3S7O A;  2K31 A;  4EUV A;  1YLP A;  2EX8 A;  3HCY A;  1EW0 A;  4OVD A;  1UWN X;  4GN2 A;  4UAA A;  2HPB A;  3EOI A;  4FTX A;  4ZJ3 A;  1YLY A;  3C4P A;  4X68 A;  5TBM A;  2VGL S;  3FC7 A;  5HAI A;  1E25 A;  2B18 A;  3GV9 A;  3ZNT A;  3BRM A;  4OQG A;  3W4Q A;  2J9O A;  5FAS A;  1ONH A;  1PFL A;  3FV7 A;  3NDE A;  4NXE A;  4DJ2 A;  2ZM2 A;  4OPZ A;  1GA0 A;  3FPW A;  2G7U A;  4KZ5 A;  3KSG A;  3UMD A;  1NYY A;  2Q9M A;  2WAE A;  2A49 A;  4KZA A;  1A0K A;  2WGV A;  2WZZ A;  2J8Y A;  4BJP A;  1M40 A;  2CC1 A;  1AXB A;  4CLC B;  1DP9 A;  3BFG A;  3B33 A;  3QP8 A;  2K2N A;  3T1Q B;  3UNW A;  3MZF A;  4RVA A;  1PZP A;  3S1Y A;  3HLD A;  3WS0 A;  3EQV A;  3NIA A;  3JPU A;  1SHV A;  1H8M A;  4ZJ2 A;  4QHC A;  3PR6 A;  5DF7 A;  4L9E A;  4HHD A;  1XA7 A;  3LI9 A;  5EVE A;  4OPY A;  5HAP A;  1Z6F A;  5J4E A;  1NXY A;  4EBN A;  2GZA A;  2QYB A;  1IYQ A;  5KZH A;  1K56 A;  2EWV A;  3M2J A;  2PD7 A;  3MZE A;  1YLZ A;  3TOI A;  1W79 A;  2XQZ A;  3W2Z A;  2Y2L A;  5F5Y A;  3OCN A;  1XP4 A;  2BG1 A;  1YSP A;  1L2S A;  5A8B A;  4BL3 A;  4GOG A;  3UE6 A;  5CTN A;  1BLS A;  4QY5 A;  3NEC A;  2HP6 A;  4PKY A;  5FL3 A;  4OOM A;  1T1B A;  3QHY A;  3IX3 A;  5DKL A;  1LL8 A;  2LB9 A;  4BD1 A;  4BWI A;  2WKH A;  2VV7 A;  5EVI D;  4WF0 A;  1ALQ A;  1WE4 A;  1MWU A;  3RFB A;  3WRT A;  3V67 A;  1OTA A;  4X69 A;  4S2I A;  4F3L A;  1VET B;  2Y4A A;  1CQA A;  5CEC A;  3C2W A;  2Z6C A;  1EWZ A;  5EVI A;  4I3I A;  1IYS A;  3ZQ5 A;  2ZC4 B;  3Q7V B;  2HJ9 C;  2W0N A;  3NBL A;  1MWS A;  2W3G A;  4K08 A;  4O8G A;  1OTE A;  3V3S A;  2QKP A;  1IKI A;  1P9R A;  1GA9 A;  5M18 A;  1YMS A;  2WAD A;  1BYW A;  1SKF A;  1C3B A;  4HBT A;  3PAE A;  1WA9 A;  5FI6 A;  2X02 A;  2ZMA A;  2AVX A;  2VJW A;  5TBM B;  1QME A;  2R9W A;  3DWZ A;  3SH9 A;  3IF5 A;  3VFF A;  1TS7 A;  1X0O A;  2DRW A;  4D2O A;  4EER A;  5A90 A;  2W1R A;  2JKG A;  3QP4 A;  3LR5 A;  4R38 A;  5L2F A;  2XFS A;  5F1F A;  4ZAM A;  4UHU A;  2VGJ A;  3QP5 A;  2JCH A;  4WZ4 A;  3RXW A;  2B02 A;  1K54 C;  4N9K A;  1G5U A;  4RX2 A;  5HAQ A;  2M7U