3T1XA

Mglb r124a e127a monomer
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
134
structure length
134
Chain Sequence
LVLYGAPYERAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVASNAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKAAAAALARIAEEALAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Signaling protein
molecule keywords Gliding protein MglB
total genus 31
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3t1xA00
3LEQA 3T1RA 2JKGA 2PBDP 2PRFA 4FUWA 3UB5P 1VETA 2PAVP 2ACGA 2VK3A 5FDSA 3T1XA 4QWOA 1K0KA 1CQAA 4X25A 1G5UA 1FIKA 1AWIA 3DAVA 3MS6A 3NULA 1J3WA 1HLUP 4X1LA 5EM0A 3T1QB 1PFLA 1ACFA 4X1MA 1VEUA 5EM1A 1SKOB 3D9YA 3T12B 1F2KA 1Y4OA 3L9KA 2B95A 1PRQA 2ZL1A 1YPRA 2V8FA 5FEFA 5EV0A 2V8CA 3CPTB 1VETB 1Z09A 3MSHA 1PNEA 2BTFP 2E8JA 1D1JA 1A0KA 3NECA 4FTXA 1FILA 3KYEA 3L7HA 3LGOA 1SZVA 5EVEA 4D60A 5FEGA 1SKOA 2JKFA 1CJFA 1VEUB 3CPTA 3U4LP 1CF0A 3CHWP 3T1SA 2HZ5A 2ZL1B 4ESPA
chains in the Genus database with same CATH superfamily
3GV9A 1SDEA 1XJ4A 1S1YA 3D72A 2PD7A 4G3WA 3Q07A 4DXBA 3HBRA 4UQIM 3SH7A 2OV5A 2HP5A 2OLVA 1UGUA 3AGEA 3ULFA 1K56D 1TS7A 2V1AA 3QP6A 3C7VA 4L9FA 2Q0OA 5KZHA 4O7DA 1FSYA 3CHWP 4H8RA 4ZRRA 1BUEA 4BENA 4FSFA 1LHYA 4IEDA 5DFXA 1D06A 5AQBA 1ES2A 1PYYA 1SKOB 3VMAA 1YSQA 3IQAA 5TGFA 1OTAA 4QB8A 1NRFA 1WYCA 3UB8A 3NBLA 1ZKJA 4Q0IA 2ZC3B 5U47A 1G6AA 2BASA 1LL9A 4S2NA 4BBUA 4EBLA 4Q8IA 4YFMA 1IOUA 4LLOB 4FD8A 4NG2A 1BTLA 3K3CA 2ZC5B 2H28A 1KE0A 1SHVA 4B4XA 5GHXA 4E04A 2OAQ1 3EGDC 2WGVA 3G35A 2J80A 2XLNA 5EVID 4P85A 3TJZC 3G4PA 4JXVA 1XXMA 3E2KA 2WKPA 3V50A 5HPFA 3NY4A 4KG2A 3D9YA 2VA0A 3SS3A 1OTBA 1J9MA 2NUTC 3KX0X 2JKTM 2G7UA 4JGRA 5KSCA 2RCXA 1DP9A 2HP6A 2O9AA 1SKFA 3K3DA 2VK3A 3UB7A 1F9IA 1T18A 5FI2A 1GSXA 2VZWA 1JVJA 1S4SA 5DTSA 3IWOA 1XFQA 4ZJ3A 1W5DA 4E3MA 2VV8A 2Q9MA 4PAUA 2VGLM 4P6ZM 4CLCA 4X55A 3LIEA 2DMWA 2EWVA 2PAVP 2ACGA 2QPNA 3OCLA 4PM6A 3JPUA 4OPQA 1I2SA 3R4KA 4MN5A 3Q81A 2M7UA 4N92A 3MSHA 4BQMA 5E2FA 5CEBA 4GS9B 4ETXA 3CLOA 5J3WA 4KQRA 4KZ4A 1ES4A 3MFDA 5F69A 2XK1A 1IYPA 5HAIA 1C3BA 4DJ2A 2M1CA 2DNSA 4HY8A 5AVFA 1YLPA 4G3VA 4EV4A 1CI8A 1WE4A 1NXYA 3H82A 3FC7A 3IF6A 1RGZA 2PRFA 3LR5A 1TDLA 2WKEA 5FQMA 1KOUA 3UE1A 5G4ZA 1MWSA 2JC7A 1H0MA 3V39A 4WEJA 3EWKA 4MBHA 3KO6A 2ZL1A 3GMWA 4MNRA 2PYRA 1DY6A 1W7FA 1L0FA 1S6RA 2K2NA 1FSWA 5HD5A 3IWQA 3ITAA 3HREA 4UA6A 3F1PB 4EUZA 5E2GA 3RXXA 1T1BA 2V1ZA 4UHUA 3O5YA 3OPPA 4U3TA 3G32A 3F1NB 2XF3A 3E4OA 1XKZA 4GOGA 2L0WA 3UPOA 4E3IA 3IXHA 4X53A 3M6BA 5EVEA 3F1OB 5A91A 3ZNTA 3PAGA 4OPYA 2EX6A 1CEGA 3GVBA 3MFXA 2W27A 1PZPA 4C75A 1K25A 2Z2LB 4LV0A 4ZJ1A 3ZCZA 1KGFA 3GQZA 5HX9A 4I3IA 4OONA 3S7OA 3CI6A 1LL5A 1ES3A 3F1PA 3HLBA 1GA9A 3EGXC 3PBRA 1W8QA 1XFNA 2WADA 4X56A 3DWKA 4II7A 1LSXA 4FH4A 4C6YA 5LBRA 3OC2A 1T1CA 2Z6CA 2H0TA 1YKDA 4Y0TA 2W3HA 1ZG6A 4ZDXA 3VE4A 4QWOA 1N9NA 4RX2A 5FATA 3BY9A 1U60A 1VHMA 3WRTA 2ZM0A 3ZG5A 1X0OA 2Y79A 1P97A 3V3RA 2PU2A 1ERMA 2PD8A 5TBMB 5E43A 1IYQA 4KQDA 5CHUA 4M3KA 2PDRA 3LI9A 1T1AA 4PKYG 5HWVA 2Y55A 5CECA 2W3FA 4D2OA 4WBGA 3PTEA 3Q82A 1MKMA 2V0UA 3LI8A 4HJ4A 4U0TA 3S7PA 1CI9A 4I5SA 1Z6FA 5HSQA 2K7SA 4U0XA 3ZG8B 5EFWA 4EEUA 1YLJA 3UPPA 1VM1A 4GHIA 3S22A 1IEMA 4YNRA 4ARZB 1GHMA 1NJ4A 1OTEA 1E4DA 2VX8A 5KIZA 1BSGA 4LV3A 3R7WB 1FOFA 1KDWA 5EOEA 4E6WA 1GSVA 4BJPA 3NULA 3P01A 1EW0A 4IHQA 1VETB 1I5QA 3O86A 2X02A 1Q2PA 5EPHA 1KE4A 1NY0A 1K54A 2A24A 2O0YA 4L9GA 3UMEA 4CQHA 3UE3A 1LLBA 4E3NA 3NDGA 2OLUA 4DXCA 3MXQA 1S0WA 3FYZA 3UE6A 1YLWA 3BYDA 3IX8A 3EQVA 4K0XA 4PHTA 2FH5A 1E3UA 3FG8A 3M2JA 