4FTXA

Crystal structure of ego3 homodimer
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
158
Chain Sequence
HSKNVKGFLENTLKPYDLHSVDFKTSSLQSSMIITATNGGILSYATSNNDVPKNSINEINSVNNLKMMSLLIKDKWSEDENDTEEQHSNSCYPVEIDSFKTKIYTYEMEDLHTCVAQIPNSDLLLLFIAEGSFPYGLLVIKIERAMRELTDLFGYKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SLM4
publication title Ego3 functions as a homodimer to mediate the interaction between Gtr1-Gtr2 and Ego1 in the ego complex to activate TORC1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 42
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16818 SLM4 Protein SLM4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4ftxA01
3CPTB 4FTXA 2PRFA 4X1LA 3KYEA 1ACFA 2PBDP 1PFLA 3L7HA 3MSHA 1SKOB 1J3WA 4ESPA 2ZL1A 1G5UA 1A0KA 4FUWA 1F2KA 3MS6A 4X25A 3T1RA 5EM0A 1PRQA 2B95A 3NULA 3U4LP 4D60A 1FILA 1VETA 1YPRA 1D1JA 2JKGA 1K0KA 5FEGA 1PNEA 2V8FA 3CHWP 1AWIA 2JKFA 3UB5P 1Z09A 3T1QB 3D9YA 1VEUA 3CPTA 1CJFA 2E8JA 2V8CA 4X1MA 1CF0A 5FEFA 2ZL1B 1SKOA 1HLUP 1SZVA 2HZ5A 3DAVA 5FDSA 4QWOA 5EVEA 1CQAA 1FIKA 2VK3A 3L9KA 2PAVP 3LGOA 3T12B 3T1SA 1VETB 5EV0A 3LEQA 3NECA 5EM1A 2ACGA 3T1XA 2BTFP 1Y4OA 1VEUB
chains in the Genus database with same CATH superfamily
2WKRA 3HJKA 3LICA 3Q07A 3VP0A 1KVLA 3E4QA 3RTYA 5HL1A 3C7UA 2QYBA 1BLHA 1U60A 3EQVA 4R6LA 4DKIA 4QHCA 5CECA 4Y2FA 3ZVWA 5A90A 1G6OA 4DJ2A 1K55A 4R38A 3C4OA 4EV4A 3CMZA 1WA9A 4EUZA 2XLNA 4LRZE 2GJ3A 4YFMA 4D60A 3F1NB 1KOUA 2Y2KA 4QU3A 4M4XA 2Q9NA 3QP1A 5AVEA 3PAGA 3RH8B 5DVAA 3G34A 4BL2A 1H3QA 1S1YA 1IYOA 2L0WA 2VKSA 5KSHA 2VV6A 5F1FA 1T1BA 3OCNA 2WGWA 2HJ9C 2ZQ8A 2Q0OA 1XGIA 4ZJ1A 3IS2B 2ZMVA 4WZ5C 5TJJA 5DF8A 4R3JA 1QMFA 2OLUA 5CTMA 1P97A 4KZ8A 4B9OA 2JHEA 4O0PA 3MXQA 3G2ZA 4KG5A 2KLIA 5AQ9A 2QJ7A 3NBLA 2WK0A 1G68A 3NCKA 5LBRA 2ZQ9A 4G3VA 4HHDA 4EXOA 3OZHA 4X68A 2INWA 4B88A 4DF6A 4JF6A 2O9CA 1OTEA 2EX8A 2E8IA 1YLJA 3IT9A 2B02A 3A3EA 5CX7A 2BASA 4GOGA 3O86A 3UE6A 1MKMA 4JF5A 2VV7A 5CGWA 4B4ZA 4HIAA 3N4IA 1MKIA 3IWIA 4WYYA 1YLWA 4E3NA 2HP5A 3LO7A 4D2OA 4EEPA 1N9BA 1TDGA 4OQHA 2WKQA 1G28A 1TDLA 4CLCC 5KIZA 2IWCA 2Y79A 3UMDA 5G4ZA 1EROA 2V1AA 2Y2IA 3B47A 3LIEA 3VOYA 3A0RA 3P7NA 4PAUA 4QPRA 1BZAA 2XA7S 5EE8A 1FILA 4KZ7A 1ERQA 4FCFA 1TS0A 2Y2JA 5CEDA 4WUJA 5FEGA 3LUQA 1PNEA 5J3WA 4MDZA 1K6RA 5FQIA 1F9IA 1TS6A 4Y7PA 1T1AA 1LHYA 2DCFA 3UDIA 1MPLA 2WKIA 2XFSA 2G2WA 4MLLA 5TBMA 3V3SA 1CF0A 3KSFA 5HDDA 4U0XA 4EUVA 3MXRA 1HLUP 3ISGA 2ZC7A 3ZG0A 4CQHA 2OWJA 1KGGA 4KG2A 3H9WA 1K4EA 2PAVP 3DBAA 3T12B 3UB6A 3PYPA 1KDWA 2JC7A 1VM1A 3CUEC 3ZDJA 4JGPA 2KX6A 4DE3A 3KO6A 3DWZA 1ES3A 2W3DA 2X01A 4JBFA 5JYPA 2P7JA 2H5SA 4WL9A 5EOOA 4UAAA 4P6ZM 1STZA 3ZG7B 1IYSA 4JLFA 3CPTB 4PPRA 2R78A 2PBYA 3GDIA 3T4KA 3IF6C 5CERA 5FATA 2ZQCA 1NJ4A 1BLCA 3MSHA 4ESPA 3BFEA 3MZFA 1E3UD 3GMWA 2J3WA 5DFXA 2PD7A 3MKEA 1DP6A 1L2SA 3LR0A 2Q9MA 4BQMA 1F2KA 4WELA 4O7DA 1ONGA 4U0TA 1P9WA 3BQ8A 2L4RA 3C7VA 4KZBA 4E6WA 1TVFA 4FOFA 4EEUA 4II7A 3SH7A 4BBVA 4QJGA 2M1CA 2OV5A 2K2NA 2Y2OA 4KG6A 4BJPA 5EFWA 1XA1A 3SS4A 3UN7A 1CJFA 2ZM0A 5HWTA 3QP4A 2WKEA 3RFBA 4S2MA 3VP4A 3B3XA 4ARZA 4L9FA 1RCJA 3K2NA 2ZC6B 3FYZA 5TBMB 4KQDA 2J3TC 1XJ3A 3JYIA 5EV0A 1XXMA 1WYCA 3PBTA 3IHBA 3OOVA 5AQ7A 5F6AA 2H28A 5FASA 2Y2GA 1TS8A 5HPIA 2FZ0A 4BD1A 3HVFA 1NYMA 2JKTM 1YQSA 3UE3A 1FCMA 5AQBA 4LENA 1MC0A 3HLEA 1PFLA 3QHYA 1SKOB 4GD6A 2ZQDA 1BSGA 4N92A 4JXGA 5EOEA 4OPQA 2Y2HA 1A0KA 4C75A 1ERMA 2EFXA 4FUWA 1XFQA 2P9VA 3MS6A 1PIOA 1NZUA 1XX2A 1ALQA 3LFVA 1YLPA 1JNUA 1V9YA 3NULA 2IA2A 3U4LP 3QP2A 4S2NC 4G3WA 1DP8A 1HD8A 4HOIA 4C3QA 3I7JA 4GD8A 