2WKRA

Structure of a photoactivatable rac1 containing the lov2 c450m mutant
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
317
structure length
317
Chain Sequence
ATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNMRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFHHVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
pubmed doi rcsb
source organism Avena sativa
molecule tags Transferase, cell adhesion
molecule keywords NPH1-1, RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
total genus 109
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2wkrA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wkrA02
2HXSA 1E2MA 4UXHA 2WKPA 3P7NA 3E4OA 3K0SA 1E2FA 1LSXA 2AKYA 2Z6VA 1E4VA 1GKYA 1IHUA 5L8VA 3EWKA 5KIZA 1ZMXA 2VF8A 1QHIA 2ANCA 3OAAA 4CYMA 5DHFA 3WYGA 4LC1A 1UKEA 2J0UA 3RH8B 3TMKA 1XMJA 3R7WB 5LD2B 1H8HA 5EXSA 1OB5A 1TQ4A 3AV0B 3SQWA 1JECA 3QXHA 4KJZA 4KLZA 1LSWA 4K46A 1EW0A 3C4JA 3NBXX 2C78A 2A2ZA 3GEIA 2O8DA 1N9OA 1E9RA 1YQTA 4TMTA 1AA9A 1WQ1R 3F1NA 3EPLA 3F1PA 4LPKA 1LL8A 5DO9A 4XSHA 1U8ZA 3U7HB 1PVOA 2ZSEA 4TL9A 3SJCA 4PC1A 4ON9A 5GADl 1VG9B 1U9IC 3LIBA 4YDSA 1NIPA 1XXHA 1E2DA 2RKOA 5HCIA 3W8NA 3CF6R 4YXWA 1KK0A 4B3XA 2C95A 1JNYA 2VV8A 1KKMA 2C5LA 5KOYA 2GCOA 3LRPA 5JLJA 5IRCD 3QOFA 2CNWD 4JBYA 5F98A 2W6JA 2R62A 4AKHA 4BBTA 221PA 3VFDA 2IYTA 2GAAA 1T9HA 2REOA 4MDFA 5EXTA 1T0JB 3V00A 3GPLA 1FMJA 1YR9A 2FSFA 4HUQA 4EPTA 1SKQA 2INWA 2BBSA 2YWHA 5TBMA 2ZE6A 2I1VB 2V55B 1EWQA 1Z0DA 3U5ZB 4URZR 1JBKA 3GLHE 3GLIE 1NG9A 1Q0UA 3BY9A 2QGNA 2V3CC 1HE8B 2IEZA 3G0HA 3U3OA 1N6KA 4JYCA 4JVMA 4MRRA 3SJZA 2CVHA 3PEYA 1IY0A 2P6UA 4ZDJA 5HSQA 1QF9A 3OLOA 5DSZA 1IJEA 1VYTA 4XT2B 2A7QA 2ZSDA 3D31A 4LX0A 2FSGA 3W3AA 2RGDA 1OKKA 3NOPC 1ZP6A 4RFVA 4B34A 2P65A 4FXPA 3RABA 2ZTSA 4K8OA 2DPXA 4KSBA 2W6JD 3KTAA 1X1RA 4B76A 4LPZA 3AVWA 4HB4A 3R7WA 2OFWA 1U81A 4QNRA 3PUZA 3SJBA 1GP2A 1QRAA 3C7KA 2EYUA 4Q9KA 4MUBA 2RGXA 2VEAA 4D0GA 2F1RA 2ZE7A 3GLHA 4JL5A 2B8WA 3WHKA 4LYHA 3L0IB 2I1QA 2N46A 1F2UA 2D2EA 3PUVA 5CLLA 1N6HA 1TS8A 1XEWX 5HDSA 1P2UA 2W00A 4Q4AB 5SZJA 1XTQA 2IF2A 3CM0A 1Z6AA 4U7DA 5FBRB 3KKOA 4W5JA 3RRMA 3OFNA 1XEFA 2X77A 5FL7D 3AKYA 2C99A 3B82A 3IKJA 3LVRE 1K8RA 1ZCAA 3K70D 1FFHA 4MH0R 4FIDA 1S3GA 4PSAA 4HOIA 3H86A 5KHOC 1VMAA 2BBWA 3N5CA 2ZSFA 1KO1A 2F7SA 4DDVA 4IFBA 1CEEA 3OHMA 3WBKA 3QBVA 4JIMA 2HJGA 3KJHA 2D62A 4OYHA 3TAUA 5CB6A 1SKYE 4A9AA 1KI2A 3I8SA 4IDOA 4LRXC 2OAP1 4HUQB 4FCWA 2JLRA 2UZIR 1SGWA 3AP3A 3PQCA 1FMLA 4NXEA 2JCSA 2YWGA 2PZGA 1HQCA 2OCBA 2P5SA 2DWQA 1JPJA 2BWJA 1T1CA 2WVJA 3AF4A 3PUWA 3HR8A 4XVQA 4JSYA 2LWIA 3WMEA 4A1FA 2MMCA 3WRXC 1E2IA 1GZSA 1KDPA 1NN5A 4PR0A 1OLOA 2QG6A 3UMDA 4FMDF 4JT4A 4BECA 1TL7C 4BEJA 3ICYA 1VG0B 1JEDA 3KFXA 3MUFA 2AKAB 5LDDC 3E2IA 4JMPA 1SHKA 1XD8A 4N0EA 5AJXA 3THYA 2OV2A 5CIWA 2ATVA 4ESVA 1AZTA 3AQ4A 4KBFA 4KFTA 2R65A 2BMFA 4IFEA 1T3SA 2FJUA 2HT6A 5TXGA 3DEFA 4RFSA 4BFTA 1HYQA 4QFMA 2P3SA 2J41A 4JKYA 3PV0A 3QXJA 1I4DD 1M6NA 1BYIA 1H65A 1YZTA 1CR0A 1GOTA 2WICA 4LJ4A 4EPRA 1FX0B 3HJNA 4K08A 2EQBA 4E04A 1II0A 4JYBA 4YDHB 1IAQA 2CMKA 2JAQA 3EPKA 2E9SA 3LUQA 4MQBA 4QHTA 2A9KA 3BFXA 1W47A 2NO0A 4I1UA 2RGCA 3T5DA 4GNKA 1F3OA 4MRPA 3RYTC 3VR4A 2L0XA 3WHLA 1US8A 1DRMA 1OTAA 2VO1A 1U9IA 2XOKA 3ZS8A 1KSHA 4Q21A 3KFVA 1KMHA 3ZLJA 2PEYA 4W7SA 4LZZA 1TUIA 3I72A 1E0KA 5EE3A 2HXYA 4MITA 3T1VA 4QM7A 4TTQA 1GL7A 4UKDA 2JN7A 1GNQA 3RRZA 2IYYA 5C4MA 4MN5A 5CJ2A 1GDDA 4FWTA 4Z1MA 2XTZA 3FKQA 4BGDA 4NE2A 2CCKA 1HUQA 2FFHA 5CK5A 4C4PA 2O8FB 2WIAA 1G20E 2QMEA 1OH6A 1TU4A 4PO1A 2KDKA 2DY1A 2RH5A 3VMFA 1E32A 3FMOB 1BMFA 4AWXA 1II9A 5L3SA 3I92A 2Q3MA 2PCJA 4IDNA 4PHHA 3CAXA 3ADDA 1H8EA 5AJZA 4V03A 4ZI2A 2H16A 4B71A 4KXFB 4RFSB 3BIFA 5K8TA 3BBPA 3DMNA 3FVQA 4QGHA 3AF3A 1W0JD 4E09A 2P67A 3W6NA 2GAOA 2YNMA 3V9PA 2EFCB 5JS7A 1DO0A 4HB0A 1G3UA 1IJFA 5J4LA 5CJPA 5FTKA 2FGJA 1KI9A 1Q1ZA 2ZVQX 4LCBA 4N1AA 5EP3A 4PANA 4DIEA 4LDJA 3QEJA 5EP1A 3VHXA 1XMSA 4A0RA 1KKLA 4CRWB 4JL8A 2AWNA 2OBLA 1Z2AA 2DFKB 1XD2A 3NHAA 4B44A 2IS1A 4DCVA 3TQFA 5AUOB 1KGDA 3ZQ6A 5A4JA 3ZQ5A 1US8B 3H84A 2V7QA 4ZDKA 1J70A 1XMIA 4IOLA 1N9NA 4OJKA 3UK6A 3UMFA 1XJCA 4US1R 5G4ZA 4URYR 4Q4JB 1G291 1NRJB 2GKSA 2WJVA 1XJ3A 2CL7X 4GBMA 3EX7C 4PQFA 2QPOA 1G19A 2GHIA 2OCYC 2C9YA 1N6IA 2RHDA 1TF7A 3VNUA 1NKSA 1T6NA 5C2JB 2QA5A 2KBEA 1JQLB 1II8A 3KKNA 1MV5A 3CR8A 3TUJC 1DVRA 2C9CA 3RS7A 3RDPA 2G3YA 2D7DA 3PUXA 4BFUA 1KZ7B 1DO2A 4F7WA 2F9LA 3I4LA 1W7AA 2V6JA 3BJIC 3LO5A 1T19A 2B02A 1DADA 4B43A 1T18A 3QKRB 5ANRB 3UKDA 3GJ6A 4W9MC 3AVVA 3OEEA 2HF9A 4TL7A 1S1CA 2Z4SA 2IL1A 4Z1MD 4ZIRA 1E2EA 3UMRA 1P0ZA 3KQHA 5J4EA 3C8CA 3K0CA 2O52A 3AUXA 2Q3FA 1WB9A 1M1YE 1N5KA 2GJAA 1WDTA 4G5OA 5FPSA 2JA1A 2B7BA 3UXMA 5CDFE 3WRYC 4AYWA 3L8ZA 4TMZA 2XSZA 3BH7A 4WZ6A 4TLDA 2QPTA 5FTJA 5KDLA 1VDZA 5GJWC 2OHFA 3B2EA 3AVXA 2J1LA 3PCRB 2ZJYA 3I8XA 2R2AA 1F2TB 4PO9A 1NSTA 2PBRA 1W4CA 2I9VA 3UB7A 1W48A 4QHSA 5BXQC 5C1BA 4RCZA 3G5UA 2HLDA 2R6AA 1X86B 4GOJA 4R98A 2WPDA 4NBSA 2FPKA 3KDSE 5J5CA 3E4PA 1G5RA 3K3DA 4FD2A 3LICA 1XX6A 5EQTA 1KK1A 3B1XA 2KX6A 3LAWA 1Q22A 2QTFA 4BZPA 4HP4A 1FP6A 2FZ4A 