A;  2A2L A;  3DTI A;  2EXB A;  5HWV A;  3ZG7 B;  1L0D A;  3FWL A;  3HJI A;  4LV0 A;  4IHQ A;  4Q8I A;  1OT9 A;  5HPI A;  1BLH A;  3BJN A;  3G2Y A;  2HGV A;  3I7J A;  2A24 A;  3LIA A;  3E4O A;  2ZC3 B;  2ZQA A;  5AQA A;  3O87 A;  3O88 A;  4L0L A;  2JBF A;  1H3Q A;  3FYZ A;  1D06 A;  1E3U D;  4NXF A;  3MBZ A;  2GJ3 A;  5DVA A;  3N8S A;  1FCM A;  2B95 A;  4K91 A;  1VM1 A;  3ITA A;  5J7E A;  1OTB A;  4GDN A;  2MJ6 A;  4S2O A;  4X1M A;  2H0T A;  2VZW A;  4H6J A;  3SZT A;  1SKO A;  1E3U A;  3O3V A;  5CRF A;  1YQS A;  5IS1 A;  3K3C A;  3LEQ A;  4CLC C;  1KGF A;  5HD3 A;  5JYO A;  3AGE A;  4XT2 A;  4Q0J A;  3MF0 A;  4WBG A;  2WGI A;  1S4S A;  3LY3 A;  5GL9 A;  5FDH A;  5FQM A;  2EX2 A;  3LEZ A;  2V8F A;  4KZ6 A;  2Y2K A;  4UQI M;  2J7V A;  4S2J A;  4JXW A;  2GX5 A;  1KE4 A;  1PIO A;  1I2W A;  2HDU A;  3O86 A;  2ZQ7 A;  2HF6 A;  5CTM A;  1CJF A;  1KDS A;  2H10 A;  4WZ5 A;  5EUA A;  2HP9 A;  5F6A A;  3KYQ A;  1JNU A;  4QB8 A;  5EVL A;  4LV1 A;  1BT5 A;  4PHT A;  5FQK A;  2XF3 A;  4DMZ A;  3T4S A;  3OOV A;  5EVI B;  2J3T C;  4Y2F A;  1GSV A;  2KOI A;  3WS4 A;  1J9M A;  3S7Q A;  4X6T A;  4E6W A;  4KZB A;  1KVL A;  2P74 A;  1ZKJ A;  4NXG A;  2Y2G A;  3AGD A;  4HH3 A;  2HDR A;  3DAV A;  4LCM A;  4KUK A;  4X25 A;  1RCJ A;  1PWC A;  4R3J A;  1VHM A;  3ZG9 B;  2O9A A;  1TDG A;  1FR1 A;  3OPR A;  3BW6 A;  2ZM8 A;  3N8R A;  4P6Z S;  3KO6 A;  3G30 A;  4S2P A;  3A3F A;  3VP3 A;  4LPZ A;  1YT4 A;  3S4X A;  3MZD A;  3Q7Z A;  2EX9 A;  4JF6 A;  1FIK A;  1TF1 A;  3T4T A;  1ERM A;  4BBV A;  3LY4 A;  1KDW A;  4HQA A;  3U2A A;  3BWL A;  3IH8 A;  5FI7 A;  3LCE A;  4O7D A;  5FEF A;  3A0R A;  3ZFZ A;  2HV1 A;  3LR3 A;  4DE2 A;  4HJ6 A;  2PR5 A;  3T12 B;  1I2S A;  2ZMF A;  1ES2 A;  2XK1 A;  2M1C A;  4LGW A;  2O99 A;  5CHJ A;  2XGN A;  4N1X A;  4P85 A;  3VOL A;  4EET B;  3LIF A;  5TJJ A;  3LGO A;  3ZVT A;  4L9G A;  2IA2 A;  4MMN A;  3IHA A;  4PAU A;  1OTI A;  3ZNY A;  3CIT A;  1DP6 A;  3ZCZ A;  3N7W A;  3HLG A;  1LL9 A;  3UY6 A;  5DTT A;  4WEL A;  3ZYT A;  3BYD A;  3IF6 C;  1IOU A;  3P09 