3T1XA

Mglb r124a e127a monomer
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
134
structure length
134
Chain Sequence
LVLYGAPYERAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVASNAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKAAAAALARIAEEALAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Gliding protein MglB
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 31
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3t1xA00
1F2KA 3CPTA 1A0KA 2VK3A 3T1QB 1PFLA 2PRFA 3NECA 2PAVP 1YPRA 4ESPA 2V8FA 2JKGA 4QWOA 2HZ5A 4X1LA 2ACGA 3D9YA 4FTXA 5FDSA 2BTFP 1FIKA 1SZVA 1VETB 1D1JA 1SKOB 2PBDP 2V8CA 3UB5P 1HLUP 1PRQA 3LGOA 3KYEA 3T1XA 1K0KA 3L9KA 1Y4OA 2ZL1B 3T12B 3L7HA 1VETA 3T1SA 5EM1A 1VEUB 1PNEA 4X25A 2JKFA 3NULA 3T1RA 3MSHA 2B95A 1CF0A 1J3WA 1CJFA 1FILA 3U4LP 3CHWP 5FEGA 1Z09A 1SKOA 1AWIA 4X1MA 3DAVA 1G5UA 5EV0A 4D60A 2ZL1A 4FUWA 1CQAA 3CPTB 1ACFA 3LEQA 3MS6A 5FEFA 2E8JA 1VEUA 5EM0A 5EVEA
chains in the Genus database with same CATH superfamily
2O99A 1Y28A 3FC7A 2PRFA 4PM8A 1W7FA 4KQDA 5CEDA 2EX2A 2QYBA 3B47A 3G34A 3BQ8A 4X1LA 3GTCA 1BSGA 4LFUA 2PD7A 5HAIA 1K55C 2CMNA 3D4FA 1SHVA 1E3UD 1S0WA 5F1FA 5M19A 3HLDA 1S1ZA 4KZ4A 3BM6A 3SS5A 5TJJA 4KZ5A 1Y4OA 4MBKA 3W2ZA 5G4YA 3GQZA 1RCJA 5CHUA 4S2NC 1YLPA 2JKRM 3VFHA 4GZBA 5DTKA 3HLWA 3OLOA 2HDSA 4LV3A 4QU3A 2ZQ9A 3C4OA 1JTDA 2HJ9C 1BUEA 1C3BA 3OCNA 5U47A 5AVFA 3G4PA 5CERA 2UWXA 3E2KA 3OBFA 2H0TA 4GB7A 4RX3A 1J3WA 2Y2IA 3OPRA 4QY5A 1SKOA 3EOIA 5J7EA 2PDRA 5CHMA 2Y8HA 5TBMA 3VMAA 3DTMA 1MXOA 2EX8A 4BENA 3VOLA 1CQAA 1KDWA 2VJWA 3ZNTA 3V5MA 1GHIA 4OPQA 4II7A 3T50A 3LI8A 3PBQA 3BFGA 4LGWA 2W0NA 3K3CA 3CPTA 2HJEA 3UDXA 4HY8A 4X56A 4OOMA 4MNRA 5CGXA 1IKGA 5FI6A 4F3LB 1OTAA 3MZFA 5HD3A 4DE2A 2K31A 3G30A 5CGSA 4MN5A 3ZCZA 4IJGA 1S1YA 1PZPA 1MC0A 5DKKA 4MEZA 5FL3A 3IS2B 1PRQA 2PR5A 4ZTKA 5FASA 1SDEA 1PWCA 1UWPX 1DRMA 3B33A 3MXSA 4Z1WA 1K54A 2VGLS 2ZC7A 3PYPA 4GN2A 4IEDA 3N8RA 1PWGA 1YLZA 3JVUA 1KGGA 4JF4A 1D06A 5FATA 4Y0OA 4EV4A 2X02A 3V67A 4Y5FA 3IF6B 1MBLA 1Y54A 3IH8A 4GKUA 1PNEA 1GSVA 3LR3A 1ZG6A 3PBTA 1OJGA 1XP4A 2FFYA 1CJFA 1L2SA 4EEPA 3SH7A 3M6HA 4HJ6A 5TR7A 1AWIA 3SS3A 3PBRA 2LB5A 1NWZA 4MN7A 2XFSA 3F1OB 3LCEA 3S7QA 4D60A 5EVIC 1L0FA 4EUZA 1YAXA 2PBYA 1XX2A 3SH9A 4QB8A 2O9CA 3VP3A 4CQHA 2HPBA 1FCMA 4WEJA 4UQIS 3FYZA 3C4PA 3BFCA 1H5XA 3C2WA 5A8BA 3WS1A 4NXFA 1UGUA 4B4ZA 2V20A 3H9WA 2V0UA 4OKPA 1XGJA 3BFDA 2XH9A 4LRXC 4R1GA 1YSPA 4KZ3A 5DFXA 3WS4A 1KVMA 1SZVA 4IUKA 5F82A 4E3LA 1Q2PA 1RGYA 4Y0UA 4QHCA 5DF9A 2EFXA 5GLAA 3LYXA 2VV7A 1VETA 4H6JB 2EWWA 2XA7S 1ERQA 3UNWA 1XXMA 4Y13A 3Q7VA 5F83A 5HWVA 2ZC3B 3QP6A 5TGFA 3NY4A 1K4FA 4R23A 2ZM0A 2WKQA 4E04A 4LV2A 3MR0A 1G28A 1T1CA 4HOIA 1FR1A 3R7WB 4CLCB 1DY6A 1XGIA 5C5KA 3DTIA 5FI7A 3ISGA 2Z6CA 3FV7A 1LSWA 1CI9A 4LPZA 4GD6A 3BY8A 4GS9B 1MWSA 4NK3A 4WZ5C 2FZ0A 4KQRA 4X55A 1MPLA 3V50A 3QHYA 1XJ2A 2Y2QA 1PW8A 4Q0IA 1FOFA 3A0RA 5FI2A 2VZWA 2VGJA 3WS5A 1N9NA 2VGLM 4E6XA 4GHIB 2J8YA 5A93A 4WM9A 1PFLA 3W4QA 2J9PA 2VX8A 2ZQCA 4X53A 4QD4A 3HLEA 3V3RA 5EOEA 4S2IA 3CWFA 2BTFP 1IOUA 5CTNA 2WK0A 3QNBA 3PBSA 2NUTC 1JWVA 5HDCA 1PI5A 4LRZE 4WMCA 3IWIA 5AQ9A 3UPPA 1OTDA 4OLGA 1ONGA 2PD8A 4JGRA 3C7UA 3MZDA 3BLMA 4R3JA 5K5BA 3T1SA 1XA1A 4R38A 3IXHA 1TS0A 1NY0A 4FSFA 4P6BA 5HDSA 4YWZA 4XT2B 1Z6FA 4F3LA 3MSHA 1T1AA 4O01A 3HREA 4UA6A 4DXCA 4EU0A 4BBVA 2W3FA 5HWTA 4HH3A 3IS2A 5FSRA 4KENB 5I5LA 3BRMA 3HLGA 5KSCA 3BY9A 4N9LA 5FDHA 4DRTA 4IUHA 2VGKA 3EQVA 4OP8A 2IWDA 3ZYTA 1H8YA 1BLPA 3AGFA 4Y7PA 2B18A 4IVKA 5DTTA 3BQAA 5L2FA 