1U98A 4ITRC 3RS4A 3LW7A 1UBEA 2YC4C 2BBTA 1RYFA 4LBVA 5HCNA 3MCAA 2NGRA 3UB6A 3K0FB 2DB3A 2D7CA 2VL7A 2WSSD 4KUOA 4FMDB 3QPVA 4DC9A 4EPVA 2OE2A 3OF5A 1U99A 3TW8B 1IBRA 4Q9JA 4US0R 2KI5A 2QSZA 3BE4A 4KFRA 1FPMA 4ILEA 3MMPA 1VCNA 5JJKA 5EZ6B 4ZCLA 4MYTA 3NWJA 2QAGB 4DWJA 1DAHA 4NYMR 3CWZA 1JJVA 1J90A 4LRZE 3QKRA 3ZS9A 2E1RA 2GCPA 3BGWA 3HWSA 1LV7A 2Z43A 1DAKA 2Z0MA 5LD2C 4BLTA 5CK4A 1JR6A 1KSJA 2YOFA 4NP6A 4M9SA 4AY2A 3BB4A 3Q72A 4D0NA 5F69A 1MOZA 2A3RA 3BD9A 2YV5A 1YZUA 3EWAA 5FUVA 3K53A 3LW8A 1NJGA 1G9XA 1IONA 3U2QA 3CH4B 3A1SA 3LVQE 3LI8A 4ZI3A 2X19A 1U0LA 2DFTA 2VLIA 2OT3B 2XEXA 5KNDA 1P60A 4LSGA 1GRRA 2JDIA 4GRAA 2G0TA 2X1VA 1R6BX 4G5SA 4PKYA 2VTKA 1UWNX 4Q4LA 2BEKA 3EIEA 1LSVA 4G1UC 4L9SA 1CJKC 1JR3A 1PJRA 3P32A 3QEOA 1I2MA 1LW7A 4RD3A 2QBYB 3ZVLA 3I5YA 1FUUA 1HV8A 2B6HA 1UBCA 4AYXA 4D26A 3VX3A 5FOWA 2FU5C 4KSCA 1BOFA 1VCMA 3NOUC 1TQ6A 4YMUA 2VP2A 3IIMA 3VKWA 4PPQA 4A8JA 1W46A 4TSFD 2QN6A 1J8MF 3LV8A 5HE8A 2BDTA 4RZXA 3KXKA 2FWRA 2QP4A 2AD1A 5D3QA 1U8YA 3HYRA 3DM9B 5FOVA 5JEEA 1IM2A 2JLYA 3NBFA 1U90A 4OK3A 5FBQB 1GRNA 2BVNA 3KUCA 4C0HA 4BEBA 1ZNXA 5EE5B 5FTNA 3MLEA 5FR1A 4LJ5A 2EVWX 3A0VA 2CL6X 2F55A 4HJ3A 2DR3A 5JCZA 3A37A 2HV8A 1Z3IX 1EFRA 2ZOHA 1VG1A 1OB2A 3VR6A 4FCTA 3BRWD 2ZU6A 4QGAA 1LFDB 4AKEA 1Z6GA 3TE6A 5HKKA 4PZZA 1DAFA 3H7WB 3SFZA 3QPUA 4G3XA 1R0WA 1XXHB 1VTKA 2RGEA 3ZD6A 3QPWA 4M1YA 1NNEA 3ZZTA 3JVVA 1AM4D 5JWHA 3MJQA 2JGNA 2ZU0C 4R9UC 4TYWA 1Q20A 1DE0A 3B1ZA 4B73A 3LLUA 2JDID 2VRWA 5DI3B 1XCPA 2ANBA 3IIKA 1LY1A 1N5IA 1Z63A 1A4RA 3GLIA 3K3CA 3LH5A 4HLUA 4US2R 2QUZA 4KITB 4M1WA 3AKDA 5DH9A 1XDBA 2NIPA 4BFXA 2JIZD 1C1YA 4Q48A 3UG7A 3CLOA 2ZEJA 3EZ9A 1T3LA 5E3HA 3B78A 1X8LA 3UE6A 4XH9B 2NPFA 1GFIA 1QG4A 2GEDA 3TVTA 4DSUA 3E5HA 4R2HA 2XAUA 1XTSA 4NXFA 2CNWA 3OESA 2V1UA 4CEJB 1TS7A 1MABA 4CIDA 1KI4A 1Q44A 1E2NA 2WM9B 2Z4RA 4I1OA 1KNXA 3C5HA 1GITA 2MMGA 1VPLA 2YHSA 2QENA 2G1JA 2V54A 3KZ1E 4TMVA 1H8HD 2VHQA 1RRCA 3F0TA 1E2HA 1N6OA 2EFHB 2GXQA 2QQ0A 8OHMA 1EX6A 4TQAA 3CRQA 3VOLA 4B3GA 4AKIA 1NBMA 3L43A 5EZ5A 3AGQA 3TGPA 1VCOA 4PO8A 2JLSA 4R2IA 2QKPA 2ASEA 3Q8XB 4LHZA 2ZRMA 4DLWA 4MGKR 4WA7A 1F2UB 3CH5A 3MWLA 1J99A 4WXRA 3QJYA 3VE3A 2CJWB 4OKSA 2V6IA 4HZIA 4UNNA 3L0SA 3ASZA 1R8QA 1P9NA 1QVAA 1UPTA 1A7JA 1NY6A 2PLRA 4RD4A 1D6JA 2ZUBA 3EC2A 2A24B 3H7WA 3QG5A 1FZQA 4P32A 1J8YF 3KQNA 5IK2A 3B33A 2FEOA 2DWPA 4Q5IA 5DKKA 1G3RA 4L9GA 1L2TA 2CBZA 2QJ5A 1XZQA 4EPWA 3GFOA 1NLZA 5DN6D 1NLYA 3L0PA 4HAUA 3IDQA 1XTKA 1S9HA 2PMKA 2GCOB 1CLUA 2Q9AA 4NONA 4TZ6A 3CLVA 2J0UB 2ORVA 3NBZC 1XEWY 4KVGA 5AUNB 1Z0JA 1CU1A 2RGBA 4QM6A 4LYFA 3C8UA 4DJTA 1Y28A 4S2EA 2CL0X 4I3AA 5TBMB 1JR3E 3DL0A 3KB1A 3K0AB 1OXVA 4AD8A 2A30A 3DKVA 3N2EA 4NXGA 3QXSA 2WTUA 4G5QA 4IW3B 3SW1A 1YZLA 5G3YA 2N1BA 4ZKEA 3REGA 4XWKA 5JCPA 2ZI7A 5K8IA 3K70B 2VHUA 4TMXA 3MFXA 2PJRA 1TNDA 1BKDR 1N0VC 3SBEA 3EIQA 3MRSA 4WOPA 5AJYA 4CGZA 1TTTA 1Q12A 1AS0A 2YZ2A 4E03A 3H1TA 4U02A 3SYLA 4Q19A 3ZD7A 4HY8A 3BB3A 3HP1A 4HAZA 4GZMA 5L3VA 3THXB 4HLQB 4ZDWA 3AVUA 2FFAA 2W6IA 3QF7A 4D4LA 5DN6A 3EASA 4OI0A 4BRUA 2VSOA 1G4AE 1NMXA 3GLHB 3R20A 4ASUD 4JVSB 4YQFA 4XTCS 5J4YA 1T5IA 1XB2A 4JBXA 1G7RA 1JB1A 5KU1A 1NSFA 3QKSB 3UB8A 3SNHA 1Z29A 1ZAKA 4CDGA 3OIYA 1JXOA 2N42A 3NDPA 4XD7A 1KNQA 2NQ2C 5TB5A 3ZZ0A 1E98A 1QBKC 5FR2A 2Z6CA 1J2JA 1GVNB 1Z47A 2FH5B 3B13B 3Q3JB 5KDDA 4PAMA 1KSGA 3GLGA 3U44A 2J7PA 4TYNA 4DLYA 3NH6A 1C4OA 3IHLA 5AWFC 2IS6A 2OUKA 4NH0A 4GCZA 1YRAA 2FOLA 5HR5A 5LBIA 2OOLA 4Z54A 1KMHB 5FOUA 3IBRA 4HATA 3L8YA 2ZS7A 4PXAA 5JWRA 1XJQA 5JHGB 1DG1G 3SS8A 2YKHA 1CS4C 1N5JA 4Q4AA 3BB1A 4QBHA 4PTLA 3SHWA 1KIMA 3B8HA 4WL9A 1OYWA 4EQ6A 2QMHA 2RAPA 4AK9A 1KO5A 2WHXA 1BYWA 2IBMA 2A5JA 3AH8A 4HZUA 5CITA 1DEKA 1R5BA 2V1AA 4M4XA 2PYRA 1U2RA 4C2TA 3HDTA 1R0XA 3ETLA 3ICEA 1Z22A 4HH3A 5BQ5A 1G28A 3THXA 3BORA 5D3MB 1XU4A 4LJ7A 3UWOA 3X1WA 2NO1A 1OYYA 1NVWQ 4F93B 3MQQA 5LB4A 4URVR 2IYLD 1OJGA 2AXNA 2DHRA 2ZS9A 4MN6A 4B3CA 4B32A 1UBGA 1D2MA 3DOEA 1GL9B 4BE7B 1G17A 1FQKA 1E9AA 5FPKA 3KKQA 1FTNA 2FF7A 3VKHA 1AKEA 1E2QA 2P0EA 3IPXA 3QI2A 4C7OB 3PIRA 2NO9A 3N70A 3U3RA 1OTBA 1OXUA 5JSZA 2C2HA 4I1VA 1IN8A 1Z28A 2HYIC 1ZM3A 3TSOA 1ZD8A 1KMQA 2GF9A 4B47A 3SHFA 3GLGB 2V1XA 3U44B 4M1OA 2O8CB 4X8OA 5TVKA 4Q47A 1XNJA 4Q02A 1OIVA 2WJYA 4JVNA 1BMFD 1WP9A 3CRRA 4FMCB 4L9WA 5FUXA 3EZ7A 4Q66C 4XVRA 5HDCA 1CBUA 5A0FA 2FEMA 3NH9A 3SYKA 4MKHA 3HU1A 2OXCA 1CJVC 2NZ8A 3T15A 4P4SA 2ZETA 4PQYA 5IHPA 2ZAOA 2PX0A 4KU4A 3REFA 3UATA 3A0SA 1YR7A 2HLDD 4QKQA 1RKBA 2FNAA 4IXMA 4UNSA 4DDWA 5KSZA 3RTYA 4GPTA 4OQFA 2GJ3A 4OQMA 1R8SA 2KWIA 4BFZA 2ZS8A 4JZKA 4NCJA 1OTDA 1N0WA 4RKEA 3VU9A 1Z6YA 1HE1C 4GT1A 1ZM7A 5DJTA 2V9PA 4BWYA 5EE0A 2DFLA 4TYQA 5HZKA 1RFLA 1LF0A 4PZYA 4ZPXA 5BN3A 1W44A 2PD7A 1ZU4A 3IQXA 3ONWA 4TLEA 4NYIR 4HH2A 4EESA 5SZIA 1V43A 5CDFA 1KI3A 4JGOA 3M1IA 3U7EB 5EP2A 3U6KA 1HT2E 5EP4A 3B1YA 4NHOA 4TT3D 2X2FA 5C4GB 4JLAA 3TJZA 1P75A 2ORIA 5E4FA 1WA5A 1E9EA 1U94A 4PAOA 1ZBDA 3W6OA 3NXSA 1AZSC 2GF0A 4ACAA 3PJRA 3ADBA 4IHQA 4N0DA 3FPAA 5H8WA 2ZRAA 4D0LB 2FDCA 4DT1A 1JJ7A 2GTPA 4GFDA 4NYJR 2VV7A 2BC9A 4QL3A 2OFXA 3F1OB 1EFHA 2FE4A 4EEPA 4PHTA 4CW7A 3U4QA 4OI4A 2O0JA 1KJWA 1XD9A 2RGGA 1Q1EA 4RD0A 2HDNB 5L3SB 2QU8A 2ZR9A 3A1UA 1DPFA 4JS0A 4A92A 4BBVA 4JGPA 1W4BA 4OI1A 1E2LA 3ZVRA 4LV5B 2YINC 3FC7A 3VQTA 1OE0A 4R71A 3K9GA 2VLGA 4HSEA 3VAAA 1KOUA 2XJ4A 2ZAMA 1T5LA 4Q7KA 2QSYA 1XJ4A 4RZ2A 4DLVA 3KQUA 4X8HA 1NVUQ 3HPRA 1BO6A 2CK3A 1LTQA 3LIDA 4H9GA 3FOZA 2R8RA 2GJSA 1Z0AA 1CF4A 2VP9A 4LJ6A 1TUEA 3SI7A 3NVAA 2PEZA 2FN4A 2DFNA 1XD2B 2O8BA 2PYPA 3KX2A 1Q1BA 1YVDA 3QVUA 2R44A 4NCNA 1W36B 1GNRA 1UBFA 2IUTA 2QT1A 1P3JA 1LF5A 5I5LA 1K6MA 1OJ5A 2VP4A 3BC1A 3A1WA 4XWOA 4ZIRB 3GLFE 1S9DA 4LRWA 1GTVA 3HU3A 2D2FA 2QMOA 4UJ3A 4B33A 2QRZA 4Q4HB 3PG5A 4C0BA 1E69A 5B57C 2W58A 3AM1A 4DEYA 4OBEA 2C96A 2PDRA 4PX9A 1KI6B 4F3LA 3IEVA 2AK3A 2WKQA 2F6RA 4RD1A 5B2ZA 4CZ2A 1OXTA 1TPZA 2J87A 2XB2A 2WJHA 2ZJZA 2QROA 4LBZA 4RD2A 3W5IA 1MO6A 4BFSA 1XTIA 3EPHA 2NO7A 3K9HA 5EUMA 1TQ2A 5CM9C 4LYAA 2XTMA 4P4UA 4G5GA 1OIWA 2D01A 4M4SA 4HB3A 1ZIPA 4M21A 4WN5A 4EW7A 2VP0A 3FWYA 4NL4H 2IWRA 3TBKA 1P4SA 1SHZA 3O8RA 2QI9C 3NG1A 1VB6A 5DYGA 3VR5A 1KJZA 4QJ3A 2IYZA 3MWJA 3ZQJA 4LJAA 5AVEA 1KK2A 4W5HA 3W90A 2Q21A 4M9QA 3K70C 1WBDA 2ZRIA 1R0ZA 3GJ3A 3WNDA 4EJSA 2EFGA 3WYFA 2WZQA 4YWZA 4C30A 4A6XA 2WOOA 1G1MA 2AFHE 3R9XA 2AK2A 1COWA 4CEHA 4TSFA 4YMSA 4FWIB 5FOSA 3VTKA 3CNOA 1W36D 1KYIA 4UNQA 2HYDA 4HLDA 3LA6A 4Q01A 4B74A 4MGYR 1G3QA 1S3SA 2OEPA 2PL3A 2OCPA 2F1IA 1ZNZA 1FW6A 3KB2A 2GJKA 4BZQA 4TTRA 1SVSA 1M2OB 3Q9LA 5FI1B 2JJ2D 4IXNA 3FG8A 5EUQB 3OEED 1OT3A 1D8TA 3RS2A 4NCKA 1GSIA 4RY2A 2CMNA 4DCSA 4QC2A 4C0SA 5TMPA 3PHYA 4PSVA 1QHXA 4JT2A 3E4QA 5FBLB 1MRSA 4PHFA 5KDOA 3CZPA 2JJ1D 2J7KA 2NOAA 2HV1A 3C2WA 1KO7A 1KZGB 4CVNA 1L4UA 5JJLA 1YE8A 1Q3HA 3C14C 1D7EA 4BRWA 1G8FA 1RVDA 4AYTA 1FOEB 2V0WA 2C77A 1TADA 2IW3A 4LI0A 1PLKA 2G9NA 1DAIA 2XGJA 2WKRA 1NBMD 1WCV1 4EPYA 3H4MA 2RHMA 3GJ4A 4LHYA 4IEIA 3GD7A 1MH1A 1E2PA 1ESMA 1MABB 4NTZA 5FOXA 1CJTC 3MD0A 4JJZA 3WYAA 1G16A 1NI3A 4C0KA 4M1MA 1X8KA 2XZPA 5LB2A 5FOTA 1PUIA 1E2KA 1NBME 5FUYA 1G5TA 4TYPA 4RD6A 4CEHB 4BBUA 3GDIA 3IBYA 4TZ0A 3DPUA 3T1TA 4LGMA 1RE0A 1W49A 1OJLA 1XEXB 5B58C 2R6DA 3HJKA 2WWGA 3FKSD 3P4YA 3W8RA 1HH4A 1AGRA 4MKGA 1WMSA 2QRNA 3CPEA 3EARA 5AVFA 4YMWA 4GHIB 2V9AA 3QQ5A 4B2LA 1E1RD 3TRFA 4HB2A 4P31A 5DI9A 4LPSA 1F5NA 4GI7A 3D72A 3I32A 4Q9HA 1UWPX 1N2CE 1ZUNB 5AUPB 4D25A 3MG9A 4OHZA 1FP7A 2CLDX 1D2EA 3AVOA 2HF8A 1UKYA 3B1WA 2W2TA 1F60A 2BKEA 2IA5A 3PENA 1EFUA 2J3EA 4GZLA 2JLXA 2ZYWX 3WXMA 2QHKA 3U3MA 1LS1A 2G77B 4BQSA 2A5FA 4G5RA 4B3DA 5FTMA 2F43A 1D9ZA 3U7GA 2J0VA 3GFTA 4M9XA 3QSYA 2QAJA 3K0AA 2BIFA 4URXR 4C3ZA 3JZAA 4PPNA 4DSOA 1T91A 1W2GA 1E2JA 2IYSA 3NC1C 5HPYB 2PX3A 2ZRLA 1ZYUA 4WVFA 5FH9A 3Q7PA 1BYUA 1NY5A 3IHWA 4URUR 1AK2A 5IK2D 3VX4A 1VIAA 5HKKD 3QG1A 1U0HC 1EWRA 1N6PA 2BJWA 3U3JA 4UNRA 2O8EB 4EETB 2X2EA 3MWYW 3AVPA 4JLOA 2CLSA 3SOPA 2GXAA 4I99A 1IQPA 2GJ9A 4AIIA 1SVLA 1UEJA 4I81A 4Q9IA 3TUIC 4D80A 3S1AA 1RYHA 1XBTA 3LNCA 3EXAA 1ZC4A 3O47A 3CIOA 3T61A 3GLIB 4CT4B 2FV8A 4NMMA 1VECA 1SXJB 3O8BA 1AQYA 1F6BA 4DXAA 3F1PB 1KY2A 4HZUB 5KNBA 2H5EA 4IJMA 5G3ZA 1ZM2A 1G7TA 2CJWA 2IXEA 4DHEA 2CCGA 4V0LA 4Q03A 3BFKA 3K09A 3LX8A 1GL6A 1CULC 1I2DA 1NN0A 4IEEA 4UXIA 3GLGE 4DB4A 1E1RA 5HD5A 4LC0A 1NJFA 5KUTA 4M8NE 2P6RA 1R10A 2GESA 2A5GA 1GIAA 1S1ZA 4BLRA 421PA 1OXSC 3M4YA 4TMKA 4BUJA 2IT1A 1VYVA 4A82A 1JAIA 1PV4A 4W5WA 2IK8A 3LQQA 4ARZB 3RHFA 1CP2A 4JLBA 2JASA 2SHKA 4LY6A 1AS3A 1DARA 3RC8A 2V1BA 1MO4A 5E7JA 3ECCA 3LYXA 1EGAA 4AG5A 5E95A 2ZJBA 3RAPR 1P97A 3B1VA 1RW4A 2TMKA 4QBIA 4Q9LA 3KJEA 2GETA 2I4IA 5UKDA 2XZLA 1AJEA 5AJWA 5DGXA 4TT3A 4XT2A 1M7BA 1HEIA 1DP6A 3T34A 2G1KA 4I1SA 5CYPA 2WAXA 2GXUA 3U3KA 3SC3A 4Q1BA 4QJ4A 1W0KA 2XNDD 1UEIA 5IDVA 4H6JA 3NKVA 2FSHA 2GCNA 1JNUA 4NU0A 1DTSA 2XNSA 1Q21A 1W5TA 4L9FA 1QHHA 1JEEA 2Q3HA 4V0NA 821PA 2ZJAA 4HEJA 4JBWA 2UKDA 3OIUA 2IEYA 1EESA 3VE4A 1XFAA 3H0KA 3FMFA 3CPJB 2GA8A 1GNPA 2IYXA 4B3BA 2H7VA 3LX5A 3CX7A 4LLOB 2OILA 1NLFA 1E1QA 4BZXA 3IUYA 1E0AA 3AF2A 3LWNA 3HU2A 1E3MA 3LI9A 4LUCA 1LT0A 4V0OA 4JLNA 2EWWA 5JHHB 2Q9BA 1P62B 4ERNA 4OQNA 2JATA 2WMNB 2NO6A 2Y8EA 4Q1CA 2GVZC 4LK2A 2G83A 4HYYA 4EFLA 3FMPB 1UDXA 2Q6TA 4HJ6A 2BMEA 4Z8YA 4XIGS 5BN4A 3BXZA 5EXXA 3A8TA 1IY1A 1G6OA 2P6NA 2ZI3A 3CO5A 1Y3AA 3RVBA 1ZCBA 4DCUA 4EUNA 3HR7A 1KAGA 4F38A 4GS9B 3GP8A 1KDRA 1VYUA 1ZU5A 2BBOA 4DJ2A 2BCJQ 5CB8A 4DT1B 2K5UA 4AG6A 1ZD1A 4PZLA 2D74A 2J46A 4A8JC 3BFVA 4B75A 4TQ9A 3TH5A 2QGZA 1YR8A 1QHGA 4I4LA 3KJIA 4IRUB 4NPHA 1GSXA 1R5NA 2XOKD 2NPIA 4KV9A 4MKIA 2QPAA 4CT5A 2J0SA 1TS0A 3CRMA 4Q4JA 3X1DA 4DJ3A 3PEWA 2W0MA 4JLKA 4QRHA 4Q1FA 1SKYB 1ZD9A 2AX4A 2ECKA 1CRQA 1GSWA 1KJYA 2EW1A 1AN0A 4MRSA 1OW3B 2KE5A 2HT1A 1S4QA 1W5SA 3UPUA 1E94E 4OJQA 3LIFA 1G41A 1W1WA 2R78A 4V0ME 1FTSA 4EERA 4NYJQ 3SYNA 2QZ4A 1WRBA 1XTRA 1ZRHA 1ODVA 1N6RA 721PA 1EFTA 1ZUIA 2WAYA 3O8DA 2ZRKA 4Z8XA 4IOMA 3NEJA 5GJVC 3A4NA 1KSFX 4H1VA 2M1CA 3IS2B 1HY3A 4HLCA 4JL6A 4PC7A 4IVRA 4LHXA 4XTRA 4D6PA 5GVSA 3MGCA 3J81k 1M7HA 2W6ID 2WMOB 4KCGA 3FDIA 4KFSA 4LJYA 1K5GA 3EA0A 4EQ6B 3PEUA 2FG5A 3DZDA 3TR5A 2ATXA 4LV6A 5F9HA 1XWIA 4P4TA 1M7GA 2FZLA 5JJIA 3MSXA 2ZUCA 2YWFA 3QF4A 3THWB 3H82A 3DOFA 3KTAB 3L82B 1S0UA 