4FTXA

Crystal structure of ego3 homodimer
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
158
Chain Sequence
HSKNVKGFLENTLKPYDLHSVDFKTSSLQSSMIITATNGGILSYATSNNDVPKNSINEINSVNNLKMMSLLIKDKWSEDENDTEEQHSNSCYPVEIDSFKTKIYTYEMEDLHTCVAQIPNSDLLLLFIAEGSFPYGLLVIKIERAMRELTDLFGYKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ego3 functions as a homodimer to mediate the interaction between Gtr1-Gtr2 and Ego1 in the ego complex to activate TORC1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Protein SLM4
total genus 42
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16818 SLM4 Protein SLM4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4ftxA01
1SKOB 2PRFA 4ESPA 1J3WA 3D9YA 4QWOA 1SZVA 4FTXA 2E8JA 4D60A 3CHWP 3T1RA 2ACGA 2HZ5A 3T12B 2JKGA 3T1SA 3T1XA 3U4LP 2VK3A 3MSHA 1ACFA 5FDSA 1D1JA 1HLUP 2BTFP 1SKOA 1CJFA 2JKFA 2V8CA 3NECA 3NULA 1FILA 1AWIA 2PBDP 1K0KA 5EVEA 3CPTA 3T1QB 1G5UA 4X1MA 1FIKA 1YPRA 3LEQA 2B95A 5EV0A 1PFLA 5EM0A 1VETA 1VEUA 2ZL1A 4X1LA 2V8FA 5FEGA 2PAVP 3L9KA 1Z09A 3DAVA 5EM1A 1Y4OA 1PRQA 1CF0A 3MS6A 1VETB 1VEUB 2ZL1B 3CPTB 3KYEA 3L7HA 4X25A 1F2KA 1CQAA 5FEFA 3UB5P 4FUWA 1A0KA 1PNEA 3LGOA
chains in the Genus database with same CATH superfamily
5CHUA 3V5MA 5GLAA 4KUKA 5DTSA 3OPHA 1IYOA 2XA7S 5HDCA 1MWTA 2KX6A 4B4XA 3H7WB 5EM0A 1BZAA 4IUKA 3T4KA 1NYYA 3LI9A 5JYOA 3DBAA 5IT5A 1P0ZA 2C5WB 4KZ6A 3ZG8B 4E3MA 4JXWA 1WYCA 2Y2OA 4ETXA 4BMWA 2B5RA 3PBRA 1IKGA 2QYBA 5AQ7A 2XROA 3HUNA 3UE1A 4EV4A 3Q7VB 4FUWA 5CX7A 4LLOB 3LR5A 3FPVA 3QP6A 1N4OA 1E3UA 3RJUA 4FH4A 4JXVA 2XGNA 3BFGA 3JVVA 1W8YA 3A0SA 3H82B 5GHYA 5GLCA 1PFLA 4UHUA 3H7WA 4PKYA 3C38A 1TVFA 3NOPC 4GN2A 1ONGA 4KG6A 5A93A 4IVKA 2OV5A 2GDNA 4Z1WA 5M1AA 2XRNA 4U0TA 2PU2A 4FH2A 2ZBBA 3LYXA 4LPZA 3ZG7B 2W0NA 4DRTA 4E6XA 4ID4A 2OLVA 4G3WA 4X53A 4WYYA 4R4RA 4ME4A 3BY9A 4JPMA 4D60A 4WELA 1YKDA 1TS0A 4P6ZM 4MN7A 2L4RA 4H6JA 4OQGA 4YWZA 2ZC6B 4MN6A 1CEFA 5EVIA 2OWJA 2H10A 5FI2A 1YLJA 5HWWA 1D7EA 1SHVA 4PM6A 4GS9B 1S6RA 3T4LA 2OOLA 3GTCA 2JBFA 2PHYA 3T4TA 4P0MA 1LT0A 3T1RA 3T12B 4NG2A 5FQ9A 3IWOA 1K4EA 5HL6A 2YKHA 2LB9A 2OWHA 4PM8A 1J9MA 3BEBA 3PBOA 1T1BA 2WAEA 3ZQ5A 4HJ3A 5CERA 2Y55A 3PBSA 4BLMA 2C6WB 4S2JA 1K54A 2ZMFA 3FYZA 1YM1A 3M2KA 2HP9A 4QB8A 4N1XA 1YMSA 1OMEA 2ZOIA 5DTKA 2WGIA 2D02A 1MKMA 4CLCA 3G30A 1T19A 1K4FA 2ZM2A 2D01A 4RA7A 4Q0HA 1MWSA 4FTXA 5KMWA 1YAXA 4WUJA 1ERQA 1ES4A 2Y2NA 4I3IA 5EFWA 4NXBA 3SH9A 1DRMA 1H5XA 2VJWA 3C7VA 3S4XA 4UA6A 1SKFA 1GHMA 2J9OA 5FAQA 2PRFA 3UB7A 1NYMA 3NY4A 3G31A 4EBPA 3LICA 1UWNX 3DTEA 3KX0X 1CJFA 3UPOA 3E2KA 2V1BA 4BWIA 1QMFA 5FQIA 1LSXA 2A24A 4ZAMA 3SS4A 4A5RA 4I39A 3BECA 4N1HA 3UPPA 2ZMAA 3GV9A 3FC7A 1BTLA 1XJ2A 3VP2A 4DF6A 5HAIA 2M7UA 5F1FA 1FILA 1YQSA 3IXHA 2HPBA 2PBYA 2H0YA 5A91A 3B47A 3IX4A 4FSFA 3IT9A 4EUVA 3TJZC 1H3QA 4BJPA 2JKTI 2Q9NA 3Q7VA 1PIOA 4NETA 5CTNA 5HAQA 4E6WA 4UQIS 2WKPA 3HUOA 4II7A 4OH0A 4FOFA 2HP6A 4HEFA 5A92A 3ITAA 2EA9A 1MWUA 2O9CA 5HDSA 3SS5A 3LIDA 2GX5A 5IU1A 4F94A 3N7WA 4DN0A 4JF6A 3UMEA 3M2JA 2VGLS 4HJ6A 4NXGA 5HARA 3MSHA 1NRJA 1G6AA 3PR6A 4NEED 5FI6A 1JTDA 3KSIA 4X69A 3MZFA 3AGEA 4MN5A 1K56A 2Z2MB 3C8CA 2VZWA 5M19A 4BENA 1XFNA 2INWA 3VSKA 3MZDA 3OCNA 5E2GA 4S2KA 2J8YA 3NULA 5HDDA 2H28A 2Y2LA 1JNUA 1LI0A 2HJEA 1ONHA 5EE8A 3HREA 2VEAA 5HPIA 3TRCA 1IOUA 1OTBA 4PM7A 2B18A 3U2AA 2WK0A 1XGIA 4HY8A 4X6TA 3CI6A 3IH9A 4GB7A 3L9KA 2V1AA 3AGFA 1RCJA 3Q82A 5C5KA 3CUEC 3MQ0A 2WZXA 2GZAA 1L2SA 3KSHA 4PKYG 5TGFA 3V3RA 2WGWB 2VX8A 4G3VA 3QP1A 1H8MA 2Y2KA 3GSGA 2J9PA 5G4YA 4P87A 2BG1A 3IWQA 3FPWA 4KZ9A 2Y79A 4EW7A 