3T1XA

Mglb r124a e127a monomer
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
134
structure length
134
Chain Sequence
LVLYGAPYERAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVASNAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKAAAAALARIAEEALAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gliding protein MglB
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Signaling protein
total genus 31
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3t1xA00
4ESPA 2V8FA 1ACFA 3T1SA 1CQAA 3MSHA 4X1LA 4QWOA 4X25A 1SKOA 2ZL1A 1PFLA 1Z09A 2JKFA 1YPRA 3T12B 5EM1A 1G5UA 1SZVA 5EM0A 5EVEA 5EV0A 5FEGA 1Y4OA 1PNEA 3T1RA 3LEQA 5FEFA 2PBDP 4X1MA 2PRFA 3CHWP 2HZ5A 2BTFP 2PAVP 2E8JA 3DAVA 3MS6A 3L7HA 3CPTB 1CJFA 3NECA 5FDSA 2VK3A 4FUWA 2JKGA 3L9KA 3T1QB 1VEUB 1J3WA 3CPTA 2B95A 1VETB 1FIKA 3KYEA 1CF0A 2V8CA 1D1JA 3D9YA 1HLUP 1VEUA 1AWIA 1A0KA 1K0KA 3LGOA 1PRQA 4FTXA 3T1XA 1FILA 1VETA 1F2KA 3NULA 3U4LP 3UB5P 1SKOB 2ACGA 2ZL1B 4D60A
chains in the Genus database with same CATH superfamily
4MBKA 2CC1A 4PM5A 3MQOA 3SW1A 2Q9NA 2EX2A 3IQAA 4S2KA 4G3VA 4FD8A 4RVAA 3BFDA 4I3IA 4ID4A 1GCEA 5F1FA 1YPRA 3WS2A 1CI8A 5K5BA 2J3TC 1PW1A 1PNEA 2WUQA 2IWDA 2EFUA 4MN7A 3P09A 4RQ9A 2RL3A 3SZTA 1XX2A 1K6SA 5M18A 3G34A 1PIOA 4EUVA 4X1MA 2VA0A 4OKPA 3C8CA 4WLAA 4X55A 1KVMA 3DWZA 4JXWA 4I38A 3VSKA 2B02A 4P87A 3F1PB 3DW0A 1YLPA 4FUWA 3G32A 3UE3A 5AVEA 3V50A 2Z6DA 4OPYA 4CPKA 2V0UA 2GJ3A 2Y2HA 4HY8A 1VQQA 3AGDA 2XFSA 3IS2A 4UHUA 4BL3A 1BLSA 5KSCA 3UN7A 1PZOA 1MBLA 3RJUA 4IBXA 1SDNA 4Y0OA 3PYPA 1BLHA 3N4IA 4PHTA 2ZC5B 5JYPA 2ZOIA 1CEGA 4H6JA 2W3DA 3BWLA 4E3NA 5HPIA 1JWVA 3Q1FA 4WM9A 2V20A 4ZJ1A 4NXBA 5DF8A 4IBRA 1EROA 2R9WA 3HLWA 3S7PA 5CRFA 1ALQA 3GR2A 4Y7PA 1BLCA 2OLVA 4ZDXA 5TGFA 2RCXA 2XEPA 4BD1A 3FYZA 2A24A 4N1HA 3A3IA 3M2JA 4OOMA 1FQGA 2XRNA 5HWVA 5L8MA 3KSGA 3WRZA 1KE4A 2P04A 4BL2A 5TBMB 4FH2A 3LIDA 3S7QA 5FEFA 3C7VA 1NLYA 3MXQA 2XH9A 4M3KA 2ZM8A 2NUPC 1TDGA 3CITA 3PHYA 4Q8IA 1DP8A 1PWCA 3ZG5A 2VX8A 3H82A 4DN0A 1WYCA 1K56D 3PAEA 4E04A 4HHDA 3HBRA 2JKTI 4U3TA 5HSQA 2VJWA 2WKRA 4NEED 5HPFA 3RTYA 2J80A 4BD0A 3EOIA 2OWJA 5EOOA 1UWPX 4WEKA 1NXYA 5E2GA 1OJ5A 5F82A 1D1JA 4OP8A 4YNRA 4E3JA 4JPMA 3VP1A 3NY4A 1KE3A 4E3LA 3M6BA 1LLBA 4EQ1A 1XJ3A 4FOFA 3IWIA 1MXOA 1K0KA 4EEPA 1PRQA 3HLEA 3B3XA 4EWFA 3O86A 3U4LP 3NCKA 1MWSA 2Y2OA 3PR6A 1G28A 3OOVA 4L9FA 3WRTA 4C75A 3QP1A 3TG9A 2GX5A 1XJ6A 1SCWA 5GL9A 1N9NA 3DBAA 2UV0E 1JWPA 3GQZA 4K0XA 3QNCA 1NYMA 4KENB 1G5UA 3C4OA 2FFYA 4HESA 4IVKA 4O8GA 4X69A 5J8XA 3C38A 1T1AA 3MZDA 5M1AA 2EA9A 2ZD8A 1T1BA 5G4ZA 5KMWA 4EBNA 1E3UD 2B5RA 4OPRA 4UQIM 4X68A 4B4ZA 2ZMAA 3G6OA 2VV8A 5DFYA 3ZG7B 2A2LA 3NOPC 1IYOA 5GLAA 5TFQA 1T1CA 2H28A 4OQIA 3NC8A 5AJGA 4RX3A 2NUTC 3IWOA 2O99A 1IKIA 5FDSA 1GHIA 4Z1WA 3CLOA 1Q2PA 1WA9A 2XF3A 4ZRRA 3ISGA 1VM1A 4K91A 4NG2A 4KZAA 3UPNA 3ZCZA 4ARZB 3T4KA 2VZWA 4I3JA 5IU1A 1RGZA 1L3LA 2P9VA 3BYDA 1IYQA 3NHQA 1TDLA 3WS0A 3CG5A 3UNWA 3Q82A 4WZ4A 2G2WA 4RA7A 5LBRA 1T18A 1YAXA 3LIAA 2XD1A 3BFFA 1KDWA 1XFNA 4QU3A 1YKDA 3QHYA 1BSGA 1GHMA 4IVIA 4EU0A 4O7DA 3GVBA 4Z9QA 2Y2JA 4P85A 4MN6A 4UA7A 3T4TA 1BTLA 2HP9A 3H7WA 2PYPA 1FCOA 4OONA 1OMEA 3V5MA 3W4PA 4HJ4A 4U0TA 2WAEA 2BG1A 3B33A 4O01A 2H0TA 2EWVA 4DXBA 4BBTA 1JTGA 3QNBA 3N8LA 2JCHA 1ZKJA 4XXRA 1P0ZA 3KO6A 4WL9A 5HDSA 1H5XA 4OLGA 3VOLA 3ICYA 2PD7A 1N9BA 2Y4AA 2L4RA 4IUKA 3L7HA 3KSFA 5HWWA 3LCEA 2L1MA 5F69A 4YINA 3WS1A 1Y54A 4BLMA 2Y8HA 3IXHA 4BJPA 4EXOA 1ES3A 1VEUB 4LGWA 4LRZE 5FI7A 3P98A 1CK3A 3HLBA 2ZM2A 3CPTA 4KQOA 4WMCA 4Y15A 