4KUKA 3EAQA 3K09C 4JLVA 1T8UA 1RRGA 4V0MA 4QXAA 2IYRA 4JKIA 2H28A 4RSGA 5AUQA 2GNOA 2B92A 5M04A 4GSYA 4U00A 2GDJA 2V0UA 4HAVA 1TEXA 2O0HA 4V02A 4HHDA 4WUJA 4CEIB 1JPNA 2IHBA 3F8TA 4DUGD 2O8FA 2OCAA 2D3WA 3H9WA 2LKDA 5FBVB 3OIWA 4C7OA 5H68A 1D2NA 4GW9A 4Q7JB 1G8YA 2JEOA 4XJXA 4A2QA 1E9SA 2IYQA 2R6CA 1QZXA 2QORA 2CE7A 1M34E 4UQOA 1P7CA 3KQLA 3FYHA 2GVDC 1CR4A 5J47A 4QBGB 3AF1A 2H8KA 2O8CA 4DCNA 2ZE5A 2KSQA 1Z5ZA 3GLFA 3AGPA 1GWNA 5J4HA 4Q1EA 4TLBA 3M6AA 4NCIA 3U60B 3A6PC 1FUKA 1PLLA 1X8JA 1YZKA 3VHLB 2XXAB 4OHYA 3Q5EA 1DBSA 3A4MA 2O5VA 2V4ZA 3DO6A 4M9ZA 3D3QA 3AVQA 4KI0A 1TQDA 2ODBA 2EU8A 3FTQA 4CEJA 2NMVA 2BKUA 2LKCA 2ZRBA 2ONJA 4C0JA 4PC3A 3QXCA 2PJZA 4TLCA 1TU3A 1KI7A 1ZINA 2OSBA 3VR1A 1PUJA 5KNCA 1SVIA 2ZI9A 4TWZA 3CNNA 3IBGA 3CB4A 5HWTA 1EG7A 2PR5A 5EFWA 1E2GA 4ZCIA 3PEVA 5DISB 3DKPA 3A0RA 3AB3A 1T4GA 2HEIA 1G21E 4HDOB 3KL4A 3FMIA 2CEAA 3F1OA 4OHXA 1UJ2A 3PR1A 1AKYA 2CE2X 4FW9A 4L9EA 4I38A 4RQ9A 2FPMA 2QMUA 2VHTA 3GJ5A 2H18A 2ZQ5A 3NBYC 2IF0A 2JLZA 2J45A 1O87A 1OHHA 2R6GA 2IYWA 2ZSBA 3P26A 3DHWC 2KB0A 2Z5FA 3THOA 4C2UA 5A8BA 1OSNA 1G6HA 3ZH9B 1RIFA 2QY9A 3KKMA 1Z83A 4PPFA 2VPPA 4FINA 1GKUB 1F2TA 1JAHA 3EZFA 2JLUA 5DE3A 5BWMA 2GRJA 3R9IA 1JXMA 3CRVA 1E99A 1G4UR 4Q00A 2EFDB 2D06A 3EW9A 2O0KA 3NEYA 1CR2A 3T12A 2WWXA 1IXZA 1F48A 1Z0KA 3I5XA 2Z83A 5F68A 2Q0HA 3QBTA 3IEUA 4ZV4A 1S4RA 3ZGXA 4S35A 2BOVA 1M74A 4M22A 4B9OA 1P61B 2ERXA 4GDFA 3TW4A 5HWVA 1DAGA 4ACBA 1U0JA 4LJ8A 2QEQA 4MDEA 3H2YA 2V7QD 1YU9A 1S1MA 1HT1E 4L4UA 1JI0A 3K0EA 1F98A 1KDOA 4R6LA 2WWHA 3M0EA 2ZITA 1FQJA 3SEAA 3RWMB 3T1OA 2ZYVX 3U6BA 1COWD 2YC2C 1II8B 1KO4A 1VIYA 3LBIA 3I61A 4DLRA 1K5DA 1SVOA 1XPOA 4HNBA 1OFTA 1Q3TA 4F3LB 2AFIE 2ZIAA 4TLAA 5DHAA 3WP1B 2ZUDA 2BV3A 3P4XA 1LB1B 4A6PA 4WIAA 4A36A 4O3MA 2D4HA 5E7IA 1J7KA 2WPDD 5C18A 4WZBE 1WBBA 2W83A 2GILA 5B64A 2VHCA 1GRQA 1YJ5A 4DB2A 2RGNA 4IOKA 5EE1A 4EFNA 1Z2CA 1CKEA 3GJ8A 2PLFA 5HD3A 2IX3A 1XFNA 5JRZA 2GWHA 3ADKA 1A1VA 1N9LA 3EEHA 1A82A 3R8CA 1P72A 4WF0A 5FL3A 2YYZA 3A1VA 3B6EA 4F4CA 1ODFA 5DI3A 2FPLA 2ODNA 3CPHA 4AKGA 4Q4HA 4YC7A 3JVUA 2PZFA 2FFBA 3LBNA 1SVWA 1L7VC 3EA5A 3RANA 2QAGA 3B7GA 2OWJA 2ODWA 2R6FA 1KO8A 2VP6A 2ERYA 4MGIR 1OFIA 1XPUA 4C0LA 3A58B 1XTJA 3CONA 2G0NA 4EKDA 3A4LA 3CX8A 3OEHA 3T06B 1XPRA 1TS6A 4II7A 3OE7D 2PZEA 3NTUA 3LDAA 1RRFA 4L5BA 3JZMA 1ZNWA 3B85A 4DLUA 2OFOA 4G0NA 3WMGA 1S1YA 1ONBA 3RLFA 5LPNA 1FNMA 4PSKA 1PZNA 2QJ7A 3RSOA 4KFUA 1R5OA 1ZM9A 1QHYA 3RSLA 5JZVA 1OT6A 5DKLA 3K8YA 5KSYA 5EE9A 3RS3A 4F4IA 4NYIQ 1N3BA 5CM8B 4A15A 2VH5R 4TMWA 3B9QA 3GEEA 5GVRA 2PD8A 3LXRA 2J9RA 2AN9A 4E07A 1D5CA 4HI4A 4I5SA 1G8HA 2MSEB 2PCLA 3HYTA 2QBYA 2OO7A 3P20A 1E9DA 3X1ZA 3ZVNA 1Z0IA 1X1SA 1W4AA 5SZHB 1Z06A 2WJJA 3V4FA 4LOAA 3TLXA 2REBA 3OAAD 2E87A 5JBQA 5GJBA 4RZUA 1A2BA 1UAAA 2JLWA 2ZE8A 4DLZA 1C9KA 4A8JB 4EFMA 4EEUA 1QVRA 2KJQA 1TF5A 5AR1A 1G8GA 1O3YA 3CKLA 1E6CA 1A2KC 2X8AA 2BHRA 1BIFA 2CXXA 2K7SA 2ZSAA 1OTIA 1IY2A 4O25A 3TR0A 3TIFA 3O8CA 3GJXC 1UDWA 2VIIA 2VQSA 2ZRFA 3OZXA 1E79D 3F5FA 1G7SA 3LY5A 3GFPA 4Q1AA 4NDZA 4BLOA 3FHOA 5ELXA 3P1JA 4D4MA 5BW8A 1LVGA 1KAOA 3TSWA 3I73A 4OL0A 5KTYA 5EJEA 3MQOA 4HJ4A 2YOHA 3K9LA 5JRJA 2OZEA 5JI3E 4EQ1A 2OXRA 3UANA 3NHBA 4MKFA 2RMKA 4EJSC 1BS1A 1ZM4A 2HUPA 3MXQA 2GZAA 1YZGA 1OFUX 1BH2A 2VF7A 5FUWA 1FNNA 5G4YA 1P2VA 1P2TA 1T0HB 2G6BA 2BCGY 5JECA 1OXXK 4OHVA 2QP3A 2WV9A 4ZO4A 1DOAA 1NIJA 1E96A 4Q7LA 1OH5A 3QUSA 1P5ZB 4LRYC 3BWLA 1QHHB 4HP9A 3OE7A 1MRNA 2ZVPX 4PQRA 2O8DB 4MRVA 2AHOA 2AR7A 3EC1A 4BASA 3U61B 1QHNA 1ZVQA 2W0SA 2WBLC 3F1NB 3PUYA 2ZREA 4K81B 4M1SA 5FL7A 4D4KA 2OLKA 3NIBA 1ZW6A 1JR3D 1SXJD 3LIEA 1RJ9A 3QKSA 4OI2A 5AJVB 3AVTA 1ZUHA 3B5JA 3CR7A 2QP9X 3MJHA 5GJCA 5J4VA 1OF1A 2F1HA 4MA4A 4C0AC 5JEDA 4Y0AA 5H1YA 4UNPA 5BN5A 5JI2E 4O0MA 2F3TA 5F6AA 1TF2A 1DS6A 6Q21A 3SQXA 5KPJA 4WXPA 5JFGA 3T5GA 1CJMA 5L3RA 4GHIA 3RRNA 1CXZA 1OT9A 4PAQA 3Q7QA 2GZHA 1QG2A 4QJ5A 3ZIAD 1UF9A 4M1KA 3IQWA 4KHZA 3CUEF 3N2IA 4LHWA 5FPTA 2ZRJA 5IT5A 5JS8A 4WLAA 4WAUA 5G41A 5DJUA 3W3ZB 1ZJ6A 4H1UA 5FPYA 1GKIA 2WIBA 2WWIA 4QHYA 3GCGA 3MWKA 3OIVA 1V9YA 1DG3A 5HWWA 1XZPA 1T1BA 1P73A 2P2LA 2ZJOA 4IVPA 1TAGA 3TQCA 2C9OA 1E0SA 1TX4B 1DAMA 1MKYA 2B21A 1IN4A 1NMZA 1W0KD 1IN5A 2EWVA 1CTQA 1XCGB 1GUAA 2JLQA 3D8BA 3KXLA 4BFYA 3RRYA 1XCMA 4BLQA 2ZXUA 3G6OA 4DUGA 4JLDA 1NN3A 1E4YA 2QWSA 5KYKA 4B2IA 3GJ7A 3ZYCA 3R8FA 2V8OA 3NJAA 3EZ2A 3Q5DA 2UZ3A 1IN7A 3BY8A 3X1YA 4YONB 2WOJA 4L16A 4ZDIA 2QM7A 2ZANA 1JQJC 4EXOA 4X8MA 2Q9CA 4BFWA 2ZM5A 3C41J 2AD5A 4DSTA 1Z07A 4FN5A 4A2WA 1X6VA 3FHTA 1G3IA 1E9CA 1CJUC 2EYQA 2BEJA 3SBDA 2F1JA 3D6TB 3NDBB 3AKCA 1RRPA 3SFVA 4JLPA 4HQAA 1AGPA 4PKYG 1S67L 4O2RA 4JGQA 4POAA 3WNCA 4PC6A 5L3QA 4F92B 3OFND 1CIPA 1IXRC 1GG2A 1EFRD 3QF4B 1AIPA 4R38A 2YKFA 1V5WA 2L4RA 2VYFA 2WWFA 5J3WA 1ZC3A 3DM5A 4GOXA 1YKSA 3WBJA 2NTYC 2XNDA 1YZQA 2L0WA 5HZHA 2CHQA 1DP8A 2J5XA 1R7RA 2ZRHA 2CCJA 3P27A 2FA9A 3VNVA 3B9PA 2RB4A 121PA 2H17A 4TTPA 4DDUA 2W2XA 2ZYTX 4LJ9A 4TYYA 3DDCA 3DMDA 1GAJA 2ZI4A 4UJ5A 2NG1A 2IYUA 2OBNA 1ZIOA 1OKKD 3C16C 4KYUA 4MGZR 3AVYA 4A0HA 4RKFA 4MYUA 4RZ3A 1CRPA 3X1XA 3NHQA 3G82C 4IOJA 1GSVA 5JMTA 