1ALQA

Circularly permuted beta-lactamase from staphylococcus aureus pc1
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
263
structure length
259
Chain Sequence
SEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEFAAAAKELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CP254 BETA-LACTAMASE
publication title Circularly permuted beta-lactamase from Staphylococcus aureus PC1.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 90
structure length 259
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1997-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1alqA00
2PBYA 1DJAA 2ZM0A 4X6TA 4OPZA 3LEZA 4FCFA 4R0QA 5HFOA 3BLMA 5J8XA 1HTZA 4N1XA 4OQ0A 1ES4A 5FQKA 2ZJ9A 1XKZA 4KENB 5EVIA 3HUNA 3BLSA 4O7DA 3G2ZA 3GR2A 4WM9A 4RYEA 1PZPA 4JLFA 4LV0A 3SH7A 4JF5A 5G18A 4S2IA 3GMWA 2ZQCA 5FA7A 3ZVWA 3UDIA 5HAQA 4BLMA 1KE3A 1W8QA 1K25A 5FAPA 1YMSA 3IXGA 1FQGA 4EBNA 1J9MA 1CI8A 5FI2A 4U0TA 1OMEA 4X55A 2OV5A 3TOIA 1S6RA 3W8KA 3A3DA 1BZAA 4GN2A 1FSWA 1SHVA 4CJNA 5CGSA 4KZ5A 3DWZA 4GD6A 3NDEA 4BENA 5FASA 1XPBA 4S2OA 2WZZA 2R9XA 2H0TA 4N9KA 1ESIA 1PWGA 2UWXA 3VFHA 1Q2QA 1PYYA 1XA7A 3GQZA 3UY6A 1DJBA 3PTEA 3TG9A 3WRTA 1ESUA 3HLDA 3M6BA 3N6IA 5EVIB 1E25A 4U3TA 1RGZA 1TDLA 2XD5A 4Z9QA 1NZUA 4ZJ1A 4HBUA 3LCEA 4H8RA 4FH2A 2JC7A 2Y2IA 4RVAA 2ZLYA 3HLFA 4OQHA 3NCKA 4LV1A 5FI7A 4JXSA 4EBPA 3A3JA 3AGEA 4GZBA 4KG6A 3G30A 4DE0A 3HBRA 1IEMA 2C5WB 2XFSA 5CGWA 1SDEA 2EX2A 5TFQA 4WZ5C 4ZDXA 5GHYA 3MXSA 1YMXA 1JVJA 2HP6A 4LV2A 2IWDA 3BFCA 2Q9MA 3E2LA 3NBLA 4KZAA 4NETA 4OONA 3UE0A 5CGXA 1LL9A 1CK3A 3D4FA 4K0XA 1WE4A 1K54C 2JE5A 3OZHA 3PAGA 4OOYA 3FKVA 1I5QA 3SS5A 4JKTA 1XX2A 3LY3A 5CRFA 1XXMA 5DTKA 4DKIA 1K55C 2ZC6B 5FI6A 3S1YA 5CTMA 2ZC5B 1HZOA 3FKWA 2ZQ7A 3IF5A 4WZ5A 2EX9A 5BOHA 3ITAA 4ID4A 1RCJA 5JYOA 1LHYA 3HVFA 2XF3A 1XGIA 4C6YA 4K0WA 1MY8A 2ZQAA 4IVKA 5E2HA 1KVMA 1MXOA 4WEJA 4E3JA 4HEFA 5CXWA 3SS3A 2E8IA 4UAAA 1BTLA 2J9PA 4DF6A 1PW8A 1MWSA 2Y2PA 1K55A 4NK3A 4UA7A 1L0FA 2VGJA 4ZTKA 3IF6A 2WGWA 4C3QA 1K56D 3GSGA 5AQ9A 3ZG5A 3V39A 3VSKA 1N4OA 5GLAA 3N7WA 1MWTA 4KG2A 1Z6FA 3LO7A 2EXBA 5DTTA 3O88A 4B4ZA 3FZCA 3ZG7B 3ISGA 5A92A 2H5SA 1HD8A 3IWOA 1LL5A 2H10A 5M19A 4BL2A 3RXWA 5M18A 5EVLA 1FR6A 5EE8A 3P09A 2Y2OA 4QD4A 1CI9A 4QY6A 1LI9A 3M2KA 3DW0A 1L0DA 1W79A 2HDSA 3IHAA 5HARA 2DNSA 3ZGAB 1U60A 3VFFA 4F94A 1AXBA 4DDYA 1Y54A 4KZ4A 3C4OA 4A5RA 2Y2KA 4OPRA 4LCLA 4XUZA 2WGWB 2EX6A 5FATA 1TVFA 1IKIA 3E2KA 4KZ9A 4Y0TA 4Y7PA 3GRJA 4WYYA 2Y2HA 5EVIC 4R3BA 5E2FA 3W4PA 1KDSA 4E6XA 4JXVA 4Y0OA 4OQGA 3UDFA 3V3RA 5HAPA 5TGFA 3G31A 2EX8A 3BFEA 4R3JA 3Q07A 1FCNA 3OPRA 2XH9A 1M6KA 1KE4A 2RCXA 1HVBA 5HX9A 2WZXA 4S2KA 3MZDA 3QNBA 1C3BA 5JYPA 1CEFA 5GLDA 3I7JA 2WKIA 1LI0A 2EFUA 2XQZA 5FSRA 2P74A 1YLZA 1IELA 3UO9A 4X68A 1ERMA 3BFDA 3Q7ZA 1VQQA 3ZG0A 3VP2A 1MPLA 1GA9A 2ZQ9A 1EWZA 3NC8A 1S0WA 3HLEA 4MLLA 1GHIA 1JTDA 1G68A 2G2UA 3HUOA 1N9BA 4KZ6A 4QU3A 4P87A 4MBFA 5FAQA 3ZDJA 1ZKJA 4P85A 5FQMA 2XGNA 4QJGA 4GDNA 1YLTA 4MBHA 4WELA 5HW3A 2XFTA 1I2WA 1H5XA 4LCMA 1ZG4A 2A49A 3MKFA 3VSLA 4UA9A 4OP5A 2OSUA 3BECA 4D2OA 3PBTA 1ES2A 2P9VA 3B3XA 2HDRA 4C75A 2IWBA 5EUAA 1K56A 4R4SA 5FDHA 4OP8A 4EV4A 1ERQA 1MWRA 1K38A 2I72A 4FD8A 2WGVA 2Y2QA 4S2JA 4UHUA 5GLCA 4LV3A 3MKEA 1O07A 1XP4A 2FFFB 3IHBA 4WZ4A 4XUXA 3IXHA 5FQ9A 3SH8A 2PU2A 2ZQ8A 4OPYA 5A91A 4GNUA 4BL3A 3BFFA 3NI9A 3A3IA 4N92A 5EPHA 3G2YA 3V50A 1I2SA 1IYPA 3PBRA 3N8LA 1EROA 3MZEA 3O86A 1E3UA 5FQJA 3ZCZA 4LENA 1WYCA 4FSFA 4WMCD 3CMZA 1ES3A 1YLPA 1YT4A 4IBRA 3BEBA 4ZBEA 4RX2A 1IYSA 2Y91A 3Q1FA 4OOLA 4PM9A 3IF6C 1DJCA 2HDQA 5GLBA 3PBSA 3RJUA 2P9VB 3SOIA 4E3KA 1GHMA 1XGJA 3Q7VA 3IXDA 3VP1A 2QPNA 2EXAA 1RGYA 1L0GA 5DF8A 2Y55A 3HLGA 4JXGA 1E4DA 2VGKA 5L2FA 2Y59A 4IEDA 3VMAA 4UA6A 5TR7A 4BQMA 1TEMA 2X02A 1SKFA 3W4QA 4B88A 1KVLA 4GB7A 4CPKA 5AQAA 2Y2NA 5DF9A 4OKPA 1QMFA 1PIOA 3WS1A 3ZHHA 1W8YA 2XLNA 3OPHA 4QB8A 5AQBA 4GKUA 4QY5A 3A3EA 4P0MA 4L0LA 4BD0A 4S2LA 4IVIA 1PWCA 2ZM2A 4QHCA 5E2GA 3DTMA 1JWPA 3G35A 3WS5A 4KZ3A 1NY0A 1O7EA 3CG5A 1PW1A 2ZC7A 5E43A 4MNRA 1BULA 4FH4A 5F82A 3UE3A 1GCEA 3Q7VB 2XEPA 5CEDA 3IQAA 3GTCA 1FOFA 3BFGA 3NY4A 1BLPA 2FFYA 3ZG8B 4PM5A 4S2PA 1JTGA 3VP3A 1NJ4A 1NZOA 5E2EA 5EOEA 3ZNTA 1BLHA 5CTNA 4N1HA 3IF6B 4S2NC 2Y2GA 5FQIA 5A90A 4ZAMA 2Z2LB 3O87A 4OLGA 5F83A 4DE2A 2A3UA 2HDUA 3FWLA 5KSCA 1WYBA 3M6HA 3N8SA 2X71A 3UPNA 1IKGA 2ZM8A 2HP9A 3UDXA 4DRTA 4RA7A 2Z2MB 5U47A 2BLSA 4DE3A 2Y4AA 2ZQDA 4PM7A 4S2NA 3UPOA 3TSGA 1BSGA 2V2FF 1YLJA 3A3FA 4K91A 4R23A 2XR0A 3MXRA 4OOMA 5KMWA 2JCHA 5GHXA 2WKHA 2V1ZA 3GV9A 5I94A 2B5RA 4KQRA 1K6RA 3PBOA 3UPPA 3ZNYA 5CERA 4BJPA 3EQVA 3C7UA 1YM1A 3MFDA 3GVBA 3IXBA 2WADA 3ZFZA 4WMCA 3IH9A 1MBLA 1ES5A 3S4XA 3WS0A 4KQOA 3WWXA 1EI5A 1MKIA 1YLYA 3LY4A 2HP5A 2HPBA 4KZBA 3WS4A 3OCLA 1M40A 4ZJ3A 1RP5A 4PM8A 1K4FA 1ONHA 5M1AA 3OC2A 4GDBA 3M2JA 3V3SA 2OLUA 1GHPA 2C6WB 4ZJ2A 4JF4A 4P6BA 1QMEA 4WEKA 1G6AA 3IWIA 4YINA 1CEGA 3IT9A 3VP0A 1GA0A 5HL1A 4RX3A 1FR1A 2CC1A 3IWQA 3SH9A 4GOGA 1ZG6A 5CHUA 3HLCA 2DRWA 2OLVA 4E3LA 5GHZA 1FCMA 3SS4A 5FQQA 2Y2LA 4N9LA 1L2SA 5IHVA 3WS2A 4HESA 1NYMA 3V5MA 3ITBA 3DWKA 3HLWA 4E3OA 2H0YA 4DE1A 2JBFA 1LLBA 5CHJA 2WKEA 1TDGA 1ZC2A 5A93A 2V20A 3PAEA 3UE1A 4YFMA 4B4XA 4BD1A 4JBFA 4KZ7A 4PMAA 4Q8IA 1K6SA 2WGIA 4KG5A 4E3NA 3C7VA 2WYXA 3O3VA 5DF7A 1H8YA 3FYZA 5CECA 5FAOA 4EBLA 2R9WA 3C5AA 3HLBA 1KGGA 4X56A 1NRFA 5AQ7A 1KGEA 1ALQA 2X01A 5GL9A 5EVID 4OLDA 4KQQA 4E3MA 2J7VA 3NIAA 1YLWA 1H8ZA 3QHYA 5F1GA 4OH0A 3PBQA 4DXCA 3ZG9B 1FSYA 4WBGA 3BRMA 1NXYA 3VOZA 3IH8A 3HUMA 3UNWA 1PZOA 3BM6A 4JPMA 3RXXA 1YQSA 4S2MA 4OVDA 2BG1A 4GD8A 4Y0UA 2XD1A 1BLSA 1PWDA 2Q9NA 2QZ6A 4XXRA 5D3OA 2WUQA 1IYOA 2XK1A 3EQUA 5HAIA 1BT5A 3AGDA 5KSHA 2ZMAA 3BYDA 3JYIA 4IBXA 1BLCA 3ZVTA 2EFXA 1VM1A 1PI5A 3PBNA 4EUZA 5DVAA 4HBTA 5F1FA 3HL9A 1K54A 2ZC3B 4EQIA 1JWZA 3S22A 3FV7A 3Q81A 2J8YA 2GDNA 2RL3A 4E3IA 5KZHA 1L0EA 3G4PA 3UN7A 2G2WA 1KGFA 3MBZA 5DTSA 3HREA 4JXWA 2QMIA 3OPPA 4M3KA 4X69A 4MEZA 3NDGA 2DCFA 1BUEA 3VOYA 1JWVA 3W4OA 1K57C 1SCWA 3OCNA 4E6WA 2J9OA 2IWCA 2XDMA 1FCOA 3CJMA 5CHMA 1KE0A 4PM6A 1E3UD 1SDNA 3G32A 1MWUA 2Y2JA 5EECA 1K57A 2ZC4B 3VP4A 1W5DA 3OPLA 3N8RA 4OQIA 2Y2MA 3P98A 4R4RA 4R1GA 3QNCA 1NYYA 4MBKA 3N4IA 2ZD8A 4U0XA 4X53A 3G34A 5EOOA 1KDWA 1DY6A 4EWFA 5CEBA 3CZDA 1IYQA 3C4PA 4KZ8A 2WAFA 1XA1A 2WK0A 4PPRA 3MZFA 1W7FA 1K4EA 2WAEA 1PI4A 4JF6A 4OPQA 3WRZA 4DXBA 2PU4A 1Q2PA 4DDSA 1ONGA 3Q82A 3AGFA
chains in the Genus database with same CATH superfamily
