2WKRA

Structure of a photoactivatable rac1 containing the lov2 c450m mutant
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
317
structure length
317
Chain Sequence
b'ATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNMRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFHHVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NPH1-1, RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
publication title A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
pubmed doi rcsb
source organism Avena sativa
molecule tags Transferase, cell adhesion
total genus 109
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2wkrA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wkrA02
4Q5IA 1LT0A 1YRBA 3U7EB 3LIFA 3QBTA 4ZCMA 1CJMA 4JGOA 4MRSA 4R71A 2ZE7A 1E99A 5EP4A 2NTYC 2JHEA 2CEAA 3B8HA 4FWIB 4OQNA 2BEKA 3IIKA 2YC4C 4Q03A 3VR1A 3CM0A 4URXR 1E2NA 4MYTA 4IXMA 1IQPA 4AURA 4F91B 4JBYA 1DP6A 4I1OA 1Z6GA 3C5HA 5DYIA 4K81B 1E94E 5HCNA 1KI6A 2A5GA 1E79A 1DO2A 1PLLA 2ZRBA 2ZVQX 3IIJA 3L0PA 4Q1BA 3KKQA 3GLFE 3RRNA 2JJ2D 3ZVRA 1HT1E 2HXSA 2PT7A 1VYUA 3DVLA 2YWHA 1YZQA 2L1MA 4M53A 3IS2A 3SZRA 5A0FA 4DLSA 1R7RA 4P4SB 4NU0A 3TR5A 4PR0A 4BLTA 1P75A 3LDAA 1F98A 1X8JA 1QHNA 1NN1A 2AR7A 2IYRA 5DYGA 4QKQA 2JEOA 3A1UA 1XMIA 2AD5A 5GJCA 5JBQA 4PAMA 4D81A 2DCUA 5AJWA 3W6OA 3KTAB 4M9QA 2BEJA 4I3IA 3UB9A 2EQBA 1KSGA 1E1QD 2BJWA 3PENA 1WB9A 3G6OA 4FINA 5HTKA 1XPRA 2ZI7A 3BH7A 1OB2A 4BE7B 5J4VA 1Q0UA 2QHKA 1A2KC 2I1QA 4GRAA 4X8OA 2KB0A 3BWLA 4AI6A 1ESNA 4D4KA 2QJ7A 1D5CA 3ULFA 2FG5A 4ERNA 3GLGB 2FEMA 4A8JC 1G8FA 1WQ1R 1I2DA 2CJWA 3EX7C 1N5LA 4LC0A 3LWNA 4XSHA 2Z0MA 3IO3A 3VMFA 5F69A 1DOAA 4WN5A 1VHLA 2VLIA 3WYFA 1RRFA 2OBNA 1XJCA 2PJRA 4CVNA 4HUQA 4P0TA 4EPRA 5D3QA 3D3QA 4NCHA 2PYPA 2IF0A 1T8TA 3R7WA 3P20A 4DEYA 4W7SA 1KTVA 1P72A 3GFTA 1KMHB 2A9KA 4RSGA 2IS2A 1VIAA 5GJVC 3AVWA 3ADKA 2IHBA 3GLHE 2AKAB 1G8GA 2EFDB 3RLFA 2F1JA 5DI3A 1E4YA 2IA5A 2QMOA 2K7SA 3M4YA 1AK2A 3GLFA 4CEHA 1XXHB 4HH3A 1SVIA 4TLAA 1XZQA 1G3UA 1RJ9A 3FKSA 1Z0FA 1T1CA 2EW1A 3FYHA 3ZS8A 2Q6TA 4BBUA 1R5OA 4PO9A 1KSHA 4NH0A 4C30A 1T3HA 3HJKA 4GOKA 3VOLA 1Z0AA 2EWWA 3MWLA 2D2FA 3NEYA 4BASA 5D3MB 2GF9A 4PO1A 4RY2A 3DEFA 1A5TA 2WVJA 1MKYA 3BOSA 4D4LA 3GQBA 1GKUB 2AD1A 2HV1A 2ZYVX 4DEXA 5EXPA 2JLWA 2GESA 2X77A 1W36B 4BQSA 2AFIE 3L0SA 4BRUA 5EP1A 2ZXUA 3QXCA 4LPZA 4JJKA 5AVFA 1IY0A 1LVGA 2AL7A 2ZJZA 2MSCB 5J40A 4NYIR 3VR6A 4KQDA 1WDTA 4IXNA 4Q4AA 3SQWA 2BDTA 1R0XA 4DCVA 1J7KA 3Q85A 4L4UA 1NI3A 4EFMA 1AS2A 1E1RD 5K8TA 1CU1A 1T0JB 1NLFA 2Z5FA 1M7GA 2ZRAA 1AKEA 4ILEA 4E09A 5SZJA 1GRQA 2PX0A 4MH0R 3GJ5A 3CPEA 5DHAA 3I1FA 1XEXA 3B78A 5EP2A 3PUYA 2ZUCA 1H8HA 1DE0A 4B32A 1M74A 4LYJA 2VQSA 2ZJOA 1IN5A 4PSKA 4GSYA 5E4FA 1J2JA 5H1YA 1BO6A 3RHFA 2HXYA 3KFVA 1F2TB 2VHQA 3NIBA 4V03A 1DG1G 2D3WA 2J7KA 4OHXA 5C2JB 4ZKDA 4MGYR 3VTKA 1AZTA 4B35A 2DY1A 4PANA 1ZIPA 1DAKA 1XD2A 2J0UB 3TAUA 4OJKA 3VKGA 4D26A 1E2HA 3CF2A 3K9HA 2KI5A 3PEUA 1KK0A 4M9ZA 3ZS9A 3VNUA 1KOUA 1S4SA 2PR5A 1GRNA 4D0NA 4WZAE 3F1NA 4JLNA 2ZU6A 1VCNA 3GFPA 2GXUA 2OCAA 4TMZA 3MCAA 1GZSA 1O3YA 3R8CA 1KK1A 3KDSE 5FTMA 2ZVPX 3VE4A 4ON9A 4IOJA 1P3JA 1S4QA 1Q3HA 2CHVA 3SQXA 3QXSA 4HP9A 1KY2A 3NEJA 4TT3A 4BGDA 4LHZA 4XWAA 3PUWA 1S3SA 4TMKA 1W1WA 3MRSA 3OESA 3TMKA 1YZLA 1BOFA 1IXSB 3HU2A 4B6EA 4UQOA 2ECKA 2QI9C 1CF4A 1NY5A 4URZR 4MN6A 1PUIA 1E96A 3G0HA 2QE7A 4XIGS 1N0WA 3I8SA 2BJVA 1IHUA 3QNUA 5L3RA 3U44B 5F5YA 2PZFA 4TTPA 4Q7LA 4TWZA 4EQ6B 2JLQA 3MXQA 1K5GA 4DC9A 1ZYUA 5EXTA 2JJ1A 4XSGA 3AB3A 1JR3E 4YMSA 2W0MA 3QBVA 3CF0A 3F1PA 1ZINA 1EG7A 4Q7KA 3SN6A 4PAQA 3KUDA 4GMDA 1CS4C 4NCIA 1XCPA 1HQYE 1X3SA 5IHPA 2RMKA 2GZAA 3OAAA 3PCRB 4OI0A 3W5IA 4GNKA 3H82B 3SBEA 4KITB 2FZ4A 1P9RA 2XX3A 4RD2A 3QI2A 4V0NA 1FFHA 3PUVA 4G1UC 4KVGA 4DZZA 4GHIA 4TMVA 4QC2A 1RRPA 1NIJA 5KSOA 4KVAA 2QN6A 1Z08A 2JDID 4L9FA 5L3QA 3ZYCA 3AVPA 2V1AA 1EX6A 2BKUA 2ZJYA 4HAZA 2PH1A 1DO0A 3T5GA 5DSZA 5TVKA 2BCJQ 4J0QA 3FMPB 2XJ4A 2FSHA 3FG8A 2GF0A 2H28A 2QY9A 2UZIR 3REGA 4PPNA 1JR6A 2EYUA 2RGCA 4B33A 4OHYA 2P67A 1Z29A 4B76A 3QXJA 4M22A 3LX5A 3EA5A 2OXCA 3A1WA 4GOJA 2REXB 4N0EA 4NP6A 3JZMA 2G1JA 4JL5A 4BUJA 4DUGA 1CJKC 1K8RA 4F4IA 1W0KD 3AKDA 3AVVA 1Q1BA 1T9HA 3HWSA 3HJNA 5E7JA 1SXJE 4XVUA 2WJGA 3RS5A 2WSSA 3CRQA 1EXMA 1DBSA 4MRNA 5AUNB 1U0HC 3FMIA 4QFMA 4FWTA 1M2OB 1NP6A 3PG5A 3MQOA 1TF5A 3E1SA 4KBGA 4PZYA 4D80A 4RD4A 2CK3D 3FC7A 1QHGA 1VCOA 5K8UA 3HR8A 2GJAA 5UKDA 1N6RA 4OK6A 3FFAA 3GJ4A 2FFAA 2ZUBA 5HZHA 4FW9A 1GIAA 1F9IA 1J90A 2ZRDA 2GJ9A 3R9IA 1JEEA 2WJVA 3RRZA 2A24B 2O8FB 3PHYA 4HJ3A 1S1CA 4KJZA 4LRWA 2JLXA 4OQFA 1WE2A 1RVDA 3KTAA 4HZUB 3W3ZB 3BORA 1KI2A 4ZCIA 2Q9CA 1XTKA 5SZKB 2JLZA 3BERA 4D25A 2CHGA 5HD5A 1WP9A 1W44A 3UATA 1FP7A 4Q66C 3SFZA 2W6IA 1TX4B 5EJEA 2NO1A 1N9NA 4KUOA 1P2TA 3OHMA 2GCPA 4C9BA 4JLOA 3NDBB 1A7JA 2VF8A 1TS6A 1DAEA 1EGAA 2FPLA 4AYXA 2B92A 5HPYB 1OV4A 3ADBA 4AC9A 1OH8A 2V1BA 3DO6A 3AP3A 4ZI2A 1D9ZA 5JJIA 1U81A 3QEJA 1S4RA 2DYKA 3TSOA 1JAHA 1FX0B 5DJUA 2QT1A 1Z06A 3OLOA 4GFDA 1M7HA 5BYJA 1OXXK 1DAIA 4R70A 3ZGXA 2O0JA 2O8BB 3IUYA 2IYZA 5FBLB 1A82A 3SFVA 4M1WA 1SZPA 1GKIA 2RGBA 2PBRA 