2WKRA

Structure of a photoactivatable rac1 containing the lov2 c450m mutant
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
317
structure length
317
Chain Sequence
ATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNMRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFHHVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NPH1-1, RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
publication title A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
pubmed doi rcsb
source organism Avena sativa
molecule tags Transferase, cell adhesion
total genus 109
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2wkrA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wkrA02
1VKJA 1JAIA 2RGEA 3GLGB 2XOKA 3T15A 2H1LA 1S96A 4OL0A 3SYKA 3TAUA 4CW7A 1Z2AA 4XOIA 4A4DA 4KJZA 3K9LA 1P2VA 1CRPA 1MZUA 4DZZA 2IYVA 1TQDA 1G7SA 5TBMA 1IOZA 1COWD 2WZQA 2G3YA 1P9WA 3WP0A 3WXMA 4EAQA 3K70B 1DBSA 5EZ5A 5G4ZA 4DLVA 3HJNA 3THXB 2GXAA 2CVHA 1OFTA 1KO5A 4ACBA 1VMAA 1SKYE 4C0SA 4GOXA 4NYMR 4B44A 2ZRDA 1G5RA 5CYOA 1G3RA 5K8UA 1V5WA 2HV1A 1DAFA 3U3RA 4DDWA 5JECA 2PD7A 1ZU5A 4HHDA 3NBXX 2HXYA 5AUOB 2QTVB 2A78A 3GJXC 1N2CE 4IVQA 4JBXA 2ZJ2A 1XJ0A 3VR6A 3UB9A 3X1WA 4NTZA 4BFUA 3ZQ6A 4K81B 2FH5B 5AJXA 3IIJA 4K8OA 2NG1A 2JJ1D 1MABA 4IFBA 1DADA 2EA9A 4NYMQ 1LSXA 1Z0AA 2PX0A 4Q4HB 4HJ6A 1LW7A 2FGKA 3GLFA 1KK3A 3F1OB 3Q7QA 4ZDKA 1TL7C 1XEXA 2JLWA 3IGFA 4KFUA 2BM1A 3QOFA 4PZLA 2BCGY 1T8UA 2MSDB 1IXZA 3LY5A 4HB0A 5CITA 1U0JA 4TYQA 3RYTC 5DJUA 2Q9BA 2VL7A 4IXMA 3AUYA 4ZIRB 4I99A 3VX4A 5JFGA 1P2TA 1E9AA 5J4VA 1IN6A 2XXAB 4D25A 2BBSA 1WA9A 2WWFA 4FWTA 2ZE7A 3LLUA 5DE3A 1Q21A 3RS5A 3WY9A 1TNDA 3VTKA 2CLSA 4ZO4A 1ZC4A 2H28A 1G20E 2J45A 5JJLA 1VHLA 2IBMA 1GRNA 1RRPA 4Q5IA 1GDDA 3KJGA 1JECA 2ZU0C 4AYTA 2VV7A 2IW3A 2PT5A 3P4YA 5FBLB 3IUYA 4JLBA 2WMOB 4M53A 2ZRNA 2ZS7A 5FBWB 1RVDA 1E1QA 1VCNA 2P0EA 3R8FA 2QTHA 3K0EA 2PCJA 1XU4A 2CHQA 1UDWA 2VF7A 4RD6A 4G5QA 3WYAA 3X1XA 4Q4JB 4M1YA 3O8BA 2ZRJA 3TIFA 2XOKD 3W90A 1OTDA 1MT0A 1R0WA 2F1JA 3AUXA 3P26A 3AVWA 5BXQC 4R7ZA 4Q02A 2PJRA 1XRJA 3BB3A 1FQKA 4C0BA 3VNVA 3AM1A 3CPJB 1S1YA 2YJTD 2DWQA 3U5ZB 3F1PB 3B7GA 2NO1A 3CRRA 4IOMA 4JT2A 1A2BA 1HE8B 3BD9A 4BLRA 5C2JB 2WKQA 4BASA 4X8MA 1UM8A 3WYGA 4RZ2A 1G7CA 4JVSB 4RD2A 1TS6A 1M74A 2ASEA 1OYWA 2DFKB 2MMCA 2D74A 2RCNA 1CJVC 3U7EB 2ZE6A 2CCKA 1V9ZA 4QHYA 5K8TA 2WPDA 4TTRA 2W2XA 3TMKA 4ZKDA 2RGAA 4DSUA 2HYDA 1UWNX 4F4IA 1NY5A 1N9NA 1CTQA 4R70A 3JVVA 2OOLA 4PXAA 4AKGA 3OIYA 5TVKA 3IO3A 4JGQA 2C95A 3W6NA 4XTCS 2VP6A 2W6JA 3FFAA 4GOJA 1U8YA 3GQBA 4Q9HA 1ESMA 4M21A 3KB1A 4Q7JB 5TXGA 3EAQA 1TUEA 2VSFA 1T1AA 1Z08A 5KDOA 2HXSA 4C7OA 1QHGA 4JGRA 3UMFA 1VPLA 1TU3A 3WP1B 1RE0A 1XTRA 2O0KA 4NP6A 3BORA 3MFYA 3THWB 3VNUA 3I8XA 1A7JA 2GDJA 4BE7B 4Z51A 1OTAA 2RGCA 5FPTA 4LYJA 1TQ4A 3KDSE 4LBZA 2CMNA 1KNXA 5CB6A 2A2ZA 3C7KA 4B3XA 3JVUA 5DHAA 3RVBA 2XGJA 4R71A 4LJ8A 3QENA 3QXCA 3P4XA 4ACAA 4BZXA 1R0ZA 2VPPA 4HB3A 5GVRA 2PZGA 2KB0A 5GJWC 4AURA 1GKIA 1G1MA 4PSVA 3DKPA 2R6FA 1E1QD 2FWRA 1Z29A 4GNKA 3VKHA 5KIZA 3P1JA 3RAPR 4IVPA 2PEZA 1Q1EA 1MO4A 1NIPA 2XAUA 2Q9CA 1T19A 4G1UC 3KQNA 1G21E 5DH9A 2XB4A 4PC6A 4GBMA 2PLFA 1GSIA 3IEUA 2ZSDA 1U8ZA 4YMVA 1GILA 1TF2A 2RGNC 1WBDA 2IS6A 1VG8A 1KI4A 3I1FA 5HWTA 4Q48A 4JLKA 4E04A 4JS0A 1T8TA 3ADDA 2WAYA 2J0UB 3NDBB 2LKDA 4FMBB 4GFDA 1NVUQ 2E1RA 1EESA 1K5DA 2I1VB 2WPDD 3EPJA 4UNNA 1E9DA 4A2QA 4PTLA 2V54A 1KGDA 1TAGA 2O5VA 2QENA 4NCIA 5CJPA 2EYUA 4M9SA 3TUZC 1MV5A 4PAMA 4US2R 4E22A 3TSZA 1P4SA 2W6JD 3B1ZA 3E2IA 4PO9A 4CZ2A 5E4FA 1W4CA 4JBWA 4HB2A 4V0ME 3MGCA 2F1HA 2C99A 1N0UA 2FFAA 5J4HA 2IT1A 5E7JA 5G53C 1R5BA 2OXCA 3GFOA 3FB4A 1KK0A 2OV2A 1ODVA 4NH0A 1HTWA 3MXQA 1I4TD 3I61A 4EJSA 1NJFA 3KL4A 3N5CA 4PPFA 4CEJA 4DLWA 2IX3A 5H68A 3E5HA 2IC5A 1DG1G 2ZSBA 1IY2A 2FJUA 3AF2A 3ONWA 4UNPA 5HZKA 3VR4A 1RFLA 3B6EA 5EE5B 2DHRA 4MGYR 4DJTA 4W5HA 2O52A 2YOGA 3GJ6A 2WSSA 3MJQA 4JLJA 4NONA 4PZYA 3T06B 2WOOA 4AC9A 3QE0A 3W9YA 1E6CA 4YXWD 2C9CA 5L3QA 2GK6A 1DO0A 1YZNA 2QSYA 1E0JA 1Q57A 3U7GA 1E98A 3ZJYA 2X19A 4X8HA 1FTSA 2YINC 2KWIA 1KYIA 4MN6A 5FTKA 1GP2A 5KSOA 4EFNA 4LLOB 4EEUA 1X1SA 4Q03A 1Q20A 3R7WB 3T1OA 4GS9A 2O8DA 4MYTA 3FGNA 3T5GA 4ITRC 3VX3A 3GCGA 5KNCA 3QQ5A 3WNBA 1HURA 4HUTA 2ZRIA 4QNRA 4L5BA 1OXVA 2ZJYA 1KAGA 3UMDA 2B7BA 4WUJA 1N6NA 3H0KA 1G17A 2OWHA 3IHLA 3K0AB 5FOXA 4Q9LA 2OWJA 4BFZA 3DPUA 1SXJB 4QGHA 4HH3A 1IN7A 5HCNA 3B8HA 4HZIA 3EWAA 5HE8A 1MRSA 3T61A 1F9IA 4QBFA 1UKVY 4YMTA 2W6IA 3GMTA 3VR1A 4PFSA 2GVDC 3FE2A 4MYUA 2RGNA 2GILA 1RYHA 4ZI3A 1YZTA 2EQBA 1XPOA 4D82A 3QEJA 1DRMA 4YXWA 3RRZA 4HATA 4DCSA 4E09A 3SEAA 1T1BA 3BGWA 2R6GA 4HDOB 5E3HA 1GSWA 2IEZA 5HE9A 2GCOB 2WJGA 2ZR0A 3FWYA 2O8CA 1FMLA 3C41J 4MH0R 221PA 1TS0A 2W83A 3SHWA 3ZDQA 3R9XA 2J0SA 5IDVA 2CCJA 4XJXA 1EW0A 1ZUHA 3KQHA 2GJSA 3F0TA 4NU0A 2ZI3A 5FR2A 3BY8A 2QPOA 3GFTA 3CWZA 1YJ5A 3BXZA 4DCVA 3REFA 4WXRA 5EXSA 4FMCB 4KUOA 3LH5A 4NCHA 4AWXA 5CDFE 2AN9A 1UEIA 4OK3A 4EPXA 4Z8YA 1SVIA 2WM9B 3GLHE 3W6PA 3WBKA 1JB1A 3X2SA 2WSSD 4F4CA 3TJZA 5EE3A 2VHUA 4LYFA 2O0HA 2YVUA 3C15C 3ADBA 1YE8A 1Z63A 2ORWA 3G5UA 4DLXA 1IJFA 4BRWA 1A82A 2P6NA 