2JKTI

Ap2 clathrin adaptor core with cd4 dileucine peptide rm(phosphos) eikrllse q to e mutant
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
142
structure length
142
Chain Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-2 COMPLEX SUBUNIT ALPHA-2
publication title A Structural Explanation for the Binding of Endocytic Dileucine Motifs by the Ap2 Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 39
structure length 142
sequence length 142
chains with identical sequence S
ec nomenclature
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2jktI00
2JKTI 2FH5A 3TJZC 4NEED 2XA7S 2JKRI 2XA7M 1W63Q 2VGLS 4P6ZS 2VGLM 4P6ZM 2JKTM 1NRJA 1W63M 5MC7A 4UQIS 2JKRM 2HF6A 4UQIM
chains in the Genus database with same CATH superfamily
3CUEA 3SH7A 4A5RA 3UMEA 4EEPA 4LRYC 2HDQA 4N1HA 4LCLA 4E3MA 3WRZA 2ZLYA 1W8QA 4PM8A 4JF6A 2XFTA 4GJ4A 4Y7PA 1ESIA 3MKEA 3T4TA 5J8XA 3RXWA 2O9AA 5I94A 3PR6A 3EGXC 3OPRA 5HD5A 3NY4A 3ZVTA 2D02A 4OQHA 4HJ6A 3O5YA 4BBUA 3OZHA 3OPLA 3UB5P 1S66L 4R1GA 1KVLA 3VP2A 4OVDA 4WBGA 3O86A 2V8FA 2ZMVA 4LRZE 1TDGA 1EROA 4S2IA 1H0MA 4UQIM 3UB6A 2Y8HA 4LRXC 3CJMA 2Y59A 3DTMA 3IH9A 4Y3IA 5DTKA 4KG6A 3RXXA 4E6XA 3L9KA 4CLCC 4AFIA 1IOUA 3HLGA 5F1FA 5F68A 1WA9A 5E2EA 3CMZA 3CI6A 5DKLA 2WADA 1KDWA 1KVMA 3HLFA 5CEBA 5HWWA 1D06A 4OPRA 3FWLA 4CLCB 3RFBA 2QWSA 2JKTI 2FH5A 4PM5A 4S2NA 5TR7A 3OC2A 5AQAA 2Y79A 4NEED 4UA7A 2C6WB 3F1PB 2MJ6A 4RA7A 1DJCA 3WWXA 2B95A 1PW1A 1PW8A 2UV0E 5EM0A 3FC7A 2VKSA 5DF7A 3JVVA 2XFSA 1HTZA 4OKPA 4K91A 3B47A 4PAUA 5HWVA 1PWCA 3CPTA 4F3LB 3KO6A 5J7EA 2X02A 2GNXA 3BM6A 4IJGA 1ONGA 3VOLA 2OAP1 2PAVP 3V50A 3LFVA 1FR6A 4I5SA 4RX2A 1K56D 4KZ9A 1G5UA 1YT4A 2HZ5A 1GCEA 2Q9MA 4N92A 3TJZC 3W8KA 2L0WA 1X0OA 1XX2A 5EOOA 4YOFA 3VSKA 2VV8A 2G2UA 3O88A 3KYQA 1TEMA 1MWRA 3D72A 1W63M 5GHYA 3NIAA 4G3WA 1GSVA 4KZ7A 2HF6A 2X71A 2YKHA 2A2LA 2W1TB 4B93A 5HDSA 5FDSA 4KG2A 3T1QB 3T4JA 5A93A 1K54C 4LV2A 1KE3A 4BENA 3LR5A 2FFYA 2OWJA 4IBRA 4JGOA 5F69A 3LICA 4QWOA 3DWKA 4U0TA 3DTEA 3WS1A 1MWSA 5HFOA 5IS1A 1GHMA 5F83A 4L9EA 3IHAA 3QP5A 5K5BA 1J3WA 1ES2A 1FOFA 4UEYA 1K4EA 3LCEA 1HVBA 3BJNA 2B18A 4Y0OA 3LUQA 4Y15A 3BEBA 1ERMA 3G2YA 2JKFA 2WKIA 4U0XA 4QY6A 4RVAA 3V39A 3SH9A 3NOPC 3BFEA 2VV7A 1XKZA 4KUKA 5F82A 4E3KA 1OTEA 4PMAA 3A3EA 3A0SA 3B33A 4BL2A 4BMWA 5M19A 4GD8A 3WRTA 1A0KA 5A90A 2H5SA 2HDSA 2HV1A 4BJPA 1VQQA 5L07A 2OLVA 2W3EA 5CGSA 2J3TC 3HUMA 3HJKA 4I3JA 5AQBA 4MMNA 1PYYA 4OP8A 2VGLM 5DVAA 5DFYA 1FSWA 4GS9A 1XGIA 3WS5A 2PBYA 4FSFA 4LENA 3UDIA 1PWGA 4Y13A 5TBMA 2HP9A 3L7HA 2Y2HA 3G2ZA 4OONA 2ZC5B 2OOLA 4N1XA 1KDSA 4KZ3A 3F1OB 4DXCA 3N6IA 3FPVA 4X6TA 4BBTA 2LB5A 3EGDC 4QB8A 3LYXA 2JKGA 3UY6A 2PR5A 3A0RA 5CHMA 3S4XA 1Z6FA 3NC8A 4IUHA 1DRMA 1OTAA 3QHYA 3CPTB 3FV7A 3TE8A 1W8YA 2QKPA 4DJ2A 4JPMA 3V67A 2ZMFA 3HBRA 1S1ZA 4S2LA 3IXBA 4JGRA 1K6RA 3BWLA 3UDXA 1NXYA 2XA7M 5IT5A 3MR0A 2JC7A 3FZCA 3B3XA 4WN5A 5CERA 1AXBA 3MFXA 1V9ZA 3LI8A 5FQMA 2Z2LB 2L1MA 4DDSA 1CI8A 4OLGA 2Y2GA 1P0ZA 1SDNA 3BRMA 4PKYG 4R0QA 4OLDA 3A3JA 4EQ1A 1I5QA 2ZD8A 5A91A 1YLPA 2JKRM 3HLEA 3CHWP 2EX9A 5TJJA 1XXMA 3F1NA 3NDGA 4L0LA 3G30A 4C75A 3G31A 3H82A 3UB7A 2EX6A 2QJ5A 3EOIA 2WGWA 2RL3A 1K38A 3VP4A 4P87A 3C7VA 2WKQA 4CQHA 3MQ0A 4U3TA 3C7UA 2XA7S 4OQ0A 1IEMA 3HJIA 2P9VB 1FR1A 4ESPA 3N7WA 4X68A 2V1AA 3LIFA 1ONHA 5FAPA 1P97A 3IH8A 1H5XA 2XQZA 3S7QA 4E3JA 2V0WA 5J4EA 1MXOA 3QNCA 3G34A 4IBXA 3P7NA 4GOGA 4RX3A 1NJ4A 3B42A 2WAFA 3MZEA 4CLCE 1MPLA 3IWIA 2BTFP 2VZWA 2H10A 2PHYA 3IXGA 2BASA 2WAEA 4LV0A 2WUQA 4BBVA 2ZBBA 5EOEA 4IVKA 3SH8A 4JXVA 1L0DA 5KIZA 4GS9B 1PNEA 3BECA 2XK1A 3UO9A 1YSPA 3BFFA 2WKRA 4KZ8A 5TBMB 4EW7A 4O7DA 1K0KA 2XR0A 2EX8A 2ZC7A 3HLWA 5F1GA 2PYRA 3Q82A 4Y17A 2DRWA 4HHDA 1E25A 5E43A 3ZQ5A 3NOUC 4E3IA 4KZBA 1IKGA 4HH2A 1EW0A 3UE3A 2Y4AA 1XJ3A 5DTTA 3ZNYA 3GR2A 5FQKA 1BLHA 3UPOA 4IEDA 3UB8A 4FTXA 1RP5A 4XT2B 5EV0A 3E2LA 4KQDA 1PIOA 4WUJA 3LIAA 4OQIA 2O99A 1S0WA 4Q0HA 3LR0A 5CTNA 3IF6A 2G2WA 1J9MA 2PDRA 2WKEA 4GDNA 2Y2KA 2E8IA 1DY6A 1YLWA 2WZXA 1TF1A 4N9LA 1ZG4A 5KSHA 4BWIA 5GL9A 1K25A 4X55A 3QP8A 4I3IA 3C5AA 1V9YA 2WGIA 4S2MA 3BW6A 2HJEA 4Q8IA 5FL3A 5HWTA 4KQRA 1OMEA 4WM9A 1N4OA 5CHJA 3F1NB 3HUNA 3UPNA 1UWNX 3SW1A 3VV4A 2KX6A 3H82B 2LB9A 1MWTA 2WGWB 2PR6A 4HBUA 1KGGA 1CQAA 1WYCA 4C3QA 4ZDXA 3SS5A 3MQQA 1KE0A 3LY4A 3A3IA 4KZ5A 2Q9NA 3MF0A 5JYOA 3QP2A 3OOVA 1KGEA 4ZBEA 5HDDA 3A3DA 4LLOB 4Q0IA 2A24A 1LL8A 4YNRA 2VV6A 3OCLA 2HGVA 3QP4A 4BQMA 1JWPA 1K55A 4WYYA 5FI2A 1NZOA 3CLOA 