4HI4A 3CPTB 2Y2KA 1SCWA 2QHKA 3IF6A 3GECA 1SDNA 4R0QA 4OPZA 3NIAA 4EBNA 3T4JA 3VE3A 2JKTI 3OOVA 3HLFA 4U0TA 1IFQA 2D01A 1N4OA 2XA7M 2W3EA 1OTIA 4MMNA 5D3OA 2WKHA 3LUQA 2K7SA 3E98A 5F69A 2JKGA 4OPRA 3F1OA 3MQ0A 4YINA 3ZNYA 1N9BA 3GR2A 3SH8A 2PHYA 1FIKA 1KOUA 1IEMA 2R9XA 2WGWA 4IVIA 2R78A 4G3WA 4PM5A 3LR0A 3IX3A 3A3EA 5HZHA 2L0WA 2ZM2A 2P74A 1PIOA 5M18A 5HD5A 4DE1A 1RP5A 3CLOA 2Y91A 4K0XA 4NETA 4RVAA 3DWKA 3I7JA 3M6BA 3N8SA 3WWXA 5GLCA 2W1TB 4KG6A 3H82B 3OCLA 2E8IA 5FEGA 2HP5A 2WZXA 3MXQA 3R4KA 1MY8A 2GZAA 1XJ3A 3NDEA 3P98A 4HBUA 1O07A 4GNUA 4N9KA 3KSFA 1LI0A 4H6JA 2Y2PA 1K57A 4HBTA 4FD8A 2WAEA 4P0MA 3MS6A 3Q82A 4BD0A 4BQMA 3RXWA 2FFFB 5EM0A 2VA0A 1O7EA 3ZVWA 3VSKA 4ZBEA 4QPRA 2HDQA 3VSLA 3NECA 5AQ7A 4PM9A 2J9OA 1ESUA 1OTEA 4HQAA 4QWOA 2L4RA 3UO9A 4C75A 1FR6A 3S7PA 4Q0JA 1FCNA 1VETB 4GS9A 5EVID 1G68A 3H7WB 4ZJ1A 3N6IA 4R3BA 4GDNA 1TVFA 3O88A 4OVDA 1K0KA 5HW3A 4FCFA 5EPHA 3LR5A 1ZC2A 3Q7VB 2OWHA 1G6OA 3TRCA 3MBZA 3Q7ZA 3G32A 1K4EA 4WUJA 4R4RA 4GHIA 2WKPA 5CHJA 1ODVA 1VEUB 3DTKA 4I3IA 3BECA 3T1RA 1K55A 1BLCA 3NOTC 4A5RA 4X6TA 1YSQA 3A3FA 3CUEA 2C6WB 1K38A 1ERMA 4KZBA 3F1PB 1BZAA 5CTMA 2Y2NA 3IXDA 3GV9A 4H8RA 4I3JA 4ZJ3A 5FQKA 5AVEA 4OP5A 4Y3IA 4BJPA 1JNUA 1EI5A 2P04A 2Y79A 2XGNA 3KYQA 4XT2A 3MF0A 1ONHA 3U2AA 3ZG7B 1VHMA 3DBAA 3BJNA 2XK1A 5IT5A 3P7NA 1M40A 3A3IA 3IX8A 1OT6A 3T4LA 1KGFA 3T1QB 1IYQA 2QWSA 1IYSA 3HUNA 2H0YA 1IYOA 1XJ4A 4K08A 4WF0A 1K56D 5JYPA 1TD5A 1ES2A 4MBFA 1CI8A 2D02A 1ZTUA 4L9FA 5GHZA 4Y15A 3IWQA 4Y0TA 2JE5A 2LB9A 5HL1A 1KGEA 2J80A 2WKRA 3HJKA 1NXYA 3NHQA 2HF6A 3GMWA 3EWKA 4KZ9A 4OOYA 2A2LA 1OTBA 1YLJA 1S66L 2H28A 2GDNA 5M1AA 1WA9A 3LIEA 1EWZA 3BEBA 4ARZB 5CXWA 3VE4A 1JTGA 3MQQA 2X01A 3P09A 1HTZA 3CITA 3CHWP 2DCFA 4O0PA 4LV1A 2FH5A 3TJZC 2G2UA 5G4ZA 5A92A 3F1NA 1K54C 1IYPA 4OQ0A 3E4PA 5EUAA 5F68A 3BW6A 2VKSA 4GDBA 5E2HA 3VV4A 5HAQA 4UEYA 3Q81A 5FAOA 5HARA 1F5MA 1GA0A 5KMWA 4UAAA 2J7VA 3KSHA 3S1YA 4DMZA 3UE0A 2W1TA 1TDLA 3H82A 4EBPA 2WGWB 4FOFA 4LLOB 2VV6A 3SZTA 2A3UA 2ACGA 2XQZA 2EXBA 1PW1A 4NXGA 1DJCA 1Q2QA 1FSYA 1YM1A 2CC1A 2Z2MB 3VP2A 3S7NA 4O7DA 1OMEA 2W3DA 2ZL1B 4NEED 2PYPA 1H3QA 3ULFA 5FQQA 2WGIA 1MKIA 1E3UA 4C6YA 4BBTA 1KE4A 3N7WA 4BLMA 2H5SA 1GA9A 5FQIA 4GCZA 4I39A 4KZ8A 4I38A 4KUOA 5L8MA 1YMXA 2B95A 4JBFA 2WKEA 3EGDC 3E0YA 1L0EA 2BG1A 2DMWA 4DF6A 1Z09A 3GSGA 3H7WA 2GJ3A 4IBRA 2VV8A 4BMWA 3LIDA 4E6WA 2EFUA 4WBGA 5EV0A 1L0GA 3HVFA 2OAQ1 3UB8A 3LIAA 4S2LA 4OQHA 4F94A 4FUWA 4RA7A 3MFDA 4UA7A 5I94A 3B3XA 1VEUA 2Y2GA 4OQGA 3AGDA 1EROA 2IA2A 2ZQAA 1GCEA 1A0KA 2OLVA 4MLLA 3G31A 4EW7A 2KX6A 2P9VB 1JVJA 5BOHA 5MC7A 4N92A 2O9BA 3F1PA 1I5QA 1TS6A 4WYYA 3G35A 1U60A 2M1CA 3RTYA 1I2SA 4BWIA 2G7UA 1YKDA 1HVBA 1HLUP 3PBNA 4HEFA 5HPFA 2ZBBA 2KOIA 3WS2A 1QMEA 5DKLA 3ZG0A 2QZ6A 4JGOA 3T12B 4JF6A 4OQIA 4XUZA 3EEHA 5KZHA 2Y2OA 4JLFA 2Y2HA 3SW1A 1W63Q 2V1ZA 3NBLA 2GX5A 5FQJA 3Q07A 1T18A 5GL9A 2XROA 3MKEA 2Y2LA 3UMDA 4AFIA 2WZZA 2ZC6B 4G3VA 5CEBA 1LHYA 1MWUA 4JPMA 2VLGA 3SS4A 4DDSA 4CLCD 3LICA 3BFFA 2ZQDA 1NYMA 3A0VA 2JBFA 3ZHHA 1CEGA 3UDFA 4EBLA 4DKIA 4HP9A 3V39A 5HWWA 2B5RA 4EUVA 1YMSA 3A3JA 3ZFZA 4UQIM 3IF5A 4MN6A 3RXXA 2EXAA 1KVLA 2E8JA 4ARZA 2MJ6A 3T4OA 3O5YA 2EX6A 3VP0A 3MFXA 3UMEA 1HD8A 3EEAA 2QKPA 2EWVA 2Q9MA 1F9IA 3LIBA 1W8QA 1VB6A 1YT4A 5L07A 3VP4A 4X68A 1X0OA 1PYYA 1BYWA 5FQ9A 3IWOA 2ZLYA 2ZMAA 1TDGA 2W1RA 3CJMA 4OLDA 3MXRA 2Y2JA 2ZOIA 3AGEA 5F5YA 4EQIA 2B02A 2XD5A 3NI9A 3ZVTA 3MKFA 4ID4A 4I3AA 1ALQA 2ZOHA 2WUQA 3UE3A 2IWBA 3CMZA 4ME4A 2W3HA 5EE8A 3NC8A 4E3MA 1WYBA 1AXBA 2JKFA 2ZC5B 1H8ZA 