2P7JA 1XA7A 3GV9A 2DRWA 5F5YA 1MZUA 4OQ0A 1IFQA 1AWIA 1E4DA 2VV6A 3BFGA 1TVFA 4YFMA 4FTXA 5KSHA 3ZDJA 1VB6A 1F2KA 3EEAA 1CI9A 3FV7A 2L0WA 3K3CA 4Q0JA 4D60A 2J3WA 1LI9A 1SKFA 1P97A 1JVJA 4LV3A 3UY6A 2VGLS 2V0WA 5DTKA 3VP3A 2ZQ8A 3PXPA 4OPZA 1W63M 4U0XA 2XQZA 3G4PA 1ZC2A 5EM0A 4CLCA 4GS9B 3JVVA 5KIZA 3LY3A 1MKMA 3B42A 5GHYA 3E4PA 2UWXA 4BMWA 4Y17A 4EESA 3FWLA 3LYXA 1FSYA 3LICA 1H0MA 2PBDP 5GHXA 3VP4A 1DY6A 2E8JA 3T4LA 4R38A 3Q07A 1JWZA 1K57A 2M1CA 1N9OA 4P6ZS 4EBPA 3HJKA 2BASA 3C7UA 5HFOA 3T1QB 3T4QA 1K38A 2WGWA 2ZQCA 3BW6A 1VETB 3B47A 5L09A 1NYYA 4GHIA 1CEFA 1ESUA 1QMEA 3CWFA 4HH2A 5FL3A 5FI2A 3MMHA 1NZOA 2R78A 3Q81A 3QP4A 5EOEA 3D3OA 1DJBA 1MY8A 5HX9A 5DF7A 1V9ZA 1H8MA 2QYBA 3PBQA 4E6XA 3HLGA 3VV4A 2ZC4B 3SH8A 4DRTA 4DJ2A 1YM1A 1LL9A 3ULFA 2ZL1A 2ZC7A 1TS7A 3G2YA 2HP5A 4HJ6A 4ETZA 4DF6A 2G7UA 3ZVWA 2JKFA 1OTIA 3S7NA 4KZ6A 2M7VA 2OV5A 3ZG0A 2LB5A 5CGWA 4E3IA 3RH8B 3NDGA 3T4JA 4LFUA 1IELA 3EEHA 1N9LA 4KZ5A 3IT9A 1Y28A 1K54A 2WKEA 3HLCA 1ES4A 4GKUA 4QPRA 5L10A 5DKLA 4L9GA 5EVIA 3MS6A 5CGSA 2YKHA 3F1OB 3NOUC 3NECA 4LLOB 3BLMA 3G30A 2J8YA 4OLDA 1W8QA 3FKVA 3ZQ5A 1RP5A 5HAIA 1P9RA 4GNUA 5U47A 2Y2MA 1XFQA 2B95A 3Q7VA 2PDRA 4ETXA 2HPBA 3IBJA 3KYEA 3FPWA 1GSVA 3PAGA 3E98A 3IXDA 5A92A 2PBYA 1FILA 1ERQA 5IS1A 5BOHA 2ACGA 4FH4A 4RYEA 4GJ4A 3ITAA 1G6OA 2DNSA 4I3AA 3UO9A 4DJ3A 2D01A 3IF5A 2WGVA 2E8IA 3IBRA 5CTNA 3VP0A 4N1XA 4JF6A 2J7VA 2XA7S 3G31A 4R6LA 3W4QA 3OPLA 1PI5A 4Q0HA 2JKRM 4UEYA 5MC7A 2KOIA 4NKPA 5E2FA 3GECA 4OVDA 3IF6C 2P9VB 4BBUA 4MBFA 4JGQA 3SH7A 3UB6A 2KLIA 2W1TA 3TE8A 4XT2A 4ME4A 4LV0A 5DTTA 3MFXA 1W79A 3E0YA 4I5SA 3KSIA 4DDSA 1F98A 1SHVA 4BENA 2KX6A 3IHBA 3MR0A 5HDCA 1K55C 2JKGA 4KUOA 1DJAA 2PR6A 5AQAA 3LFVA 1ZTUA 1K25A 1XJ2A 4Y2FA 1M6KA 2ZQDA 2WAFA 3ZHHA 3IF6A 4JKTA 3A0VA 1S1ZA 4IJGA 3NULA 1SKOB 3DTKA 2WKPA 1MWTA 2VLGA 2FFFB 5G18A 2A3UA 3VOYA 5HDDA 3ZNYA 1YT4A 3T1SA 3VOZA 5F6AA 2W1RA 5TR7A 4I39A 3LI9A 3IH9A 4R3AA 5CHMA 4E3MA 1J9MA 2JKTM 4YOFA 4EQIA 2JC7A 3DTEA 3T12B 2O9AA 4OOYA 3N7WA 1C3BA 1OJGA 3E2LA 3WS4A 5A93A 5FSRA 1Z6FA 3LUQA 1VHMA 3MFDA 3OLOA 4P0MA 2EX6A 3C5AA 5FA7A 3DTIA 1K56A 4LV2A 4JF5A 4B9OA 1OPXA 4JGOA 5DTSA 2O9BA 5GLBA 3I7JA 4EV4A 3QP2A 4OOLA 3PBRA 1YQSA 5CHUA 3EQUA 3M6HA 3BEBA 3OPHA 1KGFA 2EWWA 4ZJ2A 1TS0A 3MXRA 1IYSA 3R7WB 3W8KA 2VK3A 3PBTA 3TSGA 4R4SA 1LT0A 1MWUA 2OAP1 5J7EA 2V2FF 3N6IA 3UDFA 3MKFA 1FCMA 2O0YA 4S2NC 3F1PA 1I2SA 2AVXA 4JGPA 4EEUA 5EUAA 2V8CA 3UB9A 2OWHA 3LGOA 3O3VA 1FCNA 3FG8A 4MLLA 1S4SA 4WZ5C 1ES2A 2QJ5A 4KZ7A 4Y0UA 4HOIA 2Y2PA 4Y13A 3BJNA 3MQQA 4GLQA 4GW9A 3NIAA 4NXFA 4IHQA 4R23A 4ESPA 5HD3A 3D72A 3ZYTA 1G6AA 2P08A 1F9IA 1YSQA 2Q0OA 4K08A 1NLZA 1M40A 4Y0TA 1E3UA 2W3GA 3E4OA 3TJZC 3UB7A 2PR5A 1OTAA 4MMNA 3LR5A 5EV0A 5FEGA 1W63Q 1F5MA 3OCNA 1WYBA 3LEQA 3F1NB 2ZM0A 5FASA 4JGRA 5TJJA 5C5KA 4WUJA 1DJCA 4R70A 1S0WA 5G4YA 1H3QA 3UMDA 4NETA 2HJEA 5GLCA 1TEMA 4NXEA 1GSWA 1HTZA 5TBMA 4F3LB 4RX2A 1IKGA 1L2SA 4OQHA 3QP8A 4LRXC 5HARA 2V1AA 3V3SA 2QWSA 3LEZA 4BQMA 4WYYA 3UPOA 3NJAA 1O07A 1LL5A 3M2KA 4G3KA 4LRYC 3ZGAB 1EWZA 2W3FA 2PU4A 5F83A 3WS5A 1CF0A 3EGDC 4ZAMA 1RGYA 5I94A 3NBLA 4Y3IA 3IX8A 4OQGA 4X6TA 4B4XA 1S1YA 4S2MA 3G2ZA 4EUZA 3EQVA 2WK0A 3VSLA 4UAAA 5AQBA 3GMWA 5E43A 3TW8A 3W2ZA 1V9YA 2ZQAA 1LSXA 5EVIB 3BQ8A 1S67L 1CQAA 4PPRA 5FAOA 4X1LA 1O7EA 3VMAA 2LB9A 1NRJA 4CLCD 3A0SA 1FR1A 2W3HA 1L0GA 4UQIS 2I9VA 3CMZA 4KZ8A 1SDEA 1XA1A 4N9KA 1S6RA 2OAQ1 3LO7A 1PW8A 3BFEA 4QY6A 4D2OA 2WKHA 1S66L 5CGXA 5F68A 1L0FA 3CHWP 3UMEA 2XSSA 3A3DA 4KZ9A 3P01A 3DAVA 2C6WB 1PWGA 1D06A 1YLWA 