2JKTI

Ap2 clathrin adaptor core with cd4 dileucine peptide rm(phosphos) eikrllse q to e mutant
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
142
structure length
142
Chain Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords AP-2 COMPLEX SUBUNIT ALPHA-2
publication title A Structural Explanation for the Binding of Endocytic Dileucine Motifs by the Ap2 Complex.
pubmed doi rcsb
source organism Mus musculus
total genus 39
structure length 142
sequence length 142
chains with identical sequence S
ec nomenclature
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2jktI00
4UQIM 4NEED 1NRJA 4P6ZS 3TJZC 5MC7A 2VGLS 4UQIS 2FH5A 2JKRI 1W63M 1W63Q 2HF6A 2JKRM 2XA7M 2JKTI 4P6ZM 2VGLM 2XA7S 2JKTM
chains in the Genus database with same CATH superfamily
3G2ZA 3O87A 2Y79A 2ZMVA 2A3UA 3IF5A 2EX8A 1XA7A 5GHXA 2WGWB 4CJNA 2Q9MA 3V50A 3BW6A 2IWBA 1KGGA 2HDUA 1ES4A 5FQMA 1CI8A 1H8YA 1N9BA 5HSQA 1F9IA 2MJ6A 4IBXA 5F5YA 3M6BA 1MWRA 1OTBA 4S2MA 3Q7VB 4OONA 3T4JA 4U3TA 3H9WA 5GHZA 2XFSA 3DWZA 1UWNX 4JXWA 4ESPA 3BJNA 4E6XA 3IF6C 2JHEA 3W4QA 1PZOA 1XXMA 1KDSA 3GDIA 4EV4A 1MZUA 3SZTA 5FEGA 4EW7A 2JCHA 5CGWA 2EWVA 4KZ3A 3MKEA 2W1TB 2H28A 2WKHA 5FI7A 3BQAA 3A0RA 4OP5A 4B4XA 4XUZA 4Q8IA 1TVFA 2Z2LB 3NULA 3B3XA 5DF9A 4ETXA 2V20A 3MS6A 4LLOB 5M1AA 4X56A 3EGXC 4P0MA 2ZQAA 2XD1A 1S4SA 1BT5A 2JKFA 1ESIA 4MEZA 1OMEA 1YMSA 5GLAA 3VE4A 3IS2A 3MJQA 1MWUA 3T4QA 5M19A 4KZ9A 2P08A 1Z6FA 3B47A 5FDSA 4LGWA 3ZG0A 4XUXA 3T4LA 3GMWA 3E98A 5EVIB 4BBUA 4UQIS 1XFQA 3M6HA 1FIKA 2ZMAA 4RQ9A 3ZVTA 1Y54A 1K54C 4DDSA 3OPPA 5DF8A 3KSIA 4S2LA 3VOLA 3Q1FA 1JTGA 3HUNA 5F83A 5HARA 2JKGA 4ZTKA 1ZTUA 4QJGA 3AGEA 5L8MA 4OOLA 3UDFA 4BWIA 3NHQA 2JC7A 3BLMA 5CTMA 3QP1A 4MMNA 2P04A 1K4EA 5EVLA 5CERA 4UA7A 3UPPA 1TDGA 1MKIA 4Y13A 2RL3A 1KOUA 3QP2A 1OTAA 3UPNA 5I5LA 1CQAA 4D2OA 4MBHA 3N6IA 5IHVA 5HL6A 1OJ5A 2WKPA 4KQRA 2C6WB 5GLDA 2G2WA 3NIAA 2E8IA 1K57A 1IKIA 4OLDA 3NOTC 3OC2A 1DP9A 3MMHA 1W5DA 2WKQA 2ZQ7A 3O5YA 4IBRA 3BEBA 4JXGA 1K4FA 1H0MA 3TE8A 5TJJA 1P9WA 4S2NC 4C3QA 1FILA 1TS0A 1VETA 5F82A 1JTDA 2QHKA 3EGDC 5AJGA 4KG2A 2PRFA 4GS9A 4KZ6A 4E3NA 4N92A 4Y2FA 1K25A 1KE4A 2FH5A 5EUAA 4GHIA 2Z6DA 4PM5A 2ACGA 2WGIA 3CI6A 1TEMA 3ZVWA 3QP5A 5J7EA 2O0YA 1K0KA 1ZG6A 3NDGA 3U2AA 1YKDA 1H8ZA 3D4FA 3A0SA 2WKEA 2E8JA 1EI5A 1XA1A 4HESA 4EEUA 1WA9A 2JKRI 2Y2KA 4OQHA 5HZHA 3N8LA 2A24B 4LRXC 3G34A 1CJFA 1GHPA 3HLDA 3C7VA 5DKKA 2VGLM 4PPRA 5CGSA 1FCNA 5CHJA 5KMWA 1NLZA 3IXHA 1PI5A 2OAP1 2VGLS 3S4XA 1PRQA 4WELA 5AQAA 2Y59A 3LR3A 4R0QA 1K56D 2ZM8A 1F5MA 4UA9A 1W8YA 3R7WA 3LY4A 3OPRA 5HWWA 4E3IA 2VGJA 2W3HA 4PKYA 4BBTA 4LENA 3C4OA 5FQ9A 2Y2QA 2P7JA 5FQIA 1OJGA 3BYDA 5DKLA 5JYOA 4DF6A 1MY8A 1WYBA 5FAQA 1ALQA 5FAPA 1YT4A 4EBLA 2VX8A 4P6ZM 3BFDA 1LHYA 3C30A 3FYZA 4P6ZS 1DP6A 2Y8HA 1OTIA 1PW1A 2CC1A 4X1LA 3EQUA 3MBZA 4ME4A 2BTFP 1YSPA 1DJBA 1K6RA 3P98A 4JGQA 4DE2A 1YAXA 1H3QA 4BL3A 5AQBA 4ZJ1A 4JGRA 5J4EA 1NLYA 3HBRA 3PAGA 1T1BA 4DDYA 4E3MA 1S67L 5EVIA 1DY6A 3G2YA 5HD5A 3LIFA 5FL3A 4ZDXA 4QPRA 4C75A 4FUWA 1KE3A 3Q7ZA 4F3LB 4HP9A 1BTLA 1IYOA 1NRFA 3NI9A 1XJ2A 4QB8A 4GW9A 1L3LA 3P09A 2VKSA 2K2NA 1P9RA 2R9XA 4JXSA 1GA9A 1D06A 1NYYA 2FFFB 1IYQA 3V5MA 1N9OA 1FSYA 4Q0IA 5TFQA 3S22A 3G32A 4O0PA 1YPRA 3E4QA 5AQ7A 1BZAA 5U47A 5FI2A 3IBJA 4EWFA 4KQQA 3HCYA 3PBQA 4WMCA 3ZCZA 1GCEA 1MWTA 3L9KA 3E4OA 2PU2A 4Z1WA 4WZ5C 2O9BA 1EW0A 4FH4A 4P87A 4MN6A 3BECA 1XJ4A 2QYBA 4BBVA 1G6OA 3RH8B 3KYZA 2XK1A 5DTSA 2L1MA 2J9OA 1LT0A 4LCMA 2D02A 3PTEA 4WEKA 3MXQA 3UE3A 4EQIA 1RGYA 3BM6A 1P0ZA 3TW8A 4FD8A 3C5AA 4PMAA 2XGNA 3UPOA 3IX3A 2XEPA 3ZNTA 2XSSA 4NG2A 1I2WA 1K55A 3WS0A 1YQSA 1XX2A 2WAFA 3IX4A 3BFGA 4KZ4A 5BOHA 4LRZE 5A93A 3MXRA 2G2UA 3PXPA 3LFVA 3O3VA 4BL2A 3ITAA 3A3FA 4S2PA 5E43A 3NECA 4B9OA 2Y2JA 2IWCA 4R3BA 1KE0A 5HAIA 4X1MA 1NYMA 1KGFA 3MFDA 3VFFA 3UO9A 1TS8A 4DMZA 2A24A 1E3UD 1EWZA 1VETB 4E3LA 4WBGA 3UNWA 2FZ0A 2EFUA 4GS9B 4B88A 2KX6A 5KIZA 4EUZA 3IF6B 4K0XA 3TSGA 4EERA 3VP1A 5HDDA 3N8RA 1LI0A 3LEZA 1NZOA 4N1XA 2ZC6B 1K38A 2GNXA 4C6YA 1T1CA 2ZC4B 1JWVA 1BULA 2ZOIA 2WZXA 4LRYC 2Y2PA 1S1YA 2H5SA 2BG1A 5E2FA 3UB8A 5D3OA 4Y5FA 5AVFA 3NC8A 3UMDA 4KQDA 3VOYA 5DFXA 3FWLA 3BWLA 3IXGA 3QP6A 4QD4A 2JN7A 2Y2GA 1N9LA 2CMNA 1MKMA 4GNUA 4CLCC 3NY4A 2PD8A 1IKGA 5CTNA 3V39A 1RCJA 3MXSA 3VV4A 2IWDA 3QNCA 4EU0A 3R7WB 2GJ3A 1ONGA 2HGVA 4BD1A 5FATA 2GX5A 5F69A 3HLBA 5HAQA 4KZ7A 1V9ZA 1SKOA 5HW3A 1DJAA 3CLOA 1WE4A 1YM1A 3F1OA 4IUKA 2M1CA 4Y0TA 1BYWA 2K7SA 1ODVA 4OQGA 3BFCA 