A;  4GKU A;  5BOH A;  1PWD A;  1K25 A;  1T19 A;  4KG2 A;  4P6Z M;  1SKO B;  4IED A;  5CER A;  4DKI A;  3N6I A;  3QNB A;  4MN5 A;  2EX6 A;  4XT2 B;  2Y55 A;  1UGU A;  3IX4 A;  1T1C A;  1NRJ A;  1MKM A;  3VE3 A;  5DTS A;  1O07 A;  5FI2 A;  4QPR A;  4ZBE A;  3MS6 A;  4EW7 A;  2O9B A;  5JYP A;  3T1R A;  2WKR A;  5GLA A;  1LL5 A;  5HDD A;  4R23 A;  1V9Z A;  4GZB A;  3IWQ A;  1PI4 A;  2KLI A;  3U4L P;  3A0S A;  3UB6 A;  4R70 A;  3GQZ A;  3DTM A;  3C7U A;  4S2L A;  3PTE A;  4JGO A;  4FUW A;  1JTG A;  4WMC D;  1VB6 A;  4MLL A;  2QWS A;  5HD5 A;  3Q81 A;  4IJG A;  1PWG A;  5AJG A;  2A3U A;  1ERQ A;  1NY0 A;  4A5R A;  3C30 A;  3BY9 A;  3GEC A;  4N9L A;  4OLD A;  4S2M A;  2VGK A;  4F94 A;  3BFF A;  4PM7 A;  4JPM A;  1L0G A;  4JKT A;  4JGQ A;  2PRF A;  4E3O A;  3BFE A;  1P9W A;  5IT5 A;  5HPF A;  1M6K A;  3GR2 A;  1L0F A;  3S22 A;  1UWP X;  3UPN A;  3VOY A;  4JXG A;  3PHY A;  4HEF A;  4K0W A;  2ZQC A;  5DJT A;  1EI5 A;  4OQI A;  3LO7 A;  2VEA A;  3KSF A;  5AQ7 A;  1VEU A;  4JXS A;  3M6H A;  3HRE A;  5EVI C;  1CEG A;  2M7V A;  3LYX A;  4P6B A;  3ZG0 A;  5I94 A;  4DE3 A;  5LBR A;  5MC7 A;  4WL9 A;  4HNB A;  2QJ5 A;  3JYI A;  4EQI A;  2ZLY A;  1MBL A;  5TGF A;  4YFM A;  2WK0 A;  4EV4 A;  3LI8 A;  1GHP A;  1MWT A;  4K0X A;  1FSY A;  3D4F A;  5GHZ A;  3QNC A;  4OKP A;  4PM5 A;  1DJA A;  2E8I A;  5HSQ A;  1OJG A;  4UEY A;  5EEC A;  1V9Y A;  3IS2 B;  3GDI A;  3NJA A;  3P7N A;  3BEC A;  2Y59 A;  2EWW A;  4MN6 A;  3G35 A;  3QP1 A;  1N4O A;  1HVB A;  5DF8 A;  3T1S A;  2ZJ9 A;  4RX3 A;  1W63 M;  3IX8 A;  2PYR A;  3T4O A;  4Y15 A;  5D3O A;  1RGZ A;  4WUJ A;  1K6R A;  4E3K A;  2ZC6 B;  3KSI A;  1ODV A;  1OTD A;  2B5R A;  4KZ7 A;  5HFO A;  4IUK A;  5EPH A;  3NOT C;  2XEP A;  2JN7 A;  3OLO A;  4Y3I A;  1BUL A;  1LI9 A;  1XKZ A;  4HI4 A;  4QD4 A;  3DTK A;  5AVE A;  4HES A;  1XGJ A;  2Y2I A;  2Y91 A;  3H9W A;  5CEB A;  5DFY A;  4ZJ1 A;  4R1G A;  3H7W A;  2XH9 A;  1D7E A;  4LRY C;  2HP5 A;  5TR7 A;  4CLC E;  3NHQ A;  1MKI A;  5EFW A;  1FQG A;  2EFX A;  3PBQ A;  4HJ3 A;  3FG8 A;  1CI9 A;  