2WKRA

Structure of a photoactivatable rac1 containing the lov2 c450m mutant
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
317
structure length
317
Chain Sequence
ATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNMRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFHHVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
pubmed doi rcsb
source organism Avena sativa
molecule tags Transferase, cell adhesion
molecule keywords NPH1-1, RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
total genus 109
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2wkrA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wkrA02
1N9NA 4EQ6B 1KY2A 2BC9A 5IRCD 2ZE6A 4HY8A 1SQ5A 2GVDC 1DADA 2RGAA 4PHFA 1XMIA 3SYNA 3TUIC 2QWSA 2Z43A 5AUQA 2IUSA 1JB1A 4LJ4A 3LD9A 2ZU6A 5KDOA 3GFTA 4CZ2A 3EZ2A 5HTKA 4DSUA 2X1VA 2OXCA 4QGHA 1Q22A 1RW4A 4RSGA 4U02A 3VKHA 1KI7A 1LV7A 2A5DA 3BY9A 2JJ2A 4QG7A 4BEJA 4NXFA 2W83A 4TMZA 1QF9A 4WN5A 2VHQA 4A0HA 1P4SA 3CZPA 2CL7X 1OFHA 4B3DA 3K9HA 1WA5A 4Q1EA 5GVSA 4DZZA 1W48A 4JYCA 2Z6DA 3Q3JB 1OT6A 5DHFA 3AF3A 2ZRBA 3HWSA 4A2PA 2BKEA 1TUEA 3VU9A 4URVR 3MWYW 4DHEA 2JA1A 3CWQA 4FI3C 1RC8A 4GZMA 4RD2A 4Z8XA 2GK7A 1ZC4A 8OHMA 4DSTA 4DRZA 4LPKA 5LBIA 2LWIA 1JPNA 4FMBB 1KO7A 2F3RA 4GOXA 2QUZA 4NYIR 5FOUA 4BFUA 2ODEA 1MT0A 5F68A 2P67A 3SJZA 4UNRA 1GL6A 4HLUA 3D31A 2DB3A 1S3SA 4DBLC 3ZD7A 2BMDA 2BBWA 4LX0A 5FUVA 4JYBA 3CRVA 3FMPB 4TL7A 3GEIA 1G17A 1SHZA 2MMCA 5DGXA 3RWOA 4R71A 1KJZA 1A82A 1HH4A 2ORIA 3MCAA 4AYTA 1E32A 4HAUA 2PHYA 2QEQA 2WWFA 4PPFA 3TQCA 1E94E 3A0SA 2AL7A 1OIWA 3VHXA 3T50A 5KDDA 2OE2A 4XVRA 1BS1A 1E79A 3FKQA 1T8UA 3KKOA 3ONWA 1RE0A 3W9YA 3C41J 1ZRHA 2GDJA 1XFNA 2OT3B 1E2EA 3FPAA 2O8FB 3TMKA 2OCPA 3M4YA 2GXUA 2PYRA 1I2DA 1ZINA 4DJ2A 2BVNA 2EYUA 3OFNA 4OQXA 2ZSEA 2ZE8A 5J4LA 5DIFA 5KTYA 2QTFA 2FZ4A 2QMEA 1EXMA 1GUAA 2ZJZA 5FTNA 5IT5A 4PHHA 2GCOB 2DYKA 3RRYA 3WP0A 2FEMA 1CEEA 1YR7A 2PZGA 4ASUD 1NN3A 4GOJA 4M1OA 2HYIC 2WJHA 2OILA 5KSPA 1IOZA 4PC1A 1B23P 4HLUC 3ZDQA 2IHYA 4DWJA 3B5JA 4D82A 4HAWA 4GT1A 4HB4A 4DSNA 4YWZA 2YJTD 1OW3B 3LDAA 4BRWA 3O8RA 2IHBA 3MR0A 1NIJA 4M22A 2NZ8A 1XB2A 1GRNA 1WBDA 2GF9A 4GI7A 2VP6A 2JLXA 2QT0A 4QNMA 4UXHA 3UIEA 4I4LA 5IU1A 1M8PA 1S9DA 3GFOA 4MGZR 2WKQA 5K8IA 1NVUQ 3NOUC 4LRZE 3TBKA 1B0UA 1AN0A 1DG1G 2XX3A 2QROA 3OAAA 4KXFB 2CMNA 1HEIA 2W2TA 2WSSA 3C4JA 4Q4AA 4LYAA 3X1WA 2FG5A 3A1WA 1KYIA 1YZQA 2F1HA 2WAXA 3NC0C 4LBWA 2NQ2C 5JHHB 5JWOA 2D06A 4D25A 2L1MA 3PITA 2YV5A 2CHGA 5GJBA 4JMPA 5DJTA 2H8KA 2ZR7A 4PO9A 5JEDA 1KHTA 3U44A 5F69A 2IBMA 1U99A 1BKDR 3IILA 4ACAA 5JLJA 2VSXA 2ZVPX 2ZRMA 1RFLA 3IQXA 3KZ1E 4L16A 3GLFB 3TW8B 1NBME 2R44A 4Q4JB 5JI2E 4DLTA 5FTKA 4A0FA 3QPWA 4C0JA 3FVQA 3T1QA 1YR9A 1ZJ6A 4EEUA 1VCOA 5JSZA 2O8DA 4A6XA 2RGNC 1AJEA 5J5CA 3X1DA 3U3MA 3DDCA 2AKAB 2B6HA 2V6JA 4O3MA 5J47A 4OQLA 4IVQA 3AQ4A 3CPHA 3OE7D 5EZ5A 4BUJA 5LD2B 1XXHA 2IF2A 1RYFA 1QHGA 1NN1A 4BBTA 3PVSA 1JECA 1JAHA 2ERYA 3RC3A 4R38A 2NPFA 1DAHA 5EE0A 4PSAA 3W6NA 4IVRA 4B74A 5JEEA 4FCVA 3B9PA 3R9XA 3V9PA 3VOLA 1QHHA 2PR5A 1QHYA 1UBFA 3E5HA 5EP3A 5HE8A 4DDTA 2FNAA 3TLXA 1OXUA 1Z6AA 3MFYA 5JI3E 1UM8A 2AD5A 2WJIA 2XOKD 4GW9A 4JBWA 1GFIA 1EFRA 1TMKA 2C9CA 3PEWA 4TQ9A 2GTPA 4TYYA 3VAAA 5AVFA 4BFWA 1BYUA 3LAWA 821PA 1EFCA 1MR3F 1XJCA 2IC5A 3EEHA 1CBUA 3K1JA 4OL0A 4TN1A 5B2ZA 3TKLA 5KHOC 3SN6A 2ATXA 1QHNA 1NWZA 1XX6A 1GZSA 1OXVA 5JWHA 2XZPA 5FBWB 1E2MA 1NSTA 5EXPA 1VPLA 2XTNA 1ZM3A 1OH8A 2V1UA 1ZD9A 2ATVA 1HE8B 3BXZA 3IKJA 4JLKA 4XIGS 3AM1A 4KBGA 1A4RA 2FN4A 4GP6A 2GAAA 3BOSA 1CJUC 5FBQB 4YMVA 1VTKA 4LJ7A 3W90A 4KFSA 4YDHB 4M1YA 2NO0A 3QBVA 4ZI3A 1G4UR 1U98A 2AFIE 1FMLA 2P3SA 2ZRIA 4NPHA 4ZKEA 3LIBA 2VP9A 1S2MA 3AVXA 4AI6A 2A7QA 1S1MA 2QSYA 2WICA 1UKEA 3B78A 1OH7A 1OPXA 2LKDA 2ZREA 3QF4A 1PVOA 3PJRA 2BKUA 1FNNA 5E3HA 4BGDA 4FMCB 4PSVA 4MITA 2A30A 4ZDJA 1L4UA 2CCGA 2V55B 2ZJ8A 5TXGA 4ARZA 4C0KA 4RFVA 2CLCX 2YWFA 1KDOA 4TWZA 3T61A 4OK6A 4XT2B 1ETUA 3PENA 4MKHA 4WZBE 4ZDKA 1G8YA 1NJGA 2NGRA 5L3RA 1P5ZB 2J41A 2FOLA 1JI0A 1KK3A 3PUZA 4M1TA 4Q66C 3BIFA 3TW4A 1UAAA 4EPWA 3WRXC 2GZDA 1HUQA 4QRHA 2C9OA 5CK5A 5CYPA 3LO5A 2GILA 5IK2D 5H1YA 3EPKA 1Q20A 2V0UA 2W6JA 2XJ9A 2XAUA 4X8LA 4AK9A 2GCNA 2B02A 4GFDA 1XTJA 2AWNA 2IYVA 4WUJA 3QJYA 1XTRA 2VBCA 1I4LD 2VEDA 3AUYA 3CF0A 3FB4A 1CKEA 3WMGA 3B1YA 4CGZA 1H8ED 2ZSBA 1TF2A 4DJ3A 3REFA 4ZKDA 1KY3A 1CS4C 1ZM9A 1W4AA 2O0JA 5DNYB 1DS6A 1Q44A 3TSZA 2ZSFA 2X19A 3LICA 4S2EA 3NBXX 1Z28A 1CR0A 1G8FA 2FWRA 3F8TA 1JJVA 3THOA 4TYQA 2XZOA 1AS0A 2P6NA 4US1R 2F9MA 1XD9A 1M7BA 3M0EA 1OLOA 2NPIA 4B2LA 3HYTA 4LWZA 3HDTA 1J7KA 4AIIA 1E4YA 2KBEA 3JVUA 2B92A 5GJWC 4Q1AA 2WMOB 5AWFC 3VU9B 2GXAA 4B43A 3QY0A 5CDFE 3LUQA 2PD8A 4LLOB 4HZIA 4TT3D 3RANA 2I9VA 5EP4A 3DM9B 3JZMA 4K8OA 4KLNA 2R65A 4EIWA 1UFQA 2X2FA 3DMNA 1M34E 4B6EA 2ZYTX 3NH9A 5FTLA 2Q6TA 1T5LA 2QP9X 2IWHA 1VYTA 3WYAA 5F5YA 4D4MA 5B30A 5HZKA 1SHKA 2ZI7A 4B6FA 4P33A 4P4TA 3L8ZA 4QJ3A 1WF3A 4Y0AA 1NVWQ 2IYSA 4CEJA 1TF5A 2V8OA 1P97A 1SVLA 4N0EA 3NH6A 4IJMA 4Q02A 2DY1A 1D8TA 1JBKA 2OWHA 3FG8A 2CL6X 3NDPA 4KQDA 4Q1CA 5FOVA 1G18A 3THYA 1OKKA 3BORA 3JVVA 2QM8A 