3FPVA 2E8JA 4OPZA 4CLCA 5J4EA 4R0QA 4OQ0A 3VE4A 1DRMA 2J3TD 4KUOA 4WM9A 4S2IA 1P97A 1HLUP 4BLMA 4I5SA 3IXGA 1CI8A 1VB6A 1DP8A 1S6RA 1FSWA 5CGSA 2LB5A 2EWVA 5FASA 3NDEA 3IBRA 4N9KA 1PFLA 1D06A 1ESIA 4CLCB 1XFNA 3VFHA 2PDRA 3UY6A 1DJBA 3PTEA 3TG9A 3KSGA 4I3AA 4PHTA 4Z9QA 4QPRA 4ZJ1A 3LCEA 4H8RA 4GHIA 4XT2A 3MR0A 2VA0A 4EBPA 3AGEA 4GZBA 3G30A 4DE0A 3HBRA 1IEMA 5CGWA 4H6JB 4WZ5C 5GHYA 2HP6A 2L1MA 4OONA 3UE0A 2BASA 1K54C 4OOYA 1I5QA 2A2LA 2PAVP 3SS5A 3U2AA 4JKTA 5CRFA 1XXMA 5DTKA 4Q0JA 5IU1A 1HZOA 2OWJA 3IF5A 3ITAA 1LHYA 1XGIA 1FIKA 2J3WA 4IVKA 2I9VA 1MXOA 4XT2B 3BY9A 2HJEA 2J9PA 1MWSA 2Y2PA 1A0KA 4HP9A 3IF6A 1K56D 1N4OA 1JNUA 3B47A 3N7WA 1Z6FA 2PR6A 3C38A 3O88A 1OTAA 3NOTC 3QP8A 4I3JA 3IWOA 2JKRM 1UWNX 5EE8A 3CITA 1S66L 1CI9A 3DW0A 5MC7A 5HARA 3IHAA 3ZGAB 5HDCA 4EERA 2NUPC 2V1AA 4KZ4A 4A5RA 4OPRA 3C2WA 1UWPX 3B33A 1F2KA 1TVFA 4KZ9A 5FATA 3QP4A 4I3IA 4Y0OA 2XA7S 4OQGA 3UDFA 2O9CA 3EOIA 4EU0A 2XH9A 2JKTI 1N9NA 3ZQ5A 5GLDA 2XQZA 3FPWA 1YLZA 4X68A 1ERMA 3Q7ZA 1EWZA 2VGLS 2G2UA 2QYBA 1N9BA 4P87A 2YKFA 2XGNA 3CHWP 4MBHA 4WELA 5EV0A 3PBTA 2P9VA 1XFQA 1K56A 5FDHA 4OP8A 2I72A 2WGVA 2Y2QA 4S2JA 4UHUA 3MKEA 1O07A 2O0YA 1XP4A 2FFFB 3IXHA 5FQ9A 4GNUA 3BFFA 4N92A 5EPHA 1YSPA 1EROA 3ZCZA 3CMZA 3KO6A 4CQHA 2PD8A 3Q1FA 4OOLA 4PM9A 3OLOA 5GLBA 2ZOIA 3SOIA 2P9VB 3VP1A 1RGYA 2Y59A 1AWIA 4IEDA 3VMAA 2XA7M 4UA6A 5TR7A 1SKFA 5AQAA 3PR6A 5DF9A 3WS1A 1PIOA 3R7WB 4Y17A 4ESPA 1D1JA 3OPHA 4X1LA 3BQ8A 3A3EA 4QY5A 2OWHA 3RTYA 1JWPA 3G35A 1N9OA 4FH4A 5F82A 2XEPA 4IJGA 3IQAA 5F68A 3BFGA 2QJ5A 4S2PA 1Y28A 4KUKA 5E2EA 1H0MA 4N1HA 3NOUC 2VV6A 3BY8A 3FWLA 3D72A 1XJ6A 3UPNA 3F1PA 3UDXA 4L9EA 4DE3A 2M7VA 4PM7A 4S2NA 3TSGA 1BSGA 3UB5P 1YLJA 3A3FA 5I5LA 4K91A 4R23A 2XR0A 5DJTA 5J3WA 2JCHA 5I94A 4EXOA 2XRNA 3ZNYA 5CERA 3C7UA 3MFDA 2WADA 4JGPA 1T18A 5EM1A 1EI5A 3LY4A 3T4QA 2HP5A 2ZMFA 4KZBA 3V67A 5C5KA 4ZJ3A 1ONHA 3F1PB 4GDBA 4FUWA 2OLUA 4P6BA 4WEKA 1GA0A 4E3LA 3P7NA 5GHZA 3SS4A 4L9FA 3HLWA 3C30A 4E3OA 5FDSA 1LLBA 5CHJA 1ZC2A 5A93A 4Y2FA 1VETB 3PAEA 4KZ7A 3A0RA 1MC0A 2PYPA 3C7VA 5DF7A 1H8YA 5CECA 4M4XA 4G3VA 4EBLA 3C5AA 4X56A 4DMZA 1NRFA 4KQQA 2J7VA 1DP9A 3NIAA 3QHYA 4WBGA 1NXYA 5DFYA 4S2MA 2V8CA 4HJ4A 5D3OA 3S7NA 2QZ6A 2WUQA 3EQUA 2ZMAA 3LEQA 2EFXA 5DVAA 4HBTA 1K54A 1JWZA 3FV7A 5KZHA 3IX8A 1L0EA 3UN7A 5DTSA 3LI9A 4JXWA 2QMIA 3NDGA 1K57C 1T1BA 4G3WA 5EVEA 2D02A 1SZVA 2J9OA 3E0YA 5IS1A 4WN5A 5CHMA 4PM6A 1E3UD 5EFWA 2VZWA 2ZC4B 3K3CA 3OPLA 4OQIA 1S1ZA 3UE6A 2ZD8A 4X53A 5CEBA 1DY6A 4X1MA 3MZFA 2V0UA 3T4OA 3F1OB 5FEFA 3CUEC 2ZM0A 3FC7A 4NXFA 2Q0OA 4FCFA 5J8XA 5HZHA 1XKZA 4KENB 4O7DA 3GR2A 1S1YA 5G18A 3MJQA 5FA7A 4F3LA 5FI2A 3TOIA 3A3DA 5HPFA 1BZAA 4GN2A 4CJNA 2VJWA 2QJ7A 4GD6A 3DTIA 1XPBA 4S2OA 2WZZA 2R9XA 3EEHA 1PWGA 2M7UA 2UWXA 3VV4A 2KOIA 1ESUA 3M6BA 1E25A 1RGZA 1TDLA 2XD5A 4FH2A 2JC7A 4R70A 3UMEA 4Y15A 4RVAA 3HLFA 4F3LB 1NRJA 4LGWA 3EEAA 5FI7A 5AVFA 4KG6A 4EESA 5L8MA 5EVLA 4DRTA 5CGXA 4K0XA 3OZHA 3PAGA 1H3QA 2VV8A 1K55C 3S1YA 5CTMA 4ID4A 3UB9A 4JGOA 3JVUA 3HVFA 4C6YA 4K0WA 1MY8A 4HIAA 5E2HA 1KVMA 4WEJA 4E3JA 4HEFA 5CXWA 5HD5A 3SS3A 2E8IA 5HDDA 1L0FA 2JN7A 3T4JA 4UEYA 4ZTKA 2WGWA 4C3QA 3GSGA 2FH5A 5AQ9A 3V39A 1MWTA 4KG2A 3MQOA 1T1AA 2WKRA 2EXBA 5DTTA 5AVEA 3ZG7B 5A92A 2H5SA 1HD8A 1LL5A 3LUQA 3GECA 4BL2A 3RXWA 3P09A 2K7SA 4QY6A 3M2KA 4DJ2A 2DNSA 1U60A 2MJ6A 3VFFA 4F94A 3H82A 4DDYA 1OTDA 2WGWB 2M1CA 4WYYA 2Y2HA 3MQQA 1KDSA 4JXVA 3E98A 5TBMA 3V3RA 5HSQA 3D9YA 5TGFA 3G31A 1VEUA 3OPRA 4MN7A 1KE4A 1WA9A 1HVBA 2ZL1A 5HX9A 4ETXA 5HWWA 3LR5A 2WZXA 3MZDA 3QNBA 4Z1WA 1IOUA 3LIDA 1CEFA 1TF1A 5FSRA 4WL9A 4Y13A 2K2NA 2WKPA 4I38A 2JKTM 4Y5FA 3ZG0A 3NC8A 1S0WA 3HLEA 4MLLA 3V3SA 4QU3A 2D01A 3BJNA 4HH3A 2DMWA 2LB9A 5HW3A 2YKHA 1I2WA 1ZG4A 5DJUA 3BECA 5F69A 2ZL1B 4D2OA 4BMWA 4EV4A 4LPZA 4FD8A 5GLCA 5IT5A 1NWZA 3IHBA 1G6OA 2W1TA 3S7QA 5A91A 4I39A 1W63M 2W0NA 1I2SA 1IYPA 1DP6A 2BTFP 1WYCA 4GCZA 4WMCD 1ES3A 4IBRA 1IYSA 1P9RA 1X0OA 2HDQA 3RJUA 3BQAA 3Q7VA 2QPNA 1L0GA 4GHIB 4RQ9A 1TEMA 2X02A 3NOPC 1KVLA 4GB7A 1OTEA 1OT9A 1T1CA 1MKMA 3ZHHA 5FL3A 2XLNA 4QB8A 2PR5A 4QWOA 4P0MA 4MMNA 5E2GA 3DTMA 3WS5A 4KZ3A 1NY0A 1O7EA 1PW1A 5HWTA 1BULA 5L07A 3Q7VB 5CEDA 3KYEA 3GTCA 1FOFA 3NY4A 3ZG8B 1TD5A 2W3FA 1JTGA 5A8BA 1NZOA 3MS6A 2Z6DA 3IF6B 4NKPA 5FQIA 4HNBA 4DE2A 4OLGA 5F83A 2HDUA 1WYBA 3S7OA 4O8GA 5HWVA 1F5MA 5U47A 4Q0HA 3L9KA 4YOFA 2WKHA 3LIAA 2V1ZA 3GV9A 4KQRA 3UB8A 2WKQA 1YM1A 3IXBA 4WMCA 3IH9A 1ES5A 3S4XA 3JVVA 3WS0A 3WWXA 1YLYA 4JGRA 3WS4A 1LL8A 1K4FA 3EGDC 5L09A 2P04A 2C6WB 3CUEA 1QMEA 4ETZA 5DKKA 1FR1A 3FG8A 4WUJA 1S4SA 1ZG6A 5FQQA 4N9LA 1NYMA 3V5MA 3ITBA 1UGUA 2GZAA 3UE1A 1ODVA 3K2NA 4PMAA 1K6SA 3PYPA 5FAOA 1KGGA 4EETB 1NLZA 5AQ7A 1ALQA 4FOFA 3UB7A 5GL9A 4E3MA 1YLWA 4OH0A 4DXCA 3BRMA 3NECA 1YQSA 2BG1A 2XD1A 1PWDA 3MQ0A 4L9GA 2XK1A 2W3DA 3AGDA 2JKFA 3JYIA 3ZVTA 3PBNA 3L7HA 3LR3A 3Q81A 2QKPA 1XJ3A 1KGFA 3VOYA 2L4RA 1JWVA 3NHQA 3MSHA 2XDMA 1FCOA 1OPXA 3W2ZA 5EECA 3QP2A 4GW9A 3H7WA 2P7JA 3IS2A 4LFUA 1MZUA 5EOOA 4EWFA 4CLCC 2G7UA 3NJAA 3C4PA 4KZ8A 2WAFA 1K4EA 4JF6A 1ONGA 3Q82A 2HF6A 1DJAA 2PBYA 4X6TA 1KOUA 3S7PA 5HFOA 3ZYTA 3BLMA 1HTZA 4N1XA 5FQKA 2ZJ9A 2INWA 3HUNA 3BLSA 3G2ZA 4RYEA 3O5YA 1PZPA 3SH7A 3IS2B 2OOLA 2ZQCA 3MXQA 3UDIA 5HAQA 1KE3A 4ZRRA 1K25A 1FQGA 1TS7A 1J9MA 4GJ4A 4CLCE 4EBNA 2J80A 2W27A 4U0TA 2OV5A 2H28A 3RFBA 1Y4OA 2H0TA 5F5YA 1Q2QA 1PYYA 1XA7A 3GQZA 5HPIA 3WRTA 4O01A 4U3TA 4LRXC 1NZUA 2KLIA 4NXGA 2HJ9C 2ZLYA 4OQHA 3NCKA 2OAQ1 2XFSA 5TFQA 2EX2A 4ZDXA 3MXSA 1YMXA 4LV2A 2IWDA 3BFCA 3NBLA 1LL9A 1CK3A 2JE5A 1XX2A 3LY3A 4DKIA 3LYXA 2ZC6B 5FI6A 4MN5A 3KX0X 2ZQ7A 4WZ5A 4R38A 5F6AA 2PYRA 5JYOA 4EEUA 4NXEA 4O0PA 3NULA 3JPUA 1G5UA 4UAAA 1BTLA 4DF6A 1PW8A 4UA7A 2VGJA 1TS8A 3QP5A 5GLAA 3LIFA 4B4ZA 3H9WA 3TE8A 3FZCA 3ISGA 2H10A 3DTEA 5M19A 1FR6A 2ZOHA 4QD4A 5FEGA 2HDSA 4IUKA 3LIEA 3C4OA 4IHQA 2Y2KA 5K5BA 1VHMA 2EX6A 3OBFA 1IKIA 1G28A 3GRJA 5EVIC 3TJZC 4YNRA 4R3BA 5E2FA 3P01A 3W4PA 5HAPA 3Q07A 3R4KA 5G4ZA 3A0SA 3ULFA 4HOIA 2RCXA 1C3BA 4K08A 5DKLA 5JYPA 2WKIA 2EFUA 3LGOA 2P74A 1IELA 3UO9A 3VP2A 4DJ3A 1MPLA 3T1QB 2ZQ9A 1GHIA 3HUOA 1ZKJA 3MMHA 4QJGA 4GDNA 1YLTA 4MDZA 4LCMA 2A49A 3MKFA 4OP5A 2OSUA 2B02A 3B3XA 2IWBA 5EUAA 1ERQA 1K38A 2W3EA 3KYZA 4WZ4A 3SH8A 2PU2A 2ZQ8A 4OPYA 4NEED 4BL3A 2VK3A 3NI9A 3A3IA 3G2YA 3V50A 3KSIA 3MZEA 2VKSA 3O86A 1E3UA 2A24A 2R78A 3EWKA 2Y8HA 4FSFA 4ARZA 1YLPA 1YT4A 4CLCD 3BEBA 4ZBEA 4RX2A 4HJ6A 3PBSA 4E3KA 1GHMA 1XGJA 3IXDA 4HH2A 3T1SA 2Y55A 3HLGA 4JXGA 1E4DA 4KQDA 4BQMA 3IX3A 4CPKA 2PBDP 1IFQA 2ZBBA 3B42A 2B18A 3LI8A 5AQBA 3KSFA 2Z6CA 2A24B 4GKUA 4BD0A 4IVIA 1S67L 2ZM2A 4ARZB 3T4TA 4QHCA 1FILA 4Y3IA 3CG5A 2ZC7A 4MNRA 4WLAA 1GCEA 1TS0A 4PM5A 3VP3A 1NJ4A 3ZNTA 2W3HA 5CTNA 4S2NC 5A90A 4ZAMA 3T4KA 2Z2LB 3O87A 5KSCA 3M6HA 2X71A 2UV0E 4E04A 2ZM8A 4RA7A 2Z2MB 2BLSA 4MN6A 2ZQDA 3A0VA 3QP6A 5CX7A 2V2FF 3MXRA 4OOMA 4FTXA 5GHXA 3SW1A 3H82B 4BJPA 3EQVA 1MBLA 3TW8A 1M40A 3IX4A 3KSHA 5TBMB 2V1BA 1L3LA 1Z09A 5M1AA 3OC2A 3M2JA 4ZJ2A 1VEUB 4JF4A 4LLOB 2XSSA 3IWIA 2P08A 1CEGA 4YINA 3VP0A 4BWIA 5HL1A 1CQAA 2V8FA 3E4QA 3IBJA 1YKDA 3HLCA 1SKOA 3LR0A 4H6JA 3WS2A 3DWKA 2H0YA 4DE1A 2JBFA 4YFMA 4JBFA 2GX5A 2WGIA 2V9AA 3FYZA 5J7EA 1LSVA 4ME4A 1D7EA 1EW0A 2KDKA 2R9WA 2OAP1 5EM0A 1KGEA 3E4OA 2X01A 5EVID 4OLDA 1XJ2A 1H8ZA 1SKOB 3PBQA 3ZG9B 