1ALQA

Circularly permuted beta-lactamase from staphylococcus aureus pc1
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
263
structure length
259
Chain Sequence
b'SEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEFAAAAKELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CP254 BETA-LACTAMASE
publication title Circularly permuted beta-lactamase from Staphylococcus aureus PC1.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 90
structure length 259
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1997-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1alqA00
1ES2A 3N8SA 1OMEA 3WRZA 3BFFA 5HFOA 4WEJA 2HDUA 3DWKA 1BLHA 2ZD8A 1YLPA 2WZXA 4EUZA 2ZMAA 1NZOA 4L0LA 4DKIA 3CJMA 2VGJA 1L0FA 3C4OA 3V3RA 4DXBA 4KZ9A 4S2NA 5EVIA 2WKHA 2IWBA 1K54C 5DF9A 2XF3A 3GRJA 3N4IA 4NK3A 4OOMA 1PWDA 1DJBA 1K4FA 3W8KA 3ZNTA 4YINA 3IF6A 4B4ZA 3Q7ZA 1KDSA 3NIAA 5GLDA 3A3FA 2ZC6B 3MZEA 4ID4A 1ZG6A 2XEPA 1XXMA 2JC7A 1YQSA 1ZC2A 4RX2A 4N9KA 4HESA 1XGJA 2ZM8A 3HLBA 4C6YA 3G30A 3VP0A 4JF5A 1TDLA 1IYPA 2XFTA 1LL5A 4OPYA 3OCLA 2Y2MA 2ZM2A 3OZHA 4WZ5C 5F83A 3BFEA 4K0WA 4WZ4A 3MKEA 2OV5A 1E3UA 1CK3A 1W5DA 3IXBA 3NY4A 1PZPA 4MBKA 5EVIB 3Q81A 4OP8A 3N6IA 3E2KA 3IF6C 5FQKA 4JF4A 4OONA 1NYYA 2WGIA 2RL3A 2WKIA 2FFYA 3IF6B 1PI5A 3G34A 3IT9A 4GN2A 4OPRA 5FI7A 5M1AA 5EOEA 3WS1A 4QB8A 3DWZA 3QNBA 5FATA 1K56A 1CI8A 4H8RA 3SOIA 2WGWA 4OPQA 4GNUA 1O07A 2PU2A 5F1GA 1MXOA 3NDGA 3Q1FA 4CJNA 5GL9A 1K38A 2G2WA 1RCJA 4B4XA 1GCEA 1J9MA 3LCEA 1ES3A 4N1XA 5M19A 3CMZA 3TG9A 2Q9MA 2EFUA 4KZ3A 4OQGA 4A5RA 3HL9A 4ZJ1A 2QPNA 3FWLA 4JF6A 1BUEA 1HZOA 4BD0A 3BFCA 1YMXA 3AGFA 4QY5A 3UPNA 1PWGA 3HLGA 4OH0A 3HLEA 2HPBA 2XK1A 3SH8A 1QMFA 5HW3A 2H0TA 3RJUA 4UA6A 5CTMA 4KZ6A 4B88A 1SCWA 3PAGA 3HUMA 3G2YA 2WGWB 5CTNA 3G32A 4HBTA 4BQMA 4OQ0A 3UDFA 3MXRA 3ISGA 1I2SA 4IVKA 1YLTA 5JYPA 4E3OA 2OLVA 3SS3A 3NI9A 3IWOA 4KQQA 5DTSA 3W4QA 1E3UD 2OSUA 1FCMA 4MBFA 5A91A 1BTLA 5AQBA 4E3KA 2V2FF 4KZBA 4KZ4A 1BLCA 1IEMA 2UWXA 4QHCA 4WYYA 5A90A 1SKFA 1LI9A 1W8YA 4EBLA 2HDSA 4UA7A 3WS0A 2H0YA 4YFMA 4KG2A 3D4FA 3G31A 3HBRA 4P85A 5KSCA 4X56A 3VMAA 5E2EA 4U3TA 5E43A 3B3XA 4X55A 1VQQA 5BOHA 5F1FA 2E8IA 1BZAA 4HEFA 3CZDA 4WMCD 4KENB 3RXWA 2J7VA 2XQZA 1MWRA 1IYOA 1GHMA 3W4OA 1S0WA 4Y0UA 3HLFA 3HREA 4XUZA 3IQAA 4GD8A 3ZCZA 2WYXA 4JXGA 4LV1A 4GDBA 5TGFA 3VOZA 3UPOA 2J9PA 2X71A 5DF8A 3O87A 2B5RA 4MBHA 1MY8A 1K6RA 2H10A 3EQUA 5U47A 4WELA 1E25A 3GQZA 3WS4A 1MBLA 1KGEA 1QMEA 3G35A 4BD1A 3I7JA 3NC8A 3NCKA 4Y7PA 4PM5A 3ZVWA 3JYIA 5FAPA 1BLSA 1EI5A 2Y2OA 3QHYA 1PZOA 2IWCA 2ZQ8A 2GDNA 3NDEA 5AQAA 3G4PA 4KQRA 1M6KA 4UA9A 2HP9A 4WBGA 1PW1A 4RYEA 1L0GA 2QZ6A 3GMWA 3V50A 2EX2A 4S2IA 4C75A 4R3JA 2V1ZA 5FSRA 5GLBA 1HD8A 1W8QA 4PM8A 3ITAA 2X01A 3DW0A 1ZG4A 2ZQCA 4EV4A 3C7VA 5CXWA 5GHYA 3ITBA 1Z6FA 2XDMA 4GZBA 3PBTA 2ZQAA 5E2GA 2HP6A 2RCXA 3PTEA 3ZG5A 1N4OA 3BM6A 4P6BA 1LL9A 5HAIA 3N7WA 3SH7A 1LHYA 3W4PA 1MKIA 1K57A 4RX3A 4DE0A 1CI9A 4S2NC 5CRFA 5EVIC 5HAQA 1RGYA 3VOYA 2WAEA 3N8LA 5FA7A 4KZ7A 2A3UA 5EE8A 3VFFA 1L2SA 4P0MA 4DDSA 1ONGA 4R3BA 2XLNA 3HLDA 3FKWA 3PBRA 1FCOA 2EX9A 1K25A 1LLBA 3MKFA 2WAFA 4R4RA 3GSGA 5CGXA 3BLSA 2HP5A 1NZUA 2Y91A 2ZC4B 4N9LA 3OPRA 1FSWA 1W79A 4OQIA 3SH9A 3UO9A 1ZKJA 5EPHA 2Y2JA 3WWXA 5M18A 5EVLA 3IWQA 4KZAA 1N9BA 2Y2NA 4GB7A 3UE0A 4X6TA 3HVFA 1L0DA 3GV9A 4E3IA 2ZC5B 2JE5A 3ZG7B 4E3MA 4X68A 1NY0A 4FH4A 3A3DA 2HDQA 1XP4A 2ZQDA 4MEZA 4OKPA 4OOLA 4PMAA 5FAOA 5FAQA 4OLGA 4Q8IA 3IHAA 1RGZA 5G18A 1K55A 1O7EA 5GHXA 3PBOA 1BT5A 2WK0A 1FOFA 1XPBA 3P09A 3BRMA 5EVID 3SS5A 4FSFA 1KVLA 1E4DA 1JWVA 1PIOA 2VGKA 5FQMA 3VP3A 1YM1A 4JPMA 5FQJA 3ZFZA 2EXAA 1YLZA 4N92A 4OVDA 1JTDA 2ZLYA 1K6SA 1KE3A 2DNSA 1CEGA 1IELA 3VSLA 3O3VA 3ZDJA 1DJAA 2JBFA 2WGVA 2Y2LA 4E6XA 3C5AA 3V3SA 5CEDA 4LV3A 2C6WB 4P87A 4ZJ3A 3ZG9B 3CG5A 4KG6A 4BL3A 4E3JA 1FCNA 4S2PA 1PWCA 3S4XA 3ZVTA 1WE4A 4FCFA 4LENA 4U0XA 5KSHA 4Y0TA 4FD8A 5TFQA 1XX2A 3Q07A 3ZHHA 1JWPA 3P98A 4UAAA 4WM9A 3MZFA 3LO7A 3O88A 3PBNA 2Y2GA 3BFDA 2I72A 4RVAA 1ERQA 5I94A 1H8YA 3EQVA 4Z9QA 2Y2IA 3UY6A 2P9VA 3M2JA 3TSGA 3S22A 2WKEA 1YLYA 3UPPA 4RA7A 1TVFA 3VP4A 4GKUA 2XR0A 1BSGA 1WYBA 5KMWA 3HUNA 4DDYA 5FDHA 4QU3A 4OQHA 2C5WB 3OPLA 4OOYA 4K91A 3UE1A 2PBYA 5FQQA 4DE1A 1K56D 4KZ5A 1LI0A 1KE0A 4QD4A 5FI6A 3E2LA 1JVJA 5CERA 4KG5A 3G2ZA 4K0XA 2EFXA 3ZG0A 2IWDA 2R9XA 1HVBA 4DF6A 2JCHA 1SDEA 2P74A 5JYOA 4D2OA 2Y2PA 4LV0A 3AGEA 2Y2HA 3IH9A 4IEDA 4JXSA 4N1HA 2P9VB 1H8ZA 3WS5A 1PI4A 2XGNA 5FQ9A 4QJGA 1GA9A 1U60A 5FQIA 1K54A 3C7UA 3IHBA 3NBLA 1FQGA 1DY6A 5D3OA 4NETA 1KE4A 2WADA 5FI2A 3FKVA 1I2WA 5HX9A 1HTZA 3LY4A 4IVIA 1ALQA 3A3JA 3OCNA 3Q82A 3SS4A 4WEKA 3V39A 1KGFA 3OPHA 4BLMA 1YLJA 5GLAA 1VM1A 1JTGA 3VP2A 3Q7VA 4EQIA 5CHMA 2WZZA 2ZM0A 3C4PA 1MPLA 3PBQA 1L0EA 4X53A 1FR1A 3BFGA 1DJCA 5E2HA 2ZQ9A 3UDXA 1ESUA 2X02A 3UNWA 2XFSA 1KGGA 1YMSA 3GR2A 4WZ5A 3V5MA 1JWZA 2HDRA 3VSKA 1WYCA 5CEBA 2BLSA 2Y2QA 2EX6A 5CHJA 4JXVA 4Y0OA 4GOGA 4LV2A 1GA0A 3HUOA 3S1YA 4QY6A 5CECA 2WUQA 4OPZA 3QNCA 5AQ7A 1RP5A 5DF7A 1YLWA 3ZGAB 4MLLA 3A3EA 3MZDA 4BENA 2ZQ7A 2Y55A 3PAEA 1FSYA 3IF5A 3UN7A 2DRWA 3Q7VB 3BLMA 1ES5A 1SDNA 4S2LA 3M2KA 4DRTA 1IKGA 2G2UA 4S2KA 1I5QA 3GTCA 5EOOA 4R23A 1XA1A 1XKZA 1K4EA 3FV7A 1Y54A 3A3IA 4C3QA 4XUXA 4EWFA 1GHIA 1FR6A 2Y4AA 3DTMA 4ZJ2A 1KVMA 3IH8A 1K57C 4IBXA 2Z2MB 4GD6A 3OC2A 4PM6A 2CC1A 3N8RA 4KQOA 4EBPA 4PPRA 1G6AA 2J9OA 2H5SA 5DVAA 3MXSA 1H5XA 2DCFA 1NJ4A 1TDGA 3BECA 4M3KA 4JLFA 4R4SA 1EWZA 4EBNA 3HLCA 3O86A 5A93A 4R1GA 4O7DA 5F82A 3IWIA 4KZ8A 1IYQA 4DXCA 3HLWA 4DE3A 4JKTA 4IBRA 1AXBA 1S6RA 3FYZA 5DTTA 5KZHA 1W7FA 2Q9NA 4X69A 1ES4A 2PU4A 2Z2LB 5IHVA 4WMCA 2V20A 4E3NA 5HL1A 2XD1A 1ESIA 5CHUA 5A92A 1ERMA 1K55C 3ZNYA 5EUAA 5HAPA 1MWUA 4PM9A 2ZC7A 4UHUA 4LCLA 3LEZA 3PBSA 3AGDA 2R9WA 5DTKA 5J8XA 5GLCA 1NRFA 4DE2A 1G68A 4FH2A 4BL2A 1TEMA 1NYMA 3UE3A 2Y59A 1CEFA 3OPPA 4S2JA 4F94A 4S2OA 4XXRA 3RXXA 4R0QA 3UDIA 3WRTA 1BULA 1ONHA 2Y2KA 3TOIA 1IYSA 3IXHA 4OLDA 3FZCA 1PYYA 4JBFA 3LY3A 1YT4A 2XH9A 1C3BA 2BG1A 3VP1A 2OLUA 4OP5A 2EXBA 4U0TA 5TR7A 2ZJ9A 1Q2QA 3BEBA 5CGSA 3BYDA 2XD5A 4E3LA 5GHZA 5L2FA 3MBZA 4JXWA 5CGWA 1BLPA 1Q2PA 4GDNA 1MWSA 4PM7A 4BJPA 3IXDA 4ZBEA 1XA7A 4LCMA 1MWTA 3WS2A 3MFDA 5FASA 1NXYA 5HARA 1EROA 2EX8A 2ZC3B 4ZAMA 2A49A 5AQ9A 1GHPA 4ZTKA 3M6HA 4ZDXA 1PW8A 4S2MA 2FFFB 4CPKA 4HBUA 3GVBA 5E2FA 3IXGA 1SHVA 2J8YA 2QMIA 3VFHA 1M40A 3M6BA 1KDWA 4MNRA 1XGIA 3ZG8B 4E6WA 5EECA 1IKIA
chains in the Genus database with same CATH superfamily
