2JKTI

Ap2 clathrin adaptor core with cd4 dileucine peptide rm(phosphos) eikrllse q to e mutant
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
142
structure length
142
Chain Sequence
b'MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-2 COMPLEX SUBUNIT ALPHA-2
molecule tags Endocytosis
source organism Mus musculus
publication title A Structural Explanation for the Binding of Endocytic Dileucine Motifs by the Ap2 Complex.
pubmed doi rcsb
total genus 39
structure length 142
sequence length 142
chains with identical sequence S
ec nomenclature
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2jktI00
2XA7S 1NRJA 2HF6A 1W63M 4NEED 3TJZC 2JKRM 4P6ZS 2VGLM 4UQIM 1W63Q 2JKTI 2XA7M 2JKRI 5MC7A 4UQIS 2JKTM 4P6ZM 2FH5A 2VGLS
chains in the Genus database with same CATH superfamily
4LLOB 3TE8A 3GQZA 3TW8A 3U4LP 5EECA 1GSWA 4EESA 5CECA 2FFYA 4KZBA 2HJ9C 4FH2A 1YMXA 4JXGA 3C8CA 3VP4A 3LCEA 2PHYA 5EVIA 3G30A 5CGXA 4DE1A 1OJ5A 4II7A 4P87A 2Y2MA 4X69A 2C6WB 3V3RA 1BTLA 2HZ5A 3D9YA 1MZUA 1FCOA 4EUVA 1ONGA 2R9XA 3MFDA 5EVIB 5L8MA 3MS6A 4S2JA 2VGLS 3DTKA 2ZC5B 4PMAA 5EVEA 1MWUA 4LFUA 3C30A 1Y4OA 2HGVA 1FCNA 2ZQ7A 1T18A 2XDMA 4L9GA 5HDDA 2XK1A 3OPRA 4FUWA 2QKPA 2W3EA 2XA7M 3V67A 4Y0TA 5DFYA 2PU4A 4RX3A 1NYMA 4CLCD 3BECA 4K0XA 3M2JA 3MMHA 3VFFA 1PWCA 3MXQA 2BG1A 3LYXA 4RVAA 2ZBBA 4S2IA 2PYRA 2OLUA 4JBFA 2ZC6B 5HPFA 2QZ6A 3A0VA 1YLZA 4WEJA 3LICA 3N8RA 4OONA 3WRZA 1LI0A 4RA7A 4OQIA 3ZGAB 3ZVTA 5AQBA 1PZOA 3Q81A 1ZKJA 2J3WA 5HAQA 1OT6A 3G31A 1CF0A 3GECA 3PTEA 3HUNA 4L0LA 1H8ZA 2WGVA 3CLOA 1Y54A 4Y3IA 4PM8A 1NYYA 1BLCA 2DMWA 1K56D 1HTZA 1ZG6A 3PAGA 4PM5A 3GVBA 2E8IA 3DTEA 5JYPA 1XKZA 3CUEC 3G6OA 3EQUA 4QY5A 3S7PA 4GNUA 4N92A 4GLQA 1E3UA 5CHJA 4YWZA 2B18A 2W27A 1K54C 4BLMA 4KG6A 2H28A 1S1ZA 1BZAA 2IWDA 3KYQA 3PBNA 4P6ZS 5EE8A 1XA7A 2G2WA 1XJ6A 3P98A 2XLNA 5FI6A 1CJFA 3OOVA 4Y13A 2A3UA 4K08A 4LRXC 3VP1A 5L10A 3C4OA 2ZM2A 1LL8A 4BMWA 4C6YA 2WGWB 2EX6A 2MJ6A 2PAVP 4QY6A 4IUHA 2HPBA 1KE3A 4JXVA 4FH4A 2L0WA 4K0WA 2HV1A 1QMFA 3CG5A 1MXOA 2VV6A 1ZG4A 2ZC4B 3A3JA 3C7UA 3N8LA 2L4RA 4ZRRA 2A2LA 1PZPA 3NBLA 4R23A 3LR0A 3VFHA 3QHYA 3FV7A 1IOUA 3K3CA 4FSFA 2WKIA 1MWSA 1RGYA 3IXGA 1K54A 2I72A 2ZQ9A 2GJ3A 4KZ4A 1ES4A 3DTIA 4BD0A 2XD1A 1K4FA 4LV3A 3N6IA 1JNUA 4NXEA 2W3HA 4U0TA 1YSQA 4F3LA 3B42A 2XGNA 5HARA 3UMDA 2WKPA 1K38A 1M6KA 1HD8A 2XH9A 2PT7A 3KSGA 3T1SA 1GCEA 1NJ4A 1NXYA 1CEFA 1JVJA 5IT5A 1XGJA 5G4YA 4X56A 5J3WA 1O7EA 3BLSA 2LB5A 4GZBA 1E3UD 5EM0A 3LFVA 3G4PA 3F1OB 4OH0A 1Y28A 1H8YA 5G18A 3FPWA 3FC7A 3T4JA 3T4OA 2A24A 1DRMA 2ZMFA 4HESA 2P9VA 4ZAMA 1LT0A 4PKYA 4ZJ1A 2ZQ8A 2JE5A 4QU3A 4E3KA 4S2NC 1RCJA 3WWXA 5CRFA 3S7OA 4WYYA 1XGIA 4PKYG 1MPLA 2ZM0A 3T4QA 1U60A 1N9LA 4S2KA 1F2KA 2JHEA 4GDNA 3N8SA 5EVID 4E3IA 4OOMA 4BJPA 3OLOA 5JYOA 3HLBA 3UDIA 3NDGA 1K55A 3IS2A 3FPVA 2XEPA 3UPNA 1YLPA 4HBTA 4HP9A 3KYZA 4MNRA 1YAXA 3VE3A 4RYEA 4Y5FA 2V0WA 1K6RA 3LR4A 4GN2A 1SKOB 4GD8A 1XJ2A 3UB7A 1IEMA 5FDSA 4WZ5C 1E25A 1P9WA 4MN6A 2ZQCA 3LR5A 2G2UA 3HLCA 4ESPA 4GW9A 4QD4A 4UA9A 3V5MA 3ITAA 1N4OA 3RH8B 3QNBA 1IELA 4U0XA 2O9BA 4P85A 3EGDC 2Y79A 1G6OA 1JTDA 1OT9A 5FQQA 3WS2A 1W8YA 5AVFA 2XQZA 4HJ3A 4R4RA 5F1GA 4EV4A 1HLUP 2HJEA 1I5QA 3IWIA 1ERMA 4S2OA 3QNCA 2OSUA 4FTXA 1L0GA 5KIZA 2W1RA 2V8CA 3W2ZA 2EWWA 3ZYTA 5EVIC 4GJ4A 1LI9A 2PBYA 3LEZA 3LIEA 3PBSA 5EVLA 2Y2NA 3F1NA 3OCLA 2P08A 3MZFA 4DJ3A 2BASA 5KSHA 3F1OA 4HQAA 2R9WA 2JN7A 3O86A 3HLWA 5IU1A 3R7WA 2Y59A 4GDBA 1O07A 4QWOA 3E0YA 2WYXA 3HLDA 5HWVA 2GNXA 3NECA 1EI5A 2GDNA 3H7WB 1BYWA 1YM1A 2VV8A 4WN5A 5MC7A 1K56A 3WS5A 4E3LA 4D60A 3Q7VA 2FZ0A 4X53A 3GRJA 5CGSA 2NUTC 2UWXA 3QP6A 1M40A 3KYEA 3MQ0A 3LEQA 1OJGA 1BULA 2V2FF 2CMNA 4MBHA 2J9PA 1L0FA 5DKLA 1KE4A 5E43A 1CQAA 1SCWA 3NJAA 3TSGA 4HNBA 2Q0OA 1CK3A 3QP1A 1GSVA 3TJZC 4BBUA 2WKRA 5F5YA 2HDSA 4JF4A 2WADA 4LV1A 3HBRA 5A91A 2J3TC 3C4PA 2WKHA 3IF6C 4QHCA 3CZDA 5AJGA 4KZ5A 1K0KA 2P04A 2Y2QA 2RL3A 3RTYA 3LGOA 5A8BA 4E6XA 3NDEA 4DE0A 3SS5A 1L0DA 1EWZA 3MKFA 1EROA 4R3JA 1YLWA 2OLVA 3EGXC 1WYCA 1Q2PA 1TF1A 3LO7A 1ERQA 2Z2MB 4CJNA 4N9KA 2PDRA 4I3AA 2OV5A 3EEHA 2HP5A 2PD7A 4S2MA 4B93A 2ZL1B 3T4KA 4E3NA 3HLFA 2R78A 5HD3A 3IF5A 4EBPA 4ZDXA 2VLGA 4EETB 1ALQA 4R0QA 1BLPA 4I39A 1MY8A 4GHIA 4MLLA 3IF6A 5HW3A 3OCNA 3ZVWA 4O7DA 1LL5A 3VP2A 3T1QB 1FSYA 3WS0A 1KGEA 1Q2QA 5FA7A 3FG8A 2XA7S 3S22A 3P01A 5CHUA 4L9EA 1VQQA 2M7UA 3IF6B 4RX2A 3IBJA 4Q0JA 2V8FA 3HVFA 1K25A 2XFTA 4HHDA 2CC1A 3NHQA 3T50A 3ZHHA 1WE4A 3OPHA 2B95A 1ES2A 