4Q4HA 2V9AA 1Z07A 4B3CA 2QE7D 3EPJA 1E99A 5FPYA 3OEEA 2VP0A 1EK0A 2O8FA 5DYGA 4ITRC 3H1TA 4JT4A 1NN0A 3ZIAD 3GLHE 3KB2A 4MGKR 2QM7A 4HLDA 4M9SA 3NHAA 1N6HA 3T15A 2D2FA 5KYKA 4UNPA 4D4JA 3AF4A 5KO2A 1VKJA 2D4HA 2HEIA 4V0OA 1P7CA 1R5BA 3CPJB 1CF4A 4M21A 1F2TA 1W46A 1DARA 1T0JB 1X1SA 1LSXA 1DAEA 3RVBA 3ND9A 1OXTA 3QEJA 1G28A 1HQYE 3D72A 3RS2A 1T5IA 5FBLB 1TAGA 4CT4B 1P9WA 2OWJA 5CDFA 2WIAA 1JQJC 2BOVA 1YZUA 4I1VA 2OV2A 4KI0A 121PA 2GEUA 2JLRA 2FMXA 3I3SR 4KHZA 4JVLA 3RWMB 1FFHA 3L2OB 3Q85A 4LJYA 2Q3MA 4EFMA 2ZRPA 1TQ2A 4Q4LA 5HWVA 5CB8A 4HYYA 1ZUNB 2PZEA 4ABYA 1KSJA 4K46A 5EUQB 4A8JA 2QN6A 4R70A 2OXRA 3BB3A 3TVDA 4D26A 2L4RA 4Q4AB 3CH4B 4JVSB 2J9RA 3BGWA 5DI3A 2ASEA 3K9NA 1JR3A 3QOFA 2J0QA 2ZJAA 4GMXA 2FGJA 1VIYA 1E1QD 4DKXA 4EPTA 4H6JB 1YJ5A 2OLJA 1E4VA 1AK2A 1U8ZA 1Z5ZA 4KV9A 4OHZA 1XTIA 2Q9AA 4ESHA 3KQUA 2VV6A 2YOHA 4GHIA 2NO1A 3QE0A 1IY0A 5J4EA 5JCZA 4Q4JA 1E1RA 4Q9JA 2XITA 4Q9KA 4A2QA 1ZCBA 4BFTA 3I32A 4FCWA 3UMDA 1F9IA 1FW6A 1E2IA 2ZBBA 1AS2A 2K7SA 1XDBA 2HJVA 4DB2A 5TBMB 1ONBA 2OSBA 5JMTA 1J90A 2G77B 1Q3TA 3Q7QA 4JLMA 4C4PA 3A0RA 4MGIR 2JDIA 1OTBA 3UB7A 2L0WA 2F3TA 2RGDA 4BBVA 3W6PA 4EJSA 2RH5A 2YC4C 3MWLA 4LYHA 3TRFA 5FR1A 3PQCA 1S0UA 1E79D 3F1OA 4N1AA 3C15C 1U90A 1DRMA 2VIIA 2QP4A 2ZXUA 1WE2A 1T8TA 1U81A 3T1OA 4C0AC 3RS4A 2IS4A 5DJUA 1M7GA 3M1IA 3GEEA 3AEZA 4X8MA 4B73A 3UXMA 4OJKA 4D0NA 1EFUA 3E70C 3N5CA 1WP9A 4DUGD 2G6BA 4TMKA 3GQBA 2X2EA 2JATA 4TL6A 4GS9A 2EU8A 4JLAA 1NBMA 4HB0A 2L0XA 4NYJQ 3C8UA 2OCAA 3GMTA 3K0FA 2BEKA 2JLUA 1RZ3A 5J3WA 2D62A 2JGNA 1G7SA 2C03A 4URYR 4PPGA 4F3LA 5JWRA 4F91B 1LS6A 3C7KA 2ZOIA 2F43B 1OT3A 2QMHA 3BH7A 3LXXA 4HSEA 4C2UA 4OK5A 5AJVB 4DLUA 4Z54A 3GJ0A 3CX7A 1CTQA 1BMFD 5UKDA 1R0WA 3QQ5A 2A5GA 1E1RD 2WV9A 5K8LA 3L0PA 4PHGA 2QJ7A 3RSOA 3GJ8A 4NXEA 5HE9A 3K70D 5KPDA 4A2WA 2Q0HA 1WB9A 3X2SA 3GEHA 3F1NB 4D4KA 2NO7A 1T3SA 2Z5FA 5TDHA 1W0JD 1C1YA 2FFHA 3CO5A 3D7MA 4HLQB 5KNDA 5A0FA 1J8YF 1W4BA 3ND8A 5BN4A 4BECA 3A1SA 3GDIA 4EPXA 4ZO4A 1CR1A 2F1IA 5J4YA 2WTUA 2YKHA 1TS0A 4LBYA 5EUMA 3ZS9A 4EDHA 3DPUA 4ARZB 2IYXA 1AA9A 3NG1A 4UQOA 2IYZA 1E2LA 2IYQA 4HUQA 4OQFA 3LNCA 1IY1A 1D2EA 1YRBA 4QBFA 2V1XA 1LB1B 5G53C 4HP4A 4QGGA 2EYQA 5EE3A 3BRWD 4RFSB 1EFRD 1Z63A 1G21E 1AZTA 3CIOA 3ZVLA 5D3MB 4BFXA 4PAOA 2ORVA 3EXAA 2HV8A 3KB1A 4O2LA 3RS0A 1BMFA 1BYIA 1ZD8A 3D8BA 5AUPB 4RD4A 5CLLA 2GETA 2XTMA 3K3DA 1TPZA 5IDVA 1W0KA 1YRAA 3SBEA 1XP8A 3HR7A 4JBYA 3H7WB 2XEXA 3KKMA 2YVUA 2KSQA 3PEUA 1PUJA 2HT1A 1DTSA 2QP3A 1NLYA 4C2TA 1II8B 2CMKA 2NZJA 2DCUA 1FTSA 1NIPA 3FYHA 3P7NA 1T91A 2CVHA 1MO3A 1Q3HA 3B33A 3BS4A 3NDBB 1Q1QA 2FE4A 2IEZA 3OAAD 3B13B 2B7BA 2V1AA 2WSMA 4FWTA 1VCIA 1XPRA 3OLOA 2J0VA 3ZGXA 4DIEA 5HWTA 1MH1A 3CKLA 1GNRA 4D4LA 2G3YA 4LY6A 4LHWA 5TARA 3O8BA 5GJCA 1DEKA 2OBLA 2GHIA 3TAHA 1PUIA 5HCIA 1DG3A 3LIDA 1JXMA 4AKHA 3IQWA 2PR6A 4HEJA 4RVCA 1GTVA 4AYWA 1H65A 5E7JA 2QPOA 4EPRA 3GPLA 4RD6A 1UGUA 4MYTA 1N5LA 1N9OA 1SVKA 1PLLA 4YMWA 1OJGA 4IEEA 1RIFA 4Q01A 4EKDA 2PLFA 3ZLJA 1VDZA 4FXPA 3KQHA 1KDTA 3I1FA 1DAFA 1OYWA 2H5EA 2QRNA 5G41A 5TY0A 3C16C 4L15A 3EARA 4WZ6A 1GKYA 1R6BX 2ZRDA 3DM5A 4QFMA 4Q4HB 1XNJA 3IO3A 3AVQA 3ZQ6A 1TU3A 2UZIR 1AGRA 2OCBA 1AQUA 3ADBA 4F93B 4ZIRA 1R5OA 3QSYA 3QI2A 2ZUCA 1S96A 2XSZA 4UJ5A 4HAYA 3FC7A 4PO1A 3ZVMA 2K5UA 1ZM4A 3V4RA 1N0WA 2YHSA 3FMIA 1CJVC 4OQNA 4LSGA 2IS2A 3BAFA 4ERNA 2CEAA 3LIFA 1R0XA 2YYZA 4GPTA 2CJWA 2PLRA 5FUXA 3WBJA 1XFAA 2PYPA 3FTQA 3ADDA 2QZ4A 5DKKA 3TAUA 2QTHA 3ZZ0A 1CRPA 4DDWA 2JIZA 3LI8A 3DL0A 3FKSD 4I5SA 4NBSA 3KL4A 5H8WA 1NVVR 5JJIA 3IHLA 3KX2A 3VR1A 3B6EA 4JIMA 4P31A 3THWA 4DCSA 3FOZA 5FL3A 1G7CA 3DZ8A 2VEAA 3I73A 4Z1MA 2D01A 2GXSA 1MV5A 5JZVA 3LA6A 5GJVC 4A8JB 2I1QA 4OKSA 1W36C 2A2ZA 3IBGA 2D7CA 1E2FA 4KFUA 4OHXA 3LVQE 4PXAA 1S67L 3BBPA 2YOGA 4DLWA 2J7PA 1VHLA 4AC9A 3HU3A 2PZFA 2O5VA 3OIVA 1C4OA 1E6CA 4TYPA 4OI1A 3X1ZA 1IM2A 4GHIB 1Z6YA 3R9WA 5FUWA 2IUTA 3KXIA 3UATA 1N6NA 4I39A 4V0KA 1LS1A 5HKKA 1IONA 1Q1BA 2LCFA 3EZFA 4QKQA 2FH5B 3B7GA 1TX4B 1YZKA 2ZUDA 2QMOA 3LQRA 3CR7A 3T34A 3FHOA 4DCVA 1IN8A 2P6UA 3P32A 2PX3A 1CXZA 1P62B 4JSTA 5F9FA 1YZNA 2FGKA 2OESA 4RZ3A 3SNHA 4EQ6A 3UE6A 2AKYA 4A0GA 3FE2A 4LPSA 1U8YA 4QC2A 3R8CA 2CLSA 4B33A 2GJ8A 4TLBA 5G3YA 4PPQA 3W5JA 4NYIQ 4LBZA 4KFRA 4D81A 2HV1A 2IK8A 4D0LB 2VL7A 1Y28A 2JJ2D 2ZJYA 3W3AA 1F98A 3MG9A 3WY9A 1W2GA 4R2HA 2VP2A 1XEFA 3LXRA 3GLHA 2W0SA 3IIJA 3GJ4A 5C1BA 1X0OA 3BC1A 3DKPA 4JS0A 4GS9B 1XMJA 4LRYC 2A78A 3P4YA 3RLFA 2WZQA 4MYCA 3M6AA 1ELOA 1XZQA 4GOKA 2QQEA 3LBIA 4TZ0A 5E95A 1E2KA 5KSZA 3AVUA 1H8EA 4CIDA 1Z0AA 1D06A 1EG7A 2AWOA 1T19A 1E9BA 2HUPA 1H8HA 1Z0IA 4BQSA 4DCTA 1LY1A 5EXXA 1TTTA 1S3GA 3P27A 1LNZA 3GLIE 4L4UA 3CX6A 1KSGA 4RCZA 4GDFA 4YMSA 3W3ZB 4QHSA 1AQYA 3GP8A 5JJKA 1OSNA 3PYPA 3E4QA 1L8QA 2ANCA 2XNDA 5FFMA 4M53A 3UK6A 2CLDX 1GSXA 4DSOA 4DVGA 4AY2A 4PZYA 2OFOA 4BLRA 2PT5A 4POAA 3RRMA 1OJ5A 1WMSA 2D3WA 1MRSA 2WJYA 4ZCIA 1QHXA 4TZ6A 1C9KA 2IEYA 2HF9A 5EE5B 2HXYA 4Z1MD 1SVSA 3IPYA 3CR8A 2XXAB 1F5NA 4V0MA 4Q03A 3KJIA 4V03A 3FHTA 2WKRA 3Q9LA 1XF9A 4I3IA 3OFND 5L8VA 1DOAA 3EWKA 1ZVQA 1R8SA 2H28A 2MSEB 1HA3A 3E4PA 4Q19A 2OLKA 4WOPA 2A24B 