2CL7X 4B3GA 1NY6A 5L3RA 3B1XA 1OXTA 3IDQA 5L3SB 4TMWA 1OH8A 1TTTA 2IYUA 3QEOA 4A8JB 1Z6YA 1RW4A 4EXOA 4HAWA 3C14C 4I3IA 4NYIQ 1Y28A 2CXXA 3CR8A 3LUQA 5F98A 3BERA 1AA9A 1YQTA 2QGZA 2RGXA 3SU8A 2HCJB 1Z6GA 2OT3B 1XXHA 3VOLA 5AJZA 4RQ9A 1N5KA 4OBEA 2QM7A 3SBEA 3AKCA 1NI3A 1G8FA 5HDSA 5CM9C 5C1BA 1Z07A 5JMTA 5JWHA 3AVUA 4YWZA 1OIXA 1Z22A 4PKYA 3QG5A 3GLHA 4HAZA 1ZRHA 4IW3B 3W6OA 2J0VA 3RHFA 3EPLA 1NIJA 5JHHB 3AVXA 1PZNA 1W4AA 2GAAA 2N1BA 1E3MA 1ZNXA 2W6ID 1KMQA 1CBUA 2V4ZA 5LD2C 4C0HA 3T5DA 1LY1A 4O25A 4EPVA 5HDCA 3OAAA 4LRWA 4OK6A 2P7JA 4OQFA 1VG1A 2OFWA 3D31A 4HQAA 3TBKA 2J1LA 4KYUA 2EFGA 2QRNA 2H92A 2H16A 3AVPA 1AIPA 3OIUA 1E2KA 4R2IA 4MA4A 1ZNYA 2VF8A 3AP3A 4PPGA 5KDDA 3VHLB 5JWRA 1R8QA 4KHZA 3RC8A 2OBNA 5TV2A 2QMUA 1NG9A 1GL6A 2G1KA 4FD2A 2XTNA 1AK2A 2OLJA 2CLCX 2G0TA 3BK7A 2QL6A 4CRWB 2CLDX 3FFBA 2VP2A 5HSQA 3RSOA 1P5ZB 1UBEA 2C9OA 3VFDA 3U44B 1IY0A 4LJ6A 4F38A 2HT6A 1HQYE 5TMPA 2ZI4A 4L9EA 4Q1DA 2GEDA 4BEJA 1GM5A 3T34A 1LT0A 3IS2A 4UXHA 3D3QA 1OH5A 5EE0A 1SVWA 3SJBA 4NBSA 1KSJA 1HY3A 1SVLA 1JNUA 1SKQA 3T1QA 4M2LA 2REBA 2I9VA 2Z6VA 3H1TA 5G3YA 4M9ZA 5IF9A 4PO1A 4G5RA 3IPXA 2PYRA 4LJ5A 3N2EA 4QNMA 3RS2A 3TH5A 3ICQB 2VHJA 1XJ2A 1W5SA 2AKAB 1KIMA 2ZETA 2ZTSA 1XMIA 1GIAA 1KK1A 4DLZA 3PHYA 1YRBA 2WWXA 3L0IB 3Q5DA 4EQ6B 3ZVMA 2R78A 1FUKA 1G291 1ZD1A 4JT4A 4WN5A 1Z6XA 1UEJA 3LYXA 2SHKA 3W34A 4KVAA 4TQ9A 3PXGA 2Z0MA 4LWZA 3SR0A 3C8UA 3WMEA 4B3DA 4O3MA 3RDPA 4B33A 5JJKA 2CDNA 4B48A 4RD1A 3E4OA 2YWEA 3UANA 2QKPA 4M4XA 3HWSA 2GJ3A 2OCPA 3K8YA 4B32A 2AKYA 1DP8A 4ON9A 1M1YE 4PHHA 3U3JA 1MKYA 2AK3A 2IS4A 3Q72A 1P2UA 3K3DA 3P7NA 1JJ7A 3LVQE 3QY0A 1VB6A 1N6KA 4KITB 1KMHB 2YHSA 1G18A 2QG6A 3CO5A 3NOTC 1SVKA 3OAAD 4JBYA 1NBMA 2KJQA 3VMFA 1W36B 2IYLD 4M1OA 4O0MA 5F68A 2FGJA 3W3ZB 1DAMA 1KO4A 4W7SA 1KDTA 5DHFA 5JHGB 4I3AA 4ZKEA 2R6CA 3CBQA 2QAGC 1KY3A 4JLMA 1U94A 2HF8A 1Z6AA 4RFSA 1W47A 5LBIA 1OJLA 4Q9IA 2JLYA 4NCKA 2QAJA 3KQUA 2EYQA 4U7DA 4MRPA 1N5JA 4PC3A 4TMZA 4TT3A 2ZROA 2YKFA 2ZIAA 4XIGS 4GMXA 4NYJR 3DOEA 4BRUA 3AKEA 3CX6A 2FFHA 2GZHA 4HB4A 4M9XA 4DBLC 5C46F 4DXAA 1T91A 2FOLA 2JDIA 3PITA 5JCZA 1Q22A 4PZZA 5C18A 1G5PA 5IS1A 3PFIA 1AGRA 4I38A 1GRQA 2XJ9A 1R4AA 3LNCA 3BBPA 3CB4A 4D2IA 3FDIA 1UFQA 5D3MB 3F3YA 4D81A 2MSEB 3MUFA 4U00A 4IOJA 4QKQA 4YC7A 4V03A 3CPHA 3DDCA 4B34A 4XVQA 2R6DA 1EFUA 4DT1B 4HLCA 4P3YA 3TQFA 4IXNA 5JEDA 1GNQA 1LS6A 2VLGA 2ODWA 3ASZA 3U2QA 1G8YA 5FFMA 5GADl 4KUKA 3OLOA 4WL9A 5DLQC 1Z28A 2F3TA 3MLEA 3LW7A 3AF1A 1BYUA 3QVVA 4NCNA 4XD7A 4OQNA 4NMMA 3R20A 3UB8A 2D06A 3RANA 1I2MA 2RGDA 2NMVA 3VE4A 1E2QA 2R9VA 3L0SA 4YLGA 3QXJA 5FBQB 2O0JA 3EG5A 4XT2A 3W3AA 4TLDA 4AKEA 2D01A 1ZD8A 4RKFA 1XX6A 2V0WA 2K7SA 4LZZA 3V4RA 1HE1C 1AJEA 3W5IA 3AVYA 3H4MA 1SHZA 5JCPA 4DRZA 2YKGA 4H1UA 3U3MA 3CONA 3O8CA 4TMXA 3B2EA 1FX0B 3QPWA 2V1UA 4DSOA 4BECA 4R38A 4IHQA 2C96A 3VU9B 5DSZA 4U5XA 4W5JA 4IDPA 4UXIA 4BQSA 2ZJ5A 2J5XA 1T0JB 1ZVQA 3R9IA 3TK1A 3I8SA 4P4SA 1NMZA 4B2IA 1OB2A 2PZEA 4URUR 2VLIA 3M0EA 1IN5A 1ZCAA 1FP7A 3K70C 4YMUA 1E9EA 1ZAKA 4G3XA 1FTNA 3KUCA 3F1NB 3LBNA 4QHTA 2H8KA 4QGAA 4TT3D 1DEKA 1WF3A 2QAGA 2GNOA 1D2NA 2IXFA 4JGOA 1S9DA 2JDID 1Q12A 4LYHA 1HH4A 3K3CA 1P3JA 4JJKA 2ZVPX 3CKLA 1IN8A 1L8QA 1S8FA 4RVCA 2PZFA 5DGXA 1CJMA 4ASUA 4CT5A 2CVFA 3SJZA 4ILEA 5A4JA 1E2DA 4LDJA 3PUWA 1AZSC 3ZZUA 4GW9A 2P3SA 2ZS8A 4EPYA 1VG9B 1P75A 1II9A 1QHHA 2D3WA 4KODA 5DI3B 1Q1BA 4CF7A 3N2IA 5FBRB 2FV8A 5CYPA 1JR3A 1EWQA 1OLOA 4TL9A 5EXTA 3GLFE 1NMXA 1XD2A 1VDZA 2DYKA 2QPTA 3FMPB 3K53A 1F2TA 4DLUA 2Q3FA 1NRJB 5B64A 5LB4A 1VECA 2OCBA 3THYA 2PR5A 3LIEA 3A36A 4HLUC 2BKEA 5FPYA 3U6KA 2ODBA 3SOPA 4B3CA 2JA1A 1SKYB 1QG4A 2IF0A 2NO7A 3L2OB 3MJRA 1U2RA 5FR1A 2ZITA 5JS8A 3RH8B 3FHOA 2V1XA 3B85A 1D7EA 3Q3JB 3RSLA 3TKLA 2KSQA 2ZRPA 5UKDA 1DAHA 3KXIA 4GSYA 4XD7D 521PA 1F6BA 3PYPA 4FXPA 3SFVA 4PHFA 4F7WA 3MRSA 4JL8A 3GJ0A 1IJEA 2W2TA 3IBGA 3MJHA 4TMKA 3ZQ5A 3KTAA 4MYHA 2FFBA 5ANRB 2XEXA 1VCOA 5JRJA 3IILA 4HZUA 1X1RA 4JKYA 4KSCA 4B75A 3GLIA 3EZ6A 5EQTA 3LIAA 1BMFA 1MO6A 3FKQA 4ZCMA 4MDEA 4DKXA 3KX0X 1RRCA 2IYYA 3LI8A 3CLOA 3EEHA 3B9PA 3L0OA 1M8PA 1MOZA 4UNRA 1OYYA 2ZSFA 4HH2A 2BBTA 1Y63A 1J7KA 2QT1A 1OE0A 3DMDA 1NSTA 1W46A 3JZAA 4Q7KA 4A9AA 1OT3A 2YWFA 3NEYA 5HWWA 3EC2A 3AP1A 1RJ9A 3IIKA 4BFWA 2ZJBA 3WMFA 4BFTA 4D26A 2CJWA 4LHWA 1EK0A 4YDHB 1P62B 2MMGA 1UKEA 2RHMA 4O2RA 1O87A 1W5TA 3H82B 4RCZA 2QQEA 4TN1A 2Q9AA 3GLGA 4ZV4A 1SVSA 1KSGA 1IM2A 1BIFA 2V1BA 2CCGA 5B58C 4EPWA 4LCBA 4K46A 3LBIA 2NPFA 3ZVLA 3R8CA 2BCJQ 2C9YA 3HR8A 2ANCA 4BBVA 1N9LA 1KO1A 4ASUD 1TPZA 1Z47A 3THXA 5DNYB 4FMCF 1TX4B 4WA7A 4H6JB 2GF9A 2OSBA 2ZUDA 4QBIA 1TF5A 4CEIB 3KFXA 1E79A 1JR3D 1UAAA 2ZI6A 2AXPA 1N6LA 4V0OA 3LQQA 3C2WA 2VP0A 1AKYA 1JAHA 1ANKA 1KDPA 4KYIB 1HYQA 3KJIA 3NBZC 2VP9A 3NEJA 4PANA 4P32A 4AIIA 1S2MA 2ONJA 4BZPA 1FMJA 5KPJA 2GKSA 4FCWA 1NG1A 3A1VA 4YONB 5HTKA 1N6PA 1XBTA 4Q1CA 2Y8EA 4LBWA 5IK2A 5SZIA 1WRBA 2C98A 2FSIA 2KBFA 2QSZA 3EIHA 1Q44A 4Q4HA 2P2LA 3CR7A 3F1OA 3AV0B 3VR3A 4NL4H 2V55B 2JATA 2F6RA 4HLUA 2OUKA 3RWMB 3LFUA 2NZJA 4L4UA 2YYZA 1F60A 2VP5A 3X1YA 2M1CA 2O8BB 4NPHA 2FZ4A 4MN5A 1QHNA 2JCSA 2ZJOA 3UG7A 