4Q0IA 1TS7A 3A0SA 5TJJA 1ES3A 1IKIA 3C5AA 1J3WA 3O88A 5U47A 3NOUC 3BEBA 4NXGA 4CLCE 3LI9A 4X1LA 3BFFA 2INWA 4X1MA 4NKPA 1FILA 4UHUA 3QP5A 2PRFA 4CLCB 2ZMVA 2O9CA 3UE1A 1OMEA 4NXBA 5F6AA 5TR7A 4Y0UA 4HY8A 5DJUA 4BL2A 5J7EA 1KGFA 5AQ7A 3PBQA 5HX9A 2YKFA 1VHMA 4E3OA 4GOGA 3D72A 3AGFA 5J4EA 3P7NA 4BBTA 5G4ZA 1CI9A 5F1FA 3M6BA 3B3XA 1XJ4A 2W3GA 4CPKA 1ESUA 3CITA 1OPXA 3DAVA 4OQGA 4DDSA 3BWLA 4OVDA 4MEZA 2EXBA 3VSKA 1NWZA 4IUKA 5EPHA 3V3SA 3MZEA 4JGOA 1P97A 1WYBA 2JKTM 1JWZA 3UDFA 2L1MA 3IX3A 1D1JA 4X68A 2ZQDA 3UY6A 1YMSA 3OBFA 1Z09A 4LGWA 3FWLA 5TGFA 5C5KA 3F1PA 2EWVA 4OQ0A 4P6BA 1XP4A 5HWWA 2Z6DA 3EQVA 1VB6A 2BTFP 1C3BA 3UN7A 4M4XA 1NLZA 5FQMA 2VEAA 2WAEA 1PW8A 2EX9A 3JYIA 5FI2A 1L3LA 4FCFA 5FL3A 4P6ZM 5KMWA 2EX8A 3MKEA 4X25A 1MC0A 4B4XA 5DF9A 4IEDA 2Y2KA 4OPRA 3WS1A 1VM1A 2QJ7A 1K57C 4BD1A 1YSPA 1PI4A 3SH9A 1WA9A 3CPTA 1J9MA 2JCHA 3A3EA 4Y2FA 3SOIA 1IYOA 3IHBA 3NIAA 4XUZA 2Y2JA 3BQ8A 2O9AA 1S1YA 1IYPA 1NZOA 3IXDA 4OKPA 2Y2IA 4IBXA 4NEED 4ZTKA 5DF8A 1BUEA 1FQGA 2UV0E 4HH2A 3GTCA 3BM6A 2W3FA 1ACFA 2XFSA 5L09A 3LIDA 3R4KA 1MWTA 3UB9A 3KO6A 3UE3A 3KSFA 5LBRA 4WLAA 2FFFB 2XROA 3FYZA 4X6TA 4EUZA 1X0OA 3BJNA 1TS6A 3ULFA 3ZG7B 2X71A 4R3BA 2W3DA 5AQ9A 4N9LA 2H5SA 3UPPA 4S2PA 1H5XA 5FQ9A 3V39A 2WZZA 4BENA 4EXOA 1EW0A 1W79A 2IWBA 1YPRA 3MXSA 3CMZA 3EEAA 2ZC3B 2XF3A 2KX6A 3E2LA 1FR1A 4IBRA 2JC7A 3ZDJA 1FIKA 1NZUA 4BL3A 1FOFA 4XUXA 5HFOA 3N7WA 1KE0A 2Z6CA 2EX2A 2X01A 2V0UA 1W7FA 2QWSA 4GS9A 2EXAA 3BFEA 4UQIS 1UGUA 4ZBEA 5CXWA 2GX5A 4E3JA 4GKUA 4KZ7A 2VJWA 4N1HA 4PPRA 3ZQ5A 4DE3A 2H10A 4O0PA 3L9KA 4ETZA 3LR3A 2YKHA 1E4DA 5AQAA 4UEYA 4E3MA 4R6LA 3T1RA 3CJMA 2PU2A 3HREA 1IKGA 1SDEA 1UWNX 3IXHA 3LIBA 3UNWA 4I3IA 5DTKA 2ZD8A 4LPZA 3HJKA 1VETB 5FAQA 3PBTA 1TEMA 4XT2A 1V9YA 3SH7A 5DKKA 1PW1A 3HUOA 1F5MA 2K31A 5TFQA 2VV7A 3CAXA 3JPUA 3MR0A 3C38A 5GLBA 2B02A 5DTTA 2H0TA 3IXBA 2QJ5A 4X55A 4LCMA 1SHVA 4A5RA 4CLCC 1A0KA 3IBRA 2J3TD 3EWKA 4LRZE 1P0ZA 2E8JA 1MBLA 1DJAA 4IVKA 5CTNA 1XFNA 2C5WB 2D02A 4UA7A 1AWIA 2PYPA 2VA0A 4B9OA 1W63M 3DTMA 3WS4A 4DXCA 2ZOHA 3HLEA 4MMNA 4E6WA 4YOFA 4GHIB 5E2GA 4Y0OA 3S7QA 5FASA 4ARZB 5FQKA 5TBMB 4DN0A 5AVEA 4JLFA 4P0MA 4JKTA 4H6JB 1MKIA 3LY3A 4GB7A 4Z9QA 2ZMAA 1H3QA 2HDUA 1T1BA 4OOLA 3S7NA 5GLCA 1NRFA 2W1TA 5E2HA 2Y4AA 2ZM8A 5DVAA 5FSRA 4DE2A 4QJGA 2HDQA 3UB8A 3PAEA 4WMCD 2M7VA 1YT4A 4HI4A 4HIAA 1OTDA 1KVMA 3JVUA 3G2YA 1K55C 5M18A 3IWQA 4H8RA 4Q8IA 1ESIA 1DY6A 4PM6A 4MBKA 1SKOA 4U3TA 5GLDA 5L07A 2ACGA 5IHVA 3T4TA 3LY4A 4WUJA 1VETA 3UB6A 4KQRA 5EM1A 4S2NA 4XT2B 2V1AA 4F3LB 4HBUA 5I94A 3F1NB 4M3KA 5FATA 2GZAA 2ZOIA 4EWFA 4F94A 2EFUA 1S66L 5DF7A 1XFQA 1PIOA 3H82B 5FQJA 3SS3A 1V9ZA 4DDYA 5CERA 4YFMA 2Q9NA 4LV0A 3HCYA 1K57A 4DJ2A 2HP9A 4KZ9A 5HPIA 5D3OA 2PR6A 2JKGA 3IH8A 2VX8A 3IX8A 1XJ3A 5HSQA 3W4OA 1LSXA 1RP5A 2EFXA 4JF6A 3N4IA 3GMWA 4DF6A 3DW0A 3H82A 3UMEA 1IFQA 5DFXA 2Y2OA 1SKFA 1CI8A 2WGWA 4UQIM 1PWGA 4EEUA 4R1GA 2VK3A 4R4SA 1S4RA 1SZVA 5CHMA 4OP5A 1GHIA 1G5UA 2AVXA 1BLHA 5HDSA 4LV2A 1BSGA 4IVIA 1XX2A 2DNSA 4PHTA 3LUQA 1YKDA 3QP8A 2JKRM 3KX0X 4LENA 1PYYA 4WMCA 2FH5A 2J7VA 2J9OA 1FCMA 1GA0A 3VP0A 4KZAA 5K5BA 4FOFA 3DWZA 3MFXA 3Q7VB 1QMEA 4HOIA 1G68A 3VV4A 3E2KA 3A3IA 3BFCA 4PM9A 4OLGA 1PFLA 3WRTA 3ZNYA 1GA9A 1HVBA 3BY8A 4KUKA 5IS1A 2KOIA 2JKFA 4EBNA 3E98A 5GHXA 3NI9A 2KLIA 4G3KA 3G34A 1K4EA 1SDNA 4EU0A 3IWOA 3MQQA 4WZ4A 3T1XA 3G35A 1KDSA 3IQAA 3ZG8B 3O5YA 3ZG0A 2HP6A 3W4PA 2ZJ9A 4Y15A 5EOEA 4JXSA 2VGJA 2WGIA 3IHAA 2XR0A 2OOLA 5EOOA 4KQQA 3S1YA 3CUEA 4C75A 5KSCA 3PYPA 2EA9A 4HJ6A 3TRCA 3GSGA 5F68A 2QPNA 4LRYC 3L7HA 4OPQA 5HWTA 1NLYA 4JGQA 1PRQA 1OTIA 4ZJ3A 1D06A 4HEFA 1Z6FA 3T12B 1KVLA 5GHZA 3LIAA 1STZA 2Y8HA 3IX4A 4ID4A 3MSHA 2Y2PA 3A0RA 3Q1FA 1PI5A 1H8MA 5EFWA 3G2ZA 3VMAA 3MZDA 3H7WA 4EQIA 3BY9A 3SW1A 1CEGA 3ZCZA 1LLBA 4OOYA 2WKEA 2ZQAA 3PBRA 1TS8A 4GCZA 4NETA 2VGKA 3U2AA 4UA6A 1OTAA 3MF0A 4EERA 2LB9A 4ZJ2A 3G32A 5CGWA 2V1BA 1I2WA 1K6SA 3NOPC 4C3QA 3ZNTA 4MN7A 4KUOA 3VP3A 3B47A 5FI7A 1MWRA 1FR6A 4UAAA 3IH9A 2JKTI 2QHKA 2XRNA 3OPLA 4K91A 2VGLM 4KZ8A 5HDCA 5J8XA 3CWFA 2VKSA 4S2LA 1JTGA 1XA1A 1W5DA 3ZG9B 2XSSA 4R38A 1ES5A 4NG2A 2V9AA 3NY4A 4IJGA 1YLTA 5F83A 4EEPA 1TS0A 5HAIA 1OTEA 4G3WA 2K2NA 3LI8A 3KSHA 3UE0A 3RJUA 4RQ9A 5FEGA 5FQIA 2OWJA 3RXXA 4ETXA 3VOYA 4FD8A 3ZG5A 4LCLA 1TD5A 3KSIA 5CEDA 3B33A 3MXRA 2QYBA 3FZCA 3UB5P 4PM7A 1XXMA 5FAPA 3AGDA 4HP4A 2HF6A 1TDLA 4JF5A 3JVVA 4I3JA 2PR5A 3RXWA 2W0NA 4MDZA 5GL9A 4EBLA 1LSVA 1S0WA 3M6HA 2OAP1 4KG5A 3IS2B 3HUMA 