2WKRA

Structure of a photoactivatable rac1 containing the lov2 c450m mutant
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
317
structure length
317
Chain Sequence
ATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNMRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFHHVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase, cell adhesion
molecule keywords NPH1-1, RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
publication title A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
pubmed doi rcsb
source organism Avena sativa
total genus 109
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2wkrA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wkrA02
2OV2A 1W5SA 3AB3A 4YMSA 2GKSA 1S1YA 4LV6A 1A2KC 3D31A 3LW7A 1KKMA 1KMHB 1XJCA 4TYYA 4DCUA 1DARA 3A36A 4IJMA 3NH6A 2VLIA 4JBYA 2DBYA 3CH5A 2FNAA 1P2SA 1J8MF 1JPNA 4V0OA 4P4SB 5FUYA 4Q4HB 1Y28A 4NXFA 1GZSA 3NIBA 1VG1A 2QEQA 1UKVY 1ZNZA 1J7KA 2CMNA 4U7DA 1SQ5A 4EJSA 3W34A 5HWWA 2WAXA 4PAQA 2JATA 3FDIA 4OBEA 1CJKC 2CCKA 4TYQA 3T35A 2F3RA 4B2IA 1FUKA 1OIXA 3EZFA 2ODWA 4URYR 1GRQA 1X3SA 1GNPA 3KXKA 2CCGA 4I5SA 2CHGA 4C2TA 2ECKA 4PPFA 3ADDA 4HLDA 4ON9A 2FJUA 1S9HA 2F9LA 1XJQA 1KOFA 3RRMA 3KUCA 2N42A 3T12A 3K0AA 2QQ0A 4JS0A 1ZD8A 4Q1BA 5HD3A 3AVUA 3KJEA 1GKIA 4QNMA 5G40A 1BH2A 2QMEA 1Z0KA 4DSTA 3KJIA 1XMIA 4KCGA 3F3YA 2ONJA 2OCAA 1NMYA 1IONA 1R7RA 1DAMA 3IDQA 4L8GA 4TL8A 1EFCA 1ZBDA 2VTKA 4AI6A 2V0UA 2BHRA 3K70C 1DP9A 3SEAA 2ZR9A 4JZKA 3H82B 4AK9A 1E2KA 5EFWA 5HSQA 3R7WB 5HZKA 2D3WA 2UKDA 3ICEA 1N5IA 3KTAA 4PZYA 4XWOA 4JLBA 2PL3A 3C7KA 3K0CC 3W9YA 2YYZA 1ETUA 3LBHA 1JEEA 4MN6A 4PXAA 4Q01A 3NHBA 4WZBE 1FZQA 3MAAC 2R6AA 2R2AA 4NYMQ 4YDSA 1WQ1R 2ZS7A 3BFXA 5DIFA 3DPUA 2J80A 1N6OA 2F9MA 2WKRA 1QHHB 2GXSA 4IVPA 2PJZA 4E07A 4GHIA 2IYSA 4HAXA 3HR7A 3L82B 5CITA 2BOVA 1G9XA 5DJTA 1G20E 3LH5A 4Q9JA 5AUPB 4BECA 2R65A 2C9CA 1HURA 1MO5A 3A58B 3FGNA 3G5UA 5UKDA 4FIDA 5BN5A 5FR1A 3SS8A 1JI0A 3NWJA 1Z22A 2NGRA 1N9LA 3MWKA 2GAAA 4EAQA 3VR4A 3CRVA 1PVOA 3EA0A 5DNYB 1C4OA 1X8LA 3KFXA 2ZEJA 2V54A 4BFXA 3RS7A 1GKYA 1S3GA 1UBGA 1Z08A 5FUVA 1ZCBA 2ZYVX 2DPXA 3BBPA 2ZOIA 5HDCA 1YRAA 2ZE7A 2FSFA 3EAQA 4IDNA 3RANA 5EP1A 1G7RA 1XEWX 3MQQA 2CLSA 4POAA 4US1R 4EESA 1OXUA 2O0KA 3ZS8A 1S4SA 5EE3A 1B23P 1SXJD 1OHHA 3PUWA 4PTLA 2OBNA 1OFTA 2J0UA 4JBXA 5EXSA 4GNKA 4QM7A 4XWAA 4M1MA 1E1RA 1A2BA 4IOJA 4F93B 1DEKA 2J59A 2FFQA 2GBLC 1JAHA 2BWJA 5IRCD 1IN8A 4PAMA 2HXSA 4G01B 4TMTA 4ARZB 2CJWB 2IEZA 2IYWA 4LSGA 4WIAA 1G4AE 2A24A 2MMCA 2PEYA 4CEHB 3ICQB 2TMKA 2FSGA 3F1PB 3LVQE 3VAAA 5JWOA 3IEVA 1R5OA 4EFNA 1US8A 2RGEA 2IYLD 4ZCIA 1YE8A 3DVLA 1UKYA 1Z5ZA 2FPLA 3RHFA 2VEAA 4OHVA 4A36A 3AQ4A 4I81A 1RYHA 4WXPA 1OYYA 1UGUA 3OEEA 3QY0A 1Z06A 4B34A 1T0JB 5KHOC 1YVDA 2D01A 4YLGA 1H8HA 3IQXA 2J1LA 1M74A 1NMXA 2HLDA 5GJCA 1XPUA 4IEEA 1XNJA 5EQTA 2IX3A 2IC5A 3DOFA 1T1AA 2IW3A 2GK6A 4B44A 4KHZA 2PJRA 3M1IA 3CWZA 3TE6A 2HCBA 2CNWA 1AKEA 5AVEA 2XOKA 3MFYA 4L9EA 2D62A 2C2HA 4W7SA 3GEHA 3ZDQA 1T18A 3EPHA 4MN5A 1F3OA 1W47A 2G3YA 5CLLA 1NJGA 1J70A 2ZS9A 3FWYA 4D81A 2D4HA 1DAFA 1BOFA 2ZI5A 4TYNA 4AKGA 1KKLA 1N6NA 1E32A 1Q21A 1Z0FA 1UKEA 3MGCA 1HH4A 3QKSA 2CHVA 4JLJA 3EW9A 4Q9IA 1M1YE 3L0PA 3WP1B 3QSYA 4NP6A 2KI5A 2ZI6A 3MJHA 4Q1EA 2IUUA 2BV3A 2AWOA 