3K0FB 3I62A 2EWVA 1KY3A 1XXHA 2VSFA 4R2HA 4NCKA 2CLSA 3C8UA 4I99A 3EPLA 1HE8B 2GBLA 1JPJA 4AWXA 3GJ6A 5AUPB 2A78A 4L9WA 5FBWB 4LSGA 3W90A 1TUEA 2CVFA 4A8JB 2CDNA 3NOPC 3BFVA 3SHFA 4C0BA 1YR8A 1W2GA 1M6NA 1KO5A 1LB1B 5D3MA 2SHKA 1G8HA 4DUGD 3I61A 1T0HB 2ZRIA 5ELXA 3GLIA 1PUJA 2V8OA 3SEAA 2AK3A 5FUVA 3H84A 5DLQC 1FP6A 2WWHA 3AP1A 2ZI6A 1G3RA 3WY9A 5KYKA 1XTQA 3MFYA 1KDPA 4BFZA 2W27A 5JS7A 4LX0A 4EPTA 2CL0X 2ZI4A 1OJLA 3S1AA 3GP8A 2C9CA 2JIZA 2OXRA 4IKEA 2PHYA 1AS3A 2A30A 3LNCA 1PZNA 1ZJ6A 3TSWA 1JR3D 5BWMA 3ND9A 4XTRA 1Q3TA 2JASA 1QVRA 3UMFA 4QBHA 4JSYA 3V9PA 1L4YA 2IEZA 4L15A 1S9DA 3ZDQA 2QROA 1ZNZA 3TUIC 2P5TB 3MR0A 1DAHA 2GXAA 2DBYA 4UNPA 1CKEA 2GVZC 3AF1A 2R6FA 1NIPA 2ZRFA 4OK3A 4LJ7A 2RKOA 5IK2A 3KXLA 3BGWA 1F2TA 3R9WA 1S66L 3KB2A 1OXUA 4DIEA 5CM9C 1DP9A 1SXJC 2WIBA 4TQUS 1FPMA 4B3GA 2J0UA 4LPSA 4KV9A 4Y0VA 2OM2A 5LD2C 1NG1A 3D7MA 1NMZA 1ODFA 2V7QD 2NZJA 2TMKA 1NG9A 3TNFA 3GJ0A 1UADA 1IN4A 3OIYA 2ANBA 4JJZA 2WBLC 4LOAA 3VKHA 4EESA 2QAJA 3IBRA 4O0MA 1R0WA 2F1RA 2FFHA 4V0OA 4QJ3A 1TEVA 1UFQA 2KWIA 4NDZA 3U3RA 4IW3B 3WHLA 1FW6A 1EESA 4GW9A 2CHQA 1S0UA 1SXJD 2ZR9A 3KUCA 2ODEA 5B2ZA 3F1OB 5JZVA 2A5DA 2FWRA 4LPKA 5FUXA 3UG7A 4HUQB 1NBME 2QRZA 3IPYA 4JL8A 3MJRA 5F3WB 4B73A 3R7WB 3THXB 4ZKEA 3AVOA 1FTNA 2ASEA 5B30A 2ZTSA 4QHYA 2VH5R 4DKXA 1Q12A 2A5JA 5GJWC 3EPJA 4DLWA 1QHSA 4HHDA 1U8ZA 3T61A 3QF4A 3AUXA 5CYOA 4MRVA 2FGJA 3ECCA 1EWQA 3LBIA 2RGEA 4QJ5A 1XBTA 4UNQA 2HDNB 4CDGA 3GLFB 3GJ8A 4JGPA 3REFA 3U6BA 4B48A 1GAJA 4Q21A 4IVPA 2IS4A 1RW4A 1GG2A 4EQ6A 4EKDA 2CVHA 1T91A 2XAUA 3RABA 5HKKA 3Q5EA 3UB6A 2VPPA 4BPBA 3LW8A 4W5WA 2VHJA 2EA9A 1ZU5A 5EP3A 4DT1B 2H5EA 1WRBA 1G3IA 1HQCA 4IHQA 4KFSA 1G6OA 4RCYA 4B3FX 3IDQA 2WTUA 2WICA 1XU4A 1Z3IX 2VV8A 2JN7A 3H82A 5GVSA 2C96A 3BE4A 1BMFD 1KO1A 1LSXA 3WXMA 1T8UA 4DDTA 5C4GB 1Y3AA 2RHMA 3MGCA 3EZFA 3RRYA 4POAA 1FQJA 1Q21A 1TQ2A 3CONA 4O2LA 3U60B 4JGQA 2BM1A 4YDHB 3IHWA 1DS6A 4HLQB 3RSLA 4JL6A 3C7KA 3QF7A 2OFOA 3WBKA 2OFWA 3BK7A 4L5BA 3WHKA 1FOEB 3MD0A 5BW8A 1XD8A 5IK2D 4G5RA 2V54A 4URWR 3CWZA 1OIVA 2O0KA 5H8WA 4ASUA 2OZEA 3NH6A 1N0UA 1Z0JA 3KJEA 1D06A 1KJWA 1TU3A 2ZSAA 3X1WA 1XF9A 1Z6XA 2QRNA 4A82A 2CXXA 2IHYA 4Q4HB 3C14C 2VP0A 1SKYE 3ZD7A 4QHSA 3NTUA 3C8CA 4QNMA 1XMVA 3GLHB 3T5DA 1MO5A 2WKRA 4PQYA 1P6XA 1SKQA 1SGWA 1WMSA 2ZS7A 4QRHA 1JI0A 2ZI5A 4CT4B 3K09C 4E03A 1XD2B 1XD9A 1CJVC 4LCBA 2C8VA 2BC9A 4I1UA 2IS6A 4PTLA 4DIDA 1W4RA 4KBFA 2CE2X 3QJYA 2GDJA 1P2UA 4OL0A 4AKHA 1KDRA 4LRZE 3VHLB 5DH9A 4HATA 4B3DA 3EC2A 3AF0A 3EARA 1OIWA 4DLYA 1RIFA 4BLRA 1G9XA 3LVRE 4JLKA 4KHZA 5M04A 5BYKA 3A37A 1XEFA 4OQMA 5FTNA 2V9AA 1T1BA 2A24A 4NXEA 1KHTA 1FMJA 3AGQA 3AF4A 2X19A 3TIFA 1SVOA 1AQYA 1ZM3A 3BFXA 2VEAA 2L0XA 4A6PA 1YZGA 2ERYA 1JJ7A 2FA9A 1RRCA 1FZQA 3U7HB 2V9PA 4OQXA 3IBYA 3N5CA 2QP9X 5JCPA 2VSOA 4KLNA 2IXFA 3AKEA 1DRMA 3H7WA 3J81k 4A6XA 4C0KA 4C7OB 3A0VA 4BBTA 1NVVR 1E0KA 1UBEA 3AP2A 1JNYA 2Q9AA 4A0GA 1E1QA 2B6HA 2ZSFA 5J4YA 2W83A 1WBBA 4DDUA 1G3QA 4G5QA 4PXAA 4TYNA 1XTRA 3FGNA 4B43A 3RVBA 1W0JD 3H9WA 1X1RA 1JXOA 4PPQA 2PX3A 1RFLA 4HH2A 3LIEA 4HJ4A 1OFIA 1Z6AA 3MWYW 2ZRNA 5HCIA 2ZBBA 4Q00A 4DCSA 4KXFB 2QBYA 2FPMA 2JLVA 2O8BA 1MABA 2PCLA 5FOXA 4F92B 1RPZA 2ONKA 2W2VA 1EFCA 4CZ2A 2P65A 2C5LA 4YMTA 2AKYA 1G7CA 3B7GA 4XVQA 2K5UA 5LDDC 2OCYC 2AFHE 3BJIC 3K0FA 1PJRA 4JVSB 1IXRC 1GOTA 1MO4A 4WLAA 1IM2A 4XWKA 4MKGA 1WCV1 3N2IA 5A4JA 4ZDJA 2XEXA 4FMCF 4PC7A 2QMHA 3W34A 2XNDD 4F7WA 3EZ9A 3M1IA 3P26A 4KYIB 2QEQA 2W0NA 1NBMD 4GPTA 3ZQ6A 4A8JA 1VYVA 4ZPXA 3RYTC 3FE2A 2QM7A 1UKZA 1D2EA 3RH8B 1AM4D 2F7SA 3KB1A 3HPQA 1X1SA 5DIFA 4UNSA 4ZDIA 4WIAA 4Q1AA 4G5SA 4DLZA 3IQXA 4Q1DA 3U7FB 5CYPA 4DWJA 4EIWA 3U61B 4ACBA 3A36A 4DSOA 1OHHA 3LQRA 3CIOA 4LJ6A 4ESVA 2PZEA 2IYLD 4MGZR 4DDWA 5J47A 1SQ5A 1CP2A 4P33A 3TK1A 1NVVQ 2H57A 3E4QA 1HH4A 4LLOB 3AKCA 1K5DA 1KDOA 1XMSA 1NLZA 2QG6A 5JHHB 2GWHA 3CRRA 4W5JA 1T4GA 3U3MA 3ICYA 1G3MA 2ZI9A 2JCSA 3L8ZA 4PC1A 1SVMA 4Q7MB 4BEJA 1MO6A 2WPDD 4DXAA 4RZ3A 5DN6A 1J99A 4FI3C 2VLGA 1E2JA 2Z6CA 2ZRJA 4YMWA 3HDTA 4LRYC 1OW3B 3PUZA 3EZ7A 3RNLA 4P4UA 4IOLA 4NONA 1HTWA 3GCGA 4HEJA 4M8NE 4PHGA 1E1RA 3QPUA 4ZDKA 4PHFA 2PEYA 4TTQA 4D2IA 1OXVA 3QXXA 5DO9A 4BFYA 2M1CA 2J45A 3QQ5A 3I72A 1ZUHA 1A1VA 1E2PA 1GSIA 2BCGY 2JLRA 3ND8A 2HJGA 4NYMQ 3RS2A 1J8MF 4MGKR 4BRWA 4GL2A 2OLKA 4URYR 1SHKA 1LS1A 1OYYA 4JGRA 3KQUA 4BEBA 2G1KA 3QG5A 4WA7A 2ZE5A 1NMYA 2F1HA 2AN9A 4MGIR 1RYHA 3BB3A 1N2CE 3UWOA 3SI7A 3BIFA 1OXTA 3NBXX 4DCUA 6Q21A 5JHGB 2Z4RA 1S67L 5CDFA 4Q02A 3SOPA 1FUUA 4XTCS 4Z54A 2ORIA 2X2EA 3F1OA 3BY9A 3QKSB 2GJ8A 2LWIA 4OJQA 5TDHA 2Z83A 3OF5A 2YHSA 1SVLA 4EPVA 1KYIA 3B85A 1R4AA 2JA1A 5JMTA 5GADl 4MDEA 1V9ZA 3THXA 1V43A 2YJTD 1K6MA 2GRJA 5KDOA 3EW9A 3NBZC 4RD0A 5FOUA 4B34A 3I92A 1SXJB 4KFUA 1YR6A 3PUXA 5CB6A 5CIQA 1KKMA 4MDFA 3JVVA 4B3XA 3LA6A 4BFWA 4UXHA 2WOOA 2WZQA 5LD2B 1ZMXA 1KO7A 5JEEA 3U3JA 2LKDA 5J3WA 1P9WA 2ATVA 2BBOA 5CJ2A 3OEHD 2R9VA 1T5LA 2WV9A 2XZLA 4GP7A 4KO8A 3GDIA 5CJPA 3QPVA 1OHHD 3SNHA 4C0JA 4OHVA 4Q1EA 2ZAMA 2ZITA 2IC5A 5BN3A 4HAYA 4KUKA 2OLJA 1Z47A 5FR2A 3QPWA 5FTJA 1IXZA 5CLLA 2IYXA 3K53A 4DT1A 2I1VB 4WXRA 3TRFA 3EIQA 4OI1A 