5EV0A 2HDUA 5HWWA 2ZD8A 3V3RA 4FOFA 3MSHA 4HJ4A 3VE3A 4LGWA 1ODVA 4B4ZA 1KDSA 2L1MA 1ZG6A 1XXMA 2L4RA 3NOTC 4M4XA 4C6YA 3MQQA 1IYPA 4OPYA 2XA7M 3T4LA 4NEED 5F83A 2VX8A 4K0WA 4WZ4A 2OV5A 1CK3A 1PZPA 4MBKA 4UEYA 3Q81A 4OP8A 4GS9B 4BBVA 5FQKA 4JF4A 2WGIA 1PI5A 3G34A 5FATA 1K56A 1O07A 2EWWA 3S7QA 3Q1FA 4CJNA 1D1JA 1GCEA 1J9MA 3LCEA 1ES3A 4EU0A 5M19A 3HL9A 2QPNA 4JF6A 1BUEA 1YMXA 2PR6A 4QY5A 2W3GA 1UWNX 1OJGA 2QJ5A 5HW3A 4I39A 4WUJA 5CTNA 4HBTA 3HJIA 2JN7A 3UDFA 5AVEA 3MXRA 4NG2A 3OLOA 1I2SA 2ZMVA 5DFXA 5A91A 2PT7A 2V2FF 4KZBA 4KZ4A 2UWXA 1IEMA 1MKMA 5A90A 3PYPA 4ARZB 2A24A 3H7WA 3WS0A 1YPRA 2H0YA 4KG2A 3D4FA 1XFNA 3HBRA 4P85A 4X56A 1PNEA 3GDIA 4U3TA 3B3XA 4X55A 1VQQA 2D02A 1BZAA 2FH5A 3CZDA 1V9ZA 1IYOA 3LI9A 1S0WA 3H82A 4GD8A 2W1TA 4GDBA 5TGFA 3VOZA 2M7VA 2X71A 4ZRRA 4EEPA 4MBHA 1MY8A 2OWJA 3WS4A 2K2NA 4WN5A 4BD1A 4PM5A 3JYIA 1BLSA 2Y2OA 3QHYA 1PZOA 5CX7A 2GDNA 1XJ6A 3EWKA 3V50A 2JKRI 4R3JA 2V1ZA 1W8QA 3BY8A 2XDMA 2RCXA 5F69A 5HAIA 1K57A 4RX3A 2D01A 4S2NC 5CRFA 5EVIC 3R7WA 3N8LA 4R3BA 2XLNA 3PBRA 3MKFA 5CGXA 2AVXA 5IU1A 1V9YA 3KYEA 3DAVA 5F68A 5EPHA 3F1PA 4KZAA 3FPWA 3NOUC 1L0DA 4G3VA 2ZC5B 3ZG7B 4E3MA 4GHIB 4FH4A 2ZQDA 5FAOA 1LSVA 1RGZA 1K55A 5GHXA 4DN0A 2WK0A 1FOFA 3CITA 1PIOA 5FQMA 1YM1A 2EXAA 4N92A 1N9NA 1JTDA 2ZLYA 2GZAA 1KE3A 5DFYA 3ZDJA 1DJAA 2Y2LA 3C5AA 4Y15A 4ZJ3A 4E3JA 3CG5A 5TJJA 1PWCA 4AFIA 5KSHA 1TS0A 3Q07A 5IT5A 3MZFA 1T1AA 1ERQA 2Y2IA 4YNRA 1X0OA 5DJUA 1YLYA 2JKTI 3VP4A 2XR0A 1BSGA 1WYBA 5FDHA 3A0SA 4OOYA 4KZ5A 1DRMA 5FL3A 1W63M 5FI6A 3TRCA 4Y2FA 3UB8A 1K0KA 4K0XA 4X25A 4DF6A 2JCHA 3AGEA 3IH9A 3WS5A 2P9VB 1H8ZA 5DJTA 3C7UA 4JGQA 2WADA 5FI2A 1S1YA 3BQAA 2A24B 1I2WA 3FKVA 1HTZA 3LY4A 3Q82A 3ULFA 2A2LA 4WL9A 3V67A 3MQOA 4BLMA 5GLAA 1VM1A 3Q7VA 1PRQA 3LIBA 1XFQA 2B02A 3KX0X 3L9KA 3RH8B 2OAQ1 3BW6A 4EW7A 5CEBA 1ACFA 5CHJA 2DMWA 2V8CA 3MXQA 2WKPA 1GA0A 5DF7A 2Y55A 1FSYA 2DRWA 2P04A 4S2LA 3M2KA 1IKGA 4YOFA 1YSQA 3C2WA 3CAXA 1OPXA 1OTBA 1XA1A 4XUXA 4EWFA 1TF1A 3FG8A 1W63Q 4ZJ2A 2PDRA 4GD6A 3OC2A 4PM6A 5TBMA 4KQOA 5EVEA 3CLOA 3CUEC 5DVAA 3BECA 4M3KA 4R4SA 1YKDA 3S7PA 3T1XA 2VV6A 1A0KA 1GSVA 2QWSA 1IYQA 4DE3A 4IBRA 2Q9NA 3NECA 4Y17A 2J3TC 1PFLA 5CHUA 5A92A 1ERMA 1VEUA 4GCZA 4PM9A 3PBSA 3AGDA 5DTKA 3UB6A 5GLCA 4DE2A 4BL2A 3LR0A 4S2OA 1XJ3A 4R0QA 3WRTA 1OJ5A 1BULA 4LRXC 5AJGA 4OLDA 1IFQA 1YT4A 4QPRA 3CPTA 2H28A 5TR7A 2ZJ9A 1Q2QA 5CGSA 3KYZA 4E3LA 5KIZA 1UGUA 1BLPA 1NXYA 4HNBA 1EROA 2EX8A 2ZC3B 3M6HA 4BBUA 4S2MA 4CPKA 4HBUA 4Y3IA 2QYBA 2K31A 2W3HA 4I3JA 2J8YA 1KDWA 4MNRA 4MCWA 2VLGA 3N8SA 1OMEA 4MN5A 4WEJA 3ICYA 1YLPA 1NZOA 3CHWP 3C4OA 3QP6A 2MJ6A 1K54C 1VHMA 3GRJA 4GS9A 1PWDA 1K4FA 5GLDA 3MZEA 2JC7A 3S7NA 1ZC2A 4RX2A 4N9KA 1XGJA 5HZHA 3A0RA 3VP0A 2XFTA 1LL5A 2GJ3A 3OZHA 3BFEA 5EVIB 5HD5A 3N6IA 5IS1A 2PYRA 2RL3A 4OPRA 3IF6B 5M1AA 3QNBA 2PR5A 4HJ6A 4GNUA 4CLCE 2PU2A 5HDDA 1RCJA 4N1XA 3CMZA 2Q9MA 4OQGA 2XSSA 4ZJ1A 1WA9A 3UE6A 4BD0A 4HI4A 3D9YA 3AGFA 3UPNA 1DP8A 1PWGA 4ARZA 3EGDC 3HLEA 2HPBA 3SH8A 4EUVA 2W3EA 3O5YA 2H0TA 2O9AA 5CTMA 4KZ6A 4HHDA 3G2YA 2WGWB 3T4KA 3FC7A 5HWTA 1YLTA 3LFVA 2O9CA 3BJNA 2OLVA 3IWOA 4KQQA 5DTSA 3S7OA 1E3UD 1FCMA 1H0MA 3KSGA 4R6LA 2KLIA 1LI9A 4LFUA 4PKYA 4EBLA 2HDSA 3G31A 3GECA 4F3LB 5F1FA 2E8IA 3RXWA 2XQZA 4PAUA 1GHMA 3W4OA 4MMNA 1T1CA 4JXGA 3QP5A 2VZWA 1S1ZA 2H10A 3NC8A 1P0ZA 4HH2A 3G4PA 4KQRA 1GSWA 4UA9A 4RYEA 2QZ6A 3E0YA 2EX2A 4S2IA 3OBFA 5FSRA 3TJZC 4PM8A 3E98A 1ZG4A 3SW1A 3C7VA 4I38A 3TE8A 3ITBA 1Z6FA 4GZBA 3MJQA 4GHIA 2HP6A 3ZG5A 1N4OA 1LL9A 3N7WA 1CI9A 5HAQA 1TD5A 4CLCC 5FA7A 2A3UA 4Q0HA 3HLDA 1FCOA 2EX9A 1K25A 2JKRM 4R3AA 2PRFA 1NZUA 2Y91A 4N9LA 1LSWA 3UO9A 3T4QA 5M18A 4GB7A 3UE0A 4X6TA 3HVFA 4E3IA 3A3DA 4OOLA 4PMAA 5FAQA 3PBOA 1BT5A 3F1NB 5I5LA 3P09A 5EVID 4GLQA 1KVLA 1JWVA 2KOIA 2VGKA 3C8CA 4OVDA 5C5KA 1P97A 5HDSA 2V0UA 1IELA 4E6XA 5CEDA 4E04A 2C6WB 3S4XA 3ZVTA 1WE4A 4LENA 1FILA 4U0XA 4Y0TA 3RFBA 1JWPA 3ZHHA 3PBNA 1S4RA 1H8YA 4Z9QA 2P9VA 3IX3A 4GKUA 4FUWA 5FQQA 3T4OA 3E2LA 3MFXA 4KG5A 1LL8A 4JGPA 2R9XA 1HVBA 2JKTM 1SDEA 4D2OA 4LV0A 2Y2HA 4IEDA 4JGRA 2XGNA 3T4SA 1CJFA 4Q0IA 1GA9A 5FQIA 3E4PA 4K08A 1FQGA 1OTDA 1Y28A 5HX9A 4YWZA 3A3JA 3OCNA 4WEKA 1KGFA 3CWFA 3VP2A 3VOLA 2WZZA 2ZM0A 3PBQA 1L0EA 2NUTC 1FR1A 3BFGA 5EFWA 5E2HA 3UDXA 3HJKA 2X02A 3B47A 2J3WA 2XFSA 2HDRA 3VSKA 1KOUA 3IBRA 2Y2QA 1H3QA 4GOGA 4LV2A 5LBRA 3LIEA 3HUOA 2Q0OA 5MC7A 4QY6A 1Y4OA 3U4LP 4MLLA 2VA0A 3PAEA 3IF5A 4EERA 3W2ZA 4UQIS 5HD3A 3GTCA 5EOOA 4R23A 1K4EA 1STZA 3DTMA 3EOIA 2Z2MB 4I3IA 3C38A 3TW8A 3N8RA 2J9OA 3E4OA 3UB9A 2H5SA 3MXSA 1H5XA 2DCFA 3LIFA 1NJ4A 4B9OA 5EM1A 3HLCA 4R1GA 3L7HA 3HLWA 3T12B 1AXBA 1S6RA 3FYZA 5KZHA 1W7FA 2PU4A 2XD1A 1ESIA 2VEAA 3ZNYA 1NLZA 5HAPA 1MWUA 2P7JA 4LCLA 3PXPA 1G68A 3T1SA 5AVFA 2Y59A 1CEFA 3IS2B 3OPPA 2ZL1B 4F94A 4KUKA 2Y2KA 1PYYA 2XH9A 1C3BA 4OP5A 1FIKA 2J3TD 2KX6A 4XT2B 2XD5A 1S4SA 1NLYA 1Q2PA 1MWSA 1XJ4A 4PM7A 4LRYC 4ZBEA 4BJPA 1XA7A 1P9RA 1DP9A 4DJ3A 4ZAMA 5AQ9A 1D7EA 2QHKA 1GHPA 4HP4A 1OT9A 4ZDXA 2FFFB 4HOIA 3GVBA 1G28A 3VFHA 3LYXA 4GW9A 1ES2A 3WRZA 3RTYA 5HFOA 1BLHA 2WZXA 2ZMAA 4DKIA 4HIAA 3CJMA 2VGJA 4DXBA 4S2NA 5EVIA 2IWBA 5DF9A 2XF3A 4NK3A 4OOMA 4YINA 3IF6A 4L9FA 3A3FA 2ZC6B 4ID4A 3MR0A 3ZYTA 2ZM8A 4IUKA 3G30A 1G5UA 4JF5A 1GSXA 4O0PA 4EXOA 1TDLA 4HQAA 3OCLA 3VV4A 2Y2MA 2ZM2A 4MN7A 4WZ5C 1YAXA 3MKEA 1W5DA 3DTKA 3IXBA 3NY4A 4CLCB 3NOPC 4KQDA 4GN2A 5FI7A 4QB8A 3DWZA 1CI8A 4H8RA 2WGWA 4OPQA 5F1GA 1MXOA 3QP8A 1K38A 2G2WA 1SZVA 4MDZA 4B4XA 5DKKA 2Y8HA 4NXFA 4PHTA 2HZ5A 3K2NA 1YSPA 3T4JA 4OH0A 1TS7A 2XK1A 2HJ9C 3KO6A 3RJUA 4UA6A 4B88A 1SCWA 2KDKA 3PAGA 3F1OB 4F3LA 4BQMA 3ISGA 3UB5P 5JYPA 4E3OA 2W0NA 3BQ8A 3NI9A 4L9GA 3W4QA 2OSUA 1XJ2A 2ACGA 5HL6A 2V9AA 1BLCA 1W8YA 2O99A 4UA7A 4UQIM 3MS6A 2Z6DA 3B42A 5KSCA 5E2EA 4WLAA 4HEFA 3IX4A 4WMCD 4KENB 2J7VA 4LLOB 3HREA 4XUZA 5HPIA 4O8GA 2QJ7A 2V0WA 2J9PA 4D60A 5DF8A 3O87A 4H6JB 3R4KA 1K6RA 5U47A 3EQUA 4ESPA 4WELA 1E25A 1MBLA 1KGEA 1T1BA 3DTIA 3G35A 3I7JA 3NCKA 4Y7PA 3ZVWA 5AQAA 3NDEA 5L07A 2PAVP 1L0GA 3GMWA 5GLBA 1HD8A 3ITAA 2X01A 3DW0A 2ZQCA 5CXWA 5GHYA 3PHYA 4EQ1A 3PBTA 3OOVA 2ZQAA 5E2GA 3NHQA 3T50A 3F1NA 4EETB 4HP9A 1LHYA 1MKIA 1RGYA 2WAEA 4EV4A 4KZ7A 5EE8A 4DDSA 4P0MA 3A0VA 3FKWA 3E4QA 4BBTA 2OOLA 2WAFA 1VB6A 3GSGA 4R4RA 3BLSA 2ZC4B 1FSWA 3WWXA 1ZKJA 3PR6A 5J7EA 3IWQA 2Y2NA 2JE5A 4X68A 1NY0A 1XP4A 4MEZA 4G3KA 5G18A 1XPBA 3BRMA 3K3CA 4CLCD 4FSFA 1E4DA 1F9IA 4ETXA 3EGXC 5FQJA 3ZFZA 1YLZA 4HY8A 1CEGA 3O3VA 2JBFA 2WGVA 3V3SA 4P87A 4BL3A 3ZG9B 4KG6A 4S2PA 3JVVA 3HCYA 4ETZA 4FD8A 5TFQA 1XX2A 4UAAA 3O88A 4LPZA 3BFDA 2I72A 5I94A 3TSGA 2WKEA 3UPPA 4DDYA 4QU3A 4OQHA 3MQ0A 2C5WB 3OPLA 4K91A 3UE1A 2LB9A 2PBYA 3H9WA 4DE1A 1LI0A 4BMWA 2W1RA 4DMZA 2B18A 5CERA 3DTEA 3G2ZA 2EFXA 4NXBA 2P74A 5JYOA 1F2KA 3QP1A 1PI4A 1F98A 3D3OA 1K54A 3IHBA 1DY6A 5D3OA 1D06A 3SS4A 3ZQ5A 3OPHA 2HV1A 1JTGA 1ZHHB 4EQIA 1MPLA 4O01A 4DJ2A 1P9WA 3UNWA 1YMSA 3GR2A 3V5MA 3P01A 1WYCA 3DBAA 2WKQA 4ME4A 3S1YA 5CECA 3JVUA 2WUQA 3QNCA 5AQ7A 2G7UA 1YLWA 3ZGAB 3A3EA 3MZDA 2ZQ7A 2XROA 3UN7A 1BYWA 3BLMA 1ES5A 1SDNA 1J3WA 4S2KA 4DRTA 2GX5A 1I5QA 2OAP1 1XKZA 3FV7A 3LGOA 1FR6A 1UWPX 1KVMA 3IH8A 1K57C 2HJEA 4QWOA 2PD7A 4PPRA 4G3WA 3IS2A 2ZL1A 1TDGA 4RQ9A 4EBNA 3O86A 4I5SA 4KZ8A 4JKTA 2W3DA 5DTTA 4X69A 1ES4A 2JKFA 4WMCA 5HL1A 4XT2A 1K55C 2Y79A 