5HL6A 3F1PB 3O87A 5HD5A 4BBVA 5GLAA 4B88A 3O3VA 4WBGA 4JGPA 3A3FA 3T4SA 1JWVA 4KENB 4CQHA 2P74A 3Q7ZA 3V50A 5A93A 2WAFA 1W8QA 2H0YA 2ZC7A 5E2EA 1DP9A 4I5SA 2QMIA 1F98A 2M1CA 4R3AA 2I9VA 1PWDA 4WF0A 3TG9A 5FDHA 3NULA 4KQOA 2WKQA 4NK3A 1S6RA 3SH8A 4HJ4A 5M19A 2JBFA 5FEFA 4WL9A 2NUPC 4Z1WA 2PBDP 3DWKA 3K2NA 1TDGA 5KZHA 4IHQA 4YNRA 1S67L 1W63Q 3PBOA 5F82A 1OTBA 2Y2GA 1GSXA 2IA2A 3GR2A 1S4SA 4KQDA 5CEBA 3MBZA 1BLSA 1BT5A 3BFGA 2Y55A 4KG2A 1YQSA 3S4XA 4JGRA 3BLMA 1DP6A 2ZL1A 3OPPA 3M2KA 1N9BA 4L9FA 5A92A 3NCKA 2G7UA 4Q0HA 4OLDA 2WUQA 3BRMA 3Q07A 3ITBA 4WM9A 5CTMA 3AGEA 2OAQ1 3TOIA 4JPMA 1ONHA 3VE4A 4EW7A 1ODVA 3E4QA 2PD8A 4E04A 2P7JA 3UO9A 2RCXA 4O8GA 2P9VB 3W4QA 1L2SA 5EUAA 2DRWA 4B4ZA 5DJTA 4OP8A 2D01A 2J80A 1P9RA 2Y2HA 2ZLYA 4QB8A 1ZC2A 2K7SA 2BLSA 4ME4A 4GD6A 4BWIA 2V20A 3R7WB 3SZTA 1G6AA 5M1AA 4H6JA 1I2SA 1T19A 4OPZA 4Y17A 1UWPX 1KOUA 3QP4A 3Q82A 2XD5A 3VOZA 4NXFA 1IYQA 3OC2A 3CHWP 1FSWA 4O01A 2Z2LB 2WZXA 1T1CA 4N1XA 1IYSA 3D3OA 2B5RA 3BQAA 2VZWA 5I5LA 5DTSA 3D4FA 2WK0A 5L2FA 4OQHA 3MQOA 4BQMA 1HZOA 1KDWA 3H9WA 2A49A 3CPTB 3ICYA 3CI6A 3DBAA 3BYDA 2KDKA 3LIFA 2HDRA 4KZ3A 3PHYA 5A90A 4WEKA 1G28A 3HLGA 3PR6A 3BW6A 3MJQA 3A3DA 3ZFZA 1DJBA 3FKWA 5BOHA 4YINA 3OZHA 1L0EA 4MCWA 1LL9A 4EQ1A 2O0YA 2A24B 5FAOA 1RGZA 5E2FA 3UDXA 1ZTUA 5CX7A 1XPBA 3VOLA 3E4PA 4MBFA 1F9IA 1LHYA 1T1AA 4Y7PA 3I7JA 4WELA 1H0MA 1LSWA 3VSLA 1AXBA 3EOIA 3BFDA 1NY0A 3K3DA 5TBMA 4I38A 4DRTA 4JXWA 2Y91A 3GV9A 5HZHA 2OWHA 3SS4A 3P09A 4PAUA 4KZ6A 5GHYA 4DXBA 3GDIA 4WZ5A 3T4LA 1TVFA 2W1TB 1ZHHB 1DP8A 4D2OA 5F69A 5HL1A 1N9OA 1JWPA 2JKRI 3HL9A 4OPYA 2DCFA 2IWCA 1YLJA 3FKVA 1D7EA 1VEUB 2Q9MA 4R70A 4QPRA 1GHPA 3W8KA 2X02A 3C2WA 4CLCA 4ARZA 4DKIA 3E4OA 3PXPA 4AFIA 2J8YA 1PNEA 1KGGA 3ISGA 4DMZA 2V1ZA 4GS9B 3IT9A 1NRJA 3HJIA 1MKMA 3RFBA 1VEUA 4HH3A 3UPOA 3QP2A 2Y2LA 3C7VA 2O99A 3NC8A 1YLYA 4G3VA 5HAPA 1GHMA 1N9NA 5EV0A 4MN5A 3NOTC 4XXRA 3UE6A 1DJCA
chains in the Genus database with same CATH topology
2P08A 4MN7A 4DJ3A 2BASA 4KUOA 4LLOB 5KSHA 3TE8A 3F1OA 4HQAA 3TW8A 2JN7A 2KX6A 3B47A 1GSWA 4EESA 2JKTI 2QHKA 5IU1A 2XRNA 2HJ9C 2VGLM 5HDCA 3R7WA 3C8CA 3CWFA 3E0YA 2VKSA 2PHYA 5HWVA 2GNXA 2XSSA 4R38A 2Z6CA 2V9AA 1OJ5A 4II7A 3H7WB 1BYWA 2V0UA 4IJGA 2QWSA 2VV8A 4GS9A 4EEPA 1TS0A 4WN5A 5MC7A 4UQIS 1OTEA 1UGUA 4G3WA 2K2NA 3LI8A 1MZUA 2GX5A 3KSHA 2FZ0A 4EUVA 2NUTC 2VJWA 4RQ9A 3ZQ5A 5L8MA 4O0PA 2OWJA 2VGLS 4ETZA 3LR3A 4ETXA 2YKHA 3MQ0A 4UEYA 4R6LA 1OJGA 2CMNA 1TD5A 3C30A 3KSIA 2HGVA 1UWNX 1T18A 4L9GA 3B33A 5DKLA 3LIBA 5HDDA 2QYBA 4I3IA 3NJAA 4HP4A 2HF6A 4HNBA 2QKPA 4LPZA 2W3EA 3JVVA 3HJKA 2XA7M 4I3JA 2PR5A 3V67A 1GSVA 3TJZC 4BBUA 2WKRA 5F5YA 3PBTA 2W0NA 4MDZA 4XT2A 5DFYA 1V9YA 2J3TC 5DKKA 1LSVA 4CLCD 2OAP1 1F5MA 5AJGA 2K31A 3IS2B 2P04A 2VV7A 3CAXA 3MR0A 3RTYA 3C38A 5A8BA 5HL6A 3F1PB 3MMHA 2B02A 5HD5A 4BBVA 3MXQA 2QJ5A 4CLCC 3LYXA 3IBRA 2J3TD 3EWKA 4LRZE 2ZBBA 4JGPA 3EGXC 2PYRA 1P0ZA 5HPFA 3T4SA 3A0VA 4CQHA 1TF1A 4WEJA 3LICA 1XFNA 2D02A 2PDRA 4I3AA 2PYPA 2VA0A 3EEHA 4B9OA 1W63M 2PD7A 4B93A 2ZOHA 1DP9A 4I5SA 4MMNA 3T4KA 4YOFA 1F98A 2J3WA 4GHIB 1OT6A 2R78A 2M1CA 5HD3A 3S7QA 3GECA 4R3AA 2I9VA 4WF0A 4ARZB 2VLGA 4EETB 5TBMB 4DN0A 5AVEA 4L0LA 4KQOA 2WKQA 4I39A 4GHIA 4H6JB 3CLOA 4Y3IA 4HJ4A 3OCNA 1H3QA 2DMWA 4WL9A 1T1BA 2NUPC 4OOLA 4Z1WA 3S7NA 3K2NA 4IHQA 4YNRA 2W1TA 1S67L 1W63Q 3PBOA 1OTBA 1GSXA 2IA2A 3CUEC 3FG8A 2XA7S 3G6OA 3EQUA 3P01A 3S7PA 1S4SA 4KQDA 4L9EA 2M7UA 3UB8A 3IBJA 4GLQA 4Q0JA 2M7VA 4HHDA 4HI4A 4HIAA 4JGRA 4YWZA 2B18A 2W27A 1OTDA 3NHQA 3T50A 3JVUA 1DP6A 2H28A 1S1ZA 4L9FA 3KYQA 3PBNA 4P6ZS 2G7UA 4Q0HA 1XJ6A 4Q0IA 1TS7A 3A0SA 5TJJA 3OOVA 4K08A 4LRXC 2OAQ1 1LL8A 3VE4A 4BMWA 3T4TA 4EW7A 1ODVA 3NOUC 3E4QA 2PD8A 4WUJA 4E04A 3UB6A 4NXGA 2MJ6A 2P7JA 4IUHA 4CLCE 4XT2B 4O8GA 3LI9A 2V1AA 4F3LB 2INWA 3F1NB 4NKPA 2L0WA 2HV1A 2GZAA 2ZOIA 2VV6A 4CLCB 2ZMVA 1S66L 2O9CA 2L4RA 4ZRRA 5DJTA 2A2LA 1XFQA 4NXBA 2D01A 2J80A 5F6AA 1P9RA 3H82B 1V9ZA 3LR0A 2K7SA 4HY8A 5DJUA 3HCYA 4ME4A 4DJ2A 5HPIA 4BWIA 3R7WB 5J7EA 2PR6A 1IOUA 3K3CA 3PBQA 2VX8A 4FSFA 1XJ3A 5HSQA 2YKFA 4H6JA 1LSXA 1VHMA 1T19A 3D72A 1UWPX 1KOUA 5J4EA 2GJ3A 3P7NA 4BBTA 3H82A 5G4ZA 3UMEA 1IFQA 5DFXA 4NXFA 3OC2A 4UQIM 4O01A 4EEUA 1XJ4A 1JNUA 2W3GA 1T1CA 4NXEA 2W3HA 3CITA 1OPXA 3D3OA 1S4RA 1YSQA 4F3LA 3B42A 3BQAA 2VZWA 5I5LA 3UMDA 2WKPA 2PT7A 3KSGA 3BWLA 3MQOA 5HDSA 1NWZA 4PHTA 4IUKA 5IT5A 3LUQA 3H9WA 1YKDA 5G4YA 2JKRM 5J3WA 4JGOA 3ICYA 2LB5A 3KX0X 1P97A 3CI6A 3DBAA 2JKTM 2FH5A 2KDKA 