4B88A 4II7A 4DE2A 4R3BA 3IS2B 3MZEA 4K0WA 4JF4A 2QKPA 1J3WA 3O88A 1NJ4A 3FPVA 4KZBA 2GDNA 2ZC3B 4H6JB 4S2IA 2Z2MB 3D9YA 4L0LA 2HF6A 1X0OA 2IWBA 4MEZA 3R4KA 3CUEC 4ARZA 3K2NA 1ERMA 1HZOA 4DDYA 1IOUA 5DKKA 4XT2B 2A24B 4IEDA 4CJNA 4KQQA 3HL9A 3SS3A 1WE4A 1PFLA 2WGIA 3UE0A 3VFFA 5AQ9A 1NWZA 4DXCA 4DMZA 2K2NA 2BLSA 3GTCA 4BWIA 3UE1A 4LCMA 1Y4OA 3T1RA 2OSUA 2C5WB 1OTEA 3H82B 1BLPA 4KG2A 5EVID 1GHPA 5FQMA 3OPRA 3O87A 3AGFA 2H0YA 3EWKA 1ZG6A 4E6WA 4F94A 2W27A 4OP5A 4CQHA 4NXGA 3BLSA 2XD5A 2K31A 1IEMA 5CXWA 2YKFA 3PTEA 2DCFA 4WBGA 4EERA 4MN5A 3L9KA 4GD6A 4GN2A 1PWDA 5HWTA 3P7NA 2MJ6A 2EX9A 2X01A 2JN7A 2IWCA 1XGIA 5GHZA 2VGKA 1DRMA 2J3TD 1GA9A 3C4PA 1VEUA 5FAQA 1W7FA 2Y91A 1K4EA 1GA0A 3DTMA 4LCLA 3CAXA 3GSGA 3FKWA 2QJ7A 2PD8A 3HJIA 2W0NA 4QY5A 4LPZA 2V9AA 3CI6A 4HP9A 2QZ6A 2HDQA 3K3DA 2V8FA 2Y59A 3H9WA 1KGGA 2HV1A 4ZBEA 3ZVTA 4HJ3A 5FQ9A 1NRFA 3RXXA 3IXBA 2Y79A 3WWXA 1BUEA 3UPPA 5HAQA 1Z09A 4PKYG 5CECA 3MXSA 1SZVA 5J4EA 4XUZA 2QMIA 4P6BA 2HDUA 1PZPA 5A91A 2INWA 5FQJA 4JXGA 1EI5A 4ZJ3A 3LR4A 3HLDA 5A8BA 1FOFA 2PHYA 1JNUA 2JKRI 4GS9A 2Y2NA 5IT5A 2I72A 2Y2GA 3OCLA 3HUNA 2JE5A 4HBTA 5D3OA 1YMXA 3A0RA 5FAPA 3BQAA 3TOIA 2G2UA 4JLFA 1L0EA 2VEAA 3DWKA 4CLCE 4S2JA 5CEBA 1AXBA 5FQKA 2EFXA 2JBFA 3V67A 2ZQ9A 3A3FA 1KGEA 4YWZA 1LHYA 1K6RA 2Y2KA 3C30A 3AGEA 3T1XA 1I5QA 1VETA 4DE3A 2H10A 3PBSA 4GB7A 5FI6A 4UA6A 3W4OA 4QB8A 5EVLA 1XKZA 4HNBA 4A5RA 1ZHHB 3H7WB 2K7SA 1OT6A 1ACFA 1E25A 1PYYA 1UGUA 1XJ4A 4X25A 3JVUA 4GZBA 1IYPA 4PKYA 4HEFA 3UDIA 2XDMA 1GSXA 4H8RA 3LR3A 4R0QA 2ZMVA 3GRJA 5EVEA 1H8ZA 1MKIA 4G3WA 5L2FA 4GDNA 2WADA 2EX8A 1LSWA 3CZDA 4PMAA 3GDIA 5DJUA 4KQRA 1EW0A 4KG5A 1K55A 2J9PA 5EECA 2BTFP 4QD4A 4KZ4A 1RCJA 2PAVP 3UDXA 3LI8A 4HP4A 4B93A 3HUMA 1TS6A 1UWNX 5F1GA 3VFHA 3CPTB 4IUHA 2R9XA 4KQDA 2B18A 3BM6A 3MKEA 1HD8A 4C6YA 3ITBA 4PM9A 1BT5A 5EFWA 3E4QA 1NY0A 1NZUA 3F1OA 1HVBA 3FC7A 4AFIA 2EXAA 3QP6A 3OPPA 1XGJA 3S7OA 2Y2LA 1STZA 4LENA 4HH3A 3JPUA 1HLUP 1A0KA 3ZG9B 4WF0A 5EE8A 3VE3A 4WELA 5L07A 3A3JA 1KDSA 4ZTKA 2KDKA 4PM8A 1XXMA 4MBHA 1ESIA 4O0PA 2FZ0A 2XROA 3OZHA 1YLZA 3PBNA 5HL1A 5HZHA 2XLNA 3D4FA 4PM7A 2EXBA 2XR0A 4CLCB 3MSHA 2Z6CA 4EBLA 1D7EA 2GZAA 3ZFZA 4S2OA 3FZCA 1U60A 5CEDA 2OOLA 5EM1A 2Q9MA 1XP4A 1I2WA 3IWQA 4HI4A 2Y2IA 3EGXC 2P74A 5CTMA 2FH5A 3KYQA 2ZOHA 2VGLM 5GLDA 3LIFA 5AQ7A 1YLJA 2VV7A 3HUOA 4N9LA 3S4XA 2W3EA 3S22A 2WYXA 1ONHA 3Q7ZA 3T50A 2Y55A 4S2NA 2Z2LB 2H5SA 1N4OA 1ONGA 3VE4A 1KVLA 2HDRA 3OC2A 3IX4A 2WGWB 3BY9A 3E2KA 3LIBA 5CX7A 2XGNA 1LI0A 4C3QA 5E2HA 4GHIB 3UB8A 4WZ5A 2Y2QA 5DF9A 3HCYA 5IHVA 1ODVA 3VP2A 3TRCA 3MJQA 2ZMFA 3N8RA 4WEJA 2V1BA 1G68A 3SS4A 3T4SA 4P6ZM 2JHEA 2QPNA 2WZXA 5HW3A 1DP9A 2WKQA 4OH0A 5FATA 5EPHA 4WMCD 4JXSA 1JTDA 2HGVA 1OTBA 1W8YA 4NK3A 5I5LA 2OLUA 2ZBBA 5CHJA 3ZNTA 2ZL1B 1FSWA 3MQ0A 5A90A 3IX3A 3OBFA 1L0DA 2HP6A 3A3EA 3SH9A 4LV1A 3NDEA 2ZLYA 1MWRA 4QWOA 4E3KA 3T4OA 4XUXA 4DE0A 1SKOA 1YMSA 5HAPA 4PM6A 2VGJA 1ZG4A 3LY4A 3V3RA 4Y5FA 5DFXA 4BBVA 5E2EA 4MNRA 2X02A 3HLFA 3QP5A 1BYWA 4MDZA 3KYZA 2V1ZA 3BFCA 4EETB 3IHAA 2HDSA 4GD8A 3BRMA 4QJGA 2HZ5A 2D02A 4EW7A 3SS5A 2J9OA 2M7UA 4KG6A 4CLCC 3S1YA 3MZFA 2IA2A 2XFTA 3Q7VB 4FSFA 4Q0IA 2WKIA 4R1GA 1Q2QA 4DE1A 2XK1A 1K4FA 1FIKA 3R7WA 4M4XA 2DMWA 4S2LA 4S2PA 4KZ3A 1PI4A 2A49A 3CJMA 1P9WA 3IH8A 1K57C 4N92A 1LL8A 3HREA 3JYIA 2HJ9C 3SOIA 1MC0A 1W5DA 2PT7A 3HVFA 4R3JA 1QMFA 1TF1A 1FR6A 1ES5A 2X71A 4R4RA 3U2AA 1BULA 1BZAA 4GDBA 3RFBA 1OT9A 4L9EA 4HBUA 5JYOA 2QHKA 4QHCA 1YLTA 5HD5A 4GOGA 2VKSA 5CERA 3RXWA 5FQIA 2ZC6B 1TS8A 2PYRA 4JBFA 3UE6A 3BECA 3NI9A 2W1TB 3LIEA 4OPQA 5M19A 3N8SA 2XA7M 1YSPA 4HIAA 4JXVA 2ZJ9A 1YLYA 4DKIA 2PRFA 2GNXA 5DVAA 3KX0X 3O5YA 4E3OA 1KOUA 3F1NA 3BY8A 1TD5A 4HQAA 4GCZA 1LSVA 1CJFA 1H8YA 5HL6A 1XPBA 3CUEA 2ZQ7A 3IF6B 1MPLA 4WN5A 4KUKA 5KZHA 4PAUA 1KE0A 4F3LA 3G35A 3V39A 1K54C 1S4RA 5AVFA 3NOTC 2O9CA 4UA9A 5EVIC 3IXGA 3MBZA 4FCFA 2PU2A 5DJTA 4X56A 5FDHA 5FQQA 1DP6A 3UB5P 2WZZA 3KSHA 4X53A 2CMNA 3LR0A 3MF0A 5J3WA 1T19A 3C2WA 3PBOA 4MCWA 3ZG8B 1OTDA