1FSYA 2NUTC 3VE4A 1ERQA 4GB7A 4OOYA 5HDCA 3SOIA 3NOTC 4GN2A 2VA0A 2VX8A 1M6KA 3VE3A 3IWOA 1GA0A 2K7SA 3TSGA 4B4ZA 2I9VA 4P85A 2ZM0A 1K57A 4I39A 1BLCA 2DCFA 1WYBA 1YLYA 2K2NA 3GRJA 5HL6A 1MKIA 3AGEA 1OT6A 4JGPA 4HJ4A 4R38A 5DF9A 1VETA 4H6JA 5HL1A 3P01A 4DE0A 4Q0JA 4LGWA 1TDLA 3BY9A 2W3FA 2OV5A 5CECA 3ZG0A 3KYEA 4F94A 4WZ5A 3E2KA 3S22A 3EQVA 3CAXA 3MS6A 4KZ6A 3LR3A 1ZHHB 1VEUA 3LGOA 4WEKA 5G4YA 5F5YA 4S2KA 1IYQA 3MMHA 3KSGA 4UQIS 1JVJA 1YLZA 3AGDA 1MY8A 1PI4A 4GW9A 4Z9QA 3QP1A 3BLMA 3IS2A 1Q2QA 1H8ZA 2VGKA 5FASA 3KX0X 4EEUA 5EM1A 2BLSA 2V2FF 1C3BA 1DP9A 3PBSA 4XUZA 3E4OA 3RJUA 3C4PA 4WLAA 4LCMA 1GSWA 2B02A 4L9GA 3PTEA 4EU0A 2GJ3A 4UA6A 1NRFA 5DF8A 1N9BA 3CUEC 4ID4A 3BQ8A 1D1JA 3MZDA 3W4QA 3D4FA 3ZCZA 5F6AA 2Y2JA 1I2WA 5EUAA 1Y4OA 1XGJA 3PBOA 4X56A 1KE4A 1M40A 5FSRA 4X53A 4ZJ3A 4GCZA 2ZOHA 4HNBA 4GNUA 4MEZA 4P6ZM 5AJGA 3QNBA 2WYXA 3GTCA 1YSQA 2ZQDA 5G4ZA 1JTGA 3T12B 4ZAMA 4NXGA 2OLUA 1EI5A 4I3AA 2XLNA 3ULFA 1JWVA 4PM7A 4FD8A 1SDEA 3OCNA 4XXRA 3T4SA 1OT9A 4II7A 5GLBA 3VP0A 3G4PA 3NCKA 1K55C 1S6RA 2QMIA 2D01A 4EWFA 3T1XA 4DJ3A 2V8CA 3IWQA 4E3LA 2Y2LA 3EQUA 1VHMA 2ZQ8A 3OPPA 3ICYA 3VP1A 2Z6CA 3ZG5A 4D2OA 4OOLA 3FKVA 2M7VA 2HDUA 5AVFA 3V3RA 4B4XA 2O9BA 1L0FA 3A3FA 3BFGA 1G68A 4DE3A 1MBLA 3HL9A 5GLDA 3MXSA 4O0PA 4S2NC 4X1LA 3IX3A 1UGUA 3CZDA 3FG8A 2RCXA 3PAEA 2XF3A 5FAOA 4EBLA 5C5KA 3T50A 4NG2A 2HJ9C 3Q81A 4YFMA 3CG5A 3GMWA 2M1CA 1W5DA 4WEJA 3UPPA 4ETXA 1T18A 4MBFA 1LT0A 3C8CA 3IXHA 3WS0A 3NI9A 1S67L 1KOUA 3H7WA 3TG9A 2IWCA 5FA7A 1W79A 1ALQA 4O01A 4ETZA 1LHYA 2JKRI 4X69A 3TOIA 4MBHA 2EWVA 3GECA 3W4PA 3GDIA 4PM6A 3JYIA 2KOIA 3UE1A 4QU3A 2EFUA 1VM1A 3DTKA 2QYBA 1VEUB 3ZG9B 3IXDA 1XJ6A 5EFWA 4O8GA 3MQOA 3P09A 4JBFA 2H0TA 4B88A 1BLSA 2OWHA 2DNSA 2VGLS 3IS2B 4HH3A 3GVBA 2KLIA 4EUVA 3MXRA 5FQQA 3C30A 5M18A 1N9NA 5FQ9A 3WS2A 1YMXA 4G3VA 1UWPX 2PYPA 3ISGA 1MC0A 3UB9A 1OJGA 1CJFA 4JKTA 4R3BA 4KENB 1ES5A 3BY8A 3LEQA 3ZVWA 2ZC4B 3O3VA 3ITBA 5M1AA 5HZHA 5HSQA 2JN7A 4E6WA 1G28A 2VEAA 1FIKA 1VB6A 4K0WA 1NWZA 1L0EA 2W0NA 1XA7A 3FYZA 4EV4A 2UWXA 4DMZA 1Z09A 3ZFZA 3WS4A 1L3LA 3SS3A 3GSGA 1H3QA 3E98A 5FAQA 2H0YA 1ZKJA 3G35A 3K3DA 3NECA 1DJAA 1RGZA 3KSFA 4XUXA 3NJAA 4HIAA 4B9OA 1I2SA 2P04A 3LIDA 3HCYA 2I72A 4DN0A 3KSHA 3PBRA 2FZ0A 2XH9A 2A49A 4NK3A 2WZZA 3ZHHA 4QPRA 2J9OA 4QD4A 2J3WA 3PHYA 3D3OA 1NLYA 2HP5A 3G32A 2Y91A 1F5MA 2VLGA 3T1SA 1IELA 4Y0UA 4LV3A 2Q0OA 3LEZA 3TW8A 5D3OA 4Y0TA 3Q7ZA 5A92A 5FEFA 4PHTA 4ZJ1A 2JE5A 4FH2A 3GV9A 4NXEA 2XRNA 1OJ5A 3RTYA 3UE6A 5TGFA 2WK0A 2L4RA 3IX4A 2HDRA 1NYYA 2HP6A 2V1BA 2IWDA 3N8LA 5DKKA 3F1PA 2PU4A 5HX9A 2O0YA 5I5LA 5HAPA 2W27A 1TS8A 4UAAA 5FI6A 5EVLA 3H7WB 3UNWA 3NDEA 1JWZA 4HY8A 2IA2A 4OPYA 3Q1FA 2CC1A 2ZOIA 3M6HA 4PKYA 2WGVA 4X1MA 4FUWA 4UA9A 1AWIA 5DFXA 5FATA 1BSGA 1XPBA 1NYMA 4F3LA 1FILA 1K6SA 5FI7A 4EQIA 3MZFA 2C5WB 1BTLA 3VSLA 2M7UA 2PD7A 4JXWA 1SKOA 1TVFA 2R78A 3M2KA 4NKPA 2XEPA 4JLFA 1YKDA 1JNUA 5EECA 3ZNTA 4E3NA 2JBFA 3IBJA 3S7PA 1PI5A 5EPHA 1YPRA 4MNRA 5AQ7A 5KZHA 2W1TA 2XD1A 2Y2IA 1G6OA 4QHCA 4HESA 1IFQA 2EFXA 4HQAA 3JPUA 1LSVA 5A8BA 3UN7A 1IKIA 2QJ7A 4N9KA 1LL5A 1XA1A 4OPZA 3N4IA 3C38A 4KUOA 2G7UA 4KQOA 4GD6A 5CGWA 1SCWA 3PBQA 1BT5A 3OBFA 2XROA 1SHVA 2ZM8A 5CGXA 4DE1A 1XFQA 5L2FA 1T1AA 1T1BA 4R4RA 1LLBA 2AVXA 4MDZA 2V1ZA 2PU2A 1H8MA 1GSXA 4CPKA 5CX7A 1PZPA 4JF5A 4OQGA 3I7JA 3MFDA 2BG1A 3EWKA 3T4KA 4EETB 3NULA 2W3DA 4MBKA 1W7FA 2V0UA 3HVFA 2Z2MB 2ZC3B 3KSIA 1GHIA 4ZRRA 4YWZA 2R9XA 1YMSA 1BYWA 1MZUA 1MKMA 5CEDA 3VP3A 1IYOA 4E3OA 1NZUA 2FFFB 4PPRA 4LPZA 3CITA 3F1OA 1HD8A 4R70A 1D7EA 3R4KA 5L8MA 4P0MA 2VJWA 1W63Q 3C2WA 3BQAA 1PRQA 4KZAA 1E3UD 2CMNA 2EXAA 3N8SA 4JXGA 3FKWA 5JYPA 2P74A 3VFFA 3D9YA 4UHUA 1ZTUA 2JHEA 4Z1WA 1RCJA 5EVID 3EEHA 1L0GA 3TRCA 1IYPA 3LY3A 3PYPA 3IF6C 1P9RA 1JTDA 3MSHA 1FCMA 4HP9A 2ZC6B 4OP5A 1S4RA 5AVEA 1DP8A 4EXOA 1SKOB 2XSSA 1ZC2A 5GLCA 3IF6B 4JGQA 3ZG8B 3IHBA 1QMEA 3BFCA 2P08A 3NBLA 2EWWA 3HUOA 4K08A 1CF0A 4R6LA 4QY5A 2JKTM 2DMWA 5HARA 4RYEA 1E4DA 3E0YA 1OTDA 5DJTA 5GHXA 1Y28A 3SS4A 2P7JA 4NXBA 4YINA 3VMAA 4KQQA 1GHPA 2Y55A 1OTIA 3Q7VA 4OOMA 1XJ2A 4JXSA 3BFDA 1F9IA 4LV1A 1L2SA 2IWBA 2X01A 2PBDP 3V5MA 3UMDA 3LR4A 4R4SA 5J3WA 3RH8B 3ZG7B 3MBZA 5HPIA 1NY0A 3EEAA 1T19A 4I38A 4WZ4A 3JVUA 2Y2PA 4WMCD 4R23A 1F2KA 2J80A 5E2GA 2W3GA 5AQ9A 3FPWA 1YLTA 3PBNA 5HD3A 4L9FA 3W2ZA 1E3UA 2XGNA 4GZBA 3PXPA 5L10A 2E8JA 1QMFA 3AGFA 4ZTKA 2PD8A 5IHVA 2P9VA 2A24B 3IQAA 5LBRA 2J8YA 5FEGA 1YLJA 5EVIA 2QZ6A 4MN6A 4IHQA 4FH4A 1LSXA 5DTSA 