4ZIRA 4ZDJA 4DC9A 1OW3B 3A1UA 3QSYA 1CXZA 4JLPA 4DJ3A 3BH6A 2ZE8A 3W8NA 4A1FA 4M4SA 2ZI9A 2XXAA 3LW8A 1BMFD 3BH7A 1CR1A 2E87A 3QIAA 3M6AA 4B2LA 1N6HA 1J8MF 3GJ4A 1F48A 2W0NA 1J70A 1YZLA 3ADKA 4NKRA 1CJUC 2ZJAA 1H8HA 1JXMA 1ZM9A 3WMGA 2RHDA 1EFHA 1FW6A 1KTVA 2PJZA 3TNFA 2ORIA 2BOVA 4JYCA 1XFQA 3AEZA 4UNSA 1PLLA 1XCMA 1N6IA 5JSZA 1R5OA 3MR0A 4Q4AB 2VV6A 3VR5A 4TYNA 4TSFA 4US0R 1N25A 5ELXA 3FPAA 1Z0JA 4Q1FA 3BY9A 4EQ1A 1ZMXA 4XVRA 5TY0A 2DFLA 3DZ8A 2HJGA 2OLKA 1S4QA 4TZ6A 2J7KA 3IPYA 3DOFA 1OJ5A 1DAGA 5AJYA 2PLRA 2V3CC 5A8BA 1FNNA 2XTZA 2X1VA 3CNLA 5DISB 4DCNA 1BOFA 1W2GA 2BEKA 2C5LA 3A4LA 4QC2A 4EW7A 5B30A 5KU1A 1L7VC 2QGNA 4HYYA 2GZAA 3K70D 1AS0A 1N5IA 4CT4B 4AK9A 4EFMA 4UXJA 3GFPA 3AKYA 2G83A 3F1PA 2Z4SA 3SJAA 1DPFA 2HJVA 4F92B 3FOZA 4ARZB 1CS4C 721PA 3IEVA 2XITA 1G7RA 3BJIC 3KXKA 1JR6A 2QZ4A 5DIFA 1IXRC 2ODNA 4IVRA 1E79D 2F55A 1NVXQ 2IWHA 1G7TA 2YC4C 3OIWA 4YMSA 3VKGA 5J4LA 4M8NE 4ERNA 1QVRA 4DJ2A 1TS7A 3FC7A 4HUQB 4QGGA 1C4OA 2ZI5A 2AK2A 3H9WA 1J2JA 3QBTA 3ZS8A 4D0GA 1M2OB 3F8TA 4HI4A 3I73A 3AVOA 2GZDA 4EJSB 4F91B 2O8FB 1XEWY 2J87A 4D4KA 4BLTA 2ZR9A 2IYZA 3FTQA 2WTUA 5IK2D 1XTJA 1LSWA 1J90A 2A9KA 4PAOA 4PQYA 1LNZA 2OAQ1 1X86B 3BE4A 1QHXA 3BOSA 3EZ2A 2VTKA 1NN5A 4QL3A 5EUQB 2BMEA 2OM2A 1T5IA 4BFVA 2F43B 5HCIA 5FPKA 1DO2A 4LK2A 4AKIA 1UDXA 1DAIA 3SHFA 2G77B 3IQWA 5HPYB 4URYR 5L3QB 2ZQ5A 2WKRA 1XNJA 4C4PA 1VYTA 2KI5A 5KSPA 5IRCD 1P73A 1U0HC 2QORA 2IEYA 1KSFX 1W2HA 4RSGA 2UKDA 3KJEA 1AN0A 5FL7A 4OI2A 1KHTA 2O8DB 2PL3A 2C03A 3EWSA 1H8HD 2WWGA 3TSWA 1D6JA 4IEEA 3EIEA 4TZ0A 4OQXA 5GJBA 3AP2A 4JSTA 3IO5A 1YR9A 4FI3C 4GRAA 4TSFD 1QZXA 1UADA 1X8LA 2P6RA 4WOPA 4EESA 5BN3A 5KNBA 3I5YA 4URXR 1XFAA 4GMDA 1SXJC 4KU4A 2FPLA 2PBRA 4IRUB 5DYIA 1KKLA 5KOYA 1Q1QA 3LRPA 5CLQA 2VSOA 2ZXUA 1SHKA 3CNNA 5EZ6B 1R5NA 1XEFA 4C0JA 4CVNA 3H7WB 2EWWA 1JEDA 5B2ZA 4PPQA 3KX2A 2A5FA 3DO6A 4TYPA 3ECCA 2BMFA 2JLUA 1M6NA 1NVVR 2BASA 4GHIB 1VCMA 2OFOA 2ZYWX 4POAA 1Z0FA 4IOKA 3A8TA 2ZPTX 4LYAA 3RABA 2J7PA 3D7MA 3C5HA 2J0UA 1JBKA 2O8CB 2LCFA 1KOFA 2GA8A 1P97A 2J0QA 4TL6A 1OFHA 4M1WA 2XSZA 3Q8XB 3U7FB 3ZD6A 2ZM5A 2FEOA 2IYSA 4NXFA 1ZCBA 2REOA 3K1JA 3RWOA 1MRNA 4R98A 3R9WA 3RTYA 1XFNA 4WAUA 4MKHA 4Q19A 1FL9A 4BZQA 1KKMA 2X2EA 1F2UB 1PJRA 4DCUA 3LD9A 4LGMA 3K9HA 5JBQA 5AJWA 1IAQA 4KAXA 1N6OA 4RKEA 1C1YA 2QP3A 2A24B 1FQJA 2D7CA 1W0JA 4TQAA 4NCJA 5F9HA 1E2HA 3UK6A 1FZQA 2Q0HA 1GNPA 4MGKR 1KI1A 4GP7A 1I4LD 1MO5A 4URVR 1YR8A 1HQCA 3KXLA 1E69A 2ERYA 3LIFA 3NOUC 1E94E 1KI2A 4EPRA 5FL7D 4ZPXA 2C2HA 3GD7A 3EA0A 2R6AA 1AGPA 4A8JC 2D2EA 1KI3A 1JI0A 1G41A 2GETA 2WHXA 2X2FA 2WVJA 1JQJC 4OHXA 2VBCA 4RCYA 1W49A 1KI6B 1S66L 1XXHE 4IDNA 3EZ9A 3FHCB 4DLTA 4JSYA 1UPTA 3AF3A 1OHHA 4NHOA 4M22A 3KKPA 3FMIA 1LF5A 3R7WA 3C5CA 2WJHA 5BYJA 2FFQA 3PVSA 2VHQA 4LJ4A 821PA 1II0A 1KJZA 3KKOA 1HV8A 3GEEA 4CGZA 1TQ6A 3NOPC 2QUZA 3Q7PA 4C0AC 5CM8B 4H9GA 2ZANA 1D9XA 2XNSA 4WW0A 3VQTA 1US8A 4B2PA 2VO1A 3NH9A 3PG5A 4HEJA 2WBLC 2ATVA 5LPNA 2GJ9A 3OZXA 3K0AA 5J3WA 4MGIR 3EX7C 3W8RA 4R3AA 1SXJA 5J7EA 2PD8A 1TS8A 4E07A 2ZSEA 1ZNWA 3NHQA 1EWRA 3A4NA 5FOVA 3AKDA 4GPTA 3AQ4A 1L2TA 1GNRA 3A1SA 2J7PD 3DEFA 4AYXA 5HDDA 1ONBA 1LF0A 4RD0A 3DM9B 5GJCA 1DE0A 3WBJA 4WF0A 2Z83A 2XSZD 3PIRA 3RLFA 5JS7A 3X1ZA 2WIBA 4MRRA 2FDCA 1ZM3A 2IYTA 3L8ZA 1ZM7A 4BUJA 3EIQA 4Q01A 3E4QA 1V43A 1E2GA 4HI0E 1M7HA 5KSZA 2AFIE 3S1AA 1XTQA 1JJVA 3GJ7A 3CRQA 3LX5A 1AZTA 3G82C 3A37A 1XWIA 1EFCA 4KCGA 3KKNA 3HU1A 2ZBBA 4OK5A 1YHNA 4LJ9A 1W0JD 2ZAOA 3WNCA 5E7MA 2H57A 2FE4A 5FUWA 4F93B 2GHIA 3EASA 2J59A 4D4MA 3L82B 1S3SA 2A5JA 4BEBA 2RH5A 3CPEA 2ZE5A 1TEVA 3HPRA 2C8VA 5KHOC 4KVGA 1KDOA 4WZ6A 1G3MA 1G19A 4KFRA 2V9AA 5JJIA 2ZR7A 5FPHA 1QHSA 1OB5A 4G5OA 3NTUA 1YZKA 2NZ8A 4M1KA 2QMHA 2XTMA 2GJAA 3MMPA 2WWYA 1Y3AA 1E2JA 1BH2A 1QDEA 1TEXA 1Q1ZA 1N9OA 3QXSA 2NIPA 4FCTA 4Z1MA 1OHHD 1J99A 2ZRAA 4P33A 3QUSA 3NWJA 2NOAA 4I5SA 3P20A 3A0RA 4L8GA 4DIEA 3NHAA 4A0GA 5L3SA 2O8EB 2PDRA 3HPQA 2NTYC 3OESA 4PHGA 2Z6DA 4LC0A 5F3WB 3LIBA 3CWQA 3EA5A 1E32A 3UIEA 3UMSA 2ZUBA 4ZDIA 2GAOA 4BGDA 4GDFA 1NVWQ 4D0LB 3DKVA 3B9QA 2IXEA 3TRFA 3KFVA 4EERA 2XX3A 4TLAA 2AFHE 3LO5A 2ORVA 2QP9X 2XNDA 4UJ5A 5TARA 5JZVA 3NJAA 1NBME 1S0UA 1SXJD 1KI9A 5FTLA 4MRSA 2I1QA 1W36C 4QBHA 3FVQA 1WB9A 2BJVA 1GUAA 2KE5A 2F3RA 3SYLA 2DCUA 2C77A 3UWOA 1XPUA 2VEDA 1K6MA 2G0NA 3U6BA 4LX0A 1OIVA 1JQLB 1Z6TA 4XH9B 2OFXA 1KZ7B 3B13B 1UBCA 2GEUA 1KO7A 1OIWA 3BS4A 2EFCB 2JEOA 2OAP1 4HY8A 3DVLA 2W0MA 3TUIC 1LB1B 1TU4A 1E9SA 3NC0C 4BLOA 2D02A 1U98A 2BM0A 3LXXA 4TQUS 4IOLA 5P21A 2Q21A 2ZYUX 1XCGB 2WJVA 1DP9A 1UJ2A 2ZYVX 1LS1A 4QHSA 3HDTA 2ANBA 5CB8A 1F5NA 1E0AA 4LOAA 4I39A 1OF1A 1Q3TA 4B74A 1X0OA 5FOTA 2R62A 2WJYA 4HIAA 2EU8A 3LBHA 4BWYA 3GJ3A 3U44A 3PUYA 1BYWA 2G6BA 2K5UA 3HJIA 1JALA 5CK4A 1KJWA 3QF4B 3BAFA 2GXSA 3BIFA 5FOSA 5C4GB 3AVQA 1T9HA 2REXB 5DJTA 3WRYC 5JWOA 2ZI7A 2B7CA 2FSHA 2KX6A 4LJ7A 5G3ZA 4AY2A 1S1ZA 4BPBA 1WDTA 4II7A 1IBRA 1OXUA 3AF4A 5DYGA 5FPSA 4JGPA 2N42A 4ZDWA 5J40A 3RRYA 2AR7A 3GJ8A 4BBUA 4Z1MD 2HUPA 4KLZA 5EUMA 3WHKA 2HT1A 2G88A 1YZUA 4NDZA 3PR1A 3B1WA 4A6PA 3L0PA 2QBYB 5DO9A 3JZMA 4LC1A 5KDLA 4YDSA 1KY2A 3PUVA 