4CPKA 4I5SA 3KSGA 3UDXA 3IWOA 2OLUA 5EOEA 3WS5A 2M7UA 4I38A 2B02A 4F3LA 2PYPA 3MQOA 2QPNA 3G6OA 2HP5A 4WF0A 2W3GA 3HLFA 4GDBA 2Y2LA 1YLYA 4HY8A 5CGXA 4MBKA 4LV2A 1Q2PA 3ZG9B 4E3OA 3LO7A 3MF0A 3T4OA 4H6JB 1AXBA 3T4KA 4UQIM 1YMXA 3RXWA 4KUKA 2NUTC 1YSQA 3MQ0A 5TBMB 1G68A 3FPVA 3HLEA 2JKTI 5GHYA 5IS1A 4BQMA 4ETZA 3SH8A 5CX7A 4KQOA 3BQ8A 3PBSA 4I3IA 5J3WA 3W4OA 2HP9A 2IA2A 5EECA 3WRZA 2VLGA 2ZJ9A 4WUJA 4PM7A 3CUEA 4XT2B 3E2LA 4R1GA 2WADA 3DW0A 1PFLA 2HF6A 3BFFA 4HOIA 4YWZA 3B33A 4MLLA 4HNBA 5DTTA 1O07A 5FI6A 3LEQA 5E2EA 3A3JA 3FZCA 1JVJA 2JE5A 4LV0A 4L9GA 1W79A 3JYIA 2H0TA 1S4RA 5L09A 4E3KA 4FSFA 2Y2HA 3EEAA 4NXEA 3ZHHA 1BUEA 1BLSA 3PHYA 1BLHA 1L0EA 3KX0X 4I3JA 1KVLA 1M40A 4NKPA 3LR4A 4CLCD 3E4PA 1MC0A 1NRJA 3RJUA 3F1PA 3WWXA 5CEDA 3SOIA 2HDQA 1CEFA 1BLPA 4S2OA 3DWKA 5HPFA 1JWPA 4Y7PA 4S2IA 3Q82A 2EX6A 4UA6A 3H7WB 4DE0A 2XDMA 4DJ3A 1SZVA 1S1ZA 3IF6A 4LV1A 5FA7A 5KZHA 1H5XA 4JF6A 3OBFA 3G4PA 2OV5A 4I39A 2OAQ1 5E2HA 4MN5A 4JF4A 4OLGA 5FDHA 4IJGA 5I94A 3ICYA 5HFOA 2L0WA 3IWQA 2OWHA 4RYEA 3IQAA 3UDIA 1E25A 3LGOA 1W7FA 4HQAA 1PYYA 3C7UA 2ZQ9A 3PBRA 2KDKA 4BMWA 5DJUA 3D3OA 3SW1A 2QZ6A 3LR5A 1TF1A 1OTEA 3DBAA 4ZRRA 3QP8A 1LI9A 5LBRA 3OCLA 2ZMFA 2GDNA 1XGJA 5A91A 1F98A 3CWFA 2ZOHA 4I3AA 3FV7A 4EESA 2EX9A 4ID4A 1D1JA 3ULFA 3KO6A 3IXDA 1MBLA 3NOPC 2P9VB 2VV8A 4YINA 2VZWA 1J9MA 3IXBA 4OOMA 3LIBA 4HH3A 3CAXA 1Q2QA 2DMWA 3LIAA 4G3WA 4RX2A 4MCWA 5CRFA 5HWVA 1K56A 1YLJA 1K54A 2VGKA 3P01A 2XQZA 2X71A 3CITA 3GRJA 3PAEA 4M3KA 4ZJ2A 1STZA 5AQ9A 1FR1A 3S7QA 1X0OA 2O9CA 2XF3A 3PBNA 2KLIA 1J3WA 3LI8A 2EX2A 2M7VA 5HAPA 3KSHA 5F1FA 5A92A 1Z09A 2OLVA 1ZG4A 2ZLYA 2LB5A 1IYSA 1QMEA 4NEED 2D01A 3FC7A 4E04A 1SKOB 4H6JA 3VP4A 3NOUC 3VFHA 4GB7A 4OPQA 1T1AA 4R4SA 3JPUA 1T18A 5A90A 3F1OB 5EM1A 5JYPA 3GTCA 3LYXA 5DVAA 2PAVP 2Q0OA 3HL9A 3LIEA 5EVID 1TS6A 4UAAA 3VP2A 3CHWP 3GVBA 2WKRA 1V9YA 2AVXA 2HZ5A 2LB9A 4X25A 1VB6A 4R23A 5TBMA 2GZAA 3MFXA 1S66L 3VOZA 1W8QA 4H8RA 4KUOA 1NJ4A 4R70A 3K3DA 1SDEA 2W27A 4II7A 1K6SA 2OSUA 4P85A 5TR7A 3OOVA 2Y2MA 3BFEA 4S2NA 3DAVA 3UE0A 3T1QB 3UMEA 4XT2A 1ESUA 4IVIA 4MN7A 3NCKA 4Y15A 1IELA 1DP8A 3UE1A 4LV3A 2C5WB 1SCWA 2XRNA 3C4PA 2VJWA 3D9YA 1CEGA 3CPTA 1M6KA 5FQJA 4WMCD 3ZFZA 2V0WA 4GDNA 5HPIA 4HJ6A 5CHMA 2J3TC 2V0UA 4IVKA 1DJCA 5L10A 3LIDA 5G18A 4Y0OA 3MQQA 4JPMA 3WS2A 4YNRA 4BJPA 3VE3A 1C3BA 2PDRA 5HDCA 2B95A 3F1NA 3QP4A 4YOFA 1PIOA 3OPLA 1MWSA 3ZG8B 4LPZA 2ZBBA 3IH9A 3C38A 4QU3A 3KSFA 1OTDA 5C5KA 3BLSA 5G4ZA 2J8YA 1HVBA 2J7VA 3S7NA 5MC7A 3BRMA 4KZ8A 3MZDA 5FQQA 2YKFA 3UE6A 5J8XA 4PHTA 4OOYA 4NXFA 4GOGA 1W63Q 1N9NA 4GD8A 2UWXA 3H7WA 4YFMA 4E3JA 3ZYTA 4JXVA 1LSXA 4B93A 3IHBA 2J9PA 5HDSA 3NBLA 2ZL1A 4KZAA 4B4ZA 2Z2MB 2ZC5B 3ZGAB 3HLCA 4O7DA 3KYQA 1DRMA 5CHUA 4PM9A 3F1PB 4G3KA 3ZG5A 1L0GA 3N8SA 2HDRA 4Y17A 2EXAA 4BENA 4L9EA 4MNRA 1LL9A 1XJ3A 4KG5A 3DTMA 3UB5P 1MXOA 2W1RA 1VM1A 3D72A 4R38A 4JKTA 2ZD8A 1AWIA 3E0YA 5F6AA 4DXBA 2RCXA 4S2JA 1E3UA 1LLBA 1L0DA 4FCFA 2ZM0A 2P9VA 5G4YA 3W8KA 5EE8A 2BLSA 2A2LA 4R3AA 5EV0A 4HBTA 5IT5A 2HJEA 5DFYA 2Y2IA 2PR5A 2W3FA 4U0XA 1PWDA 2J3WA 4U0TA 4D60A 3LCEA 3N7WA 4NXBA 2ZQCA 3IX8A 4WN5A 2JKRM 5FAOA 1K57C 1VHMA 3GQZA 1VEUB 2J3TD 4EQ1A 4Q0HA 1G28A 3RXXA 4EUVA 4CLCE 5FSRA 1CK3A 4EEPA 3SS3A 2WZZA 4UEYA 2H0YA 4Y3IA 4Z9QA 2Q9NA 2X01A 1GHIA 2Y2NA 1N4OA 2FFYA 2HPBA 5L07A 4X69A 1PWCA 2PYRA 2L4RA 1NZUA 2O9AA 1OT6A 4ARZA 1FQGA 1IFQA 2QJ5A 4XXRA 1ES2A 5HX9A 4PAUA 1ZHHB 4GLQA 3HLWA 4DE3A 4WZ5A 3LICA 2VEAA 3M2JA 3ZNYA 1D7EA 2G7UA 4NXGA 4N1HA 1PW8A 3IT9A 3K2NA 1MPLA 1G5UA 1SHVA 3A3DA 4X68A 1XGIA 2VK3A 1NXYA 5EPHA 4DRTA 3E2KA 4M4XA 4LCLA 3A0VA 2W3DA 5HL1A 5IU1A 3FKVA 5FEFA 3G30A 5HD3A 3IH8A 3UY6A 2WK0A 1FCMA 4QHCA 1GSWA 1BLCA 1HZOA 3EQVA 2PHYA 1YLZA 5DJTA 2O99A 1ERMA 5F68A 4GKUA 3QNBA 4JBFA 4EETB 1S6RA 4S2KA 4Y0UA 4GCZA 4L0LA 5EOOA 3A3IA 2Y55A 4OPRA 1G6AA 4K91A 4FH2A 3PR6A 3SH7A 5AVEA 4HH2A 4JF5A 3H82A 2V8FA 2OOLA 4Q0JA 4HJ3A 3PYPA 2V1ZA 5FASA 4WM9A 1GSVA 2JBFA 1GA0A 3CPTB 1CI9A 5DTKA 5GLCA 5L2FA 2Z6CA 3EOIA 1Y28A 3R4KA 1JNUA 1TS7A 3C8CA 1W63M 3OCNA 2W0NA 3A3EA 2R78A 5EFWA 1ZKJA 3MR0A 1JWZA 1XFNA 3PBOA 3F1NB 1H8MA 1PZPA 4N9KA 4DXCA 3IHAA 4HJ4A 4RVAA 3OPHA 1HD8A 1XJ6A 2PBYA 2ZQ8A 4P6BA 2XH9A 1UGUA 1HLUP 1HTZA 1O7EA 3DTIA 5EVIC 1LL8A 1LL5A 3GSGA 3RFBA 3UB9A 4DN0A 3W4PA 1FOFA 4CLCA 1ERQA 4MDZA 4WZ4A 2PU4A 1OT9A 3EWKA 4OVDA 5DF7A 3EEHA 2HJ9C 3T4TA 4A5RA 3DTEA 5A8BA 2INWA 2ZL1B 3P7NA 3AGFA 3CMZA 3JVVA 5CECA 2EA9A 2WUQA 1ACFA 2XR0A 4GD6A 1ONHA 3LY3A 