3IH8A 4JPMA 3BM6A 2W1TB 3RXXA 4PKYA 4OVDA 4GD8A 4EEPA 1BLSA 4XXRA 2Q9NA 1IYOA 5KSHA 4IBXA 4HQAA 1ACFA 3HL9A 3BWLA 2VEAA 4BBVA 2W1RA 2IA2A 2J8YA 2RL3A 2G2WA 3HREA 3PXPA 3OPPA 4EUVA 1YPRA 2DCFA 2VV7A 3W4OA 1SCWA 3OCNA 4E6WA 4HI4A 5AJGA 1GSVA 2CMNA 3ICYA 3G32A 1MWUA 1K57A 1PNEA 3P98A 1F98A 4R1GA 4MBKA 1NYYA 3N4IA 2XROA 3G34A 3DTKA 1IYQA 1XA1A 2WK0A 1P0ZA 4X25A 1TS6A 4DXBA 3WRZA 4G3KA 1Q2PA 2EWWA 3AGFA 3RH8B 4PAUA 3LEZA 2O99A 1P9WA 4JGQA 1GSWA 1ES4A 2NUTC 5EVIA 1T19A 2Y79A 4JLFA 4LV0A 4JF5A 2FZ0A 3GMWA 3G6OA 1OJGA 3ZVWA 2JHEA 1W8QA 5FAPA 1YMSA 3CWFA 4X55A 1OMEA 3W8KA 1W63Q 1SHVA 2B95A 4KZ5A 3DWZA 4BENA 4D60A 4II7A 4Q0IA 4R3AA 4MCWA 1ZTUA 3HLDA 3N6IA 5EVIB 4HBUA 2Y2IA 3HJIA 2VX8A 3QP1A 1CJFA 4LV1A 4JXSA 3A3JA 1LT0A 3UMDA 2C5WB 1SDEA 1JVJA 4NETA 2Q9MA 3E2LA 4KZAA 3R7WA 3D4FA 2AVXA 3CPTA 1WE4A 3FKVA 4LRYC 2JKGA 2ZC5B 3LICA 3FKWA 2EX9A 5BOHA 1RCJA 2XF3A 2ZQAA 2PT7A 2GNXA 4NK3A 1K55A 2JKRI 3ZG5A 3VSKA 3LFVA 3LO7A 3CPTB 4B9OA 4EW7A 3EGXC 3OOVA 2ZMVA 5M18A 4NXBA 2QHKA 3VE3A 3PHYA 1LSWA 5HD3A 2Y2OA 1LI9A 4AFIA 4WF0A 1YSQA 1L0DA 1W79A 4NG2A 2VGLM 2HV1A 1AXBA 1Y54A 2K31A 4LCLA 4XUZA 4Y0TA 3E2KA 1CF0A 4Y7PA 4BBTA 4E6XA 2GJ3A 2EX8A 3BFEA 4R3JA 1FCNA 1M6KA 1V9YA 3H7WB 2O9BA 4S2KA 1OTBA 5HDSA 3I7JA 1LI0A 3D3OA 1OT6A 3BFDA 1YAXA 1VQQA 1GA9A 1VETA 3T4LA 1JTDA 4KZ6A 1G68A 5FAQA 3ZDJA 4MBFA 2L0WA 4P85A 5FQMA 3T1XA 2XFTA 1H5XA 3VSLA 4UA9A 4R6LA 1ES2A 2HDRA 4HHDA 4C75A 4R4SA 1MWRA 2HZ5A 3GDIA 4LV3A 4XUXA 2V0WA 1STZA 1NLYA 3PBRA 3N8LA 5FQJA 4LENA 3SZTA 3DBAA 4HY8A 2Y91A 2EA9A 3IF6C 3T50A 1DJCA 1N9LA 2EXAA 5DF8A 2J3TC 2PRFA 2VGKA 1F9IA 5L2FA 2KX6A 1J3WA 3W4QA 4B88A 2QWSA 2Y2NA 4OKPA 1QMFA 1W8YA 3KYQA 1OJ5A 4LRZE 4L0LA 4S2LA 1PWCA 3HCYA 5LBRA 5E43A 3UE3A 3T4SA 1BLPA 2FFYA 3F1OA 5G4YA 3U4LP 5EOEA 1BLHA 2HGVA 2Y2GA 5KIZA 1OTIA 2A3UA 3N8SA 1IKGA 1GSXA 3E4PA 2HP9A 5TJJA 2Y4AA 3UPOA 3T12B 3MFXA 5KMWA 2B5RA 1K6RA 3PBOA 3UPPA 3GVBA 3ZFZA 3CAXA 3CLOA 4KQOA 1MKIA 1K0KA 2PHYA 2HPBA 3LIBA 3OCLA 1ZHHB 1RP5A 4PM8A 3F1NA 1GHPA 2W3GA 1G6AA 3IT9A 4RX3A 4EQ1A 2CC1A 3IWQA 3SH9A 4GOGA 5CHUA 2DRWA 2OLVA 3HJKA 1FCMA 2Y2LA 1L2SA 5IHVA 4HESA 3K3DA 1PRQA 2WKEA 1TDGA 4P6ZS 1LSXA 4PKYG 2V20A 5DFXA 4B4XA 4BD1A 4UQIS 4Q8IA 4KG5A 4E3NA 2WYXA 3O3VA 2ACGA 3F1NB 3HLBA 3UB6A 5F1GA 4BBUA 1FSYA 3VOZA 3HUMA 3UNWA 1PZOA 3T1RA 2VLGA 4Y0UA 5HAIA 1BT5A 4HJ3A 3BYDA 3C8CA 1BLCA 4EUZA 1VM1A 1PI5A 4IUHA 2PD7A 3DAVA 4GS9A 5F1FA 1V9ZA 2ZC3B 4EQIA 5L10A 3S22A 2GDNA 4E3IA 3G4PA 1S4RA 3MBZA 4X69A 4M3KA 3CI6A 4MEZA 1BUEA 3TRCA 5HL6A 3MF0A 2IWCA 1BYWA 3LR4A 3VOLA 3CJMA 1H8MA 1KE0A 1SDNA 3BW6A 2Y2JA 4B93A 2O9AA 4GS9B 3VP4A 1W5DA 3N8RA 2Y2MA 4R4RA 1XJ4A 3QNCA 4U0XA 4YWZA 4DN0A 1KDWA 3CZDA 4PPRA 4P6ZM 1W7FA 2WAEA 1PI4A 4OPQA 2PU4A 4UQIM 4HP4A 4DDSA 4GLQA
chains in the Genus database with same CATH topology
2PBYA 1DJAA 2ZM0A 4X6TA 4OPZA 3LEZA 4FCFA 4R0QA 5HFOA 3BLMA 5J8XA 1HTZA 4N1XA 4OQ0A 1ES4A 5FQKA 2ZJ9A 1XKZA 4KENB 5EVIA 3HUNA 3BLSA 4O7DA 3G2ZA 3GR2A 4WM9A 4RYEA 1PZPA 4JLFA 4LV0A 3SH7A 4JF5A 5G18A 4S2IA 3GMWA 2ZQCA 5FA7A 3ZVWA 3UDIA 5HAQA 4BLMA 1KE3A 1W8QA 1K25A 5FAPA 1YMSA 3IXGA 1FQGA 4EBNA 1J9MA 1CI8A 5FI2A 4U0TA 1OMEA 4X55A 2OV5A 3TOIA 1S6RA 3W8KA 3A3DA 1BZAA 4GN2A 1FSWA 1SHVA 4CJNA 5CGSA 4KZ5A 3DWZA 4GD6A 3NDEA 4BENA 5FASA 1XPBA 4S2OA 2WZZA 2R9XA 2H0TA 4N9KA 1ESIA 1PWGA 2UWXA 3VFHA 1Q2QA 1PYYA 1XA7A 3GQZA 3UY6A 1DJBA 3PTEA 3TG9A 3WRTA 1ESUA 3HLDA 3M6BA 3N6IA 5EVIB 1E25A 4U3TA 1RGZA 1TDLA 2XD5A 4Z9QA 1NZUA 4ZJ1A 4HBUA 3LCEA 4H8RA 4FH2A 2JC7A 2Y2IA 4RVAA 2ZLYA 3HLFA 4OQHA 3NCKA 4LV1A 5FI7A 4JXSA 4EBPA 3A3JA 3AGEA 4GZBA 4KG6A 3G30A 4DE0A 3HBRA 1IEMA 2C5WB 2XFSA 5CGWA 1SDEA 2EX2A 5TFQA 4WZ5C 4ZDXA 5GHYA 3MXSA 1YMXA 1JVJA 2HP6A 4LV2A 2IWDA 3BFCA 2Q9MA 3E2LA 3NBLA 4KZAA 4NETA 4OONA 3UE0A 5CGXA 1LL9A 1CK3A 3D4FA 4K0XA 1WE4A 1K54C 2JE5A 3OZHA 3PAGA 4OOYA 3FKVA 1I5QA 3SS5A 4JKTA 1XX2A 3LY3A 5CRFA 1XXMA 5DTKA 4DKIA 1K55C 2ZC6B 5FI6A 3S1YA 5CTMA 2ZC5B 1HZOA 3FKWA 2ZQ7A 3IF5A 4WZ5A 2EX9A 5BOHA 3ITAA 4ID4A 1RCJA 5JYOA 1LHYA 3HVFA 2XF3A 1XGIA 4C6YA 4K0WA 1MY8A 2ZQAA 4IVKA 5E2HA 1KVMA 1MXOA 4WEJA 4E3JA 4HEFA 5CXWA 3SS3A 2E8IA 4UAAA 1BTLA 2J9PA 4DF6A 1PW8A 1MWSA 2Y2PA 1K55A 4NK3A 4UA7A 1L0FA 2VGJA 4ZTKA 3IF6A 2WGWA 4C3QA 1K56D 3GSGA 5AQ9A 3ZG5A 3V39A 3VSKA 1N4OA 5GLAA 3N7WA 1MWTA 4KG2A 1Z6FA 3LO7A 2EXBA 5DTTA 3O88A 4B4ZA 3FZCA 3ZG7B 3ISGA 5A92A 2H5SA 1HD8A 3IWOA 1LL5A 2H10A 5M19A 4BL2A 3RXWA 5M18A 5EVLA 1FR6A 5EE8A 3P09A 2Y2OA 4QD4A 1CI9A 4QY6A 1LI9A 3M2KA 3DW0A 1L0DA 1W79A 2HDSA 3IHAA 5HARA 2DNSA 3ZGAB 1U60A 3VFFA 4F94A 1AXBA 4DDYA 1Y54A 4KZ4A 3C4OA 4A5RA 2Y2KA 4OPRA 4LCLA 4XUZA 2WGWB 2EX6A 5FATA 1TVFA 1IKIA 3E2KA 4KZ9A 4Y0TA 4Y7PA 3GRJA 4WYYA 2Y2HA 5EVIC 4R3BA 5E2FA 3W4PA 1KDSA 4E6XA 4JXVA 4Y0OA 4OQGA 3UDFA 3V3RA 5HAPA 5TGFA 3G31A 2EX8A 3BFEA 4R3JA 3Q07A 1FCNA 3OPRA 2XH9A 1M6KA 1KE4A 2RCXA 1HVBA 5HX9A 2WZXA 4S2KA 3MZDA 3QNBA 1C3BA 5JYPA 1CEFA 5GLDA 3I7JA 2WKIA 1LI0A 2EFUA 2XQZA 5FSRA 2P74A 1YLZA 1IELA 3UO9A 4X68A 1ERMA 3BFDA 3Q7ZA 1VQQA 3ZG0A 3VP2A 1MPLA 1GA9A 2ZQ9A 1EWZA 3NC8A 1S0WA 3HLEA 4MLLA 1GHIA 1JTDA 1G68A 2G2UA 3HUOA 1N9BA 4KZ6A 4QU3A 4P87A 4MBFA 5FAQA 3ZDJA 1ZKJA 4P85A 5FQMA 2XGNA 4QJGA 4GDNA 1YLTA 4MBHA 4WELA 5HW3A 2XFTA 1I2WA 1H5XA 4LCMA 1ZG4A 2A49A 3MKFA 3VSLA 4UA9A 4OP5A 2OSUA 3BECA 4D2OA 3PBTA 1ES2A 2P9VA 3B3XA 2HDRA 4C75A 2IWBA 5EUAA 1K56A 4R4SA 5FDHA 4OP8A 4EV4A 1ERQA 1MWRA 1K38A 2I72A 4FD8A 2WGVA 2Y2QA 4S2JA 4UHUA 5GLCA 4LV3A 3MKEA 1O07A 1XP4A 2FFFB 3IHBA 4WZ4A 4XUXA 3IXHA 5FQ9A 3SH8A 2PU2A 2ZQ8A 4OPYA 5A91A 4GNUA 4BL3A 3BFFA 3NI9A 3A3IA 4N92A 5EPHA 3G2YA 3V50A 1I2SA 1IYPA 3PBRA 3N8LA 1EROA 3MZEA 3O86A 1E3UA 5FQJA 3ZCZA 4LENA 1WYCA 4FSFA 4WMCD 3CMZA 1ES3A 1YLPA 1YT4A 4IBRA 3BEBA 4ZBEA 4RX2A 1IYSA 2Y91A 3Q1FA 4OOLA 4PM9A 3IF6C 1DJCA 2HDQA 5GLBA 3PBSA 3RJUA 2P9VB 3SOIA 4E3KA 1GHMA 1XGJA 3Q7VA 3IXDA 3VP1A 2QPNA 2EXAA 1RGYA 1L0GA 5DF8A 2Y55A 3HLGA 4JXGA 1E4DA 2VGKA 5L2FA 2Y59A 4IEDA 3VMAA 4UA6A 5TR7A 4BQMA 1TEMA 2X02A 1SKFA 3W4QA 4B88A 1KVLA 4GB7A 4CPKA 5AQAA 2Y2NA 5DF9A 4OKPA 1QMFA 1PIOA 3WS1A 3ZHHA 1W8YA 2XLNA 3OPHA 4QB8A 5AQBA 4GKUA 4QY5A 3A3EA 4P0MA 4L0LA 4BD0A 4S2LA 4IVIA 1PWCA 2ZM2A 4QHCA 5E2GA 3DTMA 1JWPA 3G35A 3WS5A 4KZ3A 1NY0A 1O7EA 3CG5A 1PW1A 2ZC7A 5E43A 4MNRA 1BULA 4FH4A 5F82A 3UE3A 1GCEA 3Q7VB 2XEPA 5CEDA 3IQAA 3GTCA 1FOFA 3BFGA 3NY4A 1BLPA 2FFYA 3ZG8B 4PM5A 4S2PA 1JTGA 3VP3A 1NJ4A 1NZOA 5E2EA 5EOEA 3ZNTA 1BLHA 5CTNA 4N1HA 3IF6B 4S2NC 2Y2GA 5FQIA 5A90A 4ZAMA 2Z2LB 3O87A 4OLGA 5F83A 4DE2A 2A3UA 2HDUA 3FWLA 5KSCA 1WYBA 3M6HA 3N8SA 2X71A 3UPNA 1IKGA 2ZM8A 2HP9A 3UDXA 4DRTA 4RA7A 2Z2MB 5U47A 2BLSA 4DE3A 2Y4AA 2ZQDA 4PM7A 4S2NA 3UPOA 3TSGA 1BSGA 2V2FF 1YLJA 3A3FA 4K91A 4R23A 2XR0A 3MXRA 4OOMA 5KMWA 2JCHA 5GHXA 2WKHA 2V1ZA 3GV9A 5I94A 2B5RA 4KQRA 1K6RA 3PBOA 3UPPA 3ZNYA 5CERA 4BJPA 3EQVA 3C7UA 1YM1A 3MFDA 3GVBA 3IXBA 2WADA 3ZFZA 4WMCA 3IH9A 