4WIAA 4UKDA 4EQ6A 2MSCB 5AUPB 1FUUA 1II8B 3PUZA 4BBTA 2KBEA 2QROA 1P7CA 3I92A 3QKSB 2QP4A 4D0NA 4EUNA 4NYJQ 2QJ7A 5BYKA 2QMEA 1RIFA 3DMNA 4WZAE 3LQRA 3KKQA 1T5LA 2NGRA 3UE6A 2QY9A 2XNDD 4HDCA 3I72A 2QJ5A 1ELOA 5EP4A 2AWNA 2FZLA 4B71A 1KI8A 1OTIA 1XTSA 2I4IA 2IUUA 3LDAA 3CF0A 2ZOHA 3QKRB 1IQPA 2OCAA 3K0SA 2Z6CA 1QHYA 4P4SB 2JLSA 4M0LA 1TF7A 1IONA 3U60B 4CEHB 5FOWA 1KMHA 1OSNA 1K5GA 2GCNA 4H1VA 4V0KA 2DPXA 3RC3A 1A4RA 1OV4A 2CE7A 121PA 1GITA 1SQ5A 2AHOA 2WIAA 3OE7A 5BQ5A 4OI1A 4UJ3A 1NMYA 4JVNA 5L8VA 1R8SA 4QOSA 1W48A 1L4UA 1NJGA 4KFTA 5BW8A 1KI7A 4LRYC 2VHCA 2QPAA 4MYCA 4WZBE 3AGQA 1YU9A 1M34E 5J4EA 5AVEA 2JJ8A 1ZP6A 4ZI2A 1NBMD 1YZQA 5EFWA 3Q5EA 1JR3E 1XMSA 1GSVA 1QF9A 2DR3A 2R8RA 4DB2A 3CF2A 3CW2A 2LWIA 2H17A 3BFVA 2VQSA 3B33A 5TBMB 1U90A 3UKDA 5JI3E 2LKCA 4HLQB 3AGPA 5D3MA 2OG2A 4K08A 3E70C 4PQFA 2A5GA 3H84A 2IUSA 1XJ6A 4XTRA 1G6OA 2ZRGA 4RFVA 2YOFA 3IBYA 3CF6R 1G3UA 2ZRFA 1Z3IX 4LV6A 2G9NA 1W44A 1NN0A 3MQQA 1YR7A 4FINA 1BKDR 3REGA 4DT1A 2ZJ8A 5B57C 3VE3A 4LBVA 2IYXA 3U4QA 3UPUA 1PLJA 4ABYA 3KZ1E 1MABB 4KV9A 2OCYC 4LY6A 5AWFC 2YZ2A 1S1CA 2VV8A 1ZD9A 3F5FA 1YKSA 3K9NA 4MUBA 3GLIE 1GVNB 2X8AA 3OFNA 4KFSA 4W9MC 2GRJA 4JLVA 3A6PC 1W1WA 3GLFB 1UKYA 4F4JA 1KJYA 3TAHA 1GKUB 1XEXB 4GP6A 2TMKA 1DG3A 4YMWA 1XZPA 4QJ5A 1E0KA 1OH7A 1CJKC 4GZMA 5EXPA 3UATA 1YR6A 2OHFA 1EXMA 4A92A 1E9FA 2RB4A 4QJ3A 3CIOA 1QHIA 1X3SA 1G64A 2PMKA 1OTEA 2IWRA 3EZFA 3GP8A 2IYRA 1W4RA 2BVNA 3I32A 5EJEA 1G16A 3BC1A 1Z8FA 3SQXA 2NQ2C 4DSNA 1G28A 2P5TB 4QXAA 1GAJA 1FX0A 3EXAA 4Q47A 1W36D 3GLGE 3VU9A 5A5GA 1ZUNB 3OE7D 4N3NA 4RZUA 4NXGA 2GWHA 4Q4LA 2HF9A 4KI0A 4X8LA 4QJ4A 1S4SA 1BO6A 4AI6A 4D4LA 1A2KC 3IBRA 1XP8A 2FNAA 4PSAA 1N6RA 3K0FA 4BLPA 4DLRA 1E2LA 1G8HA 5KUTA 4OHYA 4Y0VA 2AD5A 4F3LA 4WXPA 4Q1EA 2B6HA 2ZAMA 4M1TA 1W4BA 4U02A 3I5XA 2R44A 2P65A 3F1NA 4MITA 3CAXA 3D72A 2VHTA 3P32A 4HLDA 5DKLA 1E9BA 1EX7A 1H8EA 5HD3A 4JKIA 4DEYA 1S9HA 3HR7A 5E7IA 2VA8A 3U3KA 3LXRA 5KNDA 1XPRA 4TTPA 3KUDA 5LDDC 3N70A 2HDNB 1G6HA 1C9KA 1MR3F 2BHRA 2ZEJA 5FI1B 2BC9A 5GVSA 3ZLJA 1FFHA 2ZRCA 3MCAA 5FUVA 3V00A 4E5UA 1I4DD 3U61B 2A5YB 2VSXA 3QBVA 5EE9A 2WICA 2OESA 5G4YA 3OEHA 4G0NA 4M1SA 5DI3A 1VCIA 1E2PA 3TE6A 1Z83A 1N3BA 4GT1A 4PO8A 3WRXC 2XZOA 1XD8A 2D62A 1WA5A 2Z4RA 2RAPA 3QF7A 2YWHA 3LICA 1ZC3A 2OEPA 1B23P 4L16A 3VR2A 3BB1A 1QRAA 2QRZA 5CJ2A 1XTKA 5AUNB 2PH1A 4WLAA 4GZLA 1GOTA 5FH9A 2EFEB 3CLVA 1SVOA 3C8CA 2CE2X 2D2FA 2VYFA 2WWHA 3OFND 2QA5A 5A0FA 4LV5B 4B6EA 4ZCIA 2B02A 2YKHA 1GTVA 3DM5A 2ZRMA 1VTKA 2EFHB 3TQCA 5EP3A 4RZ3A 4KBFA 1A5TA 1SULA 3LWNA 2INWA 1OXSC 2BMJA 4C7OB 5JSZB 5JLJA 4MUAA 5FBVB 4KQDA 4TWZA 4LBYA 1J8YF 4PC1A 5SZHB 4D4JA 3TGPA 1HT1E 2G1JA 2V1AA 1G8GA 2VP4A 4LHVA 1DTSA 2OO7A 2RKOA 4XWOA 2HV8A 3SFZA 1XDBA 4Q7MB 2RMKA 4O2LA 4HJ3A 2W58A 2W2VA 4I1UA 4B6FA 1WP9A 4XWAA 1XTIA 2BKUA 1CR0A 4MKFA 4A2WA 3MWLA 3TSOA 1PUIA 5SZKB 4EDHA 2ECKA 2E9SA 3ZGXA 3DHWC 2ZU6A 4J0QA 3EWKA 3H82A 2H18A 3ICYA 3NXSA 4GL2A 3A1WA 1KNQA 1N0VC 1H8ED 2PCLA 1RPZA 2XZPA 2EWVA 3LX8A 3QXHA 2L4RA 4UQOA 6Q21A 4EETB 4HSEA 2BBWA 3L43A 5TB5A 4XSHA 1OKKA 1ETUA 2CK3A 1DAKA 1MH1A 1ZNZA 1UKZA 4LHYA 2C04A 4AD8A 4BLSA 1R0YA 4LPZA 4OQLA 1T3LA 4H6JA 1S3GA 3NH6A 4JYBA 4UNQA 4CEIA 2ZS9A 4OHVA 3OEHD 2GVZC 1NNEA 3QI2A 2ZYTX 4XWKA 4A15A 4KLNA 4EJSC 1X8JA 2GCPA 4Q4JA 4DHEA 3CX8A 2WJIA 3PCRB 4C2UA 1UGUA 3PEUA 3WNDA 2FPKA 2WAXA 1HT2E 1UBFA 4CYMA 5C4MA 2Z43A 2CL0X 4LHXA 3K09C 1KAOA 2ODEA 2J80A 4KBGA 3ZD7A 3GDIA 2QHKA 3RS3A 1VHTA 4LHZA 5IHPA 3IKJA 1GG2A 2L1MA 3VAAA 5BWMA 1WMSA 4TL7A 5FTMA 1GKYA 2CHGA 4QM6A 2NO9A 3LIDA 1KK2A 3FYHA 3RRMA 3ZZ0A 3CNOA 2F9LA 4A2PA 4FMDB 4P31A 1XMJA 3CM0A 1OFIA 2OBMA 1B0UA 2B8TA 2QNRA 4Q18A 2O8BA 2GXQA 1VIYA 1E4YA 2JGNA 4S2EA 5FTJA 1X8KA 1CIPA 4OYHA 4MKGA 1AQUA 5FOUA 3TVDA 3SYNA 4CEJB 4JZKA 4QG7A 2RGGA 1UF9A 2Q3MA 3RRNA 3SN6A 2JASA 4C9BA 4TMVA 5AK0A 4LPSA 2WKPA 3GEIA 3QKUA 1FP6A 5D3QA 5GJVC 1TQ2A 5J5CA 8OHMA 4N1AA 2PMDA 1U99A 1XD9A 1KZGB 2J41A 2QE7A 1N5LA 4Q4AA 2WV9A 3IQXA 1JPJA 4DVGA 1E2NA 3IIMA 1T3HA 3NIBA 4X8OA 5H8WA 1GL7A 4AKHA 1W7AA 3CRMA 3ZVNA 3THWA 3NBYC 3CX7A 1EFTA 1EFRA 4PQRA 5AUQA 2BEJA 4ESHA 2HCBA 4HAYA 1ZBDA 1JXOA 1A1VA 1QVAA 4JIMA 4PC7A 5E95A 3KJHA 4GS9B 3ICEA 3A0VA 2FMXA 3BRWD 5HWVA 5K8IA 5TDHA 4C3ZA 4A82A 2BMDA 3UB7A 3B82A 4Q7LA 1MO3A 4OI4A 4C30A 2DB3A 1XJCA 1N0WA 1Z0DA 2OILA 3CUEF 3UXMA 1FNMA 3FHTA 2V6JA 5I5LA 2C78A 3PQCA 5EP2A 3CWFA 1OKKD 1P60A 1ZYUA 2CK3D 5HKKA 2QTFA 1Z0IA 2BBOA 1E9CA 4ARZA 3RNLA 1CULC 4I1OA 2P5SA 4A36A 3QNUA 4DEXA 5J4YA 4FW9A 4Q21A 4TL8A 4AG6A 4RJLA 3HJKA 1D9ZA 3B1YA 2AL7A 4I1SA 5BN5A 4HOIA 3PUXA 3J81k 4HUQA 4CDGA 4L9WA 4KSBA 2IXGA 3OF5A 3SQWA 4R2HA 3LLMA 1WE2A 2BJWA 4V0NA 4TLBA 4TLEA 5JI2E 2JN7A 3CZQA 4PKYG 2O8FA 1CR2A 1RRGA 4HNBA 1E2EA 3GEHA 1T0HB 3QJYA 2AXNA 3M4YA 1RYFA 2CNWA 2GF0A 1OJGA 4KO8A 3NKVA 1U0LA 1Z5ZA 2J9RA 3RS7A 2IUTA 3K09A 2V0UA 3Q85A 5HZHA 1VG0B 2QMOA 3CH4B 3FG8A 2F43A 4I4LA 4Y0AA 2A3RA 4Q9JA 1UBGA 3KKMA 3T1TA 3AVTA 4B43A 4JLOA 3PENA 4MGZR 2I3BA 2DWOA 2B8WA 4RZXA 1NVVQ 4JLDA 4NZYA 2FX3A 4Q66C 3HYTA 3PJRA 2FPMA 3CRVA 2GK7A 4P4UA 4OJQA 4DDVA 2JJ2A 3EPHA 1CR4A 4V0MA 3D6TB 3NBFA 2ATXA 