5EUAA 4JGOA 3TG9A 2EWWA 3KYQA 1O07A 1VEUA 1LLBA 1W7FA 3MFDA 1RP5A 1YSQA 5DF9A 1XP4A 4MEZA 2IWDA 3HLCA 3MR0A 4LCMA 4NXBA 4GKUA 3LIDA 4RX3A 3DAVA 3KX0X 1FSWA 4R3AA 4RYEA 4HJ6A 4GNUA 3GVBA 5HFOA 1P9RA 4OPRA 4PHTA 3KYZA 2HDRA 4IUKA 3BFGA 3ZGAB 5C5KA 1L3LA 1DY6A 1IKIA 4OVDA 4X6TA 5D3OA 4E6XA 4KZ4A 5J8XA 3HLFA 5AJGA 4S2LA 3RXXA 3BLSA 4K91A 1TEMA 3NHQA 3PBRA 3ZG9B 4Y0TA 2X71A 4H8RA 4B93A 4R1GA 4IBRA 3O87A 2PYPA 3BJNA 1KDSA 3W4QA 4H6JB 2EX6A 2W3EA 4QD4A 4JXSA 5FQQA 1P0ZA 4HI4A 2ZOIA 1ES2A 1ACFA 4DRTA 3DTEA 4KUKA 4EW7A 4FSFA 2XRNA 3WS4A 4M3KA 2A24B 3CITA 4PM6A 3O5YA 1IELA 5EM0A 4LV3A 4P6BA 1IYPA 3AGEA 2JKRI 4OOLA 4LGWA 1OT9A 5HSQA 3SOIA 3CLOA 4E3IA 1GA0A 4WZ5A 4EERA 1DJCA 3FWLA 4MBFA 2UWXA 1GHPA 3HCYA 2EA9A 3LIAA 1W63Q 4LRXC 3O3VA 1VB6A 2QZ6A 1LI0A 2ZLYA 4MMNA 2W27A 4DDSA 1MWTA 3HLWA 5FDSA 5J4EA 2OOLA 2R9WA 3A3FA 3BY8A 3Q7VA 5HL6A 3ZG8B 4MBKA 3A3JA 2J9OA 2HGVA 1PYYA 3SS5A 4K08A 3GTCA 4QB8A 3UE0A 3EGXC 4F3LA 4K0XA 4CJNA 3IBRA 3BY9A 4JPMA 4U3TA 2VGKA 3CZDA 3N7WA 3UB9A 4ETXA 2KOIA 5K5BA 4C6YA 4MCWA 2XF3A 4Q0JA 4LRYC 3VP3A 4X1LA 4CLCA 2JCHA 2BLSA 3BFCA 5HWWA 3GQZA 2H10A 2YKFA 3L7HA 1D06A 4GS9A 5M1AA 4P6ZS 1ZG6A 2XD1A 4R4RA 3H82B 1CK3A 4XT2B 3EEHA 5IS1A 3WS2A 2V20A 3IQAA 3E0YA 3TSGA 1RGZA 1IYQA 3HLGA 1PW1A 1T1CA 5HW3A 1D1JA 2L1MA 1I5QA 3ZQ5A 3A3IA 3S1YA 1XGJA 4Z9QA 1S4SA 3UB5P 3ZFZA 3T1QB 4Y0UA 1BUEA 3HJIA 1T19A 2XEPA 5HD5A 1PW8A 3VV4A 3UPPA 4GHIA 4I38A 4IVKA 3OPHA 5FEFA 4NK3A 2HZ5A 3T4OA 4OKPA 4PKYG 4DDYA 3SW1A 2VX8A 5CGSA 3CUEA 1I2SA 5U47A 1K54C 5FAPA 4CLCD 4ETZA 2OLVA 3LEZA 5F69A 1L0GA 1MXOA 3CI6A 4UA6A 1K25A 1SDNA 2ZQAA 3F1OA 4WEKA 4MBHA 4MNRA 5A91A 3IWOA 4Y0OA 3IF6A 3LI8A 3BEBA 4ZJ3A 1C3BA 1SKFA 1EWZA 2XFTA 4WLAA 3QP8A 4FTXA 2IWBA 1FQGA 3KSHA 4OLGA 1N4OA 1W79A 1E25A 4I3IA 5DJUA 4OLDA 5HAIA 3TE8A 2Y2MA 4HP4A 4DXCA 2P74A 2ZL1A 4KQOA 3V67A 4HESA 5I5LA 4N1XA 3NOTC 5TGFA 3UY6A 4X25A 3UMEA 4S2PA 4IVIA 3LIBA 4Y17A 3MMHA 1LSXA 3IX8A 1NY0A 1F5MA 3LR3A 1WYBA 3T4JA 5F83A 2Y55A 4WEJA 4JXVA 2HDSA 2Y8HA 3UB8A 5GLAA 2RCXA 3IHAA 1Z6FA 4GJ4A 3SH8A 2ZMFA 2Y2NA 3JVVA 4G3KA 2W1TA 3SZTA 3W4OA 2QPNA 4MN7A 3OPLA 1XFNA 4HY8A 4JF4A 3G31A 2WGVA 4OP5A 2PU4A 2GX5A 2XDMA 3MQ0A 2V0WA 5A92A 1YLZA 2XROA 1GSXA 1S6RA 2V0UA 3O88A 3NIAA 4P87A 4HH3A 5MC7A 3T1XA 3NDGA 3N8SA 2WGWB 3V3RA 3WRZA 3Q7ZA 1O7EA 1L0DA 2WZXA 2NUTC 1H8YA 4IHQA 3LIFA 4EU0A 2FFFB 3F1OB 4KZ9A 4RQ9A 1G6AA 4FH4A 1LSVA 5FQ9A 3LR4A 4ID4A 1PWDA 4GLQA 3IF6B 5EVIC 4FD8A 2K7SA 4OPZA 3NOPC 4S2NA 4PM7A 1YKDA 3Q81A 3VOLA 1YAXA 2B95A 1Q2QA 2P04A 1VETA 1IFQA 4WF0A 1YM1A 3E4PA 1F98A 3OPPA 4E04A 2J3TD 1OJGA 3W8KA 3F1PA 3TOIA 2PT7A 4LLOB 5GLDA 1PWCA 4ME4A 4Y5FA 3UE1A 1NYYA 4RVAA 4YNRA 3FKWA 3NJAA 3HREA 4X53A 1GSVA 1S67L 2DMWA 4OQIA 1K4FA 4PM8A 3GSGA 4PM5A 3N6IA 4LV1A 3ZNYA 1FIKA 3ULFA 3S7NA 3VE4A 1X0OA 1HVBA 2V1BA 3NOUC 3UO9A 1QMEA 3IWQA 3HUOA 3LY4A 4UEYA 4HP9A 5GHYA 2QHKA 3MXSA 3P09A 3MF0A 5HAQA 2Z2LB 2HPBA 4WN5A 4NG2A 5EPHA 3LR5A 3PBQA 1N9OA 2A49A 3G6OA 1MY8A 2PBDP 5CTNA 3IX4A 3PTEA 4HH2A 1IKGA 1CEGA 2Y91A 5FL3A 1YT4A 3G32A 3NC8A 4WM9A 1ZHHB 3CWFA 3R7WA 1UWPX 4Q8IA 1AWIA 4AFIA 2QWSA 3KSGA 2B18A 3IXDA 2W3GA 5M19A 5HWVA 1JWPA 5GLCA 3C38A 3NI9A 5CXWA 1S0WA 4OQGA 3MKFA 1FSYA 3UPOA 3FC7A 1SZVA 3WS5A 3UPNA 3MZDA 4NXEA 5FQJA 5EVEA 1YMXA 4JGQA 1L0EA 5GL9A 1LT0A 4BBUA 3H7WA 5CHMA 1RGYA 4BLMA 3QP5A 1XA7A 3FPWA 2KDKA 2VJWA 2EX9A 1OTDA 3T4SA 4XUXA 3K3CA 3BWLA 1MWRA 4R23A 3HLDA 4WMCA 2WZZA 1LL9A 3W2ZA 4UQIM 4XXRA 4NKPA 3FZCA 1NZOA 2DNSA 1D7EA 3EGDC 2G7UA 4GZBA 3ICYA 2ZMAA 4ZBEA 4OQ0A 1NRFA 4EQ1A 4WBGA 2ZC3B 2XGNA 2HP6A 1UGUA 