3GLIB 5HE8A 1G7TA 2BMFA 2WWFA 4CW7A 1DAGA 2ATXA 1CJTC 2OILA 4YWZA 1TMKA 3CBQA 4LBWA 4LYAA 2ZROA 4N3NA 4MA4A 1D8TA 2JLUA 1UM8A 1CXZA 3V4FA 2DPXA 5DN6D 4F93B 3I5YA 1VG1A 2NIPA 2J0QA 4B6FA 3B6EA 2WAXA 1NSFA 4FIDA 3HYTA 3MMPA 3S1AB 2NMVA 1Z83A 2O52A 1OTDA 3HU3A 1ESMA 1UBGA 3PEWA 3O8CA 4LJYA 4EQ1A 1E2EA 1E2LA 2GK7A 1I4TD 1VCIA 3AKYA 3NHBA 3Q9LA 4RFVA 3SYLA 1TF2A 2QP3A 5E7MA 5B58C 4CEIB 5JEDA 4S35A 2V0WA 2BWJA 2QKPA 3TW4A 1X6VA 4CF7A 2Z4SA 5EUMA 2DHRA 4O2RA 2ZJ5A 2WWWA 4EERA 1NF3A 2ZIAA 3TQFA 2P5SA 1G5TA 4OHWA 4KSCA 3CLOA 2YWEA 3KKPA 2VV6A 2JDIA 4RVCA 2DB3A 5HDSA 1G4UR 4PQFA 4Q4HA 4ACAA 2YKGA 4WVFA 2V6IA 4K08A 1Q1ZA 4WZ6A 3RWMB 2GZHA 4GOXA 1UEIA 1YR9A 1U8YA 1VB6A 4DSTA 5F98A 3GLHA 2D4HA 5G4YA 2JAQA 3PQCA 1CIPA 3KQLA 3G5UA 1H8ED 4FCVA 4FD2A 2L4RA 2RGDA 4LJAA 3KQKA 2V3CC 4AY2A 4JKIA 1ZM4A 1W0KA 1V9YA 3KQHA 1G7SA 1TEXA 4TYQA 1JEDA 1HA3A 1NVWQ 3KJGA 4LBYA 4HYYA 1UDWA 1NL3A 3C15C 4OHZA 2ZJ8A 5HSQA 4KAXA 3P4XA 2BMDA 1RYFA 4HQAA 2CK3A 2QTFA 5KTYA 5I5LA 1D9XA 5B64A 2VA8A 2CMNA 4NYIQ 2ODNA 1G28A 1Q44A 2GHIA 2VEDA 4HY8A 3WNDA 2KDKA 1BH2A 2Q21A 2WWXA 1R5BA 1UKVY 3T15A 1N6IA 3EPHA 3KX0X 1GUAA 4BFUA 3QF4B 1B23P 1II9A 4AG5A 3HU1A 3P4YA 4C7OA 5SZHB 3PEYA 4JLPA 2FF7A 2ZRKA 421PA 2ZETA 1VHTA 2J80A 2VP4A 4GBMA 4LJ4A 4I3JA 4CT5A 3ONWA 3THWB 1E3MA 5JWOA 4EFLA 3EIHA 1JQJC 3QKUA 5E95A 2OBMA 2OCBA 5AJXA 4L9GA 1C4OA 1SHZA 3PITA 1KOFA 1OT9A 3CPHA 4IEEA 3U3KA 1N9OA 5EZ5A 3A58B 5AJYA 1QVAA 2GILA 2X2FA 4JT4A 5AJZA 1ZC3A 2GCOB 4WAUA 2P7JA 2CNWD 2OEPA 4HLUC 3I8XA 3QE0A 2XOKD 1S9HA 1G41A 2GJKA 4L9EA 3MSXA 3QY0A 3LRPA 4LUCA 2RH5A 3M0EA 3PR1A 5LBIA 1OIXA 4NMMA 1KZ7B 1W2HA 3VU9A 4TTRA 5DNYB 4BWYA 3VE3A 3W9YA 2J5XA 2QPOA 4RD1A 1KSFX 1GRRA 1IOZA 2FNAA 4UJ3A 3ZQ5A 2NG1A 2O5VA 1PLJA 3X1YA 2QT0A 5HDCA 4DCTA 5LB2A 3EWKA 1G291 2F9LA 5H70A 2I3BA 3B1WA 1ZUNB 2BKEA 4OQLA 1OF1A 2E1RA 4UXIA 1XFNA 4PZLA 3T1QA 4ZV4A 3SJAA 3ADCA 121PA 1ZVQA 3HP1A 3JZAA 1AGPA 4RZ2A 1ZNYA 4ESHA 3L8YA 2PEZA 2XZPA 4QOSA 1YVDA 3TBKA 1YJ5A 5KNCA 1SULA 4IVQA 3N70A 5KOYA 4RD3A 2PMKA 2I9VA 1JB1A 4WUJA 1N5KA 1U9IC 1I4DD 1XRJA 3CZQA 1D7EA 2J3EA 2YYZA 1MV5A 1Z6TA 1EFUA 3IEUA 3WBJA 4EAQA 2XSZD 3CH5A 4Q19A 5KUTA 4I39A 3ZZUA 2D2EA 2XITA 1TS8A 3VR4A 1OB5A 3WYGA 4LJ5A 4A0HA 3CR8A 4RFSB 3HR7A 4HI0E 1ANKA 1DARA 2G3YA 4GCZA 3PXGA 2RAPA 3UANA 1JR3A 2VF7A 1TNDA 1S3GA 2B8WA 4H9GA 4ZDWA 3CAXA 2LCFA 2F6RA 4BLQA 1D6JA 1N5JA 2OV2A 3O8RA 4Q48A 2KSQA 4Y0AA 3GFOA 4TL9A 1GDDA 3TW8B 3IHLA 5F9HA 2V6JA 1SVSA 4M2LA 3GEHA 4JKYA 1VG9B 1TQ4A 2VV7A 2Z43A 2VP9A 4LV5B 4PQRA 2NOAA 3C2WA 3BFKA 5LPNA 4M1SA 2NQ2C 4HUTA 5AJVB 5KSPA 3E4PA 1XPUA 2Q3HA 3H7WB 5BQ5A 4QGFA 1AZSC 1EFRD 3RDPA 4GZMA 1CR2A 1G17A 3UKDA 4U5XA 2HT6A 2VP5A 4FXPA 5HD3A 4G5OA 4Q18A 1ZUIA 1W5SA 1Q1EA 3UMEA 2IYQA 2MSDB 2IUSA 1DADA 4KODA 3X1DA 1KJYA 3QKSA 1ZNWA 5EE1A 3I5XA 3BB1A 4DLRA 2R6DA 2V7QA 4B71A 5J5CA 4HSEA 4DHEA 2QM8A 3NVAA 1QHXA 521PA 4F4CA 1S96A 1E0AA 3FHTA 3KFXA 3A0SA 4URUR 2UVQA 1SKYB 2QNRA 4A2PA 1UAAA 2QBYB 4UJ5A 1SXJA 1MABB 1IBRA 2CE7A 3FB4A 4IDPA 4DRZA 3O47A 3X2SA 4QM6A 5DKKA 1XJ3A 3K3DA 1NVXQ 2EYQA 3EXAA 3SE0A 4HOIA 1NRJB 4G5GA 3A1TA 4DCNA 1W48A 3TAHA 5FPHA 2FDCA 2QJ5A 1E2DA 4N0DA 1VPLA 3I3SR 1JALA 2H7VA 2JLYA 4Q4JB 4O25A 2ZJAA 4Q7JB 2H16A 5FUWA 2REOA 3QIAA 4Q4LA 5J4HA 1PVOA 1GP2A 2C9YA 2Y8EA 4JS0A 4DBLC 3E2IA 5TV2A 2ORWA 1T3SA 2D74A 4UKDA 4NXBA 2QL6A 3TE6A 4TLEA 3IO5A 1XTIA 1GSXA 4CGZA 4FMDF 3CX8A 1OTBA 4MYHA 3LFUA 4JBWA 3VHXA 4LWZA 2I4IA 2C04A 2JATA 1S8FA 2ZSDA 5CK5A 2ZE6A 2EFCB 1AGRA 1UWPX 3F5FA 2J41A 2OT3B 2ONJA 4CEIA 1MRNA 2OHFA 3QOFA 3TR0A 1WF3A 2GAAA 1BMFA 1T3LA 2VP6A 4KI0A 2HUPA 3UK6A 3CKLA 2VTKA 1MZUA 2A5YB 2HCBA 3K9NA 2AWOA 1DP8A 2FSIA 2WKQA 4XD7D 3A1SA 2VL7A 4WOPA 3VAAA 1SVKA 4LBVA 2QSZA 5CB8A 4DJ3A 4XH9B 1W4CA 3A1VA 2YWFA 4L16A 1E9CA 2J46A 2W0SA 1U0JA 1U98A 3CNNA 3FHOA 3WMEA 2P6UA 4HI4A 1ODVA 2BV3A 2XTNA 3W6NA 2A3RA 5AUQA 4EPYA 1HT2E 1XX6A 1W46A 4IDHA 3WNBA 4A4DA 1E9AA 1ZCAA 3IEVA 5L3SB 5C46F 4MITA 1ZIOA 5FR1A 2R2AA 3DL0A 3RS4A 4PPFA 2C9OA 5JRJA 2ZRLA 4LDJA 1VECA 2FX3A 1XJ2A 2ZI3A 2PJZA 1E32A 3LV8A 1N25A 2Q0HA 5KDLA 4AIIA 5HWWA 4XT2B 1T19A 2QPAA 3NJAA 3QVUA 3RC3A 1LSVA 1UDXA 5CM8B 1P7CA 3N2EA 2ZSBA 3FKQA 1OPXA 2B7CA 2XXAB 4TL7A 3B60A 2W6JD 3MJQA 2F3RA 3T12A 4B75A 3Q5DA 1KI7A 5TXGA 2QU8A 2FE4A 1AQUA 2IBMA 1Z0DA 2QTVB 4EJSC 1KMQA 1H65A 1KIMA 5AR1A 3NDPA 2ZS9A 1GKYA 3Q8XB 3T1VA 1T18A 2YWGA 2QGNA 2OOLA 3EIEA 3K09A 5FUYA 5B57C 4AYWA 3NOUC 1W4BA 2YVUA 3EA0A 4KYUA 3UMSA 2IX3A 3SW1A 4I4LA 3THWA 4AD8A 5F2EA 1TQ6A 3LUQA 3FPAA 4D82A 5IF9A 4Q47A 2N42A 1OLOA 1T5IA 2IYUA 2BHRA 3SU8A 1YU9A 2H8KA 3DMNA 1DAFA 3CNLA 2GCOA 1G7RA 2BMJA 3VNVA 1OTEA 2A5FA 2PT5A 1GL9B 3AF3A 3B1YA 4AKGA 1ZD9A 4ARZB 1W0JA 3B33A 1UWNX 3U4QB 4TMTA 3K0SA 3E4OA 3LD9A 4CRWB 3NOTC 3FHCB 2HF9A 1R0ZA 5DE3A 1F48A 4Z1MD 3QSYA 4M1OA 2KJQA 1KZGB 2D62A 1COWD 2RB4A 3AGPA 2ZRHA 1Z07A 1DAMA 4G3XA 2ZS8A 1W7AA 3NXSA 2XB2A 1NSTA 2QQ0A 4KU4A 1T6NA 2J0VA 3SS8A 1II0A 2HF8A 2PD8A 1F3OA 2OSBA 2PL3A 2R6AA 3CW2A 3QEOA 1VG0B 5JSZA 3TUZC 4LHYA 1HV8A 2CBZA 2XNDA 4L9SA 4UNNA 1NBMA 3OEEA 4X8MA 2YOHA 5GVRA 1E9DA 1CTQA 3UE6A 1UEJA 1YKSA 2ORVA 2VHCA 