3LR5A 5J8XA 1NRFA 3NJAA 4FH2A 4WF0A 1TEMA 1NYMA 4S2JA 2O9BA 3UDIA 1IYSA 2YKFA 3FZCA 1VETB 4R70A 2BG1A 2OLUA 2EXBA 2VJWA 3EEHA 2V1BA 3MBZA 4JXWA 4GDNA 2EA9A 2R78A 1MWTA 4L9EA 3WS2A 3MFDA 5FASA 4Y5FA 1SKOB 5A8BA 1T19A 3UMEA 2WKRA 1CQAA 3T1RA 3SZTA 5E2FA 1DP6A 1SHVA 2QMIA 1M40A 1XGIA 3ZG8B 1TS8A 4E6WA 5EECA 1IKIA 2IA2A 3QP2A 3BFFA 3DWKA 1OTEA 4II7A 4EUZA 4L0LA 1L0FA 4KZ9A 2JKGA 2WKHA 4CLCA 3N4IA 1DJBA 4NKPA 3W8KA 3ZNTA 3Q7ZA 3NIAA 2QKPA 2XEPA 1YQSA 3UB7A 2YKHA 4HESA 3HLBA 4KUOA 3KSFA 1LT0A 2INWA 1T18A 2V1AA 3LR3A 2ZBBA 3T1QB 5L8MA 2CMNA 1E3UA 1CF0A 3E2KA 3IF6C 4OONA 1NYYA 2WKIA 2FFYA 3IT9A 1TS6A 4MN6A 3WS1A 5EOEA 2VV8A 5EM0A 3SOIA 2V8FA 3F1OA 2J80A 4P6ZS 3NDGA 5GL9A 3TG9A 2EFUA 4KZ3A 4A5RA 3FWLA 1HZOA 1OT6A 3BFCA 3U2AA 1OTIA 3HLGA 1N9OA 2ZOIA 2HF6A 4HJ3A 3LICA 1QMFA 3MF0A 5F6AA 1MC0A 3HUMA 3G32A 4OQ0A 5FEGA 5DKLA 4PKYG 2UV0E 4IVKA 4Z1WA 3SS3A 3IBJA 4EEUA 3D72A 4MBFA 1BTLA 5AQBA 4E3KA 4Y13A 3VE4A 3G6OA 4H6JA 4WYYA 4QHCA 1L3LA 1SKFA 2BTFP 4YFMA 3VMAA 2M1CA 5E43A 5BOHA 3MMHA 2LB5A 2VGLS 2OWHA 1MWRA 4Y0UA 3HLFA 3IQAA 3ZCZA 2WYXA 4GJ4A 2FZ0A 4LV1A 3UPOA 2B5RA 2Z6CA 3GQZA 1QMEA 1NRJA 3H7WB 1EI5A 3EEAA 5FAPA 2IWCA 2ZQ8A 1M6KA 2HP9A 4WBGA 1PW1A 4C75A 4B93A 4LRZE 3BY9A 3P7NA 3PTEA 3H82B 3BM6A 4P6BA 2VV7A 2W1TB 1G6OA 3SH7A 3W4PA 4DE0A 2PD8A 1HLUP 3VOYA 3VFFA 4IHQA 1L2SA 1ONGA 1N9LA 1OTAA 1LLBA 1JNUA 4IJGA 2HP5A 3UMDA 3OPRA 5HDCA 1W79A 4OQIA 3SH9A 2Y2JA 1LSXA 5EVLA 1N9BA 3GV9A 4JGOA 2HDQA 4Q8IA 4OKPA 2HGVA 4OLGA 3IHAA 1O7EA 1IOUA 1AWIA 3SS5A 1MZUA 3R7WB 3CI6A 3VP3A 4JPMA 1K6SA 2DNSA 3VSLA 4LV3A 3KSHA 3F1PB 1FCNA 4FCFA 2K7SA 2PHYA 3P98A 4WM9A 3LO7A 2Y2GA 4RVAA 3EQVA 3UY6A 3M2JA 3S22A 4X1MA 2VKSA 3KYQA 1TVFA 4RA7A 3LUQA 5KMWA 3HUNA 2NUPC 2BASA 2XA7S 2B95A 3T4TA 1K56D 3JPUA 1KE0A 4QD4A 4I3AA 1JVJA 3QP4A 5G4ZA 4Q0JA 3ZG0A 5F5YA 4FTXA 2IWDA 5L09A 2Y2PA 2M7UA 4JXSA 4N1HA 3LI8A 5FQ9A 4QJGA 4R38A 1U60A 3NBLA 4P6ZM 4NETA 1KE4A 4EESA 2W27A 2L0WA 4IVIA 1ALQA 2ZOHA 3V39A 1YLJA 5CHMA 3C4PA 2I9VA 4X53A 1DJCA 2ZQ9A 2E8JA 1ESUA 4NXEA 5FDSA 1KGGA 4WZ5A 1S67L 1JWZA 2BLSA 2EX6A 4JXVA 4Y0OA 3CUEA 2O0YA 3B33A 4OPZA 1RP5A 1F5MA 4BENA 1ZTUA 3IX8A 3Q7VB 1EW0A 2W3FA 2G2UA 2EWVA 1Y54A 3A3IA 4C3QA 1GHIA 2Y4AA 3LIAA 2JHEA 4IBXA 3LIDA 5J4EA 2CC1A 1NWZA 4EBPA 1G6AA 1S66L 2VK3A 5HSQA 1Z09A 2VGLM 4JLFA 1EWZA 5A93A 5FEFA 4O7DA 5F82A 1VETA 3IWIA 4X1LA 4IUHA 4DXCA 4NXGA 5L10A 2Z2LB 5IHVA 5J3WA 2V20A 4E3NA 4BWIA 2XRNA 5EUAA 3KSIA 3FPVA 2ZC7A 4UHUA 3LEZA 2R9WA 5K5BA 5TBMB 1SKOA 3UE3A 4XXRA 3RXXA 5HPFA 1ONHA 3NULA 3TOIA 3IXHA 3LEQA 4JBFA 3LY3A 5G4YA 5HWVA 3K3DA 3VP1A 3C30A 4U0TA 3LR4A 3BEBA 3BYDA 5L2FA 5GHZA 1VEUB 5CGWA 3IXDA 4LCMA 1H8MA 5HARA 3BWLA 2P08A 2A49A 2GNXA 4ZTKA 4CQHA 1PW8A 2PYPA 2ZMFA 2PBDP 3IXGA 3CPTB 3M6BA 4HH3A
chains in the Genus database with same CATH topology
1ES2A 3N8SA 1OMEA 3WRZA 3BFFA 5HFOA 4WEJA 2HDUA 3DWKA 1BLHA 2ZD8A 1YLPA 2WZXA 4EUZA 2ZMAA 1NZOA 4L0LA 4DKIA 3CJMA 2VGJA 1L0FA 3C4OA 3V3RA 4DXBA 4KZ9A 4S2NA 5EVIA 2WKHA 2IWBA 1K54C 5DF9A 2XF3A 3GRJA 3N4IA 4NK3A 4OOMA 1PWDA 1DJBA 1K4FA 3W8KA 3ZNTA 4YINA 3IF6A 4B4ZA 3Q7ZA 1KDSA 3NIAA 5GLDA 3A3FA 2ZC6B 3MZEA 4ID4A 1ZG6A 2XEPA 1XXMA 2JC7A 1YQSA 1ZC2A 4RX2A 4N9KA 4HESA 1XGJA 2ZM8A 3HLBA 4C6YA 3G30A 3VP0A 4JF5A 1TDLA 1IYPA 2XFTA 1LL5A 4OPYA 3OCLA 2Y2MA 2ZM2A 3OZHA 4WZ5C 5F83A 3BFEA 4K0WA 4WZ4A 3MKEA 2OV5A 1E3UA 1CK3A 1W5DA 3IXBA 3NY4A 1PZPA 4MBKA 5EVIB 3Q81A 4OP8A 3N6IA 3E2KA 3IF6C 5FQKA 4JF4A 4OONA 1NYYA 2WGIA 2RL3A 2WKIA 2FFYA 3IF6B 1PI5A 3G34A 3IT9A 4GN2A 4OPRA 5FI7A 5M1AA 5EOEA 3WS1A 4QB8A 3DWZA 3QNBA 5FATA 1K56A 1CI8A 4H8RA 3SOIA 2WGWA 4OPQA 4GNUA 1O07A 2PU2A 5F1GA 1MXOA 3NDGA 3Q1FA 4CJNA 5GL9A 1K38A 2G2WA 1RCJA 4B4XA 1GCEA 1J9MA 3LCEA 1ES3A 4N1XA 5M19A 3CMZA 3TG9A 2Q9MA 2EFUA 4KZ3A 4OQGA 4A5RA 3HL9A 4ZJ1A 2QPNA 3FWLA 4JF6A 1BUEA 1HZOA 4BD0A 3BFCA 1YMXA 3AGFA 4QY5A 3UPNA 1PWGA 3HLGA 4OH0A 3HLEA 2HPBA 2XK1A 3SH8A 1QMFA 5HW3A 2H0TA 3RJUA 4UA6A 5CTMA 4KZ6A 4B88A 1SCWA 3PAGA 3HUMA 3G2YA 2WGWB 5CTNA 3G32A 4HBTA 4BQMA 4OQ0A 3UDFA 3MXRA 3ISGA 1I2SA 4IVKA 1YLTA 5JYPA 4E3OA 2OLVA 3SS3A 3NI9A 3IWOA 4KQQA 5DTSA 3W4QA 1E3UD 2OSUA 1FCMA 4MBFA 5A91A 1BTLA 5AQBA 4E3KA 2V2FF 4KZBA 4KZ4A 1BLCA 1IEMA 2UWXA 4QHCA 4WYYA 5A90A 1SKFA 1LI9A 1W8YA 4EBLA 2HDSA 4UA7A 3WS0A 2H0YA 4YFMA 4KG2A 3D4FA 3G31A 3HBRA 4P85A 5KSCA 4X56A 3VMAA 5E2EA 4U3TA 5E43A 3B3XA 4X55A 1VQQA 5BOHA 5F1FA 2E8IA 1BZAA 4HEFA 3CZDA 4WMCD 4KENB 3RXWA 2J7VA 2XQZA 1MWRA 1IYOA 1GHMA 3W4OA 1S0WA 4Y0UA 3HLFA 3HREA 4XUZA 3IQAA 4GD8A 3ZCZA 2WYXA 4JXGA 4LV1A 4GDBA 5TGFA 3VOZA 3UPOA 2J9PA 2X71A 5DF8A 3O87A 2B5RA 4MBHA 1MY8A 1K6RA 2H10A 3EQUA 5U47A 4WELA 1E25A 3GQZA 3WS4A 1MBLA 1KGEA 1QMEA 3G35A 4BD1A 3I7JA 3NC8A 3NCKA 4Y7PA 4PM5A 3ZVWA 3JYIA 5FAPA 1BLSA 1EI5A 2Y2OA 3QHYA 1PZOA 2IWCA 2ZQ8A 2GDNA 3NDEA 5AQAA 3G4PA 4KQRA 1M6KA 4UA9A 2HP9A 4WBGA 1PW1A 4RYEA 1L0GA 2QZ6A 3GMWA 3V50A 2EX2A 4S2IA 4C75A 4R3JA 2V1ZA 5FSRA 5GLBA 1HD8A 1W8QA 4PM8A 3ITAA 2X01A 3DW0A 1ZG4A 2ZQCA 4EV4A 3C7VA 5CXWA 5GHYA 3ITBA 1Z6FA 2XDMA 4GZBA 3PBTA 2ZQAA 5E2GA 2HP6A 2RCXA 3PTEA 3ZG5A 1N4OA 3BM6A 4P6BA 1LL9A 5HAIA 3N7WA 3SH7A 1LHYA 3W4PA 1MKIA 1K57A 4RX3A 4DE0A 1CI9A 4S2NC 5CRFA 5EVIC 5HAQA 1RGYA 3VOYA 2WAEA 3N8LA 5FA7A 4KZ7A 2A3UA 5EE8A 3VFFA 1L2SA 4P0MA 4DDSA 1ONGA 4R3BA 2XLNA 3HLDA 3FKWA 3PBRA 1FCOA 2EX9A 1K25A 1LLBA 3MKFA 2WAFA 4R4RA 3GSGA 5CGXA 3BLSA 2HP5A 1NZUA 2Y91A 2ZC4B 4N9LA 3OPRA 1FSWA 1W79A 4OQIA 3SH9A 3UO9A 1ZKJA 5EPHA 2Y2JA 3WWXA 5M18A 5EVLA 3IWQA 4KZAA 1N9BA 2Y2NA 4GB7A 3UE0A 4X6TA 3HVFA 1L0DA 3GV9A 4E3IA 2ZC5B 2JE5A 3ZG7B 4E3MA 4X68A 1NY0A 4FH4A 3A3DA 2HDQA 1XP4A 2ZQDA 4MEZA 4OKPA 4OOLA 4PMAA 5FAOA 5FAQA 4OLGA 4Q8IA 3IHAA 1RGZA 5G18A 1K55A 1O7EA 5GHXA 3PBOA 1BT5A 2WK0A 1FOFA 1XPBA 3P09A 3BRMA 5EVID 3SS5A 4FSFA 1KVLA 1E4DA 1JWVA 1PIOA 2VGKA 5FQMA 3VP3A 1YM1A 4JPMA 5FQJA 3ZFZA 2EXAA 1YLZA 4N92A 4OVDA 1JTDA 2ZLYA 1K6SA 1KE3A 2DNSA 1CEGA 1IELA 3VSLA 3O3VA 3ZDJA 1DJAA 2JBFA 2WGVA 2Y2LA 4E6XA 3C5AA 3V3SA 5CEDA 4LV3A 2C6WB 4P87A 4ZJ3A 3ZG9B 3CG5A 4KG6A 4BL3A 4E3JA 1FCNA 4S2PA 1PWCA 3S4XA 3ZVTA 1WE4A 4FCFA 4LENA 4U0XA 5KSHA 4Y0TA 4FD8A 5TFQA 1XX2A 3Q07A 3ZHHA 1JWPA 3P98A 4UAAA 4WM9A 3MZFA 3LO7A 3O88A 3PBNA 2Y2GA 3BFDA 2I72A 4RVAA 1ERQA 5I94A 1H8YA 3EQVA 4Z9QA 2Y2IA 3UY6A 2P9VA 3M2JA 3TSGA 3S22A 2WKEA 1YLYA 3UPPA 4RA7A 1TVFA 3VP4A 4GKUA 2XR0A 1BSGA 1WYBA 5KMWA 3HUNA 4DDYA 5FDHA 4QU3A 4OQHA 2C5WB 3OPLA 4OOYA 4K91A 3UE1A 2PBYA 5FQQA 4DE1A 1K56D 4KZ5A 1LI0A 1KE0A 4QD4A 5FI6A 3E2LA 1JVJA 5CERA 4KG5A 3G2ZA 4K0XA 2EFXA 3ZG0A 2IWDA 2R9XA 1HVBA 4DF6A 2JCHA 1SDEA 2P74A 5JYOA 4D2OA 2Y2PA 4LV0A 3AGEA 2Y2HA 3IH9A 4IEDA 4JXSA 4N1HA 2P9VB 1H8ZA 3WS5A 1PI4A 2XGNA 5FQ9A 4QJGA 1GA9A 1U60A 5FQIA 1K54A 3C7UA 3IHBA 3NBLA 1FQGA 1DY6A 5D3OA 4NETA 1KE4A 2WADA 5FI2A 3FKVA 1I2WA 5HX9A 1HTZA 3LY4A 4IVIA 1ALQA 3A3JA 3OCNA 3Q82A 3SS4A 4WEKA 3V39A 1KGFA 3OPHA 4BLMA 1YLJA 