4YOFA 1P9RA 2RL3A 3BLSA 2LB5A 1K6RA 1L3LA 4MBKA 3VOLA 4Y0TA 1VETB 4X55A 1E4DA 1PZOA 4QD4A 3E2LA 3HLFA 4LRYC 4BD0A 4JBFA 2W27A 2BTFP 1GCEA 2M1CA 1I5QA 1T18A 4WZ5A 3ZHHA 2RCXA 4R4SA 2IA2A 4KQQA 3QHYA 1SKOB 5AVFA 3NHQA 3CLOA 1M6KA 4UEYA 5DTTA 1RGZA 2ACGA 5DFXA 4XT2A 1ACFA 3G35A 3V3SA 2Y59A 2HF6A 3D3OA 5HSQA 3VFFA 1YT4A 1LLBA 5L10A 1BLCA 3Q07A 1S66L 2ZJ9A 2XEPA 3IWIA 1VQQA 4WLAA 2IWCA 4N92A 3NECA 2PYPA 1V9ZA 1MC0A 5L09A 4E3OA 4Q0JA 4M4XA 5HFOA 3T4QA 4F3LA 3QP5A 4C3QA 3NBLA 4BQMA 1Q2PA 4HI4A 1PNEA 1DP8A 5J4EA 3IH8A 4OLGA 3C30A 4MLLA 4M3KA 4PM5A 3ZDJA 1VM1A 3ZG5A 1H0MA 3W2ZA 4BBVA 5CEDA 1UWPX 2ZQDA 4X25A 2W3FA 2QPNA 3TE8A 1PI5A 4GHIB 1LSVA 2H5SA 2R9WA 1XKZA 3IF5A 3KSFA 2WKRA 3O3VA 1V9YA 4OKPA 4QPRA 4X68A 3WRTA 4HNBA 4HP4A 4OP5A 3OC2A 4WL9A 1DY6A 2VV7A 2ZC5B 1KVMA 2O9AA 5GLDA 2J80A 3CJMA 3MQOA 2JHEA 4O7DA 3PAEA 3WS0A 2XLNA 2XDMA 2W1TB 3CUEA 1IFQA 3F1OA 4KZ7A 5E2EA 5KIZA 3OZHA 1TS6A 4PAUA 2UV0E 3W8KA 1Q2QA 3S7QA 3HVFA 1JWPA 2ZOHA 2FZ0A 4IBXA 3F1NB 3QP8A 1WE4A 4Y5FA 4E3KA 1D06A 4UQIM 2VV8A 1TF1A 3ZFZA 2CC1A 3P09A 1GSWA 4E3NA 1KDSA 5CEBA 2ZM0A 2G2WA 4EWFA 1I2SA 4WZ4A 3Q1FA 1O07A 3U4LP 2XD5A 1K38A 3LR3A 3M6BA 2Y4AA 1SCWA 1W5DA 4IHQA 1DP9A 3ICYA 3UDFA 2ZL1B 1S1ZA 4N9LA 1K25A 4KQRA 2HV1A 3C4PA 2EWWA 3UE3A 5FAPA 1CI8A 4K0WA 1TEMA 4ETZA 3D4FA 4MBFA 5BOHA 4O8GA 1LSWA 1SDNA 1XXMA 1OJ5A 2NUPC 1S67L 3LIBA 4ZJ3A 3LO7A 3E4PA 5EOOA 1LHYA 1WYBA 2Z6DA 1YMXA 4E04A 4L0LA 3P01A 3SW1A 1YPRA 1QMEA 4ZTKA 3SOIA 3CAXA 3HLCA 2Y2HA 1PI4A 4QJGA 4HH2A 3ISGA 3LIEA 1RP5A 5EUAA 3VOZA 2JN7A 4GS9A 1KGFA 1W63Q 4OPQA 1P9WA 2X02A 1I2WA 1STZA 1K57A 2V0UA 4MBHA 1DJBA 1VEUB 2OLUA 4OLDA 3UN7A 1BLSA 5FA7A 5HX9A 4WEJA 1JWVA 2Y2QA 3FKVA 4GOGA 3IF6B 5F83A 3FKWA 1PWCA 3IBJA 2HGVA 4PPRA 1KE4A 1FR6A 4FCFA 3UE0A 3UB6A 3VE3A 4WZ5C 4KZ8A 5EVIC 4JKTA 2H0TA 3LFVA 3MJQA 4IJGA 3LEZA 5CRFA 3GDIA 4GJ4A 2JCHA 2W3HA 3O88A 3QP4A 3DAVA 3S22A 3PYPA 3R7WA 1KGEA 3KSGA 2XSSA 3UB8A 5F5YA 3MS6A 1CEGA 4R3BA 2L0WA 5F1GA 1WA9A 4HESA 5DVAA 4HQAA 5IHVA 2PR6A 3RXXA 5F69A 3HLWA 1PZPA 2X01A 3LUQA 4HH3A 2MJ6A 1MBLA 1FSYA 3G2YA 1XA7A 2WKIA 1BULA 1XFQA 1XPBA 4CLCC 4EBLA 2Z6CA 3G34A 2XH9A 1W63M 5DJTA 4Y0UA 3BQ8A 3KYEA 1MPLA 4HIAA 5DF7A 5L2FA 3EOIA 3VP1A 1IEMA 2PR5A 2XR0A 2ZC7A 5DKLA 3MFXA 3G4PA 5F6AA 5GLBA 3S7PA 3NI9A 3NOUC 3F1PB 5A90A 3LEQA 1KDWA 4DDSA 3LR0A 5F82A 3T50A 4LENA 4LV2A 3UDXA 1F2KA 3PTEA 4HP9A 4NK3A 4GNUA 5DJUA 3D9YA 4GCZA 3DTKA 3TW8A 4LFUA 3BFEA 4I3AA 3GQZA 5TBMA 1NRFA 3OOVA 3NDGA 5K5BA 2XFSA 2WKQA 4QU3A 3MZEA 4CQHA 3WWXA 3FZCA 1XA1A 2JKRI 3LR4A 3CITA 1Z6FA 5HAPA 5HW3A 3GRJA 1CK3A 5LBRA 3P98A 4WMCD 1CF0A 5CHJA 1EI5A 1FCOA 2ZM8A 2OAQ1 1F9IA 3EGXC 3FV7A 1PW8A 4WEKA 3LI8A 4K08A 1GHPA 5CGSA 5IS1A 4KZ5A 4CPKA 1E25A 2E8JA 4MNRA 1W79A 3RXWA 2A2LA 1BT5A 2JKFA 1U60A 3IXDA 1FOFA 1LL5A 1PW1A 1NXYA 3ULFA 5FQQA 1N9NA 1PRQA 3NCKA 3LY3A 4LGWA 2W1TA 2FFYA 4G3KA 5J7EA 4EQ1A 3B33A 4EU0A 2FH5A 2VV6A 2E8IA 4BBUA 2KDKA 4KQOA 4I38A 3FWLA 3VE4A 2EWVA 4UAAA 3HLGA 4B9OA 3BQAA 4ARZB 4OONA 1ES2A 2O99A 5GHZA 3T1XA 3BYDA 3BFDA 4JF4A 4OOMA 3MKFA 4CLCB 2K7SA 3VMAA 5CXWA 3W4OA 4EESA 3JPUA 3CPTB 4LRXC 5L07A 4DE0A 3ZG9B 3RFBA 4XUZA 4ZJ2A 3NOTC 4ESPA 3OBFA 3MR0A 2J3WA 3E98A 4ZBEA 3R7WB 3HJKA 3O86A 3NIAA 3BFCA 1IYQA 4Y2FA 2B95A 2XQZA 4Y0OA 5HWTA 5CGXA 3MXSA 4GDBA 1K54C 1E3UD 2Y2GA 4LV1A 2Q0OA 1G68A 4B88A 2J3TC 3FG8A 4HBTA 4EXOA 1H8YA 4KQDA 4CLCE 2UWXA 4BL2A 4Y13A 2R9XA 4F3LB 2PBDP 1BYWA 2Y8HA 2PU4A 3EQVA 1S4RA 1Z09A 3M6HA 3F1PA 2Q9MA 5EVIB 1TDLA 1L0FA 1ERMA 5CHMA 3ZVWA 1IKIA 5U47A 5JYPA 1BLPA 3BW6A 2Y2MA 3R4KA 2YKFA 1DP6A 4JGOA 