5CK5A 4D4LA 4IXNA 3QXXA 2ZSEA 2A5GA 3MWYW 3BWLA 4NYJQ 3Q7QA 4HB2A 4XJXA 1GRRA 4ZI3A 5TBMB 2FFHA 4K46A 3FTQA 2AFHE 1KYIA 4JJZA 2H92A 2NIPA 4DCNA 4JBWA 1FX0B 4H6JB 3V4FA 1HUQA 4B3DA 2BBWA 4HUQA 3X1ZA 2A3RA 3AVTA 1BS1A 4L9SA 1WP9A 2QP3A 4RKEA 1KO4A 1S9DA 4EDHA 5JECA 3ZD7A 3LI8A 1NBMD 4V0NA 4QBFA 3WBJA 4B33A 2ANCA 2ZAOA 5FOVA 3K70B 4Q5IA 1SGWA 4Q21A 1X1SA 2QRZA 4I1OA 3RWMB 2Q9AA 3CR8A 2KE5A 821PA 4XWKA 3K70D 2NMVA 1EG7A 4JMPA 3VE3A 5FUXA 1OTIA 2XB4A 4GMXA 3VKGA 4NCIA 3DKVA 3VMFA 1P61B 1D06A 4LK2A 5KUTA 2IWRA 4JLVA 4LC1A 1XFNA 4NHOA 3GJXC 3BH6A 2GAOA 4XSGA 1GP2A 3MLEA 2PHYA 2FV8A 2G0NA 5K8TA 3KX2A 3T5GA 3ZVNA 4A15A 1VCIA 3J81k 1TUIA 2AKAB 4DT1A 5EUQB 4C0QC 4QBIA 1RPZA 1Q20A 3ADCA 1U2RA 3QKUA 1KNQA 4QJ5A 2W0MA 2NG1A 3X2SA 3IBGA 3SQXA 3AVVA 1G8FA 4A2WA 1OXSC 1FP6A 5JEDA 3HWSA 2ZE5A 3N5CA 3IBRA 1XXHB 2FEMA 3T1TA 1IN4A 2PD7A 4M0LA 1VG9B 2QJ5A 1AZTA 1NG9A 521PA 3NC1C 4HZUA 4LHWA 2OWHA 2H8KA 4IFBA 4CW7A 5K8LA 4J0QA 4NYMR 5A4JA 4JSTA 3QG5A 4CEJB 3K1JA 4EEPA 1RRCA 2FEOA 4A2QA 4HAWA 1SVOA 2DFLA 4Q4AB 3ZQ5A 3I73A 5DN6A 3ZQ6A 4B75A 3GFOA 3ZIAD 5JRZA 2NPIA 2V7QA 4RVCA 2I3BA 1MV5A 2OFXA 1VIYA 2ZUDA 3GLGB 1S4RA 1OE0A 5DI3A 1NWZA 3AKCA 2N1BA 2RCNA 3MG9A 4JVSB 2AD5A 3V4RA 3ZH9B 1A5TA 2X19A 2QQEA 4RCYA 3EARA 4I3JA 1W44A 3F1OB 2O8CB 4CVNA 4WOPA 4EQ6B 2CHQA 3PR1A 2HYIC 1AA9A 3D7MA 1GOTA 3GECA 4LRZE 3C15C 4F3LB 1OH5A 4ITRC 4QM6A 3QNUA 6Q21A 3FMPB 1TNDA 2GZAA 5AJZA 4MYCA 1E79A 1ZCAA 2BBOA 4ZCLA 4LLOB 4HI0E 5FPHA 1W2GA 4R9UC 5HWVA 2J45A 5FFMA 5AJVB 4ACAA 1CKEA 1TEVA 2ZR7A 4LZZA 4X8HA 4EPYA 5JCPA 1VG8A 4YXWA 2G83A 2W0NA 5J4LA 1XTJA 1NN3A 4A8JA 4YC7A 1TS0A 4GW9A 3P32A 121PA 4G5RA 1WCV1 4HY8A 2OT3B 4EJSB 3DKPA 4LYFA 5CK4A 2QI9C 3W3AA 1D8TA 1FTSA 4TL9A 4ZDKA 3U3JA 3NDPA 4N1AA 4F4CA 4XTCS 5DKKA 4ZIRA 3RTYA 4AYWA 4EKDA 2W6ID 4G5GA 4LOAA 4OI2A 2WMOB 3AGPA 2WJIA 1V5WA 3K0AB 4LJ9A 1WRBA 4UXHA 2V1UA 3CB4A 3KKOA 2WTUA 1TTTA 2N46A 3IHWA 1PJRA 2FGJA 1YZLA 1AGPA 2ZBBA 4PKYG 3RYTC 4RD1A 2J87A 3UB9A 4B35A 1JR3A 1J90A 5JJLA 3CWFA 3QQ5A 1EFUA 1NN0A 5D3QA 5G3ZA 4RJLA 1OTBA 5KDLA 1MR3F 1XTSA 3KTAB 3QI2A 4N0DA 2BCJQ 2B92A 2YNMA 4LDJA 3T06B 4WL9A 1UWPX 1OPXA 3QF4A 3BY8A 3K09C 4UNQA 4B74A 1PLKA 2ORIA 2Q3HA 3Q85A 4NYJR 2QTHA 5IU1A 4OHZA 3BS4A 1YZTA 4GHIB 3AM1A 1U0HC 3U2QA 4HB4A 2PBRA 1JQJC 3CZPA 1S1ZA 4AG5A 5KNCA 4L9GA 1QHSA 2RGAA 4C0AC 1G3RA 4BLSA 2P6UA 1OJGA 2ZR0A 1ESMA 4L15A 4JGRA 3RVBA 1NBME 1CS4C 1YJ5A 3OIYA 3P20A 4PHFA 3V9PA 2WOOA 4GOXA 2RAPA 1G16A 1E2DA 3NEJA 2REXB 1IY0A 3SYNA 1DAHA 1Z83A 4I39A 5AVFA 4A1FA 8OHMA 3HJNA 5HWTA 4FMBB 1KDOA 4DBLC 3V00A 1EWRA 2FG5A 5JS8A 4EW7A 1WBDA 1EK0A 3UMFA 4AIIA 3TRFA 3Q8XB 2V6IA 4TYWA 4Q1CA 2P67A 4HP4A 3PUXA 1Q22A 2CEAA 2J0UB 2ZRFA 3I4LA 4I38A 2IS6A 2QORA 1OHHD 1II9A 2VP4A 5G53C 2ZRNA 2IYUA 1OIWA 2EU8A 4BFSA 5EP3A 5EE0A 1NRJB 1P9NA 3EG5A 1TQDA 3L8ZA 4OJKA 2VV6A 1KI4A 4RFVA 2A24B 4EERA 1FMLA 1EX6A 3LIEA 3PYPA 1SXJA 1VDZA 1DE0A 2GJKA 1XMVA 2QL6A 1US8B 2REOA 2J41A 3PEVA 3WMGA 4B3GA 1W0JA 5DLQC 4YDHB 4E22A 4Z8XA 4URZR 3UXMA 1PUIA 4IVQA 1XXHE 1W36B 5SZIA 3LXRA 1KK0A 1NL3A 3WRXC 1LNZA 2QROA 5SZJA 4HAVA 4TMKA 3MJRA 5FUWA 2J5XA 5E7JA 1W36D 3OEED 2W27A 1LSWA 2WWYA 3DHWC 3K0SA 2EFCB 3TSOA 1J2JA 5ANRB 1TADA 1H8HD 2VLGA 3FOZA 2ZVQX 1RZ3A 3K3CA 4R6LA 1CJTC 4S35A 1XTRA 3L8YA 1XZQA 