4K0WA 3T4QA 4MN5A 4ARZB 1GA9A 1XPBA 3UDFA 3WS1A 2EFUA 3PBNA 5GHZA 3LYXA 2FFYA 4IEDA 1K56A 4P85A 4Y3IA 1K0KA 3GV9A 3IXHA 4BWIA 5F5YA 3WRTA 3VOZA 1K38A 2Y2LA 4DE1A 4YINA 2M7VA 1ES4A 1JTGA 4KZAA 5GLBA 3WS0A 2V8CA 4YOFA 2W0NA 1NRJA 4HBTA 3BYDA 4E3OA 2VLGA 1PZPA 2A2LA 4BENA 4X55A 1YSPA 3PHYA 2ZM2A 1K54A 1DP9A 4WMCD 2P9VB 1CQAA 2H0YA 1ESUA 5TR7A 4O01A 3GRJA 4P0MA 5HZHA 4L9EA 5G4YA 1BULA 4OH0A 1SCWA 1BLSA 5A93A 1JVJA 5G18A 3LY3A 3TJZC 2VEAA 3F1NA 3PBOA 3VFFA 2GDNA 4N9LA 1GHMA 2ZC5B 1VEUB 3MBZA 2VA0A 5F68A 4OONA 3HUNA 1FCNA 4RX2A 1M40A 3IH9A 3IS2A 5F1GA 4BL3A 2EXBA 4I3JA 4EESA 2ZD8A 5A8BA 4OP8A 4EETB 4OOMA 1W5DA 2AVXA 1H8MA 2PDRA 1YLTA 5E2HA 3C8CA 3OPRA 3OLOA 1MZUA 2DRWA 5AQAA 4EQIA 4KZ3A 3VSLA 1VHMA 2ZBBA 3BW6A 4YWZA 2K31A 4EBLA 3ZG5A 2QJ5A 4ZDXA 4E3MA 1PWGA 4F94A 5FAQA 2J80A 5F82A 3CHWP 5L10A 5JYOA 3MQQA 3V39A 3M2KA 4QY5A 2HDQA 2Y2PA 3IF5A 3CAXA 2Y4AA 3EQUA 1FOFA 3N8LA 1J9MA 4Q0HA 5L2FA 5CEBA 1ZTUA 5L09A 2P08A 1XKZA 3FG8A 3MQOA 1HZOA 1XJ2A 2D01A 4I5SA 3EOIA 2O0YA 3JVUA 5FDHA 2QMIA 2NUPC 2I72A 4IUHA 3Q82A 3T1SA 3LEQA 4HJ4A 4OPYA 4DJ3A 4HNBA 3PR6A 3TRCA 4N1HA 4JKTA 5E2FA 2JKTI 1TS7A 4R4SA 1YLYA 1W8YA 2XH9A 5HAPA 1H0MA 1CI9A 3QP6A 1FCOA 5KMWA 4IJGA 5EVIA 3C5AA 3G4PA 4B4XA 2Z6DA 4DE2A 3TW8A 1I2WA 2O99A 4KUOA 1G5UA 2PHYA 5TFQA 1FR6A 1S4RA 3P01A 5FI2A 3Q7VB 1IOUA 1OJ5A 1DJAA 2XR0A 2WYXA 3T1RA 5CHJA 1PRQA 1IEMA 2VV8A 2WKPA 4F3LB 3LCEA 4A5RA 4R70A 4RA7A 3G2YA 2JKGA 4KQQA 2XK1A 4HEFA 3E98A 5GHXA 2GNXA 1TD5A 1XJ6A 5FQKA 3GR2A 3CPTA 4CLCB 3OC2A 4FH2A 1TF1A 2E8JA 3OBFA 3S22A 4LV0A 3R4KA 2J9PA 1OTAA 2ZC4B 2WAEA 3LI9A 4LCLA 3CG5A 3D72A 4GS9B 3BQAA 1NXYA 2WUQA 3RXWA 5KSCA 2VGLS 2GZAA 2W3HA 3QNCA 4PMAA 2W1RA 3DTKA 4S2IA 5EVID 5KZHA 3C2WA 1EI5A 3IXGA 3UB7A 3T4LA 4HBUA 2OSUA 4JXWA 1K57C 1LL8A 5HD3A 1GCEA 3K3DA 2ZM8A 1SDEA 2M7UA 2MJ6A 5DTKA 1N9NA 1PI5A 2PRFA 4O8GA 3ZVTA 1HTZA 4GHIB 1KE4A 4EWFA 2PYRA 4DN0A 5DTTA 1E3UA 5AVFA 3HL9A 3C4PA 5J7EA 2HP9A 3HUMA 3IBJA 4EBNA 5IHVA 4UQIS 2J7VA 5EVIB 2PR5A 2OAQ1 4DE0A 2HDUA 3ZNTA 1K55C 2UV0E 4PM9A 1JWVA 4NXFA 1ZG4A 1YPRA 1N9LA 3IXBA 3JPUA 2V2FF 5DFYA 1YMSA 2JKFA 3BFDA 2JKRM 1DRMA 3DWKA 1M6KA 1GSWA 2ZOHA 1MBLA 2JN7A 1Q2PA 4Q0IA 3UNWA 5FI6A 5DKLA 4IBXA 1KGEA 5DKKA 1H8ZA 4S2JA 2ZL1B 3V5MA 1SKOA 4QY6A 1OTBA 4WZ4A 5IU1A 2XSSA 3W4PA 3E4OA 4GDNA 3VSKA 3DTMA 1AXBA 3IX3A 1KE0A 3KSIA 5EECA 5E43A 1V9ZA 3RJUA 4N9KA 4I39A 4GW9A 1NLYA 3IH8A 2LB5A 1S1ZA 3GECA 3ZCZA 5BOHA 1NLZA 1Y28A 1ZKJA 3EEAA 4R0QA 5HDCA 2O9BA 2HF6A 3HBRA 5IT5A 4ZTKA 3MZEA 1ZC2A 5E2GA 2ZQ7A 1OMEA 3NY4A 3E2KA 1BLPA 2W1TB 3MFXA 4PKYA 5FAOA 4CPKA 2Y2QA 2V1ZA 3M6BA 1ODVA 3A0VA 1ESIA 4ZRRA 2Z2MB 5DF7A 3A3DA 4E3JA 5E2EA 4LFUA 4BD0A 3T50A 2WGIA 3DTIA 3C30A 2V8FA 4GDBA 2FH5A 4DMZA 3G35A 4GCZA 3B33A 2CC1A 3PXPA 4H6JA 1WE4A 2R9XA 1NWZA 5FI7A 4MN6A 2LB9A 1EW0A 4NEED 4S2OA 4UHUA 3M6HA 1MWUA 3ITBA 2A24A 4HQAA 2VGLM 2HV1A 4KENB 1MWSA 3AGFA 5FSRA 5HARA 1VETB 2X02A 1BTLA 1GHIA 3BRMA 4ZJ2A 1ONHA 5I94A 1L0FA 2ACGA 1SHVA 3F1PB 3CJMA 2QKPA 3SS3A 4NXGA 2WAFA 2XA7M 2OWHA 2Y59A 4LPZA 4LV2A 1DJBA 3MJQA 4UA9A 3SH9A 3ZYTA 3DW0A 4XUZA 3HLBA 1FR1A 1KGFA 1OTIA 5HX9A 2VZWA 1BYWA 4JGRA 5EVLA 2PD8A 4CLCE 5DTSA 2I9VA 5HDSA 1CEFA 3G30A 4R3BA 4S2KA 4KQRA 3N8RA 3VMAA 3VFHA 2H0TA 5M18A 2WADA 3PBSA 2C6WB 1LI9A 2YKHA 3U2AA 1Z09A 3OCLA 4E3LA 5CHUA 1S66L 1BT5A 3D9YA 3E2LA 3ITAA 3AGDA 1CI8A 4X1MA 2C5WB 1W8QA 3WWXA 2G2UA 4X69A 2JBFA 4Y15A 4UA7A 3VP2A 2EWVA 3D3OA 4X56A 2VK3A 4EBPA 3L9KA 2PU2A 3H82A 3QNBA 4XT2A 3BM6A 3LGOA 2HJEA 3VP1A 2W3FA 4NETA 3A0SA 3R7WB 3Q1FA 4HJ3A 4BBTA 4L0LA 1E4DA 4GB7A 4DXBA 2BG1A 