4W7SA 4DT1A 4B9OA 4RFSA 1A1VA 1KOUA 3EIEA 2R2AA 5CM8B 3SYKA 3F3YA 1KDRA 1JQLB 2JASA 2R6AA 3EPHA 4M1KA 5FOSA 3NWJA 5D3MA 3SJAA 2J0SA 1W5SA 3EC2A 2GCOA 1J70A 4OQMA 4KSCA 2Q9BA 3K09A 1J8MF 3O8DA 5SZJA 2J0UA 2IWRA 1E2HA 4B35A 3ICEA 4YMTA 2H16A 2BCGY 2Z4RA 3P1JA 3HU2A 1SXJD 3UMSA 2RHDA 1UKZA 4BASA 1RPZA 2DPXA 1NJFA 1RJ9A 1ZNYA 4KJZA 3VMFA 5F2EA 1NI3A 1UEJA 5J4KA 3CF6R 3QXCA 4FD2A 4NE2A 3CX8A 4EFLA 5LPNA 5JFGA 4DUGA 2YWEA 4A1FA 3OIYA 2ZANA 1L7VC 2J87A 1TS8A 4JKYA 3U7HB 1KMHB 2WPDA 4NDZA 1Z8FA 3TUZC 2C95A 4RQ9A 2ZJOA 2E87A 1MZUA 2W58A 4AKEA 3NKVA 4QJ5A 1Z6XA 3GLFE 4M8NE 1NLZA 1EW0A 2VHUA 4KITB 1FUUA 4DXAA 1KO4A 4HAXA 4MKFA 3F0TA 2OFXA 3A0VA 2QQ0A 1D5CA 2PX0A 4LHZA 3U5ZB 4WBSA 3CW2A 1KSFX 1FX0B 2ZRAA 3SJBA 2Q21A 3U44B 3I72A 1W36B 2A9KA 3F5FA 4M9ZA 1CULC 4Q21A 4FN5A 3SFZA 3W8NA 1VYVA 3ECCA 4IOKA 4Q9HA 4W5JA 2ZROA 1QRAA 1XTQA 2J7KA 2R8RA 2YC2C 2J5XA 1TNDA 3A1UA 1OTIA 2CHQA 3DHWC 3WXMA 2F9LA 1FTNA 3QKUA 1JR3D 1QDEA 4TTRA 1JEEA 3LLMA 5L3QA 4L8GA 4RKFA 1YZTA 2GZAA 4BLSA 4IKEA 4IXNA 5EZ6B 521PA 5FI0B 1W47A 1TF7A 1AS3A 2J46A 2IF0A 2RGBA 1R7RA 2C04A 5ANRB 5EFWA 5KNCA 4IDPA 1Z0DA 3KFXA 4D80A 3CRMA 4H1UA 5FOXA 3ZVNA 4WVFA 2B8TA 1EWQA 1LF0A 1MO5A 4E22A 1GOTA 3CUEF 4TYWA 1OF1A 2WPDD 4U00A 3UG7A 1F60A 3ZJYA 1OHHD 4JLNA 4C0BA 2D7DA 4XJXA 3WBKA 3U7EB 2HDNB 2H18A 1V5WA 1G291 3HP1A 3NXSA 5EXTA 1GRQA 1P61B 1Z0KA 4M2LA 4CRWB 5HPYB 3LLUA 2ZJBA 4QOSA 2V9PA 5CIWA 1N5KA 5JJLA 1FZQA 1NSFA 4QBGB 2CJWB 1KJYA 1SGWA 3O47A 1XJ6A 4JGPA 1NVVQ 2VLIA 4HB2A 2A5YB 2BIFA 3RYTC 5HSQA 2QL6A 1W0KD 3PR1A 4LV6A 2ODNA 4UKDA 1SXJC 4LCBA 4BFSA 1IHUA 4BLTA 1ZCAA 4MUBA 3IDQA 1G3UA 2F6RA 3THWB 4WAUA 2KE5A 4NP6A 3RS5A 5IF9A 1DAIA 5G4ZA 1DAKA 4MYHA 4BZXA 3WYFA 1KO8A 1ZAKA 3B1ZA 3BY8A 1E3MA 2OHFA 4LBVA 2GCPA 4ASUA 1S1YA 2IW3A 3LVRE 4P32A 4I1SA 1ZU4A 2ZITA 1W49A 2FV8A 2FA9A 1KK2A 2BBOA 1T1BA 4TQUS 1YU9A 4PPNA 4QBIA 5CJPA 1E0JA 2CK3D 3IIKA 3QF4B 4PZLA 2GXQA 4W5HA 2QPTA 1ZYUA 1X3SA 3U60B 2YZ2A 3QG5A 4LC0A 2W0NA 4ACBA 4II7A 3QXHA 2IYUA 2PCLA 3AUXA 4C30A 1XCMA 1G3QA 3A6PC 3IS2A 2C98A 2JLSA 4L9WA 4Q7JB 3EW9A 2V4ZA 4HAZA 3RAPR 2DBYA 4LC1A 4LJAA 2VPPA 3VR2A 1VCNA 1XBTA 1II9A 2WM9B 3B1XA 2C8VA 1ZM7A 1G7RA 3DZDA 2ZI5A 2HCJB 4QM6A 2Q9CA 2YINC 3CRRA 2KWIA 3GECA 1G3RA 3CWFA 1FUKA 4PQFA 2FFBA 4KUOA 4LUCA 2VYFA 1R4AA 4KSBA 1OYYA 4PQRA 4LJ9A 1GL9B 4R9UC 1R5NA 3MXQA 1XCGB 3MJQA 2R78A 4US2R 3U7FB 1KAGA 3PIRA 1KI9A 2R6CA 2ZIAA 3NOPC 1QG2A 1G8GA 3WRYC 3BH6A 5A5GA 5C18A 4LI0A 3CLOA 1E96A 3IO5A 4DIDA 1G5TA 1UADA 3UMFA 5AUOB 4PO8A 1NMXA 2IYWA 3RHFA 3QKRA 1N6PA 4HJ6A 4PKYG 1D9XA 1P60A 3KQLA 1PLJA 2OCYC 1Z6TA 4W5WA 4LJ5A 4B34A 5FUYA 2GVZC 4G5SA 1P3JA 2OEPA 4J0QA 2EVWX 1VG1A 2ZYVX 3WNCA 4EESA 4PHTA 2WJVA 4C9BA 4MN6A 1EFHA 2W00A 3UB6A 4G5QA 4O25A 4TQAA 4B47A 1S1CA 4D6PA 3W8RA 1YHNA 4PAMA 421PA 1QHSA 2C2HA 2FSIA 1RRFA 2OOLA 1EGAA 4BEBA 3T35A 2QRZA 5DO9A 1ZP6A 1RRCA 1P2SA 4Q5IA 3UMRA 4KO8A 1TQ4A 3CNLA 1S9HA 1WA9A 4HI4A 3UMEA 2CNWA 2BBTA 3NC1C 5FTMA 2ONJA 2YKFA 3K09C 3RSLA 3T5GA 3U3OA 4MUAA 4JJKA 3VX4A 2O8CB 4URWR 2BDTA 4MRRA 1E98A 4CEJB 2WWHA 3SYLA 3MMPA 2MSDB 4I99A 2Z6CA 1A2KC 3EWSA 5K8TA 2PEZA 1KI1A 2Q3FA 3A8TA 4LHVA 4YC7A 5DHAA 3W6OA 1P2UA 3GCGA 5C4GB 1DP6A 2FSHA 1E2QA 1PZNA 4GNKA 3MJRA 5H68A 3AP1A 3GJXC 1XPUA 1YZGA 4WA7A 2PBRA 3UANA 5JBQA 1XRJA 4X8HA 1R10A 1IAQA 2HF8A 1UPTA 1I4TD 3KXLA 4NCNA 1LSWA 4R3AA 5B57C 3ICQB 2A24A 4DT1B 5GADl 1P73A 3KJEA 4JBXA 4TL8A 4LV5B 1UJ2A 3UB8A 1XJ0A 1XWIA 4K81B 1DO2A 4LHXA 4RCYA 2I1VB 4CT5A 3K0CA 3R20A 1F2TB 2D2EA 4DLSA 4NTZA 3SC3A 2J0UB 2B7CA 5A4JA 2IS6A 2R6GA 5B58C 4ZI2A 3HPRA 4B75A 1KJWA 1TEVA 3H86A 2WWGA 5E4FA 4HUTA 4WXRA 1MABB 1GAJA 1HQCA 1N5JA 2NOAA 3CONA 1KO1A 5IS1A 3KKQA 4XSGA 2XGJA 2J3EA 5CITA 5LB4A 1R0YA 1IJEA 1OB2A 4BRUA 2QA5A 4HJ3A 1N5IA 1KNXA 2PJZA 1WCV1 4XD7A 4GRAA 2EFDB 4M1SA 3NIBA 4G3XA 2VV7A 4YDSA 4QL3A 3CWZA 1KMHA 4NYMQ 4Y0VA 4TTQA 2WOJA 2XZLA 3PCRB 5L3SB 5HD5A 2JJ8A 4LYJA 5KPJA 3AVWA 4GSYA 4MYUA 5FPHA 3KXKA 1DP8A 4IW3B 3MQOA 1ZUIA 4E04A 2ZS7A 3PUXA 3U3KA 2I4IA 5DI3B 4M1WA 5F98A 1DAMA 4EETB 1VG0B 4JL6A 3K0AB 3THXB 4HZUB 4RZ2A 5C4MA 3OZXA 1FX0A 3PFIA 3WHKA 3I92A 3IGFA 3KDSE 4KYIB 4HH3A 3BD9A 2JJ1A 3GLGA 3CNNA 1JJ7A 2CBZA 2EFGA 3N2IA 2ZE7A 2VHTA 2H92A 2ZRLA 4CEIB 4G01B 1XJQA 4IDOA 1UBGA 3UWKA 1P9RA 2GJAA 2DFNA 1OFTA 1NG9A 3CH5A 2FPLA 3OEHA 1Q12A 1SVOA 4MH0R 1ZU5A 1W1WA 2G0NA 3ETLA 5KSOA 3ZH9B 1OXXK 1IJFA 1U0LA 1P2TA 3VQTA 2SHKA 3VE4A 2JEOA 3BK7A 4LGMA 3GLGE 2BASA 1DELA 3LW7A 3FMOB 2YOFA 3SU8A 2IYTA 3AKDA 2VH5R 1S4RA 4MN5A 2W6IA 1SKYE 1L4YA 3OHMA 4H1VA 4NHOA 3SOPA 4AYXA 3MUFA 1NKTA 3AF0A 3MGCA 2N1BA 1TS7A 3LY5A 1US8A 5FI1B 3B1VA 4F7WA 2AXNA 4DLVA 5DISB 3W34A 3UG6A 2WMNB 2RAPA 5BW8A 2QGZA 1UBEA 3LX5A 4ESVA 1TADA 1ZD1A 3CLVA 1GKUB 1I2MA 2WVJA 1NY6A 3TIFA 1S4SA 4UJ3A 2RKOA 2Z0MA 3GJ3A 2V7QA 3WMEA 1OTDA 3K0FB 4JT2A 1QG4A 2IA5A 4LJ8A 3QXJA 3NHQA 1IN7A 3T12A 1Y3AA 3SR0A 4C0LA 5BYKA 4F3LB 5G4YA 2QBYA 2Z6VA 2F43A 2QORA 1WDTA 2BM0A 3PXGA 3U4QB 1U9IA 3RABA 1M7HA 1RVDA 3QVVA 2CE2X 4TMTA 3K0SA 4PR0A 2Z83A 4IDHA 1IY2A 1Z3IX 2DWQA 1OIVA 1JNUA 2QSZA 2NIPA 3BJIC 4XSHA 1NNEA 3U3JA 2XB4A 1KTVA 2RCNA 