2F1RA 2IXEA 3UB6A 4JL5A 4JSYA 3HU3A 4DWJA 2GRJA 4M1SA 1QBKC 2XOKD 4DEXA 4EPRA 3GLGE 4B47A 2RGCA 2Z6CA 4B6FA 4C0LA 3FB4A 2OILA 3CKLA 3QKSB 1KHTA 3KFVA 1TS6A 2QMHA 3GEIA 1CBUA 3WYAA 1VYTA 1R4AA 2IEYA 2FOLA 1CP2A 1KI3A 4PHGA 4Q66C 4Y0VA 1KK1A 2IHYA 5HPYB 3UMRA 1Z2AA 2JASA 1G19A 2YVUA 2C95A 5HTKA 5F69A 2R8RA 3C16C 2P5SA 1HY3A 2FMXA 3VHLB 2V1BA 2ZTSA 1C1YA 5FTJA 4HUQB 5GVSA 1XWIA 3CRW1 4IDQA 3CNLA 3NXSA 1X1RA 2OEPA 1NG1A 3EASA 2KSQA 4HDOB 4I1UA 4TMXA 5FI1B 4C9BA 1ZM4A 4TZ0A 2QG6A 1PLJA 3FPAA 2O8BA 3KQNA 2ATVA 4MYHA 4QL3A 4Q9LA 4M1OA 2YOFA 4QC2A 4Q7MB 4CT5A 3A4MA 3PEYA 1WF3A 2ZI3A 2ZJ5A 4OQXA 2IF2A 2MSCB 2B7CA 4NXEA 1OXVA 2P2LA 1RW4A 1T8TA 2Z5FA 4XOIA 2ZVPX 3P26A 3ZLJA 4O2RA 4TMWA 4TQ9A 1KZ7B 1T5LA 3QUSA 4L16A 4Q9KA 4A0GA 5HCNA 1ODFA 1N6KA 1Z47A 3LLUA 3PIRA 2PR5A 4HB3A 1NVVQ 2ZRPA 2OG2A 2JHEA 1TMKA 4KI0A 4AD8A 5J4KA 3GP8A 2B02A 3KDSE 1FW6A 5GVRA 4TL6A 3MWJA 3LVRE 4DT1B 1IXZA 3H7WA 4Q9HA 3TKLA 4URWR 3EIQA 3LA6A 4DKXA 1VCMA 4LYJA 4DDWA 2Q9BA 2XB2A 4B48A 2C98A 4PSKA 3KJHA 2QTFA 4S2EA 2GEDA 3GPLA 5BYJA 2YZ2A 4LY6A 4DVGA 5J4HA 2ORWA 4EQ1A 2PYPA 1KO1A 1P4SA 1XRJA 4GDFA 1V9YA 1E2PA 3CRQA 1XFQA 3EWKA 4HZUB 5BN4A 5BW8A 1FPMA 1LTQA 3Q72A 1Z07A 4LYHA 3FHOA 4GS9A 3ZQJA 4JT2A 1SVIA 3UKDA 1FP7A 5BYKA 2NO7A 4RKFA 2AXNA 2VHUA 1C9KA 2DHRA 3U7HB 2O52A 4NPHA 5CLQA 3A0VA 1E2JA 2G88A 1NY6A 4UKDA 4L9FA 3RRZA 5DI3B 1NF3A 3EIEA 2ANBA 5JEEA 5HDDA 4MKGA 3TBKA 3NTUA 2V7QD 3ASYA 5JHHB 2VBCA 3A1WA 3KL4A 5E7MA 2D7CA 1LSXA 1R0YA 1W46A 4GZMA 1SXJC 4IOMA 3K9GA 3WBKA 1SVWA 1VPLA 2YWGA 2O8EA 3G0HA 1NNEA 2JLRA 3IO5A 1MO3A 2JN7A 1OSNA 1GWNA 3IBYA 2W6JD 2ZI4A 1XTKA 5J40A 1EESA 3LICA 1KOUA 2GXQA 5LD2C 4TLDA 2YINC 1YZNA 1NKTA 4GSYA 1E0JA 1KI8A 1ZIPA 2IT1A 2QM7A 4URVR 1Z8FA 2JJ1D 2ZUBA 1N0WA 3JVUA 3SJZA 2GETA 3VR1A 2ZS8A 1LF0A 1E79D 2JLZA 3B78A 4P33A 1XPRA 1UBEA 2PX0A 3HPQA 1DADA 3IHLA 4MYUA 4NXGA 2ASEA 5JJKA 2XNSA 4A8JB 4PC7A 4CF7A 4LYAA 4KFSA 1IY2A 4YXWD 2R6GA 4O25A 1OB5A 1CJMA 1G4UR 3FYHA 3E1SA 5FPSA 1LV7A 2IS2A 3PG5A 1R5NA 1AS3A 3GLFA 1UFQA 3E4OA 2MMGA 4M9QA 2QU8A 2QMUA 1ZRHA 1YHNA 1GITA 1P7CA 4US0R 4ZIRB 1EFRD 1GL7A 1OYWA 1XEXA 1CRQA 1U9IA 2OE2A 1I2DA 4PPGA 1Q0UA 4LBZA 3WYFA 1R6BX 4B32A 3HPRA 2HCJB 3K9LA 4L9WA 3O8BA 1YU9A 5J3WA 3FG8A 2ERXA 3PENA 1GAJA 2HYDA 2XZPA 4PQRA 2F43A 5CJPA 3ZD6A 5FR2A 1CF4A 2G77B 3FVQA 4HB0A 2RGNA 1TPZA 3I8XA 4E03A 1Q1EA 5CB8A 5CIQA 1DBSA 3UG6A 2D7DA 5BWMA 3NBXX 3I1FA 1DP8A 1JR3D 2BKUA 4C3ZA 4IDPA 2W6IA 3AVXA 4FMDF 1RRGA 4A9AA 3AP2A 4U00A 3EZ9A 3QIAA 2WZQA 2WVJA 2Z6VA 2FU5C 2WJHA 3ETLA 3PVSA 2A30A 1OLOA 1U98A 3TAHA 3SU8A 5HD5A 1T3SA 3B1XA 1OFIA 5H8WA 4Q03A 2VP2A 5AR1A 1EXMA 2ZQ5A 4RZ3A 4W5HA 4AKIA 2EFDB 3KKNA 5A5GA 3THYA 2WWWA 3HYTA 3HU1A 3QENA 4ZDWA 2VL7A 3WYGA 4TZ6A 2L4RA 1ZM9A 1IY1A 5LB4A 4PX9A 3U4QA 3U44A 4WA7A 5K8UA 3IIJA 4PKYA 5LPNA 1TF7A 4C0SA 1A1VA 4LJ5A 5JFGA 5GJBA 2A5JA 3KXLA 2O8DA 2XNDA 1ZC3A 1CR4A 1Z3IX 4BLTA 2OBLA 4PO1A 5E7IA 5TDHA 3CF6R 4I1VA 2WV9A 3ZJYA 4URXR 4I99A 4KVAA 3X1XA 1P2VA 1E9SA 2ODBA 2IYYA 2VV8A 4PANA 3TVTA 3W6PA 4C0BA 5JJIA 4M22A 3B5JA 1S96A 1XCGB 1W4RA 1L4YA 4ZKDA 4B2LA 1G8GA 4OI1A 3QXJA 1YR6A 4RD0A 2GCOA 4QG7A 1DAIA 2BEJA 1VIAA 1KGDA 3EZ6A 3G82C 4DRZA 3WXMA 1JXOA 1NVVR 4XTRA 2PYRA 2VSFA 2QUZA 1NVWQ 4BQSA 4H9GA 3ADBA 2NZ8A 3A37A 4V03A 1KNXA 1G291 