3MKFA 4MLLA 4HJ3A 4M4XA 4R3AA 3BYDA 1K56A 5CTMA 1K57C 3G6OA 4GHIA 5EVEA 4H8RA 4OPQA 3PBTA 5FDHA 4ARZA 5BOHA 1H8YA 3DTIA 1TD5A 1OTBA 3E4QA 4P6ZS 3VFHA 4S2PA 2OAQ1 1BUEA 4WZ5C 5GLAA 1IYSA 3LO7A 5IU1A 1VETB 4H6JB 5HAIA 2XDMA 2QPNA 4DF6A 1XP4A 2ZL1A 4KG5A 1U60A 3QP6A 1O7EA 4NXFA 2V9AA 1Y54A 2VK3A 1FCOA 4X25A 3VOZA 2VGJA 1SZVA 3R7WA 4MN7A 3T1RA 4LFUA 1LSWA 3W4OA 2Y2QA 4D60A 3K2NA 4WMCA 2ZQCA 5GHZA 3M6BA 3ZDJA 1YM1A 4WF0A 1PWDA 3V3SA 3UE0A 5KMWA 4XT2A 4HOIA 1TS7A 4OH0A 2NUPC 2OSUA 2EX2A 5CHUA 3T4QA 1ZG6A 3DAVA 2W1RA 1PFLA 2W3HA 4PM9A 3ZGAB 3GQZA 4IUKA 4EERA 4CLCD 4G3KA 4EBNA 2ZJ9A 3VOYA 2ZM2A 1S1YA 3A0VA 4BL3A 1RGYA 3CWFA 1HZOA 3BLSA 4EESA 3H9WA 3Q7VB 4C6YA 5KSCA 3IT9A 3DWZA 3IF5A 4GKUA 2Y2OA 4WELA 4JF4A 4EUZA 3OLOA 1PZOA 2K31A 4DXBA 4MCWA 1N9LA 1Q2PA 1MWUA 2J9PA 1TS0A 3HLCA 1F98A 1OPXA 3IX8A 4DE2A 4S2OA 5FQIA 3MXQA 1CEFA 2WKPA 4GDBA 3SZTA 1LI0A 3T4OA 4ZJ2A 2B5RA 5EVIC 1FCNA 3ZYTA 2KDKA 2PT7A 1GA9A 4EBPA 4FCFA 4KZ4A 4E04A 2Y2MA 4Y5FA 4NETA 4RQ9A 1N9OA 1BZAA 4M3KA 3HLDA 1XJ4A 5EVIB 3P98A 2YKFA 4QJGA 1CI9A 3T4LA 1DP6A 4DDYA 1DJBA 1HLUP 1SKFA 5FQJA 1ODVA 2Z6DA 4GHIB 4DKIA 1FQGA 2R9WA 2GZAA 2O9CA 1O07A 4ARZB 2ZQ7A 2EXBA 4HI4A 4ME4A 4CLCA 2ZQ9A 4IVIA 5E2HA 3LI9A 4HP4A 1NRJA 3S1YA 3PAGA 1LI9A 4S2JA 5HW3A 2INWA 4BD0A 1ESUA 5E2FA 2WKHA 2GX5A 5L09A 2ZL1B 2A3UA 4DRTA 1KGFA 1S4SA 1YAXA 3R7WB 2ZQAA 4BLMA 3K3CA 3ITAA 3LIBA 4P6BA 2ZMAA 3DBAA 5CXWA 4FOFA 2JCHA 2EA9A 4Y2FA 4HEFA 2Y2NA 3C4OA 3N8RA 5CRFA 1BULA 1T1CA 3Q07A 1ES4A 1WE4A 3U4LP 1CK3A 3M2JA 5DJUA 1ES3A 2PRFA 5HPFA 3HREA 3OPHA 3E4PA 1LL9A 1YQSA 4GLQA 4CJNA 1CEGA 3S7NA 4WL9A 1BLPA 2XD5A 3O87A 2J7VA 4K0XA 3HLBA 2J3TD 3DW0A 5U47A 3UDFA 1ACFA 2HPBA 5TFQA 1G6AA 1K4FA 3MJQA 4MN5A 1P9WA 3S7OA 1NLZA 1EWZA 5EE8A 2QHKA 3LIEA 3NHQA 3U2AA 1STZA 2GDNA 3KYZA 1XFNA 1K54A 4BD1A 2H28A 5G18A 4HBTA 1TS6A 2ACGA 2V20A 3IBRA 5HAQA 4R3JA 5MC7A
chains in the Genus database with same CATH topology
3CUEA 2XSSA 1S67L 1KOUA 3H7WA 3P7NA 4JGQA 3UMEA 4ETZA 4O01A 4EEPA 4LRYC 2JKRI 2P08A 3B42A 4CLCE 2EWWA 2EWVA 3GECA 4K08A 4R6LA 2VZWA 3GDIA 2PHYA 2BASA 2KOIA 4GJ4A 2JKTM 2DMWA 2ZBBA 4BBVA 3T4TA 2QYBA 3E0YA 5KIZA 1OTDA 5DJTA 2O9AA 1XJ6A 1Y28A 3PR6A 3EGXC 2P7JA 4NXBA 4GS9B 5EFWA 5HD5A 4O8GA 3MQOA 2D02A 1OTIA 4HJ6A 3O5YA 4BBUA 4OOMA 1YSPA 1XJ2A 2OWHA 2WKRA 1F9IA 5TBMB 2VGLS 1S66L 3IS2B 4EW7A 4HH3A 2KLIA 4EUVA 3C30A 4LRZE 2ZMVA 2PYRA 4HHDA 3UMDA 4UQIM 3LR4A 3UB6A 1N9NA 2Y8HA 4LRXC 3ZQ5A 5J3WA 3NOUC 3RH8B 4G3VA 5HPIA 1UWPX 2PYPA 3EEAA 1MC0A 3UB9A 1OJGA 1T19A 4Y3IA 4I38A 4HH2A 1EW0A 3JVUA 3UE3A 3BY8A 4CLCC 4AFIA 2J80A 2W3GA 1IOUA 1XJ3A 3FPWA 3PBNA 5HD3A 4L9FA 3W2ZA 5F68A 1WA9A 5HZHA 5HSQA 3CI6A 5DKLA 2JN7A 3PXPA 1G28A 3UB8A 4XT2B 5HWWA 1D06A 4CLCB 2VEAA 2PD8A 3RFBA 2QWSA 1VB6A 2JKTI 4KQDA 2FH5A 5LBRA 2A24B 3OC2A 1NWZA 4WUJA 2Y79A 2W0NA 4NEED 3F1PB 3LIAA 2MJ6A 2O99A 4DMZA 4MN6A 4IHQA 4Q0HA 3LR0A 1H3QA 3E98A 1LSXA 4HJ3A 3FC7A 2VKSA 4M4XA 3JVVA 4R3AA 3G6OA 2PDRA 3K3DA 4GHIA 3B47A 4PAUA 5HWVA 3KSFA 4F3LB 3KO6A 5J7EA 3PBTA 3NJAA 4HIAA 4B9OA 4ARZA 1TF1A 2GNXA 1TD5A 2P04A 1OTBA 3E4QA 4P6ZS 3LIDA 4IJGA 5KSHA 4BWIA 3HCYA 2OAQ1 3VOLA 4DN0A 2OAP1 4I3IA 3KSHA 3LFVA 1V9YA 3PBRA 4I5SA 3BW6A 2HJEA 2FZ0A 5IU1A 4H6JB 5FL3A 5HWTA 3TJZC 4QPRA 2L0WA 1X0OA 2J3WA 4YOFA 3PHYA 3D3OA 1NLYA 2VV8A 3F1NB 3KYQA 1F5MA 4NXFA 2V9AA 2VLGA 1UWNX 3SW1A 3VV4A 3D72A 2KX6A 3H82B 1W63M 2LB9A 2PR6A 4G3WA 1GSVA 3R7WA 3TW8A 2HF6A 2YKHA 2A2LA 2W1TB 4MN7A 4B93A 5HDSA 4PHTA 3MQQA 3T4JA 4NXEA 1LSWA 2XRNA 3MF0A 1OJ5A 3LR5A 3RTYA 3K2NA 3UE6A 2OWJA 3OOVA 2L4RA 4JGOA 4WF0A 3LICA 5F69A 4XT2A 5HDDA 2V1BA 4LLOB 4HOIA 4Q0IA 2A24A 1LL8A 4YNRA 1TS7A 5DKKA 2VV6A 3F1PA 3OCLA 5IS1A 2HGVA 2O0YA 4L9EA 5I5LA 2NUPC 3T4QA 2W27A 1TS8A 3CLOA 5K5BA 2NUTC 3H7WB 3VE4A 4UEYA 4HY8A 2IA2A 2W1RA 2W3HA 5HDCA 2ZOIA 3BJNA 2B18A 4IUKA 3NOTC 4PKYA 4EERA 2VA0A 4G3KA 4CLCD 3LUQA 5DFXA 2VX8A 3VE3A 4F3LA 1S1YA 2K7SA 3A0VA 2I9VA 3CWFA 3NOPC 2VV7A 4I39A 4EESA 4KUKA 3H9WA 2K2NA 1OTEA 5HL6A 2M7UA 1OT6A 4JGPA 2PD7A 4HJ4A 3A0SA 3B33A 4R38A 4BMWA 5DF9A 2R78A 4H6JA 2HV1A 3P01A 4NKPA 4BJPA 4WELA 4Q0JA 3BY9A 1YKDA 1JNUA 2W3FA 2W3EA 3OLOA 2K31A 2J3TC 3EQVA 3CAXA 3IBJA 3S7PA 3HJKA 4I3JA 4MCWA 3LR3A 4MMNA 1N9LA 1ZHHB 2VGLM 4WEKA 5G4YA 1TS0A 2W1TA 1F98A 5F5YA 1OPXA 5DFYA 4GS9A 3MMHA 3MXQA 3KSGA 1G6OA 4UQIS 2WKPA 3T4OA 4FSFA 4GW9A 3ZYTA 2KDKA 2PT7A 1IFQA 4HQAA 5TBMA 4E04A 3IS2A 1LSVA 5A8BA 3KX0X 4Y5FA 2OOLA 4EEUA 4RQ9A 1N9OA 3F1OB 2QJ7A 1DP9A 1XJ4A 