5GLAA 1VM1A 1JTGA 3VP2A 3Q7VA 4EQIA 5CHMA 2WZZA 2ZM0A 3C4PA 1MPLA 3PBQA 1L0EA 4X53A 1FR1A 3BFGA 1DJCA 5E2HA 2ZQ9A 3UDXA 1ESUA 2X02A 3UNWA 2XFSA 1KGGA 1YMSA 3GR2A 4WZ5A 3V5MA 1JWZA 2HDRA 3VSKA 1WYCA 5CEBA 2BLSA 2Y2QA 2EX6A 5CHJA 4JXVA 4Y0OA 4GOGA 4LV2A 1GA0A 3HUOA 3S1YA 4QY6A 5CECA 2WUQA 4OPZA 3QNCA 5AQ7A 1RP5A 5DF7A 1YLWA 3ZGAB 4MLLA 3A3EA 3MZDA 4BENA 2ZQ7A 2Y55A 3PAEA 1FSYA 3IF5A 3UN7A 2DRWA 3Q7VB 3BLMA 1ES5A 1SDNA 4S2LA 3M2KA 4DRTA 1IKGA 2G2UA 4S2KA 1I5QA 3GTCA 5EOOA 4R23A 1XA1A 1XKZA 1K4EA 3FV7A 1Y54A 3A3IA 4C3QA 4XUXA 4EWFA 1GHIA 1FR6A 2Y4AA 3DTMA 4ZJ2A 1KVMA 3IH8A 1K57C 4IBXA 2Z2MB 4GD6A 3OC2A 4PM6A 2CC1A 3N8RA 4KQOA 4EBPA 4PPRA 1G6AA 2J9OA 2H5SA 5DVAA 3MXSA 1H5XA 2DCFA 1NJ4A 1TDGA 3BECA 4M3KA 4JLFA 4R4SA 1EWZA 4EBNA 3HLCA 3O86A 5A93A 4R1GA 4O7DA 5F82A 3IWIA 4KZ8A 1IYQA 4DXCA 3HLWA 4DE3A 4JKTA 4IBRA 1AXBA 1S6RA 3FYZA 5DTTA 5KZHA 1W7FA 2Q9NA 4X69A 1ES4A 2PU4A 2Z2LB 5IHVA 4WMCA 2V20A 4E3NA 5HL1A 2XD1A 1ESIA 5CHUA 5A92A 1ERMA 1K55C 3ZNYA 5EUAA 5HAPA 1MWUA 4PM9A 2ZC7A 4UHUA 4LCLA 3LEZA 3PBSA 3AGDA 2R9WA 5DTKA 5J8XA 5GLCA 1NRFA 4DE2A 1G68A 4FH2A 4BL2A 1TEMA 1NYMA 3UE3A 2Y59A 1CEFA 3OPPA 4S2JA 4F94A 4S2OA 4XXRA 3RXXA 4R0QA 3UDIA 3WRTA 1BULA 1ONHA 2Y2KA 3TOIA 1IYSA 3IXHA 4OLDA 3FZCA 1PYYA 4JBFA 3LY3A 1YT4A 2XH9A 1C3BA 2BG1A 3VP1A 2OLUA 4OP5A 2EXBA 4U0TA 5TR7A 2ZJ9A 1Q2QA 3BEBA 5CGSA 3BYDA 2XD5A 4E3LA 5GHZA 5L2FA 3MBZA 4JXWA 5CGWA 1BLPA 1Q2PA 4GDNA 1MWSA 4PM7A 4BJPA 3IXDA 4ZBEA 1XA7A 4LCMA 1MWTA 3WS2A 3MFDA 5FASA 1NXYA 5HARA 1EROA 2EX8A 2ZC3B 4ZAMA 2A49A 5AQ9A 1GHPA 4ZTKA 3M6HA 4ZDXA 1PW8A 4S2MA 2FFFB 4CPKA 4HBUA 3GVBA 5E2FA 3IXGA 1SHVA 2J8YA 2QMIA 3VFHA 1M40A 3M6BA 1KDWA 4MNRA 1XGIA 3ZG8B 4E6WA 5EECA 1IKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ES2 A;  3N8S A;  1OME A;  3WRZ A;  3BFF A;  5HFO A;  4WEJ A;  2HDU A;  3DWK A;  1BLH A;  2ZD8 A;  1YLP A;  2WZX A;  4EUZ A;  2ZMA A;  1NZO A;  4L0L A;  4DKI A;  3CJM A;  2VGJ A;  1L0F A;  3C4O A;  3V3R A;  4DXB A;  4KZ9 A;  4S2N A;  5EVI A;  2WKH A;  2IWB A;  1K54 C;  5DF9 A;  2XF3 A;  3GRJ A;  3N4I A;  4NK3 A;  4OOM A;  1PWD A;  1DJB A;  1K4F A;  3W8K A;  3ZNT A;  4YIN A;  3IF6 A;  4B4Z A;  3Q7Z A;  1KDS A;  3NIA A;  5GLD A;  3A3F A;  2ZC6 B;  3MZE A;  4ID4 A;  1ZG6 A;  2XEP A;  1XXM A;  2JC7 A;  1YQS A;  1ZC2 A;  4RX2 A;  4N9K A;  4HES A;  1XGJ A;  2ZM8 A;  3HLB A;  4C6Y A;  3G30 A;  3VP0 A;  4JF5 A;  1TDL A;  1IYP A;  2XFT A;  1LL5 A;  4OPY A;  3OCL A;  2Y2M A;  2ZM2 A;  3OZH A;  4WZ5 C;  5F83 A;  3BFE A;  4K0W A;  4WZ4 A;  3MKE A;  2OV5 A;  1E3U A;  1CK3 A;  1W5D A;  3IXB A;  3NY4 A;  1PZP A;  4MBK A;  5EVI B;  3Q81 A;  4OP8 A;  3N6I A;  3E2K A;  3IF6 C;  5FQK A;  4JF4 A;  4OON A;  1NYY A;  2WGI A;  2RL3 A;  2WKI A;  2FFY A;  3IF6 B;  1PI5 A;  3G34 A;  3IT9 A;  4GN2 A;  4OPR A;  5FI7 A;  5M1A A;  5EOE A;  3WS1 A;  4QB8 A;  3DWZ A;  3QNB A;  5FAT A;  1K56 A;  1CI8 A;  4H8R A;  3SOI A;  2WGW A;  4OPQ A;  4GNU A;  1O07 A;  2PU2 A;  5F1G A;  1MXO A;  3NDG A;  3Q1F A;  4CJN A;  5GL9 A;  1K38 A;  2G2W A;  1RCJ A;  4B4X A;  1GCE A;  1J9M A;  3LCE A;  1ES3 A;  4N1X A;  5M19 A;  3CMZ A;  3TG9 A;  2Q9M A;  2EFU A;  4KZ3 A;  4OQG A;  4A5R A;  3HL9 A;  4ZJ1 A;  2QPN A;  3FWL A;  4JF6 A;  1BUE A;  1HZO A;  4BD0 A;  3BFC A;  1YMX A;  3AGF A;  4QY5 A;  3UPN A;  1PWG A;  3HLG A;  4OH0 A;  3HLE A;  2HPB A;  2XK1 A;  3SH8 A;  1QMF A;  5HW3 A;  2H0T A;  3RJU A;  4UA6 A;  5CTM A;  4KZ6 A;  4B88 A;  1SCW A;  3PAG A;  3HUM A;  3G2Y A;  2WGW B;  5CTN A;  3G32 A;  4HBT A;  4BQM A;  4OQ0 A;  3UDF A;  3MXR A;  3ISG A;  1I2S A;  4IVK A;  1YLT A;  5JYP A;  4E3O A;  2OLV A;  3SS3 A;  3NI9 A;  3IWO A;  4KQQ A;  5DTS A;  3W4Q A;  1E3U D;  2OSU A;  1FCM A;  4MBF A;  5A91 A;  1BTL A;  5AQB A;  4E3K A;  2V2F F;  4KZB A;  4KZ4 A;  1BLC A;  1IEM A;  2UWX A;  4QHC A;  4WYY A;  5A90 A;  1SKF A;  1LI9 A;  1W8Y A;  4EBL A;  2HDS A;  4UA7 A;  3WS0 A;  2H0Y A;  4YFM A;  4KG2 A;  3D4F A;  3G31 A;  3HBR A;  4P85 A;  5KSC A;  4X56 A;  3VMA A;  5E2E A;  4U3T A;  5E43 A;  3B3X A;  4X55 A;  1VQQ A;  5BOH A;  5F1F A;  2E8I A;  1BZA A;  4HEF A;  3CZD A;  4WMC D;  4KEN B;  3RXW A;  2J7V A;  2XQZ A;  1MWR A;  1IYO A;  1GHM A;  3W4O A;  1S0W A;  4Y0U A;  3HLF A;  3HRE A;  4XUZ A;  3IQA A;  4GD8 A;  3ZCZ A;  2WYX A;  4JXG A;  4LV1 A;  4GDB A;  5TGF A;  3VOZ A;  3UPO A;  2J9P A;  2X71 A;  5DF8 A;  3O87 A;  2B5R A;  4MBH A;  1MY8 A;  1K6R A;  2H10 A;  3EQU A;  5U47 A;  4WEL A;  1E25 A;  3GQZ A;  3WS4 A;  1MBL A;  1KGE A;  1QME A;  3G35 A;  4BD1 A;  3I7J A;  3NC8 A;  3NCK A;  4Y7P A;  4PM5 A;  3ZVW A;  3JYI A;  5FAP A;  1BLS A;  1EI5 A;  2Y2O A;  3QHY A;  1PZO A;  2IWC A;  2ZQ8 A;  2GDN A;  3NDE A;  5AQA A;  3G4P A;  4KQR A;  1M6K A;  4UA9 A;  2HP9 A;  4WBG A;  1PW1 A;  4RYE A;  1L0G A;  2QZ6 A;  3GMW A;  3V50 A;  2EX2 A;  4S2I A;  4C75 A;  4R3J A;  2V1Z A;  5FSR A;  5GLB A;  1HD8 A;  1W8Q A;  4PM8 A;  3ITA A;  2X01 A;  3DW0 A;  1ZG4 A;  2ZQC A;  4EV4 A;  3C7V A;  5CXW A;  5GHY A;  3ITB A;  1Z6F A;  2XDM A;  4GZB A;  3PBT A;  2ZQA A;  5E2G A;  2HP6 A;  2RCX A;  3PTE A;  3ZG5 A;  1N4O A;  3BM6 A;  4P6B A;  1LL9 A;  5HAI A;  3N7W A;  3SH7 A;  1LHY A;  3W4P A;  1MKI A;  1K57 A;  4RX3 A;  4DE0 A;  1CI9 A;  4S2N C;  5CRF A;  5EVI C;  5HAQ A;  1RGY A;  3VOY A;  2WAE A;  3N8L A;  5FA7 A;  4KZ7 A;  2A3U A;  5EE8 A;  3VFF A;  1L2S A;  4P0M A;  4DDS A;  1ONG A;  4R3B A;  2XLN A;  3HLD A;  3FKW A;  3PBR A;  1FCO A;  2EX9 A;  1K25 A;  1LLB A;  3MKF A;  2WAF A;  4R4R A;  3GSG A;  5CGX A;  3BLS A;  2HP5 A;  1NZU A;  2Y91 A;  2ZC4 B;  4N9L A;  3OPR A;  1FSW A;  1W79 A;  4OQI A;  3SH9 A;  3UO9 A;  1ZKJ A;  5EPH A;  2Y2J A;  3WWX A;  5M18 A;  5EVL A;  3IWQ A;  4KZA A;  1N9B A;  2Y2N A;  4GB7 A;  3UE0 A;  4X6T A;  3HVF A;  1L0D A;  3GV9 A;  4E3I A;  2ZC5 B;  2JE5 A;  3ZG7 B;  4E3M A;  4X68 A;  1NY0 A;  4FH4 A;  3A3D A;  2HDQ A;  1XP4 A;  2ZQD A;  4MEZ A;  4OKP A;  4OOL A;  4PMA A;  5FAO A;  5FAQ A;  4OLG A;  4Q8I A;  3IHA A;  1RGZ A;  5G18 A;  1K55 A;  1O7E A;  5GHX A;  3PBO A;  1BT5 A;  2WK0 A;  1FOF A;  1XPB A;  3P09 A;  3BRM A;  5EVI D;  3SS5 A;  4FSF A;  1KVL A;  1E4D A;  1JWV A;  1PIO A;  2VGK A;  5FQM A;  3VP3 A;  1YM1 A;  4JPM A;  5FQJ A;  3ZFZ A;  2EXA A;  1YLZ A;  4N92 A;  4OVD A;  1JTD A;  2ZLY A;  1K6S A;  1KE3 A;  2DNS A;  1CEG A;  1IEL A;  3VSL A;  3O3V A;  3ZDJ A;  1DJA A;  2JBF A;  2WGV A;  2Y2L A;  4E6X A;  3C5A A;  3V3S A;  5CED A;  4LV3 A;  2C6W B;  4P87 A;  4ZJ3 A;  3ZG9 B;  3CG5 A;  4KG6 A;  4BL3 A;  4E3J A;  1FCN A;  4S2P A;  1PWC A;  3S4X A;  3ZVT A;  1WE4 A;  4FCF A;  4LEN A;  4U0X A;  5KSH A;  4Y0T A;  4FD8 A;  5TFQ A;  1XX2 A;  3Q07 A;  3ZHH A;  1JWP A;  3P98 A;  4UAA A;  4WM9 A;  3MZF A;  3LO7 A;  3O88 A;  3PBN A;  2Y2G A;  3BFD A;  2I72 A;  4RVA A;  1ERQ A;  5I94 