3O86A 3SH9A 4F94A 4ZAMA 3IWIA 4HHDA 4R3JA 3CJMA 4HIAA 4HP4A 4X6TA 1XPBA 5CXWA 1QMFA 2B18A 3ZQ5A 3V3SA 4WL9A 2V1BA 2WGWA 2QJ7A 4PM8A 3TOIA 4GZBA 1RP5A 4AFIA 1PWGA 3UN7A 3FKWA 3S1YA 2X02A 1VEUA 1A0KA 3B42A 1ES3A 2HP6A 1ES5A 2QKPA 1SDNA 5GL9A 3T1SA 1P97A 3Q7VA 1UWPX 1L0FA 1OPXA 4IHQA 3BY9A 4OKPA 3ZG7B 4L9FA 3MSHA 1K55C 4NETA 2EXBA 3LI9A 1NWZA 1LSWA 2BASA 4GN2A 4KZBA 3T12B 5TGFA 5E2GA 2DRWA 3LUQA 4K0WA 1T19A 3TG9A 3FPWA 2EFXA 2XFTA 4KENB 3T4SA 2QMIA 2KOIA 2PR6A 4QWOA 2W1TA 3CZDA 3GR2A 3T1XA 3DTKA 4QY5A 4ZBEA 3UB6A 4RA7A 2VA0A 2PBDP 1ZC2A 3AGDA 2Y4AA 2XD5A 2ZM2A 5EM0A 3C2WA 1GHMA 4ARZB 4OQ0A 1NY0A 2PT7A 2A49A 4FTXA 2OWJA 3WS1A 1EROA 4R6LA 1U60A 3T1RA 1IYPA 4OH0A 1F2KA 2PD7A 1PNEA 3ITBA 1KVMA 1S0WA 5GLBA 3NJAA 2EWWA 1YLWA 2WKIA 3ZDJA 3HVFA 3KYEA 3NDEA 3JVUA 5F1GA 3VSLA 3VSKA 3VP0A 2V8CA 4K08A 5M18A 1TDLA 1SKFA 3L7HA 4FOFA 5K5BA 1IEMA 1GSXA 2V2FF 3FG8A 2R9WA 3T50A 2XROA 4O8GA 4BD0A 4GJ4A 3HJKA 2P74A 2QWSA 4G3VA 3Q07A 3S7PA 3VP3A 3TJZC 3MZFA 1BSGA 4KG6A 2V1AA 1YLPA 4WLAA 4PM6A 3MZEA 3SS4A 4EBNA 3OZHA 4X53A 2WGVA 4O01A 1FSWA 1E4DA 3CG5A 3IS2B 2WAEA 1XP4A 4OPZA 2H10A 3S7OA 3RTYA 4ZJ3A 3N4IA 4JLFA 4KZ5A 4HI4A 3UB7A 4JGPA 4X55A 4DJ2A 5HWTA 4HEFA 4RX3A 2W3EA 1KGEA 4DE1A 3H82B 3VMAA 2JKTM 2Y2OA 4QY6A 4EBPA 1IOUA 2K31A 3O88A 3W2ZA 3HLGA 1TD5A 3HREA 4OQIA 2J80A 4MBFA 4R4RA 4UHUA 2VV6A 2XA7M 3HJIA 2Y91A 3IBRA 1CF0A 1XKZA 3G35A 3V67A 4WYYA 2XA7S 2I72A 2DCFA 5KSCA 4OPYA 1FCOA 1RGZA 2YKHA 3MKFA 4DKIA 1WYCA 1KDWA 4EXOA 3BY8A 4HBUA 4LFUA 2B5RA 2ZC7A 3OLOA 3GECA 4PKYG 5CEBA 2NUPC 3LR0A 2DNSA 2UV0E 3TRCA 1I2SA 3I7JA 3HUMA 3GV9A 3WRTA 4CQHA 3ISGA 2I9VA 4CLCB 3M2KA 1Y4OA 2WYXA 2XLNA 3U4LP 1L2SA 4IEDA 4IUHA 4OP8A 1LSVA 5KSHA 1VQQA 5EVEA 2ZQDA 2VV7A 3CUEC 3K3CA 1I5QA 4NK3A 3G31A 5FQKA 4N9LA 3WS4A 4BLMA 1PI4A 4E6WA 2V9AA 2HDSA 4GHIB 3SS5A 3QHYA 3V3RA 3PBTA 3HUOA 3Q81A 1YLTA 4JGOA 4WEJA 2ZC3B 2HV1A 1FR6A
chains in the Genus database with same CATH topology
4O0PA 2Y79A 2ZMVA 3E4QA 3PR6A 1F98A 3CWFA 2ZOHA 5AVEA 4I3AA 4HH2A 3BW6A 3IBJA 4EESA 3H82A 2OOLA 4Q0JA 4HJ3A 3HCYA 3PBQA 3ULFA 3PYPA 3KO6A 3NOPC 5HSQA 1F9IA 2VV8A 1GSVA 2VZWA 2MJ6A 3E4OA 5F5YA 4Z1WA 4OOMA 3LIBA 2O9BA 1EW0A 4HH3A 3CAXA 4MN6A 2DMWA 3LIAA 1XJ4A 4G3WA 2QYBA 1OTBA 4BBVA 1G6OA 4MCWA 2Z6CA 3EOIA 1Y28A 3R4KA 1JNUA 3RH8B 3KYZA 3T4JA 1TS7A 5HWVA 3C8CA 1W63M 3OCNA 3H9WA 3P01A 2W0NA 2L1MA 1LT0A 2R78A 5EFWA 2D02A 4WEKA 1UWNX 3MR0A 3MXQA 1XFNA 3PBOA 3CITA 3UE3A 3F1NB 1H8MA 1STZA 1P0ZA 3BJNA 3TW8A 3S7QA 1X0OA 2O9CA 4HJ4A 2JHEA 1XJ6A 2XSSA 3PBNA 2KLIA 3LI8A 3GDIA 1MZUA 1UGUA 4EW7A 2M7VA 1LL8A 3KSHA 3RFBA 3UB9A 4LRZE 4DN0A 2EWVA 2LB5A 2W1TB 2H28A 4CLCA 3PXPA 3BQAA 4MDZA 4NEED 3A0RA 3LFVA 2D01A 3FC7A 4E04A 1OT9A 3EWKA 4H6JA 3NOUC 3EEHA 2HJ9C 5DF9A 1T1AA 3T4TA 4ETXA 1T18A 3F1OB 4B9OA 3LYXA 3LIEA 5A8BA 4LLOB 2INWA 1TS6A 3P7NA 2WKRA 3JVVA 1V9YA 2LB9A 3EGXC 1VB6A 5TBMA 2GZAA 3MFXA 1S4SA 2EA9A 1S66L 1TS8A 4KUOA 4R70A 3K3DA 4DMZA 2A24A 3VE4A 3IS2A 3MJQA 2W27A 4II7A 3T4QA 2FZ0A 4HHDA 2P08A 4GS9B 4HIAA 3OOVA 4HP4A 2KX6A 5KIZA 2B18A 3ZQ5A 3B47A 4WL9A 2V1BA 4EERA 5HDDA 2QJ7A 3T4LA 3UMEA 4XT2A 4MN7A 3E98A 4AFIA 4BBUA 4UQIS 1XFQA 1DP8A 2XRNA 2GNXA 4RQ9A 2VJWA 1T1CA 2ZOIA 4LRYC 3B42A 1S1YA 2V0WA 3KSIA 3VOLA 5HPIA 2QKPA 4HJ6A 3UB8A 1P97A 1ZTUA 2J3TC 2V0UA 1UWPX 4Y5FA 1OPXA 5L8MA 5AVFA 4OOLA 3UMDA 4IHQA 3BY9A 4BWIA 3NHQA 3LIDA 4L9FA 4KQDA 3MQQA 5DFXA 4MMNA 3BWLA 3LI9A 2P04A 4YNRA 4BJPA 3VE3A 2PDRA 5HDCA 1NWZA 3F1NA 4YOFA 1LSWA 2JN7A 2BASA 1N9LA 2CMNA 4LPZA 1MKMA 2ZBBA 4CLCC 1KOUA 3C38A 1OTAA 2PD8A 3LUQA 3KSFA 5I5LA 3VV4A 1OTDA 5C5KA 1T19A 5G4ZA 4EU0A 3R7WB 3S7NA 3FPWA 5MC7A 5HL6A 1OJ5A 2WKPA 2GJ3A 3T4SA 2KOIA 2YKFA 3UE6A 2PR6A 4PHTA 2HGVA 2GX5A 2W1TA 4NXFA 5F69A 1W63Q 1N9NA 1V9ZA 3H7WA 3UB6A 3ZYTA 3CLOA 1LSXA 2VA0A 4B93A 3F1OA 4IUKA 2M1CA 3NOTC 1BYWA 2K7SA 5HDSA 3OC2A 1ODVA 1DP9A 3C2WA 4I5SA 3KSGA 3MMHA 4ARZB 3KYQA 2PT7A 2WKQA 3O5YA 2OWJA 2M7UA 4I38A 1DRMA 2B02A 3TE8A 5TJJA 3F1PB 4F3LA 2PYPA 4G3KA 1P9WA 4R6LA 3MQOA 1TS0A 3G6OA 2QHKA 2PD7A 3EGDC 3NJAA 2EWWA 4WF0A 4GS9A 5AJGA 2W3GA 4L9EA 4Y2FA 3JVUA 2FH5A 4GHIA 1XJ3A 4HY8A 4K08A 2Z6DA 3CI6A 4FOFA 3MF0A 3T4OA 2W1RA 4H6JB 3D72A 4R38A 5K5BA 1GSXA 5J7EA 3FG8A 3T4KA 2O0YA 3T50A 2XROA 4O8GA 3E0YA 4GJ4A 5F6AA 3HJKA 4UQIM 2QWSA 4G3VA 3U2AA 3S7PA 1YKDA 4KUKA 3A0SA 3TJZC 2V1AA 2NUTC 1YSQA 4EEUA 4WLAA 3MQ0A 1WA9A 5TBMB 3FPVA 2JKRI 5G4YA 5HZHA 2A2LA 2A24B 4O01A 4R3AA 4LRXC 3IS2B 2JKTI 5IT5A 2HJEA 5IS1A 4ETZA 5DKKA 