4NXGA 5DTTA 3BQ8A 2HZ5A 2HDQA 4F3LA 3OPLA 4M4XA 3TG9A 1PWCA 4OLDA 3E0YA 2EWWA 2P04A 1G5UA 2PHYA 2LB9A 3OLOA 1YMSA 5FASA 3N6IA 4GB7A 3RFBA 4JKTA 4LV2A 4Y0UA 2ZMAA 4DE1A 2QHKA 3NHQA 2WZZA 2IWBA 1VEUB 3GRJA 4AFIA 1OMEA 4N9KA 2VKSA 2W3GA 5I94A 5EECA 3VP2A 3HLFA 4LENA 2DRWA 5M18A 3G2ZA 3PBQA 4L0LA 5TJJA 2GX5A 2WAEA 2JBFA 2Y2MA 2E8JA 1A0KA 2IA2A 4EBPA 1MBLA 2HF6A 4IVIA 3VV4A 5J4EA 1QMFA 3LIFA 2IWCA 4JF6A 2ZJ9A 3VSLA 3LIBA 1H8YA 1VEUA 2ZOIA 3GDIA 3Q7VA 3MZDA 3FPVA 3OPHA 1OJ5A 4S2OA 1K4FA 1FILA 3BFGA 3BFDA 2XA7M 2XFTA 3QP8A 3FPWA 1LT0A 5IHVA 2EFXA 3ZG7B 1K6SA 3TOIA 2VLGA 3UN7A 3MS6A 4E3JA 1NYMA 2PR5A 2YKFA 4I3AA 2XEPA 3A3FA 2BG1A 3OZHA 4OQIA 4P0MA 2B18A 1BLCA 1HVBA 3BWLA 3JVVA 4JXWA 3CJMA 2B02A 1ERQA 2ZLYA 4OPRA 4R4RA 4NK3A 2A24B 2JN7A 4MCWA 2WGIA 4UA7A 5MC7A 3WS1A 2JKRI 2KOIA 2VJWA 1KGGA 3MKEA 5AJGA 4WZ5A 3NC8A 3SH8A 1XJ3A 4Q0JA 3LR0A 1NLZA 3S7NA 3LR3A 1TD5A 4R23A 5FAPA 2P9VA 4G3KA 3E98A 4R3JA 1W63M 3BY8A 4Y15A 1PWDA 3ZVTA 4Z9QA 3CMZA 1MPLA 5D3OA 5EVIB 5EVLA 1XA7A 5L10A 2J3WA 2XD1A 1G6OA 4Q0HA 4NEED 4JPMA 1BYWA 2HPBA 5CEDA 1ZC2A 2EX8A 1W79A 5JYPA 2FFYA 5CERA 4Y7PA 2ZD8A 4LV1A 1DJBA 4HIAA 4LRXC 3IX3A 5BOHA 4ZTKA 3F1NA 5E2HA 3LUQA 1KE3A 3C38A 1F2KA 4I38A 3DWZA 5L09A 1P0ZA 2QJ5A 5FEFA 1H5XA 5TFQA 4FH2A 1FR6A 4OH0A 2DCFA 4KZ8A 5J7EA 1JTGA 3UB5P 3MBZA 4N1XA 1K4EA 5DKLA 2Y2IA 5TR7A 1MC0A 1GSWA 4HOIA 4QHCA 4JF5A 5EM0A 3V5MA 3IX4A 3L7HA 3Q1FA 3WRZA 1ESUA 4OQ0A 1STZA 4S2KA 1ALQA 3MXSA 4R6LA 5HPIA 3GR2A 2GNXA 3BM6A 3Q7ZA 3A3DA 3T4OA 5EUAA 4FTXA 5HWTA 4KZ9A 3MQOA 5EVIC 4MMNA 3IBJA 4QU3A 3ZDJA 2E8IA 3IHAA 4DDSA 2PBDP 3HLWA 2UWXA 2PU4A 5FI7A 4DRTA 1EI5A 4XT2B 1FIKA 2HDRA 2Y4AA 2R78A 2XDMA 3UE0A 2O99A 3CWFA 3MZEA 1E3UD 4GZBA 3F1OA 3IT9A 4CLCB 4E3LA 1YMXA 2AVXA 1NLYA 3DTEA 4HP4A 3IHBA 1OPXA 4KZBA 3T4SA 5FL3A 3PBOA 1PI5A 4LCMA 4ID4A 2V2FF 4IBRA 2M7VA 3ZG0A 3T1QB 1PNEA 4Y2FA 1ONHA 3HJIA 2ZMVA 1IYOA 4IBXA 4MEZA 5CHJA 1YT4A 4WZ4A 1ONGA 3C4OA 4UAAA 4X25A 1JWVA 2V20A 1MXOA 3QP2A 3H82B 1BULA 4DE3A 3OCNA 3IS2A 2Y59A 3ISGA 3PBTA 1K57A 1H8ZA 3ZVWA 3PBNA 1H8MA 3LYXA 2V0WA 2HP9A 2C6WB 4X69A 3W2ZA 3T4LA 1XA1A 2GJ3A 3C7UA 3K2NA 3VP0A 4H6JB 3HLEA 1YPRA 4O01A 5M1AA 4X6TA 5CXWA 3UDFA 2WZXA 3GECA 3WS5A 4HNBA 4CLCD 1FQGA 1MWUA 1WA9A 3LICA 4GCZA 2A3UA 3LIDA 2WKHA 1OT9A 1MWRA 4HJ3A 3LO7A 4QJGA 3IH9A 3T4TA 3NOUC 5EV0A 1CEFA 4N9LA 2D02A 5A93A 4R0QA 1LI9A 3KSGA 4RX3A 1CF0A 3T4KA 5DVAA 2WYXA 1EROA 4EEPA 1I2WA 2QKPA 2QYBA 5FQ9A 4I3JA 4RA7A 1RGYA 2QJ7A 3EQUA 3W8KA 5IS1A 5EVIA 4GDBA 2Y2PA 2ZC6B 3E4QA 5HWWA 2Y2GA 3BFFA 1T19A 5A8BA 2OSUA 3LEZA 2H0YA 2I72A 4HH3A 2Y2JA 2XH9A 3A3IA 2XROA 1K6RA 1MZUA 1TDGA 2Y2QA 3QP1A 2Y8HA 4OOLA 2INWA 2J7VA 3T1SA 4WL9A 2J9PA 1FCOA 1K38A 2VEAA 4OLGA 1LSVA 3BFEA 5HDSA 2V9AA 3JYIA 1XGJA 5KSHA 2L4RA 5HL1A 4PMAA 3KSFA 4OP5A 2ZC7A 4HH2A 4MDZA 3GTCA 4CPKA 2P74A 5CGSA 2HGVA 3LEQA 4HESA 5M19A 3T4QA 3MF0A 1K0KA 3G34A 3MQQA 3W4OA 1MKIA 1HD8A 4EU0A 3WS0A 1JTDA 2Q9NA 5EE8A 2Y2KA 1XX2A 4OOMA 5HDDA 3LY4A 2JCHA 1PIOA 4GJ4A 3CUEC 1TS8A 1K56A 2W1TA 1K57C 3UO9A 1S4RA 2UV0E 1GA0A 3KSIA 4GNUA 3JVUA 3FZCA 3Q7VB 2PYPA 3FWLA 3VP4A 3SS5A 1DJCA 3UPNA 5J8XA 1PI4A 1P9RA 3HLCA 1ESIA 1FR1A 4KQQA 2OAP1 1SKOA 3R7WA 2P7JA 1CJFA 2XGNA 3IXDA 2JKGA 1TS0A 3OPRA 2P08A 1SDNA 2R9WA 4R38A 1HLUP 1XGIA 4Y17A 2LB5A 5E2EA 5FQQA 2B95A 3BECA 3H7WB 3VSKA 1Z09A 4EERA 1N9LA 1K55C 2ZQCA 3EOIA 1IKGA 5HAPA 3UB6A 3TSGA 1ZG4A 4EETB 3UMDA 4WYYA 4L9EA 4JGPA 3N8SA 1L3LA 4HEFA 3G31A 2FFFB 1CK3A 2H10A 4WUJA 4KENB 4WMCD 3B33A 3HLGA 2V8FA 3LFVA 3A3EA 2EFUA 5CRFA 4NXFA 4WZ5C 3N4IA 