3I4LA 5JEEA 4JLNA 4KXFB 1ZIPA 2JLRA 5DI9A 3ZH9B 1S67L 3G6OA 1DOAA 1US8B 3LI9A 1U8AA 2X77A 1T6NA 3T35A 2QE7D 4MQBA 2CEAA 4AG5A 2F9MA 2V9PA 5AR1A 3QPUA 5AVFA 3BFXA 1G5TA 3DZDA 5BN4A 3KQKA 3ND8A 1ODFA 1DP6A 2JLQA 1HEIA 1TUIA 1EFRD 3B5JA 2ZREA 1DVRA 2FF7A 4LJYA 1LV7A 4TYWA 1SXJE 1HA3A 4V02A 3SS8A 3UMEA 2QU8A 3QXXA 4QRHA 5SZJA 1DELA 1I2DA 1P0ZA 3ZYCA 3DL0A 1XXHB 3LA6A 3O8DA 5M04A 2GEVA 1LSVA 3H7WA 1QG2A 2ZVQX 5J4KA 5AJVB 3SC3A 1AS2A 2B21A 5HKKD 2PX3A 3CRW1 4B73A 1OTBA 5F2EA 3I62A 3AB3A 4G01B 4GHIA 2IHYA 2PR6A 3ETLA 4US1R 4RY2A 1OT6A 4A0FA 1WQ1R 3GLHB 5FI0B 4BLQA 1IXSB 3KB2A 4FIDA 2EW1A 1PVOA 5F9FA 4P4TA 1G8PA 3MSXA 1G3QA 1ZW6A 3S1AB 4JJZA 4ZCLA 3HU3A 2N46A 1S4RA 4JL6A 1D2MA 2DFTA 1WXQA 2PHYA 1G4AE 4DSTA 2ZUCA 2J3EA 3OEEA 5IU1A 4QGFA 4N0EA 4C2TA 1Q3HA 1XJQA 1CP2A 1PUJA 4XVUA 2YWGA 1LL8A 4R6LA 4FWIB 5EE1A 1CF4A 2CBZA 1F2UA 2IA5A 4HP4A 1ZM2A 3BH0A 3HP1A 3SZRA 3L8YA 3ZS9A 1FOEB 2CNWD 2A5DA 2FSFA 3TR0A 3SJCA 4OKSA 4PSKA 2IS2A 5F69A 4I81A 4LPKA 4NYIR 3H2YA 4DLYA 1LVGA 2QWSA 2IYQA 4RD4A 3BWLA 1KO8A 3PEVA 5HD5A 2A24A 1ZM4A 3AH8A 2R65A 4HJ4A 1E1RA 5EP1A 4RD3A 3OIVA 4DDUA 5CK5A 1Z0KA 1AKEA 4JVLA 4L15A 1OPXA 4ESVA 2OZEA 4NXBA 1R10A 2DY1A 1F98A 2VH5R 2YV5A 3K9GA 4B3BA 1OXXK 2GCOA 2FEMA 2JJ2D 3IS2B 3SI7A 1KSHA 4BFSA 2V7QA 4A0RA 4BFXA 4AYWA 5F6AA 1NP6A 2ZRLA 1R7RA 1E2FA 2CL6X 2AX4A 3IHWA 4MRVA 4QBGB 3SNHA 3ZZTA 3Q9LA 2BDTA 4PX9A 1KI6A 4E03A 4C0QC 1OFUX 2QI9C 1DAEA 2WMNB 4IDQA 3TLXA 2PEYA 2XZLA 1RKBA 5J47A 1DS6A 1GFIA 5CDFA 3V4FA 4G5GA 1YVDA 1U9IC 1XEWX 1EGAA 1ZUIA 2IHBA 1R0XA 4GI7A 4LRXC 3NHBA 5DN6A 1JNYA 2FN4A 4FCVA 5CIWA 3MWJA 5L3VA 4S35A 2DWPA 3B78A 4PR0A 4TTQA 1W0KA 1NLYA 3WHLA 2GESA 4EPTA 1P72A 1XF9A 4NE2A 2PT7A 1V9YA 4Q1BA 4DUGA 3A1TA 2YOHA 1XCPA 3RS0A 2EFDB 2A30A 2XJ4A 3TVTA 1QBKC 4JLAA 4DIDA 1TADA 4A8JA 4QM7A 3MQOA 2ONKA 1GSXA 3C16C 1E99A 1G9XA 5FL3A 3D8BA 1BYIA 3UMRA 4A0HA 2DBYA 2JLZA 2UZIR 2WWIA 3MD0A 4OHZA 1ESNA 4YQFA 3PV0A 5KYKA 1F3OA 1Z2CA 4IJMA 1D06A 3LAWA 4HDQB 3OEED 3SW1A 4PC2A 4PAQA 3EPKA 1D8TA 1HUQA 2GBLC 2ZRHA 4L9GA 5KSYA 4B9OA 2Z5FA 4URZR 4Z54A 5EXXA 5JRZA 3NDPA 3ND9A 1XJ3A 2ZJZA 2GTPA 1Q0UA 1LTQA 3ASYA 4GOKA 5LD2B 3B60A 3KQLA 4RFSB 5G40A 2IK8A 4Q00A 3TUJC 2FSGA 2IYWA 2A7QA 1IY1A 3M1IA 3A0SA 2OE2A 4B3FX 2W0SA 2ZSAA 4OJKA 3ZVRA 2WWWA 5DKKA 1E1RD 4R9UC 4TLCA 3THOA 3EC1A 1PV4A 4GCZA 3E1SA 4W5WA 5IT5A 5G41A 4LSGA 1VYVA 3FMFA 3U7HB 4C0LA 1P2SA 1R6BX 2F1RA 2BWJA 2QN6A 2R2AA 3X1DA 3ZIAA 2V7QD 3MFXA 4LRZE 3K0CC 4MDFA 1H65A 2GXUA 1XB2A 1SVMA 1E4VA 1X6VA 1PLKA 2VRWA 3MAAC 4C0KA 1JPNA 3GECA 2YC2C 5CIQA 3LV8A 2RGBA 4HAXA 2VEAA 2V8OA 3G0HA 2O8EA 3T50A 3RS4A 4TMTA 1E96A 4WVFA 4PPNA 3VHXA 2P6UA 3NG1A 4IEIA 3HYRA 3P27A 1XZQA 2HEIA 1TMKA 2JHEA 3LVRE 5DN6D 4IDHA 1LFDB 2IF2A 5H70A 5HR5A 1AQYA 2YNMA 2PYPA 3QVUA 2WSMA 1O3YA 4EIWA 2QEQA 1W0KD 3UWKA 4OQMA 3CH5A 4JMPA 2H5EA 3BFKA 1NL3A 1U9IA 1AS3A 2FG5A 4D6PA 2D4HA 2WJJA 1T1CA 3VKWA 4FN5A 5CLLA 4DB4A 2IL1A 3SE0A 4DUGD 1E9RA 1AM4D 1Z06A 4XSGA 1EX6A 3QG1A 3NC1C 2L0XA 3O8RA 2XB2A 2FA9A 2QM8A 2AD1A 4TYYA 4DDTA 1CKEA 4XT2B 1CJTC 4DCTA 4MRNA 1NLFA 1KDRA 2ZRBA 2Q6TA 4HAVA 4IKEA 3BWDD 2CMKA 4M9QA 1GZSA 4LV8B 2VIIA 4B76A 5KPDA 1YZGA 1XJ4A 1ZU4A 1CRQA 2CHVA 3E4PA 3FKSA 4LUCA 1FPMA 4P0TA 3GJ5A 2V6IA 4B47A 3C4JA 5H1YA 3B1VA 1P9RA 1D5CA 3UG6A 1E2IA 5K8LA 1JEEA 2AWOA 2HLDA 3AF0A 4B35A 1NN1A 4NXEA 2JIZA 1CU1A 4EKDA 3BB4A 3CZPA 1NSFA 1NKSA 2GBLA 3U3OA 4G5SA 2UVQA 5LB2A 4A6XA 1RC8A 4V0LA 5FTNA 5KO2A 1GRRA 1R2QA 1OT9A 2NO6A 2NPIA 4FMDF 1NF3A 2QAGB 3A4MA 3T1VA 1G4UR 4QFMA 2GJ8A 1E0SA 2H7VA 3ZQJA 3ULFA 1COWA 2Q3HA 3QF4A 5F5YA 1ZIOA 4L9FA 4IDOA 3PEWA 3U4QB 4LJAA 1SGWA 4JVMA 3OHMA 3ZIAD 1M7GA 1NN3A 2WOJA 4EFLA 2BV3A 3MWKA 3H86A 1QHHB 4L9SA 421PA 1GL9B 1G3IA 4EEPA 3NVAA 1KOUA 5FUXA 2P67A 1L4YA 2HYIC 3T12A 1T18A 2W27A 1XD2B 4N0DA 1P9NA 3FMOB 1F2TB 3K0CA 4MKIA 1CEEA 4CIDA 1XMVA 4HP9A 1VIAA 3QKTA 4JL5A 2IS1A 3THYB 2QBYA 1UWPX 2JJ1A 3A58B 4Q1AA 2JLVA 4OHWA 4URWR 1GWNA 1VYUA 1U81A 3I3SR 1II8A 1RRFA 4Z8XA 2ZRKA 3QKSA 1RZ3A 1IHUA 4DWJA 2DFNA 3QPVA 2F7SA 4IFEA 2OXRA 3SDZA 1M7BA 4DLSA 2L0WA 3ADCA 2NO0A 2QQ0A 1S1MA 5KTYA 1OH6A 3O47A 3EW9A 1T3SA 1T4GA 3MG9A 3KTAB 4Q9KA 1ZINA 2EVWX 1NLZA 2JAQA 3W5JA 2D7DA 4M1MA 3QKRA 4HAUA 4PHTA 1SZPA 4HZUB 3SBDA 1DARA 5FUYA 3GLIB 2F1IA 3TW4A 3K0FB 1E2MA 4BFYA 4CEHA 4F3LB 1EG7A 1YRAA 2W00A 2J46A 2ZOIA 1CLUA 2OBLA 3TW8B 1WBBA 4LI0A 3V9PA 1NKTA 3FKSD 1WCV1 2BIFA 3AVVA 2FU5C 2GJKA 1IN4A 1NWZA 4I3JA 1ZJ6A 2KDKA 3GPLA 1BS1A 4D80A 4WBSA 1RJ9B 621PA 4OI0A 3WYFA 4I1VA 3EARA 3UB6A 1P6XA 2HLDD 2JLXA 1P61B 2CJWB 2JIZD 3EZ7A 3MWYW 2UZ3A 2QT0A 3HU2A 1D2EA 3PEYA 3TR5A 1K8RA 2ERXA 2B92A
chains in the Genus database with same CATH superfamily