5DFYA 2VGLM 5CX7A 2PR5A 4KQOA 3S7OA 3RTYA 3BQ8A 1NLZA 3PBSA 2W3FA 4I3IA 2OAP1 5J3WA 2VGLS 4HI4A 2IA2A 3UB7A 2VLGA 4WELA 4WUJA 4JGPA 3LR3A 2J3WA 3CUEA 4XT2B 4DJ2A 5HWTA 1F5MA 4NXBA 4WN5A 2HF6A 2JKRM 4HOIA 3R7WA 4YWZA 1VHMA 2W3EA 3B33A 5HWWA 2J3TD 4EQ1A 4HNBA 4Q0HA 3H82B 2W3HA 2JKTM 1G28A 4PKYA 4CLCE 4EUVA 4BBTA 1IOUA 2K31A 4EEPA 2P7JA 4L9GA 4UEYA 1OJGA 5DKLA 3W2ZA 1S4RA 4Y3IA 1TD5A 4FSFA 3EEAA 4NXEA 2J80A 3PHYA 2VV6A 2XA7M 2PYRA 3HJIA 3IBRA 3V67A 3KX0X 2L4RA 4I3JA 2VX8A 2O9AA 4NKPA 1OT6A 4ARZA 1IFQA 4P6ZM 3LR4A 4CLCD 2XA7S 2QJ5A 3E4PA 4PAUA 1MC0A 1ZHHB 4GLQA 1NRJA 3C30A 4P6ZS 1DP6A 2Y8HA 1OTIA 3F1PA 3LICA 2VEAA 2YKHA 3EQUA 1D7EA 2G7UA 4NXGA 5HPFA 4EXOA 3BY8A 3K2NA 4ME4A 3OLOA 3GECA 4PKYG 1YSPA 2NUPC 3LR0A 3TRCA 4JGQA 1YAXA 3H7WB 1H3QA 4DJ3A 4M4XA 1S1ZA 4CQHA 3A0VA 2W3DA 4JGRA 5J4EA 1NLYA 2I9VA 5IU1A 4CLCB 1T1BA 5HD3A 3OBFA 4I39A 2OAQ1 1S67L 4MN5A 5HD5A 4IJGA 3ICYA 3LIFA 5FL3A 4QPRA 2L0WA 1GSWA 2OWHA 4IUHA 3EQVA 1LSVA 4F3LB 5KSHA 4HP9A 2VV7A 2PHYA 3CUEC 3K3CA 1XJ2A 4HQAA 5DJTA 4GW9A 2O99A 3PBRA 2KDKA 2VKSA 5F68A 2K2NA 4BMWA 5DJUA 3D3OA 1P9RA 3SW1A 2V9AA 3LR5A 4GHIB 4EETB 1TF1A 1OTEA 3DBAA 1D06A 4ZRRA 3PBTA 4GCZA 4JGOA 4WEJA 1N9OA 4L0LA 5LBRA 3OCLA 2HV1A 4Q0IA 2ZMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UQI M;  4NEE D;  1NRJ A;  4P6Z S;  3TJZ C;  5MC7 A;  2VGL S;  4UQI S;  2FH5 A;  2JKR I;  1W63 M;  1W63 Q;  2HF6 A;  2JKR M;  2XA7 M;  2JKT I;  4P6Z M;  2VGL M;  2XA7 S;  2JKT M; 
#chains in the Genus database with same CATH topology
 3G2Z A;  3O87 A;  2Y79 A;  2ZMV A;  2A3U A;  3IF5 A;  2EX8 A;  1XA7 A;  5GHX A;  2WGW B;  4CJN A;  2Q9M A;  3V50 A;  3BW6 A;  2IWB A;  1KGG A;  2HDU A;  1ES4 A;  5FQM A;  1CI8 A;  1H8Y A;  1N9B A;  5HSQ A;  1F9I A;  2MJ6 A;  4IBX A;  5F5Y A;  3M6B A;  1MWR A;  1OTB A;  4S2M A;  3Q7V B;  4OON A;  3T4J A;  4U3T A;  3H9W A;  5GHZ A;  2XFS A;  3DWZ A;  1UWN X;  4JXW A;  4ESP A;  3BJN A;  4E6X A;  3IF6 C;  2JHE A;  3W4Q A;  1PZO A;  1XXM A;  1KDS A;  3GDI A;  4EV4 A;  1MZU A;  3SZT A;  5FEG A;  4EW7 A;  2JCH A;  5CGW A;  2EWV A;  4KZ3 A;  3MKE A;  2W1T B;  2H28 A;  2WKH A;  5FI7 A;  3BQA A;  3A0R A;  4OP5 A;  4B4X A;  4XUZ A;  4Q8I A;  1TVF A;  2Z2L B;  3NUL A;  3B3X A;  5DF9 A;  4ETX A;  2V20 A;  3MS6 A;  4LLO B;  5M1A A;  4X56 A;  3EGX C;  4P0M A;  2ZQA A;  2XD1 A;  1S4S A;  1BT5 A;  2JKF A;  1ESI A;  4MEZ A;  1OME A;  1YMS A;  5GLA A;  3VE4 A;  3IS2 A;  3MJQ A;  1MWU A;  3T4Q A;  5M19 A;  4KZ9 A;  2P08 A;  1Z6F A;  3B47 A;  5FDS A;  4LGW A;  3ZG0 A;  4XUX A;  3T4L A;  3GMW A;  3E98 A;  5EVI B;  4BBU A;  4UQI S;  1XFQ A;  3M6H A;  1FIK A;  2ZMA A;  4RQ9 A;  3ZVT A;  1Y54 A;  1K54 C;  4DDS A;  3OPP A;  5DF8 A;  3KSI A;  4S2L A;  3VOL A;  3Q1F A;  1JTG A;  3HUN A;  5F83 A;  5HAR A;  2JKG A;  4ZTK A;  1ZTU A;  4QJG A;  3AGE A;  5L8M A;  4OOL A;  3UDF A;  4BWI A;  3NHQ A;  2JC7 A;  3BLM A;  5CTM A;  3QP1 A;  4MMN A;  2P04 A;  1K4E A;  5EVL A;  5CER A;  4UA7 A;  3UPP A;  1TDG A;  1MKI A;  4Y13 A;  2RL3 A;  1KOU A;  3QP2 A;  1OTA A;  3UPN A;  5I5L A;  1CQA A;  4D2O A;  4MBH A;  3N6I A;  5IHV A;  5HL6 A;  1OJ5 A;  2WKP A;  4KQR A;  2C6W B;  5GLD A;  2G2W A;  3NIA A;  2E8I A;  1K57 A;  1IKI A;  4OLD A;  3NOT C;  3OC2 A;  1DP9 A;  3MMH A;  1W5D A;  2WKQ A;  2ZQ7 A;  3O5Y A;  4IBR A;  3BEB A;  4JXG A;  1K4F A;  1H0M A;  3TE8 A;  5TJJ A;  1P9W A;  4S2N C;  4C3Q A;  1FIL A;  1TS0 A;  1VET A;  5F82 A;  1JTD A;  2QHK A;  3EGD C;  5AJG A;  4KG2 A;  2PRF A;  4GS9 A;  4KZ6 A;  4E3N A;  4N92 A;  4Y2F A;  1K25 A;  1KE4 A;  2FH5 A;  5EUA A;  4GHI A;  2Z6D A;  4PM5 A;  2ACG A;  2WGI A;  3CI6 A;  1TEM A;  3ZVW A;  3QP5 A;  5J7E A;  2O0Y A;  1K0K A;  1ZG6 A;  3NDG A;  3U2A A;  1YKD A;  1H8Z A;  3D4F A;  3A0S A;  2WKE A;  2E8J A;  1EI5 A;  1XA1 A;  4HES A;  4EEU A;  1WA9 A;  2JKR I;  2Y2K A;  4OQH A;  5HZH A;  3N8L A;  2A24 B;  4LRX C;  3G34 A;  1CJF A;  1GHP A;  3HLD A;  3C7V A;  5DKK A;  2VGL M;  4PPR A;  5CGS A;  1FCN A;  5CHJ A;  5KMW A;  1NLZ A;  3IXH A;  1PI5 A;  2OAP 1;  2VGL S;  3S4X A;  1PRQ A;  4WEL A;  5AQA A;  2Y59 A;  3LR3 A;  4R0Q A;  1K56 D;  2ZM8 A;  1F5M A;  4UA9 A;  1W8Y A;  3R7W A;  3LY4 A;  3OPR A;  5HWW A;  4E3I A;  2VGJ A;  2W3H A;  4PKY A;  4BBT A;  4LEN A;  3C4O A;  5FQ9 A;  2Y2Q A;  2P7J A;  5FQI A;  1OJG A;  3BYD A;  5DKL A;  5JYO A;  4DF6 A;  1MY8 A;  1WYB A;  5FAQ A;  1ALQ A;  5FAP A;  1YT4 A;  4EBL A;  2VX8 A;  4P6Z