4PM5A 3EEHA 3U2AA 3G2YA 3RXWA 5K5BA 4Y13A 5DF9A 3A3JA 4HP9A 5DFYA 2XQZA 3EEAA 3IF5A 2J8YA 1NZUA 3AGFA 2Y91A 4LPZA 4S2PA 1Y28A 5FQIA 5CX7A 4MBKA 1BLPA 3ZGAB 3V3SA 2FZ0A 3IXGA 2WGWB 2PT7A 2J9OA 1VETA 5HW3A 3BFCA 4YOFA 1NYYA 3W4PA 3SOIA 2K31A 2QMIA 2HV1A 3RTYA 4ZBEA 3HVFA 1DP6A 4WM9A 3UDIA 4OPZA 2W3EA 3LIAA 4BL3A 2ZQ7A 4HJ6A 3CPTA 4K08A 3IXBA 3E4PA 1RP5A 3LR4A 4BLMA 2NUPC 3HUMA 2XFSA 1PFLA 3T4JA 5GL9A 3T12B 1DRMA 3TRCA 4EW7A 2KLIA 3KSHA 4PM9A 4EWFA 2HJEA 1NRJA 1XJ6A 2G2WA 1NZOA 1ZTUA 4JXSA 2GDNA 4Y0OA 3OBFA 4EQ1A 3QNCA 1S67L 3I7JA 1EWZA 3VOZA 3ZNYA 5L8MA 3DTMA 3QHYA 2B5RA 3C2WA 3KYQA 1N4OA 5FDHA 1OTIA 1D1JA 5HDCA 3ZHHA 2W0NA 2Y2NA 3OOVA 1UWNX 4R3AA 4UEYA 4KG5A 4XT2A 3N7WA 4XUXA 5TBMA 4NXBA 4B4ZA 5FA7A 5DKKA 3C4PA 3P09A 1HTZA 3M6HA 5DF7A 3DBAA 5A90A 4HQAA 4HHDA 1IFQA 1L0EA 4ZJ2A 2PR6A 1S1ZA 3LGOA 1BLHA 2JKTI 2ZMFA 3PYPA 1XP4A 2J3TD 3FKVA 3HCYA 3LY3A 1V9ZA 4JGQA 4RVAA 4R70A 1AWIA 3P98A 3D3OA 1K54C 3M2KA 4JF4A 2G2UA 3B3XA 5FAQA 3O3VA 3HLDA 1WYBA 3VFHA 4WELA 1IKIA 3IH8A 3VP3A 3KYEA 4D60A 3DTKA 2WKRA 3HUNA 3G6OA 4NXEA 4GS9A 4IUKA 4ME4A 1KVMA 3FKWA 4YINA 2D01A 2A2LA 1KVLA 2A49A 2KDKA 5FAOA 2QWSA 2BLSA 3S4XA 3ZG9B 4DF6A 4LFUA 3H9WA 2OWHA 4B93A 3BLMA 2XSSA 3QP4A 5F1FA 5G18A 4UA9A 2XR0A 4F94A 1KGEA 1IELA 4E3OA 3UDXA 3RH8B 4UQIS 2KX6A 2ZQ9A 1FCMA 4IUHA 5L2FA 3HJKA 2JHEA 5GLCA 5C5KA 2P9VB 5HD3A 2VGJA 5L07A 2RL3A 5HARA 1W8YA 2O9BA 4GHIB 1YM1A 3GSGA 1M40A 3O88A 5HZHA 1YLYA 3NIAA 3PR6A 4Y5FA 2V1BA 5EOOA 2WGWA 5CGXA 1E25A 2L1MA 2ZM8A 2W1TB 2Y2LA 3T1XA 3T50A 5AVEA 3CZDA 4NKPA 1LL8A 4K91A 3PHYA 5I5LA 2C5WB 4BBTA 1TEMA 1YLZA 1L0GA 3KYZA 3DW0A 3MQ0A 4GDNA 2JKFA 4JGOA 2YKHA 4KUKA 3VP1A 4YWZA 5DJTA 3MR0A 3O87A 1MY8A 3B47A 1XJ2A 4H6JA 3WS2A 4S2IA 3DTIA 1ZHHB 1RCJA 5F68A 2ZM2A 5FI6A 4FUWA 2X01A 4WN5A 1N9BA 3TE8A 3W4QA 2Y2OA 5KMWA 2J3TC 2CC1A 1ACFA 1ODVA 2WKQA 1LI0A 1YSPA 1PWGA 4Z1WA 4P6BA 5FQKA 4EQIA 3BRMA 3A0SA 3BJNA 4KUOA 1QMEA 3N8RA 3G30A 5DTKA 4ARZA 4BMWA 3NI9A 1JNUA 1AXBA 3BQAA 4MN6A 1LSWA 4KQOA 1TF1A 1SCWA 4DMZA 1L2SA 4I39A 4OQHA 1W63Q 3IF6C 2V8CA 5DJUA 5FEGA 1OJGA 1BZAA 2O9CA 4IVKA 4E6XA 2XRNA 5EM1A 4KZ3A 4ESPA 3CG5A 4CLCE 4P6ZS 3NJAA 5A92A 4BL2A 4S2NC 1S66L 1NWZA 3TW8A 4KG6A 1KDSA 4EXOA 3RJUA 1F98A 1JWPA 4PPRA 3NDEA 3V67A 2EXAA 1L0DA 1TVFA 3NOTC 5CHMA 4PKYA 5HAQA 3PAEA 2ZQDA 4P87A 1YQSA 4QY5A 2VV7A 3E2LA 3VE3A 1P9WA 1GHIA 1G28A 4F3LB 4O8GA 2VGKA 3VFFA 3IBRA 4A5RA 3CAXA 4R3BA 2XA7S 2WKIA 3PXPA 3A0VA 4N1HA 3UY6A 1JWZA 4R4SA 3QP5A 5GHZA 4HBUA 5FQJA 3NOPC 1OTDA 5GLDA 1FCNA 3ZFZA 2MJ6A 5F5YA 3B42A 3MJQA 2ZQAA 3L9KA 5F82A 4RYEA 4PM7A 1SZVA 1ES5A 1N9OA 3FV7A 4OP8A 4GD6A 4DE0A 3A0RA 3ITBA 3DAVA 2ZQ8A 1G68A 2HJ9C 3PBSA 1PRQA 4DJ3A 2EX9A 4KZ7A 4JXGA 3NECA 4OOYA 4JBFA 3IWIA 3H7WA 4DN0A 3AGDA 3MXRA 2CMNA 4EBNA 2QZ6A 4LCLA 4QY6A 5G4YA 3ZQ5A 2I9VA 1O07A 3LCEA 4WEKA 4Y3IA 4O0PA 4CJNA 3CPTB 4DKIA 3SW1A 3S1YA 3VOLA 4XXRA 2ZL1B 3CITA 1DP8A 1YLTA 3WWXA 4OQGA 2OOLA 2W1RA 4X68A 1UWPX 4ETZA 2H5SA 4KZAA 1V9YA 2XD5A 3SZTA 4WMCA 4HBTA 4B9OA 1O7EA 1DJAA 5HFOA 4S2JA 3ZYTA 2Z6DA 1BLSA 4LGWA 2WUQA 4LRYC 5DF8A 2VGLS 1GHPA 5GLAA 3IS2B 4R1GA 2JE5A 2VV6A 4X1MA 1Y4OA 4KZ6A 5F1GA 5HL6A 4MBFA 4E3KA 2WK0A 1OT6A 5AQ9A 3D4FA 5JYOA 4IJGA 5AQ7A 5IU1A 4BBVA 5CTNA 5FDSA 4PM8A 2Y2HA 5F83A 1IYSA 1CQAA 4EESA 3MMHA 1PW8A 4XUZA 3CUEA 4X1LA 3SH9A 5IT5A 1M6KA 4EUVA 4GKUA 1VQQA 5GLBA 3N8LA 3NCKA 2EX2A 4BD0A 5AQAA 2EA9A 1MWTA 5FSRA 3T1RA 2Z2MB 4RQ9A 1Y54A 4WF0A 2ZBBA 1PZOA 1F5MA 3WS4A 4B88A 3BLSA 3ICYA 3UNWA 4C3QA 4QD4A 4DE2A 2GZAA 2HDSA 2EXBA 1XPBA 4NETA 5CTMA 1K55A 3U4LP 4S2LA 4GN2A 1D7EA 4FCFA 2OWJA 4S2MA 4MN7A 1VB6A 1H3QA 3HL9A 1Q2QA 2ZC4B 5CGWA 1BT5A 3C5AA 2JKRM 4KZ5A 4JLFA 3P7NA 2HDUA 2X71A 2ZOHA 1HZOA 1PW1A 4LRZE 2R9XA 3VOYA 3IF6B 2PBYA 2IWDA 4DDYA 3MZFA 4OVDA 2BTFP 1YAXA 3BW6A 3SS4A 3BEBA 3C8CA 2W3DA 4GLQA 3HUOA 4BD1A 3C30A 4HI4A 4GD8A 4CLCC 3S7QA 5GHYA 4WLAA 1J3WA 3MKFA 3UB9A 1TS6A 3QNBA 4OKPA 4BWIA 1GCEA 4MLLA 2WAFA 4FOFA 5F6AA 4GW9A 4ZAMA 4QPRA 4K0WA