1GL6A 1EWRA 4HJ6A 1QHHB 2ZOHA 2YOGA 3TJZA 4JVNA 2XGJA 1GITA 3CB4A 1CBUA 4MYCA 4NHOA 4PHTA 4PFSA 5HZKA 3F0TA 3H2YA 4GS9B 5KDDA 3KKMA 2BASA 3KXIA 4OK5A 3FTQA 2MSEB 3CX7A 4LHVA 4RFSA 2FEOA 4WBSA 1GFIA 1Y28A 3KX2A 1AS0A 2RGGA 3E70C 1GNRA 2OWHA 1G8PA 1XB2A 1YZKA 4LYFA 5JI2E 2B21A 1P2SA 2D06A 1II8B 3NBFA 3GEEA 3LY5A 3NBYC 4TQAA 1E2MA 1HUQA 2O8CB 3FOZA 1NLYA 2WPDA 1UKEA 2HCJB 4MKFA 3VR5A 1GSVA 1KK2A 1XWIA 3LQQA 1OFUX 5E7IA 2NPFA 3C5CA 1Z2CA 3K9GA 1BKDR 2PD7A 1OJGA 4EUNA 1YE8A 1L7VC 3T50A 1FNMA 4TYWA 5TMPA 2ODWA 4V0KA 3AVXA 2PDRA 4UXJA 2AHOA 2OAP1 1M1YE 5G3ZA 1TL7C 1Q22A 5JRZA 4A36A 3Q72A 4WF0A 2YINC 2CCJA 3K8YA 4TSFA 5CIWA 4IDNA 5KSZA 1E9EA 5FL7D 2DWOA 1RE0A 3ASYA 4F38A 2XZOA 4B2LA 3H4MA 3EG5A 2ZR0A 4IRUB 1P9NA 2IL1A 2GVDC 5AVEA 3HJIA 1ZD1A 1XMJA 2OCPA 4ZIRA 4NBSA 4E22A 1N9LA 3RRMA 4JLMA 1QHIA 4AYTA 4C2UA 1W4AA 2J87A 5EZ6B 4HNBA 4R2IA 3GJXC 3CRVA 5HR5A 2J7PD 2A7QA 2F1IA 4US2R 3Q7QA 1MT0A 4HB4A 4HDCA 2O8EA 1XCMA 5FOSA 2W00A 1Y63A 2G9NA 4Q9KA 5DGXA 3OE7D 2NGRA 2D7CA 2RGNC 3B1ZA 3VU9B 5H68A 1VDZA 4RQ9A 4H6JA 4LGMA 1G5PA 1U2RA 4HIAA 5J4LA 3ZLJA 1DTSA 1E9RA 5CLQA 2CMKA 3SJZA 4XWOA 1YZNA 1B0UA 3OEED 4Q4JA 1OKKA 3CRMA 1XCGB 2FZLA 2QMUA 3IILA 4NKRA 2AXPA 2O8DB 1S1MA 2ZRGA 4X8LA 1Z6YA 3FWYA 2OAQ1 5EE3A 2XNSA 2X8AA 3O8BA 3CF6R 3OEHA 4FMDB 3P7NA 2IUUA 4EEUA 4WL9A 3RC8A 3R8FA 2N1BA 3ZD6A 4V02A 2KBEA 2WMOB 4JLVA 4LK2A 2KBFA 4HAWA 1P4SA 5FPYA 1S2MA 3AVYA 1TF7A 4YXWD 1F2UB 4MUBA 3V00A 1BIFA 3NC1C 2NO9A 1YZUA 3IBGA 3BRWD 3KJHA 1G8YA 1RKBA 3GPLA 1NY6A 3E5HA 1SVWA 4PZZA 4FCWA 2OFXA 2OO7A 3B82A 1X8KA 4QNRA 3L82B 4AK9A 1BS1A 2IYTA 4GMXA 2V55B 1W47A 4NTZA 2PR6A 1ZM7A 1GTVA 1T1AA 4X8HA 4C4PA 2W58A 2KX6A 2CLDX 2Z6VA 1Z63A 1CR0A 4A1FA 2P3SA 4BFSA 1N6KA 1EFHA 2FU5C 3OIUA 4BLSA 3NC0C 1MO3A 4TSFD 4HB3A 2IEYA 4O3MA 1X86B 2WKPA 3VFDA 3TGPA 2BBSA 1V5WA 2QGZA 1QRAA 2IXGA 3MWKA 4KFTA 4MYUA 2VIIA 4IOMA 2R8RA 3NHAA 3EZ6A 4Q9JA 3THOA 4US0R 1LFDB 3C4JA 4Z51A 1JAIA 5L3SA 5G4ZA 1E98A 1LW7A 1L4UA 5F9FA 1H8EA 2WHXA 3V4RA 4K46A 4HLDA 1XPOA 4XT2A 3LLMA 4LZZA 5L3VA 2MMGA 1OE0A 1G64A 2IYWA 2XXAA 2V1XA 2D7DA 3D31A 1LY1A 1KO8A 5KU1A 1EFTA 4C3ZA 2BIFA 1KAGA 1NN0A 1NWZA 2C77A 1E2IA 3TSZA 3D72A 4C0SA 5JJLA 3RSOA 3QKRB 4M21A 4MRPA 1CULC 4V0LA 4B2PA 4DSNA 3DOEA 1LS6A 5IT5A 1GNPA 3LBNA 3LI8A 4WZBE 2Q9BA 4G0NA 1QZXA 1ZAKA 1OKKD 1IY1A 3L0OA 4PAOA 2WOJA 4I38A 1OSNA 2EFHB 1GM5A 4BBVA 5KPJA 3FMOB 2ZM5A 2ZUDA 2F55A 1LF0A 2ZEJA 4US1R 1Z0IA 4JVLA 1OFTA 4PSAA 5JWHA 3U3OA 3LICA 4BZPA 3AV0B 3WP1B 2XTMA 1D2NA 4EETB 4P3YA 2FMXA 3ICQB 1AKYA 1KI4A 4URVR 3R9XA 3WNCA 5DKLA 1JBKA 2ANCA 4P32A 4DDVA 1E9FA 3DM5A 1UGUA 3H0KA 4ARZA 4F3LA 2JLSA 4MKHA 3EWAA 5FBRB 4EJSB 2EFGA 1U90A 5A5GA 3ZVLA 4LI0A 3U4QA 1MR3F 4PC3A 2QMEA 4HAVA 2P2LA 1R8SA 1G5RA 5EQTA 1IY2A 2NO7A 3I32A 1TQDA 3QXHA 3P1JA 3K70C 1CLUA 1RRGA 2CNWA 4L8GA 1KGDA 1E6CA 2XOKA 2PMDA 3BBPA 4NCJA 3B5JA 2GA8A 1VCMA 4R7ZA 1CRQA 2F3TA 4PSVA 1A4RA 2B8TA 2IUTA 1DPFA 2WWIA 4NXGA 3BXZA 4CYMA 3PEVA 4MUAA 4RKFA 3ZVMA 4Q9LA 1E79D 2F43A 5JWRA 1XJ0A 3BY8A 1FUKA 2WM9B 3K70D 4I3AA 1KI3A 1WXQA 4EEPA 2ERXA 2YKFA 1UF9A 1JNUA 2H1LA 4HLUA 4JLJA 3SR0A 1AN0A 3EEHA 1U8AA 1VTKA 2WWGA 1QHHA 1TADA 3CWQA 3OFNA 1QF9A 2E87A 4FCTA 4QBIA 1WA9A 3K0AA 4A2WA 3EASA 1WBDA 1QG4A 2JGNA 5SZIA 3UMDA 1LNZA 1HEIA 1OFHA 2NZ8A 4YLGA 1EK0A 3DM9B 1U94A 1ZW6A 4GS9A 4I5SA 1HURA 4QBGB 1CJUC 1VKJA 5EUQB 1LV7A 3VX3A 2RGXA 2FOLA 3AUYA 3KKNA 1W5TA 2MMCA 4LJ8A 4ABYA 2H17A 1ELOA 2XSZA 4KLZA 1P97A 5HE9A 3A4MA 2YZ2A 4JMPA 1YRAA 3WYAA 1ZU4A 4YDSA 3U7GA 1KNXA 1II8A 5J7EA 4GT1A 4TZ0A 2RGAA 3UMRA 2GAOA 2O8CA 2DWQA 3LVQE 2FFQA 3KL4A 1IONA 1RC8A 2AWNA 1GNQA 3LXXA 3EPKA 5JJKA 5EXXA 1FTSA 2D01A 3T35A 5FI1B 2GJSA 3B13B 4RKEA 821PA 5FPKA 3L43A 1U9IA 1YHNA 2FPKA 4M1KA 3MQQA 4TLBA 1U99A 3DKPA 3Q7PA 3A4NA 3T1TA 1E2KA 5KNDA 2ZYWX 1Q20A 1OT6A 3MFXA 621PA 1IN7A 2FJUA 3D6TB 5TBMA 2CLCX 2QAGA 2INWA 1DEKA 3DKVA 1FL9A 1JJVA 2IWRA 4PC2A 5JCZA 4II7A 4D6PA 2VYFA 1I4LD 3MUFA 1KKLA 1MH1A 1IAQA 2ZPTX 3LO5A 1LF5A 3LX8A 4YQFA 4TYYA 2R65A 2G77B 1VMAA 5FI0B 1EFRA 4W9MC 2GKSA 3W8NA 1G19A 1X8LA 3DZ8A 1KNQA 3A4LA 1ZNXA 3FKSD 3ZJYA 3WP0A 1P2VA 5F6AA 1US8A 2G83A 3MWJA 1N3BA 2BOVA 5FOTA 2WMNB 1N6NA 2IYVA 2NO6A 2P0EA 4FMCB 2IWHA 2YC2C 4QG7A 1I2MA 3TQCA 3CRW1 3OIWA 4QM7A 2OE2A 4OKSA 2O0HA 2LKCA 2ZRCA 3PYPA 5TY0A 4Z8XA 4IFEA 3RS0A 4BFVA 1UPTA 4A0RA 2GNOA 3KQNA 2FSFA 2GXSA 3SBDA 4IEIA 4OBEA 1GVNB 3SYKA 3ZH9B 1E2FA 3AQ4A 1R8QA 4LV6A 5EE5B 5E3HA 1C9KA 4IFBA 3U5ZB 5JS8A 1LL8A 1TU4A 1JECA 5AK0A 5EE9A 2DFLA 2O8DA 1TAGA 2R44A 3U2QA 4BFXA 3QKTA 3IPXA 4CEJB 3OFND 3A0RA 4HB2A 4RZUA 4TL6A 1OTAA 4WXPA 4A2QA 5JSZB 1FNNA 2QUZA 3NWJA 4KSBA 5DI9A 3SJBA 3SJCA 3FMFA 5EFWA 2HEIA 3RWOA 3LYXA 1E9BA 1E0JA 2UZ3A 2GEUA 3P27A 3AM1A 4QXAA 3WRXC 3BB4A 1FMLA 2CCGA 4HLCA 5GJBA 3QVVA 3VKWA 4U7DA 2A2ZA 3X1XA 4BECA 1AA9A 3AVUA 1F2UA 5BN5A 4DLTA 1H8HD 1XEWX 1Z2AA 3GLGE 1OTIA 1NKSA 1OH7A 2HV8A 1CRPA 2JJ8A 5KSYA 1Q57A 3LLUA 4RZXA 3GMTA 1RZ3A 1YR7A 5ANRB 2QAGC 4R98A 4QGAA 3EZ2A 5TARA 1ZM2A 2NO0A 3KJIA 3ASZA 1E0SA 2PYRA 3W3AA 3EC1A 4GDFA 1Z22A 4IDOA 3KZ1E 3VX4A 4IDQA 2BMEA 1L8QA 1E69A 4I1SA 4NCNA 5FOWA 4OYHA 