2OG2A 1NP6A 2CHVA 2JIZA 521PA 3TK1A 3QIAA 1XXHE 2WJIA 4O2LA 5DLQC 5DNYB 1YR6A 1OH8A 2KBFA 4WZAE 3ZZUA 2C03A 4A4DA 4DSNA 5DYIA 2L1MA 2GBLA 3D7MA 2ZJ5A 2HJVA 1MT0A 1VCIA 1VG8A 4WBSA 1UKZA 2ZRDA 1WF3A 2D02A 5FBWB 5G53C 3L0OA 1R2QA 2ZR0A 1OV4A 3EG5A 1Y63A 2REXB 2H1LA 1QDEA 2F9MA 4P3YA 5FPHA 4DEXA 3R9WA 3AEZA 2VSXA 3LBHA 5KPDA 2PHYA 4GS9A 2CHGA 4PHGA 4Q1DA 3ZDQA 4RCYA 2PT5A 2JHEA 1T3HA 2IXGA 4AURA 4DLTA 2IYVA 1DP9A 3FFBA 1YHNA 2OWHA 5C46F 5L3QB 3ICQB 4HDQB 4B3FX 4Z51A 1X0OA 2ODEA 1SZPA 3BOSA 1E1QD 4A2PA 4IVQA 5D3MA 5TY0A 3ULFA 2P7JA 3ASYA 5SZKB 4KBGA 3LXXA 2VHJA 1ESNA 2B7CA 2ZPTX 3CF0A 5IU1A 4DRZA 5JWOA 5TV2A 5KSPA 3AP2A 3QKTA 2IUUA 3SR0A 3GLFB 1XJ2A 1QHSA 4L8GA 1XP8A 1U8AA 2XXAA 4FI3C 5G40A 2XX3A 5K8UA 5CIQA 2A5DA 2FSIA 1P2SA 1P9RA 2C04A 2HCBA 2OLJA 3SE0A 3TVDA 1FX0A 3CF2A 1B23P 2BMDA 4QBFA 3SZRA 2QTVB 4KAXA 2QE7A 4DIDA 1JALA 4GOKA 4EIWA 2O8BB 4PPGA 4P33A 1MZUA 4B6FA 5K8LA 1Q57A 4R70A 1ZNYA 3PITA 3EZ6A 5JSZB 3BH6A 2Z6DA 3CWQA 4LBWA 4ASUA 1SULA 4EAQA 3QNUA 2ZRCA 1MR3F 2BM1A 1Z6TA 1Q1QA 1R4AA 2AWOA 5BYKA 1XJ0A 2DWOA 3HPQA 1IOZA 4GL2A 3FB4A 1X3SA 4P4SB 3THWA 1RZ3A 1T8TA 3AF0A 4XD7D 3V4RA 3TSZA 2H92A 3ND9A 2QM8A 1KOFA 4B48A 3I1FA 2W2VA 4RJLA 3A36A 1HA3A 1W0JA 3BWDD 4OQLA 4ZKDA 3VU9B 4CEIA 3UB9A 2ZJ2A 1TEVA 2MSDB 2IS4A 1W4RA 1E9BA 4LHVA 3IS2A 1Z6XA 3ND8A 4XWAA 4NZYA 1KHTA 2VA8A 3W34A 1DAEA 1NVXQ 1KI8A 4CF7A 3BS4A 1SQ5A 3W5JA 2DBYA 4OQXA 3FFAA 5TARA 4ZCMA 2ZI6A 2QT0A 3BAFA 1CR1A 2QE7D 3IO3A 2WWYA 3IO5A 2EA9A 4OK6A 2I3BA 2JJ8A 4A0FA 1XMVA 3PYPA 3FGNA 4L15A 3U7FB 2RCNA 5KSOA 3H82B 2GEUA 3QVVA 5TDHA 4E22A 4M53A 3ADCA 3EWSA 5CLQA 1P6XA 3WY9A 3Q85A 1M8PA 1YRBA 2NZJA 2ORWA 4HDCA 3SN6A 1AQUA 4KO8A 3UIEA 5E7MA 5B30A 5F9FA 3LLMA 3KXIA 1NVVR 2WJGA 3CBQA 4B35A 2FFQA 5J4KA 1VHTA 621PA 4BFVA 2J0QA 1E0JA 2JLVA 3QXXA 3X2SA 2GZDA 1MO3A 3K9NA 4DZZA 2F3RA 3CZQA 3IILA 3ZVMA 3TNFA 5HDDA 4ABYA 1FL9A 2JJ2A 4KVAA 3NC0C 3PXGA 1KK3A 2FGKA 5DIFA 1W2HA 4FMBB 4LBYA 4AI6A 1NF3A 1KDTA 2YKGA 2LCFA 4LV8B 3THYB 1TMKA 4BLSA 3BERA 5FFMA 3T1QA 3EIHA 4YMVA 1NN1A 1N5LA 1VKJA 2OBMA 2DCUA 1D9XA 1NL3A 3QE0A 3WNBA 4I39A 3KQKA 4C9BA 2ZRNA 1N25A 3F3YA 1L8QA 4GMDA 3RS5A 3CW2A 4M1TA 1DELA 4WW0A 2ZRPA 4HIAA 4IDQA 2YOGA 1V9ZA 4QGFA 1G5PA 4KODA 4UXJA 3VR3A 4JLJA 2QL6A 2EFEB 4D81A 3K1JA 3CNLA 2DYKA 2VBCA 1XJ6A 2W27A 1A5TA 1KY3A 2ONKA 1OIXA 2A5YB 1HQYE 3AKEA 4HAWA 1ETUA 2AL7A 4ESHA 1RC8A 4Q7MB 3BK7A 2GK6A 1UFQA 5KO2A 4G01B 4V0KA 1XRJA 2XTNA 1NVVQ 2HCJB 4QG7A 4JGRA 4BLPA 3GMTA 2IWHA 1ANKA 1G3MA 2XSZD 3MR0A 4QGGA 3DZ8A 3W9YA 3MJRA 2CK3D 4XOIA 4IKEA 2VV6A 4EJSB 2A78A 2C98A 1UKVY 4Q18A 4E5UA 2ZRGA 3LIAA 3TAHA 2PH1A 2ZOIA 1OTEA 1XEXA 4HAYA 1Z08A 3QKUA 4B2PA 4LYJA 1S8FA 2UVQA 3IIJA 4MYCA 1PLJA 1SVKA 4DLSA 3ZIAA 4MRNA 2YWEA 4MUAA 3W6PA 3IGFA 4JVLA 2QNRA 4MYHA 1EK0A 4N3NA 4YLGA 5FI0B 2OM2A 1WA9A 4DVGA 4TN1A 1RPZA 1NWZA 4NYMQ 2J80A 4JSTA 2P5TB 3L2OB 2QTHA 2WWWA 5EXPA 1XFQA 1AS2A 2ZJ8A 3K0CC 2MSCB 1Z0FA 3I3SR 3CWFA 2QAGC 5J40A 3SU8A 2H57A 3CRW1 1B0UA 2ZR7A 1D06A 1P9WA 4RVCA 2VEDA 2IHYA 1E9FA 4NXBA 1N6LA 1NG1A 1SXJE 2GJ8A 2R9VA 3FKSA 2ZBBA 2C8VA 1G8PA 1R0YA 2AXPA 3OEHD 2FX3A 2ZYUX 1LNZA 1KI1A 4URWR 2BJVA 4TL6A 1SVMA 3WMFA 4R7ZA 3U4QB 3KJGA 1ELOA 1KTVA 4F91B 5CYOA 4D2IA 5H70A 3GQBA 5P21A 3AP1A 1I4TD 2YVUA 4KQDA 1N6NA 2VP5A 2O8EA 1NMYA 4I3JA 4PFSA 1XF9A 3UMSA 3VR2A 2CLCX 3CX6A 4TQUS 3ZJYA 3I62A 3GECA 2CVFA 2VSFA 1OH7A 4TL8A 1G7CA 3E70C 4D82A 4EPXA 1T1AA 3E1SA 3FHCB 4DDTA 4XVUA 4IDPA 4B6EA 1OFHA 1UADA 2FMXA 1H8ED 3PFIA 3T35A 1SXJA 2XZOA 1I4LD 3C5CA 5IF9A 1HTWA 3KKPA 3LFUA 1HURA 1RJ9B 4YXWD 3DVLA 2BMJA 2PMDA 4HI0E 4KYIB 2IS2A 4QNMA 5F2EA 3RC3A 3RNLA 4NKRA 3LQRA 2PT7A 3B60A 3EPJA 2YJTD 1GM5A 1EXMA 2OESA 4JJKA 3SDZA 1WXQA 2XJ9A 4FCVA 2PR6A 3UMEA 4HLUC 4KLNA 4OHWA 1E79A 3KUDA 3AUYA 1NKTA 1WE2A 3GEHA 4AC9A 1MO5A 1G18A 4ARZA 3VKGA 3LD9A 4JLMA 2BASA 2B8TA 1S96A 1UM8A 3IPYA 2GEVA 2IC5A 2JJ1A 3RS0A 2W0NA 1VHLA 2XITA 2RGAA 4FMCF 4I3IA 1KI6A 1EX7A 2GBLC 4A0GA 2F43B 4PC2A 1YZNA 1IXSB 5AK0A 3FE2A 5BYJA 1LS6A 2J7PD 2XB4A 2GXSA 1OPXA 5F3WB 1W36C 4GMXA 2IXFA 4M2LA 5HTKA 1OHHD 5J7EA 1EFCA 3T50A 2ZI5A 4F4JA 4HUTA 2WSSA 1IN6A 5HE9A 4DKXA 4DCTA 4J0QA 1S66L 4M0LA 3WP0A 5F5YA 3QY0A 3NOTC 4HAXA 1SXJC 4R3AA 4X8LA 2CDNA 2OAQ1 4U5XA 1Z8FA 3RWOA 4IDHA 4H6JB 3SJAA 3KX0X 4GP7A 4QOSA 3UWKA 5A5GA 3MFYA 4EDHA 1G64A 2WSMA 1UGUA 5IS1A 1F9IA 4XSGA 3PVSA 2IUSA 4DLXA 5FTLA 1N0UA 2G88A 3K0FA 1S2MA 3C15C 1S4SA 1L4YA 4BPBA 3S1AB 3QENA 4GP6A 4C0QC 4YMTA 2J59A 4DBLC 2ZROA 3BH0A 2RGNC 3A1TA 4Y0VA 4OK5A 3TKLA 2QQEA 3UG6A 2GK7A 3GJ0A 4P0TA 2BM0A 1GILA 3TUZC 2A24A 3HJIA 3MAAC 4LWZA 4NCHA 4D4JA
chains in the Genus database with same CATH superfamily