1MBLA 1ES5A 3S4XA 3WS0A 4KQOA 3WWXA 1EI5A 1MKIA 1YLYA 3LY4A 2HP5A 2HPBA 4KZBA 3WS4A 3OCLA 1M40A 4ZJ3A 1RP5A 4PM8A 1K4FA 1ONHA 5M1AA 3OC2A 4GDBA 3M2JA 3V3SA 2OLUA 1GHPA 2C6WB 4ZJ2A 4JF4A 4P6BA 1QMEA 4WEKA 1G6AA 3IWIA 4YINA 1CEGA 3IT9A 3VP0A 1GA0A 5HL1A 4RX3A 1FR1A 2CC1A 3IWQA 3SH9A 4GOGA 1ZG6A 5CHUA 3HLCA 2DRWA 2OLVA 4E3LA 5GHZA 1FCMA 3SS4A 5FQQA 2Y2LA 4N9LA 1L2SA 5IHVA 3WS2A 4HESA 1NYMA 3V5MA 3ITBA 3DWKA 3HLWA 4E3OA 2H0YA 4DE1A 2JBFA 1LLBA 5CHJA 2WKEA 1TDGA 1ZC2A 5A93A 2V20A 3PAEA 3UE1A 4YFMA 4B4XA 4BD1A 4JBFA 4KZ7A 4PMAA 4Q8IA 1K6SA 2WGIA 4KG5A 4E3NA 3C7VA 2WYXA 3O3VA 5DF7A 1H8YA 3FYZA 5CECA 5FAOA 4EBLA 2R9WA 3C5AA 3HLBA 1KGGA 4X56A 1NRFA 5AQ7A 1KGEA 1ALQA 2X01A 5GL9A 5EVID 4OLDA 4KQQA 4E3MA 2J7VA 3NIAA 1YLWA 1H8ZA 3QHYA 5F1GA 4OH0A 3PBQA 4DXCA 3ZG9B 1FSYA 4WBGA 3BRMA 1NXYA 3VOZA 3IH8A 3HUMA 3UNWA 1PZOA 3BM6A 4JPMA 3RXXA 1YQSA 4S2MA 4OVDA 2BG1A 4GD8A 4Y0UA 2XD1A 1BLSA 1PWDA 2Q9NA 2QZ6A 4XXRA 5D3OA 2WUQA 1IYOA 2XK1A 3EQUA 5HAIA 1BT5A 3AGDA 5KSHA 2ZMAA 3BYDA 3JYIA 4IBXA 1BLCA 3ZVTA 2EFXA 1VM1A 1PI5A 3PBNA 4EUZA 5DVAA 4HBTA 5F1FA 3HL9A 1K54A 2ZC3B 4EQIA 1JWZA 3S22A 3FV7A 3Q81A 2J8YA 2GDNA 2RL3A 4E3IA 5KZHA 1L0EA 3G4PA 3UN7A 2G2WA 1KGFA 3MBZA 5DTSA 3HREA 4JXWA 2QMIA 3OPPA 4M3KA 4X69A 4MEZA 3NDGA 2DCFA 1BUEA 3VOYA 1JWVA 3W4OA 1K57C 1SCWA 3OCNA 4E6WA 2J9OA 2IWCA 2XDMA 1FCOA 3CJMA 5CHMA 1KE0A 4PM6A 1E3UD 1SDNA 3G32A 1MWUA 2Y2JA 5EECA 1K57A 2ZC4B 3VP4A 1W5DA 3OPLA 3N8RA 4OQIA 2Y2MA 3P98A 4R4RA 4R1GA 3QNCA 1NYYA 4MBKA 3N4IA 2ZD8A 4U0XA 4X53A 3G34A 5EOOA 1KDWA 1DY6A 4EWFA 5CEBA 3CZDA 1IYQA 3C4PA 4KZ8A 2WAFA 1XA1A 2WK0A 4PPRA 3MZFA 1W7FA 1K4EA 2WAEA 1PI4A 4JF6A 4OPQA 3WRZA 4DXBA 2PU4A 1Q2PA 4DDSA 1ONGA 3Q82A 3AGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBY A;  1DJA A;  2ZM0 A;  4X6T A;  4OPZ A;  3LEZ A;  4FCF A;  4R0Q A;  5HFO A;  3BLM A;  5J8X A;  1HTZ A;  4N1X A;  4OQ0 A;  1ES4 A;  5FQK A;  2ZJ9 A;  1XKZ A;  4KEN B;  5EVI A;  3HUN A;  3BLS A;  4O7D A;  3G2Z A;  3GR2 A;  4WM9 A;  4RYE A;  1PZP A;  4JLF A;  4LV0 A;  3SH7 A;  4JF5 A;  5G18 A;  4S2I A;  3GMW A;  2ZQC A;  5FA7 A;  3ZVW A;  3UDI A;  5HAQ A;  4BLM A;  1KE3 A;  1W8Q A;  1K25 A;  5FAP A;  1YMS A;  3IXG A;  1FQG A;  4EBN A;  1J9M A;  1CI8 A;  5FI2 A;  4U0T A;  1OME A;  4X55 A;  2OV5 A;  3TOI A;  1S6R A;  3W8K A;  3A3D A;  1BZA A;  4GN2 A;  1FSW A;  1SHV A;  4CJN A;  5CGS A;  4KZ5 A;  3DWZ A;  4GD6 A;  3NDE A;  4BEN A;  5FAS A;  1XPB A;  4S2O A;  2WZZ A;  2R9X A;  2H0T A;  4N9K A;  1ESI A;  1PWG A;  2UWX A;  3VFH A;  1Q2Q A;  1PYY A;  1XA7 A;  3GQZ A;  3UY6 A;  1DJB A;  3PTE A;  3TG9 A;  3WRT A;  1ESU A;  3HLD A;  3M6B A;  3N6I A;  5EVI B;  1E25 A;  4U3T A;  1RGZ A;  1TDL A;  2XD5 A;  4Z9Q A;  1NZU A;  4ZJ1 A;  4HBU A;  3LCE A;  4H8R A;  4FH2 A;  2JC7 A;  2Y2I A;  4RVA A;  2ZLY A;  3HLF A;  4OQH A;  3NCK A;  4LV1 A;  5FI7 A;  4JXS A;  4EBP A;  3A3J A;  3AGE A;  4GZB A;  4KG6 A;  3G30 A;  4DE0 A;  3HBR A;  1IEM A;  2C5W B;  2XFS A;  5CGW A;  1SDE A;  2EX2 A;  5TFQ A;  4WZ5 C;  4ZDX A;  5GHY A;  3MXS A;  1YMX A;  1JVJ A;  2HP6 A;  4LV2 A;  2IWD A;  3BFC A;  2Q9M A;  3E2L A;  3NBL A;  4KZA A;  4NET A;  4OON A;  3UE0 A;  5CGX A;  1LL9 A;  1CK3 A;  3D4F A;  4K0X A;  1WE4 A;  1K54 C;  2JE5 A;  3OZH A;  3PAG A;  4OOY A;  3FKV A;  1I5Q A;  3SS5 A;  4JKT A;  1XX2 A;  3LY3 A;  5CRF A;  1XXM A;  5DTK A;  4DKI A;  1K55 C;  2ZC6 B;  5FI6 A;  3S1Y A;  5CTM A;  2ZC5 B;  1HZO A;  3FKW A;  2ZQ7 A;  3IF5 A;  4WZ5 A;  2EX9 A;  5BOH A;  3ITA A;  4ID4 A;  1RCJ A;  5JYO A;  1LHY A;  3HVF A;  2XF3 A;  1XGI A;  4C6Y A;  4K0W A;  1MY8 A;  2ZQA A;  4IVK A;  5E2H A;  1KVM A;  1MXO A;  4WEJ A;  4E3J A;  4HEF A;  5CXW A;  3SS3 A;  2E8I A;  4UAA A;  1BTL A;  2J9P A;  4DF6 A;  1PW8 A;  1MWS A;  2Y2P A;  1K55 A;  4NK3 A;  4UA7 A;  1L0F A;  2VGJ A;  4ZTK A;  3IF6 A;  2WGW A;  4C3Q A;  1K56 D;  3GSG A;  5AQ9 A;  3ZG5 A;  3V39 A;  3VSK A;  1N4O A;  5GLA A;  3N7W A;  1MWT A;  4KG2 A;  1Z6F A;  3LO7 A;  2EXB A;  5DTT A;  3O88 A;  4B4Z A;  3FZC A;  3ZG7 B;  3ISG A;  5A92 A;  2H5S A;  1HD8 A;  3IWO A;  1LL5 A;  2H10 A;  5M19 A;  4BL2 A;  3RXW A;  5M18 A;  5EVL A;  1FR6 A;  5EE8 A;  3P09 A;  2Y2O A;  4QD4 A;  1CI9 A;  4QY6 A;  1LI9 A;  3M2K A;  3DW0 A;  1L0D A;  1W79 A;  2HDS A;  3IHA A;  5HAR A;  2DNS A;  3ZGA B;  1U60 A;  3VFF A;  4F94 A;  1AXB A;  4DDY A;  1Y54 A;  4KZ4 A;  3C4O A;  4A5R A;  2Y2K A;  4OPR A;  4LCL A;  4XUZ A;  2WGW B;  2EX6 A;  5FAT A;  1TVF A;  1IKI A;  3E2K A;  4KZ9 A;  4Y0T A;  4Y7P A;  3GRJ A;  4WYY A;  2Y2H A;  5EVI C;  4R3B A;  5E2F A;  3W4P A;  1KDS A;  4E6X A;  4JXV A;  4Y0O A;  4OQG A;  3UDF A;  3V3R A;  5HAP A;  5TGF A;  3G31 A;  2EX8 A;  3BFE A;  4R3J A;  3Q07 A;  1FCN A;  3OPR A;  2XH9 A;  1M6K A;  1KE4 A;  2RCX A;  1HVB A;  5HX9 A;  2WZX A;  4S2K A;  3MZD A;  3QNB A;  1C3B A;  5JYP A;  1CEF A;  5GLD A;  3I7J A;  2WKI A;  1LI0 A;  2EFU A;  2XQZ A;  5FSR A;  2P74 A;  1YLZ A;  1IEL A;  3UO9 A;  4X68 A;  1ERM A;  3BFD A;  3Q7Z A;  1VQQ A;  3ZG0 A;  3VP2 A;  1MPL A;  1GA9 A;  2ZQ9 A;  1EWZ A;  3NC8 A;  1S0W A;  3HLE A;  4MLL A;  1GHI A;  1JTD A;  1G68 A;  2G2U A;  3HUO A;  1N9B A;  4KZ6 A;  4QU3 A;  4P87 A;  4MBF A;  5FAQ A;  3ZDJ A;  1ZKJ A;  4P85 A;  5FQM A;  2XGN A;  4QJG A;  4GDN A;  1YLT A;  4MBH A;  4WEL A;  5HW3 A;  2XFT A;  1I2W A;  1H5X A;  4LCM A;  1ZG4 A;  2A49 A;  3MKF A;  3VSL A;  4UA9 A;  4OP5 A;  2OSU A;  3BEC A;  4D2O A;  3PBT A;  1ES2 A;  2P9V A;  3B3X A;  2HDR A;  4C75 A;  2IWB A;  5EUA A;  1K56 A;  4R4S A;  5FDH A;  4OP8 A;  4EV4 A;  1ERQ A;  1MWR A;  1K38 A;  2I72 A;  4FD8 A;  2WGV A;  2Y2Q A;  4S2J A;  4UHU A;  5GLC A;  4LV3 A;  3MKE A;  1O07 A;  1XP4 A;  2FFF B;  3IHB A;  4WZ4 A;  4XUX A;  3IXH A;  5FQ9 A;  3SH8 A;  2PU2 A;  2ZQ8 A;  4OPY A;  5A91 A;  4GNU A;  4BL3 A;  3BFF A;  3NI9 A;  3A3I A;  4N92 A;  5EPH A;  3G2Y A;  3V50 A;  1I2S A;  1IYP A;  3PBR A;  3N8L A;  1ERO A;  3MZE A;  3O86 A;  1E3U A;  5FQJ A;  3ZCZ A;  4LEN A;  1WYC A;  4FSF A;  4WMC D;  3CMZ A;  1ES3 A;  1YLP A;  1YT4 A;  4IBR A;  3BEB A;  4ZBE A;  4RX2 A;  1IYS A;  2Y91 A;  3Q1F A;  4OOL A;  4PM9 A;  3IF6 C;  1DJC A;  2HDQ A;  5GLB A;  3PBS A;  3RJU A;  2P9V B;  3SOI A;  4E3K A;  1GHM A;  1XGJ A;  3Q7V A;  3IXD A;  3VP1 A;  2QPN A;  2EXA A;  1RGY A;  1L0G A;  5DF8 A;  2Y55 A;  3HLG A;  4JXG A;  1E4D A;  2VGK A;  5L2F A;  2Y59 A;  4IED A;  3VMA A;  4UA6 A;  5TR7 A;  4BQM A;  1TEM A;  2X02 A;  1SKF A;  3W4Q A;  4B88 A;  1KVL A;  4GB7 A;  4CPK A;  5AQA A;  2Y2N A;  5DF9 A;  4OKP A;  1QMF A;  1PIO A;  3WS1 A;  3ZHH A;  1W8Y A;  2XLN A;  3OPH A;  4QB8 A;  5AQB A;  4GKU A;  4QY5 A;  3A3E A;  4P0M A;  4L0L A;  4BD0 A;  4S2L A;  4IVI A;  1PWC A;  2ZM2 A;  4QHC A;  5E2G A;  3DTM A;  1JWP A;  3G35 A;  3WS5 A;  4KZ3 A;  1NY0 A;  1O7E A;  3CG5 