2WKRA

Structure of a photoactivatable rac1 containing the lov2 c450m mutant
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
317
structure length
317
Chain Sequence
ATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNMRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFHHVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
pubmed doi rcsb
source organism Avena sativa
molecule tags Transferase, cell adhesion
molecule keywords NPH1-1, RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
total genus 109
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2wkrA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wkrA02
2PYRA 4ZDWA 2CXXA 2F9MA 5AUQA 3H7WA 3F1NA 3QF7A 4PC2A 1M7GA 2OHFA 1DAIA 2QMHA 4URWR 3A8TA 3QENA 3ZYCA 5FOVA 5AUOB 1KNXA 3QBTA 1CR1A 3PYPA 2OLJA 3SZRA 3RRZA 2L0WA 4RZXA 3ZVRA 4CRWB 4LJYA 1P75A 2AFHE 3OAAD 5AWFC 2P6RA 3HYTA 1F5NA 1XXHB 4AG5A 1LFDB 3F0TA 2P5TB 4M1OA 4XSHA 1S9DA 2WKRA 4NYMQ 4NCHA 4LYHA 1XEWY 3IILA 2C77A 3QPUA 1GSXA 2BBWA 1A4RA 3FWYA 3L0PA 4LJ8A 2WJGA 3CZPA 1CJKC 4FD2A 4UJ5A 3I5XA 3FMFA 1TQ2A 4AWXA 2MSDB 5DNYB 4FMCF 2KDKA 3BWDD 2F1HA 2FWRA 1IHUA 2AD1A 3HJIA 3SQXA 5LD2B 3BRWD 4GOJA 1PLLA 3K70D 5IU1A 3U3RA 3CRRA 5CJPA 2OWJA 1GKUB 5GVRA 2K5UA 2XAUA 5FOSA 1H65A 1JPJA 3FGNA 4RFSA 4URVR 1TS7A 1ESNA 1QHHA 4GDFA 4R71A 1JR3A 1P97A 3A4MA 4RVCA 1CS4C 4MRNA 4LHXA 1NLFA 5JI3E 5JSZA 1Z0FA 1I4LD 1YR7A 2XZPA 4URXR 1NVVQ 4ESVA 1FQJA 2N46A 4TYWA 2CNWA 3RC3A 1BYIA 1EFRD 3E4OA 4BLPA 2ODWA 4CEHB 4LBWA 1KDTA 5HZHA 3MFXA 4HAVA 4PAQA 1T91A 4IEEA 4PZYA 1A7JA 3TUIC 2QJ5A 2AXPA 3AKEA 5A0FA 3U3OA 3IDQA 5IRCD 2NO6A 1YJ5A 4A4DA 2D02A 2BV3A 2AHOA 3B6EA 2IS2A 5EE5B 3ULFA 5DYIA 1WDTA 1J99A 1DPFA 2FSHA 2ZRJA 2FFAA 5KYKA 1S4SA 3U6KA 5JI2E 2VP0A 1G3IA 1XXHA 4KQDA 2ZS8A 4PO9A 1ZAKA 2P3SA 3M1IA 3RRYA 3E4PA 2B7CA 3LAWA 1XFAA 3NH9A 4WBSA 3T1TA 2NO0A 4KFRA 3CPJB 1ONBA 1S3SA 2FN4A 4RD1A 3ICEA 2EWVA 4YMWA 4PHGA 2ORIA 3CLOA 4BBTA 1E1QD 4LLOB 4WN5A 3IUYA 4R9UC 4B2IA 2PH1A 2XNDA 1UBGA 4JL6A 2ZRAA 2Q3MA 4CW7A 4NDZA 2QRNA 1KAGA 1CR0A 4JKIA 5C46F 1G19A 4LJ6A 1UADA 4JGRA 1UEJA 4RD6A 3HU1A 1JXOA 4MA4A 2LWIA 3U3MA 2ZR0A 1U8AA 2EFHB 3H82B 4X8HA 2EFEB 3T1OA 4ZCMA 5G53C 2NPFA 3EW9A 4GZMA 5BYKA 4ZCIA 3QKUA 4AK9A 1M34E 1OXXK 1EG7A 4P0TA 3SW1A 2QY9A 4CZ2A 4BLQA 4PKYA 3G5UA 1NSFA 3KTAB 1MOZA 2OCPA 4L4UA 1DOAA 2ZVPX 2XOKD 1D9ZA 4B74A 3QXJA 3LV8A 1KSGA 1LT0A 5EE0A 3WY9A 2R78A 3C41J 4HJ4A 3QPVA 1TQ4A 1CR4A 1U81A 1W0JD 3A37A 2W6ID 1W47A 1ZCAA 1JBKA 2ZUCA 2EYUA 4BFTA 2OZEA 1VG9B 4TLBA 5GADl 4L9FA 1Z0AA 1AM4D 1Z6AA 2QAGC 1E0JA 1PV4A 4OYHA 2PZGA 5FTMA 3VR5A 6Q21A 1E69A 2WAYA 1SKYB 4OJKA 4HLQB 2G9NA 3ZVMA 1OKKA 1YZGA 4X8LA 2BIFA 2ZJ5A 1R4AA 4L9WA 4D4JA 1MO5A 1AKYA 1VIYA 3ZJYA 2WJHA 2PT7A 4ZDKA 4KVAA 2C2HA 3CRVA 4IOMA 2XEXA 4Q00A 4RKFA 4XH9B 2ZE6A 3VQTA 3W3ZB 3H7WB 1XB2A 3U6BA 3FDIA 4MITA 3DVLA 3LXXA 1OYYA 1IY1A 2XB4A 1MR3F 2PX3A 3B5JA 3VR6A 3VR4A 1CKEA 2RGXA 1NN0A 3GEEA 3R7WA 2BMFA 3NIBA 1V9ZA 1DAGA 2YINC 2C78A 3IS2A 4US1R 2W00A 4AYTA 2YWEA 1LS1A 4PHFA 1CBUA 4DBLC 1DELA 5TBMB 1F2TA 4GRAA 3DDCA 1QVAA 4OI2A 3LIEA 2AWNA 2O8FA 1TF7A 2JJ8A 1E9BA 2PR6A 1L7VC 3PCRB 4GFDA 4OL0A 4Z8XA 3MWYW 5JCZA 3GLFB 2NZ8A 2XNDD 1SKQA 5M04A 3RABA 1X8LA 4HI0E 4EPYA 4BFUA 3CX8A 4CEIA 3CWFA 1E2NA 1R0YA 1S9HA 2VHJA 4GHIA 1AS2A 4DLVA 5L8VA 2P7JA 4MUAA 4P33A 1H8HA 4FMDB 3AF1A 1RKBA 4NYIR 3RWOA 3U3KA 5AVFA 4B33A 4B34A 4OK6A 2WKPA 1T19A 2UKDA 3TAHA 1RW4A 5H1YA 5BYJA 1AJEA 1G8GA 3OEEA 3A4NA 4XJXA 2VV8A 2X8AA 2DFLA 1KIMA 1TS8A 2V7QD 3A1SA 4R3AA 1KMHB 3R7WB 3S1AB 3U60B 2AKYA 2N1BA 4LJAA 3DZ8A 2ZE5A 4E5UA 1EXMA 1CJUC 3ONWA 2INWA 1EW0A 1OXSC 2WOOA 4F38A 5E7JA 3BBPA 2C96A 4HB0A 4I1UA 2C99A 4U00A 1K8RA 1DARA 2GJSA 3CONA 1LV7A 1NMZA 2QAGB 1AGRA 3KUDA 5FUYA 4D0LB 4WF0A 4QKQA 3NHAA 3A0VA 4G5OA 1T0HB 4IFEA 1N9OA 1E99A 2PX0A 3P4XA 2W27A 1ZP6A 2XITA 3CW2A 4EJSB 2LKDA 2OSBA 4A8JB 3HJKA 3SN6A 1QHIA 1TX4B 2R62A 3AVVA 4A6PA 1E2FA 3BC1A 5G4YA 1QHXA 3PUZA 2WJIA 5G40A 2VH5R 1GOTA 2YKHA 4KSCA 2F3TA 4Q4AB 1KMHA 1SXJE 2O8EB 1OB5A 2OBLA 1XPOA 1OH8A 5H8WA 2AXNA 5J4LA 2ODBA 4YXWA 1HYQA 1NI3A 1OW3B 2OFWA 2E87A 2R6DA 1BMFD 2J0UB 3BAFA 1UBEA 2IYLD 3J81k 5G3YA 1G8YA 4DSTA 2XSZD 3THXA 4W5HA 3W8NA 1DG3A 4DCVA 3QVVA 1CU1A 1KO7A 2P0EA 4Q18A 1T5LA 1ETUA 1RRGA 2RCNA 3SR0A 2ZVQX 2ZJ2A 2YKFA 4NU0A 4UXJA 3BGWA 2O8DA 1MT0A 4Y0AA 3K0SA 1OXVA 4A0RA 1VG1A 2XB2A 3LVQE 1U99A 2PMDA 1XEFA 2JLUA 1E2PA 2R8RA 1G1MA 4EIWA 2WPDA 4TZ0A 2OM2A 2HT1A 3MFYA 1BH2A 4JLNA 5GJVC 2ZYVX 2QE7A 4Q03A 2QROA 3ZLJA 1WBBA 2O0KA 1KI7A 2PBRA 2ZBBA 3CPEA 2FGJA 2A2ZA 4Q02A 4A2PA 5CB6A 4AY2A 3WP0A 1CULC 1AZTA 3BD9A 2Z4RA 1W7AA 5J7EA 3C14C 3ZS9A 3NDBB 1ODFA 1Z29A 3OEHA 4BFXA 2GJ3A 3PQCA 3L0SA 4BRWA 4M22A 4OHYA 2ZJOA 2WWGA 4OQLA 3H84A 4CVNA 1VKJA 4KBFA 4BFYA 3TLXA 5GJCA 4B32A 4PHTA 3GLIB 1KZ7B 2YNMA 1UM8A 3BK7A 5CLLA 4PPGA 3WNBA 1P3JA 2IYQA 2NPIA 3H4MA 4Q4AA 5F6AA 1OB2A 1W44A 3LD9A 4MN5A 3ZVLA 4A1FA 2ZYWX 4BLOA 3X2SA 1DAHA 5D3MB 4F4CA 3B9PA 2E1RA 5FPYA 5F69A 1X8KA 3O8DA 4TQUS 5B30A 4JJKA 5LD2C 4EJSA 4KITB 2J41A 2VLGA 4O3MA 1NVXQ 2QENA 3R8CA 3EEHA 3UIEA 2WWYA 3KFVA 4TTRA 4LV5B 