chains in the Genus database with same CATH topology
3LEQA 3T1RA 2JKGA 2PBDP 2PRFA 4FUWA 3UB5P 1VETA 2PAVP 2ACGA 2VK3A 5FDSA 3T1XA 4QWOA 1K0KA 1CQAA 4X25A 1G5UA 1FIKA 1AWIA 3DAVA 3MS6A 3NULA 1J3WA 1HLUP 4X1LA 5EM0A 3T1QB 1PFLA 1ACFA 4X1MA 1VEUA 5EM1A 1SKOB 3D9YA 3T12B 1F2KA 1Y4OA 3L9KA 2B95A 1PRQA 2ZL1A 1YPRA 2V8FA 5FEFA 5EV0A 2V8CA 3CPTB 1VETB 1Z09A 3MSHA 1PNEA 2BTFP 2E8JA 1D1JA 1A0KA 3NECA 4FTXA 1FILA 3KYEA 3L7HA 3LGOA 1SZVA 5EVEA 4D60A 5FEGA 1SKOA 2JKFA 1CJFA 1VEUB 3CPTA 3U4LP 1CF0A 3CHWP 3T1SA 2HZ5A 2ZL1B 4ESPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEQ A;  3T1R A;  2JKG A;  2PBD P;  2PRF A;  4FUW A;  3UB5 P;  1VET A;  2PAV P;  2ACG A;  2VK3 A;  5FDS A;  3T1X A;  4QWO A;  1K0K A;  1CQA A;  4X25 A;  1G5U A;  1FIK A;  1AWI A;  3DAV A;  3MS6 A;  3NUL A;  1J3W A;  1HLU P;  4X1L A;  5EM0 A;  3T1Q B;  1PFL A;  1ACF A;  4X1M A;  1VEU A;  5EM1 A;  1SKO B;  3D9Y A;  3T12 B;  1F2K A;  1Y4O A;  3L9K A;  2B95 A;  1PRQ A;  2ZL1 A;  1YPR A;  2V8F A;  5FEF A;  5EV0 A;  2V8C A;  3CPT B;  1VET B;  1Z09 A;  3MSH A;  1PNE A;  2BTF P;  2E8J A;  1D1J A;  1A0K A;  3NEC A;  4FTX A;  1FIL A;  3KYE A;  3L7H A;  3LGO A;  1SZV A;  5EVE A;  4D60 A;  5FEG A;  1SKO A;  2JKF A;  1CJF A;  1VEU B;  3CPT A;  3U4L P;  1CF0 A;  3CHW P;  3T1S A;  2HZ5 A;  2ZL1 B;  4ESP A; 
#chains in the Genus database with same CATH topology
 3GV9 A;  1SDE A;  1XJ4 A;  1S1Y A;  3D72 A;  2PD7 A;  4G3W A;  3Q07 A;  4DXB A;  3HBR A;  4UQI M;  3SH7 A;  2OV5 A;  2HP5 A;  2OLV A;  1UGU A;  3AGE A;  3ULF A;  1K56 D;  1TS7 A;  2V1A A;  3QP6 A;  3C7V A;  4L9F A;  2Q0O A;  5KZH A;  4O7D A;  1FSY A;  3CHW P;  4H8R A;  4ZRR A;  1BUE A;  4BEN A;  4FSF A;  1LHY A;  4IED A;  5DFX A;  1D06 A;  5AQB A;  1ES2 A;  1PYY A;  1SKO B;  3VMA A;  1YSQ A;  3IQA A;  5TGF A;  1OTA A;  4QB8 A;  1NRF A;  1WYC A;  3UB8 A;  3NBL A;  1ZKJ A;  4Q0I A;  2ZC3 B;  5U47 A;  1G6A A;  2BAS A;  1LL9 A;  4S2N A;  4BBU A;  4EBL A;  4Q8I A;  4YFM A;  1IOU A;  4LLO B;  4FD8 A;  4NG2 A;  1BTL A;  3K3C A;  2ZC5 B;  2H28 A;  1KE0 A;  1SHV A;  4B4X A;  5GHX A;  4E04 A;  2OAQ 1;  3EGD C;  2WGV A;  3G35 A;  2J80 A;  2XLN A;  5EVI D;  4P85 A;  3TJZ C;  3G4P A;  4JXV A;  1XXM A;  3E2K A;  2WKP A;  3V50 A;  5HPF A;  3NY4 A;  4KG2 A;  3D9Y A;  2VA0 A;  3SS3 A;  1OTB A;  1J9M A;  2NUT C;  3KX0 X;  2JKT M;  2G7U A;  4JGR A;  5KSC A;  2RCX A;  1DP9 A;  2HP6 A;  2O9A A;  1SKF A;  3K3D A;  2VK3 A;  3UB7 A;  1F9I A;  1T18 A;  5FI2 A;  1GSX A;  2VZW A;  1JVJ A;  1S4S A;  5DTS A;  3IWO A;  1XFQ A;  4ZJ3 A;  1W5D A;  4E3M A;  2VV8 A;  2Q9M A;  4PAU A;  2VGL M;  4P6Z M;  4CLC A;  4X55 A;  3LIE A;  2DMW A;  2EWV A;  2PAV P;  2ACG A;  2QPN A;  3OCL A;  4PM6 A;  3JPU A;  4OPQ A;  1I2S A;  3R4K A;  4MN5 A;  3Q81 A;  2M7U A;  4N92 A;  3MSH A;  4BQM A;  5E2F A;  5CEB A;  4GS9 B;  4ETX A;  3CLO A;  5J3W A;  4KQR A;  4KZ4 A;  1ES4 A;  3MFD A;  5F69 A;  2XK1 A;  1IYP A;  5HAI A;  1C3B A;  4DJ2 A;  2M1C A;  2DNS A;  4HY8 A;  5AVF A;  1YLP A;  4G3V A;  4EV4 A;  1CI8 A;  1WE4 A;  1NXY A;  3H82 A;  3FC7 A;  3IF6 A;  