2O8BB 3TQFA 1Z83A 4EEPA 4OI2A 1IBRA 1N0UA 4DDUA 4Q1FA 1UDXA 5JHGB 1XD2B 2PD7A 2H7VA 4HQAA 3Q72A 1Z6GA 2PMDA 2ZPTX 1II0A 1LW7A 4M9QA 4A0RA 3GJ5A 1OTEA 2GA8A 4KU4A 1WQ1R 1ZNZA 3J81k 2JAQA 1UF9A 1N25A 4XVQA 3NBFA 3VFDA 5JRZA 3KUDA 5TMPA 1G3MA 3ZVRA 1S1ZA 1J2JA 4L9GA 1TUIA 1SVIA 3CF2A 4HUQB 5F9HA 4AKGA 2TMKA 4F4IA 4NL4H 1GVNB 5TV2A 1R0ZA 3CPEA 3TK1A 1XJ2A 4WXPA 4XWKA 1XMSA 1IXZA 1OV4A 2E1RA 2ONKA 1IN6A 3N70A 4Q00A 3T1VA 3W5IA 3QENA 3I5YA 2G88A 1G8HA 3ZQ5A 4EQ1A 4HIAA 3B2EA 3A4NA 3CBQA 3QNUA 2A5JA 4GP7A 3VR5A 1G9XA 4IXMA 4RD3A 4PC7A 4BFZA 2R6FA 1X8LA 3LWNA 2Y8EA 1N0VC 3A36A 5CJ2A 3IBRA 4WLAA 1D2NA 1FQKA 5LD2C 1M2OB 3WNBA 5CK4A 3T5DA 5B64A 2G1KA 3EA5A 1LF5A 4MDEA 3DMDA 3S1AB 1VB6A 4WIAA 2AX4A 3LQQA 4ZDWA 4JVNA 4M9XA 1Q57A 3F1PA 5D3QA 3K70C 3IBYA 4E5UA 2VRWA 4JKIA 2DFKB 4BE7B 3U6KA 2KI5A 3FGNA 1UBCA 2ZRNA 4PANA 1XZPA 4L9EA 1NKSA 2CHVA 4S35A 4TLCA 1W4CA 4MA4A 1X8JA 1YE8A 4I3AA 1SVWA 1YR6A 3I5XA 3B1WA 1G19A 2C9YA 3MWJA 5SZKB 4EW7A 1JNYA 4L9SA 3LI9A 1KOFA 5KUTA 1KKMA 3Q8XB 3H2YA 4U5XA 2MMGA 4LOAA 2PL3A 2ZS9A 2F7SA 4DDVA 4F92B 1VG9B 5HD3A 2WJJA 3ZIAA 4AG5A 1ZM2A 2QAGA 4TSFA 1V9YA 3PHYA 5K8UA 2JLZA 4EERA 3AVPA 1N6IA 2FPKA 3NVAA 4M4XA 4EXOA 1KI3A 2WWIA 1UKVY 2QJ5A 1F2UB 4OHWA 3KUCA 3A4MA 4L5BA 3ULFA 4V0NA 3R9IA 3WNDA 2ODBA 2YNMA 3H82A 5F6AA 1BOFA 3IHWA 2JCSA 3EA0A 1O3YA 3RS7A 1ODFA 3VR6A 5J40A 2P0EA 2DWOA 2GZHA 3BB4A 2WSSD 3AGPA 2GK6A 4IFEA 5DE3A 1GM5A 1NP6A 5CIQA 3UPUA 4HJ4A 2ERXA 1G3IA 4XVUA 3TNFA 1W44A 4LRXC 2ZI9A 4Q47A 5E7IA 4ZIRB 2JLWA 1KI6A 2M1CA 1T18A 2CCJA 2NTYC 3VR4A 1BYWA 1V43A 1RRPA 3CB4A 5AVEA 1G5RA 2N42A 2UZ3A 2DHRA 5AJXA 4CVNA 1N9LA 5BYJA 4XTCS 1CP2A 2QKPA 5DSZA 3TGPA 3ZQJA 5DI9A 4R6LA 2CXXA 3QXSA 1NLFA 2P5SA 1D7EA 1CU1A 4M1MA 1KDPA 3SZRA 1KI2A 1ESNA 2GJKA 2ZI4A 3RDPA 4HP9A 3EZ6A 3LBNA 4F4CA 3I62A 1YQTA 2J80A 3TH5A 2E9SA 4C0HA 4WW0A 4Q7LA 3GLIA 1GWNA 1ANKA 1D2MA 2V3CC 1ZNXA 2WAYA 2ZR0A 1OH6A 4JJZA 4DEYA 1A7JA 3TSWA 4A15A 2IT1A 3L43A 2KX6A 4IFBA 1E9CA 1MKYA 3EPLA 721PA 5C46F 3Q5EA 5L3SA 1KSHA 4FCTA 2JN7A 4XTRA 2AN9A 1NRJB 3CRW1 3ZYCA 4DC9A 4EPYA 1E0AA 1VHTA 1GDDA 3CRQA 3QG1A 3SE0A 1N6LA 1VMAA 1DPFA 2OUKA 3Q5DA 1XEXB 5F3WB 5HCNA 3RC8A 3TR5A 1L2TA 3EC1A 2EQBA 3K0AA 3THXA 4DLYA 2J1LA 1TQDA 2FEOA 5FPTA 5BXQC 1G20E 1RYHA 3AB3A 4Q1DA 5FL7A 3NBYC 2IYRA 2R62A 3IIMA 5FOTA 3SDZA 3R8FA 1YZLA 3I4LA 4NCJA 2V0WA 4GBMA 1AGPA 3AVVA 3R7WA 1F3OA 2ZTSA 1N6RA 1T0HB 1F48A 2BCJQ 4CEIA 4YONB 5AUNB 2GF0A 3U3RA 5JS7A 4BBUA 4BPBA 4LRWA 3KKNA 3GJ6A 1T1CA 2ZRJA 2ZEJA 1ZMXA 2O8DB 2BWJA 1TQ6A 1AKYA 2QPAA 2QG6A 1XD8A 4MRPA 1SZPA 4IOJA 3ZS8A 1NMYA 1K8RA 2G83A 3QXXA 1Z29A 4JLOA 1E1QA 3BH0A 4A9AA 2JLYA 5JCPA 1OIXA 1COWD 1CJMA 3AKYA 5TB5A 3ICYA 3KQKA 3DKVA 3LX8A 3OE7A 5EP2A 5HKKD 2VV8A 5SZIA 3U61B 3D6TB 4JVMA 3LIEA 4HHDA 1E9SA 1QHHB 1US8B 4JL8A 1NMZA 4LYFA 2C99A 1MO4A 3RRNA 1U0JA 1XJ3A 4P0TA 1KKLA 2CDNA 1AM4D 2VSFA 2WHXA 4MRNA 4BZPA 3GLHB 4UXJA 1CLUA 5FBRB 3H4MA 1X6VA 4G5RA 5EP1A 3SQXA 4ZCLA 4TT3A 2REOA 2GKSA 3QPUA 4H9GA 1ZIOA 4NXGA 4OI0A 4DLRA 2W2VA 3EAQA 5AR1A 2DWPA 1KK0A 4PSKA 4ZCMA 2P6RA 2REXB 1BO6A 1KGDA 4B3XA 2QBYB 3B60A 2ZSDA 2IS1A 4M4SA 2AHOA 3IEVA 4JGRA 5TVKA 3U4QA 3AVOA 1Q1EA 3EZ7A 5CYOA 2D74A 1DAGA 5E7MA 1OFIA 1K6MA 5GVRA 3NJAA 3DOEA 4QGAA 5DYIA 2ORWA 4KVAA 2FFAA 1HT2E 4HAVA 1G16A 1CR4A 1P9NA 1CR2A 2BJVA 1OTAA 2AXPA 4OBEA 1E9AA 5EXSA 2RMKA 1IQPA 2HT6A 4P4UA 5AJWA 2F1RA 3HPQA 2QE7A 3RNLA 4B2PA 2ZAMA 3QUSA 3FKSA 1W4RA 1XD2A 3ASZA 1GSIA 1N3BA 2YWGA 1NG1A 2NO9A 3A37A 3Q7PA 2RGXA 3TJZA 4AURA 1XEWY 4IHQA 2DFLA 3PEVA 4G0NA 4KYUA 621PA 3IPXA 4JLVA 5BQ5A 2ZYUX 4DCUA 4OJQA 5CLQA 2XXAA 2ZJ2A 2P2LA 2O52A 3QKTA 3VNUA 1V9ZA 1P2VA 4KUKA 5BN3A 4XT2A 2GRJA 2XNDD 4HNBA 4MRVA 4N3NA 1KMQA 2ZE5A 2KB0A 1CRQA 1G6HA 2QT1A 1W0JA 3EASA 3V4FA 2ZOHA 5FL7D 1XXHE 4QXAA 1XEWX 4IDQA 1M74A 2ZI6A 4URZR 2W27A 4A36A 3EG5A 3G0HA 3A4LA 1H8HD 2G9NA 1HT1E 4PC2A 3A58B 4XWAA 1ZNWA 4FMDB 1GIAA 2PEYA 4JGOA 3SHFA 1Z06A 4HI0E 3IEUA 5P21A 4LHYA 1Q21A 4BWYA 2RGNA 1K5DA 1MOZA 4I81A 4ZDIA 2ZRHA 1RJ9B 4NXBA 4HLCA 4TLEA 5FPKA 4O2RA 1XMVA 3CAXA 3JZAA 2ZSAA 3MLEA 4NMMA 4QJ4A 3S1AA 1Z0JA 4RY2A 1Z47A 2PH1A 4LV8B 2EA9A 3SHWA 3H84A 2VTKA 1Q1ZA 2NO6A 3OEED 3TUJC 3DVLA 3F1PB 2VO1A 3EZ9A 3FFAA 3AF1A 1TS6A 4KBFA 1W36D 3OESA 4URUR 2OO7A 1P6XA 4FINA 1NF3A 1S66L 4GCZA 2GEDA 1GG2A 2CL0X 4PC3A 3T06B 3RH8B 1E2JA 1SXJB 2QU8A 2WOOA 2Z4SA 3DO6A 1CIPA 4PAQA 3RRZA 1IN5A 3G6OA 4FW9A 4R7ZA 4WZAE 3HJNA 4UNQA 2QY9A 5KSYA 3U2QA 2X8AA 4B48A 4GL2A 3OEHD 1E9FA 2EW1A 2ZRKA 1EESA 3BWLA 2VP4A 4Q7KA 2CCKA 5FBVB 1LSVA 2GJ3A 4G1UC 4UNNA 1OKKD 1S4QA 3VE3A 4X8OA 3HYRA 4B76A 3K3CA 3P26A 3N2EA 5ELXA 2LKCA 3B82A 4PTLA 3LFUA 4R2IA 2RB4A 2QAGC 2ZR9A 3AVYA 5I5LA 2JLVA 3GFPA 5DKLA 2ANBA 1P72A 3FMFA 3PUYA 1UKYA 1FNMA 2QAGB 3KQNA 4DB4A 2YWHA 4KAXA 3MWKA 3FFBA 5G40A 5KOYA 1DP9A 4OI4A 5EE1A 2GAOA 2X77A 4RD1A 3SBDA 1PV4A 1F2UA 4OYHA 1SKQA 2OM2A 2C78A 1O87A 5L3QB 3MQQA 5HZHA 3H82B 3C8CA 2XTZA 4IVPA 5BWMA 4IEIA 3THYB 1W5TA 5KU1A 1JPJA 4MKIA 3P20A 1R8QA 3L0IB 2O8EB 5IK2A 2F55A 4LPZA 2HLDA 3KJHA 1KI4A 2QNRA 3MRSA 5CB6A 3HJIA 5DN6D 5HR5A 4LK2A 3LV8A 3P4XA 4TLDA 2ECKA 1GSVA 