M;  3BFD A;  1LHY A;  3C30 A;  3FYZ A;  4P6Z S;  1DP6 A;  2Y8H A;  1OTI A;  1PW1 A;  2CC1 A;  4X1L A;  3EQU A;  3MBZ A;  4ME4 A;  2BTF P;  1YSP A;  1DJB A;  1K6R A;  3P98 A;  4JGQ A;  4DE2 A;  1YAX A;  1H3Q A;  4BL3 A;  5AQB A;  4ZJ1 A;  4JGR A;  5J4E A;  1NLY A;  3HBR A;  3PAG A;  1T1B A;  4DDY A;  4E3M A;  1S67 L;  5EVI A;  1DY6 A;  3G2Y A;  5HD5 A;  3LIF A;  5FL3 A;  4ZDX A;  4QPR A;  4C75 A;  4FUW A;  1KE3 A;  3Q7Z A;  4F3L B;  4HP9 A;  1BTL A;  1IYO A;  1NRF A;  3NI9 A;  1XJ2 A;  4QB8 A;  4GW9 A;  1L3L A;  3P09 A;  2VKS A;  2K2N A;  1P9R A;  2R9X A;  4JXS A;  1GA9 A;  1D06 A;  1NYY A;  2FFF B;  1IYQ A;  3V5M A;  1N9O A;  1FSY A;  4Q0I A;  5TFQ A;  3S22 A;  3G32 A;  4O0P A;  1YPR A;  3E4Q A;  5AQ7 A;  1BZA A;  5U47 A;  5FI2 A;  3IBJ A;  4EWF A;  4KQQ A;  3HCY A;  3PBQ A;  4WMC A;  3ZCZ A;  1GCE A;  1MWT A;  3L9K A;  3E4O A;  2PU2 A;  4Z1W A;  4WZ5 C;  2O9B A;  1EW0 A;  4FH4 A;  4P87 A;  4MN6 A;  3BEC A;  1XJ4 A;  2QYB A;  4BBV A;  1G6O A;  3RH8 B;  3KYZ A;  2XK1 A;  5DTS A;  2L1M A;  2J9O A;  1LT0 A;  4LCM A;  2D02 A;  3PTE A;  4WEK A;  3MXQ A;  3UE3 A;  4EQI A;  1RGY A;  3BM6 A;  1P0Z A;  3TW8 A;  4FD8 A;  3C5A A;  4PMA A;  2XGN A;  3UPO A;  3IX3 A;  2XEP A;  3ZNT A;  2XSS A;  4NG2 A;  1I2W A;  1K55 A;  3WS0 A;  1YQS A;  1XX2 A;  2WAF A;  3IX4 A;  3BFG A;  4KZ4 A;  5BOH A;  4LRZ E;  5A93 A;  3MXR A;  2G2U A;  3PXP A;  3LFV A;  3O3V A;  4BL2 A;  3ITA A;  3A3F A;  4S2P A;  5E43 A;  3NEC A;  4B9O A;  2Y2J A;  2IWC A;  4R3B A;  1KE0 A;  5HAI A;  4X1M A;  1NYM A;  1KGF A;  3MFD A;  3VFF A;  3UO9 A;  1TS8 A;  4DMZ A;  2A24 A;  1E3U D;  1EWZ A;  1VET B;  4E3L A;  4WBG A;  3UNW A;  2FZ0 A;  2EFU A;  4GS9 B;  4B88 A;  2KX6 A;  5KIZ A;  4EUZ A;  3IF6 B;  4K0X A;  3TSG A;  4EER A;  3VP1 A;  5HDD A;  3N8R A;  1LI0 A;  3LEZ A;  1NZO A;  4N1X A;  2ZC6 B;  1K38 A;  2GNX A;  4C6Y A;  1T1C A;  2ZC4 B;  1JWV A;  1BUL A;  2ZOI A;  2WZX A;  4LRY C;  2Y2P A;  1S1Y A;  2H5S A;  2BG1 A;  5E2F A;  3UB8 A;  5D3O A;  4Y5F A;  5AVF A;  3NC8 A;  3UMD A;  4KQD A;  3VOY A;  5DFX A;  3FWL A;  3BWL A;  3IXG A;  3QP6 A;  4QD4 A;  2JN7 A;  2Y2G A;  1N9L A;  2CMN A;  1MKM A;  4GNU A;  4CLC C;  3NY4 A;  2PD8 A;  1IKG A;  5CTN A;  3V39 A;  1RCJ A;  3MXS A;  3VV4 A;  2IWD A;  3QNC A;  4EU0 A;  3R7W B;  2GJ3 A;  1ONG A;  2HGV A;  4BD1 A;  5FAT A;  2GX5 A;  5F69 A;  3HLB A;  5HAQ A;  4KZ7 A;  1V9Z A;  1SKO A;  5HW3 A;  1DJA A;  3CLO A;  1WE4 A;  1YM1 A;  3F1O A;  4IUK A;  2M1C A;  4Y0T A;  1BYW A;  2K7S A;  1ODV A;  4OQG A;  3BFC A;  4CPK A;  4I5S A;  3KSG A;  3UDX A;  3IWO A;  2OLU A;  5EOE A;  3WS5 A;  2M7U A;  4I38 A;  2B02 A;  4F3L A;  2PYP A;  3MQO A;  2QPN A;  3G6O A;  2HP5 A;  4WF0 A;  2W3G A;  3HLF A;  4GDB A;  2Y2L A;  1YLY A;  4HY8 A;  5CGX A;  4MBK A;  4LV2 A;  1Q2P A;  3ZG9 B;  4E3O A;  3LO7 A;  3MF0 A;  3T4O A;  4H6J B;  1AXB A;  3T4K A;  4UQI M;  1YMX A;  3RXW A;  4KUK A;  2NUT C;  1YSQ A;  3MQ0 A;  5TBM B;  1G68 A;  3FPV A;  3HLE A;  2JKT I;  5GHY A;  5IS1 A;  4BQM A;  4ETZ A;  3SH8 A;  5CX7 A;  4KQO A;  3BQ8 A;  3PBS A;  4I3I A;  5J3W A;  3W4O A;  2HP9 A;  2IA2 A;  5EEC A;  3WRZ A;  2VLG A;  2ZJ9 A;  4WUJ A;  4PM7 A;  3CUE A;  4XT2 B;  3E2L A;  4R1G A;  2WAD A;  3DW0 A;  1PFL A;  2HF6 A;  3BFF A;  4HOI A;  4YWZ A;  3B33 A;  4MLL A;  4HNB A;  5DTT A;  1O07 A;  5FI6 A;  3LEQ A;  5E2E A;  3A3J A;  3FZC A;  1JVJ A;  2JE5 A;  4LV0 A;  4L9G A;  1W79 A;  3JYI A;  2H0T A;  1S4R A;  5L09 A;  4E3K A;  4FSF A;  2Y2H A;  3EEA A;  4NXE A;  3ZHH A;  1BUE A;  1BLS A;  3PHY A;  1BLH A;  1L0E A;  3KX0 X;  4I3J A;  1KVL A;  1M40 A;  4NKP A;  3LR4 A;  4CLC D;  3E4P A;  1MC0 A;  1NRJ A;  3RJU A;  3F1P A;  3WWX A;  5CED A;  3SOI A;  2HDQ A;  1CEF A;  1BLP A;  4S2O A;  3DWK A;  5HPF A;  1JWP A;  4Y7P A;  4S2I A;  3Q82 A;  2EX6 A;  4UA6 A;  3H7W B;  4DE0 A;  2XDM A;  4DJ3 A;  1SZV A;  1S1Z A;  3IF6 A;  4LV1 A;  5FA7 A;  5KZH A;  1H5X A;  4JF6 A;  3OBF A;  3G4P A;  2OV5 A;  4I39 A;  2OAQ 1;  5E2H A;  4MN5 A;  4JF4 A;  4OLG A;  5FDH A;  4IJG A;  5I94 A;  3ICY A;  5HFO A;  2L0W A;  3IWQ A;  2OWH A;  4RYE A;  3IQA A;  3UDI A;  1E25 A;  3LGO A;  1W7F A;  4HQA A;  1PYY A;  3C7U A;  2ZQ9 A;  3PBR A;  2KDK A;  4BMW A;  5DJU A;  3D3O A;  3SW1 A;  2QZ6 A;  3LR5 A;  1TF1 A;  1OTE A;  3DBA A;  4ZRR A;  3QP8 A;  1LI9 A;  5LBR A;  3OCL A;  2ZMF A;  2GDN A;  1XGJ A;  5A91 A;  1F98 A;  3CWF A;  2ZOH A;  4I3A A;  