4OOEA 3AWDA 1BLSA 1AE1A 5AOBA 1H4TA 1HG1A 4NFYA 2VHWA 1PWXA 3NBLA 5F33A 4OA5A 2Q5QA 3PD0A 4OQPA 4MUYA 2PZAA 1IOVA 1IY9A 4GKVA 1XLTA 4JC5A 4F71A 4YPVA 3ORRA 4KIGA 5E1BA 3MUEA 4J0DA 3E7WA 2VQEB 5B7PA 1IN6A 1J8DA 1KP2A 4KJXA 1RRPA 1XDDA 3KM0A 3TB4A 4LV2A 1XU4A 1UKAA 3FV7A 5JDCA 3W90A 5CFQA 3AVWA 4GPZA 3F4LA 4MS3A 1RI1A 4XB6B 3EGWA 3UUEA 1FQKA 3CPJB 2I6QA 3MPUA 3FTDA 3U7EB 3FVWA 4ESEA 3N74A 2AR9A 3A6GA 4EW6A 3CE9A 4PXAA 3IO3A 3RS9A 1TKAA 5SYMA 3KQPA 1ESMA 1P0MA 1IU9A 4JB8A 3GFGA 1V4BA 1Z08A 4IVNA 3H3FA 2P1ZA 3L7DA 1ID8A 2J31A 2GDJA 4R2JA 5FPTA 3UPPA 5IABA 1ZWKA 2Y6UA 2NYUA 4WRRA 4UVEA 1Z73A 3OJ0A 3ZGAB 2GEKA 1EE2A 4GNKA 3RKUA 4IVPA 1JN0A 2Q8NA 2JKTM 5A06A 5JD6A 2B7LA 3L06A 2ZL1A 5LP6C 4BTEA 1I2BA 5FQ9A 2AN1A 2H08A 5HYVA 3HYNA 3FSGA 3HLYA 1RKUA 3VZPA 3AEUB 4FTWA 4IV8A 2W6JD 2OXCA 4FUWA 4KO1S 3TZ6A 4PG4A 1ODVA 4PPFA 3DTNA 1QPZA 2Z58A 2OC9A 5FWXA 3BXEA 4MGYR 4M0EA 3QE0A 2R4UA 5K01A 2VT6A 4RYEA 2P9FA 1BCRB 3HGMA 3VPDA 4LLOB 4EEUA 1K7YA 3DCJA 3D64A 3EWNA 2HSEA 2WEKA 2ZRIA 9LDBA 3OA0A 4MO2A 5GIPE 3K0AB 1THGA 1N8KA 1W52X 4HH3A 1CG6A 1ZVVA 5D3ZA 4BV3A 1I2CA 2AJBA 3R3SA 1KP9A 4P3OA 4MYUA 1U04A 4TXLA 1RYHA 3E9MA 1G5UA 4GXRA 1TKBA 2P7HA 1GCGA 1H69A 4O01A 5I7EA 4MH0R 1NJ4A 2NXJA 2JGDB 2P40A 3T7RA 3HFRA 3N05A 4WACA 3ZOKA 2VTBB 3ADBA 2FLKA 1Z63A 3BMNB 4BRWA 2P6NA 1CY6A 4YYEA 3IDQA 4B6SA 1OH8A 1AMUA 4A8JB 1Y28A 2CXXA 3NP7A 2FI1A 3A31A 3O95A 3EBLA 4Q8IA 2ZWVA 1CJSA 3SBEA 2YIJA 3MBKA 1JA0A 5K7SA 2R1TA 3VGPA 3M5CA 1YCHA 2FWIA 1Z5VA 1K2WA 4HDRA 3UFXA 2I2DA 4IWXA 3ZGNA 3DAGA 4REOA 1U5CA 4KXUA 2WVGA 3TPZA 3KZOA 2IGBA 2P4QA 1P5ZB 4J07A 5JSFA 3NWOA 3EXG2 4PWZA 4Q1DA 1JT9A 1OLUB 5EUCA 1O57A 5IC4A 3C0KA 1YVPA 1OLSB 2I9VA 2Z6VA 3H1TA 5BWLA 3RYCA 4KPYA 1CW2B 1UP7A 4ZT6A 5HRUA 4IP0A 4OSEA 1KK1A 3PHYA 3ZBPA 1NU8A 2X3YA 2H65A 4JT4A 5IKXA 1IVSA 5LQAA 4NZNA 1ISIA 1DJMA 4LWZA 2PX2A 2X5OA 1KC3A 4DN0A 1RLUA 3N8DA 4M4XA 1KS2A 3N0VA 1PZMA 2I4MA 2AK3A 2WD7A 2MINB 2H8GA 1N6KA 1DG9A 1KMHB 3OM0A 4N48A 3NOTC 2KJQA 3Q7VB 4Q9DA 4W7SA 1D1JA 2VT3A 1KDTA 2JAXA 2XEPA 2O5EA 4E31A 4M54A 3OCLA 1DKRA 2VJBA 5CB4F 3V1NA 1Y0BA 4LK3A 3CX6A 3IDAA 3LGOA 4TVSA 2C4NA 5DOZA 5D3MB 1T1GA 3AERB 3IODA 3NOQA 1L1EA 4BU0A 2J3TC 4HV4A 3CPHA 1SIOA 2XNJA 1DBPA 1EA5A 1C7FA 3PNQA 1LS6A 1M6KA 2Y2NA 1RM4A 4EF6A 3ASVA 3ACDA 1AF7A 4OQNA 4Y0OA 2E89A 5KZMB 3UAYA 2PXHA 3OZGA 4Y0TA 1IIBA 3EHEA 1PW1A 3G2JA 2VTEA 1HE1C 3W5IA 1PO7A 4N7JA 1W63M 2IZ0A 3CONA 5AXAA 3LR5A 1U1DA 1NMZA 1UFKA 1PJTA 1L7RA 5J2TB 3OQ1A 1FOFA 5FEFA 1FFSA 4GGMX 3AEXA 4MHSA 4Y67A 4DV7B 1KH2A 1Q5PA 4CV0A 1S8FA 3OCWA 1KERA 3MHTA 3TFOA 3R8XA 3B38A 2VZ0A 5DYTA 2MJLA 3AUSA 3N9IA 3G6WA 1FSSA 2DYKA 2ZWIA 4RKWA 3L8GA 3PC6A 2NO7A 3EVEA 3B85A 3ZUGA 2ATIA 521PA 2M9MA 1L7NA 4EP1A 4B3RB 2HRQA 3ZQ5A 4ZAYA 1F6WA 3A2NA 1NW7A 4A27A 4LJKA 2IYYA 2NUTB 4ZMSA 1IVYA 3DFIA 1GR0A 3EC2A 1UPXA 3AP1A 3OURA 4LY3A 4O2RA 1W5TA 4BVEA 4MWOA 5BRNA 2NUAB 4Z0TA 1GQFA 3PKZA 4RMJA 1SCAA 5DNVA 2ANCA 2XVMA 3OPNA 1XZEA 2B5OA 2OSBA 2C2GA 1UAAA 5FQIA 1CJCA 2PUJA 2QN8A 1K54A 3C2WA 1DHTA 3NEJA 4A23A 2CJPA 1GAQA 2ZT6A 1N6PA 4BNGA 3AXSA 5CVDA 4FC7A 3HYLA 3HA2A 2X9QA 1A9OA 2HPVA 2GEFA 1VI5A 3O8OB 2RC6A 4JWTA 3UG7A 3MF4A 3IP9A 1WDLA 2ZI9A 2DKNA 3BH7A 4TXMA 1F8YA 4RHEA 3FGOA 2HCRA 3P01A 4G3VA 1QC5A 2P08A 4BRSA 3AJ9A 4ZMBA 4JNCA 1ZMXA 3PCXA 1HOXA 5HQ3B 4UTNA 3RAEC 1SUAA 5KNBH 4U2GA 3WK6A 4J29A 4YI5A 4DR3B 4O8GA 2XTZA 5FLEX 2X1VA 4OHOA 1W2GA 3AKZA 2XWQA 2IKSA 4HPJB 1CS4C 4AO8A 2QD5A 4YMSA 4QGGA 2ZI5A 1RWKA 1G60A 2FMUA 1FLAA 3PUIA 4D4KA 5JISA 4GI5A 4OXXA 1T3TA 3EDOA 3IX3A 3HUNA 5HPYB 5JYBA 1FILA 2PK3A 4LGCA 5IRCD 4RJTA 1GCEA 2GM4A 5M18A 4F5YA 3I58A 5FL7A 2H0QA 5COAA 4G0OA 1WXEA 1A9SA 1H8HD 3M6IA 5JS1A 1D6JA 4NWIA 4OF4A 2ZBVA 4OIMA 1MIOB 3WKBA 2RSLA 4EESA 2HDRA 1RPTA 1XX2A 3DP9A 4GMDA 2XYQA 2PBRA 2REQA 4PNPA 2XQFA 4XCXA 4QFCA 3KX2A 2PVSA 4BCBA 3T6KA 2BMFA 3LHFA 4MK4A 4TL6A 3M1YA 1E7SA 2N75A 4M6WB 3ZV6A 4LGMA 3GDWA 2DKOA 1TMGE 4E70A 5AESA 2D0IA 2APJA 2BJHA 3WLKX 2P90A 1T0UA 1FJXA 3C2QA 1OC4A 1GLNA 3OQJA 2JBFA 3IVCA 1JI0A 3SLRA 3ELWA 1XXHE 5HUJA 2W11A 3AF3A 3GA0A 3R7WA 1KJZA 3ESQA 2ZANA 1QK3A 1F2DA 1VETA 5NLLA 4D9CA 5IXYA 5K0EA 1YDGA 2DPYA 2B34A 1ZMRA 4NAUA 3TMAA 1TK2A 3A1SA 1QXSA 2J7PD 3QHAA 3DE1X 2YZ7A 3WLNA 1V8BA 5JNWA 4RF3A 5GHZA 1IJKA 3F74A 1VPWA 4Q01A 1BN6A 3YASA 4HRAA 3LDFA 1Z56C 3HMQA 2IDKA 2ZAOA 4CNBA 1SQSA 1TC2A 2ZE5A 5K6AC 1ZH2A 1G3MA 1RHMA 1SQ6A 1M73E 4MKZA 1CNEA 3NTUA 1YZKA 1XRPA 4H4CA 4YBZA 4LZNA 1Y3AA 4FCTA 2WFAA 5I51A 4I5SA 4IUBS 2KLHA 3EE6A 5GINE 2IWCA 2I80A 3QFSA 2IXEA 1XA0A 4BMCA 3UC9A 4UUBA 4BO8A 2FVYA 1A27A 3R3ZA 4R8VA 2Y68A 3K8QA 1FBNA 2A58A 2I7CA 2DCUA 3ECAA 2C77A 3UWOA 2V7EA 3SZTA 4GX5A 5COBA 2EFCB 3DVLA 1MX3A 3TUIC 3WIUA 1JWZA 1E9SA 3D4LA 4MJLA 4M86A 3HSSA 5AH0A 3I1JA 1RHJA 5EHGA 4JH0A 1DP9A 1ZONA 1X0OA 4Y1RA 3ZKAA 4NMXB 2VKSA 1U6KA 1NBOA 5EOVA 2RHTA 1JLRA 1MB4A 7AT1A 4BNDA 3BXXA 2X3UA 5TS2A 3WHKA 2ASVA 2VT2A 3PR1A 3WQQA 5KDLA 4P5DA 4Y2TA 2ZUFA 5KVAA 2WZXA 3QU9A 5LZ2A 4CWAA 3BLMA 3KNZA 2XMPA 4P4SB 4M0LA 1NZFA 4UU8A 4PSDA 1KE3A 4H1VA 3ZLBA 2G71A 5M34A 1BX1A 2CE7A 2W6PA 3EXFB 4RA7A 4LE0A 4WQMA 1CRLA 2E4XA 3VBCA 4FT2A 4KFTA 4HSGA 1TO6A 1XLTC 4N65A 3PGA1 4GPAA 5FEGA 1VSTA 2BFDA 4R81A 2J5RA 4QQRA 5ALYA 1P5RA 4FT4A 1W44A 4Q93A 2YCBA 4MVJM 6GPBA 1QE0A 3QVWA 4JU9A 2WT8A 4C22A 5B57C 2P69A 4NMLA 1H5UA 2OCYC 1DC4A 1YKSA 2ZBQA 4JLVA 3GLFB 3DW3X 3VPSA 4QUGA 1XZPA 3BMOB 1OH7A 1UPAA 1C9MA 2ZUWA 2EHDA 1NV9A 3HDHA 5JPDA 2ZQCA 4UUAA 4PO3X 1B6GA 1VI2A 2A92A 4UM5A 1FDTA 5KUTA 8ADHA 4J0HA 1VJCA 2R44A 2QUAA 4BO9A 2IYEA 