1Y54A 2BTFP 5L07A 4KZ5A 1H5XA 3BLMA 2XQZA 1UWNX 5L8MA 2XD5A 1OT6A 3KYEA 1KVMA 3S7OA 4KZ6A 2OAP1 3B42A 3BFFA 3UDXA 2O9AA 1J3WA 1VQQA 3D4FA 3BECA 3S4XA 1K6SA 3EWKA 3FKVA 2WKHA 3FV7A 3H7WB 5HPFA 2CMNA 2JE5A 3V50A 5FQMA 1ES5A 4E3KA 3NDEA 2Z6CA 3FPVA 1K56D 3VE3A 5CRFA 2VGJA 1XJ4A 3P98A 1JTDA 2PR6A 4ZAMA 1T18A 1JWZA 1LSWA 4L9GA 2ZJ9A 3T4TA 1KE3A 1LL5A 4I3AA 5FA7A 4GN2A 1W63M 2J8YA 2D02A 5DJTA 3S7PA 4Y13A 4QWOA 2V9AA 1PI4A 3ZHHA 5CGXA 2B5RA 1OPXA 3M2JA 3PAEA 2A3UA 1PZOA 4OOYA 1K57A 4Z1WA 3NECA 2EXAA 5EM1A 2RL3A 2EX2A 1Y4OA 4BMWA 3S7QA
chains in the Genus database with same CATH topology
3CPTB 4FTXA 2PRFA 4X1LA 3KYEA 1ACFA 2PBDP 1PFLA 3L7HA 3MSHA 1SKOB 1J3WA 4ESPA 2ZL1A 1G5UA 1A0KA 4FUWA 1F2KA 3MS6A 4X25A 3T1RA 5EM0A 1PRQA 2B95A 3NULA 3U4LP 4D60A 1FILA 1VETA 1YPRA 1D1JA 2JKGA 1K0KA 5FEGA 1PNEA 2V8FA 3CHWP 1AWIA 2JKFA 3UB5P 1Z09A 3T1QB 3D9YA 1VEUA 3CPTA 1CJFA 2E8JA 2V8CA 4X1MA 1CF0A 5FEFA 2ZL1B 1SKOA 1HLUP 1SZVA 2HZ5A 3DAVA 5FDSA 4QWOA 5EVEA 1CQAA 1FIKA 2VK3A 3L9KA 2PAVP 3LGOA 3T12B 3T1SA 1VETB 5EV0A 3LEQA 3NECA 5EM1A 2ACGA 3T1XA 2BTFP 1Y4OA 1VEUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPT B;  4FTX A;  2PRF A;  4X1L A;  3KYE A;  1ACF A;  2PBD P;  1PFL A;  3L7H A;  3MSH A;  1SKO B;  1J3W A;  4ESP A;  2ZL1 A;  1G5U A;  1A0K A;  4FUW A;  1F2K A;  3MS6 A;  4X25 A;  3T1R A;  5EM0 A;  1PRQ A;  2B95 A;  3NUL A;  3U4L P;  4D60 A;  1FIL A;  1VET A;  1YPR A;  1D1J A;  2JKG A;  1K0K A;  5FEG A;  1PNE A;  2V8F A;  3CHW P;  1AWI A;  2JKF A;  3UB5 P;  1Z09 A;  3T1Q B;  3D9Y A;  1VEU A;  3CPT A;  1CJF A;  2E8J A;  2V8C A;  4X1M A;  1CF0 A;  5FEF A;  2ZL1 B;  1SKO A;  1HLU P;  1SZV A;  2HZ5 A;  3DAV A;  5FDS A;  4QWO A;  5EVE A;  1CQA A;  1FIK A;  2VK3 A;  3L9K A;  2PAV P;  3LGO A;  3T12 B;  3T1S A;  1VET B;  5EV0 A;  3LEQ A;  3NEC A;  5EM1 A;  2ACG A;  3T1X A;  2BTF P;  1Y4O A;  1VEU B; 
#chains in the Genus database with same CATH topology
 2WKR A;  3HJK A;  3LIC A;  3Q07 A;  3VP0 A;  1KVL A;  3E4Q A;  3RTY A;  5HL1 A;  3C7U A;  2QYB A;  1BLH A;  1U60 A;  3EQV A;  4R6L A;  4DKI A;  4QHC A;  5CEC A;  4Y2F A;  3ZVW A;  5A90 A;  1G6O A;  4DJ2 A;  1K55 A;  4R38 A;  3C4O A;  4EV4 A;  3CMZ A;  1WA9 A;  4EUZ A;  2XLN A;  4LRZ E;  2GJ3 A;  4YFM A;  4D60 A;  3F1N B;  1KOU A;  2Y2K A;  4QU3 A;  4M4X A;  2Q9N A;  3QP1 A;  5AVE A;  3PAG A;  3RH8 B;  5DVA A;  3G34 A;  4BL2 A;  1H3Q A;  1S1Y A;  1IYO A;  2L0W A;  2VKS A;  5KSH A;  2VV6 A;  5F1F A;  1T1B A;  3OCN A;  2WGW A;  2HJ9 C;  2ZQ8 A;  2Q0O A;  1XGI A;  4ZJ1 A;  3IS2 B;  2ZMV A;  4WZ5 C;  5TJJ A;  5DF8 A;  4R3J A;  1QMF A;  2OLU A;  5CTM A;  1P97 A;  4KZ8 A;  4B9O A;  2JHE A;  4O0P A;  3MXQ A;  3G2Z A;  4KG5 A;  2KLI A;  5AQ9 A;  2QJ7 A;  3NBL A;  2WK0 A;  1G68 A;  3NCK A;  5LBR A;  2ZQ9 A;  4G3V A;  4HHD A;  4EXO A;  3OZH A;  4X68 A;  2INW A;  4B88 A;  4DF6 A;  4JF6 A;  2O9C A;  1OTE A;  2EX8 A;  2E8I A;  1YLJ A;  3IT9 A;  2B02 A;  3A3E A;  5CX7 A;  2BAS A;  4GOG A;  3O86 A;  3UE6 A;  1MKM A;  4JF5 A;  2VV7 A;  5CGW A;  4B4Z A;  4HIA A;  3N4I A;  1MKI A;  3IWI A;  4WYY A;  1YLW A;  4E3N A;  2HP5 A;  3LO7 A;  4D2O A;  4EEP A;  1N9B A;  1TDG A;  4OQH A;  2WKQ A;  1G28 A;  1TDL A;  4CLC C;  5KIZ A;  2IWC A;  2Y79 A;  3UMD A;  5G4Z A;  1ERO A;  2V1A A;  2Y2I A;  3B47 A;  3LIE A;  3VOY A;  3A0R A;  3P7N A;  4PAU A;  4QPR A;  1BZA A;  2XA7 S;  5EE8 A;  1FIL A;  4KZ7 A;  1ERQ A;  4FCF A;  1TS0 A;  2Y2J A;  5CED A;  4WUJ A;  5FEG A;  3LUQ A;  1PNE A;  5J3W A;  4MDZ A;  1K6R A;  5FQI A;  1F9I A;  1TS6 