A;  1H8Y A;  3EQV A;  4Z9Q A;  2Y2I A;  3UY6 A;  2P9V A;  3M2J A;  3TSG A;  3S22 A;  2WKE A;  1YLY A;  3UPP A;  4RA7 A;  1TVF A;  3VP4 A;  4GKU A;  2XR0 A;  1BSG A;  1WYB A;  5KMW A;  3HUN A;  4DDY A;  5FDH A;  4QU3 A;  4OQH A;  2C5W B;  3OPL A;  4OOY A;  4K91 A;  3UE1 A;  2PBY A;  5FQQ A;  4DE1 A;  1K56 D;  4KZ5 A;  1LI0 A;  1KE0 A;  4QD4 A;  5FI6 A;  3E2L A;  1JVJ A;  5CER A;  4KG5 A;  3G2Z A;  4K0X A;  2EFX A;  3ZG0 A;  2IWD A;  2R9X A;  1HVB A;  4DF6 A;  2JCH A;  1SDE A;  2P74 A;  5JYO A;  4D2O A;  2Y2P A;  4LV0 A;  3AGE A;  2Y2H A;  3IH9 A;  4IED A;  4JXS A;  4N1H A;  2P9V B;  1H8Z A;  3WS5 A;  1PI4 A;  2XGN A;  5FQ9 A;  4QJG A;  1GA9 A;  1U60 A;  5FQI A;  1K54 A;  3C7U A;  3IHB A;  3NBL A;  1FQG A;  1DY6 A;  5D3O A;  4NET A;  1KE4 A;  2WAD A;  5FI2 A;  3FKV A;  1I2W A;  5HX9 A;  1HTZ A;  3LY4 A;  4IVI A;  1ALQ A;  3A3J A;  3OCN A;  3Q82 A;  3SS4 A;  4WEK A;  3V39 A;  1KGF A;  3OPH A;  4BLM A;  1YLJ A;  5GLA A;  1VM1 A;  1JTG A;  3VP2 A;  3Q7V A;  4EQI A;  5CHM A;  2WZZ A;  2ZM0 A;  3C4P A;  1MPL A;  3PBQ A;  1L0E A;  4X53 A;  1FR1 A;  3BFG A;  1DJC A;  5E2H A;  2ZQ9 A;  3UDX A;  1ESU A;  2X02 A;  3UNW A;  2XFS A;  1KGG A;  1YMS A;  3GR2 A;  4WZ5 A;  3V5M A;  1JWZ A;  2HDR A;  3VSK A;  1WYC A;  5CEB A;  2BLS A;  2Y2Q A;  2EX6 A;  5CHJ A;  4JXV A;  4Y0O A;  4GOG A;  4LV2 A;  1GA0 A;  3HUO A;  3S1Y A;  4QY6 A;  5CEC A;  2WUQ A;  4OPZ A;  3QNC A;  5AQ7 A;  1RP5 A;  5DF7 A;  1YLW A;  3ZGA B;  4MLL A;  3A3E A;  3MZD A;  4BEN A;  2ZQ7 A;  2Y55 A;  3PAE A;  1FSY A;  3IF5 A;  3UN7 A;  2DRW A;  3Q7V B;  3BLM A;  1ES5 A;  1SDN A;  4S2L A;  3M2K A;  4DRT A;  1IKG A;  2G2U A;  4S2K A;  1I5Q A;  3GTC A;  5EOO A;  4R23 A;  1XA1 A;  1XKZ A;  1K4E A;  3FV7 A;  1Y54 A;  3A3I A;  4C3Q A;  4XUX A;  4EWF A;  1GHI A;  1FR6 A;  2Y4A A;  3DTM A;  4ZJ2 A;  1KVM A;  3IH8 A;  1K57 C;  4IBX A;  2Z2M B;  4GD6 A;  3OC2 A;  4PM6 A;  2CC1 A;  3N8R A;  4KQO A;  4EBP A;  4PPR A;  1G6A A;  2J9O A;  2H5S A;  5DVA A;  3MXS A;  1H5X A;  2DCF A;  1NJ4 A;  1TDG A;  3BEC A;  4M3K A;  4JLF A;  4R4S A;  1EWZ A;  4EBN A;  3HLC A;  3O86 A;  5A93 A;  4R1G A;  4O7D A;  5F82 A;  3IWI A;  4KZ8 A;  1IYQ A;  4DXC A;  3HLW A;  4DE3 A;  4JKT A;  4IBR A;  1AXB A;  1S6R A;  3FYZ A;  5DTT A;  5KZH A;  1W7F A;  2Q9N A;  4X69 A;  1ES4 A;  2PU4 A;  2Z2L B;  5IHV A;  4WMC A;  2V20 A;  4E3N A;  5HL1 A;  2XD1 A;  1ESI A;  5CHU A;  5A92 A;  1ERM A;  1K55 C;  3ZNY A;  5EUA A;  5HAP A;  1MWU A;  4PM9 A;  2ZC7 A;  4UHU A;  4LCL A;  3LEZ A;  3PBS A;  3AGD A;  2R9W A;  5DTK A;  5J8X A;  5GLC A;  1NRF A;  4DE2 A;  1G68 A;  4FH2 A;  4BL2 A;  1TEM A;  1NYM A;  3UE3 A;  2Y59 A;  1CEF A;  3OPP A;  4S2J A;  4F94 A;  4S2O A;  4XXR A;  3RXX A;  4R0Q A;  3UDI A;  3WRT A;  1BUL A;  1ONH A;  2Y2K A;  3TOI A;  1IYS A;  3IXH A;  4OLD A;  3FZC A;  1PYY A;  4JBF A;  3LY3 A;  1YT4 A;  2XH9 A;  1C3B A;  2BG1 A;  3VP1 A;  2OLU A;  4OP5 A;  2EXB A;  4U0T A;  5TR7 A;  2ZJ9 A;  1Q2Q A;  3BEB A;  5CGS A;  3BYD A;  2XD5 A;  4E3L A;  5GHZ A;  5L2F A;  3MBZ A;  4JXW A;  5CGW A;  1BLP A;  1Q2P A;  4GDN A;  1MWS A;  4PM7 A;  4BJP A;  3IXD A;  4ZBE A;  1XA7 A;  4LCM A;  1MWT A;  3WS2 A;  3MFD A;  5FAS A;  1NXY A;  5HAR A;  1ERO A;  2EX8 A;  2ZC3 B;  4ZAM A;  2A49 A;  5AQ9 A;  1GHP A;  4ZTK A;  3M6H A;  4ZDX A;  1PW8 A;  4S2M A;  2FFF B;  4CPK A;  4HBU A;  3GVB A;  5E2F A;  3IXG A;  1SHV A;  2J8Y A;  2QMI A;  3VFH A;  1M40 A;  3M6B A;  1KDW A;  4MNR A;  1XGI A;  3ZG8 B;  4E6W A;  5EEC A;  1IKI A; 
#chains in the Genus database with same CATH topology
 5EV0 A;  2HDU A;  5HWW A;  2ZD8 A;  3V3R A;  4FOF A;  3MSH A;  4HJ4 A;  3VE3 A;  4LGW A;  1ODV A;  4B4Z A;  1KDS A;  2L1M A;  1ZG6 A;  1XXM A;  2L4R A;  3NOT C;  4M4X A;  4C6Y A;  3MQQ A;  1IYP A;  4OPY A;  2XA7 M;  3T4L A;  4NEE D;  5F83 A;  2VX8 A;  4K0W A;  4WZ4 A;  2OV5 A;  1CK3 A;  1PZP A;  4MBK A;  4UEY A;  3Q81 A;  4OP8 A;  4GS9 B;  4BBV A;  5FQK A;  4JF4 A;  2WGI A;  1PI5 A;  3G34 A;  5FAT A;  1K56 A;  1O07 A;  2EWW A;  3S7Q A;  3Q1F A;  4CJN A;  1D1J A;  1GCE A;  1J9M A;  3LCE A;  1ES3 A;  4EU0 A;  5M19 A;  3HL9 A;  2QPN A;  4JF6 A;  1BUE A;  1YMX A;  2PR6 A;  4QY5 A;  2W3G A;  1UWN X;  1OJG A;  2QJ5 A;  5HW3 A;  4I39 A;  4WUJ A;  5CTN A;  4HBT A;  3HJI A;  2JN7 A;  3UDF A;  5AVE A;  3MXR A;  4NG2 A;  3OLO A;  1I2S A;  2ZMV A;  5DFX A;  5A91 A;  2PT7 A;  2V2F F;  4KZB A;  4KZ4 A;  2UWX A;  1IEM A;  1MKM A;  5A90 A;  3PYP A;  4ARZ B;  2A24 A;  3H7W A;  3WS0 A;  1YPR A;  2H0Y A;  4KG2 A;  3D4F A;  1XFN A;  3HBR A;  4P85 A;  4X56 A;  1PNE A;  3GDI A;  4U3T A;  3B3X A;  4X55 A;  1VQQ A;  2D02 A;  1BZA A;  2FH5 A;  3CZD A;  1V9Z A;  1IYO A;  3LI9 A;  1S0W A;  3H82 A;  4GD8 A;  2W1T A;  4GDB A;  5TGF A;  3VOZ A;  2M7V A;  2X71 A;  4ZRR A;  4EEP A;  4MBH A;  1MY8 A;  2OWJ A;  3WS4 A;  2K2N A;  4WN5 A;  4BD1 A;  4PM5 A;  3JYI A;  1BLS A;  2Y2O A;  3QHY A;  1PZO A;  5CX7 A;  2GDN A;  1XJ6 A;  3EWK A;  3V50 A;  2JKR I;  4R3J A;  2V1Z A;  1W8Q A;  3BY8 A;  2XDM A;  2RCX A;  5F69 A;  5HAI A;  1K57 A;  4RX3 A;  2D01 A;  4S2N C;  5CRF A;  5EVI C;  3R7W A;  3N8L A;  4R3B A;  2XLN A;  3PBR A;  3MKF A;  5CGX A;  2AVX A;  5IU1 A;  1V9Y A;  3KYE A;  3DAV A;  5F68 A;  5EPH A;  3F1P A;  4KZA A;  3FPW A;  3NOU C;  1L0D A;  4G3V A;  2ZC5 B;  3ZG7 B;  4E3M A;  4GHI B;  4FH4 A;  2ZQD A;  5FAO A;  1LSV A;  1RGZ A;  1K55 A;  5GHX A;  4DN0 A;  2WK0 A;  1FOF A;  3CIT A;  1PIO A;  5FQM A;  1YM1 A;  2EXA A;  4N92 A;  1N9N A;  1JTD A;  2ZLY A;  2GZA A;  1KE3 A;  5DFY A;  3ZDJ A;  1DJA A;  2Y2L A;  3C5A A;  4Y15 A;  4ZJ3 A;  4E3J A;  3CG5 A;  5TJJ A;  1PWC A;  4AFI A;  5KSH A;  1TS0 A;  3Q07 A;  5IT5 A;  3MZF A;  1T1A A;  1ERQ A;  2Y2I A;  4YNR A;  1X0O A;  5DJU A;  1YLY A;  2JKT I;  3VP4 A;  2XR0 A;  1BSG A;  1WYB A;  5FDH A;  3A0S A;  4OOY A;  4KZ5 A;  1DRM A;  5FL3 A;  1W63 M;  5FI6 A;  3TRC A;  4Y2F A;  3UB8 A;  1K0K A;  4K0X A;  4X25 A;  4DF6 A;  2JCH A;  3AGE A;  3IH9 A;  3WS5 A;  2P9V B;  1H8Z A;  5DJT A;  3C7U A;  4JGQ A;  2WAD A;  5FI2 A;  1S1Y A;  3BQA A;  2A24 B;  1I2W A;  3FKV A;  1HTZ A;  3LY4 A;  3Q82 A;  3ULF A;  2A2L A;  4WL9 A;  3V67 A;  3MQO A;  4BLM A;  5GLA A;  1VM1 A;  3Q7V A;  1PRQ A;  3LIB A;  1XFQ A;  2B02 A;  3KX0 X;  3L9K A;  3RH8 B;  2OAQ 1;  3BW6 A;  4EW7 A;  5CEB A;  1ACF A;  5CHJ A;  2DMW A;  2V8C A;  3MXQ A;  2WKP A;  1GA0 A;  5DF7 A;  2Y55 A;  1FSY A;  2DRW A;  2P04 A;  4S2L A;  3M2K A;  1IKG A;  4YOF A;  1YSQ A;  3C2W A;  3CAX A;  1OPX A;  1OTB A;  1XA1 A;  4XUX A;  4EWF A;  1TF1 A;  3FG8 A;  1W63 Q;  4ZJ2 A;  2PDR A;  4GD6 A;  3OC2 A;  4PM6 A;  5TBM A;  4KQO A;  5EVE A;  3CLO A;  3CUE C;  5DVA A;  3BEC A;  4M3K A;  4R4S A;  1YKD A;  3S7P A;  3T1X A;  2VV6 A;  1A0K A;  1GSV A;  2QWS A;  1IYQ A;  4DE3 A;  