3LIFA 2L1MA 3LFVA 3PHYA 5K5BA 4WEKA 1G28A 3F1OB 3PR6A 3MFXA 4FOFA 1Y28A 3OBFA 3FPWA 3FC7A 3BW6A 3MJQA 4HOIA 3T4JA 3T4OA 2A24A 3VV4A 5C5KA 3F1PA 2EWVA 1DRMA 2ZMFA 5HWWA 2Z6DA 1LT0A 3EQVA 1VB6A 4PKYA 4M4XA 1NLZA 2VEAA 3BY8A 4MCWA 4KUKA 5IS1A 2KOIA 4EQ1A 3S7OA 2O0YA 3E98A 2A24B 5FL3A 2KLIA 4P6ZM 4G3KA 4PKYG 4EU0A 3MQQA 3T4QA 1ZTUA 1N9LA 1MC0A 5CX7A 2JHEA 3VOLA 5DF9A 3E4PA 1F9IA 2QJ7A 1T1AA 4OOMA 1YSPA 4BJPA 3OLOA 3O5YA 4WELA 1WA9A 1LSWA 3IS2A 3FPVA 3EOIA 3K3DA 5TBMA 4Y2FA 4HP9A 4I38A 3KYZA 1YAXA 3VE3A 5HZHA 4Y5FA 2OWHA 3BQ8A 2OOLA 2O9AA 2V0WA 1S1YA 3CUEA 4PAUA 3LR4A 3PYPA 3GDIA 4NEED 2EA9A 1XJ2A 3UB7A 4HJ6A 3T4LA 3TRCA 4HH2A 2W1TB 5F68A 1ZHHB 1DP8A 4LRYC 5HWTA 5F69A 2W3FA 1N9OA 1NLYA 1P9WA 2JKRI 4JGQA 4MN6A 3LR5A 4GW9A 3LIDA 1OTIA 3R4KA 1D06A 1D7EA 3RH8B 3UB9A 4R70A 3KO6A 4QPRA 3UE3A 3KSFA 5LBRA 3LIAA 2O9BA 3C2WA 3EGDC 4CLCA 1STZA 2Y79A 4WLAA 2XROA 2Y8HA 4ARZA 1G6OA 3A0RA 3E4OA 1OT9A 3PXPA 4AFIA 1H8MA 1X0OA 5EFWA 5AVFA 3BJNA 3H7WA 4HJ3A 1TS6A 3BY9A 4DMZA 3SW1A 3ULFA 4GS9B 1NRJA 2HJEA 3HJIA 1MKMA 2W3DA 3PBRA 3RFBA 4HH3A 1TS8A 4GCZA 3U2AA 2O99A 1OTAA 5KIZA 2W1RA 3MF0A 4EERA 4EXOA 4G3VA 3W2ZA 2EWWA 3ZYTA 1N9NA 2LB9A 4GJ4A 4MN5A 1EW0A 2V1BA 3NOTC 3LIEA 3PBSA 3UE6A 3NOPC 3F1NA 3EEAA 3OCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XA7 S;  1NRJ A;  2HF6 A;  1W63 M;  4NEE D;  3TJZ C;  2JKR M;  4P6Z S;  2VGL M;  4UQI M;  1W63 Q;  2JKT I;  2XA7 M;  2JKR I;  5MC7 A;  4UQI S;  2JKT M;  4P6Z M;  2FH5 A;  2VGL S; 
#chains in the Genus database with same CATH topology
 4LLO B;  3TE8 A;  3GQZ A;  3TW8 A;  3U4L P;  5EEC A;  1GSW A;  4EES A;  5CEC A;  2FFY A;  4KZB A;  2HJ9 C;  4FH2 A;  1YMX A;  4JXG A;  3C8C A;  3VP4 A;  3LCE A;  2PHY A;  5EVI A;  3G30 A;  5CGX A;  4DE1 A;  1OJ5 A;  4II7 A;  4P87 A;  2Y2M A;  4X69 A;  2C6W B;  3V3R A;  1BTL A;  2HZ5 A;  3D9Y A;  1MZU A;  1FCO A;  4EUV A;  1ONG A;  2R9X A;  3MFD A;  5EVI B;  5L8M A;  3MS6 A;  4S2J A;  2VGL S;  3DTK A;  2ZC5 B;  4PMA A;  5EVE A;  1MWU A;  4LFU A;  3C30 A;  1Y4O A;  2HGV A;  1FCN A;  2ZQ7 A;  1T18 A;  2XDM A;  4L9G A;  5HDD A;  2XK1 A;  3OPR A;  4FUW A;  2QKP A;  2W3E A;  2XA7 M;  3V67 A;  4Y0T A;  5DFY A;  2PU4 A;  4RX3 A;  1NYM A;  4CLC D;  3BEC A;  4K0X A;  3M2J A;  3MMH A;  3VFF A;  1PWC A;  3MXQ A;  2BG1 A;  3LYX A;  4RVA A;  2ZBB A;  4S2I A;  2PYR A;  2OLU A;  4JBF A;  2ZC6 B;  5HPF A;  2QZ6 A;  3A0V A;  1YLZ A;  4WEJ A;  3LIC A;  3N8R A;  4OON A;  3WRZ A;  1LI0 A;  4RA7 A;  4OQI A;  3ZGA B;  3ZVT A;  5AQB A;  1PZO A;  3Q81 A;  1ZKJ A;  2J3W A;  5HAQ A;  1OT6 A;  3G31 A;  1CF0 A;  3GEC A;  3PTE A;  3HUN A;  4L0L A;  1H8Z A;  2WGV A;  3CLO A;  1Y54 A;  4Y3I A;  4PM8 A;  1NYY A;  1BLC A;  2DMW A;  1K56 D;  1HTZ A;  1ZG6 A;  3PAG A;  4PM5 A;  3GVB A;  2E8I A;  3DTE A;  5JYP A;  1XKZ A;  3CUE C;  3G6O A;  3EQU A;  4QY5 A;  3S7P A;  4GNU A;  4N92 A;  4GLQ A;  1E3U A;  5CHJ A;  4YWZ A;  2B18 A;  2W27 A;  1K54 C;  4BLM A;  4KG6 A;  2H28 A;  1S1Z A;  1BZA A;  2IWD A;  3KYQ A;  3PBN A;  4P6Z S;  5EE8 A;  1XA7 A;  2G2W A;  1XJ6 A;  3P98 A;  2XLN A;  5FI6 A;  1CJF A;  3OOV A;  4Y13 A;  2A3U A;  4K08 A;  4LRX C;  3VP1 A;  5L10 A;  3C4O A;  2ZM2 A;  1LL8 A;  4BMW A;  4C6Y A;  2WGW B;  2EX6 A;  2MJ6 A;  2PAV P;  4QY6 A;  4IUH A;  2HPB A;  1KE3 A;  4JXV A;  4FH4 A;  2L0W A;  4K0W A;  2HV1 A;  1QMF A;  3CG5 A;  1MXO A;  2VV6 A;  1ZG4 A;  2ZC4 B;  3A3J A;  3C7U A;  3N8L A;  2L4R A;  4ZRR A;  2A2L A;  1PZP A;  3NBL A;  4R23 A;  3LR0 A;  3VFH A;  3QHY A;  3FV7 A;  1IOU A;  3K3C A;  4FSF A;  2WKI A;  1MWS A;  1RGY A;  3IXG A;  1K54 A;  2I72 A;  2ZQ9 A;  2GJ3 A;  4KZ4 A;  1ES4 A;  3DTI A;  4BD0 A;  2XD1 A;  1K4F A;  4LV3 A;  3N6I A;  1JNU A;  4NXE A;  2W3H A;  4U0T A;  1YSQ A;  4F3L A;  3B42 A;  2XGN A;  5HAR A;  3UMD A;  2WKP A;  1K38 A;  1M6K A;  1HD8 A;  2XH9 A;  2PT7 A;  3KSG A;  3T1S A;  1GCE A;  1NJ4 A;  1NXY A;  1CEF A;  1JVJ A;  5IT5 A;  1XGJ A;  5G4Y A;  4X56 A;  5J3W A;  1O7E A;  3BLS A;  2LB5 A;  4GZB A;  1E3U D;  5EM0 A;  3LFV A;  3G4P A;  3F1O B;  4OH0 A;  1Y28 A;  1H8Y A;  5G18 A;  3FPW A;  3FC7 A;  3T4J A;  3T4O A;  2A24 A;  1DRM A;  2ZMF A;  4HES A;  2P9V A;  4ZAM A;  1LT0 A;  4PKY A;  4ZJ1 A;  2ZQ8 A;  2JE5 A;  4QU3 A;  4E3K A;  4S2N C;  1RCJ A;  3WWX A;  5CRF A;  3S7O A;  4WYY A;  1XGI A;  4PKY G;  1MPL A;  2ZM0 A;  3T4Q A;  1U60 A;  1N9L A;  4S2K A;  1F2K A;  2JHE A;  4GDN A;  3N8S A;  5EVI D;  4E3I A;  