1Z08A 2MSCB 1KI6B 5DLQC 4HH2A 4UXIA 5EE9A 1KIMA 2JIZD 3NEJA 1EWRA 3VKGA 5BN5A 3KJGA 2AD1A 3PUWA 4C7OA 3E4OA 1M1YE 2QI9C 4W9MC 1JALA 3RTYA 3NHBA 2R6DA 1F6BA 3ZZUA 3B85A 1A5TA 4L9FA 1JEDA 3QKSA 1X1RA 3L8YA 1GL7A 2EFCB 2QAJA 3FHCB 1RKBA 3LBHA 3LRPA 3TE6A 1E2DA 4RD0A 3SQWA 2C96A 4JGQA 3I8SA 4NYMR 2IUUA 1GRRA 1OHHA 1CJTC 2XSZD 4A6PA 1G1MA 2B8WA 2HJGA 3KTAA 4P4SB 3GLIB 2INWA 1U8AA 4CEHA 1SULA 1Y63A 2ZYWX 4B2IA 1ODVA 4B3GA 1VIAA 1KZ7B 2ZRFA 4NCKA 4US0R 3K0CC 2FSGA 3E1SA 4WL9A 2UVQA 2ZRCA 1EX7A 4B32A 1VG8A 2XB2A 4MRSA 4CYMA 1XEXA 4V0ME 3BFKA 1LVGA 1FP7A 4PX9A 4QGFA 1T9HA 5FPSA 4E07A 3VTKA 4AWXA 4PKYA 1G7TA 4DCNA 2VHJA 4H6JA 2YKGA 2ZM5A 1K5GA 3LYXA 2JDID 2W0MA 2A5FA 1QBKC 2OBMA 1NL3A 5HDSA 3R7WB 1ZC3A 1COWA 2FU5C 4IDNA 4YMUA 4C0QC 2O0KA 3H0KA 3T1TA 5H70A 3C2WA 1Z22A 5IHPA 1WRBA 2OBNA 3KFVA 5AJZA 3AP2A 1OB5A 4NONA 3MSXA 2AFHE 3L82B 3IS2B 2BV3A 3PV0A 2V1BA 1E9RA 3AF2A 1G5PA 2R9VA 3A1VA 5TBMA 3G82C 1GP2A 1X86B 1YKSA 4EJSC 1XPOA 3PG5A 4BZQA 1DBSA 4YXWD 3GD7A 3K8YA 2F1JA 3AV0B 3B8HA 2QMUA 4EJSB 3QVUA 4TMWA 2EFHB 1SXJE 4IOLA 4DEXA 1PJRA 2PT7A 3SW1A 2Q3HA 2WKPA 1HE1C 3F1OB 3WHLA 1FL9A 4A82A 3HJKA 2UKDA 1Q0UA 1KI8A 3SEAA 1P0ZA 4FMDF 4C3ZA 4MKGA 4FMCF 2OAQ1 4RKEA 2C5LA 3TSOA 1G8PA 1NN5A 1ESMA 5HDCA 3K53A 4LZZA 4KVGA 5FTJA 5A8BA 3TVTA 2HYDA 4AKIA 1OXSC 3QKRB 5CM9C 3FDIA 3CM0A 3K9LA 4Q7MB 2EWWA 2XNSA 2H17A 4A4DA 2VP5A 4M0LA 1FP6A 3OIUA 5FR2A 4BLPA 4OK3A 3I8XA 4TL9A 1E0SA 2OAP1 4WF0A 4G5GA 3BWDD 5AJYA 2C77A 3DEFA 1XU4A 2GEVA 4PQYA 1ZBDA 3QF7A 4R98A 1UEIA 1U0HC 3UB9A 4EAQA 3U7GA 2AR7A 2A3RA 5C2JB 1BH2A 1HY3A 2OFWA 1UDWA 2WIBA 4V0LA 1QHIA 4IOMA 5G3ZA 1GNQA 3ZZTA 1ZIPA 3NTUA 1N2CE 3BB1A 2RHMA 3C14C 1R2QA 4NKRA 3ADCA 4HDOB 4TMXA 5AK0A 1U2RA 4QBHA 5L3VA 3CZQA 2NG1A 2P65A 4XWOA 2IXEA 1HTWA 1W2HA 1DO0A 2H1LA 5HDDA 2BMEA 4JLBA 1JR3E 4JLJA 5KIZA 5J7EA 1S8FA 2JHEA 2VHCA 3F1NA 3EWAA 1E69A 2O8CA 3VR3A 1OE0A 1WBBA 2EFEB 4DLZA 2H57A 4EPVA 3RS3A 1QVRA 4YXWA 1TL7C 1FPMA 1TU4A 4B3FX 4QNRA 2FZLA 1KAOA 3C5HA 4EFNA 2QGNA 1P75A 3O8CA 1MRNA 1PLKA 1GITA 4F4JA 1HURA 2P5TB 2DR3A 4TTPA 4BFVA 1ZUHA 4A8JC 5JECA 1UWNX 2KDKA 2KBFA 4FWIB 3K0EA 5JS8A 1NY5A 1VYUA 3MAAC 2FF7A 3EIHA 2J45A 4P3YA 2GNOA 3A1TA 3GJ7A 4F38A 5J4VA 1LL8A 5FH9A 4YLGA 2HCBA 2G1JA 2ZS8A 5FOWA 4TYNA 2DFTA 1X8KA 3REGA 2VQSA 3QEOA 4JLPA 3CNOA 1YVDA 2QTVB 4GZLA 5M04A 2V54A 1EX6A 2WWXA 1A2BA 3NEYA 4O0MA 1LTQA 1FQJA 2BJWA 1NBMD 3I61A 2QENA 3IUYA 1HYQA 1MO6A 5SZHB 2V6IA 4JSYA 4NCHA 4Q1BA 4RJLA 3C5CA 4I3JA 3EX7C 4FIDA 1E2GA 1MABA 1Z2AA 1T1AA 3H7WA 2RGEA 4K08A 2VA8A 5KDLA 4QHTA 2FFQA 1U94A 1OT9A 3OF5A 4XD7D 4CF7A 1II8A 1IXSB 4TLAA 4ILEA 4ZPXA 2IYYA 3LIAA 4NU0A 2WWYA 1JR6A 2ZJ5A 3E2IA 2QHKA 1TEXA 4TMVA 2VF7A 3VNVA 2PJRA 1KZGB 1RRGA 3BERA 2RGCA 3L0OA 4DJTA 1EFTA 3SI7A 1E9EA 2D02A 2I3BA 4JL5A 3X1YA 2WBLC 1SXJA 4D0GA 4DLXA 1QVAA 2EWVA 4QHYA 1CJKC 5DH9A 4XH9B 3NOTC 2FSFA 3QPVA 1XFQA 1W7AA 2AK3A 1LFDB 2GJSA 1NVXQ 4MGYR 3MD0A 4GMDA 3QBTA 4BLQA 2ZETA 2VSOA 4HZUA 4EUNA 3U6BA 4KODA 2OG2A 3SFVA 1T6NA 2VF8A 3KX0X 2P7JA 2HLDD 4D2IA 3GLGB 3BFXA 3OIWA 3MJHA 2CVFA 1I4DD 1GNPA 1GILA 5DN6A 3GLFA 2W2XA 4PFSA 4HOIA 4A92A 2ZU0C 5LDDC 3AP3A 1N6OA 1SKYB 3LW8A 1G64A 1YR8A 3SJCA 1KK1A 2PMKA 4CDGA 3WP1B 1E9DA 5JSZB 2IYLD 2ZUBA 4Z8YA 5JRJA 4AD8A 2ODWA 4Q9LA 2HXSA 2GESA 4BLOA 2GWHA 2OZEA 4G5OA 2BBSA 3EIQA 3UKDA 2O8EA 3V00A 1XXHB 3B9QA 2NMVA 2ZAOA 2BMJA 1VCMA 2JJ1D 1GSWA 2W6JD 4Q48A 2O0HA 2ZI3A 4C0SA 1AKEA 4V02A 1GKIA 2GJ9A 2CNWD 4KCGA 1Z0FA 2GBLC 4JLDA 3AKEA 3QIAA 2BHRA 4IRUB 1LT0A 4LJ6A 2JLQA 2G0TA 3WYGA 3FWYA 1UWPX 1HV8A 2PCJA 3DOFA 4NCIA 4I38A 1XTSA 4I1UA 4UNSA 3VKWA 4C7OB 3D3QA 4N0DA 5J4HA 1G6OA 3MFXA 2IX3A 4HDQB 2N46A 4I1OA 2ZVQX 1G4AE 1QZXA 2IXFA 4B44A 2ZQ5A 3QKSB 1JXOA 3AGQA 1DVRA 4OHYA 1DE0A 3HU1A 1XJ4A 3K9GA 2REBA 4B3BA 4CW7A 1OH5A 2FJUA 2WWWA 1E0KA 2W6ID 4XOIA 1KO5A 4AG6A 4OHVA 4U7DA 3G5UA 3KKPA 4ZV4A 4URXR 3ZD6A 3KTAB 1AZSC 1AIPA 4P4SA 4Z51A 4CEHB 2FDCA 1JAIA 1T3HA 4YQFA 3ASYA 1IXRC 1J99A 2RGGA 4Q18A 4E03A 2CK3A 5KNBA 3NBZC 2XOKA 4MQBA 4E09A 4HATA 3K70B 5EQTA 1FOEB 1XTKA 2IXGA 3UWOA 2B21A 2IL1A 3AVTA 1BIFA 1Z2CA 1IN4A 2WJGA 5LB2A 1XCPA 3WMFA 2V7QD 2XJ4A 3PUVA 4MDFA 4NZYA 1T3LA 4LDJA 3VHLB 1D9ZA 4KFTA 1KNQA 1WXQA 3SS8A 4Q9IA 3LH5A 4B71A 3AH8A 2O8BA 1SVMA 2BMFA 4PC6A 4RZUA 2FPMA 4NYJR 2J59A 4JZKA 4HB3A 1E2PA 3BFVA 3TR0A 2J7PD 3PEYA 3H9WA 3L0SA 2KJQA 2BEJA 2AK2A 1T4GA 4NH0A 1D6JA 2CE7A 3X1XA 1ZW6A 6Q21A 2FX3A 1OJLA 5EJEA 5HWWA 3HR8A 4KLZA 2BM1A 4BFYA 4ON9A 2ZRGA 4HDCA 3BE4A 4QM7A 4TSFD 2VLGA 1E2NA 2GBLA 1U9IC 3AKCA 3VX3A 1VECA 1M6NA 1OFUX 4RZXA 1FMJA 1N6KA 1G41A 3ADKA 2PDRA 221PA 4PZZA
chains in the Genus database with same CATH superfamily