3FPVA 3C38A 4BBTA 4KUOA 2G7UA 4KQOA 3PBSA 2YKFA 2LB5A 3E4OA 3EGDC 3LYXA 3PBQA 3T4LA 3OBFA 2XROA 2PR5A 1DP6A 4WLAA 3A0RA 1GSWA 2B02A 4L9GA 4EU0A 2GJ3A 1ODVA 4IUHA 1XFQA 2Z6DA 4GHIB 1T1AA 1DRMA 1OTAA 1T1BA 2GZAA 2QKPA 3TE8A 2O9CA 4DJ2A 4ARZB 4HI4A 4ME4A 4CLCA 3CUEC 3BQ8A 4MDZA 3V67A 3LI9A 4HP4A 2ZMFA 1NRJA 1S1ZA 1H8MA 1GSXA 4JGRA 5F6AA 3BWLA 5CX7A 5J4EA 3PBOA 2INWA 2XA7M 4GCZA 2ZOHA 5IT5A 3MR0A 4HNBA 2GX5A 3EWKA 4P6ZM 3T4KA 4EETB 5AJGA 4WN5A 2W3DA 2V0UA 1YSQA 5G4ZA 3MFXA 3KSIA 1S4SA 1YAXA 1V9ZA 3R7WB 4NXGA 3LI8A 4ZRRA 3K3CA 3LIBA 2L1MA 3DBAA 4YWZA 4I3AA 4FOFA 1BYWA 1MZUA 3ULFA 2EA9A 4Y2FA 1MKMA 1P0ZA 1T1CA 3OCNA 5DJUA 4PKYG 3T4SA 1OT9A 4II7A 5HPFA 3E4PA 4EQ1A 2JKRM 4GLQA 2D01A 4DJ3A 3S7NA 4WL9A 4LPZA 5TJJA 3EQUA 3CITA 1VHMA 3F1OA 3F1NA 4L0LA 3ICYA 4R70A 2Z6CA 1D7EA 3R4KA 5L8MA 2VJWA 3H82A 4OOLA 1W63Q 2M7VA 2J3TD 3UB7A 2QJ5A 3EOIA 3C2WA 5AVFA 3BQAA 2O9BA 2CMNA 4O0PA 1UGUA 2WKQA 3MJQA 4MN5A 1P9WA 4CQHA 3MQ0A 3FG8A 3S7OA 1ZTUA 1NLZA 2JHEA 4Z1WA 2QHKA 2XA7S 3LIEA 5C5KA 3T50A 3NHQA 3HJIA 3U2AA 2HJ9C 1STZA 3EEHA 3KYZA 1XFNA 2V1AA 3LIFA 2H28A 3TRCA 3PYPA 1TS6A 2M1CA 1P9RA 4WEJA 1P97A 4ETXA 1T18A 3S7QA 1LT0A 3IBRA 4HP9A 5AVEA 2V0WA 1S4RA 1DP8A 3C8CA 5MC7A 4EXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JKT I;  2FH5 A;  3TJZ C;  4NEE D;  2XA7 S;  2JKR I;  2XA7 M;  1W63 Q;  2VGL S;  4P6Z S;  2VGL M;  4P6Z M;  2JKT M;  1NRJ A;  1W63 M;  5MC7 A;  4UQI S;  2JKR M;  2HF6 A;  4UQI M; 
#chains in the Genus database with same CATH topology
 3CUE A;  3SH7 A;  4A5R A;  3UME A;  4EEP A;  4LRY C;  2HDQ A;  4N1H A;  4LCL A;  4E3M A;  3WRZ A;  2ZLY A;  1W8Q A;  4PM8 A;  4JF6 A;  2XFT A;  4GJ4 A;  4Y7P A;  1ESI A;  3MKE A;  3T4T A;  5J8X A;  3RXW A;  2O9A A;  5I94 A;  3PR6 A;  3EGX C;  3OPR A;  5HD5 A;  3NY4 A;  3ZVT A;  2D02 A;  4OQH A;  4HJ6 A;  3O5Y A;  4BBU A;  3OZH A;  3OPL A;  3UB5 P;  1S66 L;  4R1G A;  1KVL A;  3VP2 A;  4OVD A;  4WBG A;  3O86 A;  2V8F A;  2ZMV A;  4LRZ E;  1TDG A;  1ERO A;  4S2I A;  1H0M A;  4UQI M;  3UB6 A;  2Y8H A;  4LRX C;  3CJM A;  2Y59 A;  3DTM A;  3IH9 A;  4Y3I A;  5DTK A;  4KG6 A;  3RXX A;  4E6X A;  3L9K A;  4CLC C;  4AFI A;  1IOU A;  3HLG A;  5F1F A;  5F68 A;  1WA9 A;  5E2E A;  3CMZ A;  3CI6 A;  5DKL A;  2WAD A;  1KDW A;  1KVM A;  3HLF A;  5CEB A;  5HWW A;  1D06 A;  4OPR A;  3FWL A;  4CLC B;  3RFB A;  2QWS A;  2JKT I;  2FH5 A;  4PM5 A;  4S2N A;  5TR7 A;  3OC2 A;  5AQA A;  2Y79 A;  4NEE D;  4UA7 A;  2C6W B;  3F1P B;  2MJ6 A;  4RA7 A;  1DJC A;  3WWX A;  2B95 A;  1PW1 A;  1PW8 A;  2UV0 E;  5EM0 A;  3FC7 A;  2VKS A;  5DF7 A;  3JVV A;  2XFS A;  1HTZ A;  4OKP A;  4K91 A;  3B47 A;  4PAU A;  5HWV A;  1PWC A;  3CPT A;  4F3L B;  3KO6 A;  5J7E A;  2X02 A;  2GNX A;  3BM6 A;  4IJG A;  1ONG A;  3VOL A;  2OAP 1;  2PAV P;  3V50 A;  3LFV A;  1FR6 A;  4I5S A;  4RX2 A;  1K56 D;  4KZ9 A;  1G5U A;  1YT4 A;  2HZ5 A;  1GCE A;  2Q9M A;  4N92 A;  3TJZ C;  3W8K A;  2L0W A;  1X0O A;  1XX2 A;  5EOO A;  4YOF A;  3VSK A;  2VV8 A;  2G2U A;  3O88 A;  3KYQ A;  1TEM A;  1MWR A;  3D72 A;  1W63 M;  5GHY A;  3NIA A;  4G3W A;  1GSV A;  4KZ7 A;  2HF6 A;  2X71 A;  2YKH A;  2A2L A;  2W1T B;  4B93 A;  5HDS A;  5FDS A;  4KG2 A;  3T1Q B;  3T4J A;  5A93 A;  1K54 C;  4LV2 A;  1KE3 A;  4BEN A;  3LR5 A;  2FFY A;  2OWJ A;  4IBR A;  4JGO A;  5F69 A;  3LIC A;  4QWO A;  3DWK A;  4U0T A;  3DTE A;  3WS1 A;  1MWS A;  5HFO A;  5IS1 A;  1GHM A;  5F83 A;  4L9E A;  3IHA A;  3QP5 A;  5K5B A;  1J3W A;  1ES2 A;  1FOF A;  4UEY A;  1K4E A;  3LCE A;  1HVB A;  3BJN A;  2B18 A;  4Y0O A;  3LUQ A;  4Y15 A;  3BEB A;  1ERM A;  3G2Y A;  2JKF A;  2WKI A;  4U0X A;  4QY6 A;  4RVA A;  3V39 A;  3SH9 A;  3NOP C;  3BFE A;  2VV7 A;  1XKZ A;  4KUK A;  5F82 A;  4E3K A;  1OTE A;  4PMA A;  3A3E A;  3A0S A;  3B33 A;  4BL2 A;  4BMW A;  5M19 A;  4GD8 A;  3WRT A;  1A0K A;  5A90 A;  2H5S A;  2HDS A;  2HV1 A;  4BJP A;  1VQQ A;  5L07 A;  2OLV A;  2W3E A;  5CGS A;  2J3T C;  3HUM A;  3HJK A;  4I3J A;  5AQB A;  4MMN A;  1PYY A;  4OP8 A;  2VGL M;  5DVA A;  5DFY A;  1FSW A;  4GS9 A;  1XGI A;  3WS5 A;  2PBY A;  4FSF A;  4LEN A;  3UDI A;  1PWG A;  4Y13 A;  5TBM A;  2HP9 A;  3L7H A;  2Y2H A;  3G2Z A;  4OON A;  2ZC5 B;  2OOL A;  4N1X A;  1KDS A;  4KZ3 A;  3F1O B;  4DXC A;  3N6I A;  3FPV A;  4X6T A;  4BBT A;  2LB5 A;  3EGD C;  4QB8 A;  3LYX A;  2JKG A;  3UY6 A;  2PR5 A;  3A0R A;  5CHM A;  3S4X A;  1Z6F A;  3NC8 A;  4IUH A;  1DRM A;  1OTA