4OOM A;  4BJP A;  3OLO A;  5JYO A;  3HLB A;  3UDI A;  3NDG A;  1K55 A;  3IS2 A;  3FPV A;  2XEP A;  3UPN A;  1YLP A;  4HBT A;  4HP9 A;  3KYZ A;  4MNR A;  1YAX A;  3VE3 A;  4RYE A;  4Y5F A;  2V0W A;  1K6R A;  3LR4 A;  4GN2 A;  1SKO B;  4GD8 A;  1XJ2 A;  3UB7 A;  1IEM A;  5FDS A;  4WZ5 C;  1E25 A;  1P9W A;  4MN6 A;  2ZQC A;  3LR5 A;  2G2U A;  3HLC A;  4ESP A;  4GW9 A;  4QD4 A;  4UA9 A;  3V5M A;  3ITA A;  1N4O A;  3RH8 B;  3QNB A;  1IEL A;  4U0X A;  2O9B A;  4P85 A;  3EGD C;  2Y79 A;  1G6O A;  1JTD A;  1OT9 A;  5FQQ A;  3WS2 A;  1W8Y A;  5AVF A;  2XQZ A;  4HJ3 A;  4R4R A;  5F1G A;  4EV4 A;  1HLU P;  2HJE A;  1I5Q A;  3IWI A;  1ERM A;  4S2O A;  3QNC A;  2OSU A;  4FTX A;  1L0G A;  5KIZ A;  2W1R A;  2V8C A;  3W2Z A;  2EWW A;  3ZYT A;  5EVI C;  4GJ4 A;  1LI9 A;  2PBY A;  3LEZ A;  3LIE A;  3PBS A;  5EVL A;  2Y2N A;  3F1N A;  3OCL A;  2P08 A;  3MZF A;  4DJ3 A;  2BAS A;  5KSH A;  3F1O A;  4HQA A;  2R9W A;  2JN7 A;  3O86 A;  3HLW A;  5IU1 A;  3R7W A;  2Y59 A;  4GDB A;  1O07 A;  4QWO A;  3E0Y A;  2WYX A;  3HLD A;  5HWV A;  2GNX A;  3NEC A;  1EI5 A;  2GDN A;  3H7W B;  1BYW A;  1YM1 A;  2VV8 A;  4WN5 A;  5MC7 A;  1K56 A;  3WS5 A;  4E3L A;  4D60 A;  3Q7V A;  2FZ0 A;  4X53 A;  3GRJ A;  5CGS A;  2NUT C;  2UWX A;  3QP6 A;  1M40 A;  3KYE A;  3MQ0 A;  3LEQ A;  1OJG A;  1BUL A;  2V2F F;  2CMN A;  4MBH A;  2J9P A;  1L0F A;  5DKL A;  1KE4 A;  5E43 A;  1CQA A;  1SCW A;  3NJA A;  3TSG A;  4HNB A;  2Q0O A;  1CK3 A;  3QP1 A;  1GSV A;  3TJZ C;  4BBU A;  2WKR A;  5F5Y A;  2HDS A;  4JF4 A;  2WAD A;  4LV1 A;  3HBR A;  5A91 A;  2J3T C;  3C4P A;  2WKH A;  3IF6 C;  4QHC A;  3CZD A;  5AJG A;  4KZ5 A;  1K0K A;  2P04 A;  2Y2Q A;  2RL3 A;  3RTY A;  3LGO A;  5A8B A;  4E6X A;  3NDE A;  4DE0 A;  3SS5 A;  1L0D A;  1EWZ A;  3MKF A;  1ERO A;  4R3J A;  1YLW A;  2OLV A;  3EGX C;  1WYC A;  1Q2P A;  1TF1 A;  3LO7 A;  1ERQ A;  2Z2M B;  4CJN A;  4N9K A;  2PDR A;  4I3A A;  2OV5 A;  3EEH A;  2HP5 A;  2PD7 A;  4S2M A;  4B93 A;  2ZL1 B;  3T4K A;  4E3N A;  3HLF A;  2R78 A;  5HD3 A;  3IF5 A;  4EBP A;  4ZDX A;  2VLG A;  4EET B;  1ALQ A;  4R0Q A;  1BLP A;  4I39 A;  1MY8 A;  4GHI A;  4MLL A;  3IF6 A;  5HW3 A;  3OCN A;  3ZVW A;  4O7D A;  1LL5 A;  3VP2 A;  3T1Q B;  1FSY A;  3WS0 A;  1KGE A;  1Q2Q A;  5FA7 A;  3FG8 A;  2XA7 S;  3S22 A;  3P01 A;  5CHU A;  4L9E A;  1VQQ A;  2M7U A;  3IF6 B;  4RX2 A;  3IBJ A;  4Q0J A;  2V8F A;  3HVF A;  1K25 A;  2XFT A;  4HHD A;  2CC1 A;  3NHQ A;  3T50 A;  3ZHH A;  1WE4 A;  3OPH A;  2B95 A;  1ES2 A;  4Q0I A;  1TS7 A;  3A0S A;  5TJJ A;  1ES3 A;  1IKI A;  3C5A A;  1J3W A;  3O88 A;  5U47 A;  3NOU C;  3BEB A;  4NXG A;  4CLC E;  3LI9 A;  4X1L A;  3BFF A;  2INW A;  4X1M A;  4NKP A;  1FIL A;  4UHU A;  3QP5 A;  2PRF A;  4CLC B;  2ZMV A;  2O9C A;  3UE1 A;  1OME A;  4NXB A;  5F6A A;  5TR7 A;  4Y0U A;  4HY8 A;  5DJU A;  4BL2 A;  5J7E A;  1KGF A;  5AQ7 A;  3PBQ A;  5HX9 A;  2YKF A;  1VHM A;  4E3O A;  4GOG A;  3D72 A;  3AGF A;  5J4E A;  3P7N A;  4BBT A;  5G4Z A;  1CI9 A;  5F1F A;  3M6B A;  3B3X A;  1XJ4 A;  2W3G A;  4CPK A;  1ESU A;  3CIT A;  1OPX A;  3DAV A;  4OQG A;  4DDS A;  3BWL A;  4OVD A;  4MEZ A;  2EXB A;  3VSK A;  1NWZ A;  4IUK A;  5EPH A;  3V3S A;  3MZE A;  4JGO A;  1P97 A;  1WYB A;  2JKT M;  1JWZ A;  3UDF A;  2L1M A;  3IX3 A;  1D1J A;  4X68 A;  2ZQD A;  3UY6 A;  1YMS A;  3OBF A;  1Z09 A;  4LGW A;  3FWL A;  5TGF A;  5C5K A;  3F1P A;  2EWV A;  4OQ0 A;  4P6B A;  1XP4 A;  5HWW A;  2Z6D A;  3EQV A;  1VB6 A;  2BTF P;  1C3B A;  3UN7 A;  4M4X A;  1NLZ A;  5FQM A;  2VEA A;  2WAE A;  1PW8 A;  2EX9 A;  3JYI A;  5FI2 A;  1L3L A;  4FCF A;  5FL3 A;  4P6Z M;  5KMW A;  2EX8 A;  3MKE A;  4X25 A;  1MC0 A;  4B4X A;  5DF9 A;  4IED A;  2Y2K A;  4OPR A;  3WS1 A;  1VM1 A;  2QJ7 A;  1K57 C;  4BD1 A;  1YSP A;  1PI4 A;  3SH9 A;  1WA9 A;  3CPT A;  1J9M A;  2JCH A;  3A3E A;  4Y2F A;  3SOI A;  1IYO A;  3IHB A;  3NIA A;  4XUZ A;  2Y2J A;  3BQ8 A;  2O9A A;  1S1Y A;  1IYP A;  1NZO A;  3IXD A;  4OKP A;  2Y2I A;  4IBX A;  4NEE D;  4ZTK A;  5DF8 A;  1BUE A;  1FQG A;  2UV0 E;  4HH2 A;  3GTC A;  3BM6 A;  2W3F A;  1ACF A;  2XFS A;  5L09 A;  3LID A;  3R4K A;  1MWT A;  3UB9 A;  3KO6 A;  3UE3 A;  3KSF A;  5LBR A;  4WLA A;  2FFF B;  2XRO A;  3FYZ A;  4X6T A;  4EUZ A;  1X0O A;  3BJN A;  1TS6 A;  3ULF A;  3ZG7 B;  2X71 A;  4R3B A;  2W3D A;  5AQ9 A;  4N9L A;  2H5S A;  3UPP A;  4S2P A;  1H5X A;  5FQ9 A;  3V39 A;  2WZZ A;  4BEN A;  4EXO A;  