3FV7 A;  4EES A;  2EX9 A;  4ID4 A;  1D1J A;  3ULF A;  3KO6 A;  3IXD A;  1MBL A;  3NOP C;  2P9V B;  2VV8 A;  4YIN A;  2VZW A;  1J9M A;  3IXB A;  4OOM A;  3LIB A;  4HH3 A;  3CAX A;  1Q2Q A;  2DMW A;  3LIA A;  4G3W A;  4RX2 A;  4MCW A;  5CRF A;  5HWV A;  1K56 A;  1YLJ A;  1K54 A;  2VGK A;  3P01 A;  2XQZ A;  2X71 A;  3CIT A;  3GRJ A;  3PAE A;  4M3K A;  4ZJ2 A;  1STZ A;  5AQ9 A;  1FR1 A;  3S7Q A;  1X0O A;  2O9C A;  2XF3 A;  3PBN A;  2KLI A;  1J3W A;  3LI8 A;  2EX2 A;  2M7V A;  5HAP A;  3KSH A;  5F1F A;  5A92 A;  1Z09 A;  2OLV A;  1ZG4 A;  2ZLY A;  2LB5 A;  1IYS A;  1QME A;  4NEE D;  2D01 A;  3FC7 A;  4E04 A;  1SKO B;  4H6J A;  3VP4 A;  3NOU C;  3VFH A;  4GB7 A;  4OPQ A;  1T1A A;  4R4S A;  3JPU A;  1T18 A;  5A90 A;  3F1O B;  5EM1 A;  5JYP A;  3GTC A;  3LYX A;  5DVA A;  2PAV P;  2Q0O A;  3HL9 A;  3LIE A;  5EVI D;  1TS6 A;  4UAA A;  3VP2 A;  3CHW P;  3GVB A;  2WKR A;  1V9Y A;  2AVX A;  2HZ5 A;  2LB9 A;  4X25 A;  1VB6 A;  4R23 A;  5TBM A;  2GZA A;  3MFX A;  1S66 L;  3VOZ A;  1W8Q A;  4H8R A;  4KUO A;  1NJ4 A;  4R70 A;  3K3D A;  1SDE A;  2W27 A;  4II7 A;  1K6S A;  2OSU A;  4P85 A;  5TR7 A;  3OOV A;  2Y2M A;  3BFE A;  4S2N A;  3DAV A;  3UE0 A;  3T1Q B;  3UME A;  4XT2 A;  1ESU A;  4IVI A;  4MN7 A;  3NCK A;  4Y15 A;  1IEL A;  1DP8 A;  3UE1 A;  4LV3 A;  2C5W B;  1SCW A;  2XRN A;  3C4P A;  2VJW A;  3D9Y A;  1CEG A;  3CPT A;  1M6K A;  5FQJ A;  4WMC D;  3ZFZ A;  2V0W A;  4GDN A;  5HPI A;  4HJ6 A;  5CHM A;  2J3T C;  2V0U A;  4IVK A;  1DJC A;  5L10 A;  3LID A;  5G18 A;  4Y0O A;  3MQQ A;  4JPM A;  3WS2 A;  4YNR A;  4BJP A;  3VE3 A;  1C3B A;  2PDR A;  5HDC A;  2B95 A;  3F1N A;  3QP4 A;  4YOF A;  1PIO A;  3OPL A;  1MWS A;  3ZG8 B;  4LPZ A;  2ZBB A;  3IH9 A;  3C38 A;  4QU3 A;  3KSF A;  1OTD A;  5C5K A;  3BLS A;  5G4Z A;  2J8Y A;  1HVB A;  2J7V A;  3S7N A;  5MC7 A;  3BRM A;  4KZ8 A;  3MZD A;  5FQQ A;  2YKF A;  3UE6 A;  5J8X A;  4PHT A;  4OOY A;  4NXF A;  4GOG A;  1W63 Q;  1N9N A;  4GD8 A;  2UWX A;  3H7W A;  4YFM A;  4E3J A;  3ZYT A;  4JXV A;  1LSX A;  4B93 A;  3IHB A;  2J9P A;  5HDS A;  3NBL A;  2ZL1 A;  4KZA A;  4B4Z A;  2Z2M B;  2ZC5 B;  3ZGA B;  3HLC A;  4O7D A;  3KYQ A;  1DRM A;  5CHU A;  4PM9 A;  3F1P B;  4G3K A;  3ZG5 A;  1L0G A;  3N8S A;  2HDR A;  4Y17 A;  2EXA A;  4BEN A;  4L9E A;  4MNR A;  1LL9 A;  1XJ3 A;  4KG5 A;  3DTM A;  3UB5 P;  1MXO A;  2W1R A;  1VM1 A;  3D72 A;  4R38 A;  4JKT A;  2ZD8 A;  1AWI A;  3E0Y A;  5F6A A;  4DXB A;  2RCX A;  4S2J A;  1E3U A;  1LLB A;  1L0D A;  4FCF A;  2ZM0 A;  2P9V A;  5G4Y A;  3W8K A;  5EE8 A;  2BLS A;  2A2L A;  4R3A A;  5EV0 A;  4HBT A;  5IT5 A;  2HJE A;  5DFY A;  2Y2I A;  2PR5 A;  2W3F A;  4U0X A;  1PWD A;  2J3W A;  4U0T A;  4D60 A;  3LCE A;  3N7W A;  4NXB A;  2ZQC A;  3IX8 A;  4WN5 A;  2JKR M;  5FAO A;  1K57 C;  1VHM A;  3GQZ A;  1VEU B;  2J3T D;  4EQ1 A;  4Q0H A;  1G28 A;  3RXX A;  4EUV A;  4CLC E;  5FSR A;  1CK3 A;  4EEP A;  3SS3 A;  2WZZ A;  4UEY A;  2H0Y A;  4Y3I A;  4Z9Q A;  2Q9N A;  2X01 A;  1GHI A;  2Y2N A;  1N4O A;  2FFY A;  2HPB A;  5L07 A;  4X69 A;  1PWC A;  2PYR A;  2L4R A;  1NZU A;  2O9A A;  1OT6 A;  4ARZ A;  1FQG A;  1IFQ A;  2QJ5 A;  4XXR A;  1ES2 A;  5HX9 A;  4PAU A;  1ZHH B;  4GLQ A;  3HLW A;  4DE3 A;  4WZ5 A;  3LIC A;  2VEA A;  3M2J A;  3ZNY A;  1D7E A;  2G7U A;  4NXG A;  4N1H A;  1PW8 A;  3IT9 A;  3K2N A;  1MPL A;  1G5U A;  1SHV A;  3A3D A;  4X68 A;  1XGI A;  2VK3 A;  1NXY A;  5EPH A;  4DRT A;  3E2K A;  4M4X A;  4LCL A;  3A0V A;  2W3D A;  5HL1 A;  5IU1 A;  3FKV A;  5FEF A;  3G30 A;  5HD3 A;  3IH8 A;  3UY6 A;  2WK0 A;  1FCM A;  4QHC A;  1GSW A;  1BLC A;  1HZO A;  3EQV A;  2PHY A;  1YLZ A;  5DJT A;  2O99 A;  1ERM A;  5F68 A;  4GKU A;  3QNB A;  4JBF A;  4EET B;  1S6R A;  4S2K A;  4Y0U A;  4GCZ A;  4L0L A;  5EOO A;  3A3I A;  2Y55 A;  4OPR A;  1G6A A;  4K91 A;  4FH2 A;  3PR6 A;  3SH7 A;  5AVE A;  4HH2 A;  4JF5 A;  3H82 A;  2V8F A;  2OOL A;  4Q0J A;  4HJ3 A;  3PYP A;  2V1Z A;  5FAS A;  4WM9 A;  1GSV A;  2JBF A;  1GA0 A;  3CPT B;  1CI9 A;  5DTK A;  5GLC A;  5L2F A;  2Z6C A;  3EOI A;  1Y28 A;  3R4K A;  1JNU A;  1TS7 A;  3C8C A;  1W63 M;  3OCN A;  2W0N A;  3A3E A;  2R78 A;  5EFW A;  1ZKJ A;  3MR0 A;  1JWZ A;  1XFN A;  3PBO A;  3F1N B;  1H8M A;  1PZP A;  4N9K A;  4DXC A;  3IHA A;  4HJ4 A;  4RVA A;  3OPH A;  1HD8 A;  1XJ6 A;  2PBY A;  2ZQ8 A;  4P6B A;  2XH9 A;  1UGU A;  1HLU P;  1HTZ A;  1O7E A;  3DTI A;  5EVI C;  1LL8 A;  1LL5 