1RGZ A;  2PRF A;  3LR5 A;  1TDL A;  2WKE A;  5FQM A;  1KOU A;  3UE1 A;  5G4Z A;  1MWS A;  2JC7 A;  1H0M A;  3V39 A;  4WEJ A;  3EWK A;  4MBH A;  3KO6 A;  2ZL1 A;  3GMW A;  4MNR A;  2PYR A;  1DY6 A;  1W7F A;  1L0F A;  1S6R A;  2K2N A;  1FSW A;  5HD5 A;  3IWQ A;  3ITA A;  3HRE A;  4UA6 A;  3F1P B;  4EUZ A;  5E2G A;  3RXX A;  1T1B A;  2V1Z A;  4UHU A;  3O5Y A;  3OPP A;  4U3T A;  3G32 A;  3F1N B;  2XF3 A;  3E4O A;  1XKZ A;  4GOG A;  2L0W A;  3UPO A;  4E3I A;  3IXH A;  4X53 A;  3M6B A;  5EVE A;  3F1O B;  5A91 A;  3ZNT A;  3PAG A;  4OPY A;  2EX6 A;  1CEG A;  3GVB A;  3MFX A;  2W27 A;  1PZP A;  4C75 A;  1K25 A;  2Z2L B;  4LV0 A;  4ZJ1 A;  3ZCZ A;  1KGF A;  3GQZ A;  5HX9 A;  4I3I A;  4OON A;  3S7O A;  3CI6 A;  1LL5 A;  1ES3 A;  3F1P A;  3HLB A;  1GA9 A;  3EGX C;  3PBR A;  1W8Q A;  1XFN A;  2WAD A;  4X56 A;  3DWK A;  4II7 A;  1LSX A;  4FH4 A;  4C6Y A;  5LBR A;  3OC2 A;  1T1C A;  2Z6C A;  2H0T A;  1YKD A;  4Y0T A;  2W3H A;  1ZG6 A;  4ZDX A;  3VE4 A;  4QWO A;  1N9N A;  4RX2 A;  5FAT A;  3BY9 A;  1U60 A;  1VHM A;  3WRT A;  2ZM0 A;  3ZG5 A;  1X0O A;  2Y79 A;  1P97 A;  3V3R A;  2PU2 A;  1ERM A;  2PD8 A;  5TBM B;  5E43 A;  1IYQ A;  4KQD A;  5CHU A;  4M3K A;  2PDR A;  3LI9 A;  1T1A A;  4PKY G;  5HWV A;  2Y55 A;  5CEC A;  2W3F A;  4D2O A;  4WBG A;  3PTE A;  3Q82 A;  1MKM A;  2V0U A;  3LI8 A;  4HJ4 A;  4U0T A;  3S7P A;  1CI9 A;  4I5S A;  1Z6F A;  5HSQ A;  2K7S A;  4U0X A;  3ZG8 B;  5EFW A;  4EEU A;  1YLJ A;  3UPP A;  1VM1 A;  4GHI A;  3S22 A;  1IEM A;  4YNR A;  4ARZ B;  1GHM A;  1NJ4 A;  1OTE A;  1E4D A;  2VX8 A;  5KIZ A;  1BSG A;  4LV3 A;  3R7W B;  1FOF A;  1KDW A;  5EOE A;  4E6W A;  1GSV A;  4BJP A;  3NUL A;  3P01 A;  1EW0 A;  4IHQ A;  1VET B;  1I5Q A;  3O86 A;  2X02 A;  1Q2P A;  5EPH A;  1KE4 A;  1NY0 A;  1K54 A;  2A24 A;  2O0Y A;  4L9G A;  3UME A;  4CQH A;  3UE3 A;  1LLB A;  4E3N A;  3NDG A;  2OLU A;  4DXC A;  3MXQ A;  1S0W A;  3FYZ A;  3UE6 A;  1YLW A;  3BYD A;  3IX8 A;  3EQV A;  4K0X A;  4PHT A;  2FH5 A;  1E3U A;  3FG8 A;  3M2J A;  4NXG A;  5DTT A;  3BQ8 A;  2HZ5 A;  2HDQ A;  4F3L A;  3OPL A;  4M4X A;  3TG9 A;  1PWC A;  4OLD A;  3E0Y A;  2EWW A;  2P04 A;  1G5U A;  2PHY A;  2LB9 A;  3OLO A;  1YMS A;  5FAS A;  3N6I A;  4GB7 A;  3RFB A;  4JKT A;  4LV2 A;  4Y0U A;  2ZMA A;  4DE1 A;  2QHK A;  3NHQ A;  2WZZ A;  2IWB A;  1VEU B;  3GRJ A;  4AFI A;  1OME A;  4N9K A;  2VKS A;  2W3G A;  5I94 A;  5EEC A;  3VP2 A;  3HLF A;  4LEN A;  2DRW A;  5M18 A;  3G2Z A;  3PBQ A;  4L0L A;  5TJJ A;  2GX5 A;  2WAE A;  2JBF A;  2Y2M A;  2E8J A;  1A0K A;  2IA2 A;  4EBP A;  1MBL A;  2HF6 A;  4IVI A;  3VV4 A;  5J4E A;  1QMF A;  3LIF A;  2IWC A;  4JF6 A;  2ZJ9 A;  3VSL A;  3LIB A;  1H8Y A;  1VEU A;  2ZOI A;  3GDI A;  3Q7V A;  3MZD A;  3FPV A;  3OPH A;  1OJ5 A;  4S2O A;  1K4F A;  1FIL A;  3BFG A;  3BFD A;  2XA7 M;  2XFT A;  3QP8 A;  3FPW A;  1LT0 A;  5IHV A;  2EFX A;  3ZG7 B;  1K6S A;  3TOI A;  2VLG A;  3UN7 A;  3MS6 A;  4E3J A;  1NYM A;  2PR5 A;  2YKF A;  4I3A A;  2XEP A;  3A3F A;  2BG1 A;  3OZH A;  4OQI A;  4P0M A;  2B18 A;  1BLC A;  1HVB A;  3BWL A;  3JVV A;  4JXW A;  3CJM A;  2B02 A;  1ERQ A;  2ZLY A;  4OPR A;  4R4R A;  4NK3 A;  2A24 B;  2JN7 A;  4MCW A;  2WGI A;  4UA7 A;  5MC7 A;  3WS1 A;  2JKR I;  2KOI A;  2VJW A;  1KGG A;  3MKE A;  5AJG A;  4WZ5 A;  3NC8 A;  3SH8 A;  1XJ3 A;  4Q0J A;  3LR0 A;  1NLZ A;  3S7N A;  3LR3 A;  1TD5 A;  4R23 A;  5FAP A;  2P9V A;  4G3K A;  3E98 A;  4R3J A;  1W63 M;  3BY8 A;  4Y15 A;  1PWD A;  3ZVT A;  4Z9Q A;  3CMZ A;  1MPL A;  5D3O A;  5EVI B;  5EVL A;  1XA7 A;  5L10 A;  2J3W A;  2XD1 A;  1G6O A;  4Q0H A;  4NEE D;  4JPM A;  1BYW A;  2HPB A;  5CED A;  1ZC2 A;  2EX8 A;  1W79 A;  5JYP A;  2FFY A;  5CER A;  4Y7P A;  2ZD8 A;  4LV1 A;  1DJB A;  4HIA A;  4LRX C;  3IX3 A;  5BOH A;  4ZTK A;  3F1N A;  5E2H A;  3LUQ A;  1KE3 A;  3C38 A;  1F2K A;  4I38 A;  3DWZ A;  5L09 A;  1P0Z A;  2QJ5 A;  5FEF A;  1H5X A;  5TFQ A;  4FH2 A;  1FR6 A;  4OH0 A;  2DCF A;  4KZ8 A;  5J7E A;  1JTG A;  3UB5 P;  3MBZ A;  4N1X A;  1K4E A;  5DKL A;  2Y2I A;  5TR7 A;  1MC0 A;  1GSW A;  4HOI A;  4QHC A;  4JF5 A;  5EM0 A;  3V5M A;  3IX4 A;  3L7H A;  3Q1F A;  3WRZ A;  1ESU A;  4OQ0 A;  1STZ A;  4S2K A;  1ALQ A;  3MXS A;  4R6L A;  5HPI A;  3GR2 A;  2GNX A;  3BM6 A;  3Q7Z A;  3A3D A;  3T4O A;  5EUA A;  4FTX A;  5HWT A;  4KZ9 A;  3MQO A;  5EVI C;  4MMN A;  3IBJ A;  4QU3 A;  3ZDJ A;  2E8I A;  3IHA A;  4DDS A;  2PBD P;  3HLW A;  2UWX A;  2PU4 A;  5FI7 A;  4DRT A;  1EI5 A;  4XT2 B;  1FIK A;  2HDR A;  2Y4A A;  2R78 A;  2XDM A;  3UE0 A;  2O99 A;  3CWF A;  3MZE A;  1E3U D;  4GZB A;  3F1O A;  3IT9 A;  4CLC B;  4E3L A;  1YMX A;  2AVX A;  1NLY A;  3DTE A;  4HP4 A;  3IHB A;  1OPX A;  4KZB A;  3T4S A;  5FL3 A;  3PBO A;  1PI5 A;  4LCM A;  4ID4 A;  2V2F F;  4IBR A;  2M7V A;  3ZG0 A;  3T1Q B;  1PNE A;  4Y2F A;  1ONH A;  3HJI A;  2ZMV A;  1IYO A;  4IBX A;  4MEZ A;  5CHJ A;  1YT4 A;  4WZ4 A;  1ONG A;  3C4O A;  4UAA A;  4X25 A;  1JWV A;  2V20 A;  1MXO A;  3QP2 A;  3H82 B;  1BUL A;  4DE3 A;  3OCN A;  3IS2 A;  2Y59 A;  3ISG A;  3PBT A;  1K57 A;  1H8Z A;  3ZVW A;  3PBN A;  1H8M A;  3LYX A;  2V0W A;  2HP9 A;  2C6W B;  4X69 A;  3W2Z A;  3T4L A;  1XA1 A;  2GJ3 A;  3C7U A;  3K2N A;  3VP0 A;  4H6J B;  3HLE A;  1YPR A;  4O01 A;  5M1A A;  4X6T A;  5CXW A;  3UDF A;  2WZX A;  3GEC A;  3WS5 A;  4HNB A;  4CLC D;  1FQG A;  1MWU A;  1WA9 A;  3LIC A;  4GCZ A;  2A3U A;  3LID A;  2WKH A;  1OT9 A;  1MWR A;  4HJ3 A;  3LO7 A;  4QJG A;  3IH9 A;  3T4T A;  3NOU C;  5EV0 A;  1CEF A;  4N9L A;  2D02 A;  5A93 A;  4R0Q A;  1LI9 A;  3KSG A;  4RX3 A;  1CF0 A;  3T4K A;  5DVA A;  2WYX A;  1ERO A;  4EEP A;  1I2W A;  2QKP A;  2QYB A;  5FQ9 A;  4I3J A;  4RA7 A;  1RGY A;  2QJ7 A;  3EQU A;  3W8K A;  5IS1 A;  5EVI A;  4GDB A;  2Y2P A;  2ZC6 B;  3E4Q A;  5HWW A;  2Y2G A;  3BFF A;  1T19 A;  5A8B A;  2OSU A;  3LEZ A;  2H0Y A;  2I72 A;  4HH3 A;  2Y2J A;  2XH9 A;  3A3I A;  2XRO A;  1K6R A;  1MZU A;  1TDG A;  2Y2Q A;  3QP1 A;  2Y8H A;  4OOL A;  2INW A;  2J7V A;  3T1S A;  4WL9 A;  2J9P A;  1FCO A;  1K38 A;  2VEA A;  4OLG A;  1LSV A;  3BFE A;  5HDS A;  2V9A A;  3JYI A;  1XGJ A;  5KSH A;  2L4R A;  5HL1 A;  4PMA A;  3KSF A;  4OP5 A;  2ZC7 A;  4HH2 A;  4MDZ A;  3GTC A;  4CPK A;  2P74 A;  5CGS A;  2HGV A;  3LEQ A;  4HES A;  5M19 A;  3T4Q A;  3MF0 A;  1K0K A;  3G34 A;  3MQQ A;  3W4O A;  1MKI A;  1HD8 A;  4EU0 A;  3WS0 A;  1JTD A;  2Q9N A;  5EE8 A;  2Y2K A;  1XX2 A;  4OOM A;  5HDD A;  3LY4 A;  2JCH A;  1PIO A;  4GJ4 A;  3CUE C;  1TS8 A;  1K56 A;  2W1T A;  1K57 C;  3UO9 A;  1S4R A;  2UV0 E;  1GA0 A;  3KSI A;  4GNU A;  3JVU A;  3FZC A;  3Q7V B;  2PYP A;  3FWL A;  3VP4 A;  3SS5 A;  1DJC A;  3UPN A;  5J8X A;  1PI4 A;  1P9R A;  3HLC A;  1ESI A;  1FR1 A;  4KQQ A;  2OAP 1;  1SKO A;  3R7W A;  2P7J A;  1CJF A;  2XGN A;  3IXD A;  2JKG A;  1TS0 A;  3OPR A;  2P08 A;  1SDN A;  2R9W A;  4R38 A;  1HLU P;  1XGI A;  4Y17 A;  2LB5 A;  5E2E A;  5FQQ A;  2B95 A;  3BEC A;  3H7W B;  3VSK A;  1Z09 A;  4EER A;  1N9L A;  1K55 C;  2ZQC A;  3EOI A;  