chains in the Genus database with same CATH topology
4ESPA 2V8FA 1ACFA 3T1SA 1CQAA 3MSHA 4X1LA 4QWOA 4X25A 1SKOA 2ZL1A 1PFLA 1Z09A 2JKFA 1YPRA 3T12B 5EM1A 1G5UA 1SZVA 5EM0A 5EVEA 5EV0A 5FEGA 1Y4OA 1PNEA 3T1RA 3LEQA 5FEFA 2PBDP 4X1MA 2PRFA 3CHWP 2HZ5A 2BTFP 2PAVP 2E8JA 3DAVA 3MS6A 3L7HA 3CPTB 1CJFA 3NECA 5FDSA 2VK3A 4FUWA 2JKGA 3L9KA 3T1QB 1VEUB 1J3WA 3CPTA 2B95A 1VETB 1FIKA 3KYEA 1CF0A 2V8CA 1D1JA 3D9YA 1HLUP 1VEUA 1AWIA 1A0KA 1K0KA 3LGOA 1PRQA 4FTXA 3T1XA 1FILA 1VETA 1F2KA 3NULA 3U4LP 3UB5P 1SKOB 2ACGA 2ZL1B 4D60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ESP A;  2V8F A;  1ACF A;  3T1S A;  1CQA A;  3MSH A;  4X1L A;  4QWO A;  4X25 A;  1SKO A;  2ZL1 A;  1PFL A;  1Z09 A;  2JKF A;  1YPR A;  3T12 B;  5EM1 A;  1G5U A;  1SZV A;  5EM0 A;  5EVE A;  5EV0 A;  5FEG A;  1Y4O A;  1PNE A;  3T1R A;  3LEQ A;  5FEF A;  2PBD P;  4X1M A;  2PRF A;  3CHW P;  2HZ5 A;  2BTF P;  2PAV P;  2E8J A;  3DAV A;  3MS6 A;  3L7H A;  3CPT B;  1CJF A;  3NEC A;  5FDS A;  2VK3 A;  4FUW A;  2JKG A;  3L9K A;  3T1Q B;  1VEU B;  1J3W A;  3CPT A;  2B95 A;  1VET B;  1FIK A;  3KYE A;  1CF0 A;  2V8C A;  1D1J A;  3D9Y A;  1HLU P;  1VEU A;  1AWI A;  1A0K A;  1K0K A;  3LGO A;  1PRQ A;  4FTX A;  3T1X A;  1FIL A;  1VET A;  1F2K A;  3NUL A;  3U4L P;  3UB5 P;  1SKO B;  2ACG A;  2ZL1 B;  4D60 A; 
#chains in the Genus database with same CATH topology
 4MBK A;  2CC1 A;  4PM5 A;  3MQO A;  3SW1 A;  2Q9N A;  2EX2 A;  3IQA A;  4S2K A;  4G3V A;  4FD8 A;  4RVA A;  3BFD A;  4I3I A;  4ID4 A;  1GCE A;  5F1F A;  1YPR A;  3WS2 A;  1CI8 A;  5K5B A;  2J3T C;  1PW1 A;  1PNE A;  2WUQ A;  2IWD A;  2EFU A;  4MN7 A;  3P09 A;  4RQ9 A;  2RL3 A;  3SZT A;  1XX2 A;  1K6S A;  5M18 A;  3G34 A;  1PIO A;  4EUV A;  4X1M A;  2VA0 A;  4OKP A;  3C8C A;  4WLA A;  4X55 A;  1KVM A;  3DWZ A;  4JXW A;  4I38 A;  3VSK A;  2B02 A;  4P87 A;  3F1P B;  3DW0 A;  1YLP A;  4FUW A;  3G32 A;  3UE3 A;  5AVE A;  3V50 A;  2Z6D A;  4OPY A;  4CPK A;  2V0U A;  2GJ3 A;  2Y2H A;  4HY8 A;  1VQQ A;  3AGD A;  2XFS A;  3IS2 A;  4UHU A;  4BL3 A;  1BLS A;  5KSC A;  3UN7 A;  1PZO A;  1MBL A;  3RJU A;  4IBX A;  1SDN A;  4Y0O A;  3PYP A;  1BLH A;  3N4I A;  4PHT A;  2ZC5 B;  5JYP A;  2ZOI A;  1CEG A;  4H6J A;  2W3D A;  3BWL A;  4E3N A;  5HPI A;  1JWV A;  3Q1F A;  4WM9 A;  2V20 A;  4ZJ1 A;  4NXB A;  5DF8 A;  4IBR A;  1ERO A;  2R9W A;  3HLW A;  3S7P A;  5CRF A;  1ALQ A;  3GR2 A;  4Y7P A;  1BLC A;  2OLV A;  4ZDX A;  5TGF A;  2RCX A;  2XEP A;  4BD1 A;  3FYZ A;  2A24 A;  4N1H A;  3A3I A;  3M2J A;  4OOM A;  1FQG A;  2XRN A;  5HWV A;  5L8M A;  3KSG A;  3WRZ A;  1KE4 A;  2P04 A;  4BL2 A;  5TBM B;  4FH2 A;  3LID A;  3S7Q A;  5FEF A;  3C7V A;  1NLY A;  3MXQ A;  2XH9 A;  4M3K A;  2ZM8 A;  2NUP C;  1TDG A;  3CIT A;  3PHY A;  4Q8I A;  1DP8 A;  1PWC A;  3ZG5 A;  2VX8 A;  3H82 A;  4DN0 A;  1WYC A;  1K56 D;  3PAE A;  4E04 A;  4HHD A;  3HBR A;  2JKT I;  4U3T A;  5HSQ A;  2VJW A;  2WKR A;  4NEE D;  5HPF A;  3RTY A;  2J80 A;  4BD0 A;  3EOI A;  2OWJ A;  5EOO A;  1UWP X;  4WEK A;  1NXY A;  5E2G A;  1OJ5 A;  5F82 A;  