3QP5A 3F1NB 1NRJA 1MWRA 2R9WA 4K91A 4X69A 1D7EA 5A91A 4JGQA 1E25A 2A49A 4Y17A 4JXGA 3C8CA 4MBHA 4ZAMA 4B93A 2O0YA 5DVAA 4KQQA 4P6ZS 1T19A 2C5WB 1CEFA 2ZL1A 4Q0HA 1KE0A 3O3VA 4UHUA 2WADA 2QJ5A 3Q1FA 4HIAA 4N1HA 5E2FA 3UPOA 4FH4A 3PTEA 1FQGA 1XFQA 3BFEA 3EGXC 4NG2A 2Y4AA 1S67L 5EVIB 2DRWA 1BLSA 5CECA 3UDIA 3C38A 3M2JA 1XJ6A 4ZJ2A 5DTSA 3S22A 3TE8A 4G3KA 3KO6A 1VM1A 3IQAA 1V9YA 1LLBA 2Y2MA 1K6RA 2HZ5A 2V2FF 4CJNA 1JWPA 3C7VA 4R6LA 3HLBA 3ZQ5A 3HLCA 3UE1A 5HPIA 1W79A 3IHAA 5EFWA 3ZG8B 5L10A 1UWNX 2H10A 3IXGA 3T1XA 4JGPA 4BL2A 3B42A 4EWFA 3DTEA 5HDDA 5F6AA 3SOIA 5CRFA 1SKFA 4CLCC 2JKTM 1BTLA 2V9AA 2ZC4B 3N4IA 2QMIA 3G2YA 3EQUA 4KZAA 2P9VA 1P9RA 4OOLA 1HZOA 2INWA 1QMFA 1CF0A 2HP6A 3OC2A 3UB6A 2YKFA 1PZOA 2QJ7A 4YNRA 2M7VA 4PHTA 4LCMA 3HJIA 1GSXA 4U3TA 5FA7A 5DF8A 1S4RA 2XRNA 3BWLA 5J4EA 2I72A 3FWLA 3LO7A 3S4XA 3CG5A 4RX2A 4HH2A 3N8LA 1E4DA 3W4OA 4RYEA 5EVEA 4KG2A 3HUOA 3LR4A 4WN5A 2BASA 3CUEC 4S2NA 4S2MA 4JKTA 2RL3A 3IX4A 4NXBA 2PU2A 1NZUA 5GHXA 1K25A 2YKHA 3FKVA 3O86A 2ZQ7A 1J9MA 2RCXA 3OPLA 1XKZA 2JHEA 4QJGA 1WE4A 4HJ4A 5GLBA 4M3KA 4P87A 1LSVA 1D1JA 2PBDP 3FPVA 4JXVA 1W5DA 3UB7A 1LI9A 4EEUA 2ZMFA 3NOUC 3ZG5A 5DJUA 1S6RA 4ETXA 4BBUA 4P6ZM 5EECA 5FQMA 1DP8A 4EQ1A 4C3QA 4EERA 5EM1A 4L0LA 3VOYA 2JC7A 1ES3A 2GNXA 2J3TD 2IWCA 1S4SA 5J8XA 2Q9NA 1YLTA 4NKPA 4HHDA 1TS8A 2WYXA 4B9OA 4X1MA 1W8YA 3DAVA 5AQAA 1YQSA 1P0ZA 2JN7A 3PAEA 1KDSA 4R3AA 2I9VA 1GSWA 4EESA 1ES4A 3ITBA 3KSGA 4I5SA 4LRYC 3QP1A 3OZHA 4HP4A 3KYZA 3T4TA 4LENA 3BLSA 2WAFA 3MMHA 2X71A 4LV0A 1YLWA 3E4QA 1PI4A 4DDYA 3CZDA 1BLHA 4O8GA 2VK3A 1KE3A 3W8KA 3FG8A 3FKWA 2PAVP 3TG9A 4WMCD 1ZG4A 4P85A 1DJBA 5IS1A 2Z2LB 4XXRA 2ZJ9A 5IHVA 1DP6A 3UE6A 1LT0A 3LY4A 3HCYA 4JXSA 4S2KA 3LGOA 3A0SA 2PR6A 3KYEA 4ETZA 5E43A 3IH9A 4L9GA 5EVIA 3WRZA 2P7JA 4N1XA 3GDIA 1N9OA 4BL3A 3ICYA 2JCHA 5HFOA 1NYYA 3S7OA 1ES5A 4E3KA 2A24B 3NULA 3LY3A 2PT7A 3K2NA 1ZKJA 5DF7A 4B88A 3MZEA 3FZCA 3TW8A 1TF1A 1M6KA 4WEKA 5J3WA 1MWTA 1H8MA 3ZG9B 3T4SA 3IBRA 2BLSA 1G5UA 4RQ9A 3PR6A 3WS0A 3VOZA 4PPRA 3PBOA 1ACFA 4HNBA 1F98A 1STZA 1V9ZA 4Y2FA 1GHMA 5F1GA 5HL6A 2XR0A 5G18A 4YOFA 3CI6A 4PKYA 2HDUA 1TS7A 1MKMA 4YFMA 3E4OA 3E2LA 1IELA 2VEAA 3HBRA 4GLQA 2PU4A 2HDRA 5FAPA 4NXEA 3W4PA 4ESPA 4D2OA 4EXOA 2PYRA 4S2OA 4OH0A 1DJAA 4IBXA 2J3WA 5EVLA 4IHQA 4Q8IA 1JWZA 3VFFA 1IKIA 3HUMA 3UB5P 4GW9A 1K56A 1RGZA 2V1AA 1G6AA 2J3TC 2WKIA 5DFYA 4JF5A 2XFTA 4FH2A 3L7HA 4CLCE 1LL9A 3IT9A 2QPNA 4WZ5A 5GHYA 3IXBA 2OAP1 3UY6A 3G2ZA 4S2JA 2OSUA 4X25A 2V0WA 3JPUA 2XF3A 5HX9A 2XD1A 3KX0X 4KG5A 5HAPA 3DW0A 5L09A 2ZQ8A 3T4QA 2WGVA 4QY6A 3BYDA 3GRJA 4KQOA 4MDZA 4R70A 2OV5A 4UA9A 3TOIA 3LEQA 3K3DA 3CAXA 2EA9A 5AJGA 4DE0A 4ZDXA 4WL9A 1F2KA 3TSGA 2XDMA 3G6OA 1NZOA 4Z9QA 4XUXA 5EOOA 1FCOA 4MCWA 5E2GA 2OOLA 3UN7A 1LL5A 3T4KA 1GHPA 1YPRA 3FPWA 3PHYA 1NLZA 4FTXA 2UV0E 5FDSA 3LFVA 1P9WA 5HSQA 3NOPC 2M7UA 4JXWA 3IHBA 3MQOA 2KDKA 1SKOB 2V8CA 2OLUA 1I2WA 2XEPA 5TBMB 3IBJA 5CGWA 2Z6DA 5KIZA 1W63M 2ZM8A 3QP4A 5JYOA 3PXPA 1N9LA 3V3SA 2K2NA 2ZD8A 5GLDA 1VQQA 3QNCA 1BULA 3RH8B 4E3JA 4OPYA 1NJ4A 4DE3A 3LIFA 4WELA 3IF6C 2Y59A 1L0DA 3DWZA 3A3DA 2Y55A 3UB9A 4OONA 1PWDA 3LEZA 4S2PA 1WYCA 4U0XA 4HESA 1XA7A 1K6SA 2XSSA 1OJ5A 4B4XA 1BT5A 3P01A 4PM6A 5E2EA 2V1BA 3JYIA 2OWJA 3VP1A 3NDGA 3RFBA 4E3OA 2KLIA 3ZDJA 5FAQA 3NJAA 5A90A 1LSXA 4M4XA 4CPKA 3OPPA 4WLAA 1OPXA 5KSHA 4EETB 2A24A 4PMAA 3D3OA 3C30A 3MJQA 4PM7A 2NUPC 1H0MA 3M2KA 2L1MA 3WRTA 1TEMA 3O87A 2V8FA 3D9YA 4KZ7A 4DJ3A 1P97A 2JKRI 4LCLA 2P08A 4KUKA 1OT9A 1FSWA 4PAUA 3JVVA 5AQBA 5DJTA 2O9AA 4HJ3A 4BD1A 2EX9A 3KSIA 4WZ4A 4ZRRA 3GVBA 1XFNA 3PAGA 4DXBA 3L9KA 2W3GA 2XLNA 3QP8A 4DJ2A 3OPHA 3ITAA 2ZMVA 3NCKA 1CK3A 4L9EA 1K57C 1LL8A 3LI9A 2AVXA 1NLYA 4DN0A 2DNSA 1XPBA 2HGVA 4E3NA 1ESIA 1ZHHB 1FILA 3ZGAB 3U4LP 4R4SA 3C5AA 4GJ4A 2HP9A 4KZ6A 2HV1A 3RJUA 4K0WA 4GD8A 1MZUA 4E3IA 5IU1A 4GOGA 3D72A 1L3LA 3QP2A 3HL9A 3UPNA 3R7WA 4CLCA 5CX7A 1YLYA 1DP9A 1EW0A 5TFQA 1NRFA 5FEFA 4PKYG 1T1BA 2G2WA 5LBRA 2Q0OA 2W27A