A;  1PW1 A;  2ZC7 A;  5E43 A;  4MNR A;  1BUL A;  4FH4 A;  5F82 A;  3UE3 A;  1GCE A;  3Q7V B;  2XEP A;  5CED A;  3IQA A;  3GTC A;  1FOF A;  3BFG A;  3NY4 A;  1BLP A;  2FFY A;  3ZG8 B;  4PM5 A;  4S2P A;  1JTG A;  3VP3 A;  1NJ4 A;  1NZO A;  5E2E A;  5EOE A;  3ZNT A;  1BLH A;  5CTN A;  4N1H A;  3IF6 B;  4S2N C;  2Y2G A;  5FQI A;  5A90 A;  4ZAM A;  2Z2L B;  3O87 A;  4OLG A;  5F83 A;  4DE2 A;  2A3U A;  2HDU A;  3FWL A;  5KSC A;  1WYB A;  3M6H A;  3N8S A;  2X71 A;  3UPN A;  1IKG A;  2ZM8 A;  2HP9 A;  3UDX A;  4DRT A;  4RA7 A;  2Z2M B;  5U47 A;  2BLS A;  4DE3 A;  2Y4A A;  2ZQD A;  4PM7 A;  4S2N A;  3UPO A;  3TSG A;  1BSG A;  2V2F F;  1YLJ A;  3A3F A;  4K91 A;  4R23 A;  2XR0 A;  3MXR A;  4OOM A;  5KMW A;  2JCH A;  5GHX A;  2WKH A;  2V1Z A;  3GV9 A;  5I94 A;  2B5R A;  4KQR A;  1K6R A;  3PBO A;  3UPP A;  3ZNY A;  5CER A;  4BJP A;  3EQV A;  3C7U A;  1YM1 A;  3MFD A;  3GVB A;  3IXB A;  2WAD A;  3ZFZ A;  4WMC A;  3IH9 A;  1MBL A;  1ES5 A;  3S4X A;  3WS0 A;  4KQO A;  3WWX A;  1EI5 A;  1MKI A;  1YLY A;  3LY4 A;  2HP5 A;  2HPB A;  4KZB A;  3WS4 A;  3OCL A;  1M40 A;  4ZJ3 A;  1RP5 A;  4PM8 A;  1K4F A;  1ONH A;  5M1A A;  3OC2 A;  4GDB A;  3M2J A;  3V3S A;  2OLU A;  1GHP A;  2C6W B;  4ZJ2 A;  4JF4 A;  4P6B A;  1QME A;  4WEK A;  1G6A A;  3IWI A;  4YIN A;  1CEG A;  3IT9 A;  3VP0 A;  1GA0 A;  5HL1 A;  4RX3 A;  1FR1 A;  2CC1 A;  3IWQ A;  3SH9 A;  4GOG A;  1ZG6 A;  5CHU A;  3HLC A;  2DRW A;  2OLV A;  4E3L A;  5GHZ A;  1FCM A;  3SS4 A;  5FQQ A;  2Y2L A;  4N9L A;  1L2S A;  5IHV A;  3WS2 A;  4HES A;  1NYM A;  3V5M A;  3ITB A;  3DWK A;  3HLW A;  4E3O A;  2H0Y A;  4DE1 A;  2JBF A;  1LLB A;  5CHJ A;  2WKE A;  1TDG A;  1ZC2 A;  5A93 A;  2V20 A;  3PAE A;  3UE1 A;  4YFM A;  4B4X A;  4BD1 A;  4JBF A;  4KZ7 A;  4PMA A;  4Q8I A;  1K6S A;  2WGI A;  4KG5 A;  4E3N A;  3C7V A;  2WYX A;  3O3V A;  5DF7 A;  1H8Y A;  3FYZ A;  5CEC A;  5FAO A;  4EBL A;  2R9W A;  3C5A A;  3HLB A;  1KGG A;  4X56 A;  1NRF A;  5AQ7 A;  1KGE A;  1ALQ A;  2X01 A;  5GL9 A;  5EVI D;  4OLD A;  4KQQ A;  4E3M A;  2J7V A;  3NIA A;  1YLW A;  1H8Z A;  3QHY A;  5F1G A;  4OH0 A;  3PBQ A;  4DXC A;  3ZG9 B;  1FSY A;  4WBG A;  3BRM A;  1NXY A;  3VOZ A;  3IH8 A;  3HUM A;  3UNW A;  1PZO A;  3BM6 A;  4JPM A;  3RXX A;  1YQS A;  4S2M A;  4OVD A;  2BG1 A;  4GD8 A;  4Y0U A;  2XD1 A;  1BLS A;  1PWD A;  2Q9N A;  2QZ6 A;  4XXR A;  5D3O A;  2WUQ A;  1IYO A;  2XK1 A;  3EQU A;  5HAI A;  1BT5 A;  3AGD A;  5KSH A;  2ZMA A;  3BYD A;  3JYI A;  4IBX A;  1BLC A;  3ZVT A;  2EFX A;  1VM1 A;  1PI5 A;  3PBN A;  4EUZ A;  5DVA A;  4HBT A;  5F1F A;  3HL9 A;  1K54 A;  2ZC3 B;  4EQI A;  1JWZ A;  3S22 A;  3FV7 A;  3Q81 A;  2J8Y A;  2GDN A;  2RL3 A;  4E3I A;  5KZH A;  1L0E A;  3G4P A;  3UN7 A;  2G2W A;  1KGF A;  3MBZ A;  5DTS A;  3HRE A;  4JXW A;  2QMI A;  3OPP A;  4M3K A;  4X69 A;  4MEZ A;  3NDG A;  2DCF A;  1BUE A;  3VOY A;  1JWV A;  3W4O A;  1K57 C;  1SCW A;  3OCN A;  4E6W A;  2J9O A;  2IWC A;  2XDM A;  1FCO A;  3CJM A;  5CHM A;  1KE0 A;  4PM6 A;  1E3U D;  1SDN A;  3G32 A;  1MWU A;  2Y2J A;  5EEC A;  1K57 A;  2ZC4 B;  3VP4 A;  1W5D A;  3OPL A;  3N8R A;  4OQI A;  2Y2M A;  3P98 A;  4R4R A;  4R1G A;  3QNC A;  1NYY A;  4MBK A;  3N4I A;  2ZD8 A;  4U0X A;  4X53 A;  3G34 A;  5EOO A;  1KDW A;  1DY6 A;  4EWF A;  5CEB A;  3CZD A;  1IYQ A;  3C4P A;  4KZ8 A;  2WAF A;  1XA1 A;  2WK0 A;  4PPR A;  3MZF A;  1W7F A;  1K4E A;  2WAE A;  1PI4 A;  4JF6 A;  4OPQ A;  3WRZ A;  4DXB A;  2PU4 A;  1Q2P A;  4DDS A;  1ONG A;  3Q82 A;  3AGF A; 
#chains in the Genus database with same CATH topology
 3FPV A;  2E8J A;  4OPZ A;  4CLC A;  5J4E A;  4R0Q A;  4OQ0 A;  3VE4 A;  1DRM A;  2J3T D;  4KUO A;  4WM9 A;  4S2I A;  1P97 A;  1HLU P;  4BLM A;  4I5S A;  3IXG A;  1CI8 A;  1VB6 A;  1DP8 A;  1S6R A;  1FSW A;  5CGS A;  2LB5 A;  2EWV A;  5FAS A;  3NDE A;  3IBR A;  4N9K A;  1PFL A;  1D06 A;  1ESI A;  4CLC B;  1XFN A;  3VFH A;  2PDR A;  3UY6 A;  1DJB A;  3PTE A;  3TG9 A;  3KSG A;  4I3A A;  4PHT A;  4Z9Q A;  4QPR A;  4ZJ1 A;  3LCE A;  4H8R A;  4GHI A;  4XT2 A;  3MR0 A;  2VA0 A;  4EBP A;  3AGE A;  4GZB A;  3G30 A;  4DE0 A;  3HBR A;  1IEM A;  5CGW A;  4H6J B;  4WZ5 C;  5GHY A;  2HP6 A;  2L1M A;  4OON A;  3UE0 A;  2BAS A;  1K54 C;  4OOY A;  1I5Q A;  2A2L A;  2PAV P;  3SS5 A;  3U2A A;  4JKT A;  5CRF A;  1XXM A;  5DTK A;  4Q0J A;  5IU1 A;  1HZO A;  2OWJ A;  3IF5 A;  3ITA A;  1LHY A;  1XGI A;  1FIK A;  2J3W A;  4IVK A;  2I9V A;  1MXO A;  4XT2 B;  3BY9 A;  2HJE A;  2J9P A;  1MWS A;  2Y2P A;  1A0K A;  4HP9 A;  3IF6 A;  1K56 D;  1N4O A;  1JNU A;  3B47 A;  3N7W A;  1Z6F A;  2PR6 A;  3C38 A;  3O88 A;  1OTA A;  3NOT C;  3QP8 A;  4I3J A;  3IWO A;  2JKR M;  1UWN X;  5EE8 A;  3CIT A;  1S66 L;  1CI9 A;  3DW0 A;  5MC7 A;  5HAR A;  3IHA A;  3ZGA B;  5HDC A;  4EER A;  2NUP C;  2V1A A;  4KZ4 A;  4A5R A;  4OPR A;  3C2W A;  1UWP X;  3B33 A;  1F2K A;  1TVF A;  4KZ9 A;  5FAT A;  3QP4 A;  4I3I A;  4Y0O A;  2XA7 S;  4OQG A;  3UDF A;  2O9C A;  3EOI A;  4EU0 A;  2XH9 A;  2JKT I;  1N9N A;  3ZQ5 A;  5GLD A;  2XQZ A;  3FPW A;  1YLZ A;  4X68 A;  1ERM A;  3Q7Z A;  1EWZ A;  2VGL S;  2G2U A;  2QYB A;  1N9B A;  4P87 A;  2YKF A;  2XGN A;  3CHW P;  4MBH A;  4WEL A;  5EV0 A;  3PBT A;  2P9V A;  1XFQ A;  1K56 A;  5FDH A;  4OP8 A;  2I72 A;  2WGV A;  2Y2Q A;  4S2J A;  4UHU A;  3MKE A;  1O07 A;  2O0Y A;  1XP4 A;  2FFF B;  3IXH A;  5FQ9 A;  4GNU A;  3BFF A;  4N92 A;  5EPH A;  1YSP A;  1ERO A;  3ZCZ A;  3CMZ A;  3KO6 A;  4CQH A;  2PD8 A;  3Q1F A;  4OOL A;  4PM9 A;  3OLO A;  5GLB A;  2ZOI A;  3SOI A;  2P9V B;  3VP1 A;  1RGY A;  2Y59 A;  1AWI A;  4IED A;  3VMA A;  2XA7 M;  4UA6 A;  5TR7 A;  1SKF A;  5AQA A;  3PR6 A;  5DF9 A;  3WS1 A;  1PIO A;  3R7W B;  4Y17 A;  4ESP A;  1D1J A;  3OPH A;  4X1L A;  3BQ8 A;  3A3E A;  4QY5 A;  2OWH A;  3RTY A;  1JWP A;  3G35 A;  1N9O A;  4FH4 A;  5F82 A;  2XEP A;  4IJG A;  3IQA A;  5F68 A;  3BFG A;  2QJ5 A;  4S2P A;  1Y28 A;  4KUK A;  5E2E A;  1H0M A;  4N1H A;  3NOU C;  2VV6 A;  3BY8 A;  3FWL A;  3D72 A;  1XJ6 A;  3UPN A;  3F1P A;  3UDX A;  4L9E A;  4DE3 A;  2M7V A;  4PM7 A;  4S2N A;  3TSG A;  1BSG A;  3UB5 P;  1YLJ A;  3A3F A;  5I5L A;  4K91 A;  4R23 A;  2XR0 A;  5DJT A;  5J3W A;  2JCH A;  5I94 A;  4EXO A;  2XRN A;  3ZNY A;  5CER A;  3C7U A;  3MFD A;  2WAD A;  4JGP A;  1T18 A;  5EM1 A;  1EI5 A;  3LY4 A;  3T4Q A;  2HP5 A;  2ZMF A;  4KZB A;  3V67 A;  5C5K A;  4ZJ3 A;  1ONH A;  3F1P B;  4GDB A;  4FUW A;  2OLU A;  4P6B A;  4WEK A;  1GA0 A;  4E3L A;  3P7N A;  5GHZ A;  3SS4 A;  4L9F A;  3HLW A;  3C30 A;  4E3O A;  5FDS A;  1LLB A;  5CHJ A;  1ZC2 A;  5A93 A;  4Y2F A;  1VET B;  3PAE A;  4KZ7 A;  3A0R A;  1MC0 A;  2PYP A;  3C7V A;  5DF7 A;  1H8Y A;  5CEC A;  4M4X A;  4G3V A;  4EBL A;  3C5A A;  4X56 A;  4DMZ A;  1NRF A;  4KQQ A;  2J7V A;  1DP9 A;  