1G17A 2FZ4A 2GJ9A 2ZRKA 5EE9A 3AKDA 1W7AA 2PT5A 3U6KA 2G1KA 2WHXA 5KTYA 1XJ4A 1SXJB 3N2IA 1COWA 3GDIA 1WMSA 1XP8A 4LC0A 3EEHA 5DYIA 1QHGA 3QXSA 4NH0A 1PZNA 1KJYA 1FOEB 2ZI9A 4IEIA 1HQYE 4KV9A 1E9EA 5IK2A 4BBVA 1KSHA 5LD2B 5C4MA 1W0JD 2C77A 1S3SA 2FGKA 2QRNA 3H84A 4BFYA 3DM5A 1W48A 2AN9A 3A8TA 1V9ZA 4HLQB 3TJZA 3W6OA 3P4XA 3LUQA 3RS4A 4R3AA 1ZAKA 2IYRA 5FI0B 3F1NA 4DJTA 2W00A 5DE3A 1G3MA 2JJ2D 2QENA 4H1UA 1M7BA 3NBFA 5J4YA 1KO8A 1IHUA 2WIBA 4IOKA 1KAGA 1S2MA 2VHTA 3MD0A 2XTZA 1W2HA 2A5FA 3RS2A 2Q9CA 1RE0A 2JLYA 2ZPTX 3JVVA 3PITA 1BIFA 2GF9A 4JGOA 5CDFA 1Z2CA 4AC9A 2WJVA 1BKDR 1M7GA 4DEYA 2PMDA 2C9OA 5KOYA 3VR6A 4QNRA 3UG7A 2VRWA 1E2MA 2Z6DA 5DH9A 3F0TA 4UJ5A 1UAAA 3RWOA 3LD9A 2QPAA 3PHYA 3U61B 1ELOA 1X86B 1XJ2A 2R9VA 4GBMA 4DXAA 3BB3A 3FC7A 4OHWA 2VHJA 2JLVA 2ZSBA 3SC3A 1SVSA 2RGNC 2YC4C 4HATA 3IIKA 4YONB 3AKYA 2QT0A 1UDXA 2OFWA 1Z6YA 1RJ9A 2OCPA 3LXXA 4EJSC 1Q12A 3FHCB 4US2R 3WMFA 3ADKA 2O8BB 3REFA 4WAUA 3U3KA 2KBEA 1BYUA 4QXAA 3C2WA 5K8IA 4NMMA 5AJXA 3LIAA 5J47A 1I4LD 2GESA 5EE1A 3GD7A 4EFMA 1LSVA 1T3LA 4P31A 1XEFA 5L3QA 1V43A 1Z0JA 4W5WA 2E9SA 3PQCA 3QXHA 3L0OA 2OESA 2L0WA 2DFTA 3KB2A 3VNUA 2O8CA 5HCIA 2Q21A 1Q3TA 1TL7C 3B33A 5FOXA 2WKQA 2ZANA 3AF4A 1II8A 3GJ0A 4FINA 3GJ6A 4HDCA 2EWWA 5F2EA 3R8CA 2R6DA 1OF1A 1EGAA 4AURA 1E4YA 3AF1A 4G3XA 2FN4A 1Z0AA 4ABYA 2HDNB 3LV8A 1FTNA 1A7JA 1UBCA 2GCNA 3H7WB 5DSZA 2NO0A 1SVLA 1EFTA 1UM8A 1E9BA 2IYZA 3U5ZB 2IXGA 2PD8A 1JR3E 1SVMA 3BY9A 2NOAA 4NYIQ 4NU0A 3ZVLA 4HIAA 1NKSA 2IBMA 2QZ4A 1CJUC 4U5XA 2W2TA 3A4LA 2DWQA 4O0MA 1BMFA 1X6VA 1FL9A 3CIOA 3K53A 2PX3A 4FI3C 3KQUA 3OE7A 3OF5A 3TIFA 2L1MA 3UWKA 3HR8A 2ZROA 2RHDA 2BBTA 3IGFA 1NJFA 3AGQA 4X8MA 5KSZA 4GS9B 2ZE6A 3H2YA 4DC9A 2QAGA 2M1CA 4ZV4A 1OW3B 5JSZA 4Q19A 1IJEA 2ZRBA 4R38A 1SVKA 4U02A 5EXTA 4XIGS 2WAYA 3SJCA 5DHAA 4YMWA 4Q7LA 5KNDA 1E0SA 3C8UA 4G0NA 5CYPA 1F2UA 1KDTA 4HI4A 2QNRA 3PV0A 4QHYA 5FOWA 4NDZA 3EIHA 3QVUA 4FXPA 4MITA 2O8EB 1LB1B 1RVDA 4C7OA 3QOFA 1G5TA 5HKKA 2V9PA 2ZYUX 2BDTA 1RYFA 3IS2A 2CLDX 2GZDA 2XJ9A 1XBTA 5EP4A 4EUNA 2VP5A 3T34A 4AKHA 2EFHB 1N6RA 3K0EA 1QHNA 2B21A 4Q48A 4B43A 2J0QA 4HNBA 3H86A 1P5ZB 4RZ2A 3BFKA 4O3MA 2A78A 3BH0A 3Q5EA 1VECA 3KXIA 5J7EA 3WP0A 2V3CC 3E4QA 3FFAA 4A0RA 1NSTA 1YQTA 1RKBA 4MDFA 1OTEA 3AV0B 3LAWA 2W6JA 4DLXA 1LT0A 1KAOA 3LBNA 4DDUA 5B57C 4ERNA 3I62A 2QGNA 4XSHA 5TXGA 5L3SA 5B64A 1ZJ6A 3GLFB 4B3BA 1W36C 3F5FA 2GEVA 2JJ1A 2BJVA 5EXPA 1YRBA 1SXJE 4FCTA 3KUDA 2W58A 2IA5A 4BBUA 2REBA 1XEXB 1OKKA 3FKQA 3I8SA 4BASA 2VSXA 3HP1A 1P3JA 1GDDA 2IYQA 3LIBA 4DUGD 1J8YF 1YZQA 2F55A 1UADA 2BMEA 3EZ7A 3PFIA 3UIEA 1CU1A 2YWFA 2V4ZA 1TX4B 5A8BA 2WWFA 2F43B 2EFEB 4FD2A 4Y0AA 2EVWX 4CDGA 4P4TA 2VP9A 1LL8A 2EWVA 5HDSA 4GP6A 2BMFA 4UNNA 5JI2E 5D3MA 1G21E 4LX0A 4N0EA 1GL9B 4BE7B 1EFRA 1XJ3A 3VNVA 1JECA 1GUAA 3D6TB 4QHTA 2G9NA 5TB5A 1OJ5A 1L7VC 5CYOA 4OKSA 3A6PC 4HZIA 4RZXA 2PLFA 4GOJA 1KO5A 3LQQA 1N0VC 4FMCB 5L3VA 4WW0A 2JJ8A 1N5KA 3THYB 4UNRA 5ELXA 1TUEA 5KDDA 2NTYC 3MR0A 5F9FA 2C04A 1F2TA 1N5JA 2O8FA 2CE2X 3Q7PA 2LKCA 4DSOA 3TR0A 4LRXC 3SW1A 1G7CA 2FSHA 4LJ8A 3UK6A 3U44B 2XGJA 2VH5R 1EX7A 1D2EA 4CZ2A 2WSSD 3I5XA 2ZU6A 3C5HA 1RRPA 2GXUA 3CF0A 2HT1A 2OCYC 3CX8A 4BBTA 2C5LA 4IVRA 4KBFA 1G7SA 2H57A 2FZLA 2QPTA 3CW2A 2BJWA 3KZ1E 4V02A 4X8LA 4ZKEA 2XZOA 2W2VA 