1NTOA 3KSAC 4NSNA 2MU1A 5ALJA 1PNRA 2QX7A 2WU0A 4ND3A 5JADA 3H2SA 2I1LA 3TE6A 1DAPA 3ICWA 1T8PA 2X5KO 4D3FA 5CJ2A 2X0DA 3GUZA 2VXBA 4MWZA 1JLSA 5EP3A 1I0IA 1RAFA 4OLGA 4AZ3B 3UAOA 3R3XA 3ZYZA 2X8LA 4RKQA 5IT4A 2GBPA 4HGQA 3KHKA 2HV8A 1CF9A 2R2GA 4GHWA 5BO5A 1B16A 4P2BA 2W4MA 3VAYA 5SZKB 1LLQA 2E9SA 3DHWC 4PRLA 3H82A 4PR3A 1PR3A 1NI5A 3ICVA 2HDUA 4EVSA 3ENVA 3DOUA 6Q21A 4OXNA 4BQPA 3ZGLA 4CEIA 2FN8A 4F46A 5LR6A 1UGUA 3L7MA 3UXYA 3E81A 4BLVA 4R4RA 3VFHA 3KOYA 3DBRA 2YTZA 4JITA 3ZCPA 1IY8A 1Z5GA 1DJLA 4XPIB 2XQIA 2IYAA 3RRMA 4N5LA 2LCIA 4D4GA 4HYEA 4MKGA 3DEJA 1VKNA 5CB4A 4DAEA 1UF9A 2P3QA 4L9RA 4ZU1X 1N9GB 1WF6A 4RVFA 1MJGM 1PFGA 3IQXA 3CRMA 3GLSA 4P3NA 3BVPA 3ICEA 2C82A 4N92A 3E7PA 1NURA 1XROA 3FHTA 4JIGA 2C5BA 4R0VA 5HF5A 1OKKD 2I55A 1U0EA 2QE6A 3K9BA 3HJKA 2BSAA 3KVVA 4HDNB 3PUXA 2JAWA 5CIYA 2F1KA 3UJHA 1QE5A 1T0HB 4KO8A 1OJGA 3CCBA 2WUDA 2C3UA 3RS7A 4JBHA 1P3DA 2X4GA 5H3HA 2QMOA 1ZJ5A 1MAUA 1T5DX 4MVXA 5EXEA 3CG5A 2HAEA 4X1YB 1GN9A 3PENA 3TX6A 4GD6A 4WMCD 1BDMA 3PJRA 4OX9B 4N3BA 2XIQA 1YI0A 1UWCA 1QU2A 4ANFA 2W2NA 3I4LA 3HKBB 1E1CB 4QBTA 2H63A 1KFCB 3PNVA 4ZEXA 1J42A 1DELA 1DQPA 3CCFA 1P0ZA 2BISA 2G09A 3D4PA 3O8DA 3RVRA 4P36A 3AB3A 5K5EA 4P4TA 3S1AB 1HE3A 4LE1A 3SX0A 2Y79A 4N0EA 3S2EA 4FWIB 5EE1A 3L7AA 2QYHA 4S2LA 1KIAA 1VP9A 3LK6A 3K0HA 1V45E 2A5DA 5HF6A 4GUAA 4YV2A 3WC4A 2R65A 4KO4S 1QWSA 2I29A 3KWLA 1R8JA 5CK5A 2WHRA 4DR5B 1LSOA 4JVLA 4UZSA 5BT9A 2WSIA 5LDHA 1DJPA 1L4EA 3SJUA 2BDTA 1G38A 3H0EA 5KTOA 5B6PA 1KAEA 4PYIA 1IIRA 2IHBA 3W7BA 4GYWA 3NHBA 2ZLBA 2FN4A 2GESA 1LBHA 1Q15A 3JWEA 2WA2A 1BYIA 2JLZA 3B52X 3WAJA 3U48A 4KI7A 2AFHB 1FDWA 1O94D 2ZRHA 4B9OA 1UXKA 4ND7A 1GADO 3EZYA 3B60A 4RFSB 2FSGA 2IYWA 1GPMA 2W0SA 4ZOAA 5DKKA 1FTGA 4FYPA 1NQUA 3DDWA 1P6QA 4E30A 4S04A 1U0OC 3CU5A 1Y8RA 5FRDA 2QL7A 3VHXA 3LVRE 4D0RA 1NOJA 1TLFA 4MUHA 4S0ZA 1GCUA 4MO9A 2ZGVA 3VKWA 3ZUPA 2VUTA 1T8RA 1Z6PA 1GJRA 5LCXA 1NLFA 4MVJE 3RO7A 1EFDN 4P0TA 5AKGA 4QD3A 1D5CA 1NHGA 3V9AA 5DNWA 3E3AA 5JOQA 3ZH2A 2A0YA 4N7BA 3BB4A 1WXHA 3MCUA 3E6AA 5LB2A 2WJZB 3NYWA 1T2FA 4BN4A 5TMBA 3HDVA 1K66A 4BLMA 1WXDA 4IDOA 4JX8A 1YAJA 3HB9A 4LJAA 1KDSA 3CSUA 5BV8A 2VCEA 5AQ9A 3EIOA 2X5XA 1P31A 5DSTA 1BTOA 3T12A 1X94A 2ZUSA 1QKKA 4URWR 2ZRKA 4RETA 1E77A 1RZ3A 2ZSJA 4JGGA 5LYJF 4Q0MA 1ST2A 2XUJA 4DN6A 2VZ9A 4BTLA 3EGDB 2O59A 3TW4A 4PHCA 3T3MB 4A0SA 2J7VA 2HC9A 1WBBA 5K05A 4Q39A 5ERYA 3H18A 4HRYA 4YV0A 1RXCA 4I3JA 3AESA 1K54C 4NENB 3H1EA 4YRNA 2UZ3A 4H0CA 4MN7A 3Q81A 3KRTA 3A3PA 1XR3A 2J5KA 4OUDA 3LOUA 2G40A 1JSCA 4M1EA 3VDMA 1G5FA 1E0DA 1W9MA 2PNFA 2NG1A 4IFBA 4U7TB 2VDWB 4WCVA 4M88A 4L02A 2Q9NA 1A88A 2VWHA 1PGPA 4GO1A 5IDYA 3AC0A 4M3NA 2Q3JA 4KGZA 5E3IA 4FWTA 4KQCA 1G6Q1 3RT7A 4AJPA 2CLSA 3BD6A 3NATA 3ANLA 4Q5IA 4XB1A 2C7QA 4QDKA 4AYTA 2GYVA 4AVYA 1K8YB 5H0IA 2F8MA 2ZSHA 3MS7A 3DLHA 3A32A 3X1XA 4Q4JB 4LNUA 1HC7A 4RGQA 1K4YA 3WS1A 4I14A 4L4XA 4G4JA 4KEAA 4MWCA 1ZN8A 4EG3A 3NHZA 5A93A 2JFXA 5AKIA 4IBOA 1RKXA 5DVAA 1T9CA 2MMCA 1XVUA 3JALA 5DBOA 2DUUA 4KZPA 3LQ4A 2Y1WA 1T6BY 4XTCS 2NYAA 4BO4A 3IUMA 1JSXA 4YAIA 1QHGA 1ZXLA 3VNUA 4I0WB 1ZGGA 2OV5A 5EVIB 4J2OA 1V1JA 3QA3E 3I9KA 4LY9A 2A2ZA 1YE3A 3JQ8A 1QIEA 4LJ8A 5F9HA 4WLVA 2KB0A 1NOIA 1NZJA 3P1JA 3TRHA 1Q1EA 2OPBA 4DIFA 1QGZA 3P71T 1PF7E 3HHPA 6CHYA 5G1PA 4Q48A 5EN4A 4REQA 3OCUA 2O3TA 5KEIA 4RLHA 5HJEA 1L5SA 4US2R 4GZ5A 3QVMA 1N5OX 2Q49A 4ALJA 1NE7A 2IX3A 4YMIA 3PGKA 1ES3A 2ZD8A 2ZM6B 1C7RA 3MJQA 3QMVA 1QS0B 2J3DA 4C07A 2IEIA 3SYTA 2VJLA 5HARA 3U7GA 4L8WB 4KAJA 5B7NA 5EIEA 5ISMA 4AJHA 3WWYA 1Z4NA 2Q5JA 4MYTA 1S02A 2PAFA 2DWUA 3WNBA 3TTVA 2FOXA 1KPGA 3DWIA 2E4ZA 1SXJB 4QGHA 4HEFA 3WA7A 2VVTA 3DFZA 1MRSA 5DWDA 1F4PA 1R1DA 5LP6A 5I7VA 1XPOA 4DCOA 3IALA 1TUBB 2JFOA 5SY9A 3TW0A 5K0ZA 3CN9A 5TQ0B 2FG6C 3M8KA 2Q0SA 1KQOA 4DA8A 1GKLA 1EW0A 1J2EA 3EIUA 5EXSA 1TYZA 2B1JA 1E6UA 3HL9A 4EPXA 1SVIA 3SG0A 4F4CA 5FLXA 5JD4A 4JFAA 4BRZA 4BL3A 4Y3UA 1OU4A 1NI4B 4N9KA 1VKHA 1U3UA 2DUMA 4PE5B 4WESB 2OXIA 4D3DA 3OFSA 1E4EB 2HCJB 4JLUA 1IXKA 4Q3OA 3MXRA 1T9DA 7MHTA 2Z6QA 3AVXA 3ZCSA 4NFHA 3TECE 5LD2C 1UQTA 5JXIA 5L07A 4EPVA 5HDCA 4HQAA 4KYUA 1OWLA 2H16A 3OIUA 5BMOA 3BEDA 4JP3A 2VP2A 4EB3A 1JJIA 4MW7A 1AT1A 5LZ4A 1LBEA 1RXSA 1N2BA 4MVJG 1J1IA 1SVWA 5FAKA 4M2LA 4M9ZA 3VYVA 5AHKA 1BOOA 2PX4A 3R4CA 1W88A 3BA1A 1YRBA 3FAZA 2OQVA 2WWXA 4HF7A 1G291 2CB9A 3D6VA 5B3LA 4WN5A 4L5YA 4KP7A 4KVAA 5DU2A 5IW8A 4ALMA 4C88A 1JLMA 1TLLA 2E37A 5A5DA 2EX1A 1V37A 3DUFB 3HRKA 3K3DA 1JJ7A 4G0PA 3MMNA 3F6SA 2FFRA 3OAAD 5I9LA 4KQEA 3I0NA 2NVUB 3JQ9C 4JLMA 2HA2A 3PHJA 1TRHA 1W47A 1C7IA 2GZ1A 3AR3A 3IQGX 4NI5A 5C52B 2WADA 4CMBA 1R4AA 5ALNA 1UFQA 3LGSA 3BM6A 1CSEE 5F2NA 4LJRA 1QFMA 3KEGA 4H3KB 3KLOA 3DDCA 5JEDA 1GNQA 4HWGA 1WWKA 2HSGA 5I9SA 3S68A 4NU6A 5K20A 1ECCA 3KEFA 3RR2A 4ZT4A 4G07A 3EXHC 3P5BA 2BDEA 5H9VA 1S8NA 4TLDA 5EQDA 4IIGA 2E18A 1XX6A 4CF6A 3H11B 3H4MA 4JYAB 3AEQA 1KPIA 4TMXA 4ENTA 4ZJZA 4BYGA 2P9VA 1EXNA 4R2XA 2PRFA 3TR6A 4BECA 5JBIA 2J5XA 1EE1A 4ZXFA 1Z4MA 1K0UA 3B6JA 2E4WA 3R3VA 3KUCA 3VJRA 3ORSA 4M1QA 1Q12A 4IIEA 1EHYA 3MJDA 5EERA 1AZSC 3HBLA 2JC3A 3X1KA 4CFYA 1QYDA 2V6BA 3S29A 4I9FA 