3NIA A;  3QHY A;  4WBG A;  1NXY A;  5DFY A;  4S2M A;  2V8C A;  4HJ4 A;  5D3O A;  3S7N A;  2QZ6 A;  2WUQ A;  3EQU A;  2ZMA A;  3LEQ A;  2EFX A;  5DVA A;  4HBT A;  1K54 A;  1JWZ A;  3FV7 A;  5KZH A;  3IX8 A;  1L0E A;  3UN7 A;  5DTS A;  3LI9 A;  4JXW A;  2QMI A;  3NDG A;  1K57 C;  1T1B A;  4G3W A;  5EVE A;  2D02 A;  1SZV A;  2J9O A;  3E0Y A;  5IS1 A;  4WN5 A;  5CHM A;  4PM6 A;  1E3U D;  5EFW A;  2VZW A;  2ZC4 B;  3K3C A;  3OPL A;  4OQI A;  1S1Z A;  3UE6 A;  2ZD8 A;  4X53 A;  5CEB A;  1DY6 A;  4X1M A;  3MZF A;  2V0U A;  3T4O A;  3F1O B;  5FEF A;  3CUE C;  2ZM0 A;  3FC7 A;  4NXF A;  2Q0O A;  4FCF A;  5J8X A;  5HZH A;  1XKZ A;  4KEN B;  4O7D A;  3GR2 A;  1S1Y A;  5G18 A;  3MJQ A;  5FA7 A;  4F3L A;  5FI2 A;  3TOI A;  3A3D A;  5HPF A;  1BZA A;  4GN2 A;  4CJN A;  2VJW A;  2QJ7 A;  4GD6 A;  3DTI A;  1XPB A;  4S2O A;  2WZZ A;  2R9X A;  3EEH A;  1PWG A;  2M7U A;  2UWX A;  3VV4 A;  2KOI A;  1ESU A;  3M6B A;  1E25 A;  1RGZ A;  1TDL A;  2XD5 A;  4FH2 A;  2JC7 A;  4R70 A;  3UME A;  4Y15 A;  4RVA A;  3HLF A;  4F3L B;  1NRJ A;  4LGW A;  3EEA A;  5FI7 A;  5AVF A;  4KG6 A;  4EES A;  5L8M A;  5EVL A;  4DRT A;  5CGX A;  4K0X A;  3OZH A;  3PAG A;  1H3Q A;  2VV8 A;  1K55 C;  3S1Y A;  5CTM A;  4ID4 A;  3UB9 A;  4JGO A;  3JVU A;  3HVF A;  4C6Y A;  4K0W A;  1MY8 A;  4HIA A;  5E2H A;  1KVM A;  4WEJ A;  4E3J A;  4HEF A;  5CXW A;  5HD5 A;  3SS3 A;  2E8I A;  5HDD A;  1L0F A;  2JN7 A;  3T4J A;  4UEY A;  4ZTK A;  2WGW A;  4C3Q A;  3GSG A;  2FH5 A;  5AQ9 A;  3V39 A;  1MWT A;  4KG2 A;  3MQO A;  1T1A A;  2WKR A;  2EXB A;  5DTT A;  5AVE A;  3ZG7 B;  5A92 A;  2H5S A;  1HD8 A;  1LL5 A;  3LUQ A;  3GEC A;  4BL2 A;  3RXW A;  3P09 A;  2K7S A;  4QY6 A;  3M2K A;  4DJ2 A;  2DNS A;  1U60 A;  2MJ6 A;  3VFF A;  4F94 A;  3H82 A;  4DDY A;  1OTD A;  2WGW B;  2M1C A;  4WYY A;  2Y2H A;  3MQQ A;  1KDS A;  4JXV A;  3E98 A;  5TBM A;  3V3R A;  5HSQ A;  3D9Y A;  5TGF A;  3G31 A;  1VEU A;  3OPR A;  4MN7 A;  1KE4 A;  1WA9 A;  1HVB A;  2ZL1 A;  5HX9 A;  4ETX A;  5HWW A;  3LR5 A;  2WZX A;  3MZD A;  3QNB A;  4Z1W A;  1IOU A;  3LID A;  1CEF A;  1TF1 A;  5FSR A;  4WL9 A;  4Y13 A;  2K2N A;  2WKP A;  4I38 A;  2JKT M;  4Y5F A;  3ZG0 A;  3NC8 A;  1S0W A;  3HLE A;  4MLL A;  3V3S A;  4QU3 A;  2D01 A;  3BJN A;  4HH3 A;  2DMW A;  2LB9 A;  5HW3 A;  2YKH A;  1I2W A;  1ZG4 A;  5DJU A;  3BEC A;  5F69 A;  2ZL1 B;  4D2O A;  4BMW A;  4EV4 A;  4LPZ A;  4FD8 A;  5GLC A;  5IT5 A;  1NWZ A;  3IHB A;  1G6O A;  2W1T A;  3S7Q A;  5A91 A;  4I39 A;  1W63 M;  2W0N A;  1I2S A;  1IYP A;  1DP6 A;  2BTF P;  1WYC A;  4GCZ A;  4WMC D;  1ES3 A;  4IBR A;  1IYS A;  1P9R A;  1X0O A;  2HDQ A;  3RJU A;  3BQA A;  3Q7V A;  2QPN A;  1L0G A;  4GHI B;  4RQ9 A;  1TEM A;  2X02 A;  3NOP C;  1KVL A;  4GB7 A;  1OTE A;  1OT9 A;  1T1C A;  1MKM A;  3ZHH A;  5FL3 A;  2XLN A;  4QB8 A;  2PR5 A;  4QWO A;  4P0M A;  4MMN A;  5E2G A;  3DTM A;  3WS5 A;  4KZ3 A;  1NY0 A;  1O7E A;  1PW1 A;  5HWT A;  1BUL A;  5L07 A;  3Q7V B;  5CED A;  3KYE A;  3GTC A;  1FOF A;  3NY4 A;  3ZG8 B;  1TD5 A;  2W3F A;  1JTG A;  5A8B A;  1NZO A;  3MS6 A;  2Z6D A;  3IF6 B;  4NKP A;  5FQI A;  4HNB A;  4DE2 A;  4OLG A;  5F83 A;  2HDU A;  1WYB A;  3S7O A;  4O8G A;  5HWV A;  1F5M A;  5U47 A;  4Q0H A;  3L9K A;  4YOF A;  2WKH A;  3LIA A;  2V1Z A;  3GV9 A;  4KQR A;  3UB8 A;  2WKQ A;  1YM1 A;  3IXB A;  4WMC A;  3IH9 A;  1ES5 A;  3S4X A;  3JVV A;  3WS0 A;  3WWX A;  1YLY A;  4JGR A;  3WS4 A;  1LL8 A;  1K4F A;  3EGD C;  5L09 A;  2P04 A;  2C6W B;  3CUE A;  1QME A;  4ETZ A;  5DKK A;  1FR1 A;  3FG8 A;  4WUJ A;  1S4S A;  1ZG6 A;  5FQQ A;  4N9L A;  1NYM A;  3V5M A;  3ITB A;  1UGU A;  2GZA A;  3UE1 A;  1ODV A;  3K2N A;  4PMA A;  1K6S A;  3PYP A;  5FAO A;  1KGG A;  4EET B;  1NLZ A;  5AQ7 A;  1ALQ A;  4FOF A;  3UB7 A;  5GL9 A;  4E3M A;  1YLW A;  4OH0 A;  4DXC A;  3BRM A;  3NEC A;  1YQS A;  2BG1 A;  2XD1 A;  1PWD A;  3MQ0 A;  4L9G A;  2XK1 A;  2W3D A;  3AGD A;  2JKF A;  3JYI A;  3ZVT A;  3PBN A;  3L7H A;  3LR3 A;  3Q81 A;  2QKP A;  1XJ3 A;  1KGF A;  3VOY A;  2L4R A;  1JWV A;  3NHQ A;  3MSH A;  2XDM A;  1FCO A;  1OPX A;  3W2Z A;  5EEC A;  3QP2 A;  4GW9 A;  3H7W A;  2P7J A;  3IS2 A;  4LFU A;  1MZU A;  5EOO A;  4EWF A;  4CLC C;  2G7U A;  3NJA A;  3C4P A;  4KZ8 A;  2WAF A;  1K4E A;  4JF6 A;  1ONG A;  3Q82 A;  2HF6 A;  1DJA A;  2PBY A;  4X6T A;  1KOU A;  3S7P A;  5HFO A;  3ZYT A;  3BLM A;  1HTZ A;  4N1X A;  5FQK A;  2ZJ9 A;  2INW A;  3HUN A;  3BLS A;  3G2Z A;  4RYE A;  3O5Y A;  1PZP A;  3SH7 A;  3IS2 B;  2OOL A;  2ZQC A;  3MXQ A;  3UDI A;  5HAQ A;  1KE3 A;  4ZRR A;  1K25 A;  1FQG A;  1TS7 A;  1J9M A;  4GJ4 A;  4CLC E;  4EBN A;  2J80 A;  2W27 A;  4U0T A;  2OV5 A;  2H28 A;  3RFB A;  1Y4O A;  2H0T A;  5F5Y A;  1Q2Q A;  1PYY A;  1XA7 A;  3GQZ A;  5HPI A;  3WRT A;  4O01 A;  4U3T A;  4LRX C;  1NZU A;  2KLI A;  4NXG A;  2HJ9 C;  2ZLY A;  4OQH A;  3NCK A;  2OAQ 1;  2XFS A;  5TFQ A;  2EX2 A;  4ZDX A;  3MXS A;  1YMX A;  4LV2 A;  2IWD A;  3BFC A;  3NBL A;  1LL9 A;  1CK3 A;  2JE5 A;  1XX2 A;  3LY3 A;  4DKI A;  3LYX A;  2ZC6 B;  5FI6 A;  4MN5 A;  3KX0 X;  2ZQ7 A;  4WZ5 A;  4R38 A;  5F6A A;  2PYR A;  5JYO A;  4EEU A;  4NXE A;  4O0P A;  3NUL A;  3JPU A;  1G5U A;  4UAA A;  1BTL A;  4DF6 A;  1PW8 A;  4UA7 A;  2VGJ A;  1TS8 A;  3QP5 A;  5GLA A;  3LIF A;  4B4Z A;  3H9W A;  3TE8 A;  3FZC A;  3ISG A;  2H10 A;  3DTE A;  5M19 A;  1FR6 A;  2ZOH A;  4QD4 A;  5FEG A;  2HDS A;  4IUK A;  3LIE A;  3C4O A;  4IHQ A;  2Y2K A;  5K5B A;  1VHM A;  2EX6 A;  3OBF A;  1IKI A;  1G28 A;  3GRJ A;  5EVI C;  3TJZ C;  4YNR A;  4R3B A;  5E2F A;  3P01 A;  3W4P A;  5HAP A;  3Q07 A;  3R4K A;  5G4Z A;  3A0S A;  3ULF A;  4HOI A;  2RCX A;  1C3B A;  4K08 A;  5DKL A;  5JYP A;  2WKI A;  2EFU A;  3LGO A;  2P74 A;  1IEL A;  3UO9 A;  3VP2 A;  4DJ3 A;  1MPL A;  3T1Q B;  2ZQ9 A;  1GHI A;  3HUO A;  1ZKJ A;  3MMH A;  4QJG A;  4GDN A;  1YLT A;  4MDZ A;  4LCM A;  2A49 A;  3MKF A;  4OP5 A;  2OSU A;  2B02 A;  3B3X A;  2IWB A;  5EUA A;  1ERQ A;  1K38 A;  2W3E A;  3KYZ A;  4WZ4 A;  3SH8 A;  2PU2 A;  2ZQ8 A;  4OPY A;  4NEE D;  4BL3 A;  2VK3 A;  3NI9 A;  3A3I A;  3G2Y A;  3V50 A;  3KSI A;  3MZE A;  2VKS A;  3O86 A;  1E3U A;  2A24 A;  2R78 A;  3EWK A;  2Y8H A;  4FSF A;  4ARZ A;  1YLP A;  1YT4 A;  4CLC D;  3BEB A;  4ZBE A;  4RX2 A;  4HJ6 A;  3PBS A;  4E3K A;  1GHM A;  1XGJ A;  3IXD A;  4HH2 A;  3T1S A;  2Y55 A;  3HLG A;  4JXG A;  1E4D A;  4KQD A;  4BQM A;  3IX3 A;  4CPK A;  2PBD P;  1IFQ A;  2ZBB A;  3B42 A;  2B18 A;  3LI8 A;  5AQB A;  3KSF A;  2Z6C A;  2A24 B;  4GKU A;  4BD0 A;  4IVI A;  1S67 L;  2ZM2 A;  4ARZ B;  3T4T A;  4QHC A;  1FIL A;  4Y3I A;  3CG5 A;  2ZC7 A;  4MNR A;  4WLA A;  1GCE A;  1TS0 A;  4PM5 A;  3VP3 A;  1NJ4 A;  3ZNT A;  2W3H A;  5CTN A;  4S2N C;  5A90 A;  4ZAM A;  3T4K A;  2Z2L B;  3O87 A;  5KSC