5TR7A 4QY6A 5EVEA 2ZQ8A 2GJ3A 3A0VA 3A3JA 4ZJ1A 5J8XA 2V8FA 3MF0A 4QY5A 3K3CA 4U3TA 1EROA 2A49A 4OQIA 2VLGA 3HLBA 3K3DA 4MMNA 1ZG4A 4S2NA 3IBRA 2PDRA 4X56A 5TFQA 1L0GA 2Y2IA 4LV3A 4YINA 3KO6A 4JGPA 1K55A 4MCWA 2L1MA 5DF8A 2XFTA 3B3XA 2X71A 2ZD8A 4Z9QA 1O7EA 1LL9A 1YLTA 2BLSA 4WN5A 5FQJA 4JGQA 3DTMA 2FFFB 3JVUA 2EFXA 1H8ZA 2JKRM 1OT6A 3C7UA 3IXBA 3NJAA 4WF0A 5GL9A 3E4QA 1CQAA 1C3BA 3LCEA 3PBTA 4KZ4A 2EX2A 3VV4A 1IYSA 4XT2B 5KZHA 2NUTC 3IHBA 3A3FA 2DNSA 4P6BA 4DJ3A 2KLIA 2VK3A 3IXGA 2OAP1 2ZMVA 4DDYA 3UMDA 2Y91A 2BASA 1FR1A 1G6OA 1DJAA 3LY4A 1XJ3A 1ES5A 4ZDXA 2ZQCA 3ITBA 3ZVTA 2EXBA 3T4JA 3GECA 2CMNA 4WMCA 5G18A 2JKGA 5HD3A 3ZNYA 2VGKA 4Y15A 3MBZA 5FI7A 1VETA 3WS2A 2O0YA 2WADA 4KUOA 1YLPA 5HD5A 5G4ZA 2WGVA 5FSRA 3F1NA 2K31A 4C6YA 2GNXA 4K91A 4UA9A 3UB9A 5A8BA 1TDGA 4S2OA 3C5AA 2PT7A 2VA0A 3RTYA 3VP3A 2V8CA 1N9BA 5E43A 3QP2A 5CECA 5EM1A 2Z2LB 3EEHA 1NLYA 3H82A 1GSXA 3PXPA 4CLCD 1ES3A 1NY0A 4HJ4A 1ZC2A 3HUMA 5EVLA 3T4SA 1DJCA 3MFDA 4OVDA 1KE3A 2WUQA 3TOIA 3G32A 1NZUA 4AFIA 4IUHA 1NLZA 5AJGA 4Y3IA 3VFHA 3O87A 3VSLA 2JC7A 4DJ2A 3IS2B 3WS1A 1S1YA 4S2MA 5HZHA 3UNWA 3HJIA 4EETB 2VGLM 4RQ9A 1HLUP 1ODVA 1OTEA 4DE2A 4EUZA 2P7JA 4YNRA 3ZGAB 4B4ZA 3EEAA 5MC7A 3MKEA 1YLWA 4DXCA 1HD8A 5FEFA 1OJGA 5HL1A 2HDUA 2G2UA 3BLMA 3QNBA 5D3OA 3ZYTA 4DE3A 1VB6A 5EVID 2ZQAA 4ARZA 1XGJA 4PM9A 3PBNA 2M7VA 4C75A 5FL3A 1KOUA 4LV0A 1MZUA 4B93A 2G7UA 1RGYA 2Y2JA 3IS2A 1FSWA 1ALQA 2JKTM 3VP0A 4R3AA 5FQKA 4JLFA 3HCYA 2B02A 3MXQA 2XF3A 2P04A 5L8MA 4FD8A 1VEUA 4OPYA 5FEGA 2V2FF 2WKEA 3CZDA 3NC8A 4KG2A 5TBMB 2WYXA 5EOEA 2WZZA 3S7OA 1K6SA 3N4IA 3N8SA 4H8RA 1W8QA 3IF6C 2JE5A 2QHKA 1GHIA 3T1QB 3B42A 4LRZE 2W3DA 1HTZA 1ZKJA 2I9VA 1XP4A 2XA7M 1UGUA 3E4OA 1Y54A 4Q8IA 5I94A 4JGRA 4GKUA 1XX2A 2PD8A 1KE0A 1EWZA 3DTIA 3KYZA 4EEPA 4S2NC 4IBRA 1MWRA 5CGWA 3G2ZA 1MKIA 2OSUA 1ZG6A 2A24B 3TSGA 3L7HA 4S2PA 2QMIA 2Y2PA 4DE1A 4H6JB 3DWZA 3SH7A 3WS5A 3N8RA 2EX8A 1FCMA 4KZ3A 3BY8A 5AQAA 2ZQ7A 3UE6A 1D1JA 1PWGA 3K2NA 5I5LA 3SS3A 5EV0A 5TJJA 3I7JA 2ZL1A 4Q0IA 4X1LA 3JYIA 3IQAA 1Y4OA 1KGGA 4ZRRA 3MXRA 3OLOA 5GHXA 4KG5A 1NZOA 2A3UA 1K56D 2QJ7A 4GD6A 1F98A 2HZ5A 3S7NA 3LIAA 1AWIA 4CJNA 4L9FA 1G5UA 3DW0A 3N8LA 1ESIA 4E3LA 1OTIA 4RX2A 4PMAA 3GR2A 3Q81A 3C4OA 5E2FA 3O5YA 3ZNTA 3PBQA 5EPHA 1K57C 1FIKA 4R0QA 1TS7A 4NXFA 2DRWA 3EQUA 4GLQA 3A3DA 5FQMA 4D2OA 1YLYA 5M18A 1SZVA 2HP5A 4UA7A 1LI9A 3BRMA 3UPNA 1HZOA 4MEZA 4P6ZS 3IX3A 1YSPA 3BFFA 3P7NA 1LL8A 4XUXA 4LCMA 2EFUA 4OP8A 1NJ4A 3V50A 1EW0A 1FQGA 1PWDA 2W1RA 4NXEA 4E3JA 4N9KA 2QKPA 1N9LA 2V20A 2V9AA 1GA9A 1ZHHB 2EX6A 3PAGA 5HPFA 1CI9A 1S4SA 3V39A 4RX3A 1BUEA 4R1GA 4S2IA 4GZBA 1K0KA 4OPZA 3KYQA 4KENB 4OQ0A 2WKHA 4EBNA 1N9OA 2V0WA 1L0EA 1XJ4A 3EWKA 1XJ6A 3UB5P 3NDEA 3IF6A 1YSQA 3SZTA 3TG9A 1TS8A 4BL3A 3HLEA 4P85A 1OT9A 3T1SA 4EEUA 4K0XA 5FDSA 4R70A 2DMWA 3D72A 3F1OB 4RVAA 5EECA 4JF5A 3HBRA 5FATA 4PHTA 5J3WA 2K2NA 5KSCA 3A3IA 2ZC4B 3UO9A 2AVXA 3A3EA 3CG5A 4GDNA 1AXBA 2J3TD 3RH8B 2W3GA 3WRZA 2DCFA 3T4OA 5KSHA 3EGDC 3CWFA 1IELA 4DMZA 1JTGA 1MY8A 4EERA 2R78A 4L9EA 5F68A 3ZG0A 3SH8A 3Q7ZA 1TD5A 4QWOA 1K55C 1T1AA 1W7FA 3CHWP 4HOIA 1ZTUA 2O9BA 2KOIA 1SKOA 5CTMA 5E2HA 1P97A 3V67A 1JWZA 4X1MA 1GSVA 1M40A 4Y7PA 3ZCZA 2HDSA 4OPRA 1KVLA 2P9VA 3AGDA 4JXGA 1VHMA 4KZAA 1X0OA 2IWDA 4S2LA 3OPPA 1F5MA 2QJ5A 3CPTA 2ZC3B 2EXAA 1Y28A 2I72A 3IHAA 1BLHA 4HHDA 4MDZA 5FAOA 2QZ6A 3VOYA 3S1YA 4KZBA 4BD1A 2V1ZA 3W4QA 4IVIA 4BBTA 3H9WA 4U0XA 4GD8A 1T1CA 1NWZA 4L9GA 2WGWA 4HBUA 3OCLA 1G28A 4LCLA 3W4PA 3GMWA 2PAVP 4I5SA 4R23A 3G6OA 4WBGA 2XK1A 3A0RA 3MMHA 4R38A 2HJ9C 4O01A 3HLDA 