1D1J A;  4OP8 A;  4YNR A;  4E3J A;  4JPM A;  3VP1 A;  3NY4 A;  1KE3 A;  4E3L A;  3M6B A;  1LLB A;  4EQ1 A;  1XJ3 A;  4FOF A;  3IWI A;  1MXO A;  1K0K A;  4EEP A;  1PRQ A;  3HLE A;  3B3X A;  4EWF A;  3O86 A;  3U4L P;  3NCK A;  1MWS A;  2Y2O A;  3PR6 A;  1G28 A;  3OOV A;  4L9F A;  3WRT A;  4C75 A;  3QP1 A;  3TG9 A;  2GX5 A;  1XJ6 A;  1SCW A;  5GL9 A;  1N9N A;  3DBA A;  2UV0 E;  1JWP A;  3GQZ A;  4K0X A;  3QNC A;  1NYM A;  4KEN B;  1G5U A;  3C4O A;  2FFY A;  4HES A;  4IVK A;  4O8G A;  4X69 A;  5J8X A;  3C38 A;  1T1A A;  3MZD A;  5M1A A;  2EA9 A;  2ZD8 A;  1T1B A;  5G4Z A;  5KMW A;  4EBN A;  1E3U D;  2B5R A;  4OPR A;  4UQI M;  4X68 A;  4B4Z A;  2ZMA A;  3G6O A;  2VV8 A;  5DFY A;  3ZG7 B;  2A2L A;  3NOP C;  1IYO A;  5GLA A;  5TFQ A;  1T1C A;  2H28 A;  4OQI A;  3NC8 A;  5AJG A;  4RX3 A;  2NUT C;  3IWO A;  2O99 A;  1IKI A;  5FDS A;  1GHI A;  4Z1W A;  3CLO A;  1Q2P A;  1WA9 A;  2XF3 A;  4ZRR A;  3ISG A;  1VM1 A;  4K91 A;  4NG2 A;  4KZA A;  3UPN A;  3ZCZ A;  4ARZ B;  3T4K A;  2VZW A;  4I3J A;  5IU1 A;  1RGZ A;  1L3L A;  2P9V A;  3BYD A;  1IYQ A;  3NHQ A;  1TDL A;  3WS0 A;  3CG5 A;  3UNW A;  3Q82 A;  4WZ4 A;  2G2W A;  4RA7 A;  5LBR A;  1T18 A;  1YAX A;  3LIA A;  2XD1 A;  3BFF A;  1KDW A;  1XFN A;  4QU3 A;  1YKD A;  3QHY A;  1BSG A;  1GHM A;  4IVI A;  4EU0 A;  4O7D A;  3GVB A;  4Z9Q A;  2Y2J A;  4P85 A;  4MN6 A;  4UA7 A;  3T4T A;  1BTL A;  2HP9 A;  3H7W A;  2PYP A;  1FCO A;  4OON A;  1OME A;  3V5M A;  3W4P A;  4HJ4 A;  4U0T A;  2WAE A;  2BG1 A;  3B33 A;  4O01 A;  2H0T A;  2EWV A;  4DXB A;  4BBT A;  1JTG A;  3QNB A;  3N8L A;  2JCH A;  1ZKJ A;  4XXR A;  1P0Z A;  3KO6 A;  4WL9 A;  5HDS A;  1H5X A;  4OLG A;  3VOL A;  3ICY A;  2PD7 A;  1N9B A;  2Y4A A;  2L4R A;  4IUK A;  3L7H A;  3KSF A;  5HWW A;  3LCE A;  2L1M A;  5F69 A;  4YIN A;  3WS1 A;  1Y54 A;  4BLM A;  2Y8H A;  3IXH A;  4BJP A;  4EXO A;  1ES3 A;  1VEU B;  4LGW A;  4LRZ E;  5FI7 A;  3P98 A;  1CK3 A;  3HLB A;  2ZM2 A;  3CPT A;  4KQO A;  4WMC A;  4Y15 A;  2P7J A;  1XA7 A;  3GV9 A;  2DRW A;  5F5Y A;  1MZU A;  4OQ0 A;  1IFQ A;  1AWI A;  1E4D A;  2VV6 A;  3BFG A;  1TVF A;  4YFM A;  4FTX A;  5KSH A;  3ZDJ A;  1VB6 A;  1F2K A;  3EEA A;  1CI9 A;  3FV7 A;  2L0W A;  3K3C A;  4Q0J A;  4D60 A;  2J3W A;  1LI9 A;  1SKF A;  1P97 A;  1JVJ A;  4LV3 A;  3UY6 A;  2VGL S;  2V0W A;  5DTK A;  3VP3 A;  2ZQ8 A;  3PXP A;  4OPZ A;  1W63 M;  4U0X A;  2XQZ A;  3G4P A;  1ZC2 A;  5EM0 A;  4CLC A;  4GS9 B;  3JVV A;  5KIZ A;  3LY3 A;  1MKM A;  3B42 A;  5GHY A;  3E4P A;  2UWX A;  4BMW A;  4Y17 A;  4EES A;  3FWL A;  3LYX A;  1FSY A;  3LIC A;  1H0M A;  2PBD P;  5GHX A;  3VP4 A;  1DY6 A;  2E8J A;  3T4L A;  4R38 A;  3Q07 A;  1JWZ A;  1K57 A;  2M1C A;  1N9O A;  4P6Z S;  4EBP A;  3HJK A;  2BAS A;  3C7U A;  5HFO A;  3T1Q B;  3T4Q A;  1K38 A;  2WGW A;  2ZQC A;  3BW6 A;  1VET B;  3B47 A;  5L09 A;  1NYY A;  4GHI A;  1CEF A;  1ESU A;  1QME A;  3CWF A;  4HH2 A;  5FL3 A;  5FI2 A;  3MMH A;  1NZO A;  2R78 A;  3Q81 A;  3QP4 A;  5EOE A;  3D3O A;  1DJB A;  1MY8 A;  5HX9 A;  5DF7 A;  1V9Z A;  1H8M A;  2QYB A;  3PBQ A;  4E6X A;  3HLG A;  3VV4 A;  2ZC4 B;  3SH8 A;  4DRT A;  4DJ2 A;  1YM1 A;  1LL9 A;  3ULF A;  2ZL1 A;  2ZC7 A;  1TS7 A;  3G2Y A;  2HP5 A;  4HJ6 A;  4ETZ A;  4DF6 A;  2G7U A;  3ZVW A;  2JKF A;  1OTI A;  3S7N A;  4KZ6 A;  2M7V A;  2OV5 A;  3ZG0 A;  2LB5 A;  5CGW A;  4E3I A;  3RH8 B;  3NDG A;  3T4J A;  4LFU A;  1IEL A;  3EEH A;  1N9L A;  4KZ5 A;  3IT9 A;  1Y28 A;  1K54 A;  2WKE A;  3HLC A;  1ES4 A;  4GKU A;  