1FUUA 4DB4A 1LS6A 1HE8B 2HJGA 1M34E 3BC1A 1ZM7A 1CR2A 2XNDD 3B7GA 4GP7A 1T1BA 2V8OA 5AUQA 3K0FA 2ZREA 2AD1A 4RD6A 3BH7A 1GIAA 4G5QA 2OAQ1 5HE8A 1NLZA 1OTDA 3QEJA 3VU9A 3U3OA 3NG1A 1E9RA 2D06A 3GJ8A 1OT9A 1E96A 2JA1A 4D6PA 2LKDA 1UEIA 1T4GA 2AKYA 2ZU0C 3R20A 2NPFA 3ZZUA 1F48A 3FKSA 3TGPA 3AVQA 3Q3JB 2HF9A 4JYCA 2GCOB 4BWYA 2O0HA 2R78A 5B2ZA 2P5TB 4OHYA 5FBQB 4XT2A 1P60A 2XAUA 3BXZA 4V0MA 3K3DA 3HU2A 4A0FA 4MA4A 3TNFA 1DG3A 3RS3A 3THWA 4HP9A 3MUFA 2FSIA 5FBVB 2KBFA 4NYIR 1D5CA 4W5JA 4ZO4A 1AJEA 3T61A 1KJZA 2I9VA 5KSPA 4IHQA 5JCZA 2WOJA 3ONWA 4D4MA 1E2NA 1F98A 4PC6A 2O0JA 3CH4B 4HLUA 1AN0A 1COWD 2HV8A 3HJKA 4TN1A 4LHZA 5E3HA 3VQTA 4JL8A 4MRPA 4YMUA 4AYTA 2YV5A 3A1UA 2B8TA 3OEHA 1VTKA 1S8FA 4LJ4A 3TVDA 5IK2D 2A7QA 3IILA 4JLNA 4KBGA 4B6EA 3VX3A 2QM8A 2ZJ2A 1FNNA 1MT0A 4IOLA 4E04A 3IO3A 4WZ6A 3BB4A 2AK2A 5B58C 3F1NB 1SKQA 1N25A 4MGZR 4TTRA 2GJ8A 1OH8A 1AGRA 2L0XA 3QVVA 2HT6A 3QF7A 5IT5A 2WMNB 2H5EA 2ZRGA 5CM9C 5TMPA 3OIWA 1JPJA 1K5DA 2HF8A 2UZ3A 3C4JA 1N3BA 4BZXA 4ESHA 1E3MA 4OK3A 4HJ4A 3BAFA 3GMTA 4M4SA 4XVRA 1WXQA 3W6NA 4EPTA 1J99A 3VR2A 5CB6A 1HT1E 1AM4D 3A1SA 4B76A 2WKPA 1DRMA 1HEIA 4XD7A 2J0VA 5BXQC 3IIMA 4PSAA 4ZI2A 2JJ2A 2QE7A 4LHVA 3LQRA 1L4UA 3RS0A 4R71A 3U7FB 1VKJA 4OL0A 4KQDA 2K7SA 3AKEA 2JLQA 4KITB 2RGXA 1CXZA 2A5YB 5G41A 4A8JC 1H8EA 2PH1A 3DO6A 3MRSA 3VKWA 4NCHA 2R6FA 5CJ2A 4JLMA 2VO1A 1R0WA 2IUSA 1DOAA 1RJ9B 1Z63A 1SULA 4LHYA 3SYLA 2A2ZA 2X2EA 2VP0A 1Q44A 3A1VA 2LWIA 4OK6A 2GCPA 4LHXA 2CBZA 3SNHA 3AUYA 3UANA 4Q7KA 3U60B 1T6NA 1VCOA 4DSUA 2Z0MA 2WWXA 4IXMA 2PR6A 4HLCA 5JZVA 3SYKA 2PT7A 1E99A 1AIPA 3NBZC 4NCNA 4I3IA 1WA5A 3THXA 3B1ZA 5L3QB 1ESNA 2CL7X 3GLFE 2GVDC 4LBVA 1G3IA 1U8ZA 3HJIA 1ZYUA 2CMKA 3DMDA 2BMDA 4IFEA 4LPSA 3MFXA 1JAIA 2CXXA 4CEIA 3LLMA 4DDTA 5DYGA 3OFNA 4R7ZA 3CNNA 1Q1BA 1UWNX 1II8B 5JS7A 2R62A 4I1SA 4M53A 1GTVA 4Q1DA 4DCVA 3SOPA 1AKYA 1IN6A 1UKZA 4MRRA 4BFZA 1Z6TA 3BERA 1E2LA 3BWDD 4M1YA 4I3AA 4QRHA 1ZUIA 4B3FX 2WPDA 2ZJZA 4IDHA 5FPTA 2Z83A 3KQLA 2XXAA 4BPBA 1L2TA 1VYVA 3LDAA 4Q4JA 4DLRA 2QSYA 1CTQA 2IHBA 2FX3A 4R70A 1ZVQA 3K9HA 2IS1A 3EC2A 1ZM3A 3SZRA 3LIFA 4GPTA 2PLRA 4A82A 1OJLA 4JL6A 4PPNA 3BD9A 4MKHA 1PLLA 3AF2A 2ZI7A 4B71A 1BMFD 1OIVA 4D80A 3U3MA 5F5YA 3OE7D 1G28A 2GILA 2Q0HA 2GHIA 1RFLA 1DO0A 3DZ8A 2QAGB 4BLQA 3KX0X 2F1HA 4DZZA 5JSZB 3LY5A 3PJRA 1AQYA 4Z1MA 1KI1A 2ZJYA 4OQMA 3UMSA 1E2IA 4QOSA 3SN6A 3HDTA 4ASUA 2DWPA 2JLSA 3P7NA 2IF0A 2KWIA 1ZD1A 5F6AA 2YOHA 3QBVA 1P0ZA 3GQBA 4OJQA 5FOUA 2V0WA 2AFIE 1TAGA 3TR5A 2F1JA 1QDEA 5CIWA 1KI9A 1VMAA 4A2PA 3W8RA 1W0KA 4JLKA 3TLXA 1Y63A 2GA8A 4UNSA 1GSWA 3U7EB 2ZJOA 4C0HA 4C7OB 1VCNA 3THOA 4MKIA 2GF0A 3E70C 4HLUC 3O47A 3BOSA 1LW7A 2ZETA 4MGYR 3SR0A 1WDTA 2JDIA 3IS2B 2YKGA 3FFBA 4LJYA 5HKKD 2WBLC 3U6BA 1UJ2A 3K0CA 3MJQA 2QJ7A 3AUXA 2OO7A 4TT3A 2H7VA 3M6AA 1R8QA 5HE9A 4QKQA 1ONBA 3SJBA 1OB2A 1E9DA 4Z51A 2P0EA 1G8YA 4MRVA 4TQAA 3VR5A 1DS6A 1NVUQ 4TMZA 1Z6XA 4Q18A 2NO6A 2AWNA 3C8CA 3CO5A 4RZUA 3BIFA 4PC2A 2VV7A 3P1JA 1Z29A 1NVXQ 3RABA 2AK3A 2DB3A 1G8PA 2E1RA 5L3SB 1F5NA 4KYIB 3A1TA 4WLAA 2YKFA 4FWIB 4NTZA 4RY2A 3ZVRA 1FQKA 1EW0A 4KUOA 1E4VA 2QA5A 4PC3A 3VX4A 4M9XA 5KPDA 1UEJA 2D2EA 2I4IA 2ZJBA 2QTVB 3CONA 2ZXUA 1T1CA 3QPUA 3OLOA 4P32A 2WJGA 3H1TA 1OKKD 2EQBA 2X77A 3A4NA 2YKHA 3UB8A 3CZQA 2QPOA 