2ZLYA 1A0KA 1YLZA 4WM9A 4QHCA 3N6IA 2P9VB 1GA0A 1SDEA 3BWLA 1S0WA 2PD7A 3BJNA 4I3JA 1OPXA 3DWKA 2P74A 4IEDA 3OPLA 2WAFA 4DKIA 3UDIA 1L0DA 1MXOA 4DXBA 5AVEA 3LIFA 5DKKA 2EX9A 2HDQA 2VGJA 1ESUA 5FASA 3PHYA 2PYRA 1PYYA 3VP4A 1BSGA 5AQBA 4E3IA 2HDRA 4Y17A 5AQ9A 3UY6A 4XXRA 2P08A 1OTAA 5HWVA 1IYPA 3BM6A 2QWSA 4GW9A 3E0YA 3OPRA 2IWBA 1HVBA 4NKPA 2VKSA 1JVJA 5DFYA 3IX8A 3CMZA 3WS4A 4OQHA 2J7VA 4JXSA 4R6LA 3HL9A 4RYEA 3LGOA 1J3WA 3GVBA 2XD1A 4EQIA 4GHIA 5FDHA 2ZQ9A 4R3JA 5DF9A 4YFMA 1OTDA 1FCNA 4OOLA 4OOYA 3C2WA 2W3EA 4O0PA 3MQQA 3QNCA
chains in the Genus database with same CATH topology
1SKOB 2PRFA 4ESPA 1J3WA 3D9YA 4QWOA 1SZVA 4FTXA 2E8JA 4D60A 3CHWP 3T1RA 2ACGA 2HZ5A 3T12B 2JKGA 3T1SA 3T1XA 3U4LP 2VK3A 3MSHA 1ACFA 5FDSA 1D1JA 1HLUP 2BTFP 1SKOA 1CJFA 2JKFA 2V8CA 3NECA 3NULA 1FILA 1AWIA 2PBDP 1K0KA 5EVEA 3CPTA 3T1QB 1G5UA 4X1MA 1FIKA 1YPRA 3LEQA 2B95A 5EV0A 1PFLA 5EM0A 1VETA 1VEUA 2ZL1A 4X1LA 2V8FA 5FEGA 2PAVP 3L9KA 1Z09A 3DAVA 5EM1A 1Y4OA 1PRQA 1CF0A 3MS6A 1VETB 1VEUB 2ZL1B 3CPTB 3KYEA 3L7HA 4X25A 1F2KA 1CQAA 5FEFA 3UB5P 4FUWA 1A0KA 1PNEA 3LGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SKO B;  2PRF A;  4ESP A;  1J3W A;  3D9Y A;  4QWO A;  1SZV A;  4FTX A;  2E8J A;  4D60 A;  3CHW P;  3T1R A;  2ACG A;  2HZ5 A;  3T12 B;  2JKG A;  3T1S A;  3T1X A;  3U4L P;  2VK3 A;  3MSH A;  1ACF A;  5FDS A;  1D1J A;  1HLU P;  2BTF P;  1SKO A;  1CJF A;  2JKF A;  2V8C A;  3NEC A;  3NUL A;  1FIL A;  1AWI A;  2PBD P;  1K0K A;  5EVE A;  3CPT A;  3T1Q B;  1G5U A;  4X1M A;  1FIK A;  1YPR A;  3LEQ A;  2B95 A;  5EV0 A;  1PFL A;  5EM0 A;  1VET A;  1VEU A;  2ZL1 A;  4X1L A;  2V8F A;  5FEG A;  2PAV P;  3L9K A;  1Z09 A;  3DAV A;  5EM1 A;  1Y4O A;  1PRQ A;  1CF0 A;  3MS6 A;  1VET B;  1VEU B;  2ZL1 B;  3CPT B;  3KYE A;  3L7H A;  4X25 A;  1F2K A;  1CQA A;  5FEF A;  3UB5 P;  4FUW A;  1A0K A;  1PNE A;  3LGO A; 
#chains in the Genus database with same CATH topology
 5CHU A;  3V5M A;  5GLA A;  4KUK A;  5DTS A;  3OPH A;  1IYO A;  2XA7 S;  5HDC A;  1MWT A;  2KX6 A;  4B4X A;  3H7W B;  5EM0 A;  1BZA A;  4IUK A;  3T4K A;  1NYY A;  3LI9 A;  5JYO A;  3DBA A;  5IT5 A;  1P0Z A;  2C5W B;  4KZ6 A;  3ZG8 B;  4E3M A;  4JXW A;  1WYC A;  2Y2O A;  4ETX A;  4BMW A;  2B5R A;  3PBR A;  1IKG A;  2QYB A;  5AQ7 A;  2XRO A;  3HUN A;  3UE1 A;  4EV4 A;  3Q7V B;  4FUW A;  5CX7 A;  4LLO B;  3LR5 A;  3FPV A;  3QP6 A;  1N4O A;  1E3U A;  3RJU A;  4FH4 A;  4JXV A;  2XGN A;  3BFG A;  3JVV A;  1W8Y A;  3A0S A;  3H82 B;  5GHY A;  5GLC A;  1PFL A;  4UHU A;  3H7W A;  4PKY A;  3C38 A;  1TVF A;  3NOP C;  4GN2 A;  1ONG A;  4KG6 A;  5A93 A;  4IVK A;  2OV5 A;  2GDN A;  4Z1W A;  5M1A A;  2XRN A;  4U0T A;  2PU2 A;  4FH2 A;  2ZBB A;  3LYX A;  4LPZ A;  3ZG7 B;  2W0N A;  4DRT A;  4E6X A;  4ID4 A;  2OLV A;  4G3W A;  4X53 A;  4WYY A;  4R4R A;  4ME4 A;  3BY9 A;  4JPM A;  4D60 A;  4WEL A;  1YKD A;  1TS0 A;  4P6Z M;  4MN7 A;  2L4R A;  4H6J A;  4OQG A;  4YWZ A;  2ZC6 B;  4MN6 A;  1CEF A;  5EVI A;  2OWJ A;  2H10 A;  5FI2 A;  1YLJ A;  5HWW A;  1D7E A;  1SHV A;  4PM6 A;  4GS9 B;  1S6R A;  3T4L A;  2OOL A;  3GTC A;  2JBF A;  2PHY A;  3T4T A;  4P0M A;  1LT0 A;  3T1R A;  3T12 B;  4NG2 A;  5FQ9 A;  3IWO A;  1K4E A;  5HL6 A;  2YKH A;  2LB9 A;  2OWH A;  4PM8 A;  1J9M A;  3BEB A;  3PBO A;  1T1B A;  2WAE A;  3ZQ5 A;  4HJ3 A;  5CER A;  2Y55 A;  3PBS A;  4BLM A;  2C6W B;  4S2J A;  1K54 A;  2ZMF A;  3FYZ A;  1YM1 A;  3M2K A;  2HP9 A;  4QB8 A;  4N1X A;  1YMS A;  1OME A;  2ZOI A;  5DTK A;  2WGI A;  2D02 A;  1MKM A;  4CLC A;  3G30 