1EW0 A;  1W79 A;  2IWB A;  1YPR A;  3MXS A;  3CMZ A;  3EEA A;  2ZC3 B;  2XF3 A;  2KX6 A;  3E2L A;  1FR1 A;  4IBR A;  2JC7 A;  3ZDJ A;  1FIK A;  1NZU A;  4BL3 A;  1FOF A;  4XUX A;  5HFO A;  3N7W A;  1KE0 A;  2Z6C A;  2EX2 A;  2X01 A;  2V0U A;  1W7F A;  2QWS A;  4GS9 A;  2EXA A;  3BFE A;  4UQI S;  1UGU A;  4ZBE A;  5CXW A;  2GX5 A;  4E3J A;  4GKU A;  4KZ7 A;  2VJW A;  4N1H A;  4PPR A;  3ZQ5 A;  4DE3 A;  2H10 A;  4O0P A;  3L9K A;  4ETZ A;  3LR3 A;  2YKH A;  1E4D A;  5AQA A;  4UEY A;  4E3M A;  4R6L A;  3T1R A;  3CJM A;  2PU2 A;  3HRE A;  1IKG A;  1SDE A;  1UWN X;  3IXH A;  3LIB A;  3UNW A;  4I3I A;  5DTK A;  2ZD8 A;  4LPZ A;  3HJK A;  1VET B;  5FAQ A;  3PBT A;  1TEM A;  4XT2 A;  1V9Y A;  3SH7 A;  5DKK A;  1PW1 A;  3HUO A;  1F5M A;  2K31 A;  5TFQ A;  2VV7 A;  3CAX A;  3JPU A;  3MR0 A;  3C38 A;  5GLB A;  2B02 A;  5DTT A;  2H0T A;  3IXB A;  2QJ5 A;  4X55 A;  4LCM A;  1SHV A;  4A5R A;  4CLC C;  1A0K A;  3IBR A;  2J3T D;  3EWK A;  4LRZ E;  1P0Z A;  2E8J A;  1MBL A;  1DJA A;  4IVK A;  5CTN A;  1XFN A;  2C5W B;  2D02 A;  4UA7 A;  1AWI A;  2PYP A;  2VA0 A;  4B9O A;  1W63 M;  3DTM A;  3WS4 A;  4DXC A;  2ZOH A;  3HLE A;  4MMN A;  4E6W A;  4YOF A;  4GHI B;  5E2G A;  4Y0O A;  3S7Q A;  5FAS A;  4ARZ B;  5FQK A;  5TBM B;  4DN0 A;  5AVE A;  4JLF A;  4P0M A;  4JKT A;  4H6J B;  1MKI A;  3LY3 A;  4GB7 A;  4Z9Q A;  2ZMA A;  1H3Q A;  2HDU A;  1T1B A;  4OOL A;  3S7N A;  5GLC A;  1NRF A;  2W1T A;  5E2H A;  2Y4A A;  2ZM8 A;  5DVA A;  5FSR A;  4DE2 A;  4QJG A;  2HDQ A;  3UB8 A;  3PAE A;  4WMC D;  2M7V A;  1YT4 A;  4HI4 A;  4HIA A;  1OTD A;  1KVM A;  3JVU A;  3G2Y A;  1K55 C;  5M18 A;  3IWQ A;  4H8R A;  4Q8I A;  1ESI A;  1DY6 A;  4PM6 A;  4MBK A;  1SKO A;  4U3T A;  5GLD A;  5L07 A;  2ACG A;  5IHV A;  3T4T A;  3LY4 A;  4WUJ A;  1VET A;  3UB6 A;  4KQR A;  5EM1 A;  4S2N A;  4XT2 B;  2V1A A;  4F3L B;  4HBU A;  5I94 A;  3F1N B;  4M3K A;  5FAT A;  2GZA A;  2ZOI A;  4EWF A;  4F94 A;  2EFU A;  1S66 L;  5DF7 A;  1XFQ A;  1PIO A;  3H82 B;  5FQJ A;  3SS3 A;  1V9Z A;  4DDY A;  5CER A;  4YFM A;  2Q9N A;  4LV0 A;  3HCY A;  1K57 A;  4DJ2 A;  2HP9 A;  4KZ9 A;  5HPI A;  5D3O A;  2PR6 A;  2JKG A;  3IH8 A;  2VX8 A;  3IX8 A;  1XJ3 A;  5HSQ A;  3W4O A;  1LSX A;  1RP5 A;  2EFX A;  4JF6 A;  3N4I A;  3GMW A;  4DF6 A;  3DW0 A;  3H82 A;  3UME A;  1IFQ A;  5DFX A;  2Y2O A;  1SKF A;  1CI8 A;  2WGW A;  4UQI M;  1PWG A;  4EEU A;  4R1G A;  2VK3 A;  4R4S A;  1S4R A;  1SZV A;  5CHM A;  4OP5 A;  1GHI A;  1G5U A;  2AVX A;  1BLH A;  5HDS A;  4LV2 A;  1BSG A;  4IVI A;  1XX2 A;  2DNS A;  4PHT A;  3LUQ A;  1YKD A;  3QP8 A;  2JKR M;  3KX0 X;  4LEN A;  1PYY A;  4WMC A;  2FH5 A;  2J7V A;  2J9O A;  1FCM A;  1GA0 A;  3VP0 A;  4KZA A;  5K5B A;  4FOF A;  3DWZ A;  3MFX A;  3Q7V B;  1QME A;  4HOI A;  1G68 A;  3VV4 A;  3E2K A;  3A3I A;  3BFC A;  4PM9 A;  4OLG A;  1PFL A;  3WRT A;  3ZNY A;  1GA9 A;  1HVB A;  3BY8 A;  4KUK A;  5IS1 A;  2KOI A;  2JKF A;  4EBN A;  3E98 A;  5GHX A;  3NI9 A;  2KLI A;  4G3K A;  3G34 A;  1K4E A;  1SDN A;  4EU0 A;  3IWO A;  3MQQ A;  4WZ4 A;  3T1X A;  3G35 A;  1KDS A;  3IQA A;  3ZG8 B;  3O5Y A;  3ZG0 A;  2HP6 A;  3W4P A;  2ZJ9 A;  4Y15 A;  5EOE A;  4JXS A;  2VGJ A;  2WGI A;  3IHA A;  2XR0 A;  2OOL A;  5EOO A;  4KQQ A;  3S1Y A;  3CUE A;  4C75 A;  5KSC A;  3PYP A;  2EA9 A;  4HJ6 A;  3TRC A;  3GSG A;  5F68 A;  2QPN A;  4LRY C;  3L7H A;  4OPQ A;  5HWT A;  1NLY A;  4JGQ A;  1PRQ A;  1OTI A;  4ZJ3 A;  1D06 A;  4HEF A;  1Z6F A;  3T12 B;  1KVL A;  5GHZ A;  3LIA A;  1STZ A;  2Y8H A;  3IX4 A;  4ID4 A;  3MSH A;  2Y2P A;  3A0R A;  3Q1F A;  1PI5 A;  1H8M A;  5EFW A;  3G2Z A;  3VMA A;  3MZD A;  3H7W A;  4EQI A;  3BY9 A;  3SW1 A;  1CEG A;  3ZCZ A;  1LLB A;  4OOY A;  2WKE A;  2ZQA A;  3PBR A;  1TS8 A;  4GCZ A;  4NET A;  2VGK A;  3U2A A;  4UA6 A;  1OTA A;  3MF0 A;  4EER A;  2LB9 A;  4ZJ2 A;  3G32 A;  5CGW A;  2V1B A;  1I2W A;  1K6S A;  3NOP C;  4C3Q A;  3ZNT A;  4MN7 A;  4KUO A;  3VP3 A;  3B47 A;  5FI7 A;  1MWR A;  1FR6 A;  4UAA A;  3IH9 A;  2JKT I;  2QHK A;  2XRN A;  3OPL A;  4K91 A;  2VGL M;  4KZ8 A;  5HDC A;  5J8X A;  3CWF A;  2VKS A;  4S2L A;  1JTG A;  1XA1 A;  1W5D A;  3ZG9 B;  2XSS A;  4R38 A;  1ES5 A;  4NG2 A;  2V9A A;  3NY4 A;  4IJG A;  1YLT A;  5F83 A;  4EEP A;  1TS0 A;  5HAI A;  1OTE A;  4G3W A;  2K2N A;  3LI8 A;  3KSH A;  3UE0 A;  3RJU A;  4RQ9 A;  5FEG A;  5FQI A;  2OWJ A;  3RXX A;  4ETX A;  3VOY A;  4FD8 A;  3ZG5 A;  