3RTCA 3RYFA 1DWUA 1K0FA 1WB4A 4XX1A 5FR1A 1PGQA 4INAA 3R1IA 5IBCA 3DEZA 4JL8A 1DC6A 5LMUB 2AVDA 4KKXB 3LBFA 1KGGA 1MO6A 1DMRA 3ZTWA 2JF0A 4NVRA 4GGOA 1FSGA 1V25A 3AL0C 3TLCA 5DF8A 5ALHA 1JLKA 4S1NA 3SX4A 4D26A 2E82A 3LEZA 3T52A 3GIWA 4JI8B 4UULA 3Q10A 1ZJZA 2HRBA 1J97A 5AK5A 4JCOA 4QBIA 1Z2DA 3I6BA 2PWZA 1VYHA 1JR3D 3P2YA 3OP4A 1I01A 4YRPA 4P32A 1U3CA 2ONJA 3G2OA 4RK7A 2VQDA 3HUMA 5SZIA 1OLXA 4ZK2A 2GHTA 3ABIA 5F51A 3CR7A 3SEQA 4TV8F 2OUKA 2Y9MB 1OQAA 1SIBE 4L76A 3QSYA 3AYXB 1N6HA 2DCMA 3BREA 1YBHA 1ZM9A 5ENVA 3UHOA 3MB5A 2DE0X 1XCMA 1EM6A 2NU8A 3SXJA 4Q1FA 4EQ1A 2Q8QA 3AUUA 3NBQA 3T5PA 1Y8QA 1JG6A 4E3IA 4AK9A 2YFHA 4X3OA 2I2WA 1QVRA 2Q3BA 1VSVA 1EGMB 2FMKA 5CPFA 1V26A 1C9JA 3TLJA 4F91B 4EJSB 2A9KA 3BE4A 1NN5A 5F1PA 5FPKA 1ZHHA 4HADA 4D9MA 3W8EA 2PGNA 4RGVA 3CNEA 2QORA 5A62A 3EIEA 3AP2A 3E84A 1U0GA 4JSTA 5AI4A 1LPPA 3Q1LA 4IH9A 5LOVB 3DD1A 1C0LA 1EUDA 2Z09A 3HKDB 3X44A 5BN3A 1L9KA 4MVJF 2QLFA 4JEMA 4KU4A 1VL5A 2FPPB 1Z7WA 3LT4A 1LSSA 4CVNA 1QYRA 4Y2RA 2Q1XA 2A5FA 1NA5A 5CFLA 2LD4A 1YDEA 3QTTA 3IMKA 5DB4A 4XQCA 2XCTB 2EJTA 1G9SA 1IPFA 2X2EA 3ZDEA 2UUOA 3FTCA 3K9QO 4EG4A 5NULA 3UK6A 4I1PA 4DPLA 1U7HA 3TTSA 4NY1A 1KI1A 4I50F 5TC4A 2XV1A 4JYZA 1FLNA 2JFNA 2WYIA 3A6DA 3SC2A 2AG1A 2GETA 5LZ5A 4AWBA 1RQ2A 2NADA 2OXEA 4JSYA 1OHHA 5JAIA 2E5LB 1DQYA 2Z2LB 3AIMA 1US8A 3OO0A 3KZNA 3G1UA 3PG5A 1P39A 5LPNA 4KZ7A 3OX3A 1M40A 5CFNA 3PPWA 1K06A 1ZNWA 3NHQA 5K45A 3QQPA 3AKDA 4P6BA 1YJQA 4EA8A 2J0EA 3DEFA 5JFTA 1RR6A 3DWEX 3K6RA 3ORYA 2XSZD 2OTCA 3PIRA 3RLFA 1S89A 4HDKB 1LBIA 3LCCA 2XWBF 5J1TB 3H9QA 1KU6A 3IV6A 3L82B 5IWAB 4WTOA 4L8LA 4KVGA 4XLTA 2QRPA 4WWHA 2DFDA 4K91A 1JVBA 2BEWA 4RL4A 3RGGA 1YLZA 4FYMA 1E2JA 1M2JA 5F4ZA 3BIJA 4WOCA 2JAUA 2UZ4A 5AVUA 3DCNA 1IK6A 2GAFA 3EA5A 3E2LA 3UMSA 1YCFA 2GZ3A 1H66A 4PINA 1W94A 1DY6A 4XLLA 2B1GA 1OMEA 3DE6X 1R37A 1GUAA 3SYLA 2QIOA 4OAOA 2WZZA 4CM5A 4FDLA 2R6R1 2R97A 3UJ3X 3OE5A 4FFRA 1C1DA 2X7XA 3HUOA 4ND8A 2VYND 2Q21A 4DNOA 1SC6A 2QQGA 2B30A 2W2LD 1Z4PX 2LR0A 4A8PA 1M6VA 3VSBA 1JALA 3H4TA 4ARAA 4MHOA 3WRYC 1AWIA 2QL9A 3VZRA 4IIFA 3NHJA 5K6AA 1OXUA 2IODA 1G68A 2HUPA 3JZMA 2EARA 4WIAA 3BFDA 4FBLA 2J6HA 1AD2A 3G0DA 1RIFA 1XL0A 3GV0A 5BR1A 2K2WA 1NR5A 1TF7A 1RBQA 4R3JA 2OGUA 2XQGA 1GITA 2WIAA 1BKSB 4CL8A 2PGJA 1KS9A 1COZA 1B7GO 3K9FC 3DOHA 4OU5A 1ONHA 2XODA 5EFWA 4NULA 1GSVA 5KNDH 5IUJC 4F11A 1VSQA 1DLJA 2G4CA 2VQSA 1U90A 4G5HA 1NVFA 4YRZA 3D1LA 4RSRA 2ZJ8A 3U4QA 5TR7A 3RU7A 1ODCA 5E4YA 2B94A 3K9NA 3IP7A 2HMVA 2BAGA 1PR9A 3B3XA 3EH1A 1JILA 3KSGA 1CJKC 5MF6A 5IJ0A 3SE7A 1C8BA 3GLGE 1BVHA 3Q8MA 4GMFA 4YFYA 4D57A 3ZE8A 1K6XA 2AD5A 1ZBQA 2B18A 4XDZA 3VNAA 2BHRA 4MS3B 5KTPA 5CH8A 5FUVA 3JQPA 1D0IA 4X66B 2A49A 4GYKA 3AJ8A 4PO8A 2Q99A 2R00A 3DXXA 4MUMA 1JI3A 1NRJA 3A70A 3ZJ4A 4C21A 3HO8A 1RJWA 5KKAA 2EFEB 3O83A 2M2IA 4BS9A 2JH8A 2Y2MA 1GTVA 3TQCA 1X87A 1IUOA 4DXDA 1H3EA 4D43A 3ZY6A 4LBYA 5LQUA 4JF4A 3G2KA 4A6EA 3HDYA 1XGIA 2RMKA 4O2LA 5A02A 1WP9A 3IOBA 2C3YA 4MKFA 1C2TA 3CUKA 4MLPA 4YASA 2V5VA 3CWCA 3I6YA 3SFTA 1MX5A 4GL2A 3BRWA 4K9NA 3P98A 3V6LA 2XZPA 2L4RA 1KETA 3L43A 2CK3A 2ZL1B 1R0YA 1IN1A 3KBBA 4N3GA 1KQ3A 1NF8A 1F14A 1OAKA 1T34A 2HCTA 2GCPA 2J07A 4C2UA 4M9UA 1MEJA 1UBFA 5C4MA 4F72A 3U81A 2XUOA 3KUUA 2VX8A 1O9BA 1EI5A 1QPGA 3FUCA 2CVQA 1XELA 1QLWA 4DPKA 4NK5A 5H02A 1ORRA 4QM6A 2RG7A 1XXMA 2QI9F 4YJFB 1TYCA 2QNRA 1VHMA 3DZKA 5FTJA 4KAAA 2IFTA 4ENUA 1MAHA 1X15A 3SYNA 4J0GA 3JSAA 4ZXPA 4M98A 5FWXB 3A1NA 2BUCA 3QKUA 3V50A 1TQ2A 3OT5A 4YLEA 1U99A 3R7DA 3KP1A 2VJWA 1EFRA 5AUQA 2GB4A 4QZVA 3OT4A 4Q3DA 1KARA 2VC2B 3CA8A 1D2AA 1I13A 4DIKA 1L0DA 2J9PA 1VLMA 1USUA 2O1SA 4I1OA 3TNYA 4Q21A 3KALA 1AKUA 5BNFA 3DOIA 2GLXA 3DVQX 3IKVA 1ZOSA 4D6YA 1KL7A 3TOCA 2W6OA 1H9AA 3QUCA 1Z5ZA 4HN2A 1RXIA 5TIIA 3MVEA 3NDJA 3CPTA 4DLPA 4HQ0A 3QBJA 1B0PA 4MGZR 1KMMA 2OCXA 1NVMB 2RDMA 4EECA 4YVFA 4DDVA 1THMA 1BE8A 1FUYB 4ZEWA 3RHSA 2JLRA 2XUDA 5KYYA 2Q5LA 2XMBA 4DL9A 1XZLA 2VNKA 1IYZA 1DP6A 4QWOA 5EVCA 5GOZA 2FHSA 4C7XA 4EUFA 1ONNA 3MPOA 4JF6A 2B4TO 3SZ3A 4KVFA 3CRW1 2R1TB 5FI0B 2IU0A 2PYIA 3EGCA 1HE5A 4QU5A 2I3AA 4CFSA 1DT5A 3UFXB 4BO0A 3RFTA 3L9KA 2GX6A 3QLVC 1E3LA 3RVKA 2XA7S 4ID4A 3H9EO 4RANA 3L8YA 2IV2X 2OSVA 2FXIA 4WKPA 3VR0A 5HD5A 2AMFA 4B7UA 3KPYA 2I7XA 2OZEA 3IKMB 3CIFA 4BNVA 3PAGA 1K2VN 3RTDA 1KSHA 4A0RA 3MTGA 1UM9A 1MV8A 4BFXA 2BE9A 3GA5A 2VA9A 4E03A 3RYCB 3AHJA 3V4FA 5SY4A 3OX2A 5CDFA 2P79A 1U9IC 4DZTA 4YFMA 5DHSA 3G2LA 1JNYA 1V9SA 4TTQA 1B0ZA 5C32A 3WHLA 5CDTA 4ROTA 1FDIA 3OQIB 1UC5B 3RT1A 3EPRA 3RS0A 2YY5A 5LWQA 1YKDA 4MWDA 5KYKA 4YUYA 3SW1A 3OMWA 3NDPA 2P27A 3AM3A 1E1NA 1JHMA 2IK8A 2A7QA 5MN6A 3NHWA 2FHPA 3FG9A 5EJGA 4EY5A 2JIPA 4C0LA 2F1RA 1QR2A 5FV7A 4LRZE 4C29A 3UJ9A 4OXQA 2CEKA 3N1UA 1EDBA 4EX7A 3CVXA 3AR4A 2D1FA 4LOLA 1ZDMA 3R3YA 4EIWA 2QEQA 1Y6GA 1O77A 1UBLS 4XQ0A 4K1XA 4TTTS 4H3VA 3EC7A 1GZUA 2Z56A 1PL7A 2XTJA 4H7JA 5H1YA 3OFVA 3W1WA 3ETGA 2R8PA 1M1YA 4FQ8A 1NT4A 2C42A 1IG3A 1G98A 4A6XA 1OT9A 4WL0A 4F45A 1PEYA 1CNFA 1CUSA 2W6MA 3W9SA 3WFZA 1L6RA 1ZD3A 5F7JA 1YF3A 1JKFA 4WLOA 4UQIM 5KX5F 2YNMD 1IHUA 3SDZA 4U0KA 4ER7A 4HD8A 3CKMA 3MG9A 2XADA 1ZZGA 2EVWX