1T1A A;  1KE0 A;  2ZOH A;  3NOU C;  4B93 A;  3VFH A;  4DXB A;  3TE8 A;  1XJ2 A;  4GS9 A;  4EBL A;  5L8M A;  4O0P A;  4AFI A;  1NZU A;  3NDG A;  1CF0 A;  1FIL A;  4MN7 A;  1JVJ A;  4EES A;  1MXO A;  4LEN A;  3HL9 A;  1FCN A;  1Q2Q A;  3F1P A;  5DTK A;  4HBU A;  1ZG4 A;  3MJQ A;  4UA7 A;  3W4O A;  4P87 A;  2IWB A;  1F5M A;  3H82 A;  4WEJ A;  5CXW A;  5GLB A;  4DDS A;  3TRC A;  5CED A;  4E3I A;  2PBD P;  4G3K A;  3A3J A;  4KEN B;  1YMX A;  5HX9 A;  5J8X A;  3MR0 A;  1G28 A;  2K7S A;  3F1O B;  3DBA A;  5GHX A;  3NI9 A;  2D01 A;  4G3W A;  2Z6D A;  2Y8H A;  4NEE D;  3HLB A;  5CHM A;  1KE3 A;  5E2E A;  4LLO B;  1J3W A;  3JVV A;  1FR6 A;  5HDC A;  1ESI A;  1HTZ A;  3CUE A;  3QP6 A;  2ZD8 A;  4DE1 A;  4E6X A;  5FA7 A;  2PHY A;  2PBY A;  1YLT A;  1VEU B;  3G4P A;  4QY6 A;  1TS0 A;  1CEF A;  1NLZ A;  3HVF A;  2FZ0 A;  4UQI S;  4PPR A;  1I5Q A;  2V2F F;  1S6R A;  5DF9 A;  1N9N A;  3VP4 A;  1N9O A;  1DJC A;  1OPX A;  3FPV A;  3WS2 A;  5L09 A;  1SZV A;  4U3T A;  4ZDX A;  1YLJ A;  1N9L A;  3EEA A;  4KQR A;  4KQD A;  3AGF A;  4HOI A;  3BEB A;  2ZBB A;  1JWZ A;  1XXM A;  4FH2 A;  4RA7 A;  3C7V A;  4MCW A;  3CPT A;  5FAT A;  1H5X A;  5HZH A;  4PKY G;  1K57 A;  1BLC A;  4H8R A;  2XLN A;  3Q82 A;  2ZC7 A;  1S1Z A;  2QJ7 A;  3CAX A;  3PXP A;  4JLF A;  3G6O A;  1NLY A;  1DRM A;  4ESP A;  4Y7P A;  3CZD A;  3D9Y A;  3BM6 A;  4OQH A;  3UB9 A;  2JKF A;  1W7F A;  3T4J A;  1ES4 A;  1TD5 A;  2EA9 A;  4KQQ A;  4N92 A;  1IFQ A;  2L0W A;  3LR4 A;  3C8C A;  2Y2M A;  3H7W B;  2Y2J A;  3C38 A;  2C6W B;  5AQB A;  1W8Q A;  3LR0 A;  1K6S A;  2YKF A;  1BSG A;  2JC7 A;  2YKH A;  4OH0 A;  4UA6 A;  3B47 A;  1FOF A;  4GS9 B;  5K5B A;  5FDS A;  5G4Z A;  3WS5 A;  5FQQ A;  5A93 A;  2FFF B;  1S67 L;  2PR6 A;  2V9A A;  3OPL A;  4ZTK A;  4YIN A;  3HUM A;  3V5M A;  2Y79 A;  5I5L A;  4E04 A;  2QMI A;  1JTD A;  3F1P B;  2XRO A;  4WEK A;  3A3I A;  5G18 A;  1CI8 A;  4HJ4 A;  5FSR A;  3MQO A;  4PM9 A;  1T18 A;  3H82 B;  4Z9Q A;  4DXC A;  4MBK A;  1WYB A;  1LLB A;  3G32 A;  4X53 A;  4ID4 A;  1IEM A;  2ZM0 A;  1WYC