A;  3QHY A;  3CPT B;  3FV7 A;  3TE8 A;  1W8Y A;  2QKP A;  4DJ2 A;  4JPM A;  3V67 A;  2ZMF A;  3HBR A;  1S1Z A;  4S2L A;  3IXB A;  4JGR A;  1K6R A;  3BWL A;  3UDX A;  1NXY A;  2XA7 M;  5IT5 A;  3MR0 A;  2JC7 A;  3FZC A;  3B3X A;  4WN5 A;  5CER A;  1AXB A;  3MFX A;  1V9Z A;  3LI8 A;  5FQM A;  2Z2L B;  2L1M A;  4DDS A;  1CI8 A;  4OLG A;  2Y2G A;  1P0Z A;  1SDN A;  3BRM A;  4PKY G;  4R0Q A;  4OLD A;  3A3J A;  4EQ1 A;  1I5Q A;  2ZD8 A;  5A91 A;  1YLP A;  2JKR M;  3HLE A;  3CHW P;  2EX9 A;  5TJJ A;  1XXM A;  3F1N A;  3NDG A;  4L0L A;  3G30 A;  4C75 A;  3G31 A;  3H82 A;  3UB7 A;  2EX6 A;  2QJ5 A;  3EOI A;  2WGW A;  2RL3 A;  1K38 A;  3VP4 A;  4P87 A;  3C7V A;  2WKQ A;  4CQH A;  3MQ0 A;  4U3T A;  3C7U A;  2XA7 S;  4OQ0 A;  1IEM A;  3HJI A;  2P9V B;  1FR1 A;  4ESP A;  3N7W A;  4X68 A;  2V1A A;  3LIF A;  1ONH A;  5FAP A;  1P97 A;  3IH8 A;  1H5X A;  2XQZ A;  3S7Q A;  4E3J A;  2V0W A;  5J4E A;  1MXO A;  3QNC A;  3G34 A;  4IBX A;  3P7N A;  4GOG A;  4RX3 A;  1NJ4 A;  3B42 A;  2WAF A;  3MZE A;  4CLC E;  1MPL A;  3IWI A;  2BTF P;  2VZW A;  2H10 A;  2PHY A;  3IXG A;  2BAS A;  2WAE A;  4LV0 A;  2WUQ A;  4BBV A;  2ZBB A;  5EOE A;  4IVK A;  3SH8 A;  4JXV A;  1L0D A;  5KIZ A;  4GS9 B;  1PNE A;  3BEC A;  2XK1 A;  3UO9 A;  1YSP A;  3BFF A;  2WKR A;  4KZ8 A;  5TBM B;  4EW7 A;  4O7D A;  1K0K A;  2XR0 A;  2EX8 A;  2ZC7 A;  3HLW A;  5F1G A;  2PYR A;  3Q82 A;  4Y17 A;  2DRW A;  4HHD A;  1E25 A;  5E43 A;  3ZQ5 A;  3NOU C;  4E3I A;  4KZB A;  1IKG A;  4HH2 A;  1EW0 A;  3UE3 A;  2Y4A A;  1XJ3 A;  5DTT A;  3ZNY A;  3GR2 A;  5FQK A;  1BLH A;  3UPO A;  4IED A;  3UB8 A;  4FTX A;  1RP5 A;  4XT2 B;  5EV0 A;  3E2L A;  4KQD A;  1PIO A;  4WUJ A;  3LIA A;  4OQI A;  2O99 A;  1S0W A;  4Q0H A;  3LR0 A;  5CTN A;  3IF6 A;  2G2W A;  1J9M A;  2PDR A;  2WKE A;  4GDN A;  2Y2K A;  2E8I A;  1DY6 A;  1YLW A;  2WZX A;  1TF1 A;  4N9L A;  1ZG4 A;  5KSH A;  4BWI A;  5GL9 A;  1K25 A;  4X55 A;  3QP8 A;  4I3I A;  3C5A A;  1V9Y A;  2WGI A;  4S2M A;  3BW6 A;  2HJE A;  4Q8I A;  5FL3 A;  5HWT A;  4KQR A;  1OME A;  4WM9 A;  1N4O A;  5CHJ A;  3F1N B;  3HUN A;  3UPN A;  1UWN X;  3SW1 A;  3VV4 A;  2KX6 A;  3H82 B;  2LB9 A;  1MWT A;  2WGW B;  2PR6 A;  4HBU A;  1KGG A;  1CQA A;  1WYC A;  4C3Q A;  4ZDX A;  3SS5 A;  3MQQ A;  1KE0 A;  3LY4 A;  3A3I A;  4KZ5 A;  2Q9N A;  3MF0 A;  5JYO A;  3QP2 A;  3OOV A;  1KGE A;  4ZBE A;  5HDD A;  3A3D A;  4LLO B;  4Q0I A;  2A24 A;  1LL8 A;  4YNR A;  2VV6 A;  3OCL A;  2HGV A;  3QP4 A;  4BQM A;  1JWP A;  1K55 A;  4WYY A;  5FI2 A;  1NZO A;  3CLO A;  1FSY A;  2NUT C;  3VE4 A;  1ERQ A;  4GB7 A;  4OOY A;  5HDC A;  3SOI A;  3NOT C;  4GN2 A;  2VA0 A;  2VX8 A;  1M6K A;  3VE3 A;  3IWO A;  1GA0 A;  2K7S A;  3TSG A;  4B4Z A;  2I9V A;  4P85 A;  2ZM0 A;  1K57 A;  4I39 A;  1BLC A;  2DCF A;  1WYB A;  1YLY A;  2K2N A;  3GRJ A;  5HL6 A;  1MKI A;  3AGE A;  1OT6 A;  4JGP A;  4HJ4 A;  4R38 A;  5DF9 A;  1VET A;  4H6J A;  5HL1 A;  3P01 A;  4DE0 A;  4Q0J A;  4LGW A;  1TDL A;  3BY9 A;  2W3F A;  2OV5 A;  5CEC A;  3ZG0 A;  3KYE A;  4F94 A;  4WZ5 A;  3E2K A;  3S22 A;  3EQV A;  3CAX A;  3MS6 A;  4KZ6 A;  3LR3 A;  1ZHH B;  1VEU A;  3LGO A;  4WEK A;  5G4Y A;  5F5Y A;  4S2K A;  1IYQ A;  3MMH A;  3KSG A;  4UQI S;  1JVJ A;  1YLZ A;  3AGD A;  1MY8 A;  1PI4 A;  4GW9 A;  4Z9Q A;  3QP1 A;  3BLM A;  3IS2 A;  1Q2Q A;  1H8Z A;  2VGK A;  5FAS A;  3KX0 X;  4EEU A;  5EM1 A;  2BLS A;  2V2F F;  1C3B A;  1DP9 A;  3PBS A;  4XUZ A;  3E4O A;  3RJU A;  3C4P A;  4WLA A;  4LCM A;  1GSW A;  2B02 A;  4L9G A;  3PTE A;  4EU0 A;  2GJ3 A;  4UA6 A;  1NRF A;  5DF8 A;  1N9B A;  3CUE C;  4ID4 A;  3BQ8 A;  1D1J A;  3MZD A;  3W4Q A;  3D4F A;  3ZCZ A;  5F6A A;  2Y2J A;  1I2W A;  5EUA A;  1Y4O A;  1XGJ A;  3PBO A;  4X56 A;  1KE4 A;  1M40 A;  5FSR A;  4X53 A;  4ZJ3 A;  4GCZ A;  2ZOH A;  4HNB A;  4GNU A;  4MEZ A;  4P6Z M;  5AJG A;  3QNB A;  2WYX A;  3GTC A;  1YSQ A;  2ZQD A;  5G4Z A;  1JTG A;  3T12 B;  4ZAM A;  4NXG A;  2OLU A;  1EI5 A;  4I3A A;  2XLN A;  3ULF A;  1JWV A;  4PM7 A;  4FD8 A;  1SDE A;  3OCN A;  4XXR A;  3T4S A;  1OT9 A;  4II7 A;  5GLB A;  3VP0 A;  3G4P A;  3NCK A;  1K55 C;  1S6R A;  2QMI A;  2D01 A;  4EWF A;  3T1X A;  4DJ3 A;  2V8C A;  3IWQ A;  4E3L A;  2Y2L A;  3EQU A;  1VHM A;  2ZQ8 A;  3OPP A;  3ICY A;  3VP1 A;  2Z6C A;  3ZG5 A;  4D2O A;  4OOL A;  3FKV A;  2M7V A;  2HDU A;  5AVF A;  3V3R A;  4B4X A;  2O9B A;  1L0F A;  3A3F A;  3BFG A;  1G68 A;  