chains in the Genus database with same CATH topology
1F2KA 3CPTA 1A0KA 2VK3A 3T1QB 1PFLA 2PRFA 3NECA 2PAVP 1YPRA 4ESPA 2V8FA 2JKGA 4QWOA 2HZ5A 4X1LA 2ACGA 3D9YA 4FTXA 5FDSA 2BTFP 1FIKA 1SZVA 1VETB 1D1JA 1SKOB 2PBDP 2V8CA 3UB5P 1HLUP 1PRQA 3LGOA 3KYEA 3T1XA 1K0KA 3L9KA 1Y4OA 2ZL1B 3T12B 3L7HA 1VETA 3T1SA 5EM1A 1VEUB 1PNEA 4X25A 2JKFA 3NULA 3T1RA 3MSHA 2B95A 1CF0A 1J3WA 1CJFA 1FILA 3U4LP 3CHWP 5FEGA 1Z09A 1SKOA 1AWIA 4X1MA 3DAVA 1G5UA 5EV0A 4D60A 2ZL1A 4FUWA 1CQAA 3CPTB 1ACFA 3LEQA 3MS6A 5FEFA 2E8JA 1VEUA 5EM0A 5EVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2K A;  3CPT A;  1A0K A;  2VK3 A;  3T1Q B;  1PFL A;  2PRF A;  3NEC A;  2PAV P;  1YPR A;  4ESP A;  2V8F A;  2JKG A;  4QWO A;  2HZ5 A;  4X1L A;  2ACG A;  3D9Y A;  4FTX A;  5FDS A;  2BTF P;  1FIK A;  1SZV A;  1VET B;  1D1J A;  1SKO B;  2PBD P;  2V8C A;  3UB5 P;  1HLU P;  1PRQ A;  3LGO A;  3KYE A;  3T1X A;  1K0K A;  3L9K A;  1Y4O A;  2ZL1 B;  3T12 B;  3L7H A;  1VET A;  3T1S A;  5EM1 A;  1VEU B;  1PNE A;  4X25 A;  2JKF A;  3NUL A;  3T1R A;  3MSH A;  2B95 A;  1CF0 A;  1J3W A;  1CJF A;  1FIL A;  3U4L P;  3CHW P;  5FEG A;  1Z09 A;  1SKO A;  1AWI A;  4X1M A;  3DAV A;  1G5U A;  5EV0 A;  4D60 A;  2ZL1 A;  4FUW A;  1CQA A;  3CPT B;  1ACF A;  3LEQ A;  3MS6 A;  5FEF A;  2E8J A;  1VEU A;  5EM0 A;  5EVE A; 
#chains in the Genus database with same CATH topology
 2O99 A;  1Y28 A;  3FC7 A;  2PRF A;  4PM8 A;  1W7F A;  4KQD A;  5CED A;  2EX2 A;  2QYB A;  3B47 A;  3G34 A;  3BQ8 A;  4X1L A;  3GTC A;  1BSG A;  4LFU A;  2PD7 A;  5HAI A;  1K55 C;  2CMN A;  3D4F A;  1SHV A;  1E3U D;  1S0W A;  5F1F A;  5M19 A;  3HLD A;  1S1Z A;  4KZ4 A;  3BM6 A;  3SS5 A;  5TJJ A;  4KZ5 A;  1Y4O A;  4MBK A;  3W2Z A;  5G4Y A;  3GQZ A;  1RCJ A;  5CHU A;  4S2N C;  1YLP A;  2JKR M;  3VFH A;  4GZB A;  5DTK A;  3HLW A;  3OLO A;  2HDS A;  4LV3 A;  4QU3 A;  2ZQ9 A;  3C4O A;  1JTD A;  2HJ9 C;  1BUE A;  1C3B A;  3OCN A;  5U47 A;  5AVF A;  3G4P A;  5CER A;  2UWX A;  3E2K A;  3OBF A;  2H0T A;  4GB7 A;  4RX3 A;  1J3W A;  2Y2I A;  3OPR A;  4QY5 A;  1SKO A;  3EOI A;  5J7E A;  2PDR A;  5CHM A;  2Y8H A;  5TBM A;  3VMA A;  3DTM A;  1MXO A;  2EX8 A;  4BEN A;  3VOL A;  1CQA A;  1KDW A;  2VJW A;  3ZNT A;  3V5M A;  1GHI A;  4OPQ A;  4II7 A;  3T50 A;  3LI8 A;  3PBQ A;  3BFG A;  4LGW A;  2W0N A;  3K3C A;  3CPT A;  2HJE A;  3UDX A;  4HY8 A;  4X56 A;  4OOM A;  4MNR A;  5CGX A;  1IKG A;  5FI6 A;  4F3L B;  1OTA A;  3MZF A;  5HD3 A;  4DE2 A;  2K31 A;  3G30 A;  5CGS A;  4MN5 A;  3ZCZ A;  4IJG A;  1S1Y A;  1PZP A;  1MC0 A;  5DKK A;  4MEZ A;  5FL3 A;  3IS2 B;  1PRQ A;  2PR5 A;  4ZTK A;  5FAS A;  1SDE A;  1PWC A;  1UWP X;  1DRM A;  3B33 A;  3MXS A;  4Z1W A;  1K54 A;  2VGL S;  2ZC7 A;  3PYP A;  4GN2 A;  4IED A;  3N8R A;  1PWG A;  1YLZ A;  3JVU A;  1KGG A;  4JF4 A;  1D06 A;  5FAT A;  4Y0O A;  4EV4 A;  2X02 A;  3V67 A;  4Y5F A;  3IF6 B;  1MBL A;  1Y54 A;  3IH8 A;  4GKU A;  1PNE A;  1GSV A;  3LR3 A;  1ZG6 A;  3PBT A;  1OJG A;  1XP4 A;  2FFY A;  1CJF A;  1L2S A;  4EEP A;  3SH7 A;  3M6H A;  4HJ6 A;  5TR7 A;  1AWI A;  3SS3 A;  