A;  4IVI A;  3CMZ A;  4LV3 A;  2PDR A;  1F2K A;  3PBT A;  4WM9 A;  4P0M A;  3OCL A;  3S7N A;  2OSU A;  2ZMV A;  1W8Y A;  2VLG A;  4ME4 A;  3B42 A;  3BY8 A;  1PW1 A;  1GSX A;  4KZ8 A;  4E3N A;  2QZ6 A;  4M4X A;  1K4F A;  4YNR A;  4EEU A;  4MBF A;  1YM1 A;  2XD5 A;  5F82 A;  4DN0 A;  4B9O A;  3UE0 A;  4KUO A;  2CMN A;  2RL3 A;  3LIE A;  2ZQD A;  3BFC A;  4R6L A;  3TG9 A;  1HD8 A;  4PMA A;  4OQ0 A;  1STZ A;  1IKG A;  4BL2 A;  5U47 A;  4S2N A;  3VP1 A;  3KX0 X;  2JKT M;  2OWJ A;  3C4O A;  2JHE A;  3T4K A;  3SH7 A;  3CLO A;  2W3D A;  1PYY A;  3K2N A;  3IQA A;  1L0E A;  4LV2 A;  3IS2 A;  4OP5 A;  4Y0O A;  2WGW B;  4E3L A;  3QP2 A;  4QWO A;  3CPT B;  3MXQ A;  3DW0 A;  4MNR A;  1XX2 A;  1G68 A;  3PBO A;  2IWD A;  4DE0 A;  1KGE A;  2HZ5 A;  3E0Y A;  2VK3 A;  3W8K A;  3OBF A;  2Z2M B;  1BTL A;  5EOO A;  4BLM A;  2NUT C;  3T50 A;  3HJK A;  2QPN A;  4I3A A;  4Y0U A;  3G31 A;  4ARZ B;  2V0U A;  5HL1 A;  4GD6 A;  2JKR M;  3CWF A;  3ISG A;  1DJB A;  2ACG A;  4HP4 A;  5EV0 A;  3RTY A;  3IXD A;  4BEN A;  1RP5 A;  4ZRR A;  4FH4 A;  3MSH A;  4C6Y A;  3OPP A;  1TS8 A;  3T4L A;  3UPP A;  3SOI A;  2J3W A;  3IT9 A;  1ZG6 A;  4NET A;  1G6A A;  3HLF A;  2OAQ 1;  1MY8 A;  2HJE A;  2R9X A;  4Y13 A;  4HIA A;  1XJ6 A;  3MKF A;  1NWZ A;  2Z2L B;  3PBR A;  2Y2P A;  1VQQ A;  3CI6 A;  2O9C A;  2DCF A;  4LRX C;  1GSW A;  4IBX A;  3TSG A;  4EWF A;  4D60 A;  4MBH A;  2Y2Q A;  5GLD A;  4OOY A;  2HDS A;  1LSX A;  2L4R A;  3CHW P;  1MZU A;  4KZ3 A;  1P0Z A;  3NUL A;  4WMC A;  3V3R A;  4GNU A;  5EOE A;  4B4X A;  3HLC A;  3BFD A;  4I5S A;  1BZA A;  5FAO A;  5F69 A;  4HP9 A;  2I9V A;  2V1B A;  2ZQ8 A;  1TS6 A;  2XDM A;  2ZL1 A;  1QMF A;  1OME A;  5HDS A;  3F1O A;  3IBR A;  2Y2O A;  3IXG A;  4XUX A;  1XA1 A;  5EM0 A;  4NXB A;  5A91 A;  4CJN A;  1YKD A;  1OT6 A;  1Z09 A;  3EGX C;  2BTF P;  4M3K A;  3JVU A;  5F83 A;  3UO9 A;  3HLW A;  1H8Z A;  2PYP A;  2BAS A;  4KZ4 A;  3G34 A;  5A92 A;  4OON A;  4YOF A;  5KIZ A;  5E43 A;  3KSH A;  4IVK A;  3LUQ A;  1TDL A;  3RH8 B;  5M1A A;  2W3E A;  3RXX A;  1YLW A;  