3THYB 2YV5A 2REBA 4JLBA 1P5ZB 1R2QA 3DDCA 3ETLA 1TTTA 4MN5A 4ITRC 3C16C 5FTKA 1OH6A 5HWVA 2IS1A 3TH5A 3KKOA 3ZVNA 2J59A 4AG6A 4LC1A 4M9SA 3B9PA 2HJVA 3I73A 1XXHE 4Q9IA 3QUSA 2QZ4A 3TVDA 4XD7A 2VSXA 2ZE8A 4NPHA 3CWFA 2J1LA 4AKIA 1BYIA 5KHOC 4NE2A 4YMVA 4KFRA 4P4SA 3DOFA 4TT3D 2QP4A 4LV8B 2QSYA 4NYJR 8OHMA 1TS0A 4BZQA 1NVUQ 4FN5A 2ZREA 3VR3A 3LW7A 5G3YA 1F6BA 5JECA 3GLIE 2QE7D 1J8YF 4E5UA 1Z0KA 5TB5A 3IGFA 4I1VA 4MKIA 1ZBDA 3PFIA 1Z5ZA 2XB4A 4HAXA 1WA5A 3FDIA 5EE0A 2FGKA 4ZIRB 4TN1A 1NJGA 1ZD8A 4PO8A 2OG2A 4JVMA 5IRCD 1ZRHA 4DSUA 1G16A 3QKRA 3UWKA 3ZZ0A 1CR1A 3X1ZA 1G6HA 3K9LA 5KO2A 2JJ1D 4DLUA 2Q3MA 4TLCA 5C18A 3GLGA 5P21A 2P6NA 4HZIA 4Q1CA 2W6JA 1TPZA 2DFKB 5HWTA 3NH9A 3MLEA 3CNOA 2YOFA 2VHUA 1XP8A 4H6JB 1G20E 2C2HA 5IS1A 3ZIAA 2GK6A 5HDDA 1F5NA 2GETA 4OI2A 5FBVB 1MRSA 1QHYA 3C41J 3OAAD 2PLFA 2QA5A 4R3AA 2VBCA 5IU1A 1P0ZA 2BVNA 3K0CA 4DB4A 2ZYUX 3CLVA 1KMHA 1FQKA 5DISB 2DFTA 3LIAA 2EU8A 2RCNA 4DB2A 4ZCLA 1XJQA 4UNRA 2FFBA 4RJLA 2ZRMA 5BN4A 3CR7A 4M4XA 1R0YA 3W8RA 5KPDA 3B1VA 2Z6DA 2F9MA 1P60A 1QG2A 2HLDA 3CZPA 3TKLA 2D02A 4EJSA 4A92A 1OT3A 1GL7A 4KCGA 2WJYA 3OIVA 4LBZA 2VP2A 4NYJQ 4R6LA 2YNMA 1MOZA 2QORA 4ZO4A 1E9SA 3Q3JB 4NXFA 2IF2A 4DLXA 1Z8FA 4TZ6A 4HP4A 2O8EB 3EAQA 5K8IA 3KXKA 2QTHA 3H86A 3L2OB 4B3BA 2WSSD 4EW7A 2ODBA 3UXMA 4C0QC 3T1OA 2WJHA 4Z1MA 1AJEA 3JVUA 3AEZA 221PA 4JIMA 1NMXA 3RS3A 1DVRA 4LYHA 1COWA 1NN3A 4U00A 3M6AA 2CCKA 3SHWA 2HYIC 4C2TA 1QBKC 1E2QA 3G82C 3BS4A 4CIDA 4IVRA 2IW3A 2HYDA 3PIRA 1ZCBA 2WJJA 4Q01A 3T34A 2GEDA 3DMDA 1KI6B 1OJ5A 3QENA 1OXSC 5G53C 3DHWC 4M1MA 1S1YA 1XFAA 4LHXA 4TQ9A 2QENA 3CH4B 4HAUA 3K70B 2PCJA 3BH6A 2P6RA 2VRWA 4QGGA 3IS2B 3GJ7A 4XVRA 2J9RA 1LTQA 4NL4H 4TMXA 4MRRA 2VO1A 4WW0A 3O8DA 4EPXA 1CEEA 3AF2A 2GTPA 1E2GA 5FPTA 3LXRA 2DFNA 3RTYA 3K0CC 2VHTA 3ZQJA 5A8BA 3GEIA 4EPWA 4N1AA 1UJ2A 2WAYA 1KI9A 1VYTA 5JFGA 3WMGA 4QHTA 1CR4A 2W6ID 4PHHA 4EXOA 3B9QA 2CL7X 4H1UA 4V0ME 4GI7A 3LIDA 3P32A 2OESA 4JSTA 1QDEA 3BC1A 3K3CA 2OWJA 2H18A 3CX6A 1M34E 1P62B 2IK8A 2FH5B 2Q3FA 4RD6A 5J4KA 1JQLB 3ZIAD 1IJEA 1ETUA 5FPSA 2FV8A 4G01B 4GZLA 4D0LB 1KI8A 2GBLC 2XTZA 4JLDA 3BAFA 1N6HA 3CO5A 1DELA 4M9XA 1ZM9A 4QL3A 3R20A 4ZI3A 2W2XA 2CJWB 4B44A 1YZTA 1N6OA 1Q1QA 2GJ3A 1UKYA 1GILA 1EX7A 5DJTA 3TVTA 1NN5A 3H1TA 3MG9A 4BLOA 5JLJA 2HLDD 1D2MA 3EWSA 2AX4A 4DJTA 2W2TA 1W36C 1ZC4A 2FN4A 1N5IA 3CPJB 4R9UC 4XJXA 3IQWA 4A0FA 1XDBA 1U0LA 2E9SA 2IXEA 2IT1A 2UKDA 4LHWA 5FL7A 1N6PA 4BLPA 2X1VA 3RS7A 4P31A 4MQBA 1YQTA 4M1YA 4IOKA 5DI3B 1HY3A 3UIEA 4GP6A 1OH5A 3U44A 3A8TA 4CEHB 2R62A 2GZDA 4F3LB 3TLXA 2CL6X 1C1YA 4D0GA 3ZZTA 1RJ9B 2NPIA 5FL3A 2ZJ2A 4EFNA 4M4SA 4TLDA 1XZPA 1BYUA 5C4MA 4PKYA 5LB4A 1W36D 2EFEB 2J7PA 1XFQA 1HYQA 5CK4A 4F4JA 4A9AA 2WWYA 3RAPR 3SYNA 4EDHA 1KJZA 2B7BA 1XTSA 1KO4A 4YONB 1L2TA 1AIPA 3OE7A 3ADDA 1LSWA 1PV4A 2V1UA 4CEJA 1UBFA 4JLAA 2JIZD 1GSWA 5FOVA 4D4MA 5FH9A 4V0MA 3B2EA 3UB8A 2GXQA 2ZANA 1XNJA 2DWPA 2F43B 4RCZA 1KAOA 2ZJBA 3W6PA 2RHDA 1PLKA 4B2IA 2HT1A 3AVQA 4S2EA 1IN8A 3W5JA 1TS7A 4C0HA 3PVSA 4Q1FA 3NHQA 3LBHA 3MJHA 4Q4AB 3FFBA 5KNBA 1JXMA 4LRXC 2XJ9A 3K0AB 2RGNA 3BH0A 4JYCA 2IYSA 4TL8A 4XOIA 4C0AC 1EW0A 1OYWA 3BD9A 2EVWX 2PLRA 5FFMA 2G6BA 2ZSEA 2ZOIA 3UG6A 3U6KA 1VG8A 1G18A 5G40A 1XEXB 4TYPA 3DZDA 2OUKA 4YXWA 1R10A 2G88A 2OBLA 3F8TA 5CITA 2WJIA 1R5NA 1ZP6A 4FMBB 2V0UA 3THYA 4PKYG 2R6GA 3F3YA 3VQTA 5DHFA 5AWFC 2FSGA 4M0LA 5J4EA 1O87A 3WRYC 4B47A 5JI3E 1KDTA 3MAAC 3SDZA 3PJRA 3ICEA 4JYBA 5BXQC 1G4AE 4PC6A 3LIBA 1S1ZA 3B1XA 5C1BA 721PA 1TUIA 1G1MA 4D4JA 1Z28A 1GWNA 2ZRPA 3K0EA 5K8LA 3I4LA 2QQEA 4HB0A 4JT2A 1HE1C 2QWSA 1XJ4A 4B9OA 2YKHA 3IKJA 2L0WA 1NJFA 1P73A 3F1NB 4IJMA 4LJ9A 1M8PA 5IDVA 3LI9A 4TMWA 5KIZA 4P4TA 3AVTA 5TBMB 2ZU0C 2JJ2A 4DLVA 1KSJA 2QAGB 2G0NA 2PZGA 3FVQA 2O8FA 3LH5A 5L8VA 4M1TA 4A15A 4HZUA 1M7BA 4H1VA 1NNEA 3RANA 4QJ4A 3OZXA 4NZYA 1UBCA 4OI4A 3D8BA 3CUEF 4HDOB 1F60A 3NKVA 2N46A 2QPTA 3SC3A 3NG1A 4AKEA 1XJ6A 3GD7A 1N6LA 5G41A 4HDQB 4B3CA 3WMFA 1US8B 5AUOB 1N0VC 3K1JA 1DG3A 4Z8YA 3LAWA 3UB7A 3IIMA 5HKKD 4BFTA 4DVGA 2J0SA 1A2BA 4I81A 1JPNA 2C98A 2IYYA 4JZKA 1BYWA 2H92A 2ZYTX 4U02A 1VIYA 4YC7A 3A6PC 4QBFA 1IJFA 4JBXA 3HYRA 3AH8A 1P61B 3GECA 1FX0A 4E07A 2KE5A 4E04A 4B74A 3BWDD 2ZR7A 3F1PB 1KK3A 1W49A 2BBTA 2C78A 2WIAA 2C95A 4W5HA 5EXSA 2BBWA 2WSMA 1J70A 3UPUA 2R6CA 2C03A 5FTLA 2AXNA 4K8OA 4Q9HA 3TUJC 1KI1A 1ONBA 4QGHA 4LY6A 4R38A 3T06B 3VR2A 1E4VA 2DR3A 2V4ZA 1G21E 2GCNA 2BM0A 5FBQB 4ASUD 4GHIB 2G0TA 3GJ3A 4PX9A 4DJ2A 4PPGA 4NYMR 2R78A 2B02A 1XTJA 3HPRA 4C0LA 3DPUA 1R6BX 2AK2A 2C99A 5F68A 1NKTA 1IN6A 1XEWY 2ZQ5A 3QG1A 4YMUA 5L3QB 4BZXA 3L0IB 2ZAOA 5CDFE 2GEVA 3PV0A 1X0OA
chains in the Genus database with same CATH superfamily