5GZ3A 4XSVA 5AXCA 3VH1A 4ZQIA 1XK7A 3P7NA 4NNOA 4YMGA 3K0SA 1ISRA 1E2FA 3C6XA 1QGAA 2AA3A 1TK9A 2C3OA 3LGOA 4L4XA 3AG6A 1IHUA 1KEVA 2QTBA 1ZMXA 3OAAA 1QHIA 2VUIB 5K0EA 1SBIA 4RX3A 4TTAA 3IAUA 1XMJA 5I9MA 1IEQA 1H8HA 2X0FA 2XD5A 1DXHA 2YH2A 5K8CA 2HJ9A 3DOHA 1SHJA 2GARA 4P3NA 3GRYA 3K4QA 4YCCA 4FN4A 4M88A 3NBXX 3I39X 5F1OA 1YQTA 2HA2A 1JZSA 4A91A 1AA9A 1WQ1R 4OKNA 3GGGA 4H7IA 3EPLA 1HWYA 1LL8A 2BD0A 1UOEA 2E7ZA 4FYXA 1ZSVA 3GYGA 3MIIA 4EGQA 2FZGA 4YALA 3CB2A 4C1BA 4F5WA 2OWDA 2Q6VA 4MP3A 3ZC3A 4PC1A 1M2HA 3FPFA 4ZV7A 3LIBA 2VJMA 1O97D 3C5WP 4X97A 4HDKB 3PX7A 3HCWA 2X02A 1MB2A 1X1DA 5DX8A 3ROZA 1R1DA 3GCZA 1ILWA 3K2EA 2VV8A 3IHBA 4E3KA 2C5SA 1QJ4A 2DULA 3CUVA 3LRPA 1K54A 1NQXA 2GZ2A 4Z86A 1QYCA 3JQ8B 5F98A 1AV7A 2W6JA 5I9LA 3I23A 2RH4A 1MJNA 4K9DA 4MDFA 1HFKA 5EXTA 4XYMA 1FMJA 1JB9A 1W1IA 4U3TA 3EXFA 1Z8HA 2BBSA 2BM8A 3ND6A 4KG7A 2C2WA 8ABPA 1EWQA 3PUHA 3TRJA 3U5ZB 3GLHE 3C3MA 4BAZA 1Q0UA 3BY9A 2R85A 2V3CC 3KYQA 4G4GA 5FOQA 3SJZA 4MRRA 2QTVA 2CVHA 5KKAA 4R1QA 2HO5A 3OLOA 2K4MA 1VYTA 2A7QA 4XT2B 2ZSDA 4LX0A 4ROSA 3PX3A 1CJBA 4FOTA 4F11A 1LL9A 3E7WA 4LGCA 2RL3A 2ALJA 3CURA 4L5AA 3T99A 2NUTC 3AJ9A 4B34A 3LLVA 5F2OA 2ZTSA 2DPXA 1O9BA 3QV1A 4ID4A 1U4OA 1T1SA 4PM8A 2JRLA 2EDCA 4L3VA 5DT2A 5DCLA 3W79A 4O2AA 3R7WA 3V4LA 1NI5A 3T6KA 3PUZA 4YRSA 5JYOA 4ZOQI 1F0KA 3WXBA 4Q37A 4XQCA 2GFHA 4L4SA 4XZ3A 2A58A 2VEAA 2TMYA 2F1RA 5ECGC 1O0SA 1JX6A 1VJDA 4S2KA 2B8WA 3L0IB 3UPNA 1LU9A 4DIEA 2JK1A 4EY8A 1N6HA 2NT3A 1XEWX 5H0IA 3KPJA 1MOSA 2ZUUA 4U2FA 1WV1A 4LC9A 3SLGA 3AGFA 2PGIA 3KKOA 3GXOA 3RRMA 3OFNA 4P3OA 4FLEA 4L51A 5DM70 1DC3A 3IKJA 2WKSA 3LR5A 4QG3A 4JKOA 3SS5A 2QYBA 4R1PA 1FFHA 4MH0R 4DMHA 1UXHA 2RDMA 1NPDA 1KVLA 1U0OC 1VMAA 4X69A 2J3KA 3N5CA 4O4LF 5JMPA 1KO1A 1ZJ5A 1V2GA 5HBGA 4W9RA 1GGNA 2YJGA 3KJHA 4HJXA 1OWMA 1ULAA 2VJNA 4A9AA 3AXSA 2ZMVA 3I8SA 2Z3WA 2WZCA 4IDOA 2HU5A 4HUQB 1JYFA 4NBUA 4WEQA 3TECE 3PQCA 4ZK6A 1ML3A 4G86A 5BN4B 1FMLA 2YWGA 1NMEA 3DR3A 3H75A 3IEIA 2YCLA 1Y4DE 3R3YA 4I5EA 1RPTA 2ODPA 4P83A 3ZNQA 3JZIA 4XVQA 1AOXA 1PI5A 1U1FA 1X19A 4BD0A 3Q7RA 3B3FA 4BV3A 4WKOA 2MMCA 4FNMA 4LGYA 3RRFA 3DBRB 1E2IA 2Y91A 3TXXA 1OLOA 2CHEA 2QG6A 1H2AS 4JT4A 3D4PA 3F6RA 3KK0A 4N0PA 3CLTC 4RW0A 4I0WB 4ZEMA 1C1XA 5E6RA 4I5FA 4Z7JA 4TX1A 5JRDS 3PJFA 4DC1A 2F4VB 2O9BA 1TTQB 1TCCA 3W5HA 3KFXA 1K8XB 1W79A 4UPVA 5E1MA 3VDQA 4D57A 4BVAA 4BP8A 5AJGA 1DT5A 1GPNA 1PR2A 2CHUA 2CJFA 2UVPA 5F64A 3QFTA 3THYA 4W5NA 1NP3A 2UYQA 3HI6A 4LX8A 3V1LA 3NNDA 5CIWA 4EEXA 1AZTA 4YPVA 2QN1A 1DLJA 4KBFA 4KFTA 2KHZA 5KYXA 2JH3A 4N8DA 1ZMBA 2FJUA 3UT5B 4EABA 4JT9A 2VFAA 4BFTA 4OOFA 1HYQA 2CZGA 3DDNA 4QFMA 1MY8A 1EK5A 1V35A 4JKYA 4OY3A 3HXTA 3OP4A 1FMCA 4RK6A 3P2IA 2UUAB 4UAVA 3OQ6A 4UNIA 2YFQA 1C50A 3H42B 3E5RA 4F5DA 2WP8J 1QWOA 5AK6A 2NUTB 2QW0X 4B3JA 3GUZA 5COQA 1JAZA 2LE0A 4K08A 3QNBA 3MB5A 3TO5A 1YZFA 4BWFB 4EHDA 3RIEA 4Z9FA 5K3OA 1II0A 1QS0A 2E9SA 3ZEAA 2Y2LA 1Q1NA 2XUJA 3FOWA 3MCVA 4IQ8A 4MQBA 3V2GA 4EA9A 2UAGA 3KEMA 4I1UA 3DAYA 4U39A 4NZZA 1G5IA 4OPYA 1E89A 3QIVA 4MRPA 1YJBA 3UJ7A 4JOSA 1U9IA 4PGAA 1ACMA 2O3JA 3MYRA 3W7BA 1GL3A 3NGLA 5JSYA 1M0WA 3T38A 1W29A 2V3WA 4E5YA 4TV8A 1TUIA 2X4IA 1E0KA 5B1DA 3BMQA 2ZUSA 2WGWA 4MITA 1QP0A 1NAHA 3RLIA 4TTQA 1GL7A 3COYA 3Q9SA 1I14A 4QUIA 1VLMA 5EFOA 3ULKA 2HQSA 4II2A 3IESA 2VOEA 2Q0SA 2CXRA 1RI3A 3GJZA 5EAIA 2XTZA 3T95A 4BGDA 4NE2A 4IBXA 1DU4A 1QIJA 2DCMA 1I5RA 4O4IF 1YNOA 4HAIA 1YB6A 3WAGA 1WS6A 3SEQA 1OH6A 2D8MA 4ZZIA 3TGWA 1TU4A 3LX4A 3STVA 4UASA 1YJAA 3MWEA 2YIMA 3SQLA 4AXBA 1HNWB 4AWXA 4E31A 2JCHA 2LIPA 1BMFA 1LNQA 2NAPA 1OA1A 3FMOB 4MW0A 4DGSA 4EITA 1O94A 4IDNA 3ADDA 3PL1A 4KE9A 4LNUB 4UM9D 3WK5A 5BUZA 5KOJB 5KWIA 2H11A 2LDXA 4V03A 1HL7A 5AJZA 4ZI2A 1MPXA 4JR0A 1SOWA 1WF6A 1SR8A 3JVDA 4QUDA 3O0TA 4RFSB 1K4FA 3E05A 3W7VA 4KGVA 4M87A 4QGHA 2QTZA 2QJRA 1W0JD 1SKFA 4E09A 5JSUA 2BP7B 4F2GA 1YB2A 2I80A 3G0BA 3CEPB 1K56A 1XHLA 3PC3A 4Y6RA 4GOLD 5LLDA 1EQ2A 5WRFA 1VI2A 5HOQA 2FGJA 2QJTA 4LCBA 3WX0A 2GZSA 4IJGA 4C7BA 2B5RA 4F2WA 2NUTA 4X20A 2G1UA 1A8HA 1V8DA 2I7TA 2XVAA 4D9NA 3QEJA 5EP1A 4A0RA 1AKVA 3OM8A 2QYTA 2ZB4A 1ZEMA 4D6YA 2BKAA 2OBLA 4MVJG 2DFKB 2BTFP 3V8QA 4B44A 3EDMA 3HNOA 3ZX5A 4MR7A 2Z8YM 1KGDA 3G9QA 4WCDA 2IIPA 3V80A 5K99A 1SXIA 5E3IA 4EHIA 1G8KA 4MPTA 5JZSA 4RA6A 3H84A 1US8B 4FFPA 4EBLA 4U6NA 1K97A 4WK4B 1XMIA 5EWJA 4IOLA 4OJKA 5EECA 1JMYA 3OY7A 1KH1A 5H3CA 3UE3A 4URYR 1G291 3F2IA 3QU2A 4Y7PA 2CL7X 1KVRA 2C9YA 1GUDA 2EKBA 2X3FA 3EGOA 4OHCA 4P6ZM 1TF7A 2C9BA 3VNUA 1O6ZA 4RWZA 2QA5A 2CV0A 1NP7A 4Y67A 1II8A 5CA0A 1NJ4A 1L4EA 4JP2A 3RI3A 3D8HA 4P0QB 2F8TA 1ZCZA 1GTZA 4GI2A 1IG3A 1ZW1A 3TW8A 2B5VA 3EQ7A 3RS7A 3TTYA 1VSUA 3U5TA 5FA6A 3U39A 1GCGA 3EZGA 1KYWA 1DO2A 5KQSA 1C29B 4F7WA 4RYLA 3AM4A 3UAXA 3E2LA 2YHIA 1R0CA 1PG2A 4EENA 2B61A 5AVZA 3HA2A 5A71A 5GOTA 4TMYA 5ANRB 3MGBA 4G26A 3GJ6A 2BM9A 3G32A 4Q16A 1J25A 2WU8A 1CCWA 4ENVA 1S1CA 3QUQA 4OHBA 4U7TB 5K51A 1E6WA 1DBQA 1QQTA 1VM6A 1XZIA 3FOCA 3IHAA 3IV7A 1JVJA 4KTVE 4NV1A 4JU9A 3KQHA 3AUXA 4HTAA 2I7VA 1AKWA 4HCJA 3OP1A 1WB9A 2AI3A 3A3IA 2JA1A 2NVUA 1YDEA 3UXMA 1U5AA 1ZAYA 3ISGA 1BRTA 2ODTX 4S05A 4UEQA 1W52X 4WZ6A 4MVWA 4E0BA 4EOGA 5FTJA 1GQFA 3B2EA 3QYAA 2JFFA 4KIWA 2XMZA 2QK4A 1BEUB 1E4EA 3HL9A 4Q8IA 1YBVA 3NRJA 5CAEB 2IZZA 1KE2A 3FYUA 4NK5A 1O57A 3GFBA 2I9VA 1W48A 4LZOA 4QHSA 2A9VA 4RCZA 4EGCB 1GRCA 4GOJA 4JC4A 1Z38A 3R40A 2FPKA 1J2TA 3KDSE 4IX1A 2ZBRA 3UPDA 2XIQA 3NIFB 3LICA 4D9BA 4EH1A 3JY6A 3M6UA 2WYVA 1U3TA 2KX6A 2M6LA 4EJ6A 2VJOA 4HX5A 4HP4A 1ORWA 4FS8A 4EUZA 2FZ4A 1ZOOA 1U98A 2GJ4A 2QN2A 4K3VA 2Z3ZA 1CHDA 