3PBR A;  2LB5 A;  1NWZ A;  4MN7 A;  2XFS A;  3F1O B;  3LCE A;  3S7Q A;  4D60 A;  5EVI C;  1L0F A;  4EUZ A;  1YAX A;  2PBY A;  1XX2 A;  3SH9 A;  4QB8 A;  2O9C A;  3VP3 A;  4CQH A;  2HPB A;  1FCM A;  4WEJ A;  4UQI S;  3FYZ A;  3C4P A;  3BFC A;  1H5X A;  3C2W A;  5A8B A;  3WS1 A;  4NXF A;  1UGU A;  4B4Z A;  2V20 A;  3H9W A;  2V0U A;  4OKP A;  1XGJ A;  3BFD A;  2XH9 A;  4LRX C;  4R1G A;  1YSP A;  4KZ3 A;  5DFX A;  3WS4 A;  1KVM A;  1SZV A;  4IUK A;  5F82 A;  4E3L A;  1Q2P A;  1RGY A;  4Y0U A;  4QHC A;  5DF9 A;  2EFX A;  5GLA A;  3LYX A;  2VV7 A;  1VET A;  4H6J B;  2EWW A;  2XA7 S;  1ERQ A;  3UNW A;  1XXM A;  4Y13 A;  3Q7V A;  5F83 A;  5HWV A;  2ZC3 B;  3QP6 A;  5TGF A;  3NY4 A;  1K4F A;  4R23 A;  2ZM0 A;  2WKQ A;  4E04 A;  4LV2 A;  3MR0 A;  1G28 A;  1T1C A;  4HOI A;  1FR1 A;  3R7W B;  4CLC B;  1DY6 A;  1XGI A;  5C5K A;  3DTI A;  5FI7 A;  3ISG A;  2Z6C A;  3FV7 A;  1LSW A;  1CI9 A;  4LPZ A;  4GD6 A;  3BY8 A;  4GS9 B;  1MWS A;  4NK3 A;  4WZ5 C;  2FZ0 A;  4KQR A;  4X55 A;  1MPL A;  3V50 A;  3QHY A;  1XJ2 A;  2Y2Q A;  1PW8 A;  4Q0I A;  1FOF A;  3A0R A;  5FI2 A;  2VZW A;  2VGJ A;  3WS5 A;  1N9N A;  2VGL M;  4E6X A;  4GHI B;  2J8Y A;  5A93 A;  4WM9 A;  1PFL A;  3W4Q A;  2J9P A;  2VX8 A;  2ZQC A;  4X53 A;  4QD4 A;  3HLE A;  3V3R A;  5EOE A;  4S2I A;  3CWF A;  2BTF P;  1IOU A;  5CTN A;  2WK0 A;  3QNB A;  3PBS A;  2NUT C;  1JWV A;  5HDC A;  1PI5 A;  4LRZ E;  4WMC A;  3IWI A;  5AQ9 A;  3UPP A;  1OTD A;  4OLG A;  1ONG A;  2PD8 A;  4JGR A;  3C7U A;  3MZD A;  3BLM A;  4R3J A;  5K5B A;  3T1S A;  1XA1 A;  4R38 A;  3IXH A;  1TS0 A;  1NY0 A;  4FSF A;  4P6B A;  5HDS A;  4YWZ A;  4XT2 B;  1Z6F A;  4F3L A;  3MSH A;  1T1A A;  4O01 A;  3HRE A;  4UA6 A;  4DXC A;  4EU0 A;  4BBV A;  2W3F A;  5HWT A;  4HH3 A;  3IS2 A;  5FSR A;  4KEN B;  5I5L A;  3BRM A;  3HLG A;  5KSC A;  3BY9 A;  4N9L A;  5FDH A;  4DRT A;  4IUH A;  2VGK A;  3EQV A;  4OP8 A;  2IWD A;  3ZYT A;  1H8Y A;  1BLP A;  3AGF A;  4Y7P A;  2B18 A;  4IVK A;  5DTT A;  3BQA A;  5L2F A;  4HI4 A;  3CPT B;  2Y2K A;  1SCW A;  2QHK A;  3IF6 A;  3GEC A;  1SDN A;  4R0Q A;  4OPZ A;  3NIA A;  4EBN A;  3T4J A;  3VE3 A;  2JKT I;  3OOV A;  3HLF A;  4U0T A;  1IFQ A;  2D01 A;  1N4O A;  2XA7 M;  2W3E A;  1OTI A;  4MMN A;  5D3O A;  2WKH A;  3LUQ A;  2K7S A;  3E98 A;  5F69 A;  2JKG A;  4OPR A;  3F1O A;  3MQ0 A;  4YIN A;  3ZNY A;  1N9B A;  3GR2 A;  3SH8 A;  2PHY A;  1FIK A;  1KOU A;  1IEM A;  2R9X A;  2WGW A;  4IVI A;  2R78 A;  4G3W A;  4PM5 A;  3LR0 A;  3IX3 A;  3A3E A;  5HZH A;  2L0W A;  2ZM2 A;  2P74 A;  1PIO A;  5M18 A;  5HD5 A;  4DE1 A;  1RP5 A;  3CLO A;  2Y91 A;  4K0X A;  4NET A;  4RVA A;  3DWK A;  3I7J A;  3M6B A;  3N8S A;  3WWX A;  5GLC A;  2W1T B;  4KG6 A;  3H82 B;  3OCL A;  2E8I A;  5FEG A;  2HP5 A;  2WZX A;  3MXQ A;  3R4K A;  1MY8 A;  2GZA A;  1XJ3 A;  3NDE A;  3P98 A;  4HBU A;  1O07 A;  4GNU A;  4N9K A;  3KSF A;  1LI0 A;  4H6J A;  2Y2P A;  1K57 A;  4HBT A;  4FD8 A;  2WAE A;  4P0M A;  3MS6 A;  3Q82 A;  4BD0 A;  4BQM A;  3RXW A;  2FFF B;  5EM0 A;  2VA0 A;  1O7E A;  3ZVW A;  3VSK A;  4ZBE A;  4QPR A;  2HDQ A;  3VSL A;  3NEC A;  5AQ7 A;  4PM9 A;  2J9O A;  1ESU A;  1OTE A;  4HQA A;  4QWO A;  2L4R A;  3UO9 A;  4C75 A;  1FR6 A;  3S7P A;  4Q0J A;  1FCN A;  1VET B;  4GS9 A;  5EVI D;  1G68 A;  3H7W B;  4ZJ1 A;  3N6I A;  4R3B A;  4GDN A;  1TVF A;  3O88 A;  4OVD A;  1K0K A;  5HW3 A;  4FCF A;  5EPH A;  3LR5 A;  1ZC2 A;  3Q7V B;  2OWH A;  1G6O A;  3TRC A;  3MBZ A;  3Q7Z A;  3G32 A;  1K4E A;  4WUJ A;  4R4R A;  4GHI A;  2WKP A;  5CHJ A;  1ODV A;  1VEU B;  3DTK A;  4I3I A;  3BEC A;  3T1R A;  1K55 A;  1BLC A;  3NOT C;  4A5R A;  4X6T A;  1YSQ A;  3A3F A;  3CUE A;  2C6W B;  1K38 A;  1ERM A;  4KZB A;  3F1P B;  1BZA A;  5CTM A;  2Y2N A;  3IXD A;  3GV9 A;  4H8R A;  4I3J A;  4ZJ3 A;  5FQK A;  5AVE A;  4OP5 A;  4Y3I A;  4BJP A;  1JNU A;  1EI5 A;  2P04 A;  2Y79 A;  2XGN A;  3KYQ A;  4XT2 A;  3MF0 A;  1ONH A;  3U2A A;  3ZG7 B;  1VHM A;  3DBA A;  3BJN A;  2XK1 A;  5IT5 A;  3P7N A;  1M40 A;  3A3I A;  3IX8 A;  1OT6 A;  3T4L A;  1KGF A;  3T1Q B;  1IYQ A;  2QWS A;  1IYS A;  3HUN A;  2H0Y A;  1IYO A;  1XJ4 A;  4K08 A;  4WF0 A;  1K56 D;  5JYP A;  1TD5 A;  1ES2 A;  4MBF A;  1CI8 A;  2D02 A;  1ZTU A;  4L9F A;  5GHZ A;  4Y15 A;  3IWQ A;  4Y0T A;  2JE5 A;  2LB9 A;  5HL1 A;  1KGE A;  2J80 A;  2WKR A;  3HJK A;  1NXY A;  3NHQ A;  2HF6 A;  3GMW A;  3EWK A;  4KZ9 A;  4OOY A;  2A2L A;  1OTB A;  1YLJ A;  1S66 L;  2H28 A;  2GDN A;  5M1A A;  1WA9 A;  3LIE A;  1EWZ A;  3BEB A;  4ARZ B;  5CXW A;  3VE4 A;  1JTG A;  3MQQ A;  2X01 A;  3P09 A;  1HTZ A;  3CIT A;  3CHW P;  2DCF A;  4O0P A;  4LV1 A;  2FH5 A;  3TJZ C;  2G2U A;  5G4Z A;  5A92 A;  3F1N A;  1K54 C;  1IYP A;  4OQ0 A;  3E4P A;  5EUA A;  5F68 A;  3BW6 A;  2VKS A;  4GDB A;  5E2H A;  3VV4 A;  5HAQ A;  4UEY A;  3Q81 A;  5FAO A;  5HAR A;  1F5M A;  1GA0 A;  5KMW A;  4UAA A;  2J7V A;  3KSH A;  3S1Y A;  4DMZ A;  3UE0 A;  2W1T A;  1TDL A;  3H82 A;  4EBP A;  2WGW B;  4FOF A;  4LLO B;  2VV6 A;  3SZT A;  2A3U A;  2ACG A;  2XQZ A;  2EXB A;  1PW1 A;  4NXG A;  1DJC A;  1Q2Q A;  1FSY A;  1YM1 A;  2CC1 A;  2Z2M B;  3VP2 A;  3S7N A;  4O7D A;  1OME A;  2W3D A;  2ZL1 B;  4NEE D;  2PYP A;  1H3Q A;  3ULF A;  5FQQ A;  2WGI A;  1MKI A;  1E3U A;  4C6Y A;  4BBT A;  1KE4 A;  3N7W A;  4BLM A;  2H5S A;  1GA9 A;  5FQI A;  4GCZ A;  4I39 A;  4KZ8 A;  4I38 A;  4KUO A;  5L8M A;  1YMX A;  2B95 A;  4JBF A;  2WKE A;  3EGD C;  3E0Y A;  1L0E A;  2BG1 A;  2DMW A;  4DF6 A;  1Z09 A;  3GSG A;  3H7W A;  2GJ3 A;  4IBR A;  2VV8 A;  4BMW A;  3LID A;  4E6W A;  2EFU A;  4WBG A;  5EV0 A;  1L0G A;  3HVF A;  2OAQ 1;  3UB8 A;  3LIA A;  4S2L A;  4OQH A;  4F94 A;  4FUW A;  4RA7 A;  3MFD A;  4UA7 A;  5I94 A;  3B3X A;  1VEU A;  2Y2G A;  4OQG A;  3AGD A;  1ERO A;  2IA2 A;  2ZQA A;  1GCE A;  1A0K A;  2OLV A;  4MLL A;  3G31 A;  4EW7 A;  2KX6 A;  2P9V B;  1JVJ A;  5BOH A;  5MC7 A;  4N92 A;  2O9B A;  3F1P A;  1I5Q A;  1TS6 A;  4WYY A;  3G35 A;  1U60 A;  2M1C A;  3RTY A;  1I2S A;  4BWI A;  2G7U A;  1YKD A;  1HVB A;  1HLU P;  3PBN A;  4HEF A;  5HPF A;  2ZBB A;  2KOI A;  3WS2 A;  1QME A;  5DKL A;  3ZG0 A;  2QZ6 A;  4JGO A;  3T12 B;  4JF6 A;  4OQI A;  4XUZ A;  3EEH A;  5KZH A;  2Y2O A;  4JLF A;  2Y2H A;  3SW1 A;  1W63 Q;  2V1Z A;  3NBL A;  2GX5 A;  5FQJ A;  3Q07 A;  1T18 A;  5GL9 A;  2XRO A;  3MKE A;  2Y2L A;  3UMD A;  4AFI A;  2WZZ A;  2ZC6 B;  4G3V A;  5CEB A;  1LHY A;  1MWU A;  4JPM A;  2VLG A;  3SS4 A;  4DDS A;  4CLC D;  3LIC A;  3BFF A;  2ZQD A;  1NYM A;  3A0V A;  2JBF A;  3ZHH A;  1CEG A;  3UDF A;  4EBL A;  4DKI A;  4HP9 A;  3V39 A;  5HWW A;  2B5R A;  4EUV A;  1YMS A;  3A3J A;  3ZFZ A;  4UQI M;  3IF5 A;  4MN6 A;  3RXX A;  2EXA A;  1KVL A;  2E8J A;  4ARZ A;  2MJ6 A;  3T4O A;  3O5Y A;  2EX6 A;  3VP0 A;  3MFX A;  3UME A;  1HD8 A;  3EEA A;  2QKP A;  2EWV A;  2Q9M A;  1F9I A;  3LIB A;  1W8Q A;  1VB6 A;  1YT4 A;  5L07 A;  3VP4 A;  4X68 A;  1X0O A;  1PYY A;  1BYW A;  5FQ9 A;  3IWO A;  2ZLY A;  2ZMA A;  1TDG A;  2W1R A;  3CJM A;  4OLD