1NZDA 4UUBA 5EP4A 2OB1A 3D4FA 2Z2ZA 2CEAA 1E77A 5G0UA 5COBA 4WN9B 4LYDA 1KZ9A 2M2IA 1UPXA 2HO4A 1B0PA 3AM4A 1JZSA 3PSAA 3PE6A 3DVLA 4DLSA 3AM5A 1VGVA 5A0FA 3RC7A 3T4UA 1R7RA 2FWAA 3ZPXA 2JEOA 3F5QA 4PAMA 4MWSA 3EGDC 1AOXA 4FINA 2ZI7A 3BH7A 1H0SA 3DS8A 2QHKA 3H7AA 3EVDA 3C8HA 4D4KA 1BVYF 2FEMA 1U8EA 1M2FA 3WTCA 1ZSVA 1SG0A 2OBNA 1XJCA 4LOHA 5H02A 3DULA 5E6SB 2R0QC 3AW9A 4W7SA 4N03A 3F6CA 5JH7F 1KMHB 2A9KA 4DPLA 1VIAA 2IHBA 1O2DA 2EFDB 2AGVA 4MUKA 4RPGA 3GLFA 3TQSA 4H77A 4RF4A 3ZS8A 3LFTA 2XMPA 3NEYA 3ZKAA 4X6TA 4EB6B 1A5TA 4N18A 4ZVPA 3VR6A 3T4KA 4LG1A 1WSWA 4NEHB 4UVGA 1CU1A 4IIUA 2E21A 2I4LA 1NBAA 2I2XB 1NATA 1OC2A 1TZBA 2I33A 4O5AA 4D44A 1IN5A 2VKTA 3UJ9A 2HXYA 1ZG6A 1ZD3A 2VHQA 5ICEA 2D3WA 4QOGA 3EPPA 3WK5A 1PR0A 5GM1A 2FPPB 4QJIA 2KI5A 3GZTB 1S0WA 4KIWA 2ZBQA 2ZU6A 4UEOA 5GHZA 2IQIA 3EDCA 4FQ8A 1KMMA 2G67A 4IOJA 1S4QA 3LCJA 4CM4A 3EEQA 4CFZA 2FEWB 3PUWA 4D9NA 4UQOA 2QI9C 4ALKA 1BQ3A 4QGBA 1SIOA 4MMXB 3TMYA 2P9CA 4TM8A 3DBRB 1R15A 1ZK3A 2B5VA 4Q7LA 3AB3A 4JJ4A 2I6TA 4KXYA 2B34A 1OROA 1P4JA 4D3XA 1R9NA 4IJWA 3QI2A 5E2HA 4DZZA 2X22A 1W88A 2QD3A 5L3QA 3AVPA 2F90A 1WY7A 2O0YA 2BKLA 1YS1X 3AFIA 3WB1A 1LRJA 4DUGA 1K8RA 3AKDA 4R1QA 4WCFA 2N75A 1Q1BA 5LP6F 4QOIA 4UPDA 2B7LA 3I45A 1REQB 2G9VA 2C9DA 3OX1A 5D86A 5FJIA 4MW1A 3H83A 4G9BA 3EEOA 4MINA 5UKDA 2Z3VA 2P9VB 3PPVA 1EHYA 1RYYA 1AHHA 2A24B 1W35A 3UT5B 2C94A 4KJZA 5GL9A 3CVWA 4RVHA 2QLNA 3PF8A 1LLBA 3FH0A 3C3BA 2C57A 1N9NA 4U3TA 1R9GA 2FPSA 3CURA 4ML3A 5K45A 4HGYA 3M4XA 4ZI2A 5CH3A 1FRVA 2P9GA 3TSOA 4M7PA 5M18A 2PBYA 4N1XA 4R70A 3R3VA 2IYZA 3O2SB 3SMQA 2OYRA 1UFVA 1SZPA 3F98A 4Y1EA 4ZARA 3WV4A 2ES4A 1CUVA 1GR0A 1CC1S 1UAGA 4DUGD 3JALA 3RYHA 1ZSYA 5E2BA 3WY9A 3MFYA 1KDPA 3UK2A 2HZ7A 3LNCA 4UEJA 1UXJA 2AFVA 2YCLA 4M0DA 5ADUS 2QROA 4UNPA 3L3BA 2QRLA 2CGEA 1ZQ9A 4V1CB 3VFFA 4LJ7A 3PNYA 2ORYA 2JH9A 4DIEA 5GOZA 4WFKA 1VHWA 1K57A 1XRSB 2OM2A 3TOIA 3LVFO 2FMTA 5JS1A 3EFOB 2NQTA 3PLAE 1P7ZA 2X14A 3F1OB 3GFQA 3LKZA 4XE5A 3VKVA 4OU4A 4GM4A 3LT5A 3LKBA 5DFAA 5KWEA 4JXKA 5COAA 3UB5P 4RZSA 1NWCA 5E3JA 1ONPA 3PBSA 5L53A 3EMBA 1GG2A 1GTL1 4EKDA 1L8AA 1MNQA 2O48X 5HKKA 1NR1A 1K55C 1ZU5A 4JD5A 3VHQA 1WRBA 1P6UA 5GVSA 1EWTA 3Q7RA 1F0YA 1CFJA 1U0GA 3EF0A 2OFOA 3CWZA 2O0KA 3TE7A 2X6RA 2VCEA 3QUQA 4M76B 4CU5A 1MW9X 3B7PA 4A82A 1ISSA 1NMQA 5FNVF 4BVHA 5KTSA 1VKHA 5ARCA 3OSZA 4WWHA 2FPUA 3S28A 4WLVA 1P2UA 1KAQA 3MIIA 4Y2QA 1MJFA 3DFIA 2WD8A 3DKRA 4JLKA 2A1TS 3ZCSA 1Y6QA 4DR5B 1RYDA 1YZGA 2AQIA 1FZQA 2HHJA 4X60A 4O29A 1IKIA 3OURA 1JNYA 2V7PA 2B6HA 2LCQA 2QIPA 4CQHA 1RQ7A 3B7GA 2O19A 1YBAA 1IXRC 4N8SA 4TRRA 5BW5A 2OXFA 4EYKA 3Q9SA 4O5OA 2QEQA 2PMEA 1VJDA 4XCQA 2QM7A 3E7PA 3MK31 3KB1A 3HPQA 3U4CA 3GHYA 2P90A 2C00A 3S8MA 5EOVA 2XIQA 3BJZA 3S8YA 4KO1S 3BE5A 4ICIA 1VLMA 1O07A 3ENVA 2OBXA 2DF8A 2DHDA 1DUSA 3G34A 5FI5A 1YCGA 4BFYA 3DW3X 3QQ5A 2CXPA 4PM5A 2HTFA 3PICA 5E0KB 3D4LA 1FUUA 1ZD4A 3FSRA 5JE8A 4BBPA 5YASA 1SVLA 2DKFA 3B85A 3ESCA 1NX9A 1EFVA 1ENYA 3PUXA 2G8LA 4LWOA 4F97A 3ONFA 4JHXA 4EGQA 5J3WA 3B70A 3STUA 3C2QA 5IT4A 4C0JA 4R3JA 2X9VA 2POCA 5GONB 3F3SA 4UUMA 4EJMA 5JDCC 2RCYA 4LYAA 4O6VA 1WPRA 3BEBA 4MA4A 4Z7NB 2O52A 4ZICA 2BP7A 4Y17A 3CNBA 2Q0OA 3HM9A 5MGNA 2VTBA 5LNK6 3HN6A 2HFJA 4H6PA 4CF7A 2Z4SA 5DHTA 3PGKA 1VZ2A 3KKPA 3HJHA 2ZIGA 2J6IA 1Q0HA 4EYOA 2XTAA 2DFDA 1JG3A 5F64A 2RGDA 3MWDA 4BO7A 1V9YA 1HA3A 2NZYA 2P9BA 5D7NA 4MDHA 3IHKA 2AFIA 1ZOSA 4H1WA 2FF5A 3UXYA 4JU9A 4X5OA 3MS7A 3TF5A 4O08A 3IQIX 1GADO 2C07A 3I8XA 4HAOA 4A27A 1TZJA 3M0EA 1WDKA 1NW8A 3WKBA 2XVMA 1X87A 3UOAB 1GRRA 1PT7A 3RCBA 3O8OA 3ZQ5A 2O5VA 3RNOA 1YIAA 2BFPA 1ZEJA 4TOIA 2E1RA 4UPEA 1AGPA 1ZNYA 4RANA 2VRBA 1NAIA 4Q34A 5ENZA 2PMKA 4R41A 3GARA 4WUJA 4WLNA 4I39A 4A5SA 2PMWB 2XITA 2Y91A 2IGTA 1SEPA 3IBCA 2DJIA 1JR3A 3QWBA 4ZV9A 2F6RA 3TQQA 5EJ8A 2H1RA 2WP8J 1SRQA 3CKMA 2HDHA 4PQRA 5B58T 2PBDP 1UIMA 3IA2A 5D3ZA 5DXFA 4RVOA 4G5OA 3BB1A 1U6KA 4IUHA 1J20A 1E0AA 3AUTA 3K8ZA 3LC0A 4IBRA 1NYRA 1T0UA 3CE9A 5AK6A 1MABB 5DGCA 3Q81A 3EXAA 3G59A 3TAHA 2XD5A 3I3SR 3MJTA 2Z8XA 2ZJAA 4JP2A 5DHRA 4G8CA 4Q4LA 5JO9A 1C7IA 5BXYA 1D6NA 1USGA 2D74A 4BJPA 4TLEA 2X01A 4HEA6 3VTFA 3ULKA 2ZM6B 4AT1A 1MH9A 3LFUA 3VHXA 2QLJA 1O08A 1ML3A 2JAXA 4FHCA 3QOFA 2POQX 1T3LA 3IP7A 2A5YB 3RI3A 5A1TA 2J9GA 2WKQA 3H75A 4BMSA 5ECYA 1F20A 3QX7A 3UN7A 3FHOA 1W63Q 4JBFA 2XTNA 4BU0A 2WIFA 3T3MB 3E82A 1HTBA 3FV7A 5AW2A 3RC9A 2ZRLA 1DINA 3U31A 2ZSBA 1OILA 3CW8X 4CMHA 3Q5DA 3KEOA 3C3WA 3VV2A 1Z0DA 1ZVKA 4TTSA 1E6EA 2PPLA 1MGPA 2BEVB 4M8SA 4CQJA 5K3EA 3AHEA 4CM3A 1MIHA 4O4HA 3FPAA 1I2CA 4ZQFA 1YU9A 5AM3A 3DMNA 3T1XA 5HDQA 1ES9A 3V8BA 3NHPA 2BMJA 1XTUA 2A5FA 3N8NA 1N9KA 1LQTA 2GS9A 3U4QB 2G04A 5SYAA 2WF7A 3DDNA 3KQMA 1X77A 4ZODA 1ZN2A 1IY8A 1BLCA 1R37A 3G6WA 4D9FA 2J0VA 4N8DA 2VNIA 5I9NA 4ZPJA 2QIOA 1YSPA 1Z7YA 3E61A 1HZZA 1E9DA 3P9QA 4CNQA 2M6RA 2WIJA 2AE2A 4F3RA 5KDDA 4CG3A 2MSEB 5IJ0A 3MMZA 2D00A 1XB2A 2KX7A 4LYFA 3LY4A 4QD4A 4CLRB 1FDSA 2I6QA 2WAMA 2G25A 3NNNA 3HUEA 2ZC7A 3FXAA 2RG7A 4IH1A 2ZKLA 4H0CA 4MVJG 1I3OA 3K5HA 4NSNA 3S5JA 1XA1A 4C4RA 4LRYA 4YRSA 3WS5A 1H4TA 1PWXA 1K5PA 3P52A 1DOZA 3HKDA 2BL4A 3CRVA 3NY4A 4HVTA 3DE7X 3VU9B 4AMVA 5H68A 5IM4F 4NV1A 5IKOA 1J42A 1GU7A 3GRKA 3U9SA 3PNVA 3ZCQA 1E63A 4Y5FA 4C4ZA 5EV0A 4YR9A 2PVSA 4WKNA 4IV8A 3CZ5A 3F3MA 1NW5A 3P5SA 3MJFA 4PZZA 1O89A 5JG7A 2FUCA 4ENTA 4L7VA 4LJLA 3KAKA 5JSUA 4MUFA 4YRZA 4ARSA 2P3SA 1MO3A 1OI3A 3C4OA 4R83A 3W2FA 3E84A 1ACJA 3FYTA 3LZDA 2QGZA 3RFBA 2ZM8A 4CKZA 2XDQB 4HP8A 3ITBA 4JI4B 3VPCA 3TINA 3B2QA 1VJ5A 3EXIA 5IBRA 1L7OA 4WACA 4G0VA 4XT2A 