1JJVA 1XD2A 1DAKA 1JNYA 3P4YA 2QSZA 1BO6A 1MO6A 4WBSA 2O5VA 4BZPA 1A4RA 3RS5A 2ZE8A 3SQWA 3VFDA 5D3MB 4YWZA 3KQKA 1X8KA 4HDQB 4ZCMA 1U90A 1KI2A 1D9XA 2ZUCA 2ZSAA 2QT1A 2JLXA 2OWJA 3EXAA 3WRYC 4DUGA 1KY3A 2GBLA 4LPZA 3CF2A 3B85A 1XX6A 3SDZA 3RSOA 3P27A 2AR7A 4LGMA 1HTWA 3OIVA 1TF2A 4KODA 1QF9A 3BORA 3LW8A 1FMJA 1KDPA 2YJTD 2H16A 2CL0X 3RSLA 4DIDA 5CDFE 1YZGA 1VHLA 3G6OA 1I4TD 4L5BA 2F3TA 2GVZC 3AEZA 4KXFB 3NDBB 1MOZA 2YHSA 3CX7A 1ZU4A 5FTMA 5KPJA 4JLAA 3GJ5A 4AG6A 1F2TB 3CUEF 4BUJA 2O8FB 1TS7A 3B9PA 1D2NA 3X1WA 2SHKA 2XX3A 5AUNB 4F3LA 5JWRA 2KDKA 1TQ4A 1YR7A 4KLNA 3EPJA 5EE5B 3AVOA 1II0A 4JVNA 2PEZA 5FL3A 2QP4A 1NSFA 1IN7A 2WM9B 1OTAA 1G8HA 5P21A 4M21A 1UBFA 2WWHA 2DFKB 3ZZ0A 3GLIA 2XZLA 3KKPA 4E09A 2IYXA 2AXPA 2RMKA 3QF4B 2OBMA 2RH5A 4D0GA 1I4DD 3K0FB 1OT6A 4PO8A 1AZSC 2ZYTX 4LV5B 2VF7A 1XEWY 1DP6A 1HQCA 3CRRA 3BB1A 3VU9B 4BZQA 2QMOA 2WSSA 1BYWA 2OAP1 3N2EA 1N2CE 3QPWA 2OLJA 4D4KA 5JHGB 2FF7A 3KJGA 3U4QB 1E0AA 1S0UA 4EETB 3FKSD 3JZMA 5JBQA 3T50A 1GSIA 2EFGA 1P75A 1Q1ZA 4XT2B 3AF3A 1MABA 1GVNB 4TTPA 3U3RA 3AVYA 421PA 2C03A 3QKRA 2CK3D 1DAEA 3THWB 2FPKA 3EPLA 1G41A 4DLSA 4EIWA 5EUMA 4RQ9A 1GNRA 2EYUA 2GWHA 1T3HA 2XSZA 2CE7A 4LRWA 2ZJ8A 3D8BA 1SHKA 4G5SA 1XB2A 4KAXA 4X8OA 3DOEA 4B73A 3B1VA 2V6JA 3PCRB 4RD3A 2V9AA 1GM5A 1N6PA 1GSVA 4JYBA 4TLAA 4F4IA 3TMKA 1ZUNB 4KVGA 3CLOA 3IQWA 1ZC4A 1VHTA 2JIZA 5GJVC 4L4UA 1TQ2A 4FMCF 4EXOA 1F6BA 4DJ3A 5BQ5A 2J3EA 2V1XA 3OEHD 1K8RA 1QZXA 3LFUA 2FE4A 4GMDA 3NVAA 1IAQA 3TSWA 3EX7C 2F6RA 3Q5DA 4A6XA 4OI0A 3AVPA 1CRPA 3C41J 4K08A 3E2IA 3ZVMA 1X8JA 1G5RA 4FWTA 4XH9B 3DZDA 4JLDA 4UQOA 4XVQA 5DI9A 3T1QA 5EJEA 2BCGY 2ODNA 3OIUA 3ICYA 5EZ5A 1UF9A 4C4PA 3PXGA 1IN5A 1O87A 1E9CA 2VEDA 1SZPA 2ZITA 3B1YA 4M1WA 1DELA 5C1BA 5KO2A 2VPPA 4RD4A 2OOLA 4WXRA 2IYTA 2P65A 3E5HA 1KK3A 3GLHA 3QBTA 4BFVA 3U7GA 3CBQA 4TYPA 4M1KA 4H1VA 3K8YA 1UDWA 2FWRA 3KB1A 1W4AA 1GILA 2DCUA 4BFWA 3CR7A 4PC1A 4JKYA 4XD7D 4PZLA 1O3YA 3LNCA 3MQOA 2BEKA 4GZLA 2OZEA 2FDCA 3SI7A 2QE7D 2YC2C 3LX8A 4TMVA 1B0UA 1OFUX 3M4YA 4JVLA 1G1MA 4PPQA 3LRPA 4I4LA 2J0SA 4JVMA 1CLUA 1H8ED 1L8QA 4MKFA 1YKSA 4PQFA 2H18A 4TQUS 2ORVA 2DR3A 2OFOA 2QAJA 3RAPR 2H28A 3NEYA 4RCZA 1P6XA 1U9IC 3EWSA 1KI6A 3GJ3A 5AWFC 3THXB 4CGZA 5F68A 3MCAA 4JIMA 1WBBA 2QP9X 4LRYC 4EPVA 1TU4A 3PUZA 4R2HA 4HSEA 4CEIB 4EFLA 3W8NA 4EPWA 3UWOA 2VIIA 1JEDA 4PR0A 3D72A 1M8PA 2BBSA 4Q1FA 2ONKA 2G6BA 4DLYA 2AL7A 4WN5A 1GFIA 2KX6A 1KMQA 3OFND 3IUYA 3FHTA 1JJ7A 3LX5A 3B6EA 3RDPA 5EP2A 1U81A 3SJAA 2XXAB 1VYUA 5HZHA 4KFUA 4DSNA 4Q4JB 1R10A 3Q9LA 3D3QA 2WPDD 3TH5A 4LPKA 1NIPA 3RH8B 1R8SA 2BM1A 3FMIA 1D7EA 621PA 2JCSA 4MGKR 5TV2A 2NQ2C 1R0XA 1F60A 3LYXA 3E4PA 3ASZA 4C0JA 3W5JA 1S66L 2E87A 1S1MA 1HV8A 5FTKA 4MDEA 3ND8A 3UMDA 3QPVA 1E9FA 3SE0A 4BFUA 2XITA 4PZZA 2EA9A 4GFDA 1KJWA 2IXFA 1E6CA 2ZOHA 4EEUA 3TW8B 1NN5A 1TF5A 1W1WA 3B1WA 4PO9A 4FN5A 4Z1MD 4RFSA 1WA9A 3CAXA 1GRNA 2CL6X 4ASUD 1W4CA 5CM8B 3ZS9A 2UZIR 2Z4SA 5FOTA 1E94E 2D02A 1AS0A 1WB9A 1IJFA 1D6JA 4Q47A 1JALA 1ZNXA 2EYQA 4YMVA 2DYKA 2PDRA 1KTVA 3IKJA 4MRSA 1W0KD 2VQSA 4WUJA 1W49A 2VF8A 2H1LA 2GK7A 4DLZA 3L0SA 5EZ6B 1ZD9A 221PA 3A0SA 4ILEA 2FFAA 3X1YA 1Z0IA 4D4JA 3EPKA 1KIMA 2PZFA 3LWNA 3DM9B 4GL2A 2JDID 4M8NE 1U99A 3UB7A 1DAGA 3KQHA 2GDJA 3K09A 4NKRA 4PSVA 1ZW6A 3OESA 1HA3A 