2NP7A 4BKPA 2CFOA 4XGRA 4EQ6B 3AEKB 2J3WA 5E9WA 1MWUA 4L0QA 4YJHB 4ZRRA 3TEJA 3L49A 2FWMX 3R5KA 1A9PA 5GZ6A 3OF2A 3JD4A 4PHFA 4GPAA 5EJ9A 5DEOA 2QWSA 4TVOA 3RVNA 5L45A 1JB1A 1EVJA 1I3LA 2ZU6A 4TKZA 5KDOA 2GN0A 1XKLA 1UJ6A 3V4LA 3O3VA 3D4FA 1O07A 5EIHA 1I4OA 2XLCA 1Q22A 1QCDA 1T5HX 1P7ZA 2O6HA 3D81A 5HS6A 1Z6QA 2DFDA 2JJ2A 4OHBA 3L1HA 5HQJA 2NU6A 2W83A 4CLOA 2DT8A 1UFOA 4EHLA 4BJPA 1GGNA 2L42A 5LXTB 1TE2A 1WA5A 4Q1EA 2Z30A 1PJSA 5REQA 4CJXA 4JYCA 5T57A 1U5AA 2Z6DA 4WUVA 5I4BA 4IWXA 3WB0A 2NU9B 4N5IX 5KTKA 4DHEA 2CHFA 2P78A 2JA1A 3FYDA 4JC8A 2D2XA 2O20A 3W5UA 3T3NA 3JCZA 3M2PA 1EX1A 2RHJA 2R8OA 1U0EA 3OY2A 3R0QA 3ZK9A 3HV0A 3GGCA 1J22A 1R1DA 2GEJA 1EUDB 2GBFA 2QNBA 5LBIA 1JPNA 2YXDA 4FMBB 1KO7A 1RLTA 2WQZA 3SC4A 4GOXA 2QUZA 4BLUA 3RVOA 1QGDA 2ZYRA 3ZC3A 1I5QA 3B7PA 3ZHCA 4B7UA 2FMTA 1MT0A 5F68A 3R41A 4QTZA 4QATA 3SJZA 4UNRA 5EJ5A 3UYKA 4F3CA 3D31A 5H59A 3WKCA 1UINA 2OBYA 4DBLC 1OVMA 1YGPA 5FUVA 4BN0A 1P0MA 2CXNA 1ORHA 4JYBA 1EXWA 5DP1A 1KARA 1GYRA 2XUQA 4QASA 3O95A 2ZC3B 1DUSA 1ECPA 1HH4A 2ORIA 1P1FA 5EE8A 4GLLA 4QU0A 4RPHA 4D5GA 5GTDA 3ITNA 1E94E 3A0SA 2AL7A 3G2QA 5K0LA 3T50A 5DF8A 1K6XA 2VWHA 1J1ZA 4NBRA 3NP7A 4O2BF 3CV3A 3FPJA 4PSDA 1E79A 2EFJA 2PRSA 2PPLA 3W9YA 2J3TC 5EJ7A 1X2EA 4PZDA 3S4YA 4NCBA 1UC9A 2QZZA 3ROMA 1XFNA 2OT3B 3CN9A 2UXCB 1HE3A 1KA9H 1NLMA 4CMAA 1RZRA 1JHQA 3IYLW 2FN3A 5A62A 4UBIA 1C9NA 3OFNA 4HADA 4DJ2A 4LY9A 1AXGA 1TO1E 2ZKIA 2ZE8A 5J4LA 1NYTA 4D9GA 5KTYA 2QN3A 1CQIA 1GUAA 4PHHA 1YGYA 2UU9B 4YCLA 2DX7A 3WOVA 2ZB8A 3NGXA 4UHHA 2PZGA 1NN3A 4M1OA 2MCFA 3ZLBA 3TGLA 3OJLA 2R68A 2IXDA 3DR3A 4PC1A 4DWVA 3A32A 3AIKA 4LRTB 4W1QA 4GT1A 1P2FA 1NAHA 4EK9A 4O1IA 2LP4Y 4BRWA 1W1IA 1Y1LA 1D07A 3KHTA 2IHBA 4BN4A 3AWIA 3UY6A 2HK9A 1EINA 4UTPA 1N34B 3L18A 2OB1A 3U4AA 4Z7NB 1AKTA 1GRNA 1USUA 3V1TC 4J0CA 4EKNB 4I36A 3IPRA 4GI7A 3W5DA 2JLXA 2Q9NA 4K0KB 1EE1A 3RXWA 2QT0A 1KJIA 4QNMA 3FZNA 1LHYA 5FPPA 3JQBA 1D04A 3M4ZA 5CU7A 1S9DA 3W5AA 1K0KA 1UBUS 1ZJYA 1SHVA 2W6OA 3EF0A 5K8IA 1H42A 3NOUC 5E9QA 3K70B 1KYZA 3D0OA 1B0UA 3EGDC 1DG1G 2XX3A 2QROA 3CURA 4IJ6A 1XLTC 2OV4A 4EHJA 2J6CA 2W2TA 1NFRA 3E5RA 2GPNA 4LYAA 1H2RS 3OPQA 1YZQA 4LBWA 4PG7A 2BEUB 2NQ2C 3WLEA 1LSJA 2D06A 5JS2A 1IFXA 2JIBA 2YV5A 4RMHA 1FDVA 5HFAA 3ONNA 4DJ5X 3AWDA 3IT0A 4OQYA 3D7LA 5CBKA 5GLBA 3C6BA 5F69A 2IBMA 1BKDR 2OORA 3IILA 4ACAA 1ES3A 3PQ5A 3KZ1E 2J4FA 1P5JA 3OLXA 3GLFB 1F1BA 4PF1A 4K2AA 2ACKA 3GLUA 1UFKA 5JI2E 4FKBA 5AVOA 2LTAA 4CLHA 1WF6A 4Z0TA 5DF1A 1BW9B 2B5WA 2OO3A 2B30A 3T1QA 3TSYA 4ZHSA 5A5FA 2AYYA 1ZW1A 4M55A 3KKKA 4ALLA 4A6XA 2IKQA 1K8QA 3KQWA 3PFFA 4H3SA 2E0IA 2BM8A 4MUHA 1WVIA 5DNDA 5B37A 3ZQ4A 4D3ZA 4DNOA 5H0IA 4ARUA 5EZ5A 4CETA 3OE7D 1Z6PA 1XXHA 4TT8A 1UJ4A 3L7YA 3PGVA 5EWLA 1XQ1A 3PVSA 1JAHA 1R66A 4YS6A 1ARZA 3COYA 1BHSA 4P82A 2G2UA 2W2KA 3HNPA 3LOUA 3RREA 3S68A 3U0BA 1ORVA 1P4AA 1R27A 4OMFG 2O8DB 3W7VA 2IQ5A 5A02A 1PWZA 4EEXA 1PFWA 3OBFA 4NV1A 1Z5GA 2E49A 2H1IA 3X1KA 4XYLA 3BGVA 3MFYA 5HF6A 2WJIA 2XOKD 4FGJA 5ADWA 3GOHA 1EFRA 3FTEA 3V8QA 1TMKA 3TQRA 5G4KA 1Q2PA 4CN8A 1TTHA 3COZA 4TVBA 4QJBA 4HOYA 5CVUA 4UAUA 4HJRA 4MLPA 5EA2A 4K6GA 4JI3B 2PD3A 1QCZA 2IC5A 821PA 4HQ6A 4WLNA 1X0VA 1FBTA 4Q9DA 3H2SA 5D5PA 5B2ZA 5KHOC 2HSWA 4ND5A 5AQBA 4BMXA 1Z5VA 4YXFA 3P7MA 1GZSA 3S1YA 2X5KO 1XRMA 2XZPA 4HVTA 5K3BA 2DPHA 3NTXA 4RSHA 1NSTA 2ON6A 4W1PA 4ZU3A 3MUNA 4F4FA 1OH8A 2ATVA 1UXGA 3S55A 3Q6NA 1HE8B 3BXZA 4JLKA 1MJFA 1A4RA 2FN4A 2OC4A 1VPVA 2GAAA 3K4HA 4K86A 1U7PA 4O4HA 4AN1A 1YR3A 2I8AA 1VTKA 2WJ3A 1O57A 3IS3A 4KDRA 2Y9MB 1NBOA 3QBVA 1OMOA 3R7LA 1U98A 1GTJ1 1FMLA 1Y1KE 2AFIE 3BMXA 1EIWA 2Q4OA 1H8MA 1MP0A 2A9FA 3C7AA 3E27A 1MVOA 1IWBB 2A7QA 4CG2A 4E32A 1WSDA 2QSYA 4NOLA 1OPXA 3O4VA 5BN4B 1NJ2A 1DV2A 2ZB3A 5IBCA 3WWXA 1PL8A 1QAOA 1WMEA 5HJ2A 1XDSA 1G59A 1RKQA 2R97A 4PSVA 4MITA 2QTNA 1B8OA 3KQYA 1L4UA 1RYDA 1SCUA 1Z8DA 2V55B 4HAOA 3IESA 5TXGA 4RFVA 1M5UA 2I91A 4M60A 1J23A 2FZEA 3DE2X 1EFPB 4UBMA 1KDOA 1XRRA 4MR7A 4PS1A 5ALDA 2WHPA 3WV5A 1BEZA 2Z3VA 2Z95A 4B3HA 3DLPX 1EWQA 3PENA 1DJPA 2QSJA 3QA9A 3TIXB 4F72A 4ZDKA 2AG0A 4GWKA 5JDIC 1G8YA 1JG1A 3EA4A 2J41A 3NEPX 2O9BA 2FSSA 1HPLA 4MI3A 2CKMA 1QV7A 1IMJA 3MS7A 5JQGA 2ACGA 2Q27A 4BVKA 3FVTA 5CK5A 2HPAA 3GT7A 3BD8A 2I6TA 5CYPA 4DA9A 3LO5A 4OOLA 1IHYA 2QN8A 3TXAA 5IK2D 1U7HA 3OA0A 2MSWA 1KMNA 2XAUA 3DAOA 4E88A 4AK9A 2GCNA 1DKRA 2XCRB 1MOSA 3O73A 2GA9A 2DUUA 1YLWA 3QJYA 1YBHA 3FB4A 4HZGA 1CKEA 3GRZA 3X2FA 4GWLA 4Y2TA 3B1YA 2H4WA 3GMWA 5H7XA 4YMHA 3UMMA 2QYHA 4QG3A 4CGZA 4O8ZA 1E3QA 1HC7A 3PFWO 1YQSA 1CS4C 4LE2A 4RS4A 4LVOA 4TTJA 3N5KA 1H05A 5DNYB 5IJ9A 3H11A 1PW1A 3DOHA 2HMSA 2I78A 5CA1B 3R74A 1BFUA 1YL6A 3PS9A 1Z28A 3F8TA 1G8FA 1N7IA 1XL0A 2FWRA 2GLTA 3AINA 3LWDA 3THOA 1LSUA 1Y4SA 4BYMA 5A4IS 1YMVA 4US1R 3ZXIA 4BVJA 3OUUA 2XUDA 3M2KA 5JVDB 1J7KA 1OWLA 2N75A 1E4YA 2B92A 4UM7A 5DF7A 5AWFC 1KAEA 4FNOA 3WYEA 4CTNA 4E2YA 3RTDA 2I9VA 1THGA 2YRWA 3ITKA 2K4MA 3DM9B 3JZMA 5EP4A 4K8OA 3L6EA 2V4MA 3D0QA 3PJDA 1JHXA 3EUFA 4J75A 5WRFA 2X7HA 4EIWA 2X2FA 3DMNA 4LZWA 1M76A 4B4WA 1PSZA 4LF5B 3MJEA 4Y7CA 3NH9A 1MJGM 2Q6TA 3KRTA 3DCNA 2IWHA 4LCLA 3U4GA 5F5YA 1J5PA 3QBDA 3WYAA 4IPTA 4QFDA 1IPFA 3LQYA 4D4MA 2C2WA 4J0GA 2ZZKA 4P33A 4HQ0A 1SWWA 3L8ZA 4P4TA 4CL0A 4Y98A 5HIAA 5JSQA 3DL4A 3NETA 2IHTA 3UK2A 2VGKA 1QU2A 2AG5A 4HAIA 3IXDA 2V8OA 2L2QA 2OD9A 4N0EA 3E7PA 4O4JB 1HNWB 4KLCA 1V3TA 2PU2A 3GZNB 3NH6A 4IJMA 2O2ZA 4Q02A 1T6ZA 1ABEA 3NS7A 1YVPA 3FG8A 4Q1CA 3NDPA 4IV5A 3U56A 1XPJA 5E1OA 2C8LA 1G18A 3HL0A 1OILA 3THYA 3D3WB 5IF3A 1K1EA 1D0VA 2IP4A 2QM8A 2CUNA 3C43A 3N75A 1R4MA 1R12A 