A;  3MXR A;  2Y2J A;  2ZOI A;  3AGE A;  5F5Y A;  4EQI A;  2B02 A;  2XD5 A;  3NI9 A;  3ZVT A;  3MKF A;  4ID4 A;  4I3A A;  1ALQ A;  2ZOH A;  2WUQ A;  3UE3 A;  2IWB A;  3CMZ A;  4ME4 A;  2W3H A;  5EE8 A;  3NC8 A;  4E3M A;  1WYB A;  1AXB A;  2JKF A;  2ZC5 B;  1H8Z A;  3QP5 A;  3F1N B;  1NRJ A;  1MWR A;  2R9W A;  4K91 A;  4X69 A;  1D7E A;  5A91 A;  4JGQ A;  1E25 A;  2A49 A;  4Y17 A;  4JXG A;  3C8C A;  4MBH A;  4ZAM A;  4B93 A;  2O0Y A;  5DVA A;  4KQQ A;  4P6Z S;  1T19 A;  2C5W B;  1CEF A;  2ZL1 A;  4Q0H A;  1KE0 A;  3O3V A;  4UHU A;  2WAD A;  2QJ5 A;  3Q1F A;  4HIA A;  4N1H A;  5E2F A;  3UPO A;  4FH4 A;  3PTE A;  1FQG A;  1XFQ A;  3BFE A;  3EGX C;  4NG2 A;  2Y4A A;  1S67 L;  5EVI B;  2DRW A;  1BLS A;  5CEC A;  3UDI A;  3C38 A;  3M2J A;  1XJ6 A;  4ZJ2 A;  5DTS A;  3S22 A;  3TE8 A;  4G3K A;  3KO6 A;  1VM1 A;  3IQA A;  1V9Y A;  1LLB A;  2Y2M A;  1K6R A;  2HZ5 A;  2V2F F;  4CJN A;  1JWP A;  3C7V A;  4R6L A;  3HLB A;  3ZQ5 A;  3HLC A;  3UE1 A;  5HPI A;  1W79 A;  3IHA A;  5EFW A;  3ZG8 B;  5L10 A;  1UWN X;  2H10 A;  3IXG A;  3T1X A;  4JGP A;  4BL2 A;  3B42 A;  4EWF A;  3DTE A;  5HDD A;  5F6A A;  3SOI A;  5CRF A;  1SKF A;  4CLC C;  2JKT M;  1BTL A;  2V9A A;  2ZC4 B;  3N4I A;  2QMI A;  3G2Y A;  3EQU A;  4KZA A;  2P9V A;  1P9R A;  4OOL A;  1HZO A;  2INW A;  1QMF A;  1CF0 A;  2HP6 A;  3OC2 A;  3UB6 A;  2YKF A;  1PZO A;  2QJ7 A;  4YNR A;  2M7V A;  4PHT A;  4LCM A;  3HJI A;  1GSX A;  4U3T A;  5FA7 A;  5DF8 A;  1S4R A;  2XRN A;  3BWL A;  5J4E A;  2I72 A;  3FWL A;  3LO7 A;  3S4X A;  3CG5 A;  4RX2 A;  4HH2 A;  3N8L A;  1E4D A;  3W4O A;  4RYE A;  5EVE A;  4KG2 A;  3HUO A;  3LR4 A;  4WN5 A;  2BAS A;  3CUE C;  4S2N A;  4S2M A;  4JKT A;  2RL3 A;  3IX4 A;  4NXB A;  2PU2 A;  1NZU A;  5GHX A;  1K25 A;  2YKH A;  3FKV A;  3O86 A;  2ZQ7 A;  1J9M A;  2RCX A;  3OPL A;  1XKZ A;  2JHE A;  4QJG A;  1WE4 A;  4HJ4 A;  5GLB A;  4M3K A;  4P87 A;  1LSV A;  1D1J A;  2PBD P;  3FPV A;  4JXV A;  1W5D A;  3UB7 A;  1LI9 A;  4EEU A;  2ZMF A;  3NOU C;  3ZG5 A;  5DJU A;  1S6R A;  4ETX A;  4BBU A;  4P6Z M;  5EEC A;  5FQM A;  1DP8 A;  4EQ1 A;  4C3Q A;  4EER A;  5EM1 A;  4L0L A;  3VOY A;  2JC7 A;  1ES3 A;  2GNX A;  2J3T D;  2IWC A;  1S4S A;  5J8X A;  2Q9N A;  1YLT A;  4NKP A;  4HHD A;  1TS8 A;  2WYX A;  4B9O A;  4X1M A;  1W8Y A;  3DAV A;  5AQA A;  1YQS A;  1P0Z A;  2JN7 A;  3PAE A;  1KDS A;  4R3A A;  2I9V A;  1GSW A;  4EES A;  1ES4 A;  3ITB A;  3KSG A;  4I5S A;  4LRY C;  3QP1 A;  3OZH A;  4HP4 A;  3KYZ A;  3T4T A;  4LEN A;  3BLS A;  2WAF A;  3MMH A;  2X71 A;  4LV0 A;  1YLW A;  3E4Q A;  1PI4 A;  4DDY A;  3CZD A;  1BLH A;  4O8G A;  2VK3 A;  1KE3 A;  3W8K A;  3FG8 A;  3FKW A;  2PAV P;  3TG9 A;  4WMC D;  1ZG4 A;  4P85 A;  1DJB A;  5IS1 A;  2Z2L B;  4XXR A;  2ZJ9 A;  5IHV A;  1DP6 A;  3UE6 A;  1LT0 A;  3LY4 A;  3HCY A;  4JXS A;  4S2K A;  3LGO A;  3A0S A;  2PR6 A;  3KYE A;  4ETZ A;  5E43 A;  3IH9 A;  4L9G A;  5EVI A;  3WRZ A;  2P7J A;  4N1X A;  3GDI A;  1N9O A;  4BL3 A;  3ICY A;  2JCH A;  5HFO A;  1NYY A;  3S7O A;  1ES5 A;  4E3K A;  2A24 B;  3NUL A;  3LY3 A;  2PT7 A;  3K2N A;  1ZKJ A;  5DF7 A;  4B88 A;  3MZE A;  3FZC A;  3TW8 A;  1TF1 A;  1M6K A;  4WEK A;  5J3W A;  1MWT A;  1H8M A;  3ZG9 B;  3T4S A;  3IBR A;  2BLS A;  1G5U A;  4RQ9 A;  3PR6 A;  3WS0 A;  3VOZ A;  4PPR A;  3PBO A;  1ACF A;  4HNB A;  1F98 A;  1STZ A;  1V9Z A;  4Y2F A;  1GHM A;  5F1G A;  5HL6 A;  2XR0 A;  5G18 A;  4YOF A;  3CI6 A;  4PKY A;  2HDU A;  1TS7 A;  1MKM A;  4YFM A;  3E4O A;  3E2L A;  