4DE3 A;  1MBL A;  3HL9 A;  5GLD A;  3MXS A;  4O0P A;  4S2N C;  4X1L A;  3IX3 A;  1UGU A;  3CZD A;  3FG8 A;  2RCX A;  3PAE A;  2XF3 A;  5FAO A;  4EBL A;  5C5K A;  3T50 A;  4NG2 A;  2HJ9 C;  3Q81 A;  4YFM A;  3CG5 A;  3GMW A;  2M1C A;  1W5D A;  4WEJ A;  3UPP A;  4ETX A;  1T18 A;  4MBF A;  1LT0 A;  3C8C A;  3IXH A;  3WS0 A;  3NI9 A;  1S67 L;  1KOU A;  3H7W A;  3TG9 A;  2IWC A;  5FA7 A;  1W79 A;  1ALQ A;  4O01 A;  4ETZ A;  1LHY A;  2JKR I;  4X69 A;  3TOI A;  4MBH A;  2EWV A;  3GEC A;  3W4P A;  3GDI A;  4PM6 A;  3JYI A;  2KOI A;  3UE1 A;  4QU3 A;  2EFU A;  1VM1 A;  3DTK A;  2QYB A;  1VEU B;  3ZG9 B;  3IXD A;  1XJ6 A;  5EFW A;  4O8G A;  3MQO A;  3P09 A;  4JBF A;  2H0T A;  4B88 A;  1BLS A;  2OWH A;  2DNS A;  2VGL S;  3IS2 B;  4HH3 A;  3GVB A;  2KLI A;  4EUV A;  3MXR A;  5FQQ A;  3C30 A;  5M18 A;  1N9N A;  5FQ9 A;  3WS2 A;  1YMX A;  4G3V A;  1UWP X;  2PYP A;  3ISG A;  1MC0 A;  3UB9 A;  1OJG A;  1CJF A;  4JKT A;  4R3B A;  4KEN B;  1ES5 A;  3BY8 A;  3LEQ A;  3ZVW A;  2ZC4 B;  3O3V A;  3ITB A;  5M1A A;  5HZH A;  5HSQ A;  2JN7 A;  4E6W A;  1G28 A;  2VEA A;  1FIK A;  1VB6 A;  4K0W A;  1NWZ A;  1L0E A;  2W0N A;  1XA7 A;  3FYZ A;  4EV4 A;  2UWX A;  4DMZ A;  1Z09 A;  3ZFZ A;  3WS4 A;  1L3L A;  3SS3 A;  3GSG A;  1H3Q A;  3E98 A;  5FAQ A;  2H0Y A;  1ZKJ A;  3G35 A;  3K3D A;  3NEC A;  1DJA A;  1RGZ A;  3KSF A;  4XUX A;  3NJA A;  4HIA A;  4B9O A;  1I2S A;  2P04 A;  3LID A;  3HCY A;  2I72 A;  4DN0 A;  3KSH A;  3PBR A;  2FZ0 A;  2XH9 A;  2A49 A;  4NK3 A;  2WZZ A;  3ZHH A;  4QPR A;  2J9O A;  4QD4 A;  2J3W A;  3PHY A;  3D3O A;  1NLY A;  2HP5 A;  3G32 A;  2Y91 A;  1F5M A;  2VLG A;  3T1S A;  1IEL A;  4Y0U A;  4LV3 A;  2Q0O A;  3LEZ A;  3TW8 A;  5D3O A;  4Y0T A;  3Q7Z A;  5A92 A;  5FEF A;  4PHT A;  4ZJ1 A;  2JE5 A;  4FH2 A;  3GV9 A;  4NXE A;  2XRN A;  1OJ5 A;  3RTY A;  3UE6 A;  5TGF A;  2WK0 A;  2L4R A;  3IX4 A;  2HDR A;  1NYY A;  2HP6 A;  2V1B A;  2IWD A;  3N8L A;  5DKK A;  3F1P A;  2PU4 A;  5HX9 A;  2O0Y A;  5I5L A;  5HAP A;  2W27 A;  1TS8 A;  4UAA A;  5FI6 A;  5EVL A;  3H7W B;  3UNW A;  3NDE A;  1JWZ A;  4HY8 A;  2IA2 A;  4OPY A;  3Q1F A;  2CC1 A;  2ZOI A;  3M6H A;  4PKY A;  2WGV A;  4X1M A;  4FUW A;  4UA9 A;  1AWI A;  5DFX A;  5FAT A;  1BSG A;  1XPB A;  1NYM A;  4F3L A;  1FIL A;  1K6S A;  5FI7 A;  4EQI A;  3MZF A;  2C5W B;  1BTL A;  3VSL A;  2M7U A;  2PD7 A;  4JXW A;  1SKO A;  1TVF A;  2R78 A;  3M2K A;  4NKP A;  2XEP A;  4JLF A;  1YKD A;  1JNU A;  5EEC A;  3ZNT A;  4E3N A;  2JBF A;  3IBJ A;  3S7P A;  1PI5 A;  5EPH A;  1YPR A;  4MNR A;  5AQ7 A;  5KZH A;  2W1T A;  2XD1 A;  2Y2I A;  1G6O A;  4QHC A;  4HES A;  1IFQ A;  2EFX A;  4HQA A;  3JPU A;  1LSV A;  5A8B A;  3UN7 A;  1IKI A;  2QJ7 A;  4N9K A;  1LL5 A;  1XA1 A;  4OPZ A;  3N4I A;  3C38 A;  4KUO A;  2G7U A;  4KQO A;  4GD6 A;  5CGW A;  1SCW A;  3PBQ A;  1BT5 A;  3OBF A;  2XRO A;  1SHV A;  2ZM8 A;  5CGX A;  4DE1 A;  1XFQ A;  5L2F A;  1T1A A;  1T1B A;  4R4R A;  1LLB A;  2AVX A;  4MDZ A;  2V1Z A;  2PU2 A;  1H8M A;  1GSX A;  4CPK A;  5CX7 A;  1PZP A;  4JF5 A;  4OQG A;  3I7J A;  3MFD A;  2BG1 A;  3EWK A;  3T4K A;  4EET B;  3NUL A;  2W3D A;  4MBK A;  1W7F A;  2V0U A;  3HVF A;  2Z2M B;  2ZC3 B;  3KSI A;  1GHI A;  4ZRR A;  4YWZ A;  2R9X A;  1YMS A;  1BYW A;  1MZU A;  1MKM A;  5CED A;  3VP3 A;  1IYO A;  4E3O A;  1NZU A;  2FFF B;  4PPR A;  4LPZ A;  3CIT A;  3F1O A;  1HD8 A;  4R70 A;  1D7E A;  3R4K A;  5L8M A;  4P0M A;  2VJW A;  1W63 Q;  3C2W A;  3BQA A;  1PRQ A;  4KZA A;  1E3U D;  2CMN A;  2EXA A;  3N8S A;  4JXG A;  3FKW A;  5JYP A;  2P74 A;  3VFF A;  3D9Y A;  4UHU A;  1ZTU A;  2JHE A;  4Z1W A;  1RCJ A;  5EVI D;  3EEH A;  1L0G A;  3TRC A;  1IYP A;  3LY3 A;  3PYP A;  3IF6 C;  1P9R A;  1JTD A;  3MSH A;  1FCM A;  4HP9 A;  2ZC6 B;  4OP5 A;  1S4R A;  5AVE A;  1DP8 A;  4EXO A;  1SKO B;  2XSS A;  1ZC2 A;  5GLC A;  3IF6 B;  4JGQ A;  3ZG8 B;  3IHB A;  1QME A;  3BFC A;  2P08 A;  3NBL A;  2EWW A;  3HUO A;  4K08 A;  1CF0 A;  4R6L A;  4QY5 A;  2JKT M;  2DMW A;  5HAR A;  4RYE A;  1E4D A;  3E0Y A;  1OTD A;  5DJT A;  5GHX A;  1Y28 A;  3SS4 A;  2P7J A;  4NXB A;  4YIN A;  3VMA A;  4KQQ A;  1GHP A;  2Y55 A;  1OTI A;  3Q7V A;  4OOM A;  1XJ2 A;  4JXS A;  3BFD A;  1F9I A;  4LV1 A;  1L2S A;  2IWB A;  2X01 A;  2PBD P;  3V5M A;  3UMD A;  3LR4 A;  4R4S A;  5J3W A;  3RH8 B;  3ZG7 B;  3MBZ A;  5HPI A;  1NY0 A;  3EEA A;  1T19 A;  4I38 A;  4WZ4 A;  3JVU A;  2Y2P A;  