2ESRA 4B3CA 1H9CA 2QZSA 2NO4A 4FDTA 2YMQA 4RPKA 1RYNA 5TQVA 3TFQA 3CZ9A 2QW8A 5C5KA 5D3OA 4YRPA 4DM3A 2O8FA 1OFGA 1EP2B 3H1TA 1K6RA 2DLDA 4ITRC 4AU1A 2CZGA 5EPOA 3A0UA 3KB2A 4MGKR 1RD4A 2QM7A 1YVUA 2IOFA 4HLDA 4M9SA 1CJSA 1N6HA 3OCJA 2F67A 3QLJA 5A7HA 2FQYA 5KYKA 4UNPA 6NULA 2E4AA 2UYYA 5LIRA 1EVQA 2BF4A 5U1PA 1U7TA 2OV3A 1PD1A 1NBAA 1RSZA 2PNJA 4ZQEA 3GBPA 1C41A 4C7BA 3A6JA 4KR2A 2I8LA 2BFEB 2AZXA 2XWBF 3INGA 5K0FA 1IRXA 4MVJG 3V3RA 4DAOA 3H19A 1T2DA 1DAEA 1SOWA 2PU5A 4IH4A 1X1AA 3BULA 1IZ7A 3QEJA 4B80A 3D72A 3FPLA 1K63A 4N0QA 4HWGA 4CT4B 4OH1A 4JX8A 4QYWA 1X7HA 3ZNOA 2B4QA 2WIAA 2BM9A 1GGEA 4HS9A 3BGDA 1YZUA 2VXCA 4KMRA 4I1PA 121PA 3EVZA 2JLRA 3RU2A 1T9DA 3KSRA 3WGOA 3T1RA 3HREA 1FFHA 1PFLA 3ZDAA 1NYMA 2VF4X 3Q85A 1ZN8A 1RRMA 2HH9A 5E2EA 3D5TA 3G2LA 3D9YA 3V2HA 1PL0A 2Y1OA 4YRRA 5HWVA 1LU9A 1RQPA 4WESA 1K8XB 4GO1A 3KU4A 1RMTA 5B1DA 3TE7A 3AHDA 3JYLA 1E25A 1FLNA 1Y1RA 2OXRA 4YV2A 3RUDA 4D26A 3PPWA 4REOA 1X7WB 3BGWA 3NIAA 5CX7A 3T5BA 3TOCA 3UAOA 1DFIA 1V4NA 4GMXA 5AW6A 1VIYA 1E1QD 1MXOA 4NIMA 3WGUA 3I01M 4ESHA 3KQUA 2FJPA 2HCFA 3WO0A 3KAPA 3RAGA 2IRWA 2Y8HA 1HQDA 5F21A 2PTHA 4YT8A 3WFJA 5JCZA 1E1RA 4Q9JA 2XITA 4I3GA 4A2QA 4XVCA 4IRXA 3RYIB 5JALA 2Z5VA 4X41A 4BFTA 3I32A 2P9QA 3SFZA 4Y15A 3S2EA 4PE5B 2JZCA 3WL7A 4AS1A 1G68A 1O1YA 2K7SA 1J06A 5AKHA 3TTWA 5JMTA 1J90A 1WCYA 1QMEA 1FRVA 1Q3TA 2DP4E 2G77B 3Q7QA 5CW2A 3E9CA 3ZE7A 4C5AA 4C88A 5KX5F 4C4PA 3LCVB 3ZG7B 4IDGA 3L0ZA 1OTBA 1LD3A 3ETCA 3ZWWA 3PGKA 3ENWA 2RGDA 1SA0B 1HLPA 1PGOA 4CLDA 4EENA 4QGSA 1INLA 4O4IA 3K9BA 1QTQA 3MLBA 2QYSA 3MWLA 2O9JA 3T8YA 4RTKA 3TZQA 4AP5A 4JB3A 3WBFA 4X71A 4ANFA 3F1OA 3VP0A 1U90A 2NU7B 4ZZ0A 2ZM0A 2E4XA 1T8TA 1WE2A 3AEXA 3BSFA 3GH3A 3UJNA 2X0KA 2FOXA 2C5AA 1W8DA 1OOEA 3M1IA 3GEEA 4LNAA 3NOVA 5ENVA 4B73A 3A9UA 5EHIA 1EFUA 4D8YA 4MB0A 1R15A 3D3OA 1UBMS 3E70C 4X0EA 4J03A 2G6BA 3C1AA 4TMKA 3JQGA 3TJZC 2EU8A 1NXVA 2FPGB 1NBMA 2VNHA 3AR8A 1X13A 4G09A 4HB0A 1REQB 2I2BA 4RK5A 4CF3A 2IUFA 2KQUA 1WPGA 3EDOA 1VMDA 3WSWA 4MNTA 3UCFA 5J3WA 1U2EA 2H2WA 2JGNA 3OWXA 4HPXB 1MC4A 4JENA 3UICA 1P6UA 4RAOA 2FY8A 4URYR 4UVEA 4TV8F 4WA8A 3G32A 1ACMA 4F3LA 4F91B 4BWGA 3V8PA 3PF8A 5LYYA 1OT3A 3BH7A 3D7RA 2WYUA 2QRLA 4RPCA 3T0FA 4JKOA 3PYMA 1X2BA 1OTHA 5AJVB 2DTEA 4WJZA 1JL3A 1SKOA 4I6JA 4J91A 3BEBA 2B35A 1R0WA 3QQ5A 3CWCA 3RROA 2O3TA 3O4JA 3RKUA 2XMSA 1M73E 4WXEA 3RSOA 3ZD8A 4E08A 5HE9A 5KOHB 1C9DB 3G23A 4U7HA 4WVLA 2UYHA 4IS2A 5IN5A 4RMGA 5DWVA 4A2WA 1T5SA 2QL5A 4MBHA 4M87A 5CLIA 3C5EA 3GEHA 1VXRA 1CR6A 4FGLA 3HXKA 4I08A 1FP1D 1QH1A 1T1EA 5EWMB 3P2KA 2XCQA 3F1NB 4IR7A 4W7IA 4GKAA 4PR3A 3UJ7A 3P0JA 5KNDA 5K8TA 3FI0A 1J8YF 1E2UA 3KZXA 1UC4B 2PJUA 3TDKA 1YKGA 3GDIA 2R00A 1IZZA 2A0WA 2FQWA 5EIAA 1CR1A 1RTTA 2WTUA 2YKHA 1TS0A 1LRLA 3IALA 3V8BA 4PGAA 4MA0A 3DPUA 4PZUA 3TLYA 1Q91A 1E60A 3TZEA 1NJSA 1QXSA 3JPYA 4EI8A 5ICGA 2KLIA 3OT4A 1E2LA 1WLSA 2IYQA 4HUQA 3KWFA 2DQ4A 1D2EA 2ODPA 3K6KA 5CG1A 4N47A 5BR8B 4NWIA 4UM9B 4QQFA 1T29A 2X76A 3FG9A 4AX8A 1NXXA 3EXG2 1TDJA 3TW6A 2P7HA 4E3KA 4E5VA 5IXJA 1AZTA 1QX4A 2CEKA 3KT3A 3EK2A 3UO8B 1Z82A 3TZCA 3H65A 5ECGC 3QELB 4NPCA 1TT5A 4MWGA 2ZXEA 3H9QA 3Q8MA 5ARCA 5HKBA 3RK1A 3RS0A 3C7UA 2XWPA 4GDNA 4ZK6A 5JAOA 1ZD8A 2NZWA 3EDCA 4RD4A 1ORWA 4BAUA 3TGWA 1FYDA 1YRAA 1E1CA 3SZLA 8LDHA 3CRNA 2VH1A 4MUFA 1E9VA 3KKMA 1IBMB 3DFFA 3ZW7A 1W19A 3PEUA 2A2LA 3DTTA 2Z56A 5H16A 1DTSA 1KP2A 2QP3A 4C2TA 4C5BA 1LL5A 1IRIA 5EM0A 2CHUA 2NZJA 3D54D 3NM5A 3DWZA 5DTKA 1CNEA 2QHXA 3IEXA 3EPPA 5HRUA 4RQAA 3P7NA 1KMCA 1W9HA 1T91A 4BNYA 3VGJA 4NESA 1FBNA 3BS4A 1JVNA 1BCSB 1Q1QA 2IEZA 3BZWA 3OAAD 2AQHA 4Q9AA 2WSMA 2XQJA 3RYFA 2D1FA 1FJ2A 3CKLA 4M54A 4PQGA 1TVEA 2NLOA 3H8JA 4RGVA 3O8BA 1WS6A 2ZQYA 1DEKA 5IKEA 2QJOA 3L05A 3TAHA 5HCIA 2PUWA 4S2LA 1U0GA 3AUJB 3IQWA 1RBYA 1PQ4A 2KS6A 2CN1A 1DC7A 1V95A 1YA4A 3OQ6A 4LZJA 3DXZA 2UXBB 1H65A 3AM5A 3F3KA 2QPOA 4FHEA 2AFVA 1C4KA 1UGUA 1N5LA 1N9OA 2W4MA 4RMNA 4ZAVA 3T99A 2CKDA 4INJA 4EP1A 3DW1X 1BWSA 1I4EB 4CMIB 1RIFA 3G9XA 4Q01A 5FT9A 3TTUA 4QOEA 1PJCA 2JH3A 5K3CA 4B6OA 2CV1A 3FAKA 3G49A 3LFHA 2P30A 3K2NA 2EZ8A 1KDTA 2ILVA 1NRIA 1MZVA 5JXJA 5AICA 3HTXA 4S3MA 2LR0A 1KBZA 5CX4A 1I1NA 2K2WA 3P9ZA 4L15A 2J9PA 2A94A 3D8SA 3BN3A 5AI8A 3V42A 1GKYA 1QTIA 2Y76A 3DM5A 2I4NA 4L3OA 2V2FF 2OP1A 1L5OA 4K40A 2JIOA 1FILA 2QUBA 4Q4HB 4BWFB 1UM9A 1VOTA 1AUVA 2W98A 1I2AA 2UZIR 2W48A 1QONA 4GI5A 1AGRA 1UXJA 1V35A 3C3JA 4ZGBA 4EUVA 1AQUA 1ZMOA 1B42A 1O58A 2ZB4A 5AKGA 1JDNA 2Q1YA 2JCVA 3ELBA 4N7MA 3VNBA 2NP6A 2ZUCA 3LWZA 4CLRA 1WUTA 1UFRA 3W2GA 2HX1A 3O6VA 2B1JA 3L46A 4NMHA 3UDIA 4DMKA 4IKPA 4PO1A 4ZCSA 1IPEA 2K5UA 3V4RA 4GKUA 1N0WA 4EB8A 1CJVC 4LSGA 2IS2A 2F64A 5CCXA 1AHNA 3BAFA 1KZYC 4MQ6A 3WGMA 4CL2A 2AW5A 1J8QA 3FX2A 3I8OA 4XQEA 4G36A 5LSAA 1ZGJA 1R0XA 4GPTA 2YYZA 3JWEA 3U7QB 3EXEA 1BLHA 4ZI7F 2JRLA 3FTQA 4HBZA 2NTEA 5I7FA 1T3GA 5SY4A 4BQEA 1QHEA 4WKCA 3OOHA 4DDWA 3NRCA 3WWPA 2JIZA 2PZLA 5CW1A 3FKSD 4I5SA 2C20A 2O7QA 4KZ8A 2XAAA 3OM9A 3FBTA 5AHRA 5J59A 3VR1A 4P31A 3CI6A 2NO5A 2ZG6A 3KT8A 4S2KA 4R1NA 4DCSA 5K3EA 2CSXA 1F2VA 5MN6A 2VEAA 6GPBA 2PUEA 1VRWA 4PIMA 2Z3WA 3I73A 4Z1MA 