1IKG A;  5HAP A;  3UB6 A;  3TSG A;  1ZG4 A;  4EET B;  3UMD A;  4WYY A;  4L9E A;  4JGP A;  3N8S A;  1L3L A;  4HEF A;  3G31 A;  2FFF B;  1CK3 A;  2H10 A;  4WUJ A;  4KEN B;  4WMC D;  3B33 A;  3HLG A;  2V8F A;  3LFV A;  3A3E A;  2EFU A;  5CRF A;  4NXF A;  4WZ5 C;  3N4I A;  4PM5 A;  3EEH A;  3U2A A;  3G2Y A;  3RXW A;  5K5B A;  4Y13 A;  5DF9 A;  3A3J A;  4HP9 A;  5DFY A;  2XQZ A;  3EEA A;  3IF5 A;  2J8Y A;  1NZU A;  3AGF A;  2Y91 A;  4LPZ A;  4S2P A;  1Y28 A;  5FQI A;  5CX7 A;  4MBK A;  1BLP A;  3ZGA B;  3V3S A;  2FZ0 A;  3IXG A;  2WGW B;  2PT7 A;  2J9O A;  1VET A;  5HW3 A;  3BFC A;  4YOF A;  1NYY A;  3W4P A;  3SOI A;  2K31 A;  2QMI A;  2HV1 A;  3RTY A;  4ZBE A;  3HVF A;  1DP6 A;  4WM9 A;  3UDI A;  4OPZ A;  2W3E A;  3LIA A;  4BL3 A;  2ZQ7 A;  4HJ6 A;  3CPT A;  4K08 A;  3IXB A;  3E4P A;  1RP5 A;  3LR4 A;  4BLM A;  2NUP C;  3HUM A;  2XFS A;  1PFL A;  3T4J A;  5GL9 A;  3T12 B;  1DRM A;  3TRC A;  4EW7 A;  2KLI A;  3KSH A;  4PM9 A;  4EWF A;  2HJE A;  1NRJ A;  1XJ6 A;  2G2W A;  1NZO A;  1ZTU A;  4JXS A;  2GDN A;  4Y0O A;  3OBF A;  4EQ1 A;  3QNC A;  1S67 L;  3I7J A;  1EWZ A;  3VOZ A;  3ZNY A;  5L8M A;  3DTM A;  3QHY A;  2B5R A;  3C2W A;  3KYQ A;  1N4O A;  5FDH A;  1OTI A;  1D1J A;  5HDC A;  3ZHH A;  2W0N A;  2Y2N A;  3OOV A;  1UWN X;  4R3A A;  4UEY A;  4KG5 A;  4XT2 A;  3N7W A;  4XUX A;  5TBM A;  4NXB A;  4B4Z A;  5FA7 A;  5DKK A;  3C4P A;  3P09 A;  1HTZ A;  3M6H A;  5DF7 A;  3DBA A;  5A90 A;  4HQA A;  4HHD A;  1IFQ A;  1L0E A;  4ZJ2 A;  2PR6 A;  1S1Z A;  3LGO A;  1BLH A;  2JKT I;  2ZMF A;  3PYP A;  1XP4 A;  2J3T D;  3FKV A;  3HCY A;  3LY3 A;  1V9Z A;  4JGQ A;  4RVA A;  4R70 A;  1AWI A;  3P98 A;  3D3O A;  1K54 C;  3M2K A;  4JF4 A;  2G2U A;  3B3X A;  5FAQ A;  3O3V A;  3HLD A;  1WYB A;  3VFH A;  4WEL A;  1IKI A;  3IH8 A;  3VP3 A;  3KYE A;  4D60 A;  3DTK A;  2WKR A;  3HUN A;  3G6O A;  4NXE A;  4GS9 A;  4IUK A;  4ME4 A;  1KVM A;  3FKW A;  4YIN A;  2D01 A;  2A2L A;  1KVL A;  2A49 A;  2KDK A;  5FAO A;  2QWS A;  2BLS A;  3S4X A;  3ZG9 B;  4DF6 A;  4LFU A;  3H9W A;  2OWH A;  4B93 A;  3BLM A;  2XSS A;  3QP4 A;  5F1F A;  5G18 A;  4UA9 A;  2XR0 A;  4F94 A;  1KGE A;  1IEL A;  4E3O A;  3UDX A;  3RH8 B;  4UQI S;  2KX6 A;  2ZQ9 A;  1FCM A;  4IUH A;  5L2F A;  3HJK A;  2JHE A;  5GLC A;  5C5K A;  2P9V B;  5HD3 A;  2VGJ A;  5L07 A;  2RL3 A;  5HAR A;  1W8Y A;  2O9B A;  4GHI B;  1YM1 A;  3GSG A;  1M40 A;  3O88 A;  5HZH A;  1YLY A;  3NIA A;  3PR6 A;  4Y5F A;  2V1B A;  5EOO A;  2WGW A;  5CGX A;  1E25 A;  2L1M A;  2ZM8 A;  2W1T B;  2Y2L A;  3T1X A;  3T50 A;  5AVE A;  3CZD A;  4NKP A;  1LL8 A;  4K91 A;  3PHY A;  5I5L A;  2C5W B;  4BBT A;  1TEM A;  1YLZ A;  1L0G A;  3KYZ A;  3DW0 A;  3MQ0 A;  4GDN A;  2JKF A;  4JGO A;  2YKH A;  4KUK A;  3VP1 A;  4YWZ A;  5DJT A;  3MR0 A;  3O87 A;  1MY8 A;  3B47 A;  1XJ2 A;  4H6J A;  3WS2 A;  4S2I A;  3DTI A;  1ZHH B;  1RCJ A;  5F68 A;  2ZM2 A;  5FI6 A;  4FUW A;  2X01 A;  4WN5 A;  1N9B A;  3TE8 A;  3W4Q A;  2Y2O A;  5KMW A;  2J3T C;  2CC1 A;  1ACF A;  1ODV A;  2WKQ A;  1LI0 A;  1YSP A;  1PWG A;  4Z1W A;  4P6B A;  5FQK A;  4EQI A;  3BRM A;  3A0S A;  3BJN A;  4KUO A;  1QME A;  3N8R A;  3G30 A;  5DTK A;  4ARZ A;  4BMW A;  3NI9 A;  1JNU A;  1AXB A;  3BQA A;  4MN6 A;  1LSW A;  4KQO A;  1TF1 A;  1SCW A;  4DMZ A;  1L2S A;  4I39 A;  4OQH A;  1W63 Q;  3IF6 C;  2V8C A;  5DJU A;  5FEG A;  1OJG A;  1BZA A;  2O9C A;  4IVK A;  4E6X A;  2XRN A;  5EM1 A;  4KZ3 A;  4ESP A;  3CG5 A;  4CLC E;  4P6Z S;  3NJA A;  5A92 A;  4BL2 