A;  1T19 A;  1K4F A;  2ZM2 A;  2D01 A;  4RA7 A;  4Q0H A;  1MWS A;  4FTX A;  5KMW A;  1YAX A;  4WUJ A;  1ERQ A;  1ES4 A;  2Y2N A;  4I3I A;  5EFW A;  4NXB A;  3SH9 A;  1DRM A;  1H5X A;  2VJW A;  3C7V A;  3S4X A;  4UA6 A;  1SKF A;  1GHM A;  2J9O A;  5FAQ A;  2PRF A;  3UB7 A;  1NYM A;  3NY4 A;  3G31 A;  4EBP A;  3LIC A;  1UWN X;  3DTE A;  3KX0 X;  1CJF A;  3UPO A;  3E2K A;  2V1B A;  4BWI A;  1QMF A;  5FQI A;  1LSX A;  2A24 A;  4ZAM A;  3SS4 A;  4A5R A;  4I39 A;  3BEC A;  4N1H A;  3UPP A;  2ZMA A;  3GV9 A;  3FC7 A;  1BTL A;  1XJ2 A;  3VP2 A;  4DF6 A;  5HAI A;  2M7U A;  5F1F A;  1FIL A;  1YQS A;  3IXH A;  2HPB A;  2PBY A;  2H0Y A;  5A91 A;  3B47 A;  3IX4 A;  4FSF A;  3IT9 A;  4EUV A;  3TJZ C;  1H3Q A;  4BJP A;  2JKT I;  2Q9N A;  3Q7V A;  1PIO A;  4NET A;  5CTN A;  5HAQ A;  4E6W A;  4UQI S;  2WKP A;  3HUO A;  4II7 A;  4OH0 A;  4FOF A;  2HP6 A;  4HEF A;  5A92 A;  3ITA A;  2EA9 A;  1MWU A;  2O9C A;  5HDS A;  3SS5 A;  3LID A;  2GX5 A;  5IU1 A;  4F94 A;  3N7W A;  4DN0 A;  4JF6 A;  3UME A;  3M2J A;  2VGL S;  4HJ6 A;  4NXG A;  5HAR A;  3MSH A;  1NRJ A;  1G6A A;  3PR6 A;  4NEE D;  5FI6 A;  1JTD A;  3KSI A;  4X69 A;  3MZF A;  3AGE A;  4MN5 A;  1K56 A;  2Z2M B;  3C8C A;  2VZW A;  5M19 A;  4BEN A;  1XFN A;  2INW A;  3VSK A;  3MZD A;  3OCN A;  5E2G A;  4S2K A;  2J8Y A;  3NUL A;  5HDD A;  2H28 A;  2Y2L A;  1JNU A;  1LI0 A;  2HJE A;  1ONH A;  5EE8 A;  3HRE A;  2VEA A;  5HPI A;  3TRC A;  1IOU A;  1OTB A;  4PM7 A;  2B18 A;  3U2A A;  2WK0 A;  1XGI A;  4HY8 A;  4X6T A;  3CI6 A;  3IH9 A;  4GB7 A;  3L9K A;  2V1A A;  3AGF A;  1RCJ A;  3Q82 A;  5C5K A;  3CUE C;  3MQ0 A;  2WZX A;  2GZA A;  1L2S A;  3KSH A;  4PKY G;  5TGF A;  3V3R A;  2WGW B;  2VX8 A;  4G3V A;  3QP1 A;  1H8M A;  2Y2K A;  3GSG A;  2J9P A;  5G4Y A;  4P87 A;  2BG1 A;  3IWQ A;  3FPW A;  4KZ9 A;  2Y79 A;  4EW7 A;  4YOF A;  1P9R A;  2RL3 A;  3BLS A;  2LB5 A;  1K6R A;  1L3L A;  4MBK A;  3VOL A;  4Y0T A;  1VET B;  4X55 A;  1E4D A;  1PZO A;  4QD4 A;  3E2L A;  3HLF A;  4LRY C;  4BD0 A;  4JBF A;  2W27 A;  2BTF P;  1GCE A;  2M1C A;  1I5Q A;  1T18 A;  4WZ5 A;  3ZHH A;  2RCX A;  4R4S A;  2IA2 A;  4KQQ A;  3QHY A;  1SKO B;  5AVF A;  3NHQ A;  3CLO A;  1M6K A;  4UEY A;  5DTT A;  1RGZ A;  2ACG A;  5DFX A;  4XT2 A;  1ACF A;  3G35 A;  3V3S A;  2Y59 A;  2HF6 A;  3D3O A;  5HSQ A;  3VFF A;  1YT4 A;  1LLB A;  5L10 A;  1BLC A;  3Q07 A;  1S66 L;  2ZJ9 A;  2XEP A;  3IWI A;  1VQQ A;  4WLA A;  2IWC A;  4N92 A;  3NEC A;  2PYP A;  1V9Z A;  1MC0 A;  5L09 A;  4E3O A;  4Q0J A;  4M4X A;  5HFO A;  3T4Q A;  4F3L A;  3QP5 A;  4C3Q A;  3NBL A;  4BQM A;  1Q2P A;  4HI4 A;  1PNE A;  1DP8 A;  5J4E A;  3IH8 A;  4OLG A;  3C30 A;  4MLL A;  4M3K A;  4PM5 A;  3ZDJ A;  1VM1 A;  3ZG5 A;  1H0M A;  3W2Z A;  4BBV A;  5CED A;  1UWP X;  2ZQD A;  4X25 A;  2W3F A;  2QPN A;  3TE8 A;  1PI5 A;  4GHI B;  1LSV A;  2H5S A;  2R9W A;  1XKZ A;  3IF5 A;  3KSF A;  2WKR A;  3O3V A;  1V9Y A;  4OKP A;  4QPR A;  4X68 A;  3WRT A;  4HNB A;  4HP4 A;  4OP5 A;  3OC2 A;  4WL9 A;  1DY6 A;  2VV7 A;  2ZC5 B;  1KVM A;  2O9A A;  5GLD A;  2J80 A;  3CJM A;  3MQO A;  2JHE A;  4O7D A;  3PAE A;  3WS0 A;  2XLN A;  2XDM A;  2W1T B;  3CUE A;  1IFQ A;  3F1O A;  4KZ7 A;  5E2E A;  5KIZ A;  3OZH A;  1TS6 A;  4PAU A;  2UV0 E;  3W8K A;  1Q2Q A;  3S7Q A;  3HVF A;  1JWP A;  2ZOH A;  2FZ0 A;  4IBX A;  3F1N B;  3QP8 A;  1WE4 A;  4Y5F A;  4E3K A;  1D06 A;  4UQI M;  2VV8 A;  1TF1 A;  3ZFZ A;  2CC1 A;  3P09 A;  1GSW A;  4E3N A;  1KDS A;  5CEB A;  2ZM0 A;  2G2W A;  4EWF A;  1I2S A;  4WZ4 