1AQUA 4ZDJA 2INWA 4TT3D 2OSBA 1E98A 2BM0A 1JB1A 2R44A 4Q7JB 4YMTA 1I2MA 4JT4A 1NP6A 4OQFA 4QGGA 4URUR 1YZKA 4B9OA 4G1UC 1EFHA 1XTIA 2NO1A 2B6HA 3WHLA 1OXXK 3EWAA 4V0ME 1K5GA 1T0HB 5FPKA 3ECCA 1AS2A 4HUTA 1RRFA 4Q00A 2PCJA 2PCLA 4CRWB 1Z28A 5IDVA 1P9RA 2EW1A 1T8UA 3QG1A 5FPYA 3W3ZB 2A9KA 3O8RA 4RD2A 4FCWA 4TLCA 3IEUA 1E2GA 3X1DA 3NH9A 5KNBA 1IBRA 2RB4A 2I1QA 3WNCA 4LV8B 1XD2B 1NLYA 2Q3FA 3VHXA 3BRWD 1S67L 1G6OA 1KI7A 3T1VA 1P73A 2RKOA 3W5IA 3R9XA 1TQ6A 1WE2A 4PHHA 3AVWA 2JLWA 3VTKA 4M2LA 1KY2A 4HJ3A 1T9HA 1D2MA 1W4BA 4FMDB 1U8AA 3CWQA 3LI9A 5AK0A 1ZM2A 3I61A 2C99A 4Z54A 4NE2A 1G18A 5IS1A 1Z6GA 4JLPA 4NBSA 2GXAA 1E1QA 4UXIA 4F91B 4V0LA 4HAUA 4DDVA 1NN1A 1KSGA 1A82A 1Q57A 3ZGXA 3R8FA 2AHOA 2J7PA 2A5DA 5FL7A 1JNUA 4WF0A 2HEIA 3SHWA 3SBDA 1NIJA 2P6RA 2OLKA 4GRAA 1U94A 2W0SA 4QBGB 1FNMA 2Q6TA 3ZZTA 3CRMA 1QHYA 3OAAA 4ACBA 4TSFD 3M0EA 4DLVA 4N3NA 4AY2A 5LBIA 4W9MC 5FTNA 4OQNA 2QHKA 4A4DA 4JKIA 3BK7A 3TQFA 4R98A 5LB2A 5G4YA 2FPMA 1QG2A 3B8HA 4V0KA 4KO8A 5SZHB 3QXCA 1XFAA 2ZIAA 2QBYA 3NOTC 4OYHA 4QHSA 1XCMA 2MSDB 4AYXA 3GLIB 3VE4A 2X8AA 5F3WB 4DCSA 3NOUC 5IHPA 4Z8YA 2G1JA 4A0HA 1S1CA 1P97A 3L2OB 3GJ4A 3L43A 5FBLB 5H1YA 3T15A 4AKEA 4D0LB 4EPXA 2QWSA 4DCTA 3S1AA 3FE2A 1CR1A 2MSEB 4B3CA 2JGNA 2ATXA 4UNPA 4PQYA 1G3UA 4II7A 3NHQA 4DIEA 2D2FA 3CPHA 1GG2A 4WZAE 4RSGA 3CX6A 2CCJA 1PV4A 1G64A 1JR6A 5J5CA 3OZXA 1G6HA 1QG4A 4PAOA 4OHXA 2O8DB 1LF5A 1QVAA 1G5PA 1E9AA 3H4MA 1MABB 4HJ6A 1KMHA 3JZAA 4DLWA 4M9ZA 2Q3MA 3CPJB 4F4JA 4D25A 3B60A 3QKRB 4MQBA 2GTPA 2V55B 1GNQA 4BGDA 2C8VA 3NHAA 1GKUB 4NCKA 4P4SA 1DG1G 1YZUA 4LUCA 1VB6A 4Q4HA 4KSBA 4CT4B 1CR0A 4CYMA 1P2TA 1R0ZA 1XD8A 3FMFA 4XVUA 4LWZA 1DPFA 1XMSA 4ZPXA 5JWHA 4CIDA 1XTQA 4BLRA 4JGQA 2DFNA 2XSZD 4MGIR 2F1IA 1ODVA 4LJ6A 1XMJA 2ZAMA 5SZKB 2H17A 3SFZA 1SKYB 4B3XA 3MSXA 2QAGC 2NO9A 4HYYA 5L3RA 4OK5A 5J4VA 1N6HA 3KKMA 1HE1C 2Y8EA 1IXSB 2CK3A 3AF0A 4C0KA 2R6CA 1CEEA 5HR5A 1SHZA 2JIZD 2C9YA 5I5LA 1G7TA 4KFRA 3SFVA 3VKHA 4WVFA 1PUJA 5AJYA 5M04A 4HQAA 2YWHA 5G3YA 5L8VA 1U0LA 5GADl 4JJKA 4O2LA 1JBKA 1JQLB 2ZSFA 4JLOA 1GSXA 4TLEA 1GL6A 4TL7A 4ZDIA 3H9WA 1KO7A 4DHEA 2HV1A 1H65A 3H82A 3UATA 2WIAA 3R7WA 3QEOA 3TW4A 2J46A 4BFTA 2J7KA 721PA 5KIZA 3O8CA 2PZGA 2W83A 2QN6A 4QJ3A 4B2PA 3GLHB 1NMZA 4HH2A 1M6NA 1R5BA 4NONA 1D9ZA 1IQPA 1E0KA 2X1VA 4D2IA 2FFBA 3BE4A 1K6MA 4TTQA 1P72A 1DTSA 4FW9A 2ERYA 1E69A 1IXRC 2WJJA 4IKEA 2ZRIA 4MUBA 3W90A 1QHHA 1YR9A 3A0RA 4KYUA 4IDOA 1N6LA 2GJSA 4M4XA 3GCGA 4PFSA 2VP6A 3GFTA 3MMPA 4GI7A 1KDRA 2RGBA 2ZRMA 5JMTA 3I3SR 1EWQA 1S4QA 1LVGA 2KB0A 5H70A 4P4UA 3R9WA 3C14C 1W5TA 3RRYA 2PZEA 5FBRB 1DO2A 1OXTA 4KJZA 4TLBA 1LY1A 3WNBA 5TARA 1N0UA 4FCVA 5DKLA 4P0TA 1LS1A 2Z4RA 1TU3A 3WY9A 2XEXA 1KI6B 2ZRAA 1E1RD 2P6NA 1N6IA 4R2IA 1XPOA 1MRSA 4D0NA 3RC3A 2UVQA 3GJ7A 1XD9A 1CJVC 3LBIA 2OXCA 3QE0A 4KUKA 2OUKA 4BLOA 5F9HA 2BVNA 2GEUA 4F92B 5DGXA 3TQCA 1JXMA 2IWHA 4C2UA 4MRNA 4K81B 1IM2A 4KFTA 1TS8A 1X0OA 4HOIA 1KSJA 5J4EA 2ZSDA 3UPUA 1Y3AA 2WWIA 2ZRJA 2V1AA 2OCBA 2ZRCA 4IW3B 3OHMA 4MH0R 3MWLA 3C5CA 2HLDD 5FBWB 1E2FA 5C4GB 2BC9A 2CJWA 3AP1A 4ARZA 4BEJA 1NI3A 4BLPA 1XZPA 3N70A 4LBYA 5E4FA 4CEHA 4HHDA 2OHFA 4QGHA 3MXQA 3F1PA 4K8OA 1N9NA 1ZIOA 2CNWD 3T5DA 2G0TA 3DDCA 4QBHA 1U8YA 2ZM5A 2DWOA 2ZJAA 3DEFA 4GOKA 5AUOB 3I32A 4LCBA 1OH7A 