A;  4Y7P A;  1T1A A;  1LHY A;  2DCF A;  3UDI A;  1MPL A;  2WKI A;  2XFS A;  2G2W A;  4MLL A;  5TBM A;  3V3S A;  1CF0 A;  3KSF A;  5HDD A;  4U0X A;  4EUV A;  3MXR A;  1HLU P;  3ISG A;  2ZC7 A;  3ZG0 A;  4CQH A;  2OWJ A;  1KGG A;  4KG2 A;  3H9W A;  1K4E A;  2PAV P;  3DBA A;  3T12 B;  3UB6 A;  3PYP A;  1KDW A;  2JC7 A;  1VM1 A;  3CUE C;  3ZDJ A;  4JGP A;  2KX6 A;  4DE3 A;  3KO6 A;  3DWZ A;  1ES3 A;  2W3D A;  2X01 A;  4JBF A;  5JYP A;  2P7J A;  2H5S A;  4WL9 A;  5EOO A;  4UAA A;  4P6Z M;  1STZ A;  3ZG7 B;  1IYS A;  4JLF A;  3CPT B;  4PPR A;  2R78 A;  2PBY A;  3GDI A;  3T4K A;  3IF6 C;  5CER A;  5FAT A;  2ZQC A;  1NJ4 A;  1BLC A;  3MSH A;  4ESP A;  3BFE A;  3MZF A;  1E3U D;  3GMW A;  2J3W A;  5DFX A;  2PD7 A;  3MKE A;  1DP6 A;  1L2S A;  3LR0 A;  2Q9M A;  4BQM A;  1F2K A;  4WEL A;  4O7D A;  1ONG A;  4U0T A;  1P9W A;  3BQ8 A;  2L4R A;  3C7V A;  4KZB A;  4E6W A;  1TVF A;  4FOF A;  4EEU A;  4II7 A;  3SH7 A;  4BBV A;  4QJG A;  2M1C A;  2OV5 A;  2K2N A;  2Y2O A;  4KG6 A;  4BJP A;  5EFW A;  1XA1 A;  3SS4 A;  3UN7 A;  1CJF A;  2ZM0 A;  5HWT A;  3QP4 A;  2WKE A;  3RFB A;  4S2M A;  3VP4 A;  3B3X A;  4ARZ A;  4L9F A;  1RCJ A;  3K2N A;  2ZC6 B;  3FYZ A;  5TBM B;  4KQD A;  2J3T C;  1XJ3 A;  3JYI A;  5EV0 A;  1XXM A;  1WYC A;  3PBT A;  3IHB A;  3OOV A;  5AQ7 A;  5F6A A;  2H28 A;  5FAS A;  2Y2G A;  1TS8 A;  5HPI A;  2FZ0 A;  4BD1 A;  3HVF A;  1NYM A;  2JKT M;  1YQS A;  3UE3 A;  1FCM A;  5AQB A;  4LEN A;  1MC0 A;  3HLE A;  1PFL A;  3QHY A;  1SKO B;  4GD6 A;  2ZQD A;  1BSG A;  4N92 A;  4JXG A;  5EOE A;  4OPQ A;  2Y2H A;  1A0K A;  4C75 A;  1ERM A;  2EFX A;  4FUW A;  1XFQ A;  2P9V A;  3MS6 A;  1PIO A;  1NZU A;  1XX2 A;  1ALQ A;  3LFV A;  1YLP A;  1JNU A;  1V9Y A;  3NUL A;  2IA2 A;  3U4L P;  3QP2 A;  4S2N C;  4G3W A;  1DP8 A;  1HD8 A;  4HOI A;  4C3Q A;  3I7J A;  4GD8 A;  5EUA A;  4JGO A;  3TG9 A;  2EWW A;  3KYQ A;  1O07 A;  1VEU A;  1LLB A;  1W7F A;  3MFD A;  1RP5 A;  1YSQ A;  5DF9 A;  1XP4 A;  4MEZ A;  2IWD A;  3HLC A;  3MR0 A;  4LCM A;  4NXB A;  4GKU A;  3LID A;  4RX3 A;  3DAV A;  3KX0 X;  1FSW A;  4R3A A;  4RYE A;  4HJ6 A;  4GNU A;  3GVB A;  5HFO A;  1P9R A;  4OPR A;  4PHT A;  3KYZ A;  2HDR A;  4IUK A;  3BFG A;  3ZGA B;  5C5K A;  1L3L A;  1DY6 A;  1IKI A;  4OVD A;  4X6T A;  5D3O A;  4E6X A;  4KZ4 A;  5J8X A;  3HLF A;  5AJG A;  4S2L A;  3RXX A;  3BLS A;  4K91 A;  1TEM A;  3NHQ A;  3PBR A;  3ZG9 B;  4Y0T A;  2X71 A;  4H8R A;  4B93 A;  4R1G A;  4IBR A;  3O87 A;  2PYP A;  3BJN A;  1KDS A;  3W4Q A;  4H6J B;  2EX6 A;  2W3E A;  4QD4 A;  4JXS A;  5FQQ A;  1P0Z A;  4HI4 A;  2ZOI A;  1ES2 A;  1ACF A;  4DRT A;  3DTE A;  4KUK A;  4EW7 A;  4FSF A;  2XRN A;  3WS4 A;  4M3K A;  2A24 B;  3CIT A;  4PM6 A;  3O5Y A;  1IEL A;  5EM0 A;  4LV3 A;  4P6B A;  1IYP A;  3AGE A;  2JKR I;  4OOL A;  4LGW A;  1OT9 A;  5HSQ A;  3SOI A;  3CLO A;  4E3I A;  1GA0 A;  4WZ5 A;  4EER A;  1DJC A;  3FWL A;  4MBF A;  2UWX A;  1GHP A;  3HCY A;  2EA9 A;  3LIA A;  1W63 Q;  4LRX C;  3O3V A;  1VB6 A;  2QZ6 A;  1LI0 A;  2ZLY A;  4MMN A;  2W27 A;  4DDS A;  1MWT A;  3HLW A;  5FDS A;  5J4E A;  2OOL A;  2R9W A;  3A3F A;  3BY8 A;  3Q7V A;  5HL6 A;  3ZG8 B;  4MBK A;  3A3J A;  2J9O A;  2HGV A;  1PYY A;  3SS5 A;  4K08 A;  3GTC A;  4QB8 A;  3UE0 A;  3EGX C;  4F3L A;  4K0X A;  4CJN A;  3IBR A;  3BY9 A;  4JPM A;  4U3T A;  2VGK A;  3CZD A;  3N7W A;  3UB9 A;  4ETX A;  2KOI A;  5K5B A;  4C6Y A;  4MCW A;  2XF3 A;  4Q0J A;  4LRY C;  3VP3 A;  4X1L A;  4CLC A;  2JCH A;  2BLS A;  3BFC A;  5HWW A;  3GQZ A;  2H10 