4FN4A 1T1JA 1KO8A 4YB8A 1O97D 4YV7A 4DSNA 1NXOA 4UBMA 5LWHA 4PAOA 4EA9A 1PGNA 3V42A 5LXTB 1QHFA 2ZEJA 4CTMA 3WLLA 2IZZA 4MQLA 1HT3A 4W5QA 4XYGA 4BZPA 4KI7A 4KFCA 1Q1AA 2ILVA 1FRFS 3R9XA 3OKFA 4QJBA 1UGUA 4H3HB 2QL7A 2EFGA 3AR8A 1QU2A 4LI0A 5JALA 2P2LA 2XKJE 4JX9A 2VEOA 1G5UA 4S2PA 1QCZA 1J07A 1AQNA 1SZDA 3IQEA 3WX0A 2JFHA 2XA7S 1JDNA 4KZAA 5FNVB 1XMXA 1ML4A 1NRXA 1EB9A 5CXWA 4ZAMA 2G80A 4C6YA 2J8YA 3DM9B 1U94A 4QE3A 1S89A 1JG2A 3MFQA 1LV7A 3UMCA 5KJ1A 3GRYA 1CB0A 3TQOA 1MJGM 3UMRA 2GAOA 1QYVA 3WO0A 4HH3C 1RCJA 4TLBA 5TC4A 3T1TA 1G2OA 1PTJC 3GT3A 1C7JA 1IN7A 1V7ZA 4REOA 4L3WA 1JJVA 5JCZA 4II7A 4UU1A 1LF5A 5EIBC 2H10A 1TC2A 4AMGA 3ZLBA 1ZY2A 4EHNA 4I5GA 2ISSD 3EFEA 3MTJA 2ODPA 5DIZA 4BIIA 4TVKA 1QXSA 5EE5B 4BKMA 1XXLA 4ZYZA 4CIXA 2IOFA 2R96A 5JSZB 3NWJA 5DI9A 2IX9A 4O8ZA 3T3OA 4AROA 5KYWA 4I5IA 4HT3B 3VKWA 3SVTA 1B6RA 1I7QB 2A2ZA 1XL1A 4LGYA 3O1JC 3I9MA 5DM2A 1XEWX 3S3TA 2D1TA 3TB4A 5KSYA 1Q57A 4EA8A 4RKWA 4QUGA 3HCYA 1HDEA 2AS0A 3V48A 3NFRA 1TTHA 1NQTA 3IRUA 4B85A 5BQOA 4M9SA 3I73A 4Q9IA 3QUSA 2ZC4B 4XD7A 1JVNA 1X7XB 1EBBA 3I6ZA 3DOFA 4H60A 1C0EA 1N8NA 1FILA 5DU2A 1TYEB 1UFOA 2GUWA 4IG9A 1H2HA 3EGEA 3UC5A 2Q3MA 5CT9A 3K94A 4YRTA 1TW2A 1GQSA 1AO3A 2GETA 4HF7A 4OI2A 4FR5A 4QARA 2ARKA 2QA5A 5B3AA 5DISB 4XUGB 1M9NA 1QRRA 4EG5A 4NKPA 2D02A 3UAVA 3WSWA 3HQ4O 1DWPA 4CMGA 3L6OO 4GN2A 3SC2A 5IUKC 3Q3EA 4G0QA 5AW3A 5HAPA 2NNLD 5JQGA 3G82C 4CIDA 3JR7A 1T9CA 1MAUA 1X13A 5T64A 2R5FA 3UUEA 2EQAA 1JJIA 4OOLA 2VP3A 3QITA 4Q37A 3RTYA 1WWKA 4HQ0A 2O7QA 3HVJA 1GA0A 4P0PB 2XOXA 4MLLA 1VCHA 2Q3FA 2X23A 1WCIB 3G35A 1E6KA 1Q1QA 1UKYA 5BNWA 5FADA 5F2OA 4XWWA 4CIVA 4LECA 4YDQA 4DR7B 1N5IA 3ZKWB 1PNRA 3OZEA 4IOKA 1HY3A 2CVZA 4L08A 2GZDA 1HDRA 2PM8A 5FL3A 4EFNA 1NQUA 2HEGA 1AIPA 2WM2A 5K09A 2G76A 4BQEA 2D0IA 2I7CA 1KAOA 1PLKA 1WXDA 1J9EA 2CKDA 3KSHA 1U2GA 1FIKA 3EZGA 4LSZA 1O4VA 2D59A 5FDSA 2RGNA 4UTOA 4TV9B 3NS7A 4RM3A 2ZCVA 5KQGA 3AIIA 5FA8A 1MXFA 3P9IA 3WLRA 1MBZA 2V0UA 4G8JA 4TUYA 1MOPA 1O87A 1YLYA 2JHPA 4R69A 5JI3E 2PRIA 1GNTA 3DW1X 4ZHQF 4NV0A 3UHJA 3LUDA 1NVTA 2HRRA 3KOOA 3OZRA 3RQSA 1P73A 4DLLA 4PLTA 2WEKA 5KIZA 3OCNA 4ZVMA 4RDCA 3R44A 3T3NA 5JFTA 3NG1A 4AKEA 1XJ6A 3KSAC 3SMVA 5HEKA 1N0VC 2JC3A 4M7WA 2HBZA 4CMBA 3E3AA 3CVYA 1GYRA 1Q83A 3PGMA 4R68A 5IN4A 2WIAA 2ET6A 4YK7A 1FVXA 3FIUA 4UMVA 1ZH0A 3C7AA 4QD3A 2C7VA 1M1YA 1BTLA 3EIWA 5F68A 3L0IB 1LJ8A 2ZBDA 2Z8YM 1LT0A 3IQFA 4WNYA 2ZIEA 4OPQA 4R71A 3DLBA 1T2EA 4FGWA 4OLHA 4ALJA 2YC4C 4RU1A 2FWBA 4S2UA 1FYDA 1Z6GA 1CUAA 4K81B 2ID4A 4FYVA 3L0PA 1E79A 3KPWA 2ZVQX 5AKEA 2NUBA 1VYUA 4DMMA 4CTOA 3NNDA 1R88A 5AYVA 4Y6LA 3CSUA 3VDQA 1F98A 3U9TA 2IYRA 2AR7A 2PGDA 4I9NA 4FOTA 2WD7A 3I28A 3TKYA 4RH0A 2WJPA 1Q0UA 3U3XA 2P2ZA 2QXYA 3GLGB 3AI2A 2ENUA 3EX7C 2VYCA 1Y6ZA 3ZWQA 1VHLA 3WL7A 1YI8A 4J2TA 1PR9A 1T8YA 1WR8A 2WVAA 4Q3BA 1CY8A 3H6KA 1ZH2A 3AESB 3FUCA 4E5YA 2IS2A 1P19A 3ZHBA 1XQ9A 3H2JA 4WXMA 1A1SA 3M4YA 4BU1A 1C9EA 4RZIA 1QGZA 4EW6A 2C3UA 1KS9A 4RESA 2IOQA 1HEUA 4S1WA 4PRZA 4R0QA 1MKYA 5FATA 3GG9A 5IT0A 4CMKA 2ZXUA 4KLCA 3REOA 4GI3A 2PKXA 4CDNA 2NV6A 3QVOA 1KP2A 1RPJA 3HCWA 1M0SA 2H4ZA 5K8TA 1NLFA 1O57A 2R9XA 4GNUA 1BCRB 5IAGA 4FTXA 3HS3A 3PUYA 1TD1A 2XMRA 5DBIA 4OIFA 1YBFA 4RE6A 1C8LA 3TX2A 4P7GA 2WAFA 3H1GA 5AESA 1NVGA 3R5KA 3F1NA 4KOAA 3H7IA 3QFFA 2EARA 2Q2WA 4MYDA 3W8EA 3MPOA 3YASA 3AR6A 1YZLA 4WXYB 3OJOA 4JBIA 1E96A 3NTXA 5EHXA 4KR6A 3ZY5A 2FZEA 5EXTA 4JGIA 5LU8A 4KDCA 3F1PA 1ZINA 3FA2A 3SN6A 4DNQA 3KUDA 4NCIA 5CGXA 3ITEA 3W5CA 5CB4A 1S01A 3SBEA 1HLUP 1YE3A 3WFZA 2GK3A 4RQUA 3IPAA 3WNVA 2XYRA 3ZYCA 1T0IA 3JAKA 3PQ6A 3UOGA 3FNIA 2B5RA 2XV1A 3A1WA 3ZVKA 1T2AA 3I3OA 5G0SA 1NPYA 1BVUA 4DRXA 3K3PA 3HABA 3PG5A 2X0NA 3VR4H 2W4MA 3S40A 3HR8A 1LBIA 2CXTA 3T3DA 4ZYYA 2OO5A 5D87A 1F9IA 1IYOA 1Z45A 1WE2A 3E5NA 1S5PA 1U2SA 1T13A 3HJTA 1CV2A 3ISJA 5CEDA 1FBNA 1OREA 2QD5A 3HDJA 1ISGA 2FPLA 4QLOA 2B92A 2RKBA 1OV4A 4L5AA 4LOKA 3CUVA 3QP2A 4KIFA 1QRTA 1QP4A 2BGNA 2X0EA 1L4BA 2WP0A 1NW3A 3OH8A 4DNFA 4TSKA 3IUMA 1JFLA 5CLFA 4AWXA 2ZAYA 4ENUA 5D3MA 1G8HA 1ZUD1 4MWBA 1EE2A 1KVTA 4PLCA 5DLQC 2PYIA 4EBBA 4UHHA 4B6RA 3IX8A 5TQ0A 4RJIA 3N8GA 2J5BA 4FDAA 1T4DA 4EPTA 2ZI4A 3OQHA 4QXRA 1ERQA 1XZCA 3B6IA 1L4YA 4K9NA 2R6FA 4NJOA 7MHTA 3DAFA 4R9SA 1F2TA 1S66L 4D5EA 3QEKA 4Q3EA 1NG1A 5FUBA 4CV1A 2V7QD 2NZJA 4JI1B 5FEUA 3OIYA 3QFRA 1MJ5A 1JRLA 3EWIA 1KYVA 3U3RA 3I9V1 1ZR2A 3I53A 2ZTSA 4BVLA 1M2KA 5CYOA 2JIQA 2Y1EA 1KMIY 2WKSA 2E4VA 5KVQA 3CZ9A 4UOEA 5K7SA 1L4KA 2IV2X 4ZD6A 1HR0B 4GPEA 4BGUA 4HYEA 3FHLA 3GPBA 4KFSA 1QO7A 2ZKIA 5GZ6A 1UK6A 1L1FA 1LW6E 4POAA 5JD6A 3U2AA 4UTXA 3HDHA 1ZCZA 3NH6A 3KWLA 3DNMA 1VP9A 3FF4A 5IMSA 3BTUA 4EY6A 1SKYE 3K15A 2DQSA 5F82A 3NTUA 3QY9A 3SEZA 4OJYA 2VZWA 4E7PA 1YQ9A 4P85A 4PTLA 1JEQB 1DKLA 1M1XB 3T1NA 4OL0A 5DH9A 1DJNA 2YJ3A 5FLYA 1YRYE 3LZ6A 3LP5A 5D01A 1SXPA 4MCAA 4KE9A 2IHZA 1QMGA 3KBOA 4PGMA 4JITA 4UUNA 3KPJA 1LI0A 3AKEA 1DRMA 3H7WA 1EZ4A 1JIVA 3RVOA 1NC1A 4W1SA 3RJZA 1NVVR 3G2MA 1E0KA 4KLAA 3ZDYB 3DEAA 2BHLA 3DVSX 2ZZMA 3C6XA 4LVOA 3KR1A 1DSSG 4KXFB 1CQIB 2W1TA 2W2VA 1PJRA 1MO4A 4WLAA 1JH9A 2HPAA 4CMAA 4ZYUA 5LOVF 1NBMD 2Q1SA 