4P4TA 4DLRA 5L3RA 1R0WA 4OQXA 3FKSD 4HATA 3L0OA 2EYQA 3RVBA 2V1AA 3DO6A 2JHEA 4HH2A 1QG2A 3DL0A 4LJ7A 1XPUA 3F1PB 2J7KA 2XX3A 3KB2A 1OTDA 4DEXA 1E0SA 1E2JA 1TF2A 4HAWA 3ZZTA 4L9SA 4W5WA 4LRXC 2IHYA 5FTJA 3QEJA 4C0SA 3GLHB 3N70A 1WXQA 3Q85A 1I4DD 2QMUA 2A5FA 4QBIA 1NP6A 2VHCA 4XVQA 2AKAB 4I4LA 3PR1A 2WIBA 2JIZA 2VO1A 2A5YB 5KU1A 2YJTD 3SJZA 5BWMA 5KIZA 3W6OA 3E70C 3LIDA 3PEUA 4DJTA 1QG4A 4JLJA 4W9MC 2DWQA 1CLUA 1HE1C 1Z0JA 4HLUA 3CZQA 1JJ7A 1G4UR 5G4ZA 2C5LA 1US8A 2HLDD 1HH4A 2ERXA 3AKYA 3C8UA 4QC2A 5IF9A 5KTYA 5KUTA 2XZLA 1A2BA 5HCIA 3LLUA 1FX0A 2FZ4A 1VYTA 5HR5A 3VKGA 1NN1A 2OLKA 2FPMA 5SZHB 4WL9A 3QOFA 2VTKA 1DRMA 4A8JC 1P2SA 3FMPB 4EJSC 1U0HC 2GVDC 3IQXA 2FSFA 1XNJA 3UMSA 2ZREA 5HCNA 1FNMA 3TK1A 3O8CA 3KDSE 1G4AE 3X1DA 1WF3A 1Q0UA 1KI6B 1FMJA 2OUKA 5GJBA 5L3SA 1G291 3TVTA 1S1YA 2GZAA 3SYNA 5J3WA 1Z83A 4D4MA 5J47A 2PR5A 4CEJA 1CP2A 1XJ3A 3GJXC 3PG5A 3GFPA 1NF3A 1C1YA 4URYR 1ZIOA 2EFGA 1KKMA 2VRWA 5B58C 3BS4A 2JASA 1TUEA 1TEVA 1ZD1A 2BHRA 2NG1A 2JGNA 4LHVA 2WWHA 2X2EA 1NVWQ 3IO5A 3QXHA 4EPTA 1E3MA 2BEKA 1E9DA 4IDQA 1W2GA 2GCPA 1SHZA 4MKGA 4JT2A 2GK6A 1EX7A 3VMFA 3GJ6A 3I4LA 4LY6A 2QBYA 5JEEA 3MXQA 4IVQA 4NYJR 4B47A 4M1SA 2VP5A 1R0ZA 4LC0A 3AVXA 4LBZA 1Y63A 4HLDA 3FPAA 4C3ZA 4I99A 2IHBA 4YDHB 2WSSA 4XSGA 1YRAA 1CEEA 4QOSA 3WHKA 4D82A 4FMCB 4DSNA 1XF9A 3D3QA 4KVGA 3WP1B 2BEJA 3THWB 1MABB 1SZPA 2HJVA 2BMJA 2QUZA 1G7TA 2VHTA 2ZSAA 5CDFA 1HEIA 1LVGA 1D2EA 3K0CA 2L1MA 2WAXA 4ZPXA 4HDQB 3IPYA 1ZNZA 2OAP1 1W5TA 1H8ED 1HQYE 1KHTA 1UKVY 1DEKA 1YR8A 4MKIA 4WZAE 3H82A 1II0A 2ZE7A 3EZ2A 4TZ6A 1ZIPA 4DZZA 1IN6A 1ZNXA 3HYRA 4LHWA 3ZZUA 4JGOA 4H1UA 1FP6A 1KO5A 1ZINA 3AH8A 1BKDR 2OT3B 4BFWA 3N2IA 3VU9B 3FG8A 1G6OA 1EX6A 3B7GA 4TT3A 5EP3A 5L3SB 4HJ6A 2VL7A 2IYRA 1G5RA 5GJWC 1RPZA 3LIBA 1T9HA 1QHNA 2VPPA 2PYPA 4QFMA 2Z6VA 4PFSA 3KJEA 2NO1A 1LSVA 3EIEA 2WTUA 2DPXA 5J4KA 1VTKA 4BBVA 1ZC4A 4L9EA 3NHQA 1SQ5A 1VECA 1CIPA 5G41A 2GCNA 5FPHA 2V7QA 2IYSA 1ZW6A 1ZM2A 2VLIA 3BFVA 1JNUA 1OPXA 3FMOB 3NC0C 4UNQA 3KQLA 2RGBA 5EFWA 1N25A 3SE0A 5BW8A 3LX5A 5DSZA 2J0SA 2NO9A 4DLWA 1ESMA 3ICYA 1OT3A 1E0KA 1C9KA 3SOPA 1KYIA 4JL8A 5DKKA 2C9YA 3KXLA 3K8YA 1KDRA 4IRUB 4M8NE 4WZBE 5C4GB 1E2LA 1XDBA 1KJYA 2BMDA 4A0FA 1G7SA 2JAQA 4P32A 4C30A 2OV2A 5HWWA 2NTYC 1GDDA 2VP9A 4CDGA 1F3OA 1LTQA 4D0GA 4PKYG 3R9IA 3SEAA 3VR2A 3I5YA 5JHHB 1OIVA 5E7MA 3ZGXA 3SU8A 2VHUA 5HKKD 4XIGS 1N5KA 1IN8A 3U4QA 3O8BA 1PUIA 1OTAA 3B82A 2F7SA 3PVSA 1NSTA 1GRRA 4A82A 5EZ6B 5D3MA 3W5JA 1GTVA 2XZOA 2OBNA 1XD2A 3QI2A 1SVMA 1P2UA 4QGGA 4KU4A 1JEDA 1KI2A 4GS9B 2XJ4A 2XJ9A 2C98A 2GVZC 2ZI6A 3THWA 3RS0A 2BVNA 4EEUA 2ONKA 2HV1A 4HZUA 4GS9A 1R5NA 4DDWA 2OCAA 1XFQA 3OE7A 3NOTC 3AEZA 3QKSB 4KLZA 1SKYE 5F2EA 3RWMB 2CDNA 3C7KA 3IBRA 4LUCA 1HQCA 3NBZC 4GHIB 2ZU6A 3H2YA 5EE1A 3QY0A 3W9YA 2ZJAA 4A92A 2ZAOA 4URZR 4QM6A 3W3AA 5HD3A 3IKJA 4H1VA 4IDOA 1SVIA 1SVLA 4HH3A 5F68A 1D8TA 1T3LA 4JS0A 4L15A 5LB2A 2Z6DA 4HJ3A 4LYJA 1XFNA 4EFLA 1GP2A 1S0UA 5L3QA 3ND8A 1P6XA 4NXBA 3E4QA 4FIDA 4P31A 4KV9A 3UE6A 4ARZA 1SVSA 2FH5B 3HR7A 4HDCA 4M9XA 3GJ8A 3EWAA 2ZROA 1Z06A 621PA 1U0LA 1KO1A 1UWPX 1RVDA 2PEYA 2UVQA 2G3YA 4G1UC 4EPXA 3R9XA 4HNBA 3UK6A 1S1CA 1UBCA 1JR3E 3KKQA 4LBVA 2ZI4A 1IONA 3ZIAA 1HE8B 1JPNA 1VCNA 3D31A 3HU2A 3P1JA 2CCJA 1XEWX 4NKRA 4D80A 3TAUA 3TQCA 2Z6CA 3FMIA 5C1BA 1KK0A 2XTNA 4DT1B 4OJQA 5I5LA 4M4XA 1FNNA 2ZYUX 4P3YA 2EA9A 2RAPA 2CBZA 3LY5A 4B3XA 2CMKA 4JYBA 2OE2A 2D62A 3CRW1 2YV5A 3CWQA 2WPDD 4HLUC 4AC9A 1W5SA 4YLGA 4RD0A 2GWHA 1OHHA 4Q4HA 5G3ZA 5C4MA 2FSIA 1OIWA 1G3MA 1V43A 1CR2A 3H1TA 4A6XA 2ZUBA 3SQWA 1UKEA 4TL8A 5KNCA 3QG1A 3TQFA 4K46A 2PJRA 1Z8FA 3LXRA 3NC1C 3BY9A 1LW7A 4C9BA 1UF9A 2DFKB 1E2GA 2IS1A 5DH9A 1U8YA 3HPRA 3DMNA 1HA3A 2QHKA 3A1WA 3EWSA 3VNVA 3B1VA 4NMMA 2OBMA 2GKSA 2IWHA 3F1OA 2CHGA 2J3EA 2JCSA 2Q3HA 4OK3A 3MR0A 4LJ4A 4B3FX 5KSZA 1DO0A 3I72A 4PC6A 3UATA 2ZRBA 4C0HA 2WHXA 5FR2A 2RB4A 4B9OA 5JCPA 2BBTA 2HLDA 1A1VA 4FW9A 1KO4A 2HF8A 4HIAA 1RRFA 1OYWA 3FHOA 5AVEA 1LB1B 4GBMA 1G17A 4DEYA 1AKEA 3RTYA 2ZRLA 1E9AA 3TBKA 1F48A 4QG7A 2V8OA 4PC3A 2NIPA 2ZEJA 2A5DA 2G77B 1HY3A 3EZFA 5B57C 2DYKA 4B73A 1QDEA 2F43A 4BE7B 3SJBA 2QSYA 2FJUA 3CUEF 1CRPA 4JVMA 2DCUA 1RFLA 1VDZA 2F43B 5DJTA 2CL6X 1S4QA 4TYNA 1GL6A 4MKHA 2DHRA 2CVHA 2I1QA 1DS6A 1OXTA 3RAPR 3MWLA 3T1VA 5IDVA 3TE6A 1ZD8A 4KBGA 3K70B 4KUOA 2BBOA 1YQTA 4CGZA 2NQ2C 2RGDA 1YE8A 3K9LA 3A36A 221PA 3V4FA 1WB9A 1G16A 4TLAA 1W4AA 4Q66C 1FPMA 2JATA 2IF2A 2WWXA 4EPWA 1AQUA 5HE9A 3OAAA 5CK4A 4Q47A 3DMDA 1KI3A 1DG1G 1ZD9A 2CL0X 4OHZA 3UANA 3CM0A 3LA6A 4IFBA 2QMEA 3AVOA 4G0NA 4MGZR 2PZFA 4IOKA 3MWKA 3QKRB 1I2DA 4HP9A 4PTLA 2J7PA 1KI4A 2VEAA 3AVPA 5HDSA 2VV6A 1MABA 2IK8A 2HJGA 3KXKA 2A5GA 4MYUA 3CPHA 3U7EB 5JS8A 2CVFA 3PEVA 3E2IA 2JLZA 3ZQ5A 2QPAA 4PC1A 5H68A 2RH5A 1RZ3A 4HQAA 1IY0A 3GLIE 3QVUA 4H9GA 4POAA 2H16A 2GCOA 4RKEA 3UB8A 2XTZA 2D2FA 4AKEA 1NVUQ 2CE2X 2QMOA 4FCTA 5B2ZA 4EESA 4AURA 1Z63A 3T61A 1EESA 4AKGA 5DI9A 2W2TA 1E79D 1KY2A 2UZ3A 3AUXA 4MH0R 4UQOA 5FOXA 3N2EA 3U7HB 2IUSA 1MRSA 4ZKDA 1CXZA 5CJ2A 3C5HA 4Q7JB 4TYYA 4ASUA 2X19A 3D8BA 2QBYB 5SZIA 2O8BB 3NXSA 2ZAMA 2QT1A 3KQKA 1E2HA 