A;  3GSG A;  3RFB A;  3UB9 A;  4DN0 A;  3W4P A;  1FOF A;  4CLC A;  1ERQ A;  4MDZ A;  4WZ4 A;  2PU4 A;  1OT9 A;  3EWK A;  4OVD A;  5DF7 A;  3EEH A;  2HJ9 C;  3T4T A;  4A5R A;  3DTE A;  5A8B A;  2INW A;  2ZL1 B;  3P7N A;  3AGF A;  3CMZ A;  3JVV A;  5CEC A;  2EA9 A;  2WUQ A;  1ACF A;  2XR0 A;  4GD6 A;  1ONH A;  3LY3 A;  3O86 A;  3SH9 A;  4F94 A;  4ZAM A;  3IWI A;  4HHD A;  4R3J A;  3CJM A;  4HIA A;  4HP4 A;  4X6T A;  1XPB A;  5CXW A;  1QMF A;  2B18 A;  3ZQ5 A;  3V3S A;  4WL9 A;  2V1B A;  2WGW A;  2QJ7 A;  4PM8 A;  3TOI A;  4GZB A;  1RP5 A;  4AFI A;  1PWG A;  3UN7 A;  3FKW A;  3S1Y A;  2X02 A;  1VEU A;  1A0K A;  3B42 A;  1ES3 A;  2HP6 A;  1ES5 A;  2QKP A;  1SDN A;  5GL9 A;  3T1S A;  1P97 A;  3Q7V A;  1UWP X;  1L0F A;  1OPX A;  4IHQ A;  3BY9 A;  4OKP A;  3ZG7 B;  4L9F A;  3MSH A;  1K55 C;  4NET A;  2EXB A;  3LI9 A;  1NWZ A;  1LSW A;  2BAS A;  4GN2 A;  4KZB A;  3T12 B;  5TGF A;  5E2G A;  2DRW A;  3LUQ A;  4K0W A;  1T19 A;  3TG9 A;  3FPW A;  2EFX A;  2XFT A;  4KEN B;  3T4S A;  2QMI A;  2KOI A;  2PR6 A;  4QWO A;  2W1T A;  3CZD A;  3GR2 A;  3T1X A;  3DTK A;  4QY5 A;  4ZBE A;  3UB6 A;  4RA7 A;  2VA0 A;  2PBD P;  1ZC2 A;  3AGD A;  2Y4A A;  2XD5 A;  2ZM2 A;  5EM0 A;  3C2W A;  1GHM A;  4ARZ B;  4OQ0 A;  1NY0 A;  2PT7 A;  2A49 A;  4FTX A;  2OWJ A;  3WS1 A;  1ERO A;  4R6L A;  1U60 A;  3T1R A;  1IYP A;  4OH0 A;  1F2K A;  2PD7 A;  1PNE A;  3ITB A;  1KVM A;  1S0W A;  5GLB A;  3NJA A;  2EWW A;  1YLW A;  2WKI A;  3ZDJ A;  3HVF A;  3KYE A;  3NDE A;  3JVU A;  5F1G A;  3VSL A;  3VSK A;  3VP0 A;  2V8C A;  4K08 A;  5M18 A;  1TDL A;  1SKF A;  3L7H A;  4FOF A;  5K5B A;  1IEM A;  1GSX A;  2V2F F;  3FG8 A;  2R9W A;  3T50 A;  2XRO A;  4O8G A;  4BD0 A;  4GJ4 A;  3HJK A;  2P74 A;  2QWS A;  4G3V A;  3Q07 A;  3S7P A;  3VP3 A;  3TJZ C;  3MZF A;  1BSG A;  4KG6 A;  2V1A A;  1YLP A;  4WLA A;  4PM6 A;  3MZE A;  3SS4 A;  4EBN A;  3OZH A;  4X53 A;  2WGV A;  4O01 A;  1FSW A;  1E4D A;  3CG5 A;  3IS2 B;  2WAE A;  1XP4 A;  4OPZ A;  2H10 A;  3S7O A;  3RTY A;  4ZJ3 A;  3N4I A;  4JLF A;  4KZ5 A;  4HI4 A;  3UB7 A;  4JGP A;  4X55 A;  4DJ2 A;  5HWT A;  4HEF A;  4RX3 A;  2W3E A;  1KGE A;  4DE1 A;  3H82 B;  3VMA A;  2JKT M;  2Y2O A;  4QY6 A;  4EBP A;  1IOU A;  2K31 A;  3O88 A;  3W2Z A;  3HLG A;  1TD5 A;  3HRE A;  4OQI A;  2J80 A;  4MBF A;  4R4R A;  4UHU A;  2VV6 A;  2XA7 M;  3HJI A;  2Y91 A;  3IBR A;  1CF0 A;  1XKZ A;  3G35 A;  3V67 A;  4WYY A;  2XA7 S;  2I72 A;  2DCF A;  5KSC A;  4OPY A;  1FCO A;  1RGZ A;  2YKH A;  3MKF A;  4DKI A;  1WYC A;  1KDW A;  4EXO A;  3BY8 A;  4HBU A;  4LFU A;  2B5R A;  2ZC7 A;  3OLO A;  3GEC A;  4PKY G;  5CEB A;  2NUP C;  3LR0 A;  2DNS A;  2UV0 E;  3TRC A;  1I2S A;  3I7J A;  3HUM A;  3GV9 A;  3WRT A;  4CQH A;  3ISG A;  2I9V A;  4CLC B;  3M2K A;  1Y4O A;  2WYX A;  2XLN A;  3U4L P;  1L2S A;  4IED A;  4IUH A;  4OP8 A;  1LSV A;  5KSH A;  1VQQ A;  5EVE A;  2ZQD A;  2VV7 A;  3CUE C;  3K3C A;  1I5Q A;  4NK3 A;  3G31 A;  5FQK A;  4N9L A;  3WS4 A;  4BLM A;  1PI4 A;  4E6W A;  2V9A A;  2HDS A;  4GHI B;  3SS5 A;  3QHY A;  3V3R A;  3PBT A;  3HUO A;  3Q81 A;  1YLT A;  4JGO A;  4WEJ A;  2ZC3 B;  2HV1 A;  1FR6 A; 
#chains in the Genus database with same CATH homology
 4O0P A;  2Y79 A;  2ZMV A;  3E4Q A;  3PR6 A;  1F98 A;  3CWF A;  2ZOH A;  5AVE A;  4I3A A;  4HH2 A;  3BW6 A;  3IBJ A;  4EES A;  3H82 A;  2OOL A;  4Q0J A;  4HJ3 A;  3HCY A;  3PBQ A;  3ULF A;  3PYP A;  3KO6 A;  3NOP C;  5HSQ A;  1F9I A;  2VV8 A;  1GSV A;  2VZW A;  2MJ6 A;  3E4O A;  5F5Y A;  4Z1W A;  4OOM A;  3LIB A;  2O9B A;  1EW0 A;  4HH3 A;  3CAX A;  4MN6 A;  2DMW A;  3LIA A;  1XJ4 A;  4G3W A;  2QYB A;  1OTB A;  4BBV A;  1G6O A;  4MCW A;  2Z6C A;  3EOI A;  1Y28 A;  3R4K A;  1JNU A;  3RH8 B;  3KYZ A;  3T4J A;  1TS7 A;  5HWV A;  3C8C A;  1W63 M;  3OCN A;  3H9W A;  3P01 A;  2W0N A;  2L1M A;  1LT0 A;  2R78 A;  5EFW A;  2D02 A;  4WEK A;  1UWN X;  3MR0 A;  3MXQ A;  1XFN A;  3PBO A;  3CIT A;  3UE3 A;  3F1N B;  1H8M A;  1STZ A;  1P0Z A;  3BJN A;  3TW8 A;  3S7Q A;  1X0O A;  2O9C A;  4HJ4 A;  2JHE A;  1XJ6 A;  2XSS A;  3PBN A;  2KLI A;  3LI8 A;  3GDI A;  1MZU A;  1UGU A;  4EW7 A;  2M7V A;  1LL8 A;  3KSH A;  3RFB A;  3UB9 A;  4LRZ E;  4DN0 A;  2EWV A;  2LB5 A;  2W1T B;  2H28 A;  4CLC A;  3PXP A;  3BQA A;  4MDZ A;  4NEE D;  3A0R A;  3LFV A;  2D01 A;  3FC7 A;  4E04 A;  1OT9 A;  3EWK A;  4H6J A;  3NOU C;  3EEH A;  2HJ9 C;  5DF9 A;  1T1A A;  3T4T A;  