A;  2YKF A;  3L7H A;  1D06 A;  4GS9 A;  5M1A A;  4P6Z S;  1ZG6 A;  2XD1 A;  4R4R A;  3H82 B;  1CK3 A;  4XT2 B;  3EEH A;  5IS1 A;  3WS2 A;  2V20 A;  3IQA A;  3E0Y A;  3TSG A;  1RGZ A;  1IYQ A;  3HLG A;  1PW1 A;  1T1C A;  5HW3 A;  1D1J A;  2L1M A;  1I5Q A;  3ZQ5 A;  3A3I A;  3S1Y A;  1XGJ A;  4Z9Q A;  1S4S A;  3UB5 P;  3ZFZ A;  3T1Q B;  4Y0U A;  1BUE A;  3HJI A;  1T19 A;  2XEP A;  5HD5 A;  1PW8 A;  3VV4 A;  3UPP A;  4GHI A;  4I38 A;  4IVK A;  3OPH A;  5FEF A;  4NK3 A;  2HZ5 A;  3T4O A;  4OKP A;  4PKY G;  4DDY A;  3SW1 A;  2VX8 A;  5CGS A;  3CUE A;  1I2S A;  5U47 A;  1K54 C;  5FAP A;  4CLC D;  4ETZ A;  2OLV A;  3LEZ A;  5F69 A;  1L0G A;  1MXO A;  3CI6 A;  4UA6 A;  1K25 A;  1SDN A;  2ZQA A;  3F1O A;  4WEK A;  4MBH A;  4MNR A;  5A91 A;  3IWO A;  4Y0O A;  3IF6 A;  3LI8 A;  3BEB A;  4ZJ3 A;  1C3B A;  1SKF A;  1EWZ A;  2XFT A;  4WLA A;  3QP8 A;  4FTX A;  2IWB A;  1FQG A;  3KSH A;  4OLG A;  1N4O A;  1W79 A;  1E25 A;  4I3I A;  5DJU A;  4OLD A;  5HAI A;  3TE8 A;  2Y2M A;  4HP4 A;  4DXC A;  2P74 A;  2ZL1 A;  4KQO A;  3V67 A;  4HES A;  5I5L A;  4N1X A;  3NOT C;  5TGF A;  3UY6 A;  4X25 A;  3UME A;  4S2P A;  4IVI A;  3LIB A;  4Y17 A;  3MMH A;  1LSX A;  3IX8 A;  1NY0 A;  1F5M A;  3LR3 A;  1WYB A;  3T4J A;  5F83 A;  2Y55 A;  4WEJ A;  4JXV A;  2HDS A;  2Y8H A;  3UB8 A;  5GLA A;  2RCX A;  3IHA A;  1Z6F A;  4GJ4 A;  3SH8 A;  2ZMF A;  2Y2N A;  3JVV A;  4G3K A;  2W1T A;  3SZT A;  3W4O A;  2QPN A;  4MN7 A;  3OPL A;  1XFN A;  4HY8 A;  4JF4 A;  3G31 A;  2WGV A;  4OP5 A;  2PU4 A;  2GX5 A;  2XDM A;  3MQ0 A;  2V0W A;  5A92 A;  1YLZ A;  2XRO A;  1GSX A;  1S6R A;  2V0U A;  3O88 A;  3NIA A;  4P87 A;  4HH3 A;  5MC7 A;  3T1X A;  3NDG A;  3N8S A;  2WGW B;  3V3R A;  3WRZ A;  3Q7Z A;  1O7E A;  1L0D A;  2WZX A;  2NUT C;  1H8Y A;  4IHQ A;  3LIF A;  4EU0 A;  2FFF B;  3F1O B;  4KZ9 A;  4RQ9 A;  1G6A A;  4FH4 A;  1LSV A;  5FQ9 A;  3LR4 A;  4ID4 A;  1PWD A;  4GLQ A;  3IF6 B;  5EVI C;  4FD8 A;  2K7S A;  4OPZ A;  3NOP C;  4S2N A;  4PM7 A;  1YKD A;  3Q81 A;  3VOL A;  1YAX A;  2B95 A;  1Q2Q A;  2P04 A;  1VET A;  1IFQ A;  4WF0 A;  1YM1 A;  3E4P A;  1F98 A;  3OPP A;  4E04 A;  2J3T D;  1OJG A;  3W8K A;  3F1P A;  3TOI A;  2PT7 A;  4LLO B;  5GLD A;  1PWC A;  4ME4 A;  4Y5F A;  3UE1 A;  1NYY A;  4RVA A;  4YNR A;  3FKW A;  3NJA A;  3HRE A;  4X53 A;  1GSV A;  1S67 L;  2DMW A;  4OQI A;  1K4F A;  4PM8 A;  3GSG A;  4PM5 A;  3N6I A;  4LV1 A;  3ZNY A;  1FIK A;  3ULF A;  3S7N A;  3VE4 A;  1X0O A;  1HVB A;  2V1B A;  3NOU C;  3UO9 A;  1QME A;  3IWQ A;  3HUO A;  3LY4 A;  4UEY A;  4HP9 A;  5GHY A;  2QHK A;  3MXS A;  3P09 A;  3MF0 A;  5HAQ A;  2Z2L B;  2HPB A;  4WN5 A;  4NG2 A;  5EPH A;  3LR5 A;  3PBQ A;  1N9O A;  2A49 A;  3G6O A;  1MY8 A;  2PBD P;  5CTN A;  3IX4 A;  3PTE A;  4HH2 A;  1IKG A;  1CEG A;  2Y91 A;  5FL3 A;  1YT4 A;  3G32 A;  3NC8 A;  4WM9 A;  1ZHH B;  3CWF A;  3R7W A;  1UWP X;  4Q8I A;  1AWI A;  4AFI A;  2QWS A;  3KSG A;  2B18 A;  3IXD A;  2W3G A;  5M19 A;  5HWV A;  1JWP A;  5GLC A;  3C38 A;  3NI9 A;  5CXW A;  1S0W A;  4OQG A;  3MKF A;  1FSY A;  3UPO A;  3FC7 A;  1SZV A;  3WS5 A;  3UPN A;  3MZD A;  4NXE A;  5FQJ A;  5EVE A;  1YMX A;  4JGQ A;  1L0E A;  5GL9 A;  1LT0 A;  4BBU A;  3H7W A;  5CHM A;  1RGY A;  4BLM A;  3QP5 A;  1XA7 A;  3FPW A;  2KDK A;  2VJW A;  2EX9 A;  1OTD A;  3T4S A;  4XUX A;  3K3C A;  3BWL A;  1MWR A;  4R23 A;  3HLD A;  4WMC A;  2WZZ A;  1LL9 A;  3W2Z A;  4UQI M;  4XXR A;  4NKP A;  3FZC A;  1NZO A;  2DNS A;  1D7E A;  3EGD C;  2G7U A;  4GZB A;  3ICY A;  2ZMA A;  