3EAQA 2RGNA 1MO6A 4Q7MB 3MMPA 1KZGB 1OH5A 4MGIR 3V4RA 4GT1A 1IQPA 2QPOA 3UB7A 3FFBA 3EARA 4OQFA 1FZQA 5KDLA 1GWNA 2H92A 2XNSA 4EPRA 4JGQA 1Z6GA 3GLHE 1YZTA 1KI6A 2MMGA 1M2OB 2PEZA 4R70A 1Y3AA 4IXNA 1UEIA 4Q1DA 1R2QA 3UWOA 1Q20A 4M9SA 4YMUA 1NIJA 4DLXA 2GXAA 3T06B 1NG9A 3OHMA 3B78A 2OFXA 1XJ2A 1HUQA 2RMKA 3CBQA 2J5XA 3E1SA 1AK2A 1TTTA 4C2TA 5TXGA 4DJ3A 1NRJB 4V0MA 2NZJA 4X8MA 4F91B 2O8CA 3UMEA 2GCOB 2PCLA 3NKVA 1K5GA 1OV4A 2WMNB 3OFND 5EXSA 3M6AA 2QG6A 1NJGA 2Z4SA 1GAJA 4Q4HB 1ZNYA 3VR3A 2GILA 1KO8A 4M1KA 5UKDA 3AQ4A 1JQLB 4JLOA 1R6BX 2ZRKA 4YQFA 1GM5A 2V9AA 3SI7A 3LFUA 3SBDA 4RD2A 1F60A 4B2PA 3BOSA 4IVPA 2WZQA 4ACAA 4Z1MD 4WVFA 5FBVB 5JECA 3A1TA 1COWD 4MRSA 4FMDF 4Q01A 4DRZA 4LSGA 1GSVA 4KYUA 3KKMA 1XTSA 2ONJA 2C95A 1Z22A 1R5OA 1S1MA 2QZ4A 4IW3B 3KL4A 2D01A 3CNNA 4IHQA 1OSNA 2QP3A 5CDFE 2QP9X 2KX6A 3HPQA 2QT0A 3IS2B 2HYIC 2IYXA 2O0JA 3C8CA 4PSAA 1DE0A 3W8RA 2ZJBA 1JR6A 1F2TB 1VHLA 4U02A 2P67A 3SHWA 2O0HA 8OHMA 1G6HA 1RYFA 2W6IA 4F7WA 2GF9A 2ZRCA 3QXCA 2M1CA 4R2HA 2XOKA 4K8OA 1Q22A 5C18A 4CT5A 2GJAA 4AYWA 1HTWA 3QG5A 4BQSA 1G3UA 3ZS8A 2BCGY 4X8OA 4R38A 3KX2A 721PA 2CJWB 3O8RA 2ZETA 3WBKA 2ZM5A 4B76A 5DN6D 5P21A 3G6OA 2TMKA 4ZKEA 3IEVA 5J4EA 1S67L 4A2QA 2GJKA 2ZSDA 2IUUA 2PHYA 3GEHA 3P32A 4NE2A 2W2XA 4BUJA 4I81A 2ZPTX 2D74A 1M7BA 1IXZA 4N0DA 4S2EA 1G18A 2R44A 3QEOA 4LC1A 3PXGA 4Q9IA 3VE4A 1UAAA 2FMXA 2REOA 5C2JB 1ZM9A 4RZUA 2FX3A 4O25A 4B3CA 1EFHA 5FTNA 4BFSA 3IEUA 2KJQA 3R9WA 5KPDA 2FFBA 1N2CE 3BIFA 3EG5A 3PUXA 2PLFA 2KWIA 4E22A 3Q9LA 4ZV4A 2FU5C 3LICA 1B23P 2J87A 4NCIA 4GMXA 2F9LA 521PA 3U4QB 3K0FA 3AP2A 3B2EA 1CRQA 1U98A 5TMPA 5KPJA 1HV8A 1G5PA 5HDDA 2GEUA 1FL9A 4EERA 2A3RA 2JJ2A 5J5CA 2CL7X 1FW6A 2IYTA 1IN4A 3AVQA 2JN7A 2OXCA 4QGHA 1XJ6A 2RGGA 2JEOA 2CJWA 2Z83A 4KI0A 3ZIAD 1MO4A 1WE2A 3C15C 4US0R 1IOZA 5FFMA 4CYMA 2XGJA 4HAXA 4EPVA 3CF2A 4B75A 3CWZA 2FV8A 5TBMA 4JJZA 4MYCA 3BORA 4NL4H 4Q1CA 4UJ3A 4V02A 3EASA 1KAOA 4C0KA 2V0WA 4LYAA 4TMTA 2QU8A 4MYTA 2FSGA 1OFUX 3VTKA 4IOLA 3W6NA 1XJCA 2VSXA 3Q7QA 1G64A 5BXQC 3THOA 5DLQC 2G83A 4LRWA 1YHNA 2KBEA 2QORA 5EP1A 4C0JA 2QAGA 4II7A 5CM8B 4CT4B 3Q72A 3NBFA 1ELOA 4UKDA 2JA1A 3B8HA 1QF9A 4MGKR 4EQ6A 4RD4A 1JEEA 2G0NA 3OIVA 2HEIA 3IQWA 4JT4A 4S35A 4TLCA 3K70C 3DOFA 4WXPA 1RC8A 3AF0A 1Q3HA 2FGKA 1G41A 3FVQA 4TMKA 1OTBA 1W4CA 2DY1A 4WA7A 1E4YA 1YKSA 4N3NA 4KAXA 5FTLA 3MQOA 1C4OA 5DYGA 421PA 2IYWA 4BRUA 4NONA 4Q1EA 3EA0A 1Q44A 3SHFA 4HY8A 1E94E 3VHLB 1PLJA 4GOKA 1Z2CA 1Z0IA 4AD8A 1T1CA 4D0NA 2MSEB 2ZE8A 2OO7A 2AFIE 3L43A 4NCKA 2YWGA 5TB5A 2JLWA 5FOTA 4C0BA 3AM1A 4JL5A 1KK1A 2OWHA 2H5EA 4Q9KA 3X1ZA 4G5GA 4PC7A 4EFMA 5F3WB 2QE7D 4PQYA 4DCSA 1TMKA 1RRCA 1VG0B 4A36A 1R10A 4YWZA 2DWOA 1DVRA 4XTCS 1W36C 2Q0HA 2O8FB 3FHTA 2I3BA 5FL7D 4D81A 1T8UA 4WIAA 5KDDA 4KHZA 3TGPA 1PUJA 2W0SA 4NP6A 3V9PA 3WYFA 1E2EA 2WV9A 4JVLA 3LO5A 4JLVA 3PEWA 4JVSB 3KQHA 4LX0A 1PZNA 2REBA 2HXYA 2N42A 4O2RA 3BJIC 1ZVQA 2BWJA 4D2IA 1SXJB 1J90A 5AJWA 4F4JA 3THXB 3VKWA 3O47A 4DVGA 3SS8A 2H57A 3EC1A 3K0AB 4EDHA 4C0LA 3BERA 3I8XA 1NBMD 4I5SA 5JBQA 2Z0MA 4OI4A 1XTIA 4M53A 1XJ0A 5J40A 4A0GA 2J7PD 1L8QA 3LVRE 3MUFA 4WZ6A 1XBTA 4NYJQ 4XWKA 2G1JA 1ODVA 3WMGA 2XTMA 2QM8A 4M0LA 3SJAA 3AF4A 1E0AA 4JLPA 2R6FA 3U44B 4L9GA 4AG6A 2HDNB 2D06A 1ZUHA 3RRNA 3IGFA 3QNUA 3QE0A 4YMTA 2EVWX 2ZS7A 4OBEA 2QRZA 1S2MA 2FDCA 2QA5A 3NTUA 4QGAA 1US8B 2J80A 3H0KA 1U0JA 4A0HA 3IIKA 1NIPA 2FE4A 4R7ZA 4Y0VA 3K0AA 1MZUA 2WMOB 4UXHA 4PZLA 2J9RA 1G7CA 4CEJB 4RCYA 1XJQA 2ANCA 4FWIB 2GJ9A 2B7BA 4HUTA 2VP6A 2ZRDA 2FEMA 3F8TA 1NLYA 1VB6A 5D3QA 5DO9A 3GJ0A 1N5JA 4HUQB 1KDPA 4HOIA 2GF0A 5DHAA 4EUNA 4PHHA 3AVTA 3GLHA 1ZM3A 3P20A 5AJXA 2F3RA 2W6JA 2BASA 1JAHA 1SVKA 3I1FA 4QNRA 1EK0A 2I4IA 3FKSA 4LRZE 2PL3A 5E95A 1II8B 3TSWA 4BZXA 1OT9A 3RS7A 5AUPB 1OH6A 3FFAA 3AVUA 2VBCA 2W2VA 5BN5A 4US2R 4N0EA 2IX3A 4M9QA 5FOUA 2GEDA 5EUQB 3JZAA 3RDPA 2IXEA 5JJKA 1XX6A 3R8FA 3HWSA 3REFA 4Q7KA 4F93B 1BYUA 1F9IA 2ZUDA 1E96A 3CNLA 1YZKA 2JIZD 2FFQA 4V0OA 3ADBA 3Q5EA 1J7KA 4D4KA 2B6HA 3PUYA 1XPRA 5AUNB 1JNYA 3DZDA 5DI3B 1N5LA 1ZUNB 2DWPA 3CB4A 3TH5A 3MQQA 5DI3A 5E4FA 4M9ZA 3ZVNA 1E2QA 1E1RD 2QM7A 2AD5A 4R2IA 1COWA 2MSCB 3CR7A 3EC2A 5KSPA 1AA9A 1QHSA 3NHBA 2LKCA 1TU3A 2ORVA 3GEIA 1GITA 2G1KA 4I1OA 4LHYA 4NCNA 2OEPA 4BASA 2IEZA 4QGFA 2OAQ1 4RCZA 3V00A 2HV8A 3WRYC 4D25A 2QSZA 1P61B 4PO8A 1P9WA 2VP4A 2IA5A 2VSOA 3C5CA 4HB4A 1Z0KA 4R6LA 3PFIA 4J0QA 4PQRA 5FOWA 4NZYA 5F98A 5DISB 3NBXX 1YZNA 4FN5A 1XJ4A 5FBLB 1M7HA 4OK5A 5HZKA 4XD7A 2QTHA 1UBFA 2RGEA 1R0XA 4LJ9A 1DADA 3VX3A 4QHTA 1ZCBA 3KFXA 3QUSA 4NBSA 1XCMA 1F98A 3THYB 4ZIRA 4OI0A 4TN1A 4B48A 2G6BA 2HXSA 2F55A 3Q5DA 4HZUB 4Z1MA 1WA9A 4EQ6B 2VF8A 2O52A 2VEDA 3RS2A 2K7SA 4ZCLA 3NH6A 1AGPA 4PAMA 4WLAA 5FTKA 2JDID 3RSLA 2LCFA 2IS6A 4LZZA 4IOJA 4HSEA 4LV6A 1N6PA 3LBIA 1Q1EA 4A15A 3ETLA 3S1AA 1GSWA 4MRVA 2ZSBA 1VCOA 3LUQA 3LI8A 1E2KA 1QRAA 2FF7A 1W36B 3CX7A 1N6NA 2JLRA 4YXWD 1S4RA 5FUVA 4NPHA 4RSGA 2V0UA 2PLRA 1N6HA 2ZI3A 3MLEA 1XD2B 4DSUA 1YVDA 2IF0A 2XSZA 5DN6A 4MDFA 1N6IA 3QKSA 1Z3IX 1KI1A 1FTSA 1XMVA 1U90A 2MMCA 4Q4LA 2ZYTX 3FTQA 3FE2A 1GILA 1IAQA 1G3QA 3CKLA 3KJIA 1X3SA 4IDHA 3TJZA 4EFNA 2B92A 2RGCA 4C0QC 3FOZA 3VOLA 2GRJA 5IHPA 5KSYA 1T1AA 1XTRA 2H8KA 1KNQA 1AN0A 1M6NA 3U5ZB 4GI7A 1XZQA 2ZJZA 2NOAA 4QNMA 4BEJA 5AK0A 3KJHA 4QHYA 4BZQA 4BGDA 1Z0DA 5JHGB 4TT3D 3AKCA 3UMDA 3K0EA 4JLAA 2A30A 2O8EA 1I2MA 4CF7A 1OJ5A 3LWNA 4B6FA 3CRQA 4HB3A 1JALA 3UB9A 1DAFA 4TYQA 4ABYA 3EWKA 4W7SA 2RHDA 1NG1A 2V1BA 2OILA 4B2LA 4M21A 1MV5A 4Q1AA 1CJTC 3NOPC 4B71A 5HSQA 3OEHD 2QPTA 1SXJD 1ZJ6A 3ASZA 1OIXA 4B43A 4LPZA 2YOHA 3N5CA 1GFIA 1XZPA 4PSVA 3BE4A 1OXUA 3SFZA 3ZH9B 1OF1A 3M0EA 2A7QA 2WJJA 4OHXA 4DLUA 3IHLA 4HDOB 3LIFA 1P4SA 3EA5A 3GLFA 1II8A 4PO1A 1OKKD 2HT6A 1RJ9B 3PENA 4HI4A 3MSXA 1G8FA 1T1BA 1AZSC 1GL9B 4LPKA 4PQFA 4W5JA 3WBJA 4G3XA 1LNZA 1J8MF 1XWIA 4DIEA 2GDJA 1ZU5A 4B35A 4ZDJA 4U7DA 1NNEA 1NLZA 4AI6A 3GLGB 3LQRA 3LW7A 4MRPA 4KUKA 3IBYA 3VFDA 4LRYC 4HLCA 4O2LA 1W1WA 4HP4A 3ASYA 1WBDA 1T5IA 1XXHE 4NXEA 1ZRHA 4URUR 1CJVC 1P5ZB 3U3JA 3BB4A 3X1XA 4CEIB 1WRBA 2C8VA 4DIDA 3TKLA 2GBLC 2OXRA 3MCAA 4OKSA 4QJ5A 3T5DA 1G20E 2G88A 5JS7A 3K1JA 3F1OB 3UMFA 1X6VA 4PZZA 1X1RA 3T50A 4LWZA 5EE9A 3GPLA 3LX8A 3WNCA 2V55B 2W0NA 1Q57A 2H28A 3AP1A 2BJWA 2CK3A 1R8SA 4UNRA 3RS3A 4QHSA 4F4IA 2D7DA 3DKVA 2FPKA 1DBSA 4MRRA 2GJ8A 1NBMA 5LPNA 1BIFA 1SVWA 1T3SA 3WMEA 4JGPA 2ANBA 4JZKA 3AB3A 5AJYA 1SULA 3TSZA 4ZO4A 4DCNA 2QWSA 3FYHA 2ZRGA 2VF7A 2BC9A 1QBKC 2R6GA 1W4BA 1OT6A 3FB4A 5L3VA 3AF3A 4I1VA 4I1SA 1AS0A 1Z2AA 4V0NA 2JLVA 1N6OA 2Z43A 3BB1A 4YMSA 4JBXA 1F2UB 1A2KC 1IY2A 4RZ2A 2ASEA 3MG9A 1TAGA 3KKOA 5IK2A 4MDEA 1N9LA 1BYWA 4EW7A 2YHSA 4V0KA 3IIJA 4DT1A 3EPHA 1SXJA 3QQ5A 1QZXA 3K3DA 2IXGA 2Q9CA 2ATXA 4RZ3A 4KSBA 3W90A 2ATVA 5DKLA 1ANKA 1W48A 1XTJA 2IBMA 2VHQA 3ZQ6A 1DP9A 1VHTA 4B6EA 1OFHA 2KBFA 2ZSEA 1DP6A 3BH0A 2G0TA 3B33A 2IXFA 1SGWA 5KNDA 4DB4A 1XD9A 1EFRA 1N0UA 3NEJA 4LDJA 4FCVA 1RE0A 3MJQA 2AWOA 2H18A 3OF5A 1A5TA 4LK2A 3HJNA 1IBRA 2E9SA 1RJ9A 1HURA 1NY5A 3FHCB 1D2MA 4DLZA 3GD7A 2CHQA 2W6JD 1L4YA 4LPSA 5JWHA 1VCIA 2B21A 1KI8A 3QKRA 1FQKA 1G9XA 5E7IA 4EEPA 2BM1A 2R9VA 4AYXA 1T4GA 1W49A 2V6IA 4TLEA 1OFIA 2X1VA 3ND9A 2F6RA 1BMFA 1VMAA 1X0OA 2QN6A 3I3SR 3L82B 3KQNA 2VP2A 3C16C 1L2TA 2O8DB 2CLDX 4TSFD 3ICQB 1U9IA 4GNKA 2RGNC 1MH1A 1PJRA 1CF4A 1E32A 1DP8A 4TMZA 4Q48A 2KI5A 4LOAA 1S3GA 3FC7A 2AL7A 1SXJC 3U2QA 5JFGA 3I32A 1TADA 2IW3A 4GPTA 2AR7A 4L5BA 5E3HA 2J45A 3MAAC 1F2UA 2WKQA 4FINA 4YC7A 1XEXB 3LIAA 1TF5A 2GZDA 5HE8A 2J59A 3EZ6A 2ZR9A 1K5DA 4E03A 2RGAA 4C4PA 4JBYA 5JSZB 1ZM4A 3T35A 4BECA 4QM7A 3IO3A 5EE3A 4BLRA 3A0RA 3RC8A 1KY3A 1S66L 2KSQA 4L16A 4BLTA 5DE3A 3PJRA 1TQDA 4EKDA 2V4ZA 3TIFA 2ZXUA 3GLIA 1GKYA 2KB0A 3NJAA 3QF4B 1KK3A 5J4YA 5B64A 5CIQA 4B3GA 1G5TA 3VAAA 4WXRA 2R2AA 4TL9A 5F9HA 1TS0A 4WW0A 4NCJA 5HTKA 4PPQA 2BJVA 4ITRC 2B8WA 5SZKB 4BWYA 4DJ2A 1JAIA 2ZRMA 3WMFA 4XD7D 4HAYA 3UG6A 5TVKA 4B3BA 4EXOA 3MGCA 4DLTA 2AK3A 1TU4A 1P62B 2Y8EA 3WXMA 2AK2A 4MUBA 4DHEA 1OJGA 2GZHA 4FCWA 3QSYA 1JECA 2Q6TA 2OESA 2PZEA 3GCGA 5CB8A 5HDCA 4FI3C 4IVRA 4Q21A 2QGZA 5KSOA 3SFVA 1XEXA 4XT2A 4QL3A 4A2WA 4I39A 1XCPA 2J0VA 1YZQA 5ANRB 4LCBA 3UMRA 5FL3A 4ZDIA 1N6RA 3K9HA 3CX6A 5KO2A 1E2IA 3BXZA 3L8YA 2F1IA 1P0ZA 4HUQA 3DEFA 2JLYA 1YZLA 1T3HA 3UKDA 4Q1FA 2J0QA 1ZUIA 3K3CA 1P60A 4MYHA 3EZ7A 5TV2A 2FEOA 4DUGA 2GEVA 4JMPA 3GJ5A 4A8JA 1CJMA 4TL7A 3GECA 1VYUA 4E09A 2ZIAA 4PPNA 4NH0A 4QJ3A 4BPBA 2BMEA 1JQJC 3AGQA 1PLKA 3EZ9A 1I4TD 1ZNWA 1UWNX 3BWLA 1IJFA 3RS5A 1KSFX 4ZI3A 3OFNA 4ASUD 5J4HA 3OZXA 5EXXA 1T8TA 3I62A 5CITA 1VPLA 1NVVR 4ZI2A 5CM9C 2O8CB 2WJYA 2DFNA 5HPYB 5JLJA 2BCJQ 3CIOA 3JVVA 1Z6YA 4GZLA 5JRJA 5KNBA 3Q8XB 3P4YA 2EWWA 4MGYR 5K8TA 4EQ1A 4KYIB 1H8HD 4M4SA 4V0LA 3IBGA 1E2DA 1W46A 1V9YA 1TQ6A 4I38A 2RHMA 2WSMA 4AIIA 1LF0A 3U61B 3ADKA 1NBME 3IPXA 1ZYUA 2DR3A 3I73A 5EXTA 1VCMA 1NY6A 2GESA 2GXUA 4PX9A 3SYKA 4D26A 2F1JA 4DSOA 2Q9BA 4F3LA 3GQBA 4F92B 1VG8A 1LL8A 1GG2A 2PMKA 3MJHA 2XXAA 1B0UA 4V03A 3AGPA 1G21E 4G01B 4F3LB 1WCV1 5SZJA 2B02A 1NKTA 4RJLA 4QRHA 2HCJB 4ACBA 4D4LA 1G8PA 4FXPA 5DHFA 3AV0B 3Q3JB 2FZLA 4YDSA 5CYOA 4DXAA 3QXSA 4IJMA 2DB3A 1P73A 2EU8A 3OIUA 4K08A 1NWZA 4ILEA 4JLMA 1FP7A 1KMQA 2JJ1A 3KQUA 3VE3A 3BH6A 3P27A 2YWHA 2ZSFA 3T5GA 4U5XA 2WBLC 1YR6A 4XVUA 2GTPA 3EPLA 2V6JA 4ARZB 2V3CC 2SHKA 1EWRA 1KK2A 2UZIR 4DUGD 1Y28A 1HT2E 1Z08A 2IL1A 1T0JB 1Z6XA 2FG5A 2GAOA 1XRJA 2C9CA 2ERYA 3QIAA 3UXMA 1VIAA 3KKPA 4RFVA 4GL2A 1W36D 1JI0A 1N0VC 2YWFA 1J2JA 2DBYA 1TEXA 3U44A 2R6AA 5CLQA 1IXRC 2ZOHA 1GUAA 1D7EA 1EGAA 3THYA 3W5IA 4KFUA 2I1VB 3RLFA 3WRXC 5JEDA 3CR8A 1P7CA 1V5WA 1GZSA 4BFVA 1N6LA 1OLOA 3K53A 3B1XA 4JLKA 3F3YA 2PD7A 1MRNA 4Q19A 3L8ZA 4Z54A 3RANA 1GVNB 2PJZA 4Q5IA 3KKNA 3CF6R 1S1ZA 2WVJA 4Z8YA 1UFQA 1U9IC 4LHZA 2CCGA 4OHWA 2X77A 2YOGA 3AP3A 4TWZA 2XXAB 3C4JA 3GMTA 3BB3A 2PT5A 2ZANA 4M1YA 4NYMR 3T12A 2FPLA 5A8BA 2ZRFA 2YKGA 1DAKA 3A1UA 1OFTA 4XTRA 1E4VA 4L8GA 1KOFA 2BKEA 2OCYC 1TNDA 2ZITA 1KJZA 1M8PA 2J0UA 3LH5A 3MD0A 4GP6A 3VR1A 2GXQA 2J46A 1Q21A 1TPZA 3PITA 2ZJ8A 3L0IB 2IEYA 4GP7A 2EW1A 1X1SA 4O0MA 4DCUA 3EXAA 2QL6A 3LLMA 3D72A 1KOUA 4C0AC 2H7VA 4EAQA 3MRSA 1T6NA 2WM9B 2ODEA 4RD3A 3OESA 1X8JA 3LDAA 2L4RA 2P6UA 5F5YA 1S8FA 3QF4A 4RQ9A 3EX7C 4GW9A 3VKHA 1LSWA 