4QPR A;  5L10 A;  5DKL A;  4L9G A;  5EVI A;  3MS6 A;  5CGS A;  2YKH A;  3F1O B;  3NOU C;  3NEC A;  4LLO B;  3BLM A;  3G30 A;  2J8Y A;  4OLD A;  1W8Q A;  3FKV A;  3ZQ5 A;  1RP5 A;  5HAI A;  1P9R A;  4GNU A;  5U47 A;  2Y2M A;  1XFQ A;  2B95 A;  3Q7V A;  2PDR A;  4ETX A;  2HPB A;  3IBJ A;  3KYE A;  3FPW A;  1GSV A;  3PAG A;  3E98 A;  3IXD A;  5A92 A;  2PBY A;  1FIL A;  1ERQ A;  5IS1 A;  5BOH A;  2ACG A;  4FH4 A;  4RYE A;  4GJ4 A;  3ITA A;  1G6O A;  2DNS A;  4I3A A;  3UO9 A;  4DJ3 A;  2D01 A;  3IF5 A;  2WGV A;  2E8I A;  3IBR A;  5CTN A;  3VP0 A;  4N1X A;  4JF6 A;  2J7V A;  2XA7 S;  3G31 A;  4R6L A;  3W4Q A;  3OPL A;  1PI5 A;  4Q0H A;  2JKR M;  4UEY A;  5MC7 A;  2KOI A;  4NKP A;  5E2F A;  3GEC A;  4OVD A;  3IF6 C;  2P9V B;  4BBU A;  4MBF A;  4JGQ A;  3SH7 A;  3UB6 A;  2KLI A;  2W1T A;  3TE8 A;  4XT2 A;  4ME4 A;  4LV0 A;  5DTT A;  3MFX A;  1W79 A;  3E0Y A;  4I5S A;  3KSI A;  4DDS A;  1F98 A;  1SHV A;  4BEN A;  2KX6 A;  3IHB A;  3MR0 A;  5HDC A;  1K55 C;  2JKG A;  4KUO A;  1DJA A;  2PR6 A;  5AQA A;  3LFV A;  1ZTU A;  1K25 A;  1XJ2 A;  4Y2F A;  1M6K A;  2ZQD A;  2WAF A;  3ZHH A;  3IF6 A;  4JKT A;  3A0V A;  1S1Z A;  4IJG A;  3NUL A;  1SKO B;  3DTK A;  2WKP A;  1MWT A;  2VLG A;  2FFF B;  5G18 A;  2A3U A;  3VOY A;  5HDD A;  3ZNY A;  1YT4 A;  3T1S A;  3VOZ A;  5F6A A;  2W1R A;  5TR7 A;  4I39 A;  3LI9 A;  3IH9 A;  4R3A A;  5CHM A;  4E3M A;  1J9M A;  2JKT M;  4YOF A;  4EQI A;  2JC7 A;  3DTE A;  3T12 B;  2O9A A;  4OOY A;  3N7W A;  1C3B A;  1OJG A;  3E2L A;  3WS4 A;  5A93 A;  5FSR A;  1Z6F A;  3LUQ A;  1VHM A;  3MFD A;  3OLO A;  4P0M A;  2EX6 A;  3C5A A;  5FA7 A;  3DTI A;  1K56 A;  4LV2 A;  4JF5 A;  4B9O A;  1OPX A;  4JGO A;  5DTS A;  2O9B A;  5GLB A;  3I7J A;  4EV4 A;  3QP2 A;  4OOL A;  3PBR A;  1YQS A;  5CHU A;  3EQU A;  3M6H A;  3BEB A;  3OPH A;  1KGF A;  2EWW A;  4ZJ2 A;  1TS0 A;  3MXR A;  1IYS A;  3R7W B;  3W8K A;  2VK3 A;  3PBT A;  3TSG A;  4R4S A;  1LT0 A;  1MWU A;  2OAP 1;  5J7E A;  2V2F F;  3N6I A;  3UDF A;  3MKF A;  1FCM A;  2O0Y A;  4S2N C;  3F1P A;  1I2S A;  2AVX A;  4JGP A;  4EEU A;  5EUA A;  2V8C A;  3UB9 A;  2OWH A;  3LGO A;  3O3V A;  1FCN A;  3FG8 A;  4MLL A;  1S4S A;  4WZ5 C;  1ES2 A;  2QJ5 A;  4KZ7 A;  4Y0U A;  4HOI A;  2Y2P A;  4Y13 A;  3BJN A;  3MQQ A;  4GLQ A;  4GW9 A;  3NIA A;  4NXF A;  4IHQ A;  4R23 A;  4ESP A;  5HD3 A;  3D72 A;  3ZYT A;  1G6A A;  2P08 A;  1F9I A;  1YSQ A;  2Q0O A;  4K08 A;  1NLZ A;  1M40 A;  4Y0T A;  1E3U A;  2W3G A;  3E4O A;  3TJZ C;  3UB7 A;  2PR5 A;  1OTA A;  4MMN A;  3LR5 A;  5EV0 A;  5FEG A;  1W63 Q;  1F5M A;  3OCN A;  1WYB A;  3LEQ A;  3F1N B;  2ZM0 A;  5FAS A;  4JGR A;  5TJJ A;  5C5K A;  4WUJ A;  1DJC A;  4R70 A;  1S0W A;  5G4Y A;  1H3Q A;  3UMD A;  4NET A;  2HJE A;  5GLC A;  1TEM A;  4NXE A;  1GSW A;  1HTZ A;  5TBM A;  4F3L B;  4RX2 A;  1IKG A;  1L2S A;  4OQH A;  3QP8 A;  4LRX C;  5HAR A;  2V1A A;  3V3S A;  2QWS A;  3LEZ A;  4BQM A;  4WYY A;  3UPO A;  3NJA A;  1O07 A;  1LL5 A;  3M2K A;  4G3K A;  4LRY C;  3ZGA B;  1EWZ A;  2W3F A;  2PU4 A;  5F83 A;  3WS5 A;  1CF0 A;  3EGD C;  4ZAM A;  1RGY A;  5I94 A;  3NBL A;  4Y3I A;  3IX8 A;  4OQG A;  4X6T A;  4B4X A;  1S1Y A;  4S2M A;  3G2Z A;  4EUZ A;  3EQV A;  2WK0 A;  3VSL A;  4UAA A;  5AQB A;  3GMW A;  5E43 A;  3TW8 A;  3W2Z A;  1V9Y A;  2ZQA A;  1LSX A;  5EVI B;  3BQ8 A;  1S67 L;  1CQA A;  4PPR A;  5FAO A;  4X1L A;  1O7E A;  3VMA A;  2LB9 A;  1NRJ A;  4CLC D;  3A0S A;  1FR1 A;  2W3H A;  1L0G A;  4UQI S;  2I9V A;  3CMZ A;  4KZ8 A;  