4ZBE A;  4OQ0 A;  1NRF A;  4EQ1 A;  4WBG A;  2ZC3 B;  2XGN A;  2HP6 A;  1UGU A;  4K0W A;  3T4Q A;  4MN5 A;  4ARZ B;  1GA9 A;  1XPB A;  3UDF A;  3WS1 A;  2EFU A;  3PBN A;  5GHZ A;  3LYX A;  2FFY A;  4IED A;  1K56 A;  4P85 A;  4Y3I A;  1K0K A;  3GV9 A;  3IXH A;  4BWI A;  5F5Y A;  3WRT A;  3VOZ A;  1K38 A;  2Y2L A;  4DE1 A;  4YIN A;  2M7V A;  1ES4 A;  1JTG A;  4KZA A;  5GLB A;  3WS0 A;  2V8C A;  4YOF A;  2W0N A;  1NRJ A;  4HBT A;  3BYD A;  4E3O A;  2VLG A;  1PZP A;  2A2L A;  4BEN A;  4X55 A;  1YSP A;  3PHY A;  2ZM2 A;  1K54 A;  1DP9 A;  4WMC D;  2P9V B;  1CQA A;  2H0Y A;  1ESU A;  5TR7 A;  4O01 A;  3GRJ A;  4P0M A;  5HZH A;  4L9E A;  5G4Y A;  1BUL A;  4OH0 A;  1SCW A;  1BLS A;  5A93 A;  1JVJ A;  5G18 A;  3LY3 A;  3TJZ C;  2VEA A;  3F1N A;  3PBO A;  3VFF A;  2GDN A;  4N9L A;  1GHM A;  2ZC5 B;  1VEU B;  3MBZ A;  2VA0 A;  5F68 A;  4OON A;  3HUN A;  1FCN A;  4RX2 A;  1M40 A;  3IH9 A;  3IS2 A;  5F1G A;  4BL3 A;  2EXB A;  4I3J A;  4EES A;  2ZD8 A;  5A8B A;  4OP8 A;  4EET B;  4OOM A;  1W5D A;  2AVX A;  1H8M A;  2PDR A;  1YLT A;  5E2H A;  3C8C A;  3OPR A;  3OLO A;  1MZU A;  2DRW A;  5AQA A;  4EQI A;  4KZ3 A;  3VSL A;  1VHM A;  2ZBB A;  3BW6 A;  4YWZ A;  2K31 A;  4EBL A;  3ZG5 A;  2QJ5 A;  4ZDX A;  4E3M A;  1PWG A;  4F94 A;  5FAQ A;  2J80 A;  5F82 A;  3CHW P;  5L10 A;  5JYO A;  3MQQ A;  3V39 A;  3M2K A;  4QY5 A;  2HDQ A;  2Y2P A;  3IF5 A;  3CAX A;  2Y4A A;  3EQU A;  1FOF A;  3N8L A;  1J9M A;  4Q0H A;  5L2F A;  5CEB A;  1ZTU A;  5L09 A;  2P08 A;  1XKZ A;  3FG8 A;  3MQO A;  1HZO A;  1XJ2 A;  2D01 A;  4I5S A;  3EOI A;  2O0Y A;  3JVU A;  5FDH A;  2QMI A;  2NUP C;  2I72 A;  4IUH A;  3Q82 A;  3T1S A;  3LEQ A;  4HJ4 A;  4OPY A;  4DJ3 A;  4HNB A;  3PR6 A;  3TRC A;  4N1H A;  4JKT A;  5E2F A;  2JKT I;  1TS7 A;  4R4S A;  1YLY A;  1W8Y A;  2XH9 A;  5HAP A;  1H0M A;  1CI9 A;  3QP6 A;  1FCO A;  5KMW A;  4IJG A;  5EVI A;  3C5A A;  3G4P A;  4B4X A;  2Z6D A;  4DE2 A;  3TW8 A;  1I2W A;  2O99 A;  4KUO A;  1G5U A;  2PHY A;  5TFQ A;  1FR6 A;  1S4R A;  3P01 A;  5FI2 A;  3Q7V B;  1IOU A;  1OJ5 A;  1DJA A;  2XR0 A;  2WYX A;  3T1R A;  5CHJ A;  1PRQ A;  1IEM A;  2VV8 A;  2WKP A;  4F3L B;  3LCE A;  4A5R A;  4R70 A;  4RA7 A;  3G2Y A;  2JKG A;  4KQQ A;  2XK1 A;  4HEF A;  3E98 A;  5GHX A;  2GNX A;  1TD5 A;  1XJ6 A;  5FQK A;  3GR2 A;  3CPT A;  4CLC B;  3OC2 A;  4FH2 A;  1TF1 A;  2E8J A;  3OBF A;  3S22 A;  4LV0 A;  3R4K A;  2J9P A;  1OTA A;  2ZC4 B;  2WAE A;  3LI9 A;  4LCL A;  3CG5 A;  3D72 A;  4GS9 B;  3BQA A;  1NXY A;  2WUQ A;  3RXW A;  5KSC A;  2VGL S;  2GZA A;  2W3H A;  3QNC A;  4PMA A;  2W1R A;  3DTK A;  4S2I A;  5EVI D;  5KZH A;  3C2W A;  1EI5 A;  3IXG A;  3UB7 A;  3T4L A;  4HBU A;  2OSU A;  4JXW A;  1K57 C;  1LL8 A;  5HD3 A;  1GCE A;  3K3D A;  2ZM8 A;  1SDE A;  2M7U A;  2MJ6 A;  5DTK A;  1N9N A;  1PI5 A;  2PRF A;  4O8G A;  3ZVT A;  1HTZ A;  4GHI B;  1KE4 A;  4EWF A;  2PYR A;  4DN0 A;  5DTT A;  1E3U A;  5AVF A;  3HL9 A;  3C4P A;  5J7E A;  2HP9 A;  3HUM A;  3IBJ A;  4EBN A;  5IHV A;  4UQI S;  2J7V A;  5EVI B;  2PR5 A;  2OAQ 1;  4DE0 A;  2HDU A;  3ZNT A;  1K55 C;  2UV0 E;  4PM9 A;  1JWV A;  4NXF A;  1ZG4 A;  1YPR A;  1N9L A;  3IXB A;  3JPU A;  2V2F F;  5DFY A;  1YMS A;  2JKF A;  3BFD A;  2JKR M;  1DRM A;  3DWK A;  1M6K A;  1GSW A;  2ZOH A;  1MBL A;  2JN7 A;  1Q2P A;  4Q0I A;  3UNW A;  5FI6 A;  5DKL A;  4IBX A;  1KGE A;  5DKK A;  1H8Z A;  4S2J A;  2ZL1 B;  3V5M A;  1SKO A;  4QY6 A;  1OTB A;  4WZ4 A;  5IU1 A;  2XSS A;  3W4P A;  3E4O A;  4GDN A;  3VSK A;  3DTM A;  1AXB