1W4RA 4MN6A 2ODNA 3GJ3A 3K0FB 2P5SA 4B3DA 3ZD6A 3A0SA 3D7MA 4MKFA 3TUZC 3DM9B 2QAJA 4RFSB 4JKYA 1N6KA 1Z07A 5FPTA 2CLCX 3B60A 3GJ4A 4KFSA 3A6PC 2L0XA 5FR1A 4GOXA 3U7FB 1WQ1R 1GSIA 1TL7C 4R98A 5FBQB 3ZDQA 1ZC3A 4C2UA 3ECCA 1UJ2A 1UGUA 2C9OA 3QJYA 1XP8A 4B44A 1DO2A 3C2WA 1ZU4A 1Q3TA 1EFUA 4JLBA 3P7NA 2IUTA 2A24A 1E9RA 3SNHA 3AVYA 4JSTA 3K9NA 2ZR7A 1TS6A 2QNRA 1NN3A 1QVRA 3EIQA 2YC2C 5AJZA 3A1VA 3KUCA 3TW8B 1NMYA 4IDPA 1FX0B 1D6JA 1KDOA 1M74A 1M1YE 2HCBA 1LSXA 4PSKA 4UNPA 5FBRB 1UDXA 2V1XA 1E9EA 3SJCA 3T34A 2CHVA 3REGA 3LRPA 3Q7PA 2EFDB 4NXGA 1KKLA 1QHGA 2QJ7A 1IJEA 1D2NA 2J1LA 1D06A 2R65A 2P6NA 1ZMXA 2ZS9A 3OIYA 1G3RA 4NHOA 4TSFA 3SDZA 3ADDA 4ESHA 2A78A 1E79A 1JB1A 1DTSA 3PV0A 2ZOIA 5ELXA 3TNFA 2PDRA 1W0KA 5K8UA 5DIFA 2WWWA 2VIIA 3RS4A 3CAXA 2WJVA 1J70A 1NL3A 4GCZA 1Q1BA 2CLSA 2QTFA 3WNDA 5JJLA 4KCGA 1NKSA 4XVRA 821PA 2OCBA 2ECKA 1DAEA 3D6TB 3F1PA 1BS1A 2QKPA 5IS1A 1ZM7A 1XMIA 2GAAA 1KGDA 3AF2A 4M1TA 4XT2B 4TMVA 5FL7A 1QHHB 3ZZ0A 2GA8A 2WICA 2YOFA 3RHFA 5LBIA 2YZ2A 4IXMA 3BFKA 3DHWC 3K9GA 1F6BA 4KODA 4QXAA 3DM5A 1EWQA 1IXSB 3OIWA 4XWAA 3QKTA 5EP2A 3GLFE 1WA5A 1UKZA 2QP4A 2IYYA 1XTQA 4JBWA 3WHLA 1YR9A 4Q1BA 3NWJA 3HR8A 2KE5A 1KI9A 1JR3D 1DAMA 1FMLA 3IHWA 3PUWA 4D6PA 2YYZA 1TUIA 4ERNA 3TR0A 2RKOA 2EQBA 4LV8B 4QJ4A 1ZBDA 5KDOA 2ZQ5A 4KO8A 1E9CA 1N3BA 4OHVA 2CCKA 2CNWD 3PEYA 3AKDA 3HDTA 5FH9A 4NXFA 3E5HA 2GK7A 1UPTA 3GJ7A 2CEAA 3GFOA 1AIPA 4RY2A 3P26A 1GIAA 1WP9A 4TYPA 2GXSA 3RH8B 5CIWA 1UKYA 1OTEA 4E04A 1R5BA 1IM2A 121PA 2VV7A 3U7GA 2ZTSA 4WAUA 4Q9JA 1VYVA 3I61A 1R7RA 2WWFA 4M1MA 4GMDA 3DPUA 3UG7A 5BN4A 4KLNA 4P4SB 3WYAA 1CTQA 3X1YA 3GLGE 2YC4C 2QTVB 4HB2A 5EP4A 1GRQA 3KB1A 1L4UA 4I3IA 3F5FA 2BKUA 3B1ZA 2FNAA 1S96A 4MQBA 4Q4JB 2ZJYA 3TUJC 2QQ0A 4PR0A 3LBHA 1FOEB 4Q4JA 4QBHA 1E2MA 3VNUA 5JJIA 1MO3A 1XU4A 2A5JA 5HKKA 5LB4A 2WOJA 4AKHA 3LBNA 2FA9A 3I8SA 1Z6TA 4JIMA 5EJEA 3KTAA 1KSJA 1P2VA 5FPSA 3W6PA 3SC3A 4BFZA 4TTPA 1P9NA 1P2TA 4OQNA 3GDIA 4JSYA 2OOLA 4G5SA 4KJZA 2BOVA 2WSSD 1XMSA 3A4LA 4LBYA 2C04A 3X1WA 5A4JA 2ZRIA 2VSFA 3GLGA 4DLYA 5GVSA 3NVAA 2DFTA 1EFCA 4UNSA 3TR5A 1U2RA 3DOEA 4ZIRB 1O3YA 2CMNA 2AX4A 4UXIA 1II9A 5BQ5A 4NTZA 3I92A 4BEBA 2OG2A 4BBUA 2VYFA 1Z5ZA 4P4SA 5JRZA 1IN7A 1QHYA 1RYHA 1E1QA 3B13B 1NJFA 1KSHA 1GKIA 4IDNA 4JLDA 4DDTA 1SVOA 2I9VA 1H8EA 3A58B 4CIDA 2IYZA 4Z51A 3M4YA 2NGRA 3LI9A 4P4UA 2P2LA 1NMXA 4C7OB 2QGNA 2WIAA 3WYGA 2IYUA 1GRNA 3HU3A 3QXXA 1Z47A 3NG1A 2IS4A 5TY0A 4UNNA 1E1RA 5HD5A 3PIRA 1U8ZA 1U94A 3B85A 3RNLA 2ZI5A 3BFXA 4JVNA 3JZMA 5H70A 3LYXA 3PUVA 5AR1A 3DKPA 2VQSA 1RIFA 4Q9HA 4KFTA 1Z28A 3BY8A 3BH7A 5CYPA 2IC5A 4YMVA 4YONB 4OI1A 3RSOA 3OLOA 1RRPA 1E6CA 2JDIA 1O87A 4DC9A 1FTNA 1OE0A 4LJ5A 2EFCB 4PANA 1YU9A 2JLSA 4ON9A 2ZRNA 1D5CA 3NEYA 2QQEA 4QBFA 3MJRA 2ZU0C 4V0ME 2WWIA 3T15A 3EPJA 1YZUA 4OQMA 2JLXA 1LF5A 2W58A 2H1LA 4TQAA 2FFHA 1R8QA 4KXFB 3CNOA 2R6CA 2HF9A 2V1UA 2D2EA 1E9FA 2REXB 4A9AA 3PHYA 3OE7D 3KZ1E 3G82C 2BM0A 1W0JA 1XMJA 4DDUA 4TMWA 3GFTA 1T18A 3RRMA 1A82A 4BLSA 1D9XA 2X2FA 1OTIA 1N9NA 3MWJA 5FI0B 1YRBA 3K0CC 3NDPA 4TQ9A 5FPKA 4DB2A 2H17A 2Q3FA 3NBYC 2C03A 2JJ1D 2V9PA 3CH4B 4XOIA 5FBWB 3GP8A 1HT1E 1LS6A 4PPFA 3UWKA 3R20A 3KXIA 1AS3A 2AN9A 1GL7A 3AUYA 3LW8A 4FWTA 1G28A 4HZIA 4LGMA 3RYTC 2GBLA 4DWJA 3UB6A 1FUUA 3LNCA 3B1YA 3CRMA 4G5QA 1WMSA 2YVUA 3SBEA 5J4VA 1OJLA 4FMBB 1N0WA 2W83A 4PXAA 5EZ5A 1K6MA 3EPKA 3ZQJA 3LQQA 2F1RA 4I3AA 3F1NB 1EFTA 1KTVA 3CF0A 3SYLA 1GNQA 2A9KA 2D7CA 2GETA 2CE7A 5EQTA 3B1WA 5FI1B 3ZD7A 2BDTA 5TDHA 3VU9A 1FFHA 3K09A 4H6JB 1P9RA 2D3WA 1G7RA 3AVWA 3CO5A 1KJWA 2ZI7A 4N1AA 4IEIA 3ADCA 1AQYA 3L2OB 4WOPA 3G0HA 5A5GA 4M2LA 3JVUA 4HAZA 4TTQA 1X86B 2ZI9A 4HEJA 4LI0A 2IYVA 5TARA 5AJVB 4GSYA 2PCJA 5JWOA 1N5IA 3HP1A 4DCTA 5DGXA 5CK5A 2NMVA 4PAOA 3H86A 1W2HA 2PD8A 1MKYA 1OHHD 4EETB 5KHOC 3TMKA 4WUJA 3KJGA 3OEED 5LDDC 4XWOA 1E9SA 2O8BA 4E07A 3EIHA 1Q1ZA 5HWVA 4TL6A 4HAUA 3KX0X 3VHXA 2Z5FA 1IN5A 1GNPA 2ZRPA 5DJUA 5EXPA 2Q9AA 4AKIA 4DDVA 3TVDA 1GNRA 3T1QA 3UPUA 1Q12A 3FKQA 2V54A 5IT5A 5JZVA 3IIMA 5FUXA 5JWRA 5K8LA 1JXMA 5K8IA 3VX4A 1XTKA 3W34A 2BBSA 4HHDA 2QEQA 5KOYA 3QPWA 1UDWA 2B8TA 2IWRA 1FUKA 4H6JA 2VA8A 1OH7A 4Q7LA 3TW4A 2QI9C 1J8YF 2JLQA 4TLDA 3TRFA 4I3JA 2FOLA 4G5RA 1W0KD 1LY1A 3K09C 4BZPA 4K81B 1JJVA 4QBGB 4Q9LA 3CLVA 5L3QB 1Q1QA 2ZRHA 3QBVA 5FUWA 1E98A 4TMXA 3CH5A 2HUPA 2ORWA 4NYIQ 2NO7A 1G8HA 4C7OA 3H9WA 2IT1A 3B9QA 5HWTA 3NOUC 2GNOA 4IKEA 4LYFA 3TSOA 1PVOA 5F9FA 4DLSA 1P72A 1XCGB 1BOFA 5JMTA 4DKXA 4HYYA 2OFOA 5BN3A 2A24B 4M1WA 4JYCA 5IK2D 4CEHA 1NN5A 2O5VA 2W0MA 2D4HA 2JJ2D 1SHKA 1BO6A 2P65A 5EUMA 2Q21A 1XD8A 2CK3D 2HYDA 2GHIA
chains in the Genus database with same CATH superfamily