4WESB 3LA6A 2I1QA 4KUHA 3INNA 2WVHA 1SBQA 3G7NA 1F8GA 3I9NA 2F3PA 2JFPA 4DZTA 3H3FA 3C98A 4QICA 4RAQA 3T3PB 2WWVD 1KOJA 3KU1A 4AY3A 3SS3A 5FNVA 1X14A 3RI3A 3STUA 3HU3A 4R8KA 3TZLA 1G2QA 2O5VA 5B7GA 3HY6A 1E6CA 1QLJA 2VAMA 3EGOA 1Y7LA 4EUSA 1Z25A 4WN9B 3ZXXA 3UE1A 4B2YA 4DR6B 1MWTA 5ICMA 3KXIA 3L4JA 4WXYB 3X43A 4I39A 3ZEAA 1LS1A 1GFZA 1RYYA 2OOKA 5HKKA 1Q1BA 1ZD4A 5T4EA 2GPSA 4BCCA 5CLGA 1MFZA 1UZMA 4HEFA 2YBDA 3L0YA 4LE0A 4PLHA 5G1NA 4BTLA 1YZKA 1J1IA 4FQ7A 2JKTI 4G8JA 3DKRA 5DGTA 2QMOA 2IA2A 3OTIA 4FYIA 1ENOA 4JQZA 4UMEA 1LV8A 2XQZA 1IN8A 1UBNA 3SQLA 2FSVA 3O7WA 1MOQA 1F17A 4PGFA 1AGYA 4HTAA 4Q3LA 2CZQA 2OESA 1NFFA 4INZA 4XEHA 3S7NA 4RLFA 4P0MA 4C4OA 4A0GA 1L3LA 2NV6A 3G9TA 2H8GA 4K9SA 1CDZA 5JPIA 3R8CA 4B33A 1DJMA 4U7WA 5G3YA 1TT7A 1V41E 3LCCA 2DKFA 5F9MA 5HILA 4NYIQ 4LBZA 2COUA 3DA8A 4KFRA 3W5JA 2IK8A 2FFJA 1HQKA 4B9EA 2YN0A 3VP2A 2IEDA 2I3ZA 3DFZA 4E3OA 3OIGA 3WY9A 1QK4A 1YJAA 4EWFA 3NP9A 2OZPA 2A0XA 3UAYA 5BWLA 1EFDN 5KX5A 5GHYA 1WU8A 2Z8YA 3GDHA 3IIJA 4ZDIA 4G0ZA 1FU8A 3BC1A 4BRSA 4QQ8A 1QYRA 4GS9B 1GDTA 1EJ2A 2JANA 3ET5A 2A78A 3RLFA 1EM8B 2WZQA 4MYCA 3P9RA 5C1IA 2HP9A 2P1DA 3T4EA 4PC2A 1ELOA 1PT5A 3Q7VB 3W05A 3WK7A 1N8TA 1C0LA 2WK1A 1C4WA 1G2OA 2QQEA 3LQ2A 3CW8X 3H97A 4I1IA 3O38A 4YP5A 1I7SB 5ERGB 1UOOA 1Q1GA 3JAKA 3SZOA 1D0SA 5JH7A 1XHEA 2XRYA 5F1KA 4Q37A 4IP0A 1T19A 1E9BA 2HUPA 2GZRA 4UUBA 5EOEA 4BQSA 3N2LA 3CUKA 5JW6A 2E37A 4FSFA 2PKWA 3KC2A 4XIFA 5EXXA 2Y1CA 3P27A 5B55A 1OBOA 1LNZA 1XEAA 1Y7PA 2J32A 3CX6A 3PI7A 4M1EA 1KSGA 4B4KA 4QDJA 4GDFA 1JDZA 2GYVA 2O2XA 3IAM6 4YMSA 3OZDA 1ZKMA 3W3ZB 3GP8A 1KE1A 3PYPA 3A4TA 4F6RB 2ANCA 5ENDA 2XNDA 5EVCA 4L85A 4LTDA 4M53A 3UK6A 1GSXA 2PGLA 4HESA 4K3VA 3MQFA 3W06A 1WAMA 3V7WA 1XXMA 3KSGA 1VBMA 2C3MA 2EQAA 2VSNA 4P35A 3RRXA 4EATA 3AJAA 3FUTA 2D3WA 2WJYA 3MAGA 3VU0A 2GYWA 1QHXA 4BMCA 4L9AA 5FI5A 5EE5B 4LHEA 4TRRA 4F8EA 5F4ZA 3OJWA 1DAPA 1SVSA 3CR8A 4XWYA 2XXAB 2LRHA 1J2YA 4V3BA 1PWXA 1H2ZA 2XMGA 3KJIA 3KYEA 1Y8RA 2WKRA 4V03A 3KBOA 4BV9A 3M5PA 3OJCA 1SC1A 1YL5A 2YZGA 3MEQA 4TTVA 4V0RA 4ZYWA 1JWVA 2A24B 3R3XA 4B9OA 1K7FB 1P74A 3PWTA 4YUZA 4MKXA 5C9ZA 1DX6A 4MUMA 4R1SA 4XRRA 3JALA 3SYKA 3OLZA 3RU3A 5JR3A 2Q0OA 1CUFA 2R6AA 4M1KA 5FOSA 3SJAA 1XCBA 4D8WA 5LKRA 1TT5B 3VH1A 1AXBA 1HYHA 3O8DA 1ST2A 3K09A 4B7CA 1I1OA 3ICEA 4FR2A 1ODTC 5FORA 1Y1QA 3JZDA 4Y2XA 2Z4RA 4KO3S 4CM3A 1J0DA 1XFDA 2VCHA 3S2UA 1SXJD 2NYUA 3WJ1A 2RHDA 4YA6A 3U26A 1N9ZA 1UKZA 4E46A 2DPXA 2IPAB 1S2GA 3ETNA 3CEJA 4BGVA 1KIFA 2JGEA 2HRCA 2WTMA 1I4WA 1ID1A 4DQ0A 3FBGA 4U9HS 3MTGA 3TRIA 4OQ4A 1F1JA 3WI7A 5CLJA 2QXTA 3F1LA 2YWEA 2LV8A 3IC5A 2VK2A 2EJBA 1TS8A 1B3RA 1CQXA 3GEGA 3M5CA 4R54A 5DB4A 2WPDA 1H1DA 2WP8J 4GPIB 5HOEA 5IULC 4KR3A 3HBMA 2GN2A 2Z4TA 3H18A 1IK6A 2E87A 3VPFA 2IBSA 4ZOQI 3QBJA 1BJKA 4QJ5A 4UTOA 2VHUA 1XRPA 1I10A 1RQ2A 1PZMA 4MWDA 1KDWA 1V5GA 4U7GA 3A0VA 1J4AA 2EAUA 2QQ0A 1K0UA 4LMPA 3VSKA 4LHZA 3U5ZB 4FDUA 4M89A 1FC0A 3RQSA 1V7CA 3MGAA 2CD7A 2OWEA 3M5WA 4FUQA 2Q21A 1QORA 2JH8A 4QRDA 4I14A 5K3AA 3STHA 3U44B 2YYAA 1W36B 4B3MB 3KYDA 4RHYA 2O8VA 4ZA2A 4CV1A 5B5SA 1CULC 1QGUA 3QLTA 3GIDA 1M0SA 3LY7A 3ZGAB 1T5DX 1PVDA 4FN5A 1LBHA 4IOKA 4Q21A 2HQOA 4L8LA 3MT8A 4Q9HA 4YECA 1PZEA 1O0BA 3WZMA 2YC2C 4RQBA 3HN2A 3GRKA 4HFRA 4ES6A 2JA2A 3DHWC 1J3WA 3CHWP 2V6GA 1BW9A 4MKZA 4Z53A 1HDIA 4B6RA 3ZWNA 3LLMA 4QUHA 1WXDA 3TTXA 3ZCTA 1UBTS 1TM5E 1YZTA 4RKFA 4IKEA 521PA 3QW4B 1FEZA 4UEJA 3P9NA 2RGBA 5ALTA 2C04A 3IBJA 1I0LA 1NPDA 3WRTA 4IDPA 4BNTA 4E6EA 3UNWA 3BKWA 1PNTA 3ZVNA 5FOXA 2WIJA 3F6SA 5BV0A 1D6SA 1GOTA 5EI5A 1H6BA 2WPDD 4DV6B 4TYWA 3EVEA 1K57A 1F60A 4R9RA 1BTOA 1N92A 2H29A 4N1HA 2HIGA 3FYSA 4J1TA 2PZMA 2C94A 4TUYA 4WLOA 2AYXA 2XNKA 1PNVA 1XTBA 5JSYA 4B31A 1NTRA 1V5WA 5CECA 3HP1A 1MT3A 4YI3A 2B1RA 4J7CA 1XNGA 1U65A 5GMOA 3H4VA 2Q0QA 4TXJA 2Y92A 3V8RA 5C5DA 2YCLA 3LLUA 2XF2A 2K31A 3ZE6A 2GRAA 1NSFA 4K1XA 3K8QA 1O0SA 4IYJA 2CJWB 3FFXA 3PSAA 4HB2A 6ABPA 2A5YB 4MKRA 1K97A 1PT7A 4XJTA 4JA0A 2TS1A 5HSQA 4KLRA 4EZBA 1MY8A 1M6VA 4HRVA 5AYVA 3INYA 5DNEA 2XMZA 3PQFA 3SBOA 3T3MB 4MAFA 3WKDA 2H4ZA 3ICOA 3RIHA 3RTBA 4BLTA 1ZCAA 2AEMA 4DUZB 1GZ5A 1P17A 3NI2A 1WB4A 2F6RA 1FX1A 2QI9F 3C6KA 2KE5A 3QNMA 3DEZA 5ALZA 2AXQA 3B70A 5IU6A 4W5RA 1JLLB 1OI7A 4IICA 2Y2GA 3RVPA 5KYYA 1GARA 4LBVA 5FLKA 4X55A 2BGRA 4O4HB 1DL5A 3LSTA 3HEAA 2FW6A 1Y7IA 4NFYA 4LF7B 4P32A 1NVGA 1HDCA 2GOYA 1Y3CE 3KHUA 1DV1A 3QVOA 4L6CA 3ZLTA 5JC1A 3R0IA 3L77A 3SVZA 1W49A 3KOYA 4Q16A 1U7OA 3UMGA 1U9CA 4YNRA 3KUXA 2NXJA 5DV9A 3JYOA 4TQUS 3A3KA 2C1EA 2J9OA 4E2WA 1JG2A 4E2FA 1JTDA 1ZG3A 1U3VA 3OZBA 2ECQA 5TT0A 1ZK1A 1JU9A 3IIKA 3QF4B 5DW0A 4W5HA 3I01A 5EKSA 2QPTA 4IMIB 4LRSB 1FCNA 2A35A 2W0NA 4TTIA 1KWKA 3KDAA 3AKZA 1OA0A 2PFKA 4HDNA 1XR3A 3AUXA 4V2UA 1K6EA 1G3QA 1K5PA 4I9GA 4KK4A 4LXYA 4NJMA 1Z4LA 4Q7JB 1CJCA 1L4BA 1GA6A 3SF8A 1F2KA 1SUFA 2FEPA 1LSOA 4X1YA 3G2NA 3Q0IA 4FFPA 2ZJ4A 3CBGA 2XKBA 5A9SB 1FQWA 2B61A 4LWOA 1DTWB 3B1XA 4YB8A 2B2CA 2QJWA 5C81A 1K66A 4R31A 1PQWA 1PIOA 1PF7E 2HCJB 2Q9CA 2ZI5A 2HC9A 5JDIA 4X85A 2GTHA 3CWFA 1DT5A 4MV0A 1W9MA 1GT6A 4S2JA 2XROA 1JILA 4PQFA 4R9UC 4GZ6A 2VYFA 5CNIA