4IBR A;  2Q9N A;  3NEC A;  4Y17 A;  2J3T C;  1PFL A;  5CHU A;  5A92 A;  1ERM A;  1VEU A;  4GCZ A;  4PM9 A;  3PBS A;  3AGD A;  5DTK A;  3UB6 A;  5GLC A;  4DE2 A;  4BL2 A;  3LR0 A;  4S2O A;  1XJ3 A;  4R0Q A;  3WRT A;  1OJ5 A;  1BUL A;  4LRX C;  5AJG A;  4OLD A;  1IFQ A;  1YT4 A;  4QPR A;  3CPT A;  2H28 A;  5TR7 A;  2ZJ9 A;  1Q2Q A;  5CGS A;  3KYZ A;  4E3L A;  5KIZ A;  1UGU A;  1BLP A;  1NXY A;  4HNB A;  1ERO A;  2EX8 A;  2ZC3 B;  3M6H A;  4BBU A;  4S2M A;  4CPK A;  4HBU A;  4Y3I A;  2QYB A;  2K31 A;  2W3H A;  4I3J A;  2J8Y A;  1KDW A;  4MNR A;  4MCW A;  2VLG A;  3N8S A;  1OME A;  4MN5 A;  4WEJ A;  3ICY A;  1YLP A;  1NZO A;  3CHW P;  3C4O A;  3QP6 A;  2MJ6 A;  1K54 C;  1VHM A;  3GRJ A;  4GS9 A;  1PWD A;  1K4F A;  5GLD A;  3MZE A;  2JC7 A;  3S7N A;  1ZC2 A;  4RX2 A;  4N9K A;  1XGJ A;  5HZH A;  3A0R A;  3VP0 A;  2XFT A;  1LL5 A;  2GJ3 A;  3OZH A;  3BFE A;  5EVI B;  5HD5 A;  3N6I A;  5IS1 A;  2PYR A;  2RL3 A;  4OPR A;  3IF6 B;  5M1A A;  3QNB A;  2PR5 A;  4HJ6 A;  4GNU A;  4CLC E;  2PU2 A;  5HDD A;  1RCJ A;  4N1X A;  3CMZ A;  2Q9M A;  4OQG A;  2XSS A;  4ZJ1 A;  1WA9 A;  3UE6 A;  4BD0 A;  4HI4 A;  3D9Y A;  3AGF A;  3UPN A;  1DP8 A;  1PWG A;  4ARZ A;  3EGD C;  3HLE A;  2HPB A;  3SH8 A;  4EUV A;  2W3E A;  3O5Y A;  2H0T A;  2O9A A;  5CTM A;  4KZ6 A;  4HHD A;  3G2Y A;  2WGW B;  3T4K A;  3FC7 A;  5HWT A;  1YLT A;  3LFV A;  2O9C A;  3BJN A;  2OLV A;  3IWO A;  4KQQ A;  5DTS A;  3S7O A;  1E3U D;  1FCM A;  1H0M A;  3KSG A;  4R6L A;  2KLI A;  1LI9 A;  4LFU A;  4PKY A;  4EBL A;  2HDS A;  3G31 A;  3GEC A;  4F3L B;  5F1F A;  2E8I A;  3RXW A;  2XQZ A;  4PAU A;  1GHM A;  3W4O A;  4MMN A;  1T1C A;  4JXG A;  3QP5 A;  2VZW A;  1S1Z A;  2H10 A;  3NC8 A;  1P0Z A;  4HH2 A;  3G4P A;  4KQR A;  1GSW A;  4UA9 A;  4RYE A;  2QZ6 A;  3E0Y A;  2EX2 A;  4S2I A;  3OBF A;  5FSR A;  3TJZ C;  4PM8 A;  3E98 A;  1ZG4 A;  3SW1 A;  3C7V A;  4I38 A;  3TE8 A;  3ITB A;  1Z6F A;  4GZB A;  3MJQ A;  4GHI A;  2HP6 A;  3ZG5 A;  1N4O A;  1LL9 A;  3N7W A;  1CI9 A;  5HAQ A;  1TD5 A;  4CLC C;  5FA7 A;  2A3U A;  4Q0H A;  3HLD A;  1FCO A;  2EX9 A;  1K25 A;  2JKR M;  4R3A A;  2PRF A;  1NZU A;  2Y91 A;  4N9L A;  1LSW A;  3UO9 A;  3T4Q A;  5M18 A;  4GB7 A;  3UE0 A;  4X6T A;  3HVF A;  4E3I A;  3A3D A;  4OOL A;  4PMA A;  5FAQ A;  3PBO A;  1BT5 A;  3F1N B;  5I5L A;  3P09 A;  5EVI D;  4GLQ A;  1KVL A;  1JWV A;  2KOI A;  2VGK A;  3C8C A;  4OVD A;  5C5K A;  1P97 A;  5HDS A;  2V0U A;  1IEL A;  4E6X A;  5CED A;  4E04 A;  2C6W B;  3S4X A;  3ZVT A;  1WE4 A;  4LEN A;  1FIL A;  4U0X A;  4Y0T A;  3RFB A;  1JWP A;  3ZHH A;  3PBN A;  1S4R A;  1H8Y A;  4Z9Q A;  2P9V A;  3IX3 A;  4GKU A;  4FUW A;  5FQQ A;  3T4O A;  3E2L A;  3MFX A;  4KG5 A;  1LL8 A;  4JGP A;  2R9X A;  1HVB A;  2JKT M;  1SDE A;  4D2O A;  4LV0 A;  2Y2H A;  4IED A;  4JGR A;  2XGN A;  3T4S A;  1CJF A;  4Q0I A;  1GA9 A;  5FQI A;  3E4P A;  4K08 A;  1FQG A;  1OTD A;  1Y28 A;  5HX9 A;  4YWZ A;  3A3J A;  3OCN A;  4WEK A;  1KGF A;  3CWF A;  3VP2 A;  3VOL A;  2WZZ A;  2ZM0 A;  3PBQ A;  1L0E A;  2NUT C;  1FR1 A;  3BFG A;  5EFW A;  5E2H A;  3UDX A;  3HJK A;  2X02 A;  3B47 A;  2J3W A;  2XFS A;  2HDR A;  3VSK A;  1KOU A;  3IBR A;  2Y2Q A;  1H3Q A;  4GOG A;  4LV2 A;  5LBR A;  3LIE A;  3HUO A;  2Q0O A;  5MC7 A;  4QY6 A;  1Y4O A;  3U4L P;  4MLL A;  2VA0 A;  3PAE A;  3IF5 A;  4EER A;  3W2Z A;  4UQI S;  5HD3 A;  3GTC A;  5EOO A;  4R23 A;  1K4E A;  1STZ A;  3DTM A;  3EOI A;  2Z2M B;  4I3I A;  3C38 A;  3TW8 A;  3N8R A;  2J9O A;  3E4O A;  3UB9 A;  2H5S A;  3MXS A;  1H5X A;  2DCF A;  3LIF A;  1NJ4 A;  4B9O A;  5EM1 A;  3HLC A;  4R1G A;  3L7H A;  3HLW A;  3T12 B;  1AXB A;  1S6R A;  3FYZ A;  5KZH A;  1W7F A;  2PU4 A;  2XD1 A;  1ESI A;  2VEA A;  3ZNY A;  1NLZ A;  5HAP A;  1MWU A;  2P7J A;  4LCL A;  3PXP A;  1G68 A;  3T1S A;  5AVF A;  2Y59 A;  1CEF A;  3IS2 B;  3OPP A;  2ZL1 B;  4F94 A;  4KUK A;  2Y2K A;  1PYY A;  2XH9 A;  1C3B A;  4OP5 A;  1FIK A;  2J3T D;  2KX6 A;  4XT2 B;  2XD5 A;  1S4S A;  1NLY A;  1Q2P A;  1MWS A;  1XJ4 A;  4PM7 A;  4LRY C;  4ZBE A;  4BJP A;  1XA7 A;  1P9R A;  1DP9 A;  4DJ3 A;  4ZAM A;  5AQ9 A;  1D7E A;  2QHK A;  1GHP A;  4HP4 A;  1OT9 A;  4ZDX A;  2FFF B;  4HOI A;  3GVB A;  1G28 A;  3VFH A;  3LYX A;  4GW9 A;  1ES2 A;  3WRZ A;  3RTY A;  5HFO A;  1BLH A;  2WZX A;  2ZMA A;  4DKI A;  4HIA A;  3CJM A;  2VGJ A;  4DXB A;  4S2N A;  5EVI A;  2IWB A;  5DF9 A;  2XF3 A;  4NK3 A;  4OOM A;  4YIN A;  3IF6 A;  4L9F A;  3A3F A;  2ZC6 B;  4ID4 A;  3MR0 A;  3ZYT A;  2ZM8 A;  4IUK A;  3G30 A;  1G5U A;  4JF5 A;  1GSX A;  4O0P A;  4EXO A;  1TDL A;  4HQA A;  3OCL A;  3VV4 A;  2Y2M A;  2ZM2 A;  4MN7 A;  4WZ5 C;  1YAX A;  3MKE A;  1W5D A;  3DTK A;  3IXB A;  3NY4 A;  4CLC B;  3NOP C;  4KQD A;  4GN2 A;  5FI7 A;  4QB8 A;  3DWZ A;  1CI8 A;  4H8R A;  2WGW A;  4OPQ A;  5F1G A;  1MXO A;  3QP8 A;  1K38 A;  2G2W A;  1SZV A;  4MDZ A;  4B4X A;  5DKK A;  2Y8H A;  4NXF A;  4PHT A;  2HZ5 A;  3K2N A;  1YSP A;  3T4J A;  4OH0 A;  1TS7 A;  2XK1 A;  2HJ9 C;  3KO6 A;  3RJU A;  4UA6 A;  4B88 A;  1SCW A;  2KDK A;  3PAG A;  3F1O B;  4F3L A;  4BQM A;  3ISG A;  3UB5 P;  5JYP A;  4E3O A;  2W0N A;  3BQ8 A;  3NI9 A;  4L9G A;  3W4Q A;  2OSU A;  1XJ2 A;  2ACG A;  5HL6 A;  2V9A A;  1BLC A;  1W8Y A;  2O99 A;  4UA7 A;  4UQI M;  3MS6 A;  2Z6D A;  3B42 A;  5KSC A;  5E2E A;  4WLA A;  4HEF A;  3IX4 A;  4WMC D;  4KEN B;  2J7V A;  4LLO B;  3HRE A;  4XUZ A;  5HPI A;  4O8G A;  2QJ7 A;  2V0W A;  2J9P A;  4D60 A;  5DF8 A;  3O87 A;  4H6J B;  3R4K A;  1K6R A;  5U47 A;  3EQU A;  4ESP A;  4WEL A;  1E25 A;  1MBL A;  1KGE A;  1T1B A;  3DTI A;  3G35 A;  3I7J A;  3NCK A;  4Y7P A;  3ZVW A;  5AQA A;  3NDE A;  5L07 A;  2PAV P;  1L0G A;  3GMW A;  5GLB A;  1HD8 A;  3ITA A;  2X01 A;  3DW0 A;  2ZQC A;  5CXW A;  5GHY A;  3PHY A;  4EQ1 A;  3PBT A;  3OOV A;  2ZQA A;  5E2G A;  3NHQ A;  3T50 A;  3F1N A;  4EET B;  4HP9 A;  1LHY A;  1MKI A;  1RGY A;  2WAE A;  4EV4 A;  4KZ7 A;  5EE8 A;  4DDS A;  4P0M A;  3A0V A;  3FKW A;  3E4Q A;  4BBT A;  2OOL A;  2WAF A;  1VB6 A;  3GSG A;  4R4R A;  3BLS A;  2ZC4 B;  1FSW A;  3WWX A;  1ZKJ A;  3PR6 A;  5J7E A;  3IWQ A;  2Y2N A;  2JE5 A;  4X68 A;  1NY0 A;  1XP4 A;  4MEZ A;  4G3K A;  5G18 A;  1XPB A;  3BRM A;  3K3C A;  4CLC D;  4FSF A;  1E4D A;  1F9I A;  4ETX A;  3EGX C;  5FQJ A;  3ZFZ A;  1YLZ A;  4HY8 A;  1CEG A;  3O3V A;  2JBF A;  2WGV A;  3V3S A;  4P87 A;  4BL3 A;  3ZG9 B;  4KG6 A;  4S2P A;  3JVV A;  3HCY A;  4ETZ A;  4FD8 A;  5TFQ A;  1XX2 A;  4UAA A;  3O88 A;  4LPZ A;  3BFD A;  2I72 A;  5I94 A;  3TSG A;  2WKE A;  3UPP A;  4DDY A;  4QU3 A;  4OQH A;  3MQ0 A;  2C5W B;  3OPL A;  4K91 A;  3UE1 A;  2LB9 A;  2PBY A;  3H9W A;  4DE1 A;  1LI0 A;  4BMW A;  2W1R A;  4DMZ A;  2B18 A;  5CER A;  3DTE A;  3G2Z A;  2EFX A;  4NXB A;  2P74 A;  5JYO A;  1F2K