2PYRA 2CXXA 3COZA 4HG2A 2C4MA 2HN9A 4N18A 4PC2A 3TDNA 1M7GA 1DV1A 1O9GA 2GLXA 4QBFA 3MQ0A 2R2GA 1OBVA 3QENA 3RPEA 1HFEL 1N9BA 3EDRA 5J2UA 1KNXA 4GF5A 4OP2A 4RZXA 5HQTA 2GSWA 1RYEA 4LJYA 1AOXA 4CRWB 1I9GA 2P6RA 2Y1OA 2REQA 1WDLA 4I1RA 2XECA 1PEAA 3GDHA 2HHLA 3SSMA 4EGAA 3FDZB 5LQRA 1FFAA 3LYAA 4LYHA 3IUNA 5ALXA 3PFHA 5A4AA 1GVHA 3QP4A 1M1UA 3CITA 3ZG0A 4FFVA 2BBWA 1A4RA 2RJNA 2YWRA 1CUYA 4ZO8A 2WJGA 1KF0A 5CFMA 2ZRQA 4JODA 5LZ4A 1CJKC 4FD2A 3N76A 4D3XA 2M1ZA 1MXFA 4PRKA 4Q3KA 3S68A 1I2SA 1V7CA 2YYAA 2G9QA 4FFLA 2FWRA 3HJIA 3R5FA 4KBYA 4F2GA 3VAZA 5AQBA 2PS0A 3BRWD 2C9ZA 3EVCA 3L1JA 3U3RA 2CF5A 4YJDA 1RP5A 4MUXA 4Z4CA 1JSLA 4U7WA 2XAUA 1DRUA 4U6NA 1X9HA 4H4EA 1JPJA 3FGNA 4HDMB 4OBWA 4XCQA 4FC7A 5FD8A 2YV3A 4R71A 2QT9A 2Q9UA 3EJWA 4RVCA 3A4MA 2PSEA 5HF9A 1K38A 1CS4C 1G21A 1SB8A 2OXFA 2OMEA 4MRNA 1NLFA 5JSZA 2IYPA 5DCUA 5F7OA 3JAKA 2DUWA 1YR7A 3L7BA 1VLJA 2CFRA 1K56D 2A92A 4H0FA 1LBTA 1ONSA 5BRJA 3DBHA 4OP1A 2JFWA 3LT0A 5FI6A 5JVDA 1BYIA 4WBGA 4LHSA 5EE8A 3AJRA 4CTNA 3JQPA 3I2FA 5JADA 3LIIA 1KDTA 2I4OA 3MFXA 4LBWA 4WEKA 2HHHB 4O4LF 1CK3A 1SA0A 1F0NA 4EQIA 1IEXA 3E9YA 3FJOA 4RPCA 3TUIC 2QJ5A 2FQYA 2ZFUA 4YR7A 1NI5A 3OT5A 2JH3A 3EG9A 2AJ8A 1YJ5A 3QWIA 3ZDZB 4C05A 4W5NA 1GZVA 4C04A 2QTAA 1U3FA 1UM9A 2IS2A 3AGEA 2XMZA 4EMSA 4S0XA 4HQKA 4CL2A 4ZO9A 4BXOA 1WU7A 1MQAA 2FFAA 5AKJA 5IUKC 2H7CA 3U6KA 2XD5A 1VC2A 4J1TA 3CJTA 2P3SA 1FYXA 4JBFA 4FS8A 1NFFA 3E4PA 3F5QA 2B7CA 2R85A 4NABA 3HHEA 4X9XA 2Q5HA 1U1CA 4QEKA 3CPJB 1ONBA 1GTSA 4RTPA 2A0YA 4YMWA 5AVOA 4IL5A 1EDDA 1O9BA 3CLOA 1XLWA 1DT3A 2BP7B 3CUTA 5F3RA 4O7DA 3HKCA 5AVQA 3RK1A 3H16A 5IJ9A 5IZ4A 1H1DA 3FPKA 4JT9A 2PH1A 2XNDA 3NBLA 2ZRAA 3EB9A 1NW4A 2Q3MA 4CW7A 4KFCA 4FILA 4NDZA 4WLUA 3RSGA 1CR0A 4JKIA 3UT5A 4YYZA 3UT6A 1G19A 2WUWE 1UEJA 4RD6A 3HU1A 4K9PA 4X25A 3VSCA 1GD1O 3WC4A 4TTIA 3JX9A 1ECBA 2EFHB 1N2XA 2EXXA 1J8DA 3M1YA 2H2HA 3B3JA 3OQJA 1P91A 3T1OA 4ZCMA 3HFSA 3EW9A 3VR5H 4HMPA 3P9PA 5JC8A 3VNBA 2O3UA 4ZC1A 3MTDA 2KS6A 2OBFA 4JXKA 4CM8A 1HMPA 3MBOA 2Z5GA 2QVXX 5JDCC 4OLAA 3I4FA 1H6BA 2HXGA 4JR0A 5TMEA 4BFCA 4G65A 2OCPA 4XGIA 5AW0A 1ZKDA 1DOAA 5LA6F 1RWXA 2XOKD 1D9ZA 1ND5A 2QZ9A 3L6UA 3OZEA 3QXJA 1ZRNA 3KJQA 1KSGA 4B74A 5EE0A 4Z99A 2QW1A 5DTEA 2QWXA 1Y54A 3QPVA 3G4PA 1XQ9A 4EG0A 1U81A 4NENB 2JGLA 3CW9A 3A37A 3HEAA 1ZCAA 1JBKA 2RG1A 4P86A 3U17A 3RYCA 5GADl 4L9FA 1JX6A 2JZCA 4I9FA 1BN6A 1E61A 4MR9A 1IIBA 4BLPA 1S0WA 1Z6AA 5CPBA 1NNSA 2I3AA 3OCXA 5FNVB 4GGMX 1PV4A 2P68A 4ISBA 1U8EA 2PZGA 3QLVA 4PONA 1NRIA 1K4FA 3ZE6A 5B7NA 3G0OA 1H1LA 1RWOA 3T41A 2FUKA 2WHPA 2OHHA 5G0WA 4LRQA 4HLQB 4JXJA 2X1HA 1R4AA 4L9WA 4CQMB 4D4JA 3ANMA 3NHRA 1VIYA 4I5FA 3OKCA 3OETA 3TZLA 4KLCA 1EROA 4XH9B 1RQPA 4Q00A 3W3ZB 4YJ2B 2C5EA 3FDIA 1L5SA 2GZ2A 4MITA 3DVLA 3VH2A 1MR3F 2I7VA 2NT3A 1GAEO 3AEUB 4RXTA 2GGSA 4BHTA 4UAAA 1CKEA 3S2GA 1A7AA 1L9KA 2X3YA 2AGVA 4UEQA 5EKTA 5I4KA 2P9QA 3KWFA 3GEEA 4S2OA 3ORFA 3VYUB 5BWBA 3CUKA 1JKFA 1FYDA 1ZUNA 2SCUB 1A9YA 2NZVG 3MZFA 1EE2A 2QZJA 3AXTA 2ATEA 3C6QA 1JU9A 4KQKA 3L8DA 2YWEA 2G28A 4AYTA 1LS1A 5CXSA 3PNMA 1CBUA 2CLKB 4DBLC 1LZLA 2PH5A 3TBHA 5TBMB 1VXOA 3AHFA 4F56A 1A04A 1JLHA 4XCVA 2AWNA 2Y27A 4Q15A 1LU9A 3E15A 1E9BA 4H0CA 3SZ3A 3TD2A 4OL0A 1XALA 2DECA 2YXPX 1BUEA 2NZ8A 3MWYW 4TKVA 5BN1A 3D3JA 3DA8A 1UZLA 3HDJA 4HI0E 3NNNA 1LDMA 4EPYA 1NUHA 2GK3A 5A06A 2Q0OA 1H42A 5ALEA 1J2YA 1ISGA 4CCSA 1V26A 1WOMA 1GRVA 2VYND 3PX7A 4OQHA 1VIVA 3RJMA 4DLVA 4DMZA 1PJCA 2P7JA 1RAHA 5L8VA 4MUAA 1DLIA 1SOMA 2E3JA 4KPUB 4NYIR 3FYUA 4RQUA 5AVFA 4ALNA 1NQOA 2AEJA 4QWOA 4B31A 4R1NA 4OK6A 2C00A 3AEQA 2IWCA 1M54A 2XXJA 3MCUA 1QC5A 3KVVA 1PQPA 1TVKA 5BYJA 2D0DA 4M9RA 3A4NA 3NB0A 4ZQHA 5HQJA 2O8DB 2V7QD 3NHPA 2G09A 2FPIB 4PEVA 1YB7A 3S1AB 5IG2A 2AKYA 1D1TA 4LJAA 1PVVA 1QAOA 4WASA 5BWOA 2WE8A 2HJ9A 1GPBA 1LLDA 4HQFA 1W19A 3VSDA 1SC1A 3ONWA 5EWMB 3SE7A 1JTGA 4UFOA 1TAQA 3ZHVA 4HB0A 2BR4A 2EX4A 4I1UA 3L4JA 4HVTA 1K8RA 1N9GB 2WU0A 3C87A 3EPRA 1ZXXA 3RTAA 2JFUA 5AHRA 4EVRA 4ZI7F 1WM1A 1NNEA 1AGRA 5E2EA 2EZ4A 1E62A 1RCFA 5CB4B 2Q27A 3H2HA 3A0VA 2H51A 1JR2A 2O7NA 2YXEA 4G5OA 1T0HB 4L4SA 3D6VA 2FW6A 3DVSX 3LC7O 1O6GA 5IMBA 1SVNA 1SKMA 1L1EA 1MH9A 2C9DA 1OX5A 1GXSA 1QYRA 1ZP6A 2RH9B 3NOXA 5HG0A 3LZCA 3Q7VB 2ZUFA 4WPGA 1RWQA 2GOYA 2JBWA 1QHIA 2BEWA 2R62A 3SN6A 4AQYB 4G5FA 3OEWA 1PZFA 4X6TA 4DLAA 2O06A 2G2UA 4UEKA 3G1WA 2RJOA 3ORHA 3PZBA 1UPBA 4JDUA 3AR7A 1I1QB 2J6CA 2P08A 5G40A 2LDBA 5CDYA 1K5HA 4MV7A 4KR6A 1ZMOA 1OB5A 2PKYX 3O74A 2BEUA 5H9WA 1OH8A 2QTWB 3QA3E 5H8WA 3BTUA 2OLVA 5FDHA 4HGYA 4GOLD 5J4LA 5BV1A 1B0AA 4NEGA 8ATCA 3LQ4A 5GOZA 2R6DA 2V9CA 2E87A 4INAA 5BMOA 3L7JA 5HGXA 1O4VA 4NVRA 4KUHA 3J81k 1HNWB 4CKZA 4CLOA 1KBQA 3OM9A 4DIUA 1KP2A 2XROA 1FK8A 4JJIA 3PJFA 3PUIA 5CU7A 1JZQA 2DUMA 4W5HA 3NUGA 5IEBA 2J48A 4V2IA 2B9EA 3QVVA 5LZ7A 1KO7A 4FWBA 4QECA 5BUCA 4BENA 4IILA 5E2BA 2Q1WA 1UT8A 1T5LA 2QLFA 4KTTE 1IWBB 4WK0B 5F73A 3SHQA 2ZJ2A 2YKFA 1HEYA 1N2JA 1PWXA 2FTKE 2FRXA 2O2DA 4G24A 4J1TC 1GCOA 1MZVA 1XQYA 3UAWA 4CNQA 4EHJA 5ABPA 4RKYA 1JILA 4FB4A 3WKDA 1ZHHA 1Y33E 4B4KA 3T5MA 5C31A 1U99A 2PMDA 2Y2OA 1XEFA 2VKTA 2JLUA 5EI5A 3N8NA 1SCNE 4EIWA 3F9RA 4OXIA 4TZ0A 1IEWA 1NR1A 3RV3A 1ESCA 4JLNA 2ZYVX 3O26A 4L4XA 1IHPA 4ZAXA 2WSIA 2R1VB 2XGMA 2AJBA 5JZMA 5D87A 3ANNA 1Q1NA 5D01A 3WGVA 2O0KA 1MENA 1A2OA 3PUJA 5SYAA 4CKWA 1MKMA 5LLTA 1Q14A 2ZXEA 3P0IA 2YV4A 2O3RA 1T36B 2FGJA 3K2IA 4HYTA 1SOVA 3MKEA 1CULC 1PWGA 5C8YB 2OQ2A 1T0IA 3M4JA 4MUNA 2VDPB 1SN7A 2MOKA 2C3UA 5A62A 1W7AA 3H2JA 3T3MB 3UJBA 4YAWA 1WY5A 4OP3A 1EQUA 1QHEA 1OAOA 2GJ3A 1VHJA 3PQCA 3ZD8A 4EYOA 