3EGD C;  2H5S A;  1BUE A;  2J9P A;  4NG2 A;  4JBF A;  3UDI A;  3ZVW A;  2VV6 A;  3UB8 A;  1H0M A;  4PM6 A;  3GMW A;  3M2K A;  3EQU A;  1Y4O A;  3W4P A;  3LID A;  4N1H A;  3IF6 A;  1KGG A;  4QJG A;  1S4R A;  3IXB A;  4ETX A;  1OJ5 A;  5GLC A;  1KVM A;  4NKP A;  1K55 A;  5G4Y A;  5L10 A;  2VV8 A;  5AVF A;  4GLQ A;  2Q9N A;  3C5A A;  5E2H A;  4Y0T A;  3CUE C;  4DDY A;  4DJ3 A;  3UDF A;  3Q07 A;  4NK3 A;  4GD8 A;  2V8C A;  2IWC A;  2W1T A;  4GHI A;  1NYM A;  1ERO A;  2WZX A;  3N8L A;  1IYP A;  5C5K A;  1K56 D;  4KG5 A;  1SDN A;  1XFN A;  2OOL A;  5AQ9 A;  3MFD A;  3NY4 A;  2VGL M;  1K0K A;  1PI5 A;  2PAV P;  2XSS A;  3HUO A;  5GHY A;  3FKV A;  1PNE A;  3GTC A;  2H28 A;  3ZHH A;  3IWI A;  1Q2P A;  4KQO A;  4QU3 A;  2V1Z A;  1XJ4 A;  4RQ9 A;  3IWO A;  4U0T A;  4LFU A;  3A0V A;  5FQJ A;  2XR0 A;  2FFY A;  1K57 C;  2JE5 A;  3OPH A;  1IYO A;  3TW8 A;  1NZO A;  3MKE A;  1SCW A;  1MPL A;  5DJU A;  4OLG A;  1G6O A;  1JWP A;  2W3H A;  3VP2 A;  4X1L A;  2PD8 A;  4LRZ E;  3K3D A;  4I39 A;  3GRJ A;  4EXO A;  5FEG A;  2INW A;  2DNS A;  3LIB A;  4X55 A;  4FSF A;  4R3B A;  2V1A A;  4BMW A;  3ITB A;  1W63 Q;  1PRQ A;  3IHB A;  3GVB A;  2UV0 E;  4EEP A;  4YWZ A;  5FAQ A;  1N9B A;  4DF6 A;  2ZL1 B;  1AWI A;  1S0W A;  4XXR A;  2KX6 A;  4OPQ A;  3SW1 A;  4EQ1 A;  3UB5 P;  5HWT A;  5E2G A;  4WZ5 C;  1ES5 A;  3T1X A;  2GNX A;  4R3A A;  2WKE A;  3V50 A;  3VE4 A;  3BQ8 A;  4JGR A;  2W27 A;  4Q0I A;  2PU2 A;  1D1J A;  3ICY A;  2KDK A;  5CX7 A;  4Y5F A;  1CK3 A;  2Q0O A;  2PT7 A;  2OLU A;  4OOL A;  2VX8 A;  3MQQ A;  2P08 A;  3IXH A;  4EU0 A;  4GW9 A;  4CQH A;  4JGP A;  3VOZ A;  3VP0 A;  3OZH A;  4BQM A;  3LFV A;  3G2Z A;  1XGI A;  3P01 A;  4BBU A;  2V20 A;  3P98 A;  2WUQ A;  1JWV A;  4OP8 A;  1NJ4 A;  4DRT A;  3IF6 B;  1LI0 A;  1DY6 A;  3TJZ C;  3FZC A;  1ESU A;  3NCK A;  4Q0H A;  3KYE A;  3VV4 A;  2WGW A;  4WLA A;  1ES3 A;  1ACF A;  4XUZ A;  1IEL A;  3CG5 A;  3BLM A;  5CGS A;  4EBP A;  4L9F A;  4JXV A;  5EE8 A;  1ZC2 A;  3DWK A;  3BLS A;  1H8Y A;  2OV5 A;  3E98 A;  2PU4 A;  2UWX A;  1PW8 