4LCL A;  1TD5 A;  3KSI A;  5CED A;  3B33 A;  3MXR A;  2QYB A;  3FZC A;  3UB5 P;  4PM7 A;  1XXM A;  5FAP A;  3AGD A;  4HP4 A;  2HF6 A;  1TDL A;  4JF5 A;  3JVV A;  4I3J A;  2PR5 A;  3RXW A;  2W0N A;  4MDZ A;  5GL9 A;  4EBL A;  1LSV A;  1S0W A;  3M6H A;  2OAP 1;  4KG5 A;  3IS2 B;  3HUM A;  5HL6 A;  3F1P B;  3O87 A;  5HD5 A;  4BBV A;  5GLA A;  4B88 A;  3O3V A;  4WBG A;  4JGP A;  3A3F A;  3T4S A;  1JWV A;  4KEN B;  4CQH A;  2P74 A;  3Q7Z A;  3V50 A;  5A93 A;  2WAF A;  1W8Q A;  2H0Y A;  2ZC7 A;  5E2E A;  1DP9 A;  4I5S A;  2QMI A;  1F98 A;  2M1C A;  4R3A A;  2I9V A;  1PWD A;  4WF0 A;  3TG9 A;  5FDH A;  3NUL A;  4KQO A;  2WKQ A;  4NK3 A;  1S6R A;  3SH8 A;  4HJ4 A;  5M19 A;  2JBF A;  5FEF A;  4WL9 A;  2NUP C;  4Z1W A;  2PBD P;  3DWK A;  3K2N A;  1TDG A;  5KZH A;  4IHQ A;  4YNR A;  1S67 L;  1W63 Q;  3PBO A;  5F82 A;  1OTB A;  2Y2G A;  1GSX A;  2IA2 A;  3GR2 A;  1S4S A;  4KQD A;  5CEB A;  3MBZ A;  1BLS A;  1BT5 A;  3BFG A;  2Y55 A;  4KG2 A;  1YQS A;  3S4X A;  4JGR A;  3BLM A;  1DP6 A;  2ZL1 A;  3OPP A;  3M2K A;  1N9B A;  4L9F A;  5A92 A;  3NCK A;  2G7U A;  4Q0H A;  4OLD A;  2WUQ A;  3BRM A;  3Q07 A;  3ITB A;  4WM9 A;  5CTM A;  3AGE A;  2OAQ 1;  3TOI A;  4JPM A;  1ONH A;  3VE4 A;  4EW7 A;  1ODV A;  3E4Q A;  2PD8 A;  4E04 A;  2P7J A;  3UO9 A;  2RCX A;  4O8G A;  2P9V B;  3W4Q A;  1L2S A;  5EUA A;  2DRW A;  4B4Z A;  5DJT A;  4OP8 A;  2D01 A;  2J80 A;  1P9R A;  2Y2H A;  2ZLY A;  4QB8 A;  1ZC2 A;  2K7S A;  2BLS A;  4ME4 A;  4GD6 A;  4BWI A;  2V20 A;  3R7W B;  3SZT A;  1G6A A;  5M1A A;  4H6J A;  1I2S A;  1T19 A;  4OPZ A;  4Y17 A;  1UWP X;  1KOU A;  3QP4 A;  3Q82 A;  2XD5 A;  3VOZ A;  4NXF A;  1IYQ A;  3OC2 A;  3CHW P;  1FSW A;  4O01 A;  2Z2L B;  2WZX A;  1T1C A;  4N1X A;  1IYS A;  3D3O A;  2B5R A;  3BQA A;  2VZW A;  5I5L A;  5DTS A;  3D4F A;  2WK0 A;  5L2F A;  4OQH A;  3MQO A;  4BQM A;  1HZO A;  1KDW A;  3H9W A;  2A49 A;  3CPT B;  3ICY A;  3CI6 A;  3DBA A;  3BYD A;  2KDK A;  3LIF A;  2HDR A;  4KZ3 A;  3PHY A;  5A90 A;  4WEK A;  1G28 A;  3HLG A;  3PR6 A;  3BW6 A;  3MJQ A;  3A3D A;  3ZFZ A;  1DJB A;  3FKW A;  5BOH A;  4YIN A;  3OZH A;  1L0E A;  4MCW A;  1LL9 A;  4EQ1 A;  2O0Y A;  2A24 B;  5FAO A;  1RGZ A;  5E2F A;  3UDX A;  1ZTU A;  5CX7 A;  1XPB A;  3VOL A;  3E4P A;  4MBF A;  1F9I A;  1LHY A;  1T1A A;  4Y7P A;  3I7J A;  4WEL A;  1H0M A;  1LSW A;  3VSL A;  1AXB A;  3EOI A;  3BFD A;  1NY0 A;  3K3D A;  5TBM A;  4I38 A;  4DRT A;  4JXW A;  2Y91 A;  3GV9 A;  5HZH A;  2OWH A;  3SS4 A;  3P09 A;  4PAU A;  4KZ6 A;  5GHY A;  4DXB A;  3GDI A;  4WZ5 A;  3T4L A;  1TVF A;  2W1T B;  1ZHH B;  1DP8 A;  4D2O A;  5F69 A;  5HL1 A;  1N9O A;  1JWP A;  2JKR I;  3HL9 A;  4OPY A;  2DCF A;  2IWC A;  1YLJ A;  3FKV A;  1D7E A;  1VEU B;  2Q9M A;  4R70 A;  4QPR A;  1GHP A;  3W8K A;  2X02 A;  3C2W A;  4CLC A;  4ARZ A;  4DKI A;  3E4O A;  3PXP A;  4AFI A;  2J8Y A;  1PNE A;  1KGG A;  3ISG A;  4DMZ A;  2V1Z A;  4GS9 B;  3IT9 A;  1NRJ A;  3HJI A;  1MKM A;  3RFB A;  1VEU A;  4HH3 A;  3UPO A;  3QP2 A;  2Y2L A;  3C7V A;  2O99 A;  3NC8 A;  1YLY A;  4G3V A;  5HAP A;  1GHM A;  1N9N A;  5EV0 A;  4MN5 A;  3NOT C;  4XXR A;  3UE6 A;  1DJC A; 
#chains in the Genus database with same CATH homology
 2P08 A;  4MN7 A;  4DJ3 A;  2BAS A;  4KUO A;  4LLO B;  5KSH A;  3TE8 A;  3F1O A;  4HQA A;  3TW8 A;  2JN7 A;  2KX6 A;  3B47 A;  1GSW A;  4EES A;  2JKT I;  2QHK A;  5IU1 A;  2XRN A;  2HJ9 C;  2VGL M;  5HDC A;  3R7W A;  3C8C A;  3CWF A;  3E0Y A;  2VKS A;  2PHY A;  5HWV A;  2GNX A;  2XSS A;  4R38 A;  2Z6C A;  2V9A A;  1OJ5 A;  4II7 A;  3H7W B;  1BYW A;  2V0U A;  4IJG A;  2QWS A;  2VV8 A;  4GS9 A;  4EEP A;  1TS0 A;  4WN5 A;  5MC7 A;  4UQI S;  1OTE A;  1UGU A;  4G3W A;  2K2N A;  3LI8 A;  1MZU A;  2GX5 A;  3KSH A;  2FZ0 A;  4EUV A;  2NUT C;  2VJW A;  4RQ9 A;  3ZQ5 A;  5L8M A;  4O0P A;  2OWJ A;  2VGL S;  4ETZ A;  3LR3 A;  4ETX A;  2YKH A;  3MQ0 A;  4UEY A;  4R6L A;  1OJG A;  2CMN A;  1TD5 A;  3C30 A;  3KSI A;  2HGV A;  1UWN X;  1T18 A;  4L9G A;  3B33 A;  5DKL A;  3LIB A;  5HDD A;  2QYB A;  4I3I A;  3NJA A;  4HP4 A;  2HF6 A;  4HNB A;  2QKP A;  4LPZ A;  2W3E A;  3JVV A;  3HJK A;  2XA7 M;  4I3J A;  2PR5 A;  3V67 A;  1GSV A;  3TJZ C;  4BBU A;  2WKR A;  5F5Y A;  3PBT A;  2W0N A;  4MDZ A;  4XT2 A;  5DFY A;  1V9Y A;  2J3T C;  5DKK A;  1LSV A;  4CLC D;  2OAP 1;  1F5M A;  5AJG A;  2K31 A;  3IS2 B;  2P04 A;  2VV7 A;  3CAX A;  3MR0 A;  3RTY A;  3C38 