4ETX A;  1T18 A;  3F1O B;  4B9O A;  3LYX A;  3LIE A;  5A8B A;  4LLO B;  2INW A;  1TS6 A;  3P7N A;  2WKR A;  3JVV A;  1V9Y A;  2LB9 A;  3EGX C;  1VB6 A;  5TBM A;  2GZA A;  3MFX A;  1S4S A;  2EA9 A;  1S66 L;  1TS8 A;  4KUO A;  4R70 A;  3K3D A;  4DMZ A;  2A24 A;  3VE4 A;  3IS2 A;  3MJQ A;  2W27 A;  4II7 A;  3T4Q A;  2FZ0 A;  4HHD A;  2P08 A;  4GS9 B;  4HIA A;  3OOV A;  4HP4 A;  2KX6 A;  5KIZ A;  2B18 A;  3ZQ5 A;  3B47 A;  4WL9 A;  2V1B A;  4EER A;  5HDD A;  2QJ7 A;  3T4L A;  3UME A;  4XT2 A;  4MN7 A;  3E98 A;  4AFI A;  4BBU A;  4UQI S;  1XFQ A;  1DP8 A;  2XRN A;  2GNX A;  4RQ9 A;  2VJW A;  1T1C A;  2ZOI A;  4LRY C;  3B42 A;  1S1Y A;  2V0W A;  3KSI A;  3VOL A;  5HPI A;  2QKP A;  4HJ6 A;  3UB8 A;  1P97 A;  1ZTU A;  2J3T C;  2V0U A;  1UWP X;  4Y5F A;  1OPX A;  5L8M A;  5AVF A;  4OOL A;  3UMD A;  4IHQ A;  3BY9 A;  4BWI A;  3NHQ A;  3LID A;  4L9F A;  4KQD A;  3MQQ A;  5DFX A;  4MMN A;  3BWL A;  3LI9 A;  2P04 A;  4YNR A;  4BJP A;  3VE3 A;  2PDR A;  5HDC A;  1NWZ A;  3F1N A;  4YOF A;  1LSW A;  2JN7 A;  2BAS A;  1N9L A;  2CMN A;  4LPZ A;  1MKM A;  2ZBB A;  4CLC C;  1KOU A;  3C38 A;  1OTA A;  2PD8 A;  3LUQ A;  3KSF A;  5I5L A;  3VV4 A;  1OTD A;  5C5K A;  1T19 A;  5G4Z A;  4EU0 A;  3R7W B;  3S7N A;  3FPW A;  5MC7 A;  5HL6 A;  1OJ5 A;  2WKP A;  2GJ3 A;  3T4S A;  2KOI A;  2YKF A;  3UE6 A;  2PR6 A;  4PHT A;  2HGV A;  2GX5 A;  2W1T A;  4NXF A;  5F69 A;  1W63 Q;  1N9N A;  1V9Z A;  3H7W A;  3UB6 A;  3ZYT A;  3CLO A;  1LSX A;  2VA0 A;  4B93 A;  3F1O A;  4IUK A;  2M1C A;  3NOT C;  1BYW A;  2K7S A;  5HDS A;  3OC2 A;  1ODV A;  1DP9 A;  3C2W A;  4I5S A;  3KSG A;  3MMH A;  4ARZ B;  3KYQ A;  2PT7 A;  2WKQ A;  3O5Y A;  2OWJ A;  2M7U A;  4I38 A;  1DRM A;  2B02 A;  3TE8 A;  5TJJ A;  3F1P B;  4F3L A;  2PYP A;  4G3K A;  1P9W A;  4R6L A;  3MQO A;  1TS0 A;  3G6O A;  2QHK A;  2PD7 A;  3EGD C;  3NJA A;  2EWW A;  4WF0 A;  4GS9 A;  5AJG A;  2W3G A;  4L9E A;  4Y2F A;  3JVU A;  2FH5 A;  4GHI A;  1XJ3 A;  4HY8 A;  4K08 A;  2Z6D A;  3CI6 A;  4FOF A;  3MF0 A;  3T4O A;  2W1R A;  4H6J B;  3D72 A;  4R38 A;  5K5B A;  1GSX A;  5J7E A;  3FG8 A;  3T4K A;  2O0Y A;  3T50 A;  2XRO A;  4O8G A;  3E0Y A;  4GJ4 A;  5F6A A;  3HJK A;  4UQI M;  2QWS A;  4G3V A;  3U2A A;  3S7P A;  1YKD A;  4KUK A;  3A0S A;  3TJZ C;  2V1A A;  2NUT C;  1YSQ A;  4EEU A;  4WLA A;  3MQ0 A;  1WA9 A;  5TBM B;  3FPV A;  2JKR I;  5G4Y A;  5HZH A;  2A2L A;  2A24 B;  4O01 A;  4R3A A;  4LRX C;  3IS2 B;  2JKT I;  5IT5 A;  2HJE A;  5IS1 A;  4ETZ A;  5DKK A;  5DFY A;  2VGL M;  5CX7 A;  2PR5 A;  4KQO A;  3S7O A;  3RTY A;  3BQ8 A;  1NLZ A;  3PBS A;  2W3F A;  4I3I A;  2OAP 1;  5J3W A;  2VGL S;  4HI4 A;  2IA2 A;  3UB7 A;  2VLG A;  4WEL A;  4WUJ A;  4JGP A;  3LR3 A;  2J3W A;  3CUE A;  4XT2 B;  4DJ2 A;  5HWT A;  1F5M A;  4NXB A;  4WN5 A;  2HF6 A;  2JKR M;  4HOI A;  3R7W A;  4YWZ A;  1VHM A;  2W3E A;  3B33 A;  5HWW A;  2J3T D;  4EQ1 A;  4HNB A;  4Q0H A;  3H82 B;  2W3H A;  2JKT M;  1G28 A;  4PKY A;  4CLC E;  4EUV A;  4BBT A;  1IOU A;  2K31 A;  4EEP A;  2P7J A;  4L9G A;  4UEY A;  1OJG A;  5DKL A;  3W2Z A;  1S4R A;  4Y3I A;  1TD5 A;  4FSF A;  3EEA A;  4NXE A;  2J80 A;  3PHY A;  2VV6 A;  2XA7 M;  2PYR A;  3HJI A;  3IBR A;  3V67 A;  3KX0 X;  2L4R A;  4I3J A;  2VX8 A;  2O9A A;  4NKP A;  1OT6 A;  4ARZ A;  1IFQ A;  4P6Z M;  3LR4 A;  4CLC D;  2XA7 S;  2QJ5 A;  3E4P A;  4PAU A;  1MC0 A;  1ZHH B;  4GLQ A;  1NRJ A;  3C30 A;  4P6Z S;  1DP6 A;  2Y8H A;  1OTI A;  3F1P A;  3LIC A;  2VEA A;  2YKH A;  3EQU A;  1D7E A;  2G7U A;  4NXG A;  5HPF A;  4EXO A;  3BY8 A;  3K2N A;  4ME4 A;  3OLO A;  3GEC A;  4PKY G;  1YSP A;  2NUP C;  3LR0 A;  3TRC A;  4JGQ A;  1YAX A;  3H7W B;  1H3Q A;  4DJ3 A;  4M4X A;  1S1Z A;  4CQH A;  3A0V A;  2W3D A;  4JGR A;  5J4E A;  1NLY A;  2I9V A;  5IU1 A;  4CLC B;  1T1B A;  5HD3 A;  3OBF A;  4I39 A;  2OAQ 1;  1S67 L;  4MN5 A;  5HD5 A;  4IJG A;  3ICY A;  3LIF A;  5FL3 A;  4QPR A;  2L0W A;  1GSW A;  2OWH A;  4IUH A;  3EQV A;  1LSV A;  4F3L B;  5KSH A;  4HP9 A;  2VV7 A;  2PHY A;  3CUE C;  3K3C A;  1XJ2 A;  4HQA A;  5DJT A;  4GW9 A;  2O99 A;  3PBR A;  2KDK A;  2VKS A;  5F68 A;  2K2N A;  4BMW A;  5DJU A;  3D3O A;  1P9R A;  3SW1 A;  2V9A A;  3LR5 A;  4GHI B;  4EET B;  1TF1 A;  1OTE A;  3DBA A;  1D06 A;  4ZRR A;  3PBT A;  4GCZ A;  4JGO A;  4WEJ A;  1N9O A;  4L0L A;  5LBR A;  3OCL A;  2HV1 A;  4Q0I A;  2ZMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...