1IEL A;  2VEA A;  3HBR A;  4GLQ A;  2PU4 A;  2HDR A;  5FAP A;  4NXE A;  3W4P A;  4ESP A;  4D2O A;  4EXO A;  2PYR A;  4S2O A;  4OH0 A;  1DJA A;  4IBX A;  2J3W A;  5EVL A;  4IHQ A;  4Q8I A;  1JWZ A;  3VFF A;  1IKI A;  3HUM A;  3UB5 P;  4GW9 A;  1K56 A;  1RGZ A;  2V1A A;  1G6A A;  2J3T C;  2WKI A;  5DFY A;  4JF5 A;  2XFT A;  4FH2 A;  3L7H A;  4CLC E;  1LL9 A;  3IT9 A;  2QPN A;  4WZ5 A;  5GHY A;  3IXB A;  2OAP 1;  3UY6 A;  3G2Z A;  4S2J A;  2OSU A;  4X25 A;  2V0W A;  3JPU A;  2XF3 A;  5HX9 A;  2XD1 A;  3KX0 X;  4KG5 A;  5HAP A;  3DW0 A;  5L09 A;  2ZQ8 A;  3T4Q A;  2WGV A;  4QY6 A;  3BYD A;  3GRJ A;  4KQO A;  4MDZ A;  4R70 A;  2OV5 A;  4UA9 A;  3TOI A;  3LEQ A;  3K3D A;  3CAX A;  2EA9 A;  5AJG A;  4DE0 A;  4ZDX A;  4WL9 A;  1F2K A;  3TSG A;  2XDM A;  3G6O A;  1NZO A;  4Z9Q A;  4XUX A;  5EOO A;  1FCO A;  4MCW A;  5E2G A;  2OOL A;  3UN7 A;  1LL5 A;  3T4K A;  1GHP A;  1YPR A;  3FPW A;  3PHY A;  1NLZ A;  4FTX A;  2UV0 E;  5FDS A;  3LFV A;  1P9W A;  5HSQ A;  3NOP C;  2M7U A;  4JXW A;  3IHB A;  3MQO A;  2KDK A;  1SKO B;  2V8C A;  2OLU A;  1I2W A;  2XEP A;  5TBM B;  3IBJ A;  5CGW A;  2Z6D A;  5KIZ A;  1W63 M;  2ZM8 A;  3QP4 A;  5JYO A;  3PXP A;  1N9L A;  3V3S A;  2K2N A;  2ZD8 A;  5GLD A;  1VQQ A;  3QNC A;  1BUL A;  3RH8 B;  4E3J A;  4OPY A;  1NJ4 A;  4DE3 A;  3LIF A;  4WEL A;  3IF6 C;  2Y59 A;  1L0D A;  3DWZ A;  3A3D A;  2Y55 A;  3UB9 A;  4OON A;  1PWD A;  3LEZ A;  4S2P A;  1WYC A;  4U0X A;  4HES A;  1XA7 A;  1K6S A;  2XSS A;  1OJ5 A;  4B4X A;  1BT5 A;  3P01 A;  4PM6 A;  5E2E A;  2V1B A;  3JYI A;  2OWJ A;  3VP1 A;  3NDG A;  3RFB A;  4E3O A;  2KLI A;  3ZDJ A;  5FAQ A;  3NJA A;  5A90 A;  1LSX A;  4M4X A;  4CPK A;  3OPP A;  4WLA A;  1OPX A;  5KSH A;  4EET B;  2A24 A;  4PMA A;  3D3O A;  3C30 A;  3MJQ A;  4PM7 A;  2NUP C;  1H0M A;  3M2K A;  2L1M A;  3WRT A;  1TEM A;  3O87 A;  2V8F A;  3D9Y A;  4KZ7 A;  4DJ3 A;  1P97 A;  2JKR I;  4LCL A;  2P08 A;  4KUK A;  1OT9 A;  1FSW A;  4PAU A;  3JVV A;  5AQB A;  5DJT A;  2O9A A;  4HJ3 A;  4BD1 A;  2EX9 A;  3KSI A;  4WZ4 A;  4ZRR A;  3GVB A;  1XFN A;  3PAG A;  4DXB A;  3L9K A;  2W3G A;  2XLN A;  3QP8 A;  4DJ2 A;  3OPH A;  3ITA A;  2ZMV A;  3NCK A;  1CK3 A;  4L9E A;  1K57 C;  1LL8 A;  3LI9 A;  2AVX A;  1NLY A;  4DN0 A;  2DNS A;  1XPB A;  2HGV A;  4E3N A;  1ESI A;  1ZHH B;  1FIL A;  3ZGA B;  3U4L P;  4R4S A;  3C5A A;  4GJ4 A;  2HP9 A;  4KZ6 A;  2HV1 A;  3RJU A;  4K0W A;  4GD8 A;  1MZU A;  4E3I A;  5IU1 A;  4GOG A;  3D72 A;  1L3L A;  3QP2 A;  3HL9 A;  3UPN A;  3R7W A;  4CLC A;  5CX7 A;  1YLY A;  1DP9 A;  1EW0 A;  5TFQ A;  1NRF A;  5FEF A;  4PKY G;  1T1B A;  2G2W A;  5LBR A;  2Q0O A;  2W27 A; 
#chains in the Genus database with same CATH homology
 1F2K A;  3CPT A;  1A0K A;  2VK3 A;  3T1Q B;  1PFL A;  2PRF A;  3NEC A;  2PAV P;  1YPR A;  4ESP A;  2V8F A;  2JKG A;  4QWO A;  2HZ5 A;  4X1L A;  2ACG A;  3D9Y A;  4FTX A;  5FDS A;  2BTF P;  1FIK A;  1SZV A;  1VET B;  1D1J A;  1SKO B;  2PBD P;  2V8C A;  3UB5 P;  1HLU P;  1PRQ A;  3LGO A;  3KYE A;  3T1X A;  1K0K A;  3L9K A;  1Y4O A;  2ZL1 B;  3T12 B;  3L7H A;  1VET A;  3T1S A;  5EM1 A;  1VEU B;  1PNE A;  4X25 A;  2JKF A;  3NUL A;  3T1R A;  3MSH A;  2B95 A;  1CF0 A;  1J3W A;  1CJF A;  1FIL A;  3U4L P;  3CHW P;  5FEG A;  1Z09 A;  1SKO A;  1AWI A;  4X1M A;  3DAV A;  1G5U A;  5EV0 A;  4D60 A;  2ZL1 A;  4FUW A;  1CQA A;  3CPT B;  1ACF A;  3LEQ A;  3MS6 A;  5FEF A;  2E8J A;  1VEU A;  5EM0 A;  5EVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...