A;  3QP1 A;  1PI4 A;  1F98 A;  3D3O A;  1K54 A;  3IHB A;  1DY6 A;  5D3O A;  1D06 A;  3SS4 A;  3ZQ5 A;  3OPH A;  2HV1 A;  1JTG A;  1ZHH B;  4EQI A;  1MPL A;  4O01 A;  4DJ2 A;  1P9W A;  3UNW A;  1YMS A;  3GR2 A;  3V5M A;  3P01 A;  1WYC A;  3DBA A;  2WKQ A;  4ME4 A;  3S1Y A;  5CEC A;  3JVU A;  2WUQ A;  3QNC A;  5AQ7 A;  2G7U A;  1YLW A;  3ZGA B;  3A3E A;  3MZD A;  2ZQ7 A;  2XRO A;  3UN7 A;  1BYW A;  3BLM A;  1ES5 A;  1SDN A;  1J3W A;  4S2K A;  4DRT A;  2GX5 A;  1I5Q A;  2OAP 1;  1XKZ A;  3FV7 A;  3LGO A;  1FR6 A;  1UWP X;  1KVM A;  3IH8 A;  1K57 C;  2HJE A;  4QWO A;  2PD7 A;  4PPR A;  4G3W A;  3IS2 A;  2ZL1 A;  1TDG A;  4RQ9 A;  4EBN A;  3O86 A;  4I5S A;  4KZ8 A;  4JKT A;  2W3D A;  5DTT A;  4X69 A;  1ES4 A;  2JKF A;  4WMC A;  5HL1 A;  4XT2 A;  1K55 C;  2Y79 A;  3LR5 A;  5J8X A;  1NRF A;  3NJA A;  4FH2 A;  4WF0 A;  1TEM A;  1NYM A;  4S2J A;  2O9B A;  3UDI A;  1IYS A;  2YKF A;  3FZC A;  1VET B;  4R70 A;  2BG1 A;  2OLU A;  2EXB A;  2VJW A;  3EEH A;  2V1B A;  3MBZ A;  4JXW A;  4GDN A;  2EA9 A;  2R78 A;  1MWT A;  4L9E A;  3WS2 A;  3MFD A;  5FAS A;  4Y5F A;  1SKO B;  5A8B A;  1T19 A;  3UME A;  2WKR A;  1CQA A;  3T1R A;  3SZT A;  5E2F A;  1DP6 A;  1SHV A;  2QMI A;  1M40 A;  1XGI A;  3ZG8 B;  1TS8 A;  4E6W A;  5EEC A;  1IKI A;  2IA2 A;  3QP2 A;  3BFF A;  3DWK A;  1OTE A;  4II7 A;  4EUZ A;  4L0L A;  1L0F A;  4KZ9 A;  2JKG A;  2WKH A;  4CLC A;  3N4I A;  1DJB A;  4NKP A;  3W8K A;  3ZNT A;  3Q7Z A;  3NIA A;  2QKP A;  2XEP A;  1YQS A;  3UB7 A;  2YKH A;  4HES A;  3HLB A;  4KUO A;  3KSF A;  1LT0 A;  2INW A;  1T18 A;  2V1A A;  3LR3 A;  2ZBB A;  3T1Q B;  5L8M A;  2CMN A;  1E3U A;  1CF0 A;  3E2K A;  3IF6 C;  4OON A;  1NYY A;  2WKI A;  2FFY A;  3IT9 A;  1TS6 A;  4MN6 A;  3WS1 A;  5EOE A;  2VV8 A;  5EM0 A;  3SOI A;  2V8F A;  3F1O A;  2J80 A;  4P6Z S;  3NDG A;  5GL9 A;  3TG9 A;  2EFU A;  4KZ3 A;  4A5R A;  3FWL A;  1HZO A;  1OT6 A;  3BFC A;  3U2A A;  1OTI A;  3HLG A;  1N9O A;  2ZOI A;  2HF6 A;  4HJ3 A;  3LIC A;  1QMF A;  3MF0 A;  5F6A A;  1MC0 A;  3HUM A;  3G32 A;  4OQ0 A;  5FEG A;  5DKL A;  4PKY G;  2UV0 E;  4IVK A;  4Z1W A;  3SS3 A;  3IBJ A;  4EEU A;  3D72 A;  4MBF A;  1BTL A;  5AQB A;  4E3K A;  4Y13 A;  3VE4 A;  3G6O A;  4H6J A;  4WYY A;  4QHC A;  1L3L A;  1SKF A;  2BTF P;  4YFM A;  3VMA A;  2M1C A;  5E43 A;  5BOH A;  3MMH A;  2LB5 A;  2VGL S;  2OWH A;  1MWR A;  4Y0U A;  3HLF A;  3IQA A;  3ZCZ A;  2WYX A;  4GJ4 A;  2FZ0 A;  4LV1 A;  3UPO A;  2B5R A;  2Z6C A;  3GQZ A;  1QME A;  1NRJ A;  3H7W B;  1EI5 A;  3EEA A;  5FAP A;  2IWC A;  2ZQ8 A;  1M6K A;  2HP9 A;  4WBG A;  1PW1 A;  4C75 A;  4B93 A;  4LRZ E;  3BY9 A;  3P7N A;  3PTE A;  3H82 B;  3BM6 A;  4P6B A;  2VV7 A;  2W1T B;  1G6O A;  3SH7 A;  3W4P A;  4DE0 A;  2PD8 A;  1HLU P;  3VOY A;  3VFF A;  4IHQ A;  1L2S A;  1ONG A;  1N9L A;  1OTA A;  1LLB A;  1JNU A;  4IJG A;  2HP5 A;  3UMD A;  3OPR A;  5HDC A;  1W79 A;  4OQI A;  3SH9 A;  2Y2J A;  1LSX A;  5EVL A;  1N9B A;  3GV9 A;  4JGO A;  2HDQ A;  4Q8I A;  4OKP A;  2HGV A;  4OLG A;  3IHA A;  1O7E A;  1IOU A;  1AWI A;  3SS5 A;  1MZU A;  3R7W B;  3CI6 A;  3VP3 A;  4JPM A;  1K6S A;  2DNS A;  3VSL A;  4LV3 A;  3KSH A;  3F1P B;  1FCN A;  4FCF A;  2K7S A;  2PHY A;  3P98 A;  4WM9 A;  3LO7 A;  2Y2G A;  4RVA A;  3EQV A;  3UY6 A;  3M2J A;  3S22 A;  4X1M A;  2VKS A;  3KYQ A;  1TVF A;  4RA7 A;  3LUQ A;  5KMW A;  3HUN A;  2NUP C;  2BAS A;  2XA7 S;  2B95 A;  3T4T A;  1K56 D;  3JPU A;  1KE0 A;  4QD4 A;  4I3A A;  1JVJ A;  3QP4 A;  5G4Z A;  4Q0J A;  3ZG0 A;  5F5Y A;  4FTX A;  2IWD A;  5L09 A;  2Y2P A;  2M7U A;  4JXS A;  4N1H A;  3LI8 A;  5FQ9 A;  4QJG A;  4R38 A;  1U60 A;  3NBL A;  4P6Z M;  4NET A;  1KE4 A;  4EES A;  2W27 A;  2L0W A;  4IVI A;  1ALQ A;  2ZOH A;  3V39 A;  1YLJ A;  5CHM A;  3C4P A;  2I9V A;  4X53 A;  1DJC A;  2ZQ9 A;  2E8J A;  1ESU A;  4NXE A;  5FDS A;  1KGG A;  4WZ5 A;  1S67 L;  1JWZ A;  2BLS A;  2EX6 A;  4JXV A;  4Y0O A;  3CUE A;  2O0Y A;  3B33 A;  4OPZ A;  1RP5 A;  1F5M A;  4BEN A;  1ZTU A;  3IX8 A;  3Q7V B;  1EW0 A;  2W3F A;  2G2U A;  2EWV A;  1Y54 A;  3A3I A;  4C3Q A;  1GHI A;  2Y4A A;  3LIA A;  2JHE A;  4IBX A;  3LID A;  5J4E A;  2CC1 A;  1NWZ A;  4EBP A;  1G6A A;  1S66 L;  2VK3 A;  5HSQ A;  1Z09 A;  2VGL M;  4JLF A;  1EWZ A;  5A93 A;  5FEF A;  4O7D A;  5F82 A;  1VET A;  3IWI A;  4X1L A;  4IUH A;  4DXC A;  4NXG A;  5L10 A;  2Z2L B;  5IHV A;  5J3W A;  2V20 A;  4E3N A;  4BWI A;  2XRN A;  5EUA A;  3KSI A;  3FPV A;  2ZC7 A;  4UHU A;  3LEZ A;  2R9W A;  5K5B A;  5TBM B;  1SKO A;  3UE3 A;  4XXR A;  3RXX A;  5HPF A;  1ONH A;  3NUL A;  3TOI A;  3IXH A;  3LEQ A;  4JBF A;  3LY3 A;  5G4Y A;  5HWV A;  3K3D A;  3VP1 A;  3C30 A;  4U0T A;  3LR4 A;  3BEB A;  3BYD A;  5L2F A;  5GHZ A;  1VEU B;  5CGW A;  3IXD A;  4LCM A;  1H8M A;  5HAR A;  3BWL A;  2P08 A;  2A49 A;  2GNX A;  4ZTK A;  4CQH A;  1PW8 A;  2PYP A;  2ZMF A;  2PBD P;  3IXG A;  3CPT B;  3M6B A;  4HH3 A; 
#chains in the Genus database with same CATH homology
 1ES2 A;  3N8S A;  1OME A;  3WRZ A;  3BFF A;  5HFO A;  4WEJ A;  2HDU A;  3DWK A;  1BLH A;  2ZD8 A;  1YLP A;  2WZX A;  4EUZ A;  2ZMA A;  1NZO A;  4L0L A;  4DKI A;  3CJM A;  2VGJ A;  1L0F A;  3C4O A;  3V3R A;  4DXB A;  4KZ9 A;  4S2N A;  5EVI A;  2WKH A;  2IWB A;  1K54 C;  5DF9 A;  2XF3 A;  3GRJ A;  3N4I A;  4NK3 A;  4OOM A;  1PWD A;  1DJB A;  1K4F A;  3W8K A;  3ZNT A;  4YIN A;  3IF6 A;  4B4Z A;  3Q7Z A;  1KDS A;  3NIA A;  5GLD A;  3A3F A;  2ZC6 B;  3MZE A;  4ID4 A;  1ZG6 A;  2XEP A;  1XXM A;  2JC7 A;  1YQS A;  1ZC2 A;  4RX2 A;  4N9K A;  4HES A;  1XGJ A;  2ZM8 A;  3HLB A;  4C6Y A;  3G30 A;  3VP0 A;  4JF5 A;  1TDL A;  1IYP A;  2XFT A;  1LL5 A;  4OPY A;  3OCL A;  2Y2M A;  2ZM2 A;  3OZH A;  4WZ5 C;  5F83 A;  3BFE A;  4K0W A;  4WZ4 A;  3MKE A;  2OV5 A;  1E3U A;  1CK3 A;  1W5D A;  3IXB A;  3NY4 A;  1PZP A;  4MBK A;  5EVI B;  3Q81 A;  4OP8 A;  3N6I A;  3E2K A;  3IF6 C;  5FQK A;  4JF4 A;  4OON A;  1NYY A;  2WGI A;  2RL3 A;  2WKI A;  2FFY A;  3IF6 B;  1PI5 A;  3G34 A;  3IT9 A;  4GN2 A;  4OPR A;  5FI7 A;  5M1A A;  5EOE A;  3WS1 A;  4QB8 A;  3DWZ A;  3QNB A;  5FAT A;  1K56 A;  1CI8 A;  4H8R A;  3SOI A;  2WGW A;  4OPQ A;  4GNU A;  1O07 A;  2PU2 A;  5F1G A;  1MXO A;  3NDG A;  3Q1F A;  4CJN A;  5GL9 A;  1K38 A;  2G2W A;  1RCJ A;  4B4X A;  1GCE A;  1J9M A;  3LCE A;  1ES3 A;  4N1X A;  5M19 A;  3CMZ A;  3TG9 A;  2Q9M A;  2EFU A;  4KZ3 A;  4OQG A;  4A5R A;  3HL9 A;  4ZJ1 A;  2QPN A;  3FWL A;  4JF6 A;  1BUE A;  1HZO A;  4BD0 A;  3BFC A;  1YMX A;  3AGF A;  4QY5 A;  3UPN A;  1PWG A;  3HLG A;  4OH0 A;  3HLE A;  2HPB A;  2XK1 A;  3SH8 A;  1QMF A;  5HW3 A;  2H0T A;  3RJU A;  4UA6 A;  5CTM A;  4KZ6 A;  4B88 A;  1SCW A;  3PAG A;  3HUM A;  3G2Y A;  2WGW B;  5CTN A;  3G32 A;  4HBT A;  4BQM A;  4OQ0 A;  3UDF A;  3MXR A;  3ISG A;  1I2S A;  