1H3FA 3RS4A 3IH8A 3LW7A 2HRDA 2QAIA 3BFFA 3H5RA 2YC4C 3WKAA 1T2DA 5ALYA 1SG0A 2PO7A 2QZJA 5EXDA 3BYZA 4QJIA 3AC0A 2EL7A 4JB8A 1LLUA 4I8IA 4KQXA 4B4UA 3ENKA 5LZ7A 2AG8A 3E22A 1FSSA 4N9QA 1T9DA 1G8AA 1U99A 3TW8B 1XELA 4HD8A 4KR6A 2NYRA 4FT4A 4ZVPA 1FPMA 4ILEA 2O4CA 2Y4AA 4ZTKA 2VBGA 5DRTA 3MHTA 2B36A 3HUNA 4J7CA 4E08A 1VCNA 3U7IA 5T6MA 2W42A 4BV8A 3EE6A 5E2HA 4ZOEA 2QAGB 4WK2B 3ZJUA 2VX8A 3QP1A 3CWZA 1JJVA 1J90A 4K6OA 4HNTA 4LF5B 5CX1A 3BGWA 5EVIA 3LBYA 1OWLA 3BL8A 2WFLA 1LL5A 3WLLA 2JBWA 4I1OA 2Q5FA 1W0CA 5LD2C 1OBOA 1Y9JA 2OSVA 1G2PA 4HBGA 1O0CA 4HGQA 5LP6A 3I2JA 3HVHA 1T0IA 1AU9A 1L1RA 2YOFA 3KYCB 3N0TA 3T9DA 1W85B 1HRKA 4EHKA 3RYCB 1IPHA 1MB9A 1ZHHB 1YCHA 3P0RA 1HTZA 3KSIA 2OP1A 1SHLA 3K53A 1NJGA 1XHEA 3LW8A 4J7AA 3CH4B 3A1SA 1CRZA 3O3MB 2XEXA 5EESA 3IH5A 3VVCA 2B78A 2WA2A 4LSGA 5BR7A 1SBQA 1XKZA 2H4FA 4PLYA 1R6BX 2A14A 3KSUA 4Z1WA 3G9XA 5E2IA 4NSNA 2VPYA 4Q4LA 1UWNX 3TI9A 3AKZA 3KR2A 1LSVA 2ZAYA 3GLUA 2OLVA 3QEOA 1A5SB 1JR3A 2PTGA 1PS9A 2XE7A 1O77A 3P32A 3ZWXA 4RZSA 4E30A 1HV8A 5G1OA 2B6HA 3HJFA 3K9BA 2X01A 4AYXA 5TEVA 1CLEA 3CF4G 1PKXA 4FQ5A 4F3TA 4AN4A 3NOUC 3URMA 1CRWG 2VT2A 3IIMA 3VKWA 2Q4TA 3L7MA 1IYZA 4EO4A 1CY7A 4PYLA 3D1VA 4K86A 4PPQA 3SF8B 2Q07A 3FBWA 4TSFD 3C48A 4TLMB 5ETJA 5F5XA 3UWKA 4YV2A 1NPTO 3NHRA 1KP2A 3LCUA 4RZXA 4YJFB 2PUBA 1F5SA 3F4LA 1DAPA 3LIPA 2IKSA 4N7MA 3PGA1 3WWEA 4AF6A 3HI4A 1L0GA 5E2EA 2X4LA 1BZAA 2BF4A 1U8YA 4PICA 3HYRA 1JW9B 4FFSA 5BYBA 4Q05A 4D9JA 3NCHA 2CNLA 3LGSA 3LYHA 4M46A 4AS1A 1R66A 2WE7A 2ZT7A 3RHTA 3CXRA 3LP6A 5DTJA 4DQ0A 5KQRA 2QJOA 1S2LA 4P82A 5REQA 4HVCA 3FYUC 3ELWA 4JIGA 4PS0A 1WEKA 1GA9A 1J39A 3A0VA 2P0YA 1VYHA 3A6LA 3O8OA 4HJ3A 5FDHA 2AFHA 2CLMB 4LYEA 1P0FA 1EGHA 3VH4A 4AO6A 2HV8A 5AW7A 4LKOA 1T8YA 5JCZA 1PFYA 5JYDA 1VG1A 4BMNA 3HCOA 3VR6A 1BAPA 5JNRA 3C2QA 1D03A 1V47A 2K7FA 4JEUA 1LFDB 1LH0A 1A4IA 1TO6A 1Z6GA 2APJA 3DT9A 3L3BA 5FAKA 1U9YA 2QLNA 4AF8A 2C7VA 2Q2WA 1ICEA 1XXHB 1NUUA 5I7RA 4MV0A 2RGEA 3MINB 5KAMA 4NF2A 5KNBH 3QPWA 2F1KA 2QI9F 4M1YA 1T1EA 1LBIA 3CPSA 2X5XA 3PQEA 3BLMA 3WNZA 1DJCA 4DE2A 3AR2A 4UDYX 1DE0A 1XTUA 4K88A 3VP1A 4RJIA 3LLUA 5IXSA 3VP3A 1OTXA 5I7OA 1FDUA 2PZAA 4O1HA 3CV3A 3GG2A 2R1TA 4BAUA 1N5IA 2BJHA 2IYPA 2PVPA 3K3CA 4RDHA 4HLUA 3EBLA 5EWMA 3RUFA 2QUZA 4AFNA 3UN7A 4GR5A 1ODCA 5LOVF 5FQOA 1QFSA 3TPFA 4DZTA 2Y68A 3UG7A 3CLOA 2M98A 2A9JA 4YMHA 3KZKA 5BV0A 1Y4ZA 1ZY2A 2PU7A 3UK0A 3MJEA 2NPFA 5AW0A 1UWCA 1AXEA 1WVIA 4EI7A 3F5QA 4KPFC 5ALXA 4KIGA 2CNWA 3OESA 1E25A 1XO1A 2VDQB 4PNZA 1TS7A 4XQEA 3G2YA 4FTXA 1MABA 1Y9AA 1KI4A 4MV5A 4OB6A 1BT5A 2HHCA 1GT6A 2VUSA 2WM9B 3K9QO 4E2ZA 2PXXA 3GRPA 4WESB 1KNXA 5B3JA 3V48A 2IWCA 3DW1X 3PFFA 1P9OA 3KZ1E 1HLGA 4C29A 3O93A 1E2UA 4CKXA 1H8HD 4CLCA 1Z39A 2VHQA 1RRCA 1E2HA 2W70A 5A6SB 3F5SA 4YGYA 8OHMA 2GGSA 1EX6A 4MJLA 5FXMA 3T5BA 2QUIA 3E58A 4W1RA 2JKVA 4GSLA 4CGYA 4F21A 2SKEA 4MVJA 1NBMA 5JXIA 3TGPA 4GD3Q 4YO7A 4P0PB 2DLCX 2A94A 1F2UB 3MWLA 4WXRA 4MMNA 2VRNA 2EXAA 3ESXA 4Y9UA 3PBRA 2CJWB 4OKSA 2YMLA 4BMSA 2V6IA 5I7FA 4UNNA 1FDSA 1QIEA 3T7EA 2Q4DA 3BKWA 3JQPA 1A7JA 1NY6A 2PLRA 5K0SA 1D6JA 5IT9A 5ALLA 5F7OA 1HSOA 4P4NA 3CMZA 4QBTA 1SKMA 1FSYA 4L9GA 1PX2A 1L2TA 4C5BA 4JXSA 2EP8A 3LY3A 3IQHX 3TLAA 5DN6D 3VAYA 2BTOA 5TJHA 1FSPA 3E9YA 5AMXA 4NONA 2B35A 1DJQA 1ORDA 2NQ8A 2QOEA 4JMLA 3MTAA 1ML4A 2R6R1 5I8PA 1MHTA 5AOAA 4Q9DA 4UHUA 1Z0JA 5DXAA 5AUNB 2GPTA 1AUPA 1LBEA 1QAQA 3LJKA 1H22A 4S2EA 4DC0A 2CL0X 2WFMA 1K38A 3DL0A 4CDRA 5T6BA 3K0AB 3WRZA 3PTZA 2ZYRA 2JCVA 2O9CA 3N2EA 1EZZA 4G5QA 4KK3A 1IXKA 3SW1A 2FWAA 1IOUA 3REGA 4E70A 4XWKA 5JCPA 3D5TA 5K8IA 4WY2A 2VHUA 3SVLA 4M7OA 2Q0OA 2QUBA 1XVAA 2HP9A 4ESEA 2O1EA 2AE2A 2J67A 4O0PA 2X41A 4RH0A 3ZGNA 2RI0A 5G18A 4KLCA 1ID1A 4Y2UA 1ZPDA 2W1RA 1OREA 2IIQA 1H0HA 2VLBA 4HDKA 4ZYLA 3VNQA 3T1HB 1TTTA 2H2WA 1MU0A 1OOEA 2B2NA 3DMGA 3VJKA 1R0SA 1R27A 1UPBA 1P1CA 2ZQ8A 3C6YA 3CX3A 4QTZA 4PRZA 3BB3A 4U02A 2QD3A 4X1IB 4DMGA 4YUWA 1R3UA 2FUG1 3TZ6A 3OZFA 4WQMA 5CDGA 3D6AA 1J00A 4EVQA 3IB6A 3HWWA 3L04A 3KFLA 3QKIA 1QTIA 5DF9A 2YTZA 3WE7A 1G4AE 3ZZNA 3EXFB 1SUWA 3O26A 4OQHA 4ASUD 1Y5RA 4JVSB 5PGMA 4YQFA 3PKJA 4JBXA 1OFVA 4YIKA 3IDZA 3UY4A 5KU1A 1TM1E 4G24A 5TQ0B 4BCBA 2XWBF 3L0YA 5FQMA 4BVKA 3NDPA 2Q7DA 5A7HA 4LK3A 1DO8A 1Q0SA 3E9ZA 2RKBA 5AI5A 4CMBA 4BWIA 1PFLA 5FORA 5FR2A 3ICCA 1GVNB 1NLMA 2FH5B 2H0TA 1VHJA 4FFDA 3GLGA 1FIKA 2BYTA 4LEIA 3NH6A 1C4OA 3Q10A 3EY9A 5GONA 2OUKA 4NH0A 3NHKA 1J8VA 3AJAA 4L0LA 1K25A 1OX6A 2CXNA 2FOLA 1GZHB 1AC5A 2GZ3A 4I3GA 4CMAA 5HR5A 1IK6A 4OQMA 1E6MA 3KSAC 2FPPB 1KMHB 3P9XA 4E46A 3FTDA 3MLAA 5A4DA 1W5EA 4HATA 4D3DA 1WG8A 2J7VA 4BBZA 3KWLA 3DDUA 4EUVA 3FCYA 4PXAA 1R4NA 5ALTA 4B6SA 1B0PA 4CM4B 3DOUA 1U63A 2AKEA 3I42A 1X7XA 2G9ZA 2PQ0A 2OBXA 1NDQA 2PV7A 1I30A 1M5TA 3IP7A 3OF2A 1J33A 1AMOA 3TJMA 4GXRA 1RM0A 2WAFA 3RFBA 1OYWA 3DTVA 2JAUA 2R3SA 1KO5A 2P1DA 3HCCA 2FPSA 3EXIB 5D1NA 5BWNA 5F82A 4BKPA 5BUQA 2V1AA 4M4XA 1BW9B 2BFDB 2JD1A 3N59A 5JVDF 5JS1A 3IE2A 3SQMA 4TYMA 3HCYA 2YWJA 5BQ5A 3IX4A 1Z4OA 3LYUA 4BRZA 1RQ7A 4P5DA 3UWOA 4GDBA 4HBUA 1MNAA 1AXGA 3X1WA 1VCHA 1OYYA 4E6XA 1ESCA 1JHUA 2UYOA 4N18A 3V97A 2G67A 