A;  3IX3 A;  1KE0 A;  3KSI A;  5EEC A;  5E43 A;  1V9Z A;  3RJU A;  4N9K A;  4I39 A;  4GW9 A;  1NLY A;  3IH8 A;  2LB5 A;  1S1Z A;  3GEC A;  3ZCZ A;  5BOH A;  1NLZ A;  1Y28 A;  1ZKJ A;  3EEA A;  4R0Q A;  5HDC A;  2O9B A;  2HF6 A;  3HBR A;  5IT5 A;  4ZTK A;  3MZE A;  1ZC2 A;  5E2G A;  2ZQ7 A;  1OME A;  3NY4 A;  3E2K A;  1BLP A;  2W1T B;  3MFX A;  4PKY A;  5FAO A;  4CPK A;  2Y2Q A;  2V1Z A;  3M6B A;  1ODV A;  3A0V A;  1ESI A;  4ZRR A;  2Z2M B;  5DF7 A;  3A3D A;  4E3J A;  5E2E A;  4LFU A;  4BD0 A;  3T50 A;  2WGI A;  3DTI A;  3C30 A;  2V8F A;  4GDB A;  2FH5 A;  4DMZ A;  3G35 A;  4GCZ A;  3B33 A;  2CC1 A;  3PXP A;  4H6J A;  1WE4 A;  2R9X A;  1NWZ A;  5FI7 A;  4MN6 A;  2LB9 A;  1EW0 A;  4NEE D;  4S2O A;  4UHU A;  3M6H A;  1MWU A;  3ITB A;  2A24 A;  4HQA A;  2VGL M;  2HV1 A;  4KEN B;  1MWS A;  3AGF A;  5FSR A;  5HAR A;  1VET B;  2X02 A;  1BTL A;  1GHI A;  3BRM A;  4ZJ2 A;  1ONH A;  5I94 A;  1L0F A;  2ACG A;  1SHV A;  3F1P B;  3CJM A;  2QKP A;  3SS3 A;  4NXG A;  2WAF A;  2XA7 M;  2OWH A;  2Y59 A;  4LPZ A;  4LV2 A;  1DJB A;  3MJQ A;  4UA9 A;  3SH9 A;  3ZYT A;  3DW0 A;  4XUZ A;  3HLB A;  1FR1 A;  1KGF A;  1OTI A;  5HX9 A;  2VZW A;  1BYW A;  4JGR A;  5EVL A;  2PD8 A;  4CLC E;  5DTS A;  2I9V A;  5HDS A;  1CEF A;  3G30 A;  4R3B A;  4S2K A;  4KQR A;  3N8R A;  3VMA A;  3VFH A;  2H0T A;  5M18 A;  2WAD A;  3PBS A;  2C6W B;  1LI9 A;  2YKH A;  3U2A A;  1Z09 A;  3OCL A;  4E3L A;  5CHU A;  1S66 L;  1BT5 A;  3D9Y A;  3E2L A;  3ITA A;  3AGD A;  1CI8 A;  4X1M A;  2C5W B;  1W8Q A;  3WWX A;  2G2U A;  4X69 A;  2JBF A;  4Y15 A;  4UA7 A;  3VP2 A;  2EWV A;  3D3O A;  4X56 A;  2VK3 A;  4EBP A;  3L9K A;  2PU2 A;  3H82 A;  3QNB A;  4XT2 A;  3BM6 A;  3LGO A;  2HJE A;  3VP1 A;  2W3F A;  4NET A;  3A0S A;  3R7W B;  3Q1F A;  4HJ3 A;  4BBT A;  4L0L A;  1E4D A;  4GB7 A;  4DXB A;  2BG1 A;  1Y54 A;  2BTF P;  5L07 A;  4KZ5 A;  1H5X A;  3BLM A;  2XQZ A;  1UWN X;  5L8M A;  2XD5 A;  1OT6 A;  3KYE A;  1KVM A;  3S7O A;  4KZ6 A;  2OAP 1;  3B42 A;  3BFF A;  3UDX A;  2O9A A;  1J3W A;  1VQQ A;  3D4F A;  3BEC A;  3S4X A;  1K6S A;  3EWK A;  3FKV A;  2WKH A;  3FV7 A;  3H7W B;  5HPF A;  2CMN A;  2JE5 A;  3V50 A;  5FQM A;  1ES5 A;  4E3K A;  3NDE A;  2Z6C A;  3FPV A;  1K56 D;  3VE3 A;  5CRF A;  2VGJ A;  1XJ4 A;  3P98 A;  1JTD A;  2PR6 A;  4ZAM A;  1T18 A;  1JWZ A;  1LSW A;  4L9G A;  2ZJ9 A;  3T4T A;  1KE3 A;  1LL5 A;  4I3A A;  5FA7 A;  4GN2 A;  1W63 M;  2J8Y A;  2D02 A;  5DJT A;  3S7P A;  4Y13 A;  4QWO A;  2V9A A;  1PI4 A;  3ZHH A;  5CGX A;  2B5R A;  1OPX A;  3M2J A;  3PAE A;  2A3U A;  1PZO A;  4OOY A;  1K57 A;  4Z1W A;  3NEC A;  2EXA A;  5EM1 A;  2RL3 A;  2EX2 A;  1Y4O A;  4BMW A;  3S7Q A; 
#chains in the Genus database with same CATH homology
 3CPT B;  4FTX A;  2PRF A;  4X1L A;  3KYE A;  1ACF A;  2PBD P;  1PFL A;  3L7H A;  3MSH A;  1SKO B;  1J3W A;  4ESP A;  2ZL1 A;  1G5U A;  1A0K A;  4FUW A;  1F2K A;  3MS6 A;  4X25 A;  3T1R A;  5EM0 A;  1PRQ A;  2B95 A;  3NUL A;  3U4L P;  4D60 A;  1FIL A;  1VET A;  1YPR A;  1D1J A;  2JKG A;  1K0K A;  5FEG A;  1PNE A;  2V8F A;  3CHW P;  1AWI A;  2JKF A;  3UB5 P;  1Z09 A;  3T1Q B;  3D9Y A;  1VEU A;  3CPT A;  1CJF A;  2E8J A;  2V8C A;  4X1M A;  1CF0 A;  5FEF A;  2ZL1 B;  1SKO A;  1HLU P;  1SZV A;  2HZ5 A;  3DAV A;  5FDS A;  4QWO A;  5EVE A;  1CQA A;  1FIK A;  2VK3 A;  3L9K A;  2PAV P;  3LGO A;  3T12 B;  3T1S A;  1VET B;  5EV0 A;  3LEQ A;  3NEC A;  5EM1 A;  2ACG A;  3T1X A;  2BTF P;  1Y4O A;  1VEU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...