A;  5A8B A;  5HL6 A;  3F1P B;  3MMH A;  2B02 A;  5HD5 A;  4BBV A;  3MXQ A;  2QJ5 A;  4CLC C;  3LYX A;  3IBR A;  2J3T D;  3EWK A;  4LRZ E;  2ZBB A;  4JGP A;  3EGX C;  2PYR A;  1P0Z A;  5HPF A;  3T4S A;  3A0V A;  4CQH A;  1TF1 A;  4WEJ A;  3LIC A;  1XFN A;  2D02 A;  2PDR A;  4I3A A;  2PYP A;  2VA0 A;  3EEH A;  4B9O A;  1W63 M;  2PD7 A;  4B93 A;  2ZOH A;  1DP9 A;  4I5S A;  4MMN A;  3T4K A;  4YOF A;  1F98 A;  2J3W A;  4GHI B;  1OT6 A;  2R78 A;  2M1C A;  5HD3 A;  3S7Q A;  3GEC A;  4R3A A;  2I9V A;  4WF0 A;  4ARZ B;  2VLG A;  4EET B;  5TBM B;  4DN0 A;  5AVE A;  4L0L A;  4KQO A;  2WKQ A;  4I39 A;  4GHI A;  4H6J B;  3CLO A;  4Y3I A;  4HJ4 A;  3OCN A;  1H3Q A;  2DMW A;  4WL9 A;  1T1B A;  2NUP C;  4OOL A;  4Z1W A;  3S7N A;  3K2N A;  4IHQ A;  4YNR A;  2W1T A;  1S67 L;  1W63 Q;  3PBO A;  1OTB A;  1GSX A;  2IA2 A;  3CUE C;  3FG8 A;  2XA7 S;  3G6O A;  3EQU A;  3P01 A;  3S7P A;  1S4S A;  4KQD A;  4L9E A;  2M7U A;  3UB8 A;  3IBJ A;  4GLQ A;  4Q0J A;  2M7V A;  4HHD A;  4HI4 A;  4HIA A;  4JGR A;  4YWZ A;  2B18 A;  2W27 A;  1OTD A;  3NHQ A;  3T50 A;  3JVU A;  1DP6 A;  2H28 A;  1S1Z A;  4L9F A;  3KYQ A;  3PBN A;  4P6Z S;  2G7U A;  4Q0H A;  1XJ6 A;  4Q0I A;  1TS7 A;  3A0S A;  5TJJ A;  3OOV A;  4K08 A;  4LRX C;  2OAQ 1;  1LL8 A;  3VE4 A;  4BMW A;  3T4T A;  4EW7 A;  1ODV A;  3NOU C;  3E4Q A;  2PD8 A;  4WUJ A;  4E04 A;  3UB6 A;  4NXG A;  2MJ6 A;  2P7J A;  4IUH A;  4CLC E;  4XT2 B;  4O8G A;  3LI9 A;  2V1A A;  4F3L B;  2INW A;  3F1N B;  4NKP A;  2L0W A;  2HV1 A;  2GZA A;  2ZOI A;  2VV6 A;  4CLC B;  2ZMV A;  1S66 L;  2O9C A;  2L4R A;  4ZRR A;  5DJT A;  2A2L A;  1XFQ A;  4NXB A;  2D01 A;  2J80 A;  5F6A A;  1P9R A;  3H82 B;  1V9Z A;  3LR0 A;  2K7S A;  4HY8 A;  5DJU A;  3HCY A;  4ME4 A;  4DJ2 A;  5HPI A;  4BWI A;  3R7W B;  5J7E A;  2PR6 A;  1IOU A;  3K3C A;  3PBQ A;  2VX8 A;  4FSF A;  1XJ3 A;  5HSQ A;  2YKF A;  4H6J A;  1LSX A;  1VHM A;  1T19 A;  3D72 A;  1UWP X;  1KOU A;  5J4E A;  2GJ3 A;  3P7N A;  4BBT A;  3H82 A;  5G4Z A;  3UME A;  1IFQ A;  5DFX A;  4NXF A;  3OC2 A;  4UQI M;  4O01 A;  4EEU A;  1XJ4 A;  1JNU A;  2W3G A;  1T1C A;  4NXE A;  2W3H A;  3CIT A;  1OPX A;  3D3O A;  1S4R A;  1YSQ A;  4F3L A;  3B42 A;  3BQA A;  2VZW A;  5I5L A;  3UMD A;  2WKP A;  2PT7 A;  3KSG A;  3BWL A;  3MQO A;  5HDS A;  1NWZ A;  4PHT A;  4IUK A;  5IT5 A;  3LUQ A;  3H9W A;  1YKD A;  5G4Y A;  2JKR M;  5J3W A;  4JGO A;  3ICY A;  2LB5 A;  3KX0 X;  1P97 A;  3CI6 A;  3DBA A;  2JKT M;  2FH5 A;  2KDK A;  3LIF A;  2L1M A;  3LFV A;  3PHY A;  5K5B A;  4WEK A;  1G28 A;  3F1O B;  3PR6 A;  3MFX A;  4FOF A;  1Y28 A;  3OBF A;  3FPW A;  3FC7 A;  3BW6 A;  3MJQ A;  4HOI A;  3T4J A;  3T4O A;  2A24 A;  3VV4 A;  5C5K A;  3F1P A;  2EWV A;  1DRM A;  2ZMF A;  5HWW A;  2Z6D A;  1LT0 A;  3EQV A;  1VB6 A;  4PKY A;  4M4X A;  1NLZ A;  2VEA A;  3BY8 A;  4MCW A;  4KUK A;  5IS1 A;  2KOI A;  4EQ1 A;  3S7O A;  2O0Y A;  3E98 A;  2A24 B;  5FL3 A;  2KLI A;  4P6Z M;  4G3K A;  4PKY G;  4EU0 A;  3MQQ A;  3T4Q A;  1ZTU A;  1N9L A;  1MC0 A;  5CX7 A;  2JHE A;  3VOL A;  5DF9 A;  3E4P A;  1F9I A;  2QJ7 A;  1T1A A;  4OOM A;  1YSP A;  4BJP A;  3OLO A;  3O5Y A;  4WEL A;  1WA9 A;  1LSW A;  3IS2 A;  3FPV A;  3EOI A;  3K3D A;  5TBM A;  4Y2F A;  4HP9 A;  4I38 A;  3KYZ A;  1YAX A;  3VE3 A;  5HZH A;  4Y5F A;  2OWH A;  3BQ8 A;  2OOL A;  2O9A A;  2V0W A;  1S1Y A;  3CUE A;  4PAU A;  3LR4 A;  3PYP A;  3GDI A;  4NEE D;  2EA9 A;  1XJ2 A;  3UB7 A;  4HJ6 A;  3T4L A;  3TRC A;  4HH2 A;  2W1T B;  5F68 A;  1ZHH B;  1DP8 A;  4LRY C;  5HWT A;  5F69 A;  2W3F A;  1N9O A;  1NLY A;  1P9W A;  2JKR I;  4JGQ A;  4MN6 A;  3LR5 A;  4GW9 A;  3LID A;  1OTI A;  3R4K A;  1D06 A;  1D7E A;  3RH8 B;  3UB9 A;  4R70 A;  3KO6 A;  4QPR A;  3UE3 A;  3KSF A;  5LBR A;  3LIA A;  2O9B A;  3C2W A;  3EGD C;  4CLC A;  1STZ A;  2Y79 A;  4WLA A;  2XRO A;  2Y8H A;  4ARZ A;  1G6O A;  3A0R A;  3E4O A;  1OT9 A;  3PXP A;  4AFI A;  1H8M A;  1X0O A;  5EFW A;  5AVF A;  3BJN A;  3H7W A;  4HJ3 A;  1TS6 A;  3BY9 A;  4DMZ A;  3SW1 A;  3ULF A;  4GS9 B;  1NRJ A;  2HJE A;  3HJI A;  1MKM A;  2W3D A;  3PBR A;  3RFB A;  4HH3 A;  1TS8 A;  4GCZ A;  3U2A A;  2O99 A;  1OTA A;  5KIZ A;  2W1R A;  3MF0 A;  4EER A;  4EXO A;  4G3V A;  3W2Z A;  2EWW A;  3ZYT A;  1N9N A;  2LB9 A;  4GJ4 A;  4MN5 A;  1EW0 A;  2V1B A;  3NOT C;  3LIE A;  3PBS A;  3UE6 A;  3NOP C;  3F1N A;  3EEA A;  3OCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...