1SDE A;  1XA1 A;  4N9K A;  1S6R A;  2OAQ 1;  3LO7 A;  1PW8 A;  3BFE A;  4QY6 A;  4D2O A;  2WKH A;  1S66 L;  5CGX A;  5F68 A;  1L0F A;  3CHW P;  3UME A;  2XSS A;  3A3D A;  4KZ9 A;  3P01 A;  3DAV A;  2C6W B;  1PWG A;  1D06 A;  1YLW A;  4B88 A;  4II7 A;  4DE2 A;  4R3B A;  3IS2 B;  3MZE A;  4K0W A;  4JF4 A;  2QKP A;  1J3W A;  3O88 A;  1NJ4 A;  3FPV A;  4KZB A;  2GDN A;  2ZC3 B;  4H6J B;  4S2I A;  2Z2M B;  3D9Y A;  4L0L A;  2HF6 A;  1X0O A;  2IWB A;  4MEZ A;  3R4K A;  3CUE C;  4ARZ A;  3K2N A;  1ERM A;  1HZO A;  4DDY A;  1IOU A;  5DKK A;  4XT2 B;  2A24 B;  4IED A;  4CJN A;  4KQQ A;  3HL9 A;  3SS3 A;  1WE4 A;  1PFL A;  2WGI A;  3UE0 A;  3VFF A;  5AQ9 A;  1NWZ A;  4DXC A;  4DMZ A;  2K2N A;  2BLS A;  3GTC A;  4BWI A;  3UE1 A;  4LCM A;  1Y4O A;  3T1R A;  2OSU A;  2C5W B;  1OTE A;  3H82 B;  1BLP A;  4KG2 A;  5EVI D;  1GHP A;  5FQM A;  3OPR A;  3O87 A;  3AGF A;  2H0Y A;  3EWK A;  1ZG6 A;  4E6W A;  4F94 A;  2W27 A;  4OP5 A;  4CQH A;  4NXG A;  3BLS A;  2XD5 A;  2K31 A;  1IEM A;  5CXW A;  2YKF A;  3PTE A;  2DCF A;  4WBG A;  4EER A;  4MN5 A;  3L9K A;  4GD6 A;  4GN2 A;  1PWD A;  5HWT A;  3P7N A;  2MJ6 A;  2EX9 A;  2X01 A;  2JN7 A;  2IWC A;  1XGI A;  5GHZ A;  2VGK A;  1DRM A;  2J3T D;  1GA9 A;  3C4P A;  1VEU A;  5FAQ A;  1W7F A;  2Y91 A;  1K4E A;  1GA0 A;  3DTM A;  4LCL A;  3CAX A;  3GSG A;  3FKW A;  2QJ7 A;  2PD8 A;  3HJI A;  2W0N A;  4QY5 A;  4LPZ A;  2V9A A;  3CI6 A;  4HP9 A;  2QZ6 A;  2HDQ A;  3K3D A;  2V8F A;  2Y59 A;  3H9W A;  1KGG A;  2HV1 A;  4ZBE A;  3ZVT A;  4HJ3 A;  5FQ9 A;  1NRF A;  3RXX A;  3IXB A;  2Y79 A;  3WWX A;  1BUE A;  3UPP A;  5HAQ A;  1Z09 A;  4PKY G;  5CEC A;  3MXS A;  1SZV A;  5J4E A;  4XUZ A;  2QMI A;  4P6B A;  2HDU A;  1PZP A;  5A91 A;  2INW A;  5FQJ A;  4JXG A;  1EI5 A;  4ZJ3 A;  3LR4 A;  3HLD A;  5A8B A;  1FOF A;  2PHY A;  1JNU A;  2JKR I;  4GS9 A;  2Y2N A;  5IT5 A;  2I72 A;  2Y2G A;  3OCL A;  3HUN A;  2JE5 A;  4HBT A;  5D3O A;  1YMX A;  3A0R A;  5FAP A;  3BQA A;  3TOI A;  2G2U A;  4JLF A;  1L0E A;  2VEA A;  3DWK A;  4CLC E;  4S2J A;  5CEB A;  1AXB A;  5FQK A;  2EFX A;  2JBF A;  3V67 A;  2ZQ9 A;  3A3F A;  1KGE A;  4YWZ A;  1LHY A;  1K6R A;  2Y2K A;  3C30 A;  3AGE A;  3T1X A;  1I5Q A;  1VET A;  4DE3 A;  2H10 A;  3PBS A;  4GB7 A;  5FI6 A;  4UA6 A;  3W4O A;  4QB8 A;  5EVL A;  1XKZ A;  4HNB A;  4A5R A;  1ZHH B;  3H7W B;  2K7S A;  1OT6 A;  1ACF A;  1E25 A;  1PYY A;  1UGU A;  1XJ4 A;  4X25 A;  3JVU A;  4GZB A;  1IYP A;  4PKY A;  4HEF A;  3UDI A;  2XDM A;  1GSX A;  4H8R A;  3LR3 A;  4R0Q A;  2ZMV A;  3GRJ A;  5EVE A;  1H8Z A;  1MKI A;  4G3W A;  5L2F A;  4GDN A;  2WAD A;  2EX8 A;  1LSW A;  3CZD A;  4PMA A;  3GDI A;  5DJU A;  4KQR A;  1EW0 A;  4KG5 A;  1K55 A;  2J9P A;  5EEC A;  2BTF P;  4QD4 A;  4KZ4 A;  1RCJ A;  2PAV P;  3UDX A;  3LI8 A;  4HP4 A;  4B93 A;  3HUM A;  1TS6 A;  1UWN X;  5F1G A;  3VFH A;  3CPT B;  4IUH A;  2R9X A;  4KQD A;  2B18 A;  3BM6 A;  3MKE A;  1HD8 A;  4C6Y A;  3ITB A;  4PM9 A;  1BT5 A;  5EFW A;  3E4Q A;  1NY0 A;  1NZU A;  3F1O A;  1HVB A;  3FC7 A;  4AFI A;  2EXA A;  3QP6 A;  3OPP A;  1XGJ A;  3S7O A;  2Y2L A;  1STZ A;  4LEN A;  4HH3 A;  3JPU A;  1HLU P;  1A0K A;  3ZG9 B;  4WF0 A;  5EE8 A;  3VE3 A;  4WEL A;  5L07 A;  3A3J A;  1KDS A;  4ZTK A;  2KDK A;  4PM8 A;  1XXM A;  4MBH A;  1ESI A;  4O0P A;  2FZ0 A;  2XRO A;  3OZH A;  1YLZ A;  3PBN A;  5HL1 A;  5HZH A;  2XLN A;  3D4F A;  4PM7 A;  2EXB A;  2XR0 A;  4CLC B;  3MSH A;  2Z6C A;  4EBL A;  1D7E A;  2GZA A;  3ZFZ A;  4S2O A;  3FZC A;  