A;  3Q1F A;  1O07 A;  3U4L P;  2XD5 A;  1K38 A;  3LR3 A;  3M6B A;  2Y4A A;  1SCW A;  1W5D A;  4IHQ A;  1DP9 A;  3ICY A;  3UDF A;  2ZL1 B;  1S1Z A;  4N9L A;  1K25 A;  4KQR A;  2HV1 A;  3C4P A;  2EWW A;  3UE3 A;  5FAP A;  1CI8 A;  4K0W A;  1TEM A;  4ETZ A;  3D4F A;  4MBF A;  5BOH A;  4O8G A;  1LSW A;  1SDN A;  1XXM A;  1OJ5 A;  2NUP C;  1S67 L;  3LIB A;  4ZJ3 A;  3LO7 A;  3E4P A;  5EOO A;  1LHY A;  1WYB A;  2Z6D A;  1YMX A;  4E04 A;  4L0L A;  3P01 A;  3SW1 A;  1YPR A;  1QME A;  4ZTK A;  3SOI A;  3CAX A;  3HLC A;  2Y2H A;  1PI4 A;  4QJG A;  4HH2 A;  3ISG A;  3LIE A;  1RP5 A;  5EUA A;  3VOZ A;  2JN7 A;  4GS9 A;  1KGF A;  1W63 Q;  4OPQ A;  1P9W A;  2X02 A;  1I2W A;  1STZ A;  1K57 A;  2V0U A;  4MBH A;  1DJB A;  1VEU B;  2OLU A;  4OLD A;  3UN7 A;  1BLS A;  5FA7 A;  5HX9 A;  4WEJ A;  1JWV A;  2Y2Q A;  3FKV A;  4GOG A;  3IF6 B;  5F83 A;  3FKW A;  1PWC A;  3IBJ A;  2HGV A;  4PPR A;  1KE4 A;  1FR6 A;  4FCF A;  3UE0 A;  3UB6 A;  3VE3 A;  4WZ5 C;  4KZ8 A;  5EVI C;  4JKT A;  2H0T A;  3LFV A;  3MJQ A;  4IJG A;  3LEZ A;  5CRF A;  3GDI A;  4GJ4 A;  2JCH A;  2W3H A;  3O88 A;  3QP4 A;  3DAV A;  3S22 A;  3PYP A;  3R7W A;  1KGE A;  3KSG A;  2XSS A;  3UB8 A;  5F5Y A;  3MS6 A;  1CEG A;  4R3B A;  2L0W A;  5F1G A;  1WA9 A;  4HES A;  5DVA A;  4HQA A;  5IHV A;  2PR6 A;  3RXX A;  5F69 A;  3HLW A;  1PZP A;  2X01 A;  3LUQ A;  4HH3 A;  2MJ6 A;  1MBL A;  1FSY A;  3G2Y A;  1XA7 A;  2WKI A;  1BUL A;  1XFQ A;  1XPB A;  4CLC C;  4EBL A;  2Z6C A;  3G34 A;  2XH9 A;  1W63 M;  5DJT A;  4Y0U A;  3BQ8 A;  3KYE A;  1MPL A;  4HIA A;  5DF7 A;  5L2F A;  3EOI A;  3VP1 A;  1IEM A;  2PR5 A;  2XR0 A;  2ZC7 A;  5DKL A;  3MFX A;  3G4P A;  5F6A A;  5GLB A;  3S7P A;  3NI9 A;  3NOU C;  3F1P B;  5A90 A;  3LEQ A;  1KDW A;  4DDS A;  3LR0 A;  5F82 A;  3T50 A;  4LEN A;  4LV2 A;  3UDX A;  1F2K A;  3PTE A;  4HP9 A;  4NK3 A;  4GNU A;  5DJU A;  3D9Y A;  4GCZ A;  3DTK A;  3TW8 A;  4LFU A;  3BFE A;  4I3A A;  3GQZ A;  5TBM A;  1NRF A;  3OOV A;  3NDG A;  5K5B A;  2XFS A;  2WKQ A;  4QU3 A;  3MZE A;  4CQH A;  3WWX A;  3FZC A;  1XA1 A;  2JKR I;  3LR4 A;  3CIT A;  1Z6F A;  5HAP A;  5HW3 A;  3GRJ A;  1CK3 A;  5LBR A;  3P98 A;  4WMC D;  1CF0 A;  5CHJ A;  1EI5 A;  1FCO A;  2ZM8 A;  2OAQ 1;  1F9I A;  3EGX C;  3FV7 A;  1PW8 A;  4WEK A;  3LI8 A;  4K08 A;  1GHP A;  5CGS A;  5IS1 A;  4KZ5 A;  4CPK A;  1E25 A;  2E8J A;  4MNR A;  1W79 A;  3RXW A;  2A2L A;  1BT5 A;  2JKF A;  1U60 A;  3IXD A;  1FOF A;  1LL5 A;  1PW1 A;  1NXY A;  3ULF A;  5FQQ A;  1N9N A;  1PRQ A;  3NCK A;  3LY3 A;  4LGW A;  2W1T A;  2FFY A;  4G3K A;  5J7E A;  4EQ1 A;  3B33 A;  4EU0 A;  2FH5 A;  2VV6 A;  2E8I A;  4BBU A;  2KDK A;  4KQO A;  4I38 A;  3FWL A;  3VE4 A;  2EWV A;  4UAA A;  3HLG A;  4B9O A;  3BQA A;  4ARZ B;  4OON A;  1ES2 A;  2O99 A;  5GHZ A;  3T1X A;  3BYD A;  3BFD A;  4JF4 A;  4OOM A;  3MKF A;  4CLC B;  2K7S A;  3VMA A;  5CXW A;  3W4O A;  4EES A;  3JPU A;  3CPT B;  4LRX C;  5L07 A;  4DE0 A;  3ZG9 B;  3RFB A;  4XUZ A;  4ZJ2 A;  3NOT C;  4ESP A;  3OBF A;  3MR0 A;  2J3W A;  3E98 A;  4ZBE A;  3R7W B;  3HJK A;  3O86 A;  3NIA A;  3BFC A;  1IYQ A;  4Y2F A;  2B95 A;  2XQZ A;  4Y0O A;  5HWT A;  5CGX A;  3MXS A;  4GDB A;  1K54 C;  1E3U D;  2Y2G A;  4LV1 A;  2Q0O A;  1G68 A;  4B88 A;  2J3T C;  3FG8 A;  4HBT A;  4EXO A;  1H8Y A;  4KQD A;  4CLC E;  2UWX A;  4BL2 A;  4Y13 A;  2R9X A;  4F3L B;  2PBD P;  1BYW A;  2Y8H A;  2PU4 A;  3EQV A;  1S4R A;  1Z09 A;  3M6H A;  3F1P A;  2Q9M A;  5EVI B;  1TDL A;  1L0F A;  1ERM A;  5CHM A;  3ZVW A;  1IKI A;  