A;  4S2N C;  1S66 L;  1NWZ A;  3TW8 A;  4KG6 A;  1KDS A;  4EXO A;  3RJU A;  1F98 A;  1JWP A;  4PPR A;  3NDE A;  3V67 A;  2EXA A;  1L0D A;  1TVF A;  3NOT C;  5CHM A;  4PKY A;  5HAQ A;  3PAE A;  2ZQD A;  4P87 A;  1YQS A;  4QY5 A;  2VV7 A;  3E2L A;  3VE3 A;  1P9W A;  1GHI A;  1G28 A;  4F3L B;  4O8G A;  2VGK A;  3VFF A;  3IBR A;  4A5R A;  3CAX A;  4R3B A;  2XA7 S;  2WKI A;  3PXP A;  3A0V A;  4N1H A;  3UY6 A;  1JWZ A;  4R4S A;  3QP5 A;  5GHZ A;  4HBU A;  5FQJ A;  3NOP C;  1OTD A;  5GLD A;  1FCN A;  3ZFZ A;  2MJ6 A;  5F5Y A;  3B42 A;  3MJQ A;  2ZQA A;  3L9K A;  5F82 A;  4RYE A;  4PM7 A;  1SZV A;  1ES5 A;  1N9O A;  3FV7 A;  4OP8 A;  4GD6 A;  4DE0 A;  3A0R A;  3ITB A;  3DAV A;  2ZQ8 A;  1G68 A;  2HJ9 C;  3PBS A;  1PRQ A;  4DJ3 A;  2EX9 A;  4KZ7 A;  4JXG A;  3NEC A;  4OOY A;  4JBF A;  3IWI A;  3H7W A;  4DN0 A;  3AGD A;  3MXR A;  2CMN A;  4EBN A;  2QZ6 A;  4LCL A;  4QY6 A;  5G4Y A;  3ZQ5 A;  2I9V A;  1O07 A;  3LCE A;  4WEK A;  4Y3I A;  4O0P A;  4CJN A;  3CPT B;  4DKI A;  3SW1 A;  3S1Y A;  3VOL A;  4XXR A;  2ZL1 B;  3CIT A;  1DP8 A;  1YLT A;  3WWX A;  4OQG A;  2OOL A;  2W1R A;  4X68 A;  1UWP X;  4ETZ A;  2H5S A;  4KZA A;  1V9Y A;  2XD5 A;  3SZT A;  4WMC A;  4HBT A;  4B9O A;  1O7E A;  1DJA A;  5HFO A;  4S2J A;  3ZYT A;  2Z6D A;  1BLS A;  4LGW A;  2WUQ A;  4LRY C;  5DF8 A;  2VGL S;  1GHP A;  5GLA A;  3IS2 B;  4R1G A;  2JE5 A;  2VV6 A;  4X1M A;  1Y4O A;  4KZ6 A;  5F1G A;  5HL6 A;  4MBF A;  4E3K A;  2WK0 A;  1OT6 A;  5AQ9 A;  3D4F A;  5JYO A;  4IJG A;  5AQ7 A;  5IU1 A;  4BBV A;  5CTN A;  5FDS A;  4PM8 A;  2Y2H A;  5F83 A;  1IYS A;  1CQA A;  4EES A;  3MMH A;  1PW8 A;  4XUZ A;  3CUE A;  4X1L A;  3SH9 A;  5IT5 A;  1M6K A;  4EUV A;  4GKU A;  1VQQ A;  5GLB A;  3N8L A;  3NCK A;  2EX2 A;  4BD0 A;  5AQA A;  2EA9 A;  1MWT A;  5FSR A;  3T1R A;  2Z2M B;  4RQ9 A;  1Y54 A;  4WF0 A;  2ZBB A;  1PZO A;  1F5M A;  3WS4 A;  4B88 A;  3BLS A;  3ICY A;  3UNW A;  4C3Q A;  4QD4 A;  4DE2 A;  2GZA A;  2HDS A;  2EXB A;  1XPB A;  4NET A;  5CTM A;  1K55 A;  3U4L P;  4S2L A;  4GN2 A;  1D7E A;  4FCF A;  2OWJ A;  4S2M A;  4MN7 A;  1VB6 A;  1H3Q A;  3HL9 A;  1Q2Q A;  2ZC4 B;  5CGW A;  1BT5 A;  3C5A A;  2JKR M;  4KZ5 A;  4JLF A;  3P7N A;  2HDU A;  2X71 A;  2ZOH A;  1HZO A;  1PW1 A;  4LRZ E;  2R9X A;  3VOY A;  3IF6 B;  2PBY A;  2IWD A;  4DDY A;  3MZF A;  4OVD A;  2BTF P;  1YAX A;  3BW6 A;  3SS4 A;  3BEB A;  3C8C A;  2W3D A;  4GLQ A;  3HUO A;  4BD1 A;  3C30 A;  4HI4 A;  4GD8 A;  4CLC C;  3S7Q A;  5GHY A;  4WLA A;  1J3W A;  3MKF A;  3UB9 A;  1TS6 A;  3QNB A;  4OKP A;  4BWI A;  1GCE A;  4MLL A;  2WAF A;  4FOF A;  5F6A A;  4GW9 A;  4ZAM A;  4QPR A;  4K0W A; 
#chains in the Genus database with same CATH homology
 3LEQ A;  3T1R A;  2JKG A;  2PBD P;  2PRF A;  4FUW A;  3UB5 P;  1VET A;  2PAV P;  2ACG A;  2VK3 A;  5FDS A;  3T1X A;  4QWO A;  1K0K A;  1CQA A;  4X25 A;  1G5U A;  1FIK A;  1AWI A;  3DAV A;  3MS6 A;  3NUL A;  1J3W A;  1HLU P;  4X1L A;  5EM0 A;  3T1Q B;  1PFL A;  1ACF A;  4X1M A;  1VEU A;  5EM1 A;  1SKO B;  3D9Y A;  3T12 B;  1F2K A;  1Y4O A;  3L9K A;  2B95 A;  1PRQ A;  2ZL1 A;  1YPR A;  2V8F A;  5FEF A;  5EV0 A;  2V8C A;  3CPT B;  1VET B;  1Z09 A;  3MSH A;  1PNE A;  2BTF P;  2E8J A;  1D1J A;  1A0K A;  3NEC A;  4FTX A;  1FIL A;  3KYE A;  3L7H A;  3LGO A;  1SZV A;  5EVE A;  4D60 A;  5FEG A;  1SKO A;  2JKF A;  1CJF A;  1VEU B;  3CPT A;  3U4L P;  1CF0 A;  3CHW P;  3T1S A;  2HZ5 A;  2ZL1 B;  4ESP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...