4IVK A;  1YLT A;  5JYP A;  4E3O A;  2OLV A;  3SS3 A;  3NI9 A;  3IWO A;  4KQQ A;  5DTS A;  3W4Q A;  1E3U D;  2OSU A;  1FCM A;  4MBF A;  5A91 A;  1BTL A;  5AQB A;  4E3K A;  2V2F F;  4KZB A;  4KZ4 A;  1BLC A;  1IEM A;  2UWX A;  4QHC A;  4WYY A;  5A90 A;  1SKF A;  1LI9 A;  1W8Y A;  4EBL A;  2HDS A;  4UA7 A;  3WS0 A;  2H0Y A;  4YFM A;  4KG2 A;  3D4F A;  3G31 A;  3HBR A;  4P85 A;  5KSC A;  4X56 A;  3VMA A;  5E2E A;  4U3T A;  5E43 A;  3B3X A;  4X55 A;  1VQQ A;  5BOH A;  5F1F A;  2E8I A;  1BZA A;  4HEF A;  3CZD A;  4WMC D;  4KEN B;  3RXW A;  2J7V A;  2XQZ A;  1MWR A;  1IYO A;  1GHM A;  3W4O A;  1S0W A;  4Y0U A;  3HLF A;  3HRE A;  4XUZ A;  3IQA A;  4GD8 A;  3ZCZ A;  2WYX A;  4JXG A;  4LV1 A;  4GDB A;  5TGF A;  3VOZ A;  3UPO A;  2J9P A;  2X71 A;  5DF8 A;  3O87 A;  2B5R A;  4MBH A;  1MY8 A;  1K6R A;  2H10 A;  3EQU A;  5U47 A;  4WEL A;  1E25 A;  3GQZ A;  3WS4 A;  1MBL A;  1KGE A;  1QME A;  3G35 A;  4BD1 A;  3I7J A;  3NC8 A;  3NCK A;  4Y7P A;  4PM5 A;  3ZVW A;  3JYI A;  5FAP A;  1BLS A;  1EI5 A;  2Y2O A;  3QHY A;  1PZO A;  2IWC A;  2ZQ8 A;  2GDN A;  3NDE A;  5AQA A;  3G4P A;  4KQR A;  1M6K A;  4UA9 A;  2HP9 A;  4WBG A;  1PW1 A;  4RYE A;  1L0G A;  2QZ6 A;  3GMW A;  3V50 A;  2EX2 A;  4S2I A;  4C75 A;  4R3J A;  2V1Z A;  5FSR A;  5GLB A;  1HD8 A;  1W8Q A;  4PM8 A;  3ITA A;  2X01 A;  3DW0 A;  1ZG4 A;  2ZQC A;  4EV4 A;  3C7V A;  5CXW A;  5GHY A;  3ITB A;  1Z6F A;  2XDM A;  4GZB A;  3PBT A;  2ZQA A;  5E2G A;  2HP6 A;  2RCX A;  3PTE A;  3ZG5 A;  1N4O A;  3BM6 A;  4P6B A;  1LL9 A;  5HAI A;  3N7W A;  3SH7 A;  1LHY A;  3W4P A;  1MKI A;  1K57 A;  4RX3 A;  4DE0 A;  1CI9 A;  4S2N C;  5CRF A;  5EVI C;  5HAQ A;  1RGY A;  3VOY A;  2WAE A;  3N8L A;  5FA7 A;  4KZ7 A;  2A3U A;  5EE8 A;  3VFF A;  1L2S A;  4P0M A;  4DDS A;  1ONG A;  4R3B A;  2XLN A;  3HLD A;  3FKW A;  3PBR A;  1FCO A;  2EX9 A;  1K25 A;  1LLB A;  3MKF A;  2WAF A;  4R4R A;  3GSG A;  5CGX A;  3BLS A;  2HP5 A;  1NZU A;  2Y91 A;  2ZC4 B;  4N9L A;  3OPR A;  1FSW A;  1W79 A;  4OQI A;  3SH9 A;  3UO9 A;  1ZKJ A;  5EPH A;  2Y2J A;  3WWX A;  5M18 A;  5EVL A;  3IWQ A;  4KZA A;  1N9B A;  2Y2N A;  4GB7 A;  3UE0 A;  4X6T A;  3HVF A;  1L0D A;  3GV9 A;  4E3I A;  2ZC5 B;  2JE5 A;  3ZG7 B;  4E3M A;  4X68 A;  1NY0 A;  4FH4 A;  3A3D A;  2HDQ A;  1XP4 A;  2ZQD A;  4MEZ A;  4OKP A;  4OOL A;  4PMA A;  5FAO A;  5FAQ A;  4OLG A;  4Q8I A;  3IHA A;  1RGZ A;  5G18 A;  1K55 A;  1O7E A;  5GHX A;  3PBO A;  1BT5 A;  2WK0 A;  1FOF A;  1XPB A;  3P09 A;  3BRM A;  5EVI D;  3SS5 A;  4FSF A;  1KVL A;  1E4D A;  1JWV A;  1PIO A;  2VGK A;  5FQM A;  3VP3 A;  1YM1 A;  4JPM A;  5FQJ A;  3ZFZ A;  2EXA A;  1YLZ A;  4N92 A;  4OVD A;  1JTD A;  2ZLY A;  1K6S A;  1KE3 A;  2DNS A;  1CEG A;  1IEL A;  3VSL A;  3O3V A;  3ZDJ A;  1DJA A;  2JBF A;  2WGV A;  2Y2L A;  4E6X A;  3C5A A;  3V3S A;  5CED A;  4LV3 A;  2C6W B;  4P87 A;  4ZJ3 A;  3ZG9 B;  3CG5 A;  4KG6 A;  4BL3 A;  4E3J A;  1FCN A;  4S2P A;  1PWC A;  3S4X A;  3ZVT A;  1WE4 A;  4FCF A;  4LEN A;  4U0X A;  5KSH A;  4Y0T A;  4FD8 A;  5TFQ A;  1XX2 A;  3Q07 A;  3ZHH A;  1JWP A;  3P98 A;  4UAA A;  4WM9 A;  3MZF A;  3LO7 A;  3O88 A;  3PBN A;  2Y2G A;  3BFD A;  2I72 A;  4RVA A;  1ERQ A;  5I94 A;  1H8Y A;  3EQV A;  4Z9Q A;  2Y2I A;  3UY6 A;  2P9V A;  3M2J A;  3TSG A;  3S22 A;  2WKE A;  1YLY A;  3UPP A;  4RA7 A;  1TVF A;  3VP4 A;  4GKU A;  2XR0 A;  1BSG A;  1WYB A;  5KMW A;  3HUN A;  4DDY A;  5FDH A;  4QU3 A;  4OQH A;  2C5W B;  3OPL A;  4OOY A;  4K91 A;  3UE1 A;  2PBY A;  5FQQ A;  4DE1 A;  1K56 D;  4KZ5 A;  1LI0 A;  1KE0 A;  4QD4 A;  5FI6 A;  3E2L A;  1JVJ A;  5CER A;  4KG5 A;  3G2Z A;  4K0X A;  2EFX A;  3ZG0 A;  2IWD A;  2R9X A;  1HVB A;  4DF6 A;  2JCH A;  1SDE A;  2P74 A;  5JYO A;  4D2O A;  2Y2P A;  4LV0 A;  3AGE A;  2Y2H A;  3IH9 A;  4IED A;  4JXS A;  4N1H A;  2P9V B;  1H8Z A;  3WS5 A;  1PI4 A;  2XGN A;  5FQ9 A;  4QJG A;  1GA9 A;  1U60 A;  5FQI A;  1K54 A;  3C7U A;  3IHB A;  3NBL A;  1FQG A;  1DY6 A;  5D3O A;  4NET A;  1KE4 A;  2WAD A;  5FI2 A;  3FKV A;  1I2W A;  5HX9 A;  1HTZ A;  3LY4 A;  4IVI A;  1ALQ A;  3A3J A;  3OCN A;  3Q82 A;  3SS4 A;  4WEK A;  3V39 A;  1KGF A;  3OPH A;  4BLM A;  1YLJ A;  5GLA A;  1VM1 A;  1JTG A;  3VP2 A;  3Q7V A;  4EQI A;  5CHM A;  2WZZ A;  2ZM0 A;  3C4P A;  1MPL A;  3PBQ A;  1L0E A;  4X53 A;  1FR1 A;  3BFG A;  1DJC A;  5E2H A;  2ZQ9 A;  3UDX A;  1ESU A;  2X02 A;  3UNW A;  2XFS A;  1KGG A;  1YMS A;  3GR2 A;  4WZ5 A;  3V5M A;  1JWZ A;  2HDR A;  3VSK A;  1WYC A;  5CEB A;  2BLS A;  2Y2Q A;  2EX6 A;  5CHJ A;  4JXV A;  4Y0O A;  4GOG A;  4LV2 A;  1GA0 A;  3HUO A;  3S1Y A;  4QY6 A;  5CEC A;  2WUQ A;  4OPZ A;  3QNC A;  5AQ7 A;  1RP5 A;  5DF7 A;  1YLW A;  3ZGA B;  4MLL A;  3A3E A;  3MZD A;  4BEN A;  2ZQ7 A;  2Y55 A;  3PAE A;  1FSY A;  3IF5 A;  3UN7 A;  2DRW A;  3Q7V B;  3BLM A;  1ES5 A;  1SDN A;  4S2L A;  3M2K A;  4DRT A;  1IKG A;  2G2U A;  4S2K A;  1I5Q A;  3GTC A;  5EOO A;  4R23 A;  1XA1 A;  1XKZ A;  1K4E A;  3FV7 A;  1Y54 A;  3A3I A;  4C3Q A;  4XUX A;  4EWF A;  1GHI A;  1FR6 A;  2Y4A A;  3DTM A;  4ZJ2 A;  1KVM A;  3IH8 A;  1K57 C;  4IBX A;  2Z2M B;  4GD6 A;  3OC2 A;  4PM6 A;  2CC1 A;  3N8R A;  4KQO A;  4EBP A;  4PPR A;  1G6A A;  2J9O A;  2H5S A;  5DVA A;  3MXS A;  1H5X A;  2DCF A;  1NJ4 A;  1TDG A;  3BEC A;  4M3K A;  4JLF A;  4R4S A;  1EWZ A;  4EBN A;  3HLC A;  3O86 A;  5A93 A;  4R1G A;  4O7D A;  5F82 A;  3IWI A;  4KZ8 A;  1IYQ A;  4DXC A;  3HLW A;  4DE3 A;  4JKT A;  4IBR A;  1AXB A;  1S6R A;  3FYZ A;  5DTT A;  5KZH A;  1W7F A;  2Q9N A;  4X69 A;  1ES4 A;  2PU4 A;  2Z2L B;  5IHV A;  4WMC A;  2V20 A;  4E3N A;  5HL1 A;  2XD1 A;  1ESI A;  5CHU A;  5A92 A;  1ERM A;  1K55 C;  3ZNY A;  5EUA A;  5HAP A;  1MWU A;  4PM9 A;  2ZC7 A;  4UHU A;  4LCL A;  3LEZ A;  3PBS A;  3AGD A;  2R9W A;  5DTK A;  5J8X A;  5GLC A;  1NRF A;  4DE2 A;  1G68 A;  4FH2 A;  4BL2 A;  1TEM A;  1NYM A;  3UE3 A;  2Y59 A;  1CEF A;  3OPP A;  4S2J A;  4F94 A;  4S2O A;  4XXR A;  3RXX A;  4R0Q A;  3UDI A;  3WRT A;  1BUL A;  1ONH A;  2Y2K A;  3TOI A;  1IYS A;  3IXH A;  4OLD A;  3FZC A;  1PYY A;  4JBF A;  3LY3 A;  1YT4 A;  2XH9 A;  1C3B A;  2BG1 A;  3VP1 A;  2OLU A;  4OP5 A;  2EXB A;  4U0T A;  5TR7 A;  2ZJ9 A;  1Q2Q A;  3BEB A;  5CGS A;  3BYD A;  2XD5 A;  4E3L A;  5GHZ A;  5L2F A;  3MBZ A;  4JXW A;  5CGW A;  1BLP A;  1Q2P A;  4GDN A;  1MWS A;  4PM7 A;  4BJP A;  3IXD A;  4ZBE A;  1XA7 A;  4LCM A;  1MWT A;  3WS2 A;  3MFD A;  5FAS A;  1NXY A;  5HAR A;  1ERO A;  2EX8 A;  2ZC3 B;  4ZAM A;  2A49 A;  5AQ9 A;  1GHP A;  4ZTK A;  3M6H A;  4ZDX A;  1PW8 A;  4S2M A;  2FFF B;  4CPK A;  4HBU A;  3GVB A;  5E2F A;  3IXG A;  1SHV A;  2J8Y A;  2QMI A;  3VFH A;  1M40 A;  3M6B A;  1KDW A;  4MNR A;  1XGI A;  3ZG8 B;  4E6W A;  5EEC A;  1IKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...