1XLVA 2Z2XA 3N3AC 3N86A 2UYGA 3O8QB 4IDEA 3RS9A 1WE4A 4BVBA 4CVNA 4DYHA 2XGOA 3SM3A 5GJCA 1EDBA 2YNMA 3B53X 3ZDCA 4PPGA 1ICEA 2NPIA 1UWLA 5IT9A 2CMDA 5K2OA 4Q4AA 1YZHA 3DOIA 4ER6A 4MN5A 5DTKA 1QE5A 2ZYWX 3AM3A 3V1UA 2QRPA 3ZDYB 3JYLA 3HSSA 3X2SA 1DAHA 3FCAA 4EA7A 4HZGA 1IKIA 4AS1A 3OO1A 5FPYA 5F69A 2E8IA 1X8KA 1EXVA 1Q0PA 2C57A 4QO8A 5DTMA 3UH0A 4TPKA 5ILGA 5LD2C 1FC0A 4V38A 4OBBA 1SIUA 2VLGA 3H2SA 2Y2KA 3OTWA 3V67A 4I55A 4P22A 5JYEA 4HGRA 4BAGA 4WZ4A 1DP4A 1RJGA 4TZKA 5K3DA 3FKSD 4GJ4A 4QPPA 4HWRA 3R9KA 1QG2A 4LJ7A 5TJHA 5HF6A 3M70A 4ZZIA 2J7KA 1AZLA 1E2JA 2C97A 3VO2A 4BNVA 5FTJA 1H2FA 1H93A 1QIGA 2QTMA 1VE1A 3QEJA 3N2LA 3Q85A 3F8WA 4OSOA 5CYFA 3G8AA 5CPFA 4CR8A 2P04A 2DTXA 3RYFA 1KQOA 1NP6A 3NOQA 4MQMA 4G0WA 2AKAB 2ZJ7A 4PLWA 3ZHXA 4D98A 3W4JA 4CV2A 5CD9A 3HNPA 3L1UA 1UT6A 1V95A 4XYEA 3ZKWB 2YJTD 1FOFA 1LLQA 4AQDA 1J1ZA 3SZLA 2I4NA 1JHYA 3LIDA 1QG4A 2QZPA 2AJDA 4X1YB 5T4EA 2FH5A 5K6RA 4DV2B 1J4AA 2ECQA 4HLUA 1YL5A 4AQ7A 3K35A 4RLSA 1J39A 2V6BA 5ALDA 2C5LA 1OC4A 1YFLA 2V7UA 3JQ9A 4W7HA 3EA4A 3CY6A 4II3A 3SF0A 4AJ2A 4YCMA 2QK4A 1NN1A 1GTZA 2WUFA 4ND7A 5SZHB 4RUKA 4OQPA 2YN0A 3QOFA 1UC5B 4DIOA 4RX3A 2ZWAA 2I54A 3W5AA 4CMKA 4L78A 2YHBA 2GVDC 4ZP1A 3AQIA 1BE0A 2XIQA 1Z12A 4HWTA 1YVUA 2DZDA 2FSFA 3UFXB 4EI2A 1N77A 4KX3A 2F8TA 2IZ7A 4JX9A 3F4LA 1C8KA 2QYTA 1U63A 3ZG7B 1BHQ1 4MIYA 1Q0UA 1YB1A 1JXAA 1FMJA 3KP1A 5L3SA 3TVTA 1AB6A 1S1YA 3WA6A 4MPJA 2AE1A 1U0OC 1XDWA 4D4MA 1STOA 1PR2A 4LQDA 3V32A 3N6RA 3OD1A 3DQZA 1NF3A 1C1YA 1XU7A 1RWMA 1Z9BA 1ZIOA 1TMGE 3FI0A 3GFPA 3R77A 1CEGA 1KFEB 3M6UA 3UGTA 4PGGA 4YCBA 1P0PA 3CJMA 2YV1A 3FROA 4N9KA 3S7NA 1CUAA 3SXJA 3HCOA 1E3MA 2ZWVA 4EPTA 2PGAA 5JSYA 3CN9A 1UQRA 2J4CA 1KEEA 5EIOA 1X70A 3H4TA 3OUTA 1XQ6A 2NQTA 1W2GA 3OPYA 4MCHA 4W6ZA 4Z0PA 3L1VA 2GK6A 1EX7A 3BJNA 4B79A 3O3VA 5B2EA 3I4LA 1NDQA 1M2HA 1HOTA 4NYJR 4BZXA 1ZC2A 2DTDA 2TECE 2VP5A 4F96A 3NYRA 1L0EA 4X94A 3FPAA 1G5HA 1R37A 2IHBA 4YDHB 5EQFA 5FWYB 2IOHA 4C3ZA 4Z7QB 5AQ7A 4UE3S 3O9MA 3ZGAB 4HQLA 5ALZA 3T6KA 3T3NA 2XOEA 3WHKA 3OC2A 4KVGA 3V8EA 3Q15C 4P53A 1GLGA 1GQQA 5JFTA 2Z2LB 4P08A 2QUZA 3EGEA 1OILA 3KJXA 4B0OA 1HEIA 1LVGA 1D2EA 4R4JA 4R8KA 4K0WA 2GRAA 1UXOA 2L1MA 2QRKA 4DUPA 5JAHA 4ZPXA 1HSZA 3KU1A 4LSMA 5SICE 4RWEA 5K6AC 4PYJA 2I3ZA 3PQEA 5EQJB 2H5SA 4FNAA 4Z7OB 3WFIA 1M6KA 2HZ5A 2WJ3A 1UBOS 5FAPA 1UKVY 3CLTD 2PNJA 1DEKA 4WZAE 4LECA 3T7SA 4E70A 1II0A 10MHA 2I6TA 3P8ZA 1A5BB 1AGNA 4OHCA 1EMDA 2GKOA 4ZQFA 4LHWA 3ZZUA 3ZXSA 3A3PA 4JGOA 4H1UA 3ZBQA 1R0CA 1GZDA 4EY5A 3UWDA 2OT3B 4BFWA 3N2IA 4C5CA 1TF1A 2PXCA 1A9XB 4K28A 2VTDA 3UHOA 3G5TA 3RT7A 3AF6A 3LA8A 1T9BA 4X1IB 5GJWC 5E43A 2AFHB 4OXKA 1T9HA 1XK6A 3NYWA 2PYPA 1QYDA 2DUUA 3JATA 3N6XA 4B6QA 1A9ZA 4ITVA 2P2ZA 2Z6VA 4NG4A 5KQSA 4FM9A 4PFSA 2V0GA 4TRMA 3EOBI 2G08A 3COVA 4OREX 3STWA 2DPXA 4B6GA 2HKIA 3T1NA 1BA3A 4MUHA 4RPKA 2VQFB 4BIIA 1T9AA 3B1KA 1R12A 3WRXA 1HLFA 1SC4A 2GCNA 4EMTA 4HTFA 4ZN6A 1E1KA 3N75A 2IYSA 5EOOA 2VLIA 3CGGA 4FR2A 1JNUA 4R9RA 4J29A 4JOQA 2ZUUA 5AOAA 4Y2PA 4BE4A 5L51A 3KQLA 2RSLA 5MHTA 2WGVA 1FRNA 1BW9B 3LHIA 3C39A 2AZMA 2JGIA 1VYHA 4JA0A 4LZJA 2HO5A 4DLWA 4QARA 4JUFA 3K2EA 1TJNA 1KJJA 5HK9A 1FCMA 1IM5A 1C9KA 1SZVA 3P9ZA 3PR2B 4K0RA 4RZSA 3SOPA 4CDRA 5GZ3A 2J3MA 2GFHA 5C4GB 4EY4A 1M6WA 4LX8A 5DBOA 3LGOA 1EVYA 4HHEA 3SWWA 1KJYA 1P17A 1JHRA 2BMDA 1WW8A 4A0FA 3IRVA 4CIVA 1JAYA 4U2FA 3WLEA 1MN6A 5HWWA 2NTYC 2BF7A 2CLOB 1X1BA 4K0KB 3BILA 4Z3DA 4PKYG 3U2AA 1EEXB 3OX3A 3R9IA 3I5YA 2WB2A 1M0EA 1FVOA 4A23A 4GQIA 5AESA 1N5KA 1KBOA 2EIHA 7MDHA 4RVHA 4DBZA 3N53A 3O8BA 1PKEA 1NSTA 5KYUB 2Z95A 5DBFA 3T9DA 2I6XA 4A82A 5EZ6B 1F7VA 1ODKA 2C1ZA 3AW9A 3BHIA 1GTVA 2HHJA 4OQZA 3VOYA 1GAXA 4Q9AA 5AH0A 3QI2A 1C7EA 3UHAA 3ZBPA 4JBGA 4QULA 3FNIA 5T4HA 3TVYA 3FWPA 2YFQA 4YP0A 4KU4A 3SAJA 4NBTA 4FDVA 2P1ZA 2XT6A 4MLPA 4I66A 4IS2A 1RI5A 2PD6A 3JVDA 3DEKA 1MV8A 1XWFA 1M2WA 2ZZMA 3C4OA 3H5VA 5JNSA 3ORRA 1L1RA 3M6VA 3AFNA 3RWMB 3AEZA 3UJ3X 1G2IA 1SKYE 1MD9A 2XQJA 2AYXA 1PK9A 4NK5A 5AMXA 3IBRA 4LUCA 2R1UA 3W7VA 1RJWA 4GHIB 3HV2A 3NBZC 4NE9A 3HC7A 1Z3CA 1UK9A 2A3NA 3KYDB 2FK8A 3W9YA 1GKKA 4RVAA 2I8LA 3NBMA 4BAZA 5FQKA 1AKVA 3W3AA 5HD3A 1Y3FE 4RMJA 4ZVMA 5E38A 5F68A 4ZQBA 1P33A 5FI7A 1LVHA 1SUWA 4TTTS 2HCFA 4AJJA 4BNNA 4RTKA 3ENNA 4NCBA 4BZWA 2ZJ6A 2JARA 3ZGOA 1Z8DA 2BLLA 3D7RA 3G0BA 1U2GC 1GP2A 2BFWA 1TKAA 3VPXA 3MGBA 4J9UE 1M2VB 4MHSA 2WU8A 2E4XA 3D4IA 4ZTKA 1SVSA 1ZJZA 3KSMA 3HR7A 3K2QA 4HDCA 3TW0A 4BX0A 4M9XA 3GJ8A 4F45A 4LMAA 4IH1A 4QSMA 3TIVA 3ZHZA 3CCBA 3R6DA 4N6NA 5CRIA 4ZQCB 1DJOA 3E23A 2VSYA 4YINA 1W5EA 4ITUA 2JGDB 3VYTB 2O2ZA 5DLDA 2PEYA 1X80B 5KAMA 3PNOA 4RGBA 4JF6A 2NSDA 4P4NA 3LHDA 4U3JB 1X2EA 1JR3E 3ZIAA 2PMFA 1G60A 1VKNA 3G2MA 5CX1B 5F1KA 4ARAA 5MFPA 1WIWA 3VNAA 1U2ZA 3HU2A 3AU9A 3HYSA 1KZ1A 1RC0A 4Q7EA 3ZWNA 4BLUA 1U04A 5JCXA 3U5TA 4RY8A 3BMCB 3ZNNA 5B4VA 5I9BA 2Z6CA 4MUYA 4JQCA 2YHIA 1KQFA 1LEHA 1NQXA 4FH2A 2R00A 3KOWA 4H4DA 2I6QA 2XTNA 3H5WA 4HGZA 1K7EB 4OJQA 3G0IA 2DR2A 4LGVA 3ISJA 5I5LA 3VJLA 2ZYUX 1MPXA 1HR0B 3A9UA 4QTXA 3P7MA 3OMXA 2CMKA 3L06A 4G4SO 1M10A 3CRW1 2XWQA 3JQCA 2WYWA 3OLVA 1KVUA 2YV5A 1U3CA 3CWQA 