3NUGA 4DAOA 3M6HA 1D2CA 2D2XA 1JG7A 2IYLD 1OJGA 2A1IA 2AXNA 1E6EA 2DHRA 4MN6A 4GF5A 5JROA 4CLCE 2BTQB 2FKAA 1P6UA 4EW3A 4KMRA 2G82A 3KVNA 2FR8C 1GL9B 5ALSA 3JQAD 4KN6A 1KZ4A 4MHOA 5FPKA 3KKQA 1O2DA 3K35A 5ALJA 1TI7A 4DCGA 3VKHA 5CBPA 4F9TA 3QZUA 1RI1A 1UMBA 3PIRA 4OONA 3N70A 3AF5A 2KLIA 3T1SA 4Z3KA 2C2HA 5HRCA 5JSZA 3ZWQA 1U3FA 3LG2A 1JV2B 5FLXA 2E37A 3GA0A 3PTLA 2NXCA 3TSOA 1KMQA 3IJEB 1OGIA 1PZOA 3KM0A 4RBNA 3RPEA 3SICE 2A9OA 2H54A 1UXGA 5EFZA 4X8OA 3GLGB 3E3LA 4DTIA 3USCS 2WZXA 2PLWA 1TJ4A 1KGFA 1OIVA 4JVNA 1F6DA 1BMFD 4MMZB 4Q02A 4RA6B 3BF8A 3R3VA 5HDCA 1JAYA 3NH9A 1M1UA 4TMFA 4C4ZA 5DLPA 2R1VA 1XZCA 1QOQB 3HU1A 3P96A 4PQYA 4OKIA 4RPGA 5IHPA 1KDZA 1EXDA 2GPSA 2ZAOA 2C84A 4KU4A 3L8EA 3REFA 2GYVA 1YR7A 4BFLA 1MXHA 4CT0A 1PQWA 1R6UA 1A9YA 1ECJA 3FDFA 1FRNA 2WU0A 4KGXA 4YLEA 3RNOA 1W1UA 1NBWB 2NTVA 4GPTA 3TLYA 3UMBA 2GJ3A 3EZYA 1OC4A 4FH2A 1R8SA 2EZ4A 1KVSA 2V4MA 2G09A 3ISVA 4NBNA 1OTDA 5F1KA 2G17A 2X8JB 3I5AA 1NW5A 1NXQA 1Z6YA 1Q7CA 3O21A 2Y71A 4MS3A 4CIXA 4WOCA 5I01A 3QOWA 5DJTA 3M3DA 4WBNA 4BWYA 3KR0A 3RHSA 2RK4A 1FJHA 2H52A 2DFLA 3HKEA 5EE0A 5C8YF 4TYQA 3AFGA 2HEGA 5I9BA 5A2GA 5AVWA 3REQA 1W44A 3WLKX 1P4HA 1UBJS 1Q7RA 1ES9A 1AWIA 4NYIR 4HH2A 4EESA 1TM4E 4OUKX 4S12A 2VHVA 4WTOA 1V43A 3PR2B 1WDWB 1JU4A 4JGOA 2VXCA 3HN7A 3RTGA 3HDVA 4WA8A 4J29A 3MF4A 3B1YA 1I4EB 2W2PA 1S7GA 3NM4A 3WIOA 1ZI6A 3FJ1A 5C4GB 1Z4KA 3DDOA 3IP3A 3DOIA 2DKFA 1PQPA 1WA5A 5CTNA 3FNIA 1AZSC 5EHIA 3H2BA 3JQ9C 1MDFA 3AHFA 4PCLA 1SQFA 1E3UA 1PK7A 4O4JA 4QB8A 2ZRAA 4JI5B 3ZWAA 4DT1A 1GSOA 2IUFA 4GI1A 3PPVA 3QA3E 3V3KA 4H7HA 2VV7A 2BC9A 1FCNA 3ZUPA 4BWVA 2E49A 5A4KA 2ZJ9A 3G35A 3E84A 4UMVA 3VNSA 4CW7A 3OQHA 3KHUA 5CNJA 1E8DA 3ZDZB 1V3QE 1KJWA 1KZ6A 1RHUA 3AHJA 4HDRA 4WJZA 5HXAA 2XMSA 3NTRA 1DKOA 4ENWA 2FR0A 1DPFA 2ZCUA 4G4SP 3RGWS 3PWSA 3W4QA 4MVJH 4FHEA 1E77A 3PE6A 2GWRA 4B6JA 5IASA 4RMJA 3ZVRA 3MS6A 2QMQA 3X1KA 2R5WA 1IM8A 1W2WB 3QWHA 4F60A 2CB9A 2I29A 3AEUA 3D5EA 3FRIA 4ZO9A 4FZVA 2AG6A 1HDGO 4Y6QA 2O2SA 4U63A 2ZAMA 1EFKA 2NX2A 3KG2A 1UBLS 1UP6A 4PEVA 2OV8A 2ISQA 1JSCA 4RFLA 4ALKA 3KQUA 3HPRA 1PL6A 5G4KB 5A2QA 4F1KA 2CK3A 3GCDA 1LTQA 3LIDA 3JWEA 3K8OE 2LD4A 2R8RA 3P5BA 4B4ZA 4WNIA 3FOZA 3GDGA 4UAJA 5AT1A 2HA3A 1D0IA 2OD9A 1D0VA 3BRCA 5AKKA 4ETZA 5HS4A 4GH5A 2PEZA 5IW8A 1KYZA 3RK4A 2XMPA 4JNKA 1M34A 2BH2A 2F90A 1Q1BA 4Y5FA 2GTHA 1GNRA 5FNVB 2X1LA 4H27A 4RVNA 4F45A 1FJXA 1CE8B 2UZAA 5B7QA 2VP3A 5I5LA 1K6MA 2VP4A 4LQ4A 3BC1A 1I51A 2P2DA 3BVPA 2L19A 4J16C 1CJCA 3GQVA 1PL0A 4H3KB 5B1EA 2ZM0A 1GTVA 2P4UA 2YXNA 1QRDA 2J30A 1DIOB 3H19A 4IO0A 4P6VF 4EY4A 4DSZA 3PG5A 1E69A 4AL4A 4W5TA 1AK1A 2DBZA 4YJGB 4K26A 1BGWA 1H69A 1JA1A 1H3QA 1ENPA 2WJ6A 3ONEA 3AM1A 3NM5A 3PNSA 2C96A 2PDRA 1NUHA 2VHEA 3GH3A 4S2NA 4J03A 1A95A 4PX9A 1WKCA 3FSGA 4RD1A 4TT8A 2FEWB 5A05A 3WMXA 4CZ2A 1EFVA 2J87A 2WYOA 4BJ1A 1N9BA 2OK8A 1YK0A 2QROA 3SS4A 1Q1GA 5KYGA 1C8LA 2FN8A 1KWGA 2NO7A 3QVGB 5JC8A 4W9NA 3PTEA 1ZIYA 1W581 1TQ2A 3C43A 4GQIA 4RIEA 2Q3CA 2EKQA 2HU2A 2XI4A 5K6AC 2V7WA 4P4UA 3O9VA 4Y13A 5DXFA 5ILOA 2D01A 1UJ4A 3O8NA 3PSAA 2ZKIA 4ID3A 3VYVA 4BJHB 1UKCA 3MBZA 4WN5A 4EW7A 1BXRB 2D1QA 1YA4A 2ZYHA 3JPWA 3TBKA 4AVYA 3IUEA 2QI9C 4XPZA 2A67A 2I3AA 2W2LA 2Z2XA 4M8SA 3FY4A 3TTSA 3WJ7A 4ENQA 2I2FA 2JFWA 4G89A 2V20A 4K6KA 3MWJA 1M2WA 2P40A 4Q82A 1KK2A 4W5HA 1Y89A 2Q21A 3OA0A 5IRCD 2VNHA 1RTKA 1HTBA 3O2JA 1B8NA 3OZCA 1EB8A 1R0ZA 2OB2A 2X4DA 4MDHA 5L7YA 5LJLA 4B1FA 1UT5A 5HOEA 2GBPA 5K4AA 2WZQA 4C30A 2WOOA 5GLDA 3KSFA 2QY6A 1BMTA 1SUSA 1EQUA 2YVKA 2YZNA 1K6IA 3OD5A 2AK2A 4L8FA 1COWA 4J07A 4BJ3A 1TB4A 1QE5A 1CEGA 1I24A 5KSHA 2ZJ0A 3GVXA 4QD3A 4YMSA 4FWIB 5DM4A 5G4LA 1XYYA 3VTKA 4J6FA 3C1TA 2GHRA 2SKDA 3OZGA 4N9KA 2UYGA 4RVFA 4KI7A 1ISGA 4M86A 4Q01A 4FFRA 4E14A 1Q0ZA 1G3QA 3KQQA 4QOEA 4A1OA 3RKUA 4F3RA 5JQGF 3UK7A 1JDSA 1D3AA 1JHRA 2G0AA 2RK3A 3BCRA 1GNTA 3KELA 2X71A 1CIJA 1RZRD 3PRHA 2Y77A 4OA5A 2J9PA 1U2SA 1U0RA 4YP7A 3FG8A 3QH4A 2PKEA 2NWQA 3EQZA 1C3JA 4FILA 5CVCA 4EW2A 1BQEA 1TRKA 3ZHUA 1QIDA 1Y8RA 2F48A 1OT3A 3OEED 1SKOB 3RS2A 1OZAA 1PW7A 4GBGA 1GSIA 2BFBB 2B0CA 4RY2A 4QC2A 4MMYB 4D9MA 1MCZA 4FONA 3U3XA 2DTXA 3N86A 4IIEA 1XPBA 1G8SA 1O96B 5B2FA 1E2BA 3C2WA 1ORRA 3MCWA 5JJLA 4CNBA 3G8CA 3BCHA 4YOFA 2PQ2A 2DM6A 2O6HA 1D7EA 3F6BX 3MIZA 3QWIA 4N5HX 2QTAA 4BRWA 3IX7A 5FAOA 1FOEB 1LRLA 1EP2B 3EUAA 3ZG7B 1E59A 1BXRA 3I0NA 4LI0A 4MQMA 5KTTA 4E3MA 2G9NA 2WKRA 1WCV1 1P1FA 1PRQA 4ZEVA 2RHMA 3W4OA 4LHYA 4IEIA 1XIVA 3GD7A 3P9SA 2EEZA 4EHAA 1KGGA 1E2PA 1WB5A 1WVGA 3FZNA 4KMMA 4XCVA 5DM2A 5DW3A 1ZLYA 4NTZA 4D99A 5FOXA 2PH7A 2Q50A 2QHXA 1EDZA 2XWQA 2RAUA 4JP3A 4C0KA 3U4QA 4E2WA 4IGFA 5IKPA 3IEXA 3ZU6A 4HFJA 1C0KA 2H2AA 2PD3A 1NBME 1O95C 1G5TA 1YAXA 3U7QB 1V16A 3KKEA 5HYVA 3GNTA 4OP2A 2IZ0A 1X2BA 4XIFA 4BBUA 1M6WA 3O4RA 4ZGBA 2HA6A 1V1RB 1H4QA 1E3IA 5EEHA 3U4CA 3WRVA 3TZKA 1RE0A 2HTFA 1W49A 1F4LA 3DXYA 1JTGA 3NHFA 4OUDA 4S2UA 5DNDA 3TOVA 2VJYA 4B7CA 3IUPA 5B58C 3J7AC 2JBFA 4S2NC 2AMVA 1HH4A 2Q5IA 4WMCA 1CY1A 4CTMA 3UAOA 1WMSA 1ZX1A 1P19A 5AVFA 1NA5A 5A6VA 2V9AA 3WLIA 2XNCA 5IDXA 1UJNA 1E1RD 4H3SA 4M0CA 2ETXA 1Q6ZA 3TRFA 1NULA 1W88B