1U60 A;  5CED A;  2OOL A;  5EM1 A;  2Q9M A;  1XP4 A;  1I2W A;  3IWQ A;  4HI4 A;  2Y2I A;  3EGX C;  2P74 A;  5CTM A;  2FH5 A;  3KYQ A;  2ZOH A;  2VGL M;  5GLD A;  3LIF A;  5AQ7 A;  1YLJ A;  2VV7 A;  3HUO A;  4N9L A;  3S4X A;  2W3E A;  3S22 A;  2WYX A;  1ONH A;  3Q7Z A;  3T50 A;  2Y55 A;  4S2N A;  2Z2L B;  2H5S A;  1N4O A;  1ONG A;  3VE4 A;  1KVL A;  2HDR A;  3OC2 A;  3IX4 A;  2WGW B;  3BY9 A;  3E2K A;  3LIB A;  5CX7 A;  2XGN A;  1LI0 A;  4C3Q A;  5E2H A;  4GHI B;  3UB8 A;  4WZ5 A;  2Y2Q A;  5DF9 A;  3HCY A;  5IHV A;  1ODV A;  3VP2 A;  3TRC A;  3MJQ A;  2ZMF A;  3N8R A;  4WEJ A;  2V1B A;  1G68 A;  3SS4 A;  3T4S A;  4P6Z M;  2JHE A;  2QPN A;  2WZX A;  5HW3 A;  1DP9 A;  2WKQ A;  4OH0 A;  5FAT A;  5EPH A;  4WMC D;  4JXS A;  1JTD A;  2HGV A;  1OTB A;  1W8Y A;  4NK3 A;  5I5L A;  2OLU A;  2ZBB A;  5CHJ A;  3ZNT A;  2ZL1 B;  1FSW A;  3MQ0 A;  5A90 A;  3IX3 A;  3OBF A;  1L0D A;  2HP6 A;  3A3E A;  3SH9 A;  4LV1 A;  3NDE A;  2ZLY A;  1MWR A;  4QWO A;  4E3K A;  3T4O A;  4XUX A;  4DE0 A;  1SKO A;  1YMS A;  5HAP A;  4PM6 A;  2VGJ A;  1ZG4 A;  3LY4 A;  3V3R A;  4Y5F A;  5DFX A;  4BBV A;  5E2E A;  4MNR A;  2X02 A;  3HLF A;  3QP5 A;  1BYW A;  4MDZ A;  3KYZ A;  2V1Z A;  3BFC A;  4EET B;  3IHA A;  2HDS A;  4GD8 A;  3BRM A;  4QJG A;  2HZ5 A;  2D02 A;  4EW7 A;  3SS5 A;  2J9O A;  2M7U A;  4KG6 A;  4CLC C;  3S1Y A;  3MZF A;  2IA2 A;  2XFT A;  3Q7V B;  4FSF A;  4Q0I A;  2WKI A;  4R1G A;  1Q2Q A;  4DE1 A;  2XK1 A;  1K4F A;  1FIK A;  3R7W A;  4M4X A;  2DMW A;  4S2L A;  4S2P A;  4KZ3 A;  1PI4 A;  2A49 A;  3CJM A;  1P9W A;  3IH8 A;  1K57 C;  4N92 A;  1LL8 A;  3HRE A;  3JYI A;  2HJ9 C;  3SOI A;  1MC0 A;  1W5D A;  2PT7 A;  3HVF A;  4R3J A;  1QMF A;  1TF1 A;  1FR6 A;  1ES5 A;  2X71 A;  4R4R A;  3U2A A;  1BUL A;  1BZA A;  4GDB A;  3RFB A;  1OT9 A;  4L9E A;  4HBU A;  5JYO A;  2QHK A;  4QHC A;  1YLT A;  5HD5 A;  4GOG A;  2VKS A;  5CER A;  3RXW A;  5FQI A;  2ZC6 B;  1TS8 A;  2PYR A;  4JBF A;  3UE6 A;  3BEC A;  3NI9 A;  2W1T B;  3LIE A;  4OPQ A;  5M19 A;  3N8S A;  2XA7 M;  1YSP A;  4HIA A;  4JXV A;  2ZJ9 A;  1YLY A;  4DKI A;  2PRF A;  2GNX A;  5DVA A;  3KX0 X;  3O5Y A;  4E3O A;  1KOU A;  3F1N A;  3BY8 A;  1TD5 A;  4HQA A;  4GCZ A;  1LSV A;  1CJF A;  1H8Y A;  5HL6 A;  1XPB A;  3CUE A;  2ZQ7 A;  3IF6 B;  1MPL A;  4WN5 A;  4KUK A;  5KZH A;  4PAU A;  1KE0 A;  4F3L A;  3G35 A;  3V39 A;  1K54 C;  1S4R A;  5AVF A;  3NOT C;  2O9C A;  4UA9 A;  5EVI C;  3IXG A;  3MBZ A;  4FCF A;  2PU2 A;  5DJT A;  4X56 A;  5FDH A;  5FQQ A;  1DP6 A;  3UB5 P;  2WZZ A;  3KSH A;  4X53 A;  2CMN A;  3LR0 A;  3MF0 A;  5J3W A;  1T19 A;  3C2W A;  3PBO A;  4MCW A;  3ZG8 B;  1OTD A; 
#chains in the Genus database with same CATH homology
 4ESP A;  2V8F A;  1ACF A;  3T1S A;  1CQA A;  3MSH A;  4X1L A;  4QWO A;  4X25 A;  1SKO A;  2ZL1 A;  1PFL A;  1Z09 A;  2JKF A;  1YPR A;  3T12 B;  5EM1 A;  1G5U A;  1SZV A;  5EM0 A;  5EVE A;  5EV0 A;  5FEG A;  1Y4O A;  1PNE A;  3T1R A;  3LEQ A;  5FEF A;  2PBD P;  4X1M A;  2PRF A;  3CHW P;  2HZ5 A;  2BTF P;  2PAV P;  2E8J A;  3DAV A;  3MS6 A;  3L7H A;  3CPT B;  1CJF A;  3NEC A;  5FDS A;  2VK3 A;  4FUW A;  2JKG A;  3L9K A;  3T1Q B;  1VEU B;  1J3W A;  3CPT A;  2B95 A;  1VET B;  1FIK A;  3KYE A;  1CF0 A;  2V8C A;  1D1J A;  3D9Y A;  1HLU P;  1VEU A;  1AWI A;  1A0K A;  1K0K A;  3LGO A;  1PRQ A;  4FTX A;  3T1X A;  1FIL A;  1VET A;  1F2K A;  3NUL A;  3U4L P;  3UB5 P;  1SKO B;  2ACG A;  2ZL1 B;  4D60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...