4WMC D;  4R23 A;  1F2K A;  2J80 A;  5E2G A;  2W3G A;  5AQ9 A;  3FPW A;  1YLT A;  3PBN A;  5HD3 A;  4L9F A;  3W2Z A;  1E3U A;  2XGN A;  4GZB A;  3PXP A;  5L10 A;  2E8J A;  1QMF A;  3AGF A;  4ZTK A;  2PD8 A;  5IHV A;  2P9V A;  2A24 B;  3IQA A;  5LBR A;  2J8Y A;  5FEG A;  1YLJ A;  5EVI A;  2QZ6 A;  4MN6 A;  4IHQ A;  4FH4 A;  1LSX A;  5DTS A;  3MKF A;  4MLL A;  4HJ3 A;  4M4X A;  4R3A A;  3BYD A;  1K56 A;  5CTM A;  1K57 C;  3G6O A;  4GHI A;  5EVE A;  4H8R A;  4OPQ A;  3PBT A;  5FDH A;  4ARZ A;  5BOH A;  1H8Y A;  3DTI A;  1TD5 A;  1OTB A;  3E4Q A;  4P6Z S;  3VFH A;  4S2P A;  2OAQ 1;  1BUE A;  4WZ5 C;  5GLA A;  1IYS A;  3LO7 A;  5IU1 A;  1VET B;  4H6J B;  5HAI A;  2XDM A;  2QPN A;  4DF6 A;  1XP4 A;  2ZL1 A;  4KG5 A;  1U60 A;  3QP6 A;  1O7E A;  4NXF A;  2V9A A;  1Y54 A;  2VK3 A;  1FCO A;  4X25 A;  3VOZ A;  2VGJ A;  1SZV A;  3R7W A;  4MN7 A;  3T1R A;  4LFU A;  1LSW A;  3W4O A;  2Y2Q A;  4D60 A;  3K2N A;  4WMC A;  2ZQC A;  5GHZ A;  3M6B A;  3ZDJ A;  1YM1 A;  4WF0 A;  1PWD A;  3V3S A;  3UE0 A;  5KMW A;  4XT2 A;  4HOI A;  1TS7 A;  4OH0 A;  2NUP C;  2OSU A;  2EX2 A;  5CHU A;  3T4Q A;  1ZG6 A;  3DAV A;  2W1R A;  1PFL A;  2W3H A;  4PM9 A;  3ZGA B;  3GQZ A;  4IUK A;  4EER A;  4CLC D;  4G3K A;  4EBN A;  2ZJ9 A;  3VOY A;  2ZM2 A;  1S1Y A;  3A0V A;  4BL3 A;  1RGY A;  3CWF A;  1HZO A;  3BLS A;  4EES A;  3H9W A;  3Q7V B;  4C6Y A;  5KSC A;  3IT9 A;  3DWZ A;  3IF5 A;  4GKU A;  2Y2O A;  4WEL A;  4JF4 A;  4EUZ A;  3OLO A;  1PZO A;  2K31 A;  4DXB A;  4MCW A;  1N9L A;  1Q2P A;  1MWU A;  2J9P A;  1TS0 A;  3HLC A;  1F98 A;  1OPX A;  3IX8 A;  4DE2 A;  4S2O A;  5FQI A;  3MXQ A;  1CEF A;  2WKP A;  4GDB A;  3SZT A;  1LI0 A;  3T4O A;  4ZJ2 A;  2B5R A;  5EVI C;  1FCN A;  3ZYT A;  2KDK A;  2PT7 A;  1GA9 A;  4EBP A;  4FCF A;  4KZ4 A;  4E04 A;  2Y2M A;  4Y5F A;  4NET A;  4RQ9 A;  1N9O A;  1BZA A;  4M3K A;  3HLD A;  1XJ4 A;  5EVI B;  3P98 A;  2YKF A;  4QJG A;  1CI9 A;  3T4L A;  1DP6 A;  4DDY A;  1DJB A;  1HLU P;  1SKF A;  5FQJ A;  1ODV A;  2Z6D A;  4GHI B;  4DKI A;  1FQG A;  2R9W A;  2GZA A;  2O9C A;  1O07 A;  4ARZ B;  2ZQ7 A;  2EXB A;  4HI4 A;  4ME4 A;  4CLC A;  2ZQ9 A;  4IVI A;  5E2H A;  3LI9 A;  4HP4 A;  1NRJ A;  3S1Y A;  3PAG A;  1LI9 A;  4S2J A;  5HW3 A;  2INW A;  4BD0 A;  1ESU A;  5E2F A;  2WKH A;  2GX5 A;  5L09 A;  2ZL1 B;  2A3U A;  4DRT A;  1KGF A;  1S4S A;  1YAX A;  3R7W B;  2ZQA A;  4BLM A;  3K3C A;  3ITA A;  3LIB A;  4P6B A;  2ZMA A;  3DBA A;  5CXW A;  4FOF A;  2JCH A;  2EA9 A;  4Y2F A;  4HEF A;  2Y2N A;  3C4O A;  3N8R A;  5CRF A;  1BUL A;  1T1C A;  3Q07 A;  1ES4 A;  1WE4 A;  3U4L P;  1CK3 A;  3M2J A;  5DJU A;  1ES3 A;  2PRF A;  5HPF A;  3HRE A;  3OPH A;  3E4P A;  1LL9 A;  1YQS A;  4GLQ A;  4CJN A;  1CEG A;  3S7N A;  4WL9 A;  1BLP A;  2XD5 A;  3O87 A;  2J7V A;  4K0X A;  3HLB A;  2J3T D;  3DW0 A;  5U47 A;  3UDF A;  1ACF A;  2HPB A;  5TFQ A;  1G6A A;  1K4F A;  3MJQ A;  4MN5 A;  1P9W A;  3S7O A;  1NLZ A;  1EWZ A;  5EE8 A;  2QHK A;  3LIE A;  3NHQ A;  3U2A A;  1STZ A;  2GDN A;  3KYZ A;  1XFN A;  1K54 A;  4BD1 A;  2H28 A;  5G18 A;  4HBT A;  1TS6 A;  2ACG A;  2V20 A;  3IBR A;  5HAQ A;  4R3J A;  5MC7 A; 
#chains in the Genus database with same CATH homology
 3CUE A;  2XSS A;  1S67 L;  1KOU A;  3H7W A;  3P7N A;  4JGQ A;  3UME A;  4ETZ A;  4O01 A;  4EEP A;  4LRY C;  2JKR I;  2P08 A;  3B42 A;  4CLC E;  2EWW A;  2EWV A;  3GEC A;  4K08 A;  4R6L A;  2VZW A;  3GDI A;  2PHY A;  2BAS A;  2KOI A;  4GJ4 A;  2JKT M;  2DMW A;  2ZBB A;  4BBV A;  3T4T A;  2QYB A;  3E0Y A;  5KIZ A;  1OTD A;  5DJT A;  2O9A A;  1XJ6 A;  1Y28 A;  3PR6 A;  3EGX C;  2P7J A;  4NXB A;  4GS9 B;  5EFW A;  5HD5 A;  4O8G A;  3MQO A;  2D02 A;  1OTI A;  4HJ6 A;  3O5Y A;  4BBU A;  4OOM A;  1YSP A;  1XJ2 A;  2OWH A;  2WKR A;  1F9I A;  5TBM B;  2VGL S;  1S66 L;  3IS2 B;  4EW7 A;  4HH3 A;  2KLI A;  4EUV A;  3C30 A;  4LRZ E;  2ZMV A;  2PYR A;  4HHD A;  3UMD A;  4UQI M;  3LR4 A;  3UB6 A;  1N9N A;  2Y8H A;  4LRX C;  3ZQ5 A;  5J3W A;  3NOU C;  3RH8 B;  4G3V A;  5HPI A;  1UWP X;  2PYP A;  3EEA A;  1MC0 A;  3UB9 A;  1OJG A;  1T19 A;  4Y3I A;  4I38 A;  4HH2 A;  1EW0 A;  3JVU A;  3UE3 A;  3BY8 A;  4CLC C;  4AFI A;  2J80 A;  2W3G A;  1IOU A;  1XJ3 A;  3FPW A;  3PBN A;  5HD3 A;  4L9F A;  3W2Z A;  5F68 A;  1WA9 A;  5HZH A;  5HSQ A;  3CI6 A;  5DKL A;  2JN7 A;  3PXP A;  1G28 A;  3UB8 A;  4XT2 B;  5HWW A;  1D06 A;  4CLC B;  2VEA A;  2PD8 A;  3RFB A;  2QWS A;  1VB6 A;  2JKT I;  4KQD A;  2FH5 A;  5LBR A;  2A24 B;  3OC2 A;  1NWZ A;  4WUJ A;  2Y79 A;  2W0N A;  4NEE D;  3F1P B;  3LIA A;  2MJ6 A;  2O99 A;  4DMZ A;  4MN6 A;  4IHQ A;  4Q0H A;  3LR0 A;  1H3Q A;  3E98 A;  1LSX A;  4HJ3 A;  3FC7 A;  2VKS A;  4M4X A;  3JVV A;  4R3A A;  3G6O A;  2PDR A;  3K3D A;  4GHI A;  3B47 A;  4PAU A;  5HWV A;  3KSF A;  4F3L B;  3KO6 A;  5J7E A;  3PBT A;  3NJA A;  4HIA A;  4B9O A;  4ARZ A;  1TF1 A;  2GNX A;  1TD5 A;  2P04 A;  1OTB A;  3E4Q A;  4P6Z S;  3LID A;  4IJG A;  5KSH A;  4BWI A;  3HCY A;  2OAQ 1;  3VOL A;  4DN0 A;  2OAP 1;  4I3I A;  3KSH A;  3LFV A;  1V9Y A;  3PBR A;  4I5S A;  3BW6 A;  2HJE A;  2FZ0 A;  5IU1 A;  4H6J B;  5FL3 A;  5HWT A;  3TJZ C;  4QPR A;  2L0W A;  1X0O A;  2J3W A;  4YOF A;  3PHY A;  3D3O A;  1NLY A;  2VV8 A;  3F1N B;  3KYQ A;  1F5M A;  4NXF A;  2V9A A;  2VLG A;  1UWN X;  3SW1 A;  3VV4 A;  3D72 A;  2KX6 A;  3H82 B;  1W63 M;  2LB9 A;  2PR6 A;  4G3W A;  1GSV A;  3R7W A;  3TW8 A;  2HF6 A;  2YKH A;  2A2L A;  2W1T B;  4MN7 A;  4B93 A;  5HDS A;  4PHT A;  3MQQ A;  3T4J A;  4NXE A;  1LSW A;  2XRN A;  3MF0 A;  1OJ5 A;  3LR5 A;  3RTY A;  3K2N A;  3UE6 A;  2OWJ A;  3OOV A;  2L4R A;  4JGO A;  4WF0 A;  3LIC A;  5F69 A;  4XT2 A;  5HDD A;  2V1B A;  4LLO B;  4HOI A;  4Q0I A;  2A24 A;  1LL8 A;  4YNR A;  1TS7 A;  5DKK A;  2VV6 A;  3F1P A;  3OCL A;  5IS1 A;  2HGV A;  2O0Y A;  4L9E A;  5I5L A;  2NUP C;  3T4Q A;  2W27 A;  1TS8 A;  3CLO A;  5K5B A;  2NUT C;  3H7W B;  3VE4 A;  4UEY A;  4HY8 A;  2IA2 A;  2W1R A;  2W3H A;  5HDC A;  2ZOI A;  3BJN A;  2B18 A;  4IUK A;  3NOT C;  4PKY A;  4EER A;  2VA0 A;  4G3K A;  4CLC D;  3LUQ A;  5DFX A;  2VX8 A;  3VE3 A;  4F3L A;  1S1Y A;  2K7S A;  3A0V A;  2I9V A;  3CWF A;  3NOP C;  2VV7 A;  4I39 A;  4EES A;  4KUK A;  3H9W A;  2K2N A;  1OTE A;  5HL6 A;  2M7U A;  1OT6 A;  4JGP A;  2PD7 A;  4HJ4 A;  3A0S A;  3B33 A;  4R38 A;  4BMW A;  5DF9 A;  2R78 A;  4H6J A;  2HV1 A;  3P01 A;  4NKP A;  4BJP A;  4WEL A;  4Q0J A;  3BY9 A;  1YKD A;  1JNU A;  2W3F A;  2W3E A;  3OLO A;  2K31 A;  2J3T C;  3EQV A;  3CAX A;  3IBJ A;  3S7P A;  3HJK A;  4I3J A;  4MCW A;  3LR3 A;  4MMN A;  1N9L A;  1ZHH B;  2VGL M;  4WEK A;  5G4Y A;  1TS0 A;  2W1T A;  1F98 A;  5F5Y A;  1OPX A;  5DFY A;  4GS9 A;  3MMH A;  3MXQ A;  3KSG A;  1G6O A;  4UQI S;  2WKP A;  3T4O A;  4FSF A;  4GW9 A;  3ZYT A;  2KDK A;  2PT7 A;  1IFQ A;  4HQA A;  5TBM A;  4E04 A;  3IS2 A;  1LSV A;  5A8B A;  3KX0 X;  4Y5F A;  2OOL A;  4EEU A;  4RQ9 A;  1N9O A;  3F1O B;  2QJ7 A;  1DP9 A;  1XJ4 A;  3FPV A;  3C38 A;  4BBT A;  4KUO A;  2G7U A;  4KQO A;  3PBS A;  2YKF A;  2LB5 A;  3E4O A;  3EGD C;  3LYX A;  3PBQ A;  3T4L A;  3OBF A;  2XRO A;  2PR5 A;  1DP6 A;  4WLA A;  3A0R A;  1GSW A;  2B02 A;  4L9G A;  4EU0 A;  2GJ3 A;  1ODV A;  4IUH A;  1XFQ A;  2Z6D A;  4GHI B;  1T1A A;  1DRM A;  1OTA A;  1T1B A;  2GZA A;  2QKP A;  3TE8 A;  2O9C A;  4DJ2 A;  4ARZ B;  4HI4 A;  4ME4 A;  4CLC A;  3CUE C;  3BQ8 A;  4MDZ A;  3V67 A;  3LI9 A;  4HP4 A;  2ZMF A;  1NRJ A;  1S1Z A;  1H8M A;  1GSX A;  4JGR A;  5F6A A;  3BWL A;  5CX7 A;  5J4E A;  3PBO A;  2INW A;  2XA7 M;  4GCZ A;  2ZOH A;  5IT5 A;  3MR0 A;  4HNB A;  2GX5 A;  3EWK A;  4P6Z M;  3T4K A;  4EET B;  5AJG A;  4WN5 A;  2W3D A;  2V0U A;  1YSQ A;  5G4Z A;  3MFX A;  3KSI A;  1S4S A;  1YAX A;  1V9Z A;  3R7W B;  4NXG A;  3LI8 A;  4ZRR A;  3K3C A;  3LIB A;  2L1M A;  3DBA A;  4YWZ A;  4I3A A;  4FOF A;  1BYW A;  1MZU A;  3ULF A;  2EA9 A;  4Y2F A;  1MKM A;  1P0Z A;  1T1C A;  3OCN A;  5DJU A;  4PKY G;  3T4S A;  1OT9 A;  4II7 A;  5HPF A;  3E4P A;  4EQ1 A;  2JKR M;  4GLQ A;  2D01 A;  4DJ3 A;  3S7N A;  4WL9 A;  4LPZ A;  5TJJ A;  3EQU A;  3CIT A;  1VHM A;  3F1O A;  3F1N A;  4L0L A;  3ICY A;  4R70 A;  2Z6C A;  1D7E A;  3R4K A;  5L8M A;  2VJW A;  3H82 A;  4OOL A;  1W63 Q;  2M7V A;  2J3T D;  3UB7 A;  2QJ5 A;  3EOI A;  3C2W A;  5AVF A;  3BQA A;  2O9B A;  2CMN A;  4O0P A;  1UGU A;  2WKQ A;  3MJQ A;  4MN5 A;  1P9W A;  4CQH A;  3MQ0 A;  3FG8 A;  3S7O A;  1ZTU A;  1NLZ A;  2JHE A;  4Z1W A;  2QHK A;  2XA7 S;  3LIE A;  5C5K A;  3T50 A;  3NHQ A;  3HJI A;  3U2A A;  2HJ9 C;  1STZ A;  3EEH A;  3KYZ A;  1XFN A;  2V1A A;  3LIF A;  2H28 A;  3TRC A;  3PYP A;  1TS6 A;  2M1C A;  1P9R A;  4WEJ A;  1P97 A;  4ETX A;  1T18 A;  3S7Q A;  1LT0 A;  3IBR A;  4HP9 A;  5AVE A;  2V0W A;  1S4R A;  1DP8 A;  3C8C A;  5MC7 A;  4EXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...