4IYRA 1F4PA 3SXPA 4ENWA 2R4UA 3MTBA 2CYBA 1I2WA 1S2GA 1OUMA 5ERGB 2WPNA 2GWHA 3V4LA 1TZKA 2O2HA 2WGWA 4RVUA 3DVAB 5G3ZA 1XKQA 5IZCC 3WLQA 2R96A 2JIMA 5EFZA 1YCHA 2PKEA 3G0CA 3O4VA 3ZJ4A 5CG1A 2G6TA 4JP1A 4MINA 1M2JA 4UTVA 4A6XA 3AIMA 1UKEA 4H08A 1KEVA 5KNCA 1U3VA 3T4PA 5M2QA 5KOHA 4K46A 3OJEA 4KVFA 1NKVA 3EGXB 4IUDS 5LU9A 3NS7A 4TYMA 5DTIA 5CX7A 3PR6A 2FR0A 3OJFA 3I2HA 1E2GA 2IU6A 4X1LA 1A0KA 2H00A 3A28A 3H9GA 4R7GA 3A1WA 4ER3A 3BIXA 1YJ8A 4WCDA 5D7NA 4Y18A 3K0KA 4F5EA 1PWEA 3VNVA 4EW2A 2JCSA 4NKPA 3RROA 4BC0A 3OA0A 4MS1B 4C76A 3P9YA 4DPLA 1YLWA 1BHJA 1F8UA 1PQYA 1VGVA 1VLZA 1ZSYA 2FMTA 7ABPA 5LP6F 4KZ5A 3F6PA 3TEFA 3VPDA 5EVID 3RKSA 3GV0A 4KQ2A 1MPTA 3ZI0A 1SXPA 5LP6C 3B7WA 1IPHA 1AX9A 5ER9A 1ZCFA 2YDYA 1D0VA 2E21A 3FKWA 3BDAA 4MVJG 4U2EA 1RRFA 2UUOA 1T8SA 1LPMA 4TKUA 4D8TA 4MWOA 3COJA 4C4SA 3EAGA 4DA8A 3OI7A 2Q8NA 1Y34E 3I04M 2DPMA 1L5HA 1BHSA 1WD5A 4DV7B 2ZEJA 3D8HA 5AVVA 2I6UA 5DVAA 4AN1A 4TM7A 5LC1A 4G0VA 4PM7A 2F43A 2A33A 3DMGA 2QSYA 5TGDA 2FJUA 1GQ2A 1A2QA 1CRPA 3UAZA 3G5AA 4FNGA 3U81A 1RFLA 5LXTB 3W5VA 3T5CA 3P98A 4OJNA 3MGAA 4RO0A 4I7EA 3ZU6A 2Q6OA 3JAKB 2C2OA 2DM6A 2MSNA 4MKHA 5CERA 3AESB 4IGFA 4WOCA 2FZVA 4X8HA 4UQLA 3I83A 3MWLA 3T1VA 1WHSA 5IDVA 3FFWA 1ZD8A 3FN4A 3NFRA 2E4WA 3K4HA 3W6UA 2BBOA 2AA3A 1ZIYA 3IX7A 1NPTO 1YZYA 2AJLI 3R5KA 3HSYA 1ONHA 1UAGA 3VDXA 4CMBA 1LC0A 4J1QA 1KXJA 3W3AH 1MMFB 2NWQA 2OBYA 4BATA 4DQVA 3HN6A 2E5LB 4GLQA 2FUG1 2JATA 2WWXA 3AI3A 5TEWA 4EPWA 4CIYA 3Q7EA 4YP9A 1M0TA 3EGDB 5HE9A 3RYFB 2Q1UA 3WRYA 4F38A 4RZQA 3UFBA 4EB0A 3F8SA 2BP7A 3DMDA 4YP1A 2QUAA 4D8VA 1DG1G 1ZD9A 1ZD5A 5IMSA 3WGGA 2C84A 4C6RA 2PPVA 1MU0A 5AJUA 5K3AA 4JOSA 3RVOA 3ZV6A 3AVOA 3L9XA 3JVIA 4C3UA 1B6TA 3K3PA 4IOKA 4ZI5A 5A05A 2XCTB 1IOUA 4PTLA 1P8AA 1IU9A 2HB6A 4UOEA 1N1GA 3RTBA 2W71A 5KQGA 4WBNB 3GFRA 5AM3A 4PY2A 3CPHA 3PEVA 1CUGA 2A59A 2YJ5A 3E2IA 1IQUA 3GWGA 3EF1A 3BM5A 3D5TA 1PBNA 4LWQA 4XEUA 3SP1A 3TZKA 4P3XA 1RZ3A 4HQAA 4RA7A 1IY0A 1FY2A 2WHYA 3DUFB 3GPDG 3ITDA 4H9GA 1TO1E 3IV9A 1ZVJA 2IYFA 4OMFG 2XTZA 1QYXA 1FNDA 1T0BA 4AKEA 1IC6A 1NVUQ 4X00A 2NUAA 2CE2X 5BNFA 4PTZA 3OY7A 4DCJA 3V80A 3EYAA 4FCTA 4XGRA 5HIAA 4EESA 5TQVA 2XODA 2FRVA 3UCFA 5AYVA 2QZ6A 1O6CA 3JALB 4KWEA 5C8YF 2QLJA 5JXGA 2IUSA 3U0VA 5CJ2A 4UAVA 3C5HA 4Q7JB 3RSQA 4YT8A 2JI4A 2VKQA 4RU1A 2X19A 4BO3A 2KLHA 3VJRA 4BZZA 2ODTX 5HRAA 2UYOA 3OCUA 2ZAMA 2V1ZA 1PI5A 2PRIA 1Z38A 4IZ6A 2RGNA 4FDUA 4R8VA 5DM0A 4X20A 1YQXA 1E4OA 2P2DA 1FDUA 3PVZA 3W78A 1PW8A 5BSWA 1H2HA 3OTHA 3V4RA 2CV2A 2XQZA 1CHNA 2ZBDA 4C3QA 3HUMA 3SKXA 3KYEA 1VHDA 1GA6A 4OQFA 4BO6A 4Y17A 2XNSA 3LLSA 4XRRA 1VM1A 3LEQA 1C1XB 2B36A 2CVPA 3QKIA 1YZTA 4TROA 2EX2A 3QP5A 4IXNA 3UWOA 1YLPA 4IF4A 4Q1DA 3RVMA 4M9SA 3LR3A 4GSLA 4JSRA 4DLXA 2GXAA 3T06B 3HS3A 4IUYA 4NF2A 1NG9A 3O75A 3OHMA 5BR1A 3HK2A 2FXVA 4TTVA 3D59A 1OJ7A 1ST3A 2ZYDA 3E1SA 5E3JA 4D46A 2Y9MB 5K5EA 1YAHA 2O8CA 3UMEA 3OFND 4QB8A 4JWTA 1K5GA 1OV4A 3IB6A 4KXYA 3MLBA 5EXSA 1HSOA 5FWXA 3ZKAA 2FW0A 3M6AA 4YXFA 1NJGA 1YM1A 3CPTA 1ZNYA 4HXEB 2UVPA 1YB5A 1O5TA 4GXTA 4WMLA 3RT1A 5UKDA 4DDMA 4B9EA 1C3OA 2IHUA 1YLTA 1U3WA 4JLOA 3GUUA 1Z37A 2J3DA 2ZRKA 4OB7A 1PR9A 4O8GA 3DJFA 3SI7A 3W06A 1UOOA 3VP2A 1LLBA 3BOSA 4IVPA 2CF6A 4LY0A 3KYQA 2WF9A 3VA7A 5JECA 2R1ZA 3OP1A 4HDNA 1TOAA 4RNCA 3BK1A 4MRSA 4RETA 1HI9A 2WP0A 2IPLA 4LSGA 4X84A 4ALMA 4ETXA 1KHHA 3IESA 1YLZA 2IOQA 2P2YA 2YWCA 3EDYA 3LUHA 3X3HA 2A86A 4RPJA 5JAUA 3KL4A 3D1JA 3BRSA 3ICCA 1OSNA 2QP3A 5HL1A 2KX6A 4RHYA 4C78A 3EMKA 2W22A 5I9MA 4OAOA 1U8CB 4N7BA 3HUOA 5AKYA 1LK0A 1VHLA 1VOTA 4UCXA 3SHWA 4Y1GA 3U09A 4WN9B 5FNZA 4XR4A 1G6HA 1RYFA 2ZRCA 3F4KA 4S1NA 2QRQA 4L85A 1BFUA 4PM8A 4K8OA 3OTIA 5TT1A 8AT1A 3WQSB 3U4DA 2WAOA 4ZQGA 3ZS8A 3TQRA 4DUYB 2PQ0A 3MGKA 3V55A 2G72A 3VC7A 3WLNA 1JBEA 4ENRA 721PA 1H2XA 2PZLA 5A0TA 1T1IA 4EG1A 1VIDA 5F1FA 1Q1AA 1NUTA 3EUWA 2QD5A 4E5SA 2TMKA 1QKJA 4ZMRA 3IEVA 3UHPA 2ZSDA 2ZIGA 4F1WA 2W2XA 5I7EA 4OQYA 1ECCA 2JFOA 4ZARA 2VDKB 2Y05A 1NONA 1NV8A 1VFNA 2B1GA 5FNVA 3W77A 5HJEA 3PXGA 2DP4E 1UAAA 4U0TA 3U4CA 3V7WA 1KAHA 1KH1A 1ZM9A 3JQ6A 5HUHA 2FWNA 2IY9A 5FO1A 1Z68A 5MC7A 4L6AA 1PX2A 1UBJS 2Q4EA 3IOBA 4Y2VA 1N2SA 3D54D 3K1AA 5DXAA 4C5AA 5IJAA 1URPA 1Z7EA 2CJFA 2QIOA 2KWIA 3L04A 2LP4Y 2W8ZA 3EFEA 2JL1A 1BX1A 5JFOA 2QTLA 4EBPA 3AYZB 2Z5LA 3CLHA 5E2IA 3PSHA 4MA5A 2F9LA 2CYCA 2GBCA 3B2EA 2RHLA 3D0KA 3THSA 4EGFA 1E5QA 5HDDA 2A3RA 2O9BA 1CZRA 3W2GA 4R0QA 4LV0A 1HRKA 2CL7X 3OFJA 4MUMA 1FW6A 1JRLA 1MIHA 1GPDG 4PO3X 1UMDB 1XJ6A 2YFKA 3TSGA 2CJWA 5L7YA 4YQFA 1Q2QA 1MO4A 2A0FA 2D00A 3G2JA 5F52A 4EB6A 4F3NA 2MU1A 1OOEA 3A9VA 3LKVA 4QRDA 5LZ8A 3W3AD 1QAQA 5TBMA 2IGTA 4Z53A 4UJ3A 2HNKA 3EASA 4V02A 1YK0A 5FB3A 2AOUA 3QVOA 3O73A 5A93A 5JISA 1AKRA 1NBAA 1T3GA 2OCDA 4M88A 4Y30A 3BFDA 3MQ4A 1F1BA 1HKUA 5KU7A 4PQEA 3W6NA 4YJFA 2VSXA 3I1IA 4X45A 4Y7DA 1G64A 1UWVA 2F3UA 3C5EA 3QPDA 3SYRA 4Z2YA 3GFGA 2G06A 3R7NA 5IVIA 4IGAA 3GFSA 1Z5PA 2QYSA 4RK7A 3BE8A 3BRMA 3P94A 4OAPA 5CM8B 3EF3A 4CT4B 1VJGA 2M6RA 3NBQA 1BXGA 3L8GA 2JA1A 4OIFA 1J42A 3IX8A 1DCKA 4S35A 1WY7A 1FDWA 3ICPA 3PHBE 4I4TB 1Q74A 1RC8A 4Y2JA 1VEUA 2AUTA 1Q3HA 2NSHA