A;  3M6H A;  2X71 A;  2UV0 E;  4E04 A;  2ZM8 A;  4RA7 A;  2Z2M B;  2BLS A;  4MN6 A;  2ZQD A;  3A0V A;  3QP6 A;  5CX7 A;  2V2F F;  3MXR A;  4OOM A;  4FTX A;  5GHX A;  3SW1 A;  3H82 B;  4BJP A;  3EQV A;  1MBL A;  3TW8 A;  1M40 A;  3IX4 A;  3KSH A;  5TBM B;  2V1B A;  1L3L A;  1Z09 A;  5M1A A;  3OC2 A;  3M2J A;  4ZJ2 A;  1VEU B;  4JF4 A;  4LLO B;  2XSS A;  3IWI A;  2P08 A;  1CEG A;  4YIN A;  3VP0 A;  4BWI A;  5HL1 A;  1CQA A;  2V8F A;  3E4Q A;  3IBJ A;  1YKD A;  3HLC A;  1SKO A;  3LR0 A;  4H6J A;  3WS2 A;  3DWK A;  2H0Y A;  4DE1 A;  2JBF A;  4YFM A;  4JBF A;  2GX5 A;  2WGI A;  2V9A A;  3FYZ A;  5J7E A;  1LSV A;  4ME4 A;  1D7E A;  1EW0 A;  2KDK A;  2R9W A;  2OAP 1;  5EM0 A;  1KGE A;  3E4O A;  2X01 A;  5EVI D;  4OLD A;  1XJ2 A;  1H8Z A;  1SKO B;  3PBQ A;  3ZG9 B;  3IH8 A;  4JPM A;  3BM6 A;  2W1T B;  3RXX A;  4PKY A;  4OVD A;  4GD8 A;  4EEP A;  1BLS A;  4XXR A;  2Q9N A;  1IYO A;  5KSH A;  4IBX A;  4HQA A;  1ACF A;  3HL9 A;  3BWL A;  2VEA A;  4BBV A;  2W1R A;  2IA2 A;  2J8Y A;  2RL3 A;  2G2W A;  3HRE A;  3PXP A;  3OPP A;  4EUV A;  1YPR A;  2DCF A;  2VV7 A;  3W4O A;  1SCW A;  3OCN A;  4E6W A;  4HI4 A;  5AJG A;  1GSV A;  2CMN A;  3ICY A;  3G32 A;  1MWU A;  1K57 A;  1PNE A;  3P98 A;  1F98 A;  4R1G A;  4MBK A;  1NYY A;  3N4I A;  2XRO A;  3G34 A;  3DTK A;  1IYQ A;  1XA1 A;  2WK0 A;  1P0Z A;  4X25 A;  1TS6 A;  4DXB A;  3WRZ A;  4G3K A;  1Q2P A;  2EWW A;  3AGF A;  3RH8 B;  4PAU A;  3LEZ A;  2O99 A;  1P9W A;  4JGQ A;  1GSW A;  1ES4 A;  2NUT C;  5EVI A;  1T19 A;  2Y79 A;  4JLF A;  4LV0 A;  4JF5 A;  2FZ0 A;  3GMW A;  3G6O A;  1OJG A;  3ZVW A;  2JHE A;  1W8Q A;  5FAP A;  1YMS A;  3CWF A;  4X55 A;  1OME A;  3W8K A;  1W63 Q;  1SHV A;  2B95 A;  4KZ5 A;  3DWZ A;  4BEN A;  4D60 A;  4II7 A;  4Q0I A;  4R3A A;  4MCW A;  1ZTU A;  3HLD A;  3N6I A;  5EVI B;  4HBU A;  2Y2I A;  3HJI A;  2VX8 A;  3QP1 A;  1CJF A;  4LV1 A;  4JXS A;  3A3J A;  1LT0 A;  3UMD A;  2C5W B;  1SDE A;  1JVJ A;  4NET A;  2Q9M A;  3E2L A;  4KZA A;  3R7W A;  3D4F A;  2AVX A;  3CPT A;  1WE4 A;  3FKV A;  4LRY C;  2JKG A;  2ZC5 B;  3LIC A;  3FKW A;  2EX9 A;  5BOH A;  1RCJ A;  2XF3 A;  2ZQA A;  2PT7 A;  2GNX A;  4NK3 A;  1K55 A;  2JKR I;  3ZG5 A;  3VSK A;  3LFV A;  3LO7 A;  3CPT B;  4B9O A;  4EW7 A;  3EGX C;  3OOV A;  2ZMV A;  5M18 A;  4NXB A;  2QHK A;  3VE3 A;  3PHY A;  1LSW A;  5HD3 A;  2Y2O A;  1LI9 A;  4AFI A;  4WF0 A;  1YSQ A;  1L0D A;  1W79 A;  4NG2 A;  2VGL M;  2HV1 A;  1AXB A;  1Y54 A;  2K31 A;  4LCL A;  4XUZ A;  4Y0T A;  3E2K A;  1CF0 A;  4Y7P A;  4BBT A;  4E6X A;  2GJ3 A;  2EX8 A;  3BFE A;  4R3J A;  1FCN A;  1M6K A;  1V9Y A;  3H7W B;  2O9B A;  4S2K A;  1OTB A;  5HDS A;  3I7J A;  1LI0 A;  3D3O A;  1OT6 A;  3BFD A;  1YAX A;  1VQQ A;  1GA9 A;  1VET A;  3T4L A;  1JTD A;  4KZ6 A;  1G68 A;  5FAQ A;  3ZDJ A;  4MBF A;  2L0W A;  4P85 A;  5FQM A;  3T1X A;  2XFT A;  1H5X A;  3VSL A;  4UA9 A;  4R6L A;  1ES2 A;  2HDR A;  4HHD A;  4C75 A;  4R4S A;  1MWR A;  2HZ5 A;  3GDI A;  4LV3 A;  4XUX A;  2V0W A;  1STZ A;  1NLY A;  3PBR A;  3N8L A;  5FQJ A;  4LEN A;  3SZT A;  3DBA A;  4HY8 A;  2Y91 A;  2EA9 A;  3IF6 C;  3T50 A;  1DJC A;  1N9L A;  2EXA A;  5DF8 A;  2J3T C;  2PRF A;  2VGK A;  1F9I A;  5L2F A;  2KX6 A;  1J3W A;  3W4Q A;  4B88 A;  2QWS A;  2Y2N A;  4OKP A;  1QMF A;  1W8Y A;  3KYQ A;  1OJ5 A;  4LRZ E;  4L0L A;  4S2L A;  1PWC A;  3HCY A;  5LBR A;  5E43 A;  3UE3 A;  3T4S A;  1BLP A;  2FFY A;  3F1O A;  5G4Y A;  3U4L P;  5EOE A;  1BLH A;  2HGV A;  2Y2G A;  5KIZ A;  1OTI A;  2A3U A;  3N8S A;  1IKG A;  1GSX A;  3E4P A;  2HP9 A;  5TJJ A;  2Y4A A;  3UPO A;  3T12 B;  3MFX A;  5KMW A;  2B5R A;  1K6R A;  3PBO A;  3UPP A;  3GVB A;  3ZFZ A;  3CAX A;  3CLO A;  4KQO A;  1MKI A;  1K0K A;  2PHY A;  2HPB A;  3LIB A;  3OCL A;  1ZHH B;  1RP5 A;  4PM8 A;  3F1N A;  1GHP A;  2W3G A;  1G6A A;  3IT9 A;  4RX3 A;  4EQ1 A;  2CC1 A;  3IWQ A;  3SH9 A;  4GOG A;  5CHU A;  2DRW A;  2OLV A;  3HJK A;  1FCM A;  2Y2L A;  1L2S A;  5IHV A;  4HES A;  3K3D A;  1PRQ A;  2WKE A;  1TDG A;  4P6Z S;  1LSX A;  4PKY G;  2V20 A;  5DFX A;  4B4X A;  4BD1 A;  4UQI S;  4Q8I A;  4KG5 A;  4E3N A;  2WYX A;  3O3V A;  2ACG A;  3F1N B;  3HLB A;  3UB6 A;  5F1G A;  4BBU A;  1FSY A;  3VOZ A;  3HUM A;  3UNW A;  1PZO A;  3T1R A;  2VLG A;  4Y0U A;  5HAI A;  1BT5 A;  4HJ3 A;  3BYD A;  3C8C A;  1BLC A;  4EUZ A;  1VM1 A;  1PI5 A;  4IUH A;  2PD7 A;  3DAV A;  4GS9 A;  5F1F A;  1V9Z A;  2ZC3 B;  4EQI A;  5L10 A;  3S22 A;  2GDN A;  4E3I A;  3G4P A;  1S4R A;  3MBZ A;  4X69 A;  4M3K A;  3CI6 A;  4MEZ A;  1BUE A;  3TRC A;  5HL6 A;  3MF0 A;  2IWC A;  1BYW A;  3LR4 A;  3VOL A;  3CJM A;  1H8M A;  1KE0 A;  1SDN A;  3BW6 A;  2Y2J A;  4B93 A;  2O9A A;  4GS9 B;  3VP4 A;  1W5D A;  3N8R A;  2Y2M A;  4R4R A;  1XJ4 A;  3QNC A;  4U0X A;  4YWZ A;  4DN0 A;  1KDW A;  3CZD A;  4PPR A;  4P6Z M;  1W7F A;  2WAE A;  1PI4 A;  4OPQ A;  2PU4 A;  4UQI M;  4HP4 A;  4DDS A;  4GLQ A; 
#chains in the Genus database with same CATH homology
 2PBY A;  1DJA A;  2ZM0 A;  4X6T A;  4OPZ A;  3LEZ A;  4FCF A;  4R0Q A;  5HFO A;  3BLM A;  5J8X A;  1HTZ A;  4N1X A;  4OQ0 A;  1ES4 A;  5FQK A;  2ZJ9 A;  1XKZ A;  4KEN B;  5EVI A;  3HUN A;  3BLS A;  4O7D A;  3G2Z A;  3GR2 A;  4WM9 A;  4RYE A;  1PZP A;  4JLF A;  4LV0 A;  3SH7 A;  4JF5 A;  5G18 A;  4S2I A;  3GMW A;  2ZQC A;  5FA7 A;  3ZVW A;  3UDI A;  5HAQ A;  4BLM A;  1KE3 A;  1W8Q A;  1K25 A;  5FAP A;  1YMS A;  3IXG A;  1FQG A;  4EBN A;  1J9M A;  1CI8 A;  5FI2 A;  4U0T A;  1OME A;  4X55 A;  2OV5 A;  3TOI A;  1S6R A;  3W8K A;  3A3D A;  1BZA A;  4GN2 A;  1FSW A;  1SHV A;  4CJN A;  5CGS A;  4KZ5 A;  3DWZ A;  4GD6 A;  3NDE A;  4BEN A;  5FAS A;  1XPB A;  4S2O A;  2WZZ A;  2R9X A;  2H0T A;  4N9K A;  1ESI A;  1PWG A;  2UWX A;  3VFH A;  1Q2Q A;  1PYY A;  1XA7 A;  3GQZ A;  3UY6 A;  1DJB A;  3PTE A;  3TG9 A;  3WRT A;  1ESU A;  3HLD A;  3M6B A;  3N6I A;  5EVI B;  1E25 A;  4U3T A;  1RGZ A;  1TDL A;  2XD5 A;  4Z9Q A;  1NZU A;  4ZJ1 A;  4HBU A;  3LCE A;  4H8R A;  4FH2 A;  2JC7 A;  2Y2I A;  4RVA A;  2ZLY A;  3HLF A;  4OQH A;  3NCK A;  4LV1 A;  5FI7 A;  4JXS A;  4EBP A;  3A3J A;  3AGE A;  4GZB A;  4KG6 A;  3G30 A;  4DE0 A;  3HBR A;  1IEM A;  2C5W B;  2XFS A;  5CGW A;  1SDE A;  2EX2 A;  5TFQ A;  4WZ5 C;  4ZDX A;  5GHY A;  3MXS A;  1YMX A;  1JVJ A;  2HP6 A;  4LV2 A;  2IWD A;  3BFC A;  2Q9M A;  3E2L A;  3NBL A;  4KZA A;  4NET A;  4OON A;  3UE0 A;  5CGX A;  1LL9 A;  1CK3 A;  3D4F A;  4K0X A;  1WE4 A;  1K54 C;  2JE5 A;  3OZH A;  3PAG A;  4OOY A;  3FKV A;  1I5Q A;  3SS5 A;  4JKT A;  1XX2 A;  3LY3 A;  5CRF A;  1XXM A;  5DTK A;  4DKI A;  1K55 C;  2ZC6 B;  5FI6 A;  3S1Y A;  5CTM A;  2ZC5 B;  1HZO A;  3FKW A;  2ZQ7 A;  3IF5 A;  4WZ5 A;  2EX9 A;  5BOH A;  3ITA A;  4ID4 A;  1RCJ A;  5JYO A;  1LHY A;  3HVF A;  2XF3 A;  1XGI A;  4C6Y A;  