A;  2ZQ9 A;  3UN7 A;  2R78 A;  5HW3 A;  2OWH A;  4B88 A;  1RGY A;  4KZ9 A;  1GCE A;  2H0Y A;  5FQ9 A;  1YSQ A;  4R4S A;  2W1T B;  4HY8 A;  2W3F A;  4GHI B;  1BLP A;  2JKT I;  3FKW A;  2Y2H A;  5DKK A;  3VSL A;  2G2U A;  4ARZ A;  3N4I A;  1F9I A;  4OPR A;  2ZC5 B;  3MXS A;  4MDZ A;  4WYY A;  1F98 A;  2G2W A;  1LHY A;  4S2N C;  3PAG A;  2E8J A;  2BLS A;  3EEH A;  3CJM A;  1SDE A;  1ZHH B;  1LSW A;  3PBN A;  3R7W A;  3LIC A;  2XRN A;  5KMW A;  4CPK A;  5F1G A;  3A3D A;  3IH9 A;  5J3W A;  3GSG A;  5CGW A;  4FOF A;  4GB7 A;  2L1M A;  2V0W A;  3E2K A;  4GCZ A;  1S1Y A;  4BD0 A;  2JKR I;  3HLE A;  5IHV A;  1PZO A;  2NUP C;  2WAF A;  3F1N A;  4RYE A;  5KSH A;  4II7 A;  1MWR A;  5HWW A;  1KOU A;  2P7J A;  4FCF A;  3NOP C;  2GDN A;  5E2F A;  3ZGA B;  1HLU P;  2D02 A;  3L7H A;  3ZDJ A;  4IBR A;  2WKQ A;  3PYP A;  4PM8 A;  3KYZ A;  1YAX A;  4F3L B;  5KSC A;  5L07 A;  1ONG A;  2X01 A;  3BQA A;  4BBT A;  2O0Y A;  1O7E A;  3D72 A;  2P9V A;  2XA7 S;  1K54 A;  1LSV A;  3UME A;  4FD8 A;  4KG6 A;  4JF5 A;  1XPB A;  3VSK A;  1XFQ A;  4Z1W A;  2EFU A;  1E4D A;  1HZO A;  3E2L A;  1DP8 A;  3HUN A;  1NRF A;  3S7P A;  3SH8 A;  1YPR A;  2XD1 A;  5FQI A;  2J80 A;  1GHM A;  1FCO A;  5FAP A; 
#chains in the Genus database with same CATH homology
 4QWO A;  3CPT B;  1SKO B;  1SZV A;  1VET B;  1CQA A;  1D1J A;  2ZL1 A;  3DAV A;  1VEU A;  4X25 A;  2HZ5 A;  2VK3 A;  3T1Q B;  2B95 A;  5EM0 A;  1CF0 A;  1K0K A;  1FIL A;  1Z09 A;  2BTF P;  2PAV P;  4X1M A;  3MS6 A;  3CPT A;  1PNE A;  3T1R A;  1SKO A;  1VET A;  3LEQ A;  1F2K A;  2ACG A;  1FIK A;  5EVE A;  5EV0 A;  3U4L P;  3T1X A;  2V8F A;  1HLU P;  3KYE A;  3L7H A;  5FEF A;  4FUW A;  4ESP A;  3MSH A;  4X1L A;  1ACF A;  3D9Y A;  2JKG A;  2PBD P;  2JKF A;  3T12 B;  5EM1 A;  3T1S A;  1Y4O A;  5FEG A;  4FTX A;  1CJF A;  1G5U A;  1PRQ A;  3LGO A;  1J3W A;  3NEC A;  2PRF A;  1PFL A;  2ZL1 B;  3L9K A;  4D60 A;  1AWI A;  1VEU B;  3CHW P;  5FDS A;  2E8J A;  3UB5 P;  1YPR A;  3NUL A;  2V8C A;  1A0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...