3PBNA 1J9GA 1SN7A 4MVJD 6LDHA 2PV0A 1EVQA 1Z9BA 1GAQA 1PI3A 1C7ZA 3P9YA 4ESVA 2PZEA 1SQ5A 3X1JA 4LLOB 2O14A 3GVCA 1UK9A 3MT7A 2BR5A 2H0AA 3G68A 2KMLA 5DN6A 1MQ8B 1R50A 3WGIA 4UM7A 1E1RA 3IT2A 4QY6A 1HF3A 1DRJA 1PNOA 3PBOA 1O96B 2BYTA 2OCKA 3JQDA 1J23A 3RW9A 3HV0A 5AI4A 2CN1A 1PBTA 5L7WA 3R4VA 3L0BA 1V43A 2VKSA 3EW9A 2JFGA 4K6FA 4MDFA 3IPRA 1WHTB 3ZDDA 2WZQA 5JEEA 2BBOA 1XZBA 2WFAA 3H65A 4OHMA 1T5LA 3SSNA 5JZMA 4OHVA 4IDCA 3GVXA 1PJZA 4N3NA 4LBWA 1D8TA 2ZQZA 2JLUA 5DN6D 2DPXA 3I5YA 1VG1A 5FNZA 2PUJA 3CBGA 3WC4A 2AMJA 1IMJA 3O8CA 1E2EA 2JFZA 1RWPA 2ZM2A 3BT7A 3H5NA 2I87A 2V0WA 5GIPE 4LF6B 2OV5A 3TQFA 4C0WA 4IG4A 4O02B 3G5LA 5KTKA 3ZCPA 1RJEA 5HDSA 4P92A 2RJNA 3HH8A 4IR7A 4ZHQB 3RWMB 4UTVA 3PXBA 1U0FA 2JAQA 3PQCA 1Z74A 9GPBA 4OQIA 4FCVA 5K0LA 3GFSA 1ONNA 1ZWKA 4MCWA 1NL3A 2ZJ8A 1DLJA 4R2JA 3NWPA 5LBRA 4KWTA 4NZNA 3AEKB 5L10A 4MAFA 5EJFA 1UKVY 2GKOA 2C5FA 2UXDB 3P4YA 3JYLA 1XU7A 1N2ZA 421PA 1L5RA 1VHTA 3EYWA 4FFPA 2NUTA 1E7RA 1HD8A 1NJ4A 1YIOA 2ZM0A 2GCOB 4WXHA 5IX8A 1SQ6A 3HWX1 2I2AA 4XPIB 2H0TA 4ZTZB 2JFBA 1FFCA 3HGQA 3L7MA 2NG1A 2PT9A 2QT0A 1YL7A 1AZWA 1DQZA 1XFNA 4MMYB 4HFMA 4EFKA 2XZPA 2HK7A 5BMVA 4IDEA 3FYUA 2G63A 1VLVA 5ALMA 1Z6TA 5CVCA 4PG5A 2D2EA 4ZI5A 1TS8A 4KL8S 4FBGA 4A0HA 5H83A 5A1JA 5AOVA 1DX6A 3N75A 1S7CA 4TTVA 1U7UA 4MDZA 3PXUA 4MQFB 5ALHA 3DVAA 1SVSA 1G42A 3MC1A 4LV5B 2EG5A 4WUVA 4KQMA 4HNTA 3DDWA 4N5DA 1XPUA 2G9UA 1Y9EA 2HT6A 3ESDA 4FXPA 2E8IA 4J49A 1O58A 4N92A 3UICA 3KKZA 4DLRA 5C1DA 1SDEA 3NEAA 2XFTA 3UJ3X 4BP9A 4IDPA 4QM6A 3M7IA 3OICA 4OFWA 3TR6A 3VR0A 1FYEA 2QMYA 3HUUA 3ZG0A 1ORTA 2HA5A 1GP2A 3SYMA 3WIDA 3GUYA 4MV8A 4UKDA 1QNFA 1RXSA 4MR7A 4WD3A 5KOIA 3T3IA 3LJKA 3QHYA 2I4IA 1UZNA 2VK2A 1NXYA 3PUJA 2VP6A 3KKLA 4JI5B 5CHMA 4RA7A 3A1SA 3F5MA 4MICA 3TIVA 3IXHA 2YDXA 1VKOA 3A1VA 3R0VA 2AFHB 3P0JA 1UPBA 1ZJ5A 4Z1WA 1W46A 2OKGA 1ZIOA 2C9OA 5EIFA 1RKQA 3DE3X 1OLUB 4CPDA 4TL7A 3RHSA 1Z4OA 2WLTA 4PPYA 2GPTA 3IQHX 3JPYA 1H65A 4I8XA 4N5HX 3HRKA 3N0VA 3ABOB 1H1DA 4DQXA 2R751 4AD8A 3G2OA 1RQPA 2V6FA 1Y3BE 4CMJA 1W7FA 3KSIA 1ODCA 3H2IA 4AKGA 1FE8A 4XXRA 4FX5A 5CA0A 2WFZA 3KU4A 5D5QA 2X9GA 2H6EA 3AJDA 1KFJB 1C30A 2ZS8A 1GZVA 5CA1A 2XB2A 4K05A 3V1MA 2OSBA 2PD8A 3LPDA 1XRLA 2GPWA 3UZUA 5EMJA 1J0DA 4L9RA 2UYQA 3RFCA 3M5WA 3LK7A 5KKCA 3ODPA 2XGJA 3FAKA 3UGJA 1CBUA 1EP2B 3F0TA 3SF8A 5KTOA 2O2JA 5JAMA 4RFSA 1GFIA 1G8PA 4UPVA 3TOCA 4EEKA 1HUQA 1TRHA 5I3CA 3ZZ1A 5E7IA 1R0KA 2J9YB 1L1EA 1T0BA 3KTOA 3TI7A 3WS1A 2FW1A 4LXYA 3RVLA 3K1TA 3E9ZA 3RKRA 3QOXA 4C75A 4FFNA 1QF6A 1O54A 2ZR0A 4IRUB 4GGPA 4KO3S 2XQZA 1QO9A 5EUCA 4HDCA 2FMIA 3FM9A 1P1RA 2XH8A 2ZL1A 4YI3A 3FYSA 4KXVA 2FEAA 2X8WA 1RWKA 1EM6A 1KJIA 5JNSA 1UC5B 4P38A 3GDHA 2X8AA 3P7NA 3KNZA 2WDPA 3OJCA 3ZD6A 4X1IA 3N2GA 1A8IA 3AVYA 1TF7A 1K98A 3EVAA 1G8YA 2WYHA 4UTNA 3HFRA 4LE2A 2LRHA 1V8PA 1WD5A 3E58A 4H6WA 1CUJA 2QRVA 3UH0A 2ZQDA 2NTJA 1LL5A 1Z63A 1N6KA 1SAYA 1YDMA 2IEYA 2CY0A 2V7XA 3F73A 5EJ6A 2VIIA 4BV9A 3OZUA 4N01A 2RKWA 2NYVA 1O97C 3DTIA 5BV2P 2UDPA 4C3ZA 1B1AA 1M1NB 1NN0A 4B2PA 3LI8A 1QRDA 3FOBA 2RB5A 3PPIA 3JQ7B 1NLUA 3AM3A 4G1EB 2W2NA 2X5XA 2ZUDA 2A14A 1Y9DA 4PSAA 5EHGA 4AJLA 3WP1B 4FMPA 1RPAA 1T25A 4UD6A 1AUVA 4OQDA 2GPAA 3K16A 4F3LA 2WW8A 2GA9A 3H4IA 1IY2A 2FQXA 4EKIA 3ZY6A 3IH9A 2FVYA 3NGMA 4MEZA 4LZOA 1CRQA 2H2IA 4LC9A 1LPBB 5JWRA 3LA8A 3WLIA 2QD2A 1GA1A 4FCTA 2GCEA 3HZOA 1OFHA 3I5UA 3H9CA 4QBGB 3CVUA 3PFGA 3H2ZA 5FA6A 2MSLA 1K56A 1F8UA 3N76A 2RHGB 2FFQA 3ZXUB 3N8HA 1DZIA 4IHJF 5HQTA 1RLOA 2Z2YA 4H7EA 4C6SA 4RKEA 2PO5A 3K6JA 3O4GA 3AL2A 4BQOA 1AXGA 5EWLB 3UH1A 3IWOA 2PS9A 5TBMA 1Z09A 2INWA 2ZTHA 1GTSA 2XDWA 4R9RA 3FCUB 3RAEC 3FLAA 1SUSA 4QYIA 4H31A 2XCTB 1E7YA 1XG5A 5J5VA 2BOVA 5F1YA 2NO6A 5LOVB 4QM7A 4ZVUA 2PSFA 4U7FA 2ACGA 2QLTA 1C9KA 2WQ6A 4PBSA 1O8BA 3VR6D 1I5EA 3SJCA 3ROMA 3LYXA 3LDHA 1E0JA 2I54A 3BB4A 2C2YA 2RHLA 3JQFA 4ZOQI 1L0DA 1LVHA 4NECA 5DXAA 1CEFA 1CHNA 3EGXB 1SC6A 4IDOA 3KZ1E 2BMEA 1OV6A 4ID9A 2REBA 1ZKDA 3PFBA 5FTKA 3G8BA 5HWVA 3AILA 1BGWA 1PX0A 1VPVA 1JIJA 1SD5A 1ISPA 4L1KA 1PJCA 5AI0A 4JT8A 4CQNA 5C8YF 3J80A 4FN5A 1TA9A 1J8FA 4UMFA 1TUBB 3SQMA 4DSUA 2VUIB 1YZ3A 1JIXA 4J0EA 5G4LA 3MLEA 2P4EA 1QCDA 5L4SA 1M2NA 2N1MA 5HDDA 1UOQA 2W4QA 2X7HA 2A67A 5FBKA 3ILYA 4MVJM 5ALRA 4M4XA 3B1VA 2R1VA 1DKRA 1AK9A 3IF6B 1FPQA 2IF2A 5EYPB 4O1IA 4L2IB 2Q2NA 4M1EA 2G5PA 2J9ZB 4G1VA 3TQRA 3IQAA 4YEDA 4RK1A 4V0QA 1KI6B 2Y77A 3GWZA 1XFAA 4HXFB 4IZIA 2P6RA 3VOZA 2PU4A 4MRRA 2O2HA 3IE1A 1XGJA 3D4OA 4H6VA 1CR4A 5IJ9B 1GPNA 4LOJA 1MHPA 1ETUA 5FPSA 1JBEA 1KI8A 1RIIA 3A2NA 3QVGB 3BAFA 2FW8A 3NASA 2GJ3A 3U13A 4K6MA 2CBXA 2JKYA 1H23A 1N32B 4A0FA 2P7IA 3KVOA 1YVUA 1LGYA 3ET5A 3BZWA 4TLLB 2BPOA 4AF7A 3PC6A 5C4MA 4A9AA 2QW0X 5G0WA 4D42A 2PO7A 3IAEA 3DBIA 2MR6A 2F43B 3HACA 1L1QA 2W3DA 4G3KA 3AVQA 3MJHA 5KNBA 3OU2A 3T7AA 2QMQA 3ROFA 2G6BA 3CUEC 3AOGA 4AQYB 3OKAA 1YASA 3V6LA 1OAOC 2CWDA 3PJRA 3O2QB 4TTAA 1S1ZA 1QYXA 721PA 1Z28A 2QWSA 2HMUA 3SZGA 2ACKA 3JYNA 4EP1A 2JJ2A 5LZ9A 3IYLW 4MX8A 2FRDC 3N8KA 1RMYA 2JCHA 4LGWA 1N6LA 5G41A 3UHAA 1TYZA 2WT4A 1QC5B 5JDIC 2NXNA 1U2GC 5HKKD 4RL6A 2PQ0A 3PHIA 2OHVA 2X0RA 4GF5A 2I66A 3OUUA