5U47 A;  5JYP A;  1BLP A;  3BW6 A;  2Y2M A;  3R4K A;  2YKF A;  1DP6 A;  4JGO A;  5TR7 A;  4QY6 A;  5EVE A;  2ZQ8 A;  2GJ3 A;  3A0V A;  3A3J A;  4ZJ1 A;  5J8X A;  2V8F A;  3MF0 A;  4QY5 A;  3K3C A;  4U3T A;  1ERO A;  2A49 A;  4OQI A;  2VLG A;  3HLB A;  3K3D A;  4MMN A;  1ZG4 A;  4S2N A;  3IBR A;  2PDR A;  4X56 A;  5TFQ A;  1L0G A;  2Y2I A;  4LV3 A;  4YIN A;  3KO6 A;  4JGP A;  1K55 A;  4MCW A;  2L1M A;  5DF8 A;  2XFT A;  3B3X A;  2X71 A;  2ZD8 A;  4Z9Q A;  1O7E A;  1LL9 A;  1YLT A;  2BLS A;  4WN5 A;  5FQJ A;  4JGQ A;  3DTM A;  2FFF B;  3JVU A;  2EFX A;  1H8Z A;  2JKR M;  1OT6 A;  3C7U A;  3IXB A;  3NJA A;  4WF0 A;  5GL9 A;  3E4Q A;  1CQA A;  1C3B A;  3LCE A;  3PBT A;  4KZ4 A;  2EX2 A;  3VV4 A;  1IYS A;  4XT2 B;  5KZH A;  2NUT C;  3IHB A;  3A3F A;  2DNS A;  4P6B A;  4DJ3 A;  2KLI A;  2VK3 A;  3IXG A;  2OAP 1;  2ZMV A;  4DDY A;  3UMD A;  2Y91 A;  2BAS A;  1FR1 A;  1G6O A;  1DJA A;  3LY4 A;  1XJ3 A;  1ES5 A;  4ZDX A;  2ZQC A;  3ITB A;  3ZVT A;  2EXB A;  3T4J A;  3GEC A;  2CMN A;  4WMC A;  5G18 A;  2JKG A;  5HD3 A;  3ZNY A;  2VGK A;  4Y15 A;  3MBZ A;  5FI7 A;  1VET A;  3WS2 A;  2O0Y A;  2WAD A;  4KUO A;  1YLP A;  5HD5 A;  5G4Z A;  2WGV A;  5FSR A;  3F1N A;  2K31 A;  4C6Y A;  2GNX A;  4K91 A;  4UA9 A;  3UB9 A;  5A8B A;  1TDG A;  4S2O A;  3C5A A;  2PT7 A;  2VA0 A;  3RTY A;  3VP3 A;  2V8C A;  1N9B A;  5E43 A;  3QP2 A;  5CEC A;  5EM1 A;  2Z2L B;  3EEH A;  1NLY A;  3H82 A;  1GSX A;  3PXP A;  4CLC D;  1ES3 A;  1NY0 A;  4HJ4 A;  1ZC2 A;  3HUM A;  5EVL A;  3T4S A;  1DJC A;  3MFD A;  4OVD A;  1KE3 A;  2WUQ A;  3TOI A;  3G32 A;  1NZU A;  4AFI A;  4IUH A;  1NLZ A;  5AJG A;  4Y3I A;  3VFH A;  3O87 A;  3VSL A;  2JC7 A;  4DJ2 A;  3IS2 B;  3WS1 A;  1S1Y A;  4S2M A;  5HZH A;  3UNW A;  3HJI A;  4EET B;  2VGL M;  4RQ9 A;  1HLU P;  1ODV A;  1OTE A;  4DE2 A;  4EUZ A;  2P7J A;  4YNR A;  3ZGA B;  4B4Z A;  3EEA A;  5MC7 A;  3MKE A;  1YLW A;  4DXC A;  1HD8 A;  5FEF A;  1OJG A;  5HL1 A;  2HDU A;  2G2U A;  3BLM A;  3QNB A;  5D3O A;  3ZYT A;  4DE3 A;  1VB6 A;  5EVI D;  2ZQA A;  4ARZ A;  1XGJ A;  4PM9 A;  3PBN A;  2M7V A;  4C75 A;  5FL3 A;  1KOU A;  4LV0 A;  1MZU A;  4B93 A;  2G7U A;  1RGY A;  2Y2J A;  3IS2 A;  1FSW A;  1ALQ A;  2JKT M;  3VP0 A;  4R3A A;  5FQK A;  4JLF A;  3HCY A;  2B02 A;  3MXQ A;  2XF3 A;  2P04 A;  5L8M A;  4FD8 A;  1VEU A;  4OPY A;  5FEG A;  2V2F F;  2WKE A;  3CZD A;  3NC8 A;  4KG2 A;  5TBM B;  2WYX A;  5EOE A;  2WZZ A;  3S7O A;  1K6S A;  3N4I A;  3N8S A;  4H8R A;  1W8Q A;  3IF6 C;  2JE5 A;  2QHK A;  1GHI A;  3T1Q B;  3B42 A;  4LRZ E;  2W3D A;  1HTZ A;  1ZKJ A;  2I9V A;  1XP4 A;  2XA7 M;  1UGU A;  3E4O A;  1Y54 A;  4Q8I A;  5I94 A;  4JGR A;  4GKU A;  1XX2 A;  2PD8 A;  1KE0 A;  1EWZ A;  3DTI A;  3KYZ A;  4EEP A;  4S2N C;  4IBR A;  1MWR A;  5CGW A;  3G2Z A;  1MKI A;  2OSU A;  1ZG6 A;  2A24 B;  3TSG A;  3L7H A;  4S2P A;  2QMI A;  2Y2P A;  4DE1 A;  4H6J B;  3DWZ A;  3SH7 A;  3WS5 A;  3N8R A;  2EX8 A;  1FCM A;  4KZ3 A;  3BY8 A;  5AQA A;  2ZQ7 A;  3UE6 A;  1D1J A;  1PWG A;  3K2N A;  5I5L A;  3SS3 A;  5EV0 A;  5TJJ A;  3I7J A;  2ZL1 A;  4Q0I A;  4X1L A;  3JYI A;  3IQA A;  1Y4O A;  1KGG A;  4ZRR A;  3MXR A;  3OLO A;  5GHX A;  4KG5 A;  1NZO A;  2A3U A;  1K56 D;  2QJ7 A;  4GD6 A;  1F98 A;  2HZ5 A;  3S7N A;  3LIA A;  1AWI A;  4CJN A;  4L9F A;  1G5U A;  3DW0 A;  3N8L A;  1ESI A;  4E3L A;  1OTI A;  4RX2 A;  4PMA A;  3GR2 A;  3Q81 A;  3C4O A;  5E2F A;  3O5Y A;  3ZNT A;  3PBQ A;  5EPH A;  1K57 C;  1FIK A;  4R0Q A;  1TS7 A;  4NXF A;  2DRW A;  3EQU A;  4GLQ A;  3A3D A;  5FQM A;  4D2O A;  1YLY A;  5M18 A;  1SZV A;  2HP5 A;  4UA7 A;  1LI9 A;  3BRM A;  3UPN A;  1HZO A;  4MEZ A;  4P6Z S;  3IX3 A;  1YSP A;  3BFF A;  3P7N A;  1LL8 A;  4XUX A;  4LCM A;  2EFU A;  4OP8 A;  1NJ4 A;  3V50 A;  1EW0 A;  1FQG A;  1PWD A;  2W1R A;  4NXE A;  4E3J A;  4N9K A;  2QKP A;  1N9L A;  2V20 A;  2V9A A;  1GA9 A;  1ZHH B;  2EX6 A;  3PAG A;  5HPF A;  1CI9 A;  1S4S A;  3V39 A;  4RX3 A;  1BUE A;  4R1G A;  4S2I A;  4GZB A;  1K0K A;  4OPZ A;  3KYQ A;  4KEN B;  4OQ0 A;  2WKH A;  4EBN A;  1N9O A;  2V0W A;  1L0E A;  1XJ4 A;  3EWK A;  1XJ6 A;  3UB5 P;  3NDE A;  3IF6 A;  1YSQ A;  3SZT A;  3TG9 A;  1TS8 A;  4BL3 A;  3HLE A;  4P85 A;  1OT9 A;  3T1S A;  4EEU A;  4K0X A;  5FDS A;  4R70 A;  2DMW A;  3D72 A;  3F1O B;  4RVA A;  5EEC A;  4JF5 A;  3HBR A;  5FAT A;  4PHT A;  5J3W A;  2K2N A;  5KSC A;  3A3I A;  2ZC4 B;  3UO9 A;  2AVX A;  3A3E A;  3CG5 A;  4GDN A;  1AXB A;  2J3T D;  3RH8 B;  2W3G A;  3WRZ A;  2DCF A;  3T4O A;  5KSH A;  3EGD C;  3CWF A;  1IEL A;  4DMZ A;  1JTG A;  1MY8 A;  4EER A;  2R78 A;  4L9E A;  5F68 A;  3ZG0 A;  3SH8 A;  3Q7Z A;  1TD5 A;  4QWO A;  1K55 C;  1T1A A;  1W7F A;  3CHW P;  4HOI A;  1ZTU A;  2O9B A;  2KOI A;  1SKO A;  5CTM A;  5E2H A;  1P97 A;  3V67 A;  1JWZ A;  4X1M A;  1GSV A;  1M40 A;  4Y7P A;  3ZCZ A;  2HDS A;  4OPR A;  1KVL A;  2P9V A;  3AGD A;  4JXG A;  1VHM A;  4KZA A;  1X0O A;  2IWD A;  4S2L A;  3OPP A;  1F5M A;  2QJ5 A;  3CPT A;  2ZC3 B;  2EXA A;  1Y28 A;  2I72 A;  3IHA A;  1BLH A;  4HHD A;  4MDZ A;  5FAO A;  2QZ6 A;  3VOY A;  3S1Y A;  4KZB A;  4BD1 A;  2V1Z A;  3W4Q A;  4IVI A;  4BBT A;  3H9W A;  4U0X A;  4GD8 A;  1T1C A;  1NWZ A;  4L9G A;  2WGW A;  4HBU A;  3OCL A;  1G28 A;  4LCL A;  3W4P A;  3GMW A;  2PAV P;  4I5S A;  4R23 A;  3G6O A;  4WBG A;  2XK1 A;  3A0R A;  3MMH A;  4R38 A;  2HJ9 C;  4O01 A;  3HLD A;  2ZLY A;  1A0K A;  1YLZ A;  4WM9 A;  4QHC A;  3N6I A;  2P9V B;  1GA0 A;  1SDE A;  3BWL A;  1S0W A;  2PD7 A;  3BJN A;  4I3J A;  1OPX A;  3DWK A;  2P74 A;  4IED A;  3OPL A;  2WAF A;  4DKI A;  3UDI A;  1L0D A;  1MXO A;  4DXB A;  5AVE A;  3LIF A;  5DKK A;  2EX9 A;  2HDQ A;  2VGJ A;  1ESU A;  5FAS A;  3PHY A;  2PYR A;  1PYY A;  3VP4 A;  1BSG A;  5AQB A;  4E3I A;  2HDR A;  4Y17 A;  5AQ9 A;  3UY6 A;  4XXR A;  2P08 A;  1OTA A;  5HWV A;  1IYP A;  3BM6 A;  2QWS A;  4GW9 A;  3E0Y A;  3OPR A;  2IWB A;  1HVB A;  4NKP A;  2VKS A;  1JVJ A;  5DFY A;  3IX8 A;  3CMZ A;  3WS4 A;  4OQH A;  2J7V A;  4JXS A;  4R6L A;  3HL9 A;  4RYE A;  3LGO A;  1J3W A;  3GVB A;  2XD1 A;  4EQI A;  4GHI A;  5FDH A;  2ZQ9 A;  4R3J A;  5DF9 A;  4YFM A;  1OTD A;  1FCN A;  4OOL A;  4OOY A;  3C2W A;  2W3E A;  4O0P A;  3MQQ A;  3QNC A; 
#chains in the Genus database with same CATH homology
 1SKO B;  2PRF A;  4ESP A;  1J3W A;  3D9Y A;  4QWO A;  1SZV A;  4FTX A;  2E8J A;  4D60 A;  3CHW P;  3T1R A;  2ACG A;  2HZ5 A;  3T12 B;  2JKG A;  3T1S A;  3T1X A;  3U4L P;  2VK3 A;  3MSH A;  1ACF A;  5FDS A;  1D1J A;  1HLU P;  2BTF P;  1SKO A;  1CJF A;  2JKF A;  2V8C A;  3NEC A;  3NUL A;  1FIL A;  1AWI A;  2PBD P;  1K0K A;  5EVE A;  3CPT A;  3T1Q B;  1G5U A;  4X1M A;  1FIK A;  1YPR A;  3LEQ A;  2B95 A;  5EV0 A;  1PFL A;  5EM0 A;  1VET A;  1VEU A;  2ZL1 A;  4X1L A;  2V8F A;  5FEG A;  2PAV P;  3L9K A;  1Z09 A;  3DAV A;  5EM1 A;  1Y4O A;  1PRQ A;  1CF0 A;  3MS6 A;  1VET B;  1VEU B;  2ZL1 B;  3CPT B;  3KYE A;  3L7H A;  4X25 A;  1F2K A;  1CQA A;  5FEF A;  3UB5 P;  4FUW A;  1A0K A;  1PNE A;  3LGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...