4K0W A;  1MY8 A;  2ZQA A;  4IVK A;  5E2H A;  1KVM A;  1MXO A;  4WEJ A;  4E3J A;  4HEF A;  5CXW A;  3SS3 A;  2E8I A;  4UAA A;  1BTL A;  2J9P A;  4DF6 A;  1PW8 A;  1MWS A;  2Y2P A;  1K55 A;  4NK3 A;  4UA7 A;  1L0F A;  2VGJ A;  4ZTK A;  3IF6 A;  2WGW A;  4C3Q A;  1K56 D;  3GSG A;  5AQ9 A;  3ZG5 A;  3V39 A;  3VSK A;  1N4O A;  5GLA A;  3N7W A;  1MWT A;  4KG2 A;  1Z6F A;  3LO7 A;  2EXB A;  5DTT A;  3O88 A;  4B4Z A;  3FZC A;  3ZG7 B;  3ISG A;  5A92 A;  2H5S A;  1HD8 A;  3IWO A;  1LL5 A;  2H10 A;  5M19 A;  4BL2 A;  3RXW A;  5M18 A;  5EVL A;  1FR6 A;  5EE8 A;  3P09 A;  2Y2O A;  4QD4 A;  1CI9 A;  4QY6 A;  1LI9 A;  3M2K A;  3DW0 A;  1L0D A;  1W79 A;  2HDS A;  3IHA A;  5HAR A;  2DNS A;  3ZGA B;  1U60 A;  3VFF A;  4F94 A;  1AXB A;  4DDY A;  1Y54 A;  4KZ4 A;  3C4O A;  4A5R A;  2Y2K A;  4OPR A;  4LCL A;  4XUZ A;  2WGW B;  2EX6 A;  5FAT A;  1TVF A;  1IKI A;  3E2K A;  4KZ9 A;  4Y0T A;  4Y7P A;  3GRJ A;  4WYY A;  2Y2H A;  5EVI C;  4R3B A;  5E2F A;  3W4P A;  1KDS A;  4E6X A;  4JXV A;  4Y0O A;  4OQG A;  3UDF A;  3V3R A;  5HAP A;  5TGF A;  3G31 A;  2EX8 A;  3BFE A;  4R3J A;  3Q07 A;  1FCN A;  3OPR A;  2XH9 A;  1M6K A;  1KE4 A;  2RCX A;  1HVB A;  5HX9 A;  2WZX A;  4S2K A;  3MZD A;  3QNB A;  1C3B A;  5JYP A;  1CEF A;  5GLD A;  3I7J A;  2WKI A;  1LI0 A;  2EFU A;  2XQZ A;  5FSR A;  2P74 A;  1YLZ A;  1IEL A;  3UO9 A;  4X68 A;  1ERM A;  3BFD A;  3Q7Z A;  1VQQ A;  3ZG0 A;  3VP2 A;  1MPL A;  1GA9 A;  2ZQ9 A;  1EWZ A;  3NC8 A;  1S0W A;  3HLE A;  4MLL A;  1GHI A;  1JTD A;  1G68 A;  2G2U A;  3HUO A;  1N9B A;  4KZ6 A;  4QU3 A;  4P87 A;  4MBF A;  5FAQ A;  3ZDJ A;  1ZKJ A;  4P85 A;  5FQM A;  2XGN A;  4QJG A;  4GDN A;  1YLT A;  4MBH A;  4WEL A;  5HW3 A;  2XFT A;  1I2W A;  1H5X A;  4LCM A;  1ZG4 A;  2A49 A;  3MKF A;  3VSL A;  4UA9 A;  4OP5 A;  2OSU A;  3BEC A;  4D2O A;  3PBT A;  1ES2 A;  2P9V A;  3B3X A;  2HDR A;  4C75 A;  2IWB A;  5EUA A;  1K56 A;  4R4S A;  5FDH A;  4OP8 A;  4EV4 A;  1ERQ A;  1MWR A;  1K38 A;  2I72 A;  4FD8 A;  2WGV A;  2Y2Q A;  4S2J A;  4UHU A;  5GLC A;  4LV3 A;  3MKE A;  1O07 A;  1XP4 A;  2FFF B;  3IHB A;  4WZ4 A;  4XUX A;  3IXH A;  5FQ9 A;  3SH8 A;  2PU2 A;  2ZQ8 A;  4OPY A;  5A91 A;  4GNU A;  4BL3 A;  3BFF A;  3NI9 A;  3A3I A;  4N92 A;  5EPH A;  3G2Y A;  3V50 A;  1I2S A;  1IYP A;  3PBR A;  3N8L A;  1ERO A;  3MZE A;  3O86 A;  1E3U A;  5FQJ A;  3ZCZ A;  4LEN A;  1WYC A;  4FSF A;  4WMC D;  3CMZ A;  1ES3 A;  1YLP A;  1YT4 A;  4IBR A;  3BEB A;  4ZBE A;  4RX2 A;  1IYS A;  2Y91 A;  3Q1F A;  4OOL A;  4PM9 A;  3IF6 C;  1DJC A;  2HDQ A;  5GLB A;  3PBS A;  3RJU A;  2P9V B;  3SOI A;  4E3K A;  1GHM A;  1XGJ A;  3Q7V A;  3IXD A;  3VP1 A;  2QPN A;  2EXA A;  1RGY A;  1L0G A;  5DF8 A;  2Y55 A;  3HLG A;  4JXG A;  1E4D A;  2VGK A;  5L2F A;  2Y59 A;  4IED A;  3VMA A;  4UA6 A;  5TR7 A;  4BQM A;  1TEM A;  2X02 A;  1SKF A;  3W4Q A;  4B88 A;  1KVL A;  4GB7 A;  4CPK A;  5AQA A;  2Y2N A;  5DF9 A;  4OKP A;  1QMF A;  1PIO A;  3WS1 A;  3ZHH A;  1W8Y A;  2XLN A;  3OPH A;  4QB8 A;  5AQB A;  4GKU A;  4QY5 A;  3A3E A;  4P0M A;  4L0L A;  4BD0 A;  4S2L A;  4IVI A;  1PWC A;  2ZM2 A;  4QHC A;  5E2G A;  3DTM A;  1JWP A;  3G35 A;  3WS5 A;  4KZ3 A;  1NY0 A;  1O7E A;  3CG5 A;  1PW1 A;  2ZC7 A;  5E43 A;  4MNR A;  1BUL A;  4FH4 A;  5F82 A;  3UE3 A;  1GCE A;  3Q7V B;  2XEP A;  5CED A;  3IQA A;  3GTC A;  1FOF A;  3BFG A;  3NY4 A;  1BLP A;  2FFY A;  3ZG8 B;  4PM5 A;  4S2P A;  1JTG A;  3VP3 A;  1NJ4 A;  1NZO A;  5E2E A;  5EOE A;  3ZNT A;  1BLH A;  5CTN A;  4N1H A;  3IF6 B;  4S2N C;  2Y2G A;  5FQI A;  5A90 A;  4ZAM A;  2Z2L B;  3O87 A;  4OLG A;  5F83 A;  4DE2 A;  2A3U A;  2HDU A;  3FWL A;  5KSC A;  1WYB A;  3M6H A;  3N8S A;  2X71 A;  3UPN A;  1IKG A;  2ZM8 A;  2HP9 A;  3UDX A;  4DRT A;  4RA7 A;  2Z2M B;  5U47 A;  2BLS A;  4DE3 A;  2Y4A A;  2ZQD A;  4PM7 A;  4S2N A;  3UPO A;  3TSG A;  1BSG A;  2V2F F;  1YLJ A;  3A3F A;  4K91 A;  4R23 A;  2XR0 A;  3MXR A;  4OOM A;  5KMW A;  2JCH A;  5GHX A;  2WKH A;  2V1Z A;  3GV9 A;  5I94 A;  2B5R A;  4KQR A;  1K6R A;  3PBO A;  3UPP A;  3ZNY A;  5CER A;  4BJP A;  3EQV A;  3C7U A;  1YM1 A;  3MFD A;  3GVB A;  3IXB A;  2WAD A;  3ZFZ A;  4WMC A;  3IH9 A;  1MBL A;  1ES5 A;  3S4X A;  3WS0 A;  4KQO A;  3WWX A;  1EI5 A;  1MKI A;  1YLY A;  3LY4 A;  2HP5 A;  2HPB A;  4KZB A;  3WS4 A;  3OCL A;  1M40 A;  4ZJ3 A;  1RP5 A;  4PM8 A;  1K4F A;  1ONH A;  5M1A A;  3OC2 A;  4GDB A;  3M2J A;  3V3S A;  2OLU A;  1GHP A;  2C6W B;  4ZJ2 A;  4JF4 A;  4P6B A;  1QME A;  4WEK A;  1G6A A;  3IWI A;  4YIN A;  1CEG A;  3IT9 A;  3VP0 A;  1GA0 A;  5HL1 A;  4RX3 A;  1FR1 A;  2CC1 A;  3IWQ A;  3SH9 A;  4GOG A;  1ZG6 A;  5CHU A;  3HLC A;  2DRW A;  2OLV A;  4E3L A;  5GHZ A;  1FCM A;  3SS4 A;  5FQQ A;  2Y2L A;  4N9L A;  1L2S A;  5IHV A;  3WS2 A;  4HES A;  1NYM A;  3V5M A;  3ITB A;  3DWK A;  3HLW A;  4E3O A;  2H0Y A;  4DE1 A;  2JBF A;  1LLB A;  5CHJ A;  2WKE A;  1TDG A;  1ZC2 A;  5A93 A;  2V20 A;  3PAE A;  3UE1 A;  4YFM A;  4B4X A;  4BD1 A;  4JBF A;  4KZ7 A;  4PMA A;  4Q8I A;  1K6S A;  2WGI A;  4KG5 A;  4E3N A;  3C7V A;  2WYX A;  3O3V A;  5DF7 A;  1H8Y A;  3FYZ A;  5CEC A;  5FAO A;  4EBL A;  2R9W A;  3C5A A;  3HLB A;  1KGG A;  4X56 A;  1NRF A;  5AQ7 A;  1KGE A;  1ALQ A;  2X01 A;  5GL9 A;  5EVI D;  4OLD A;  4KQQ A;  4E3M A;  2J7V A;  3NIA A;  1YLW A;  1H8Z A;  3QHY A;  5F1G A;  4OH0 A;  3PBQ A;  4DXC A;  3ZG9 B;  1FSY A;  4WBG A;  3BRM A;  1NXY A;  3VOZ A;  3IH8 A;  3HUM A;  3UNW A;  1PZO A;  3BM6 A;  4JPM A;  3RXX A;  1YQS A;  4S2M A;  4OVD A;  2BG1 A;  4GD8 A;  4Y0U A;  2XD1 A;  1BLS A;  1PWD A;  2Q9N A;  2QZ6 A;  4XXR A;  5D3O A;  2WUQ A;  1IYO A;  2XK1 A;  3EQU A;  5HAI A;  1BT5 A;  3AGD A;  5KSH A;  2ZMA A;  3BYD A;  3JYI A;  4IBX A;  1BLC A;  3ZVT A;  2EFX A;  1VM1 A;  1PI5 A;  3PBN A;  4EUZ A;  5DVA A;  4HBT A;  5F1F A;  3HL9 A;  1K54 A;  2ZC3 B;  4EQI A;  1JWZ A;  3S22 A;  3FV7 A;  3Q81 A;  2J8Y A;  2GDN A;  2RL3 A;  4E3I A;  5KZH A;  1L0E A;  3G4P A;  3UN7 A;  2G2W A;  1KGF A;  3MBZ A;  5DTS A;  3HRE A;  4JXW A;  2QMI A;  3OPP A;  4M3K A;  4X69 A;  4MEZ A;  3NDG A;  2DCF A;  1BUE A;  3VOY A;  1JWV A;  3W4O A;  1K57 C;  1SCW A;  3OCN A;  4E6W A;  2J9O A;  2IWC A;  2XDM A;  1FCO A;  3CJM A;  5CHM A;  1KE0 A;  4PM6 A;  1E3U D;  1SDN A;  3G32 A;  1MWU A;  2Y2J A;  5EEC A;  1K57 A;  2ZC4 B;  3VP4 A;  1W5D A;  3OPL A;  3N8R A;  4OQI A;  2Y2M A;  3P98 A;  4R4R A;  4R1G A;  3QNC A;  1NYY A;  4MBK A;  3N4I A;  2ZD8 A;  4U0X A;  4X53 A;  3G34 A;  5EOO A;  1KDW A;  1DY6 A;  4EWF A;  5CEB A;  3CZD A;  1IYQ A;  3C4P A;  4KZ8 A;  2WAF A;  1XA1 A;  2WK0 A;  4PPR A;  3MZF A;  1W7F A;  1K4E A;  2WAE A;  1PI4 A;  4JF6 A;  4OPQ A;  3WRZ A;  4DXB A;  2PU4 A;  1Q2P A;  4DDS A;  1ONG A;  3Q82 A;  3AGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...