4QJ4A 3GFPA 1MZUA 2YWEA 2HXYA 2IS4A 4NZYA 2FA9A 2VYFA 4D82A 3NJAA 4Q1AA 3VOLA 2JEOA 4BRWA 3PEWA 5DO9A 3TSZA 4ESVA 3FMOB 1ZP6A 2IL1A 4AWXA 2OM2A 4RFSB 4LBWA 3QKTA 4GCZA 2IK8A 4LJAA 2QKPA 1KZGB 4M1TA 3WNDA 2ZRHA 5JRJA 1MH1A 1QRAA 5TVKA 4NL4H 2CDNA 1MRNA 3K9NA 3GLIE 1OH6A 3I92A 4JGPA 3ZYCA 5LDDC 2XTNA 5FTLA 3QJYA 3CPEA 4OQLA 2RHMA 2BIFA 4IRUB 1OT3A 2WSMA 2J9RA 1ANKA 4HAZA 4QGAA 2GJAA 2GZHA 4QGFA 1N9OA 3TAUA 4A92A 2OXRA 2Z43A 4PHTA 1OV4A 1CIPA 2AX4A 3ULFA 5TBMA 1XU4A 1HT2E 3NC0C 1E2HA 3NBYC 2WJYA 3PUVA 2WWGA 4DJ2A 1T5IA 2VA8A 2C78A 4A6PA 1KK2A 1XJ6A 1XF9A 3CM0A 4BRUA 1FX0A 4F7WA 4H6JA 1TEXA 3PUYA 5DHFA 1NBMA 3NOPC 1XDBA 1F2UB 1MO4A 2DY1A 4KLZA 4Q4LA 1XJ0A 5C46F 4DB2A 2NZJA 2C96A 2B8WA 1KSFX 1E2EA 3B9QA 2VHCA 2KJQA 1F9IA 1U0JA 4TWZA 2WICA 2BASA 5FH9A 1UPTA 1Q3HA 1T19A 1T91A 4DLTA 5A0FA 3TUZC 1NY5A 4UXJA 5BN3A 1OFHA 2HUPA 5FOSA 1HYQA 4NCJA 2W2XA 3AH8A 3NKVA 1E2QA 2ZYWX 3B82A 1ZUHA 2LCFA 5EXXA 5C18A 2F7SA 3L0IB 1SKYE 3T1OA 3UMEA 2XTMA 5KYKA 4NXBA 2JAQA 3AP3A 1VG0B 4HEJA 1ZNWA 5E95A 1ZNYA 2BKEA 2RGDA 3CNOA 3REGA 1M2OB 1QVRA 3KKQA 4G5OA 2QY9A 4MUAA 4UJ3A 1FFHA 3IPXA 4QFMA 5H68A 2HJVA 1BYIA 3H0KA 2XJ4A 3BJIC 4DLUA 3RLFA 3R9IA 1Z6AA 3CLVA 2CVHA 3ND9A 5DN6D 1P9WA 3VR3A 3TUIC 1N5LA 1R2QA 1ZU5A 2BMJA 3RNLA 5DJUA 1MKYA 4LJ7A 2GJ3A 2QGZA 2P7JA 1XXHA 3DMNA 3F8TA 3TUJC 1E1QD 1P62B 3B2EA 4YQFA 3B13B 5F98A 2P3SA 5TY0A 5IF9A 1RC8A 2J7PD 2CLCX 2FH5B 3GLHE 2K5UA 3GEEA 5FL7D 4Q02A 3RRNA 3WHKA 2ZRLA 4CEJA 2GNOA 1YR8A 2IUTA 1DVRA 3EZ2A 3O8DA 3ZIAA 4BEBA 2JLUA 1ZINA 3HYRA 3LO5A 3OAAD 4Q4AA 1AK2A 3UE6A 1G3QA 1LFDB 2QBYB 3I5YA 3BGWA 1Q1QA 1IOZA 2X2FA 3GLGA 4GT1A 1ZMXA 2VHQA 3DL0A 5C2JB 3SBEA 1QHXA 3TK1A 4E5UA 5KU1A 4D26A 1P2UA 2VSOA 4LI0A 1FQJA 1QHIA 2D74A 1M7HA 4C30A 2I1VB 4KSCA 2ODEA 5GJWC 5B30A 2RGGA 5JLJA 5KSOA 1CULC 2YOGA 2ZRDA 4TSFA 2PMKA 5JI3E 2IYVA 4OI4A 3F1OA 4HH3A 1NLFA 2B7BA 5G4ZA 4HAYA 3S1AB 3WMEA 4EQ6A 5KDOA 3EA5A 3EC1A 5DISB 3LIDA 3BFVA 4F38A 1XCPA 4MYTA 4P3YA 3IPYA 3SHFA 1Z0DA 2CVFA 5AJWA 3RC8A 1RIFA 3PEUA 4KU4A 5KSYA 4M9SA 3I72A
chains in the Genus database with same CATH superfamily
2HZ5A 5J43A 3QW2A 4FDTA 4LYYA 4DCUA 1GZ6A 4CIAA 4OB8A 3IA2A 4ZV9A 1GV0A 1CJKC 1UBKS 2F3RA 1J07A 3GPBA 2XIQA 2ZUVA 1GRQA 4ZVPA 4HLDA 5HRUA 4MVCA 1FRZA 3IH8A 3KYZA 1KRWA 1UDBA 2UUPA 5HJ5A 2ONJA 3IDQA 3CSUA 3SEAA 3HJAA 4UM9D 3ZD9A 3LY8A 4PZYA 2DC1A 1N2HA 5ESWA 3NHBA 3ZGZA 4EBLA 2R6AA 1N6OA 2QE6A 1NBWB 2R9XA 3R7AA 4CG3A 4FE4A 3HRKA 3V3TA 3CIFA 2G4CA 3VZDA 2DWCA 2Y1LA 2ZYVX 1YRAA 1G7RA 3WKDA 2RI1A 2M7VA 4F93B 1JAHA 2B4AA 2OOSA 3FH0A 5CCXA 4PYMA 5JWOA 5TEWA 1QIHA 4ZCIA 1UKYA 1PT5A 4IDFA 3Q7VB 5E1OA 2HLDA 5K4GA 1WD5A 2WNIA 3WGUA 3G30A 3GJRA 1QQBA 2CDRA 3FPSA 3KT3A 2DF8A 3RM3A 1RLJA 5JCOC 3RJ5A 2GD1O 1FSGA 3UFBA 3BWLA 1NYQA 3NEPX 1DJNA 4XB1A 1H05A 1UKBA 5JBIA 4R41A 1YBAA 1VEUB 3AUTA 1BS1A 1PTJC 5I9MA 3NOQA 5FOVA 2IU6A 1RTKA 1ISSA 3IP8A 3Q3HA 2XDWA 4HXGA 2P4SA 3PNYA 3VE3A 3G85A 2COEA 4OYLA 4HDNB 2NUPC 3VMFA 1D06A 2JFNA 4NHOA 1PL0A 5CA1A 1UJ4A 2IYPA 2OD7A 3TZEA 1J33A 4QJ5A 4ED9A 4EW2A 3BQ8A 3U56A 3VI4B 4G8CA 1KERA 4BB5A 3RU9A 6CHYA 3V1LA 2CLFB 4ZDXA 4RVCA 3HLBA 1NW8A 1O6CA 3VGJA 4EQIA 3BCHA 2H1WA 3F1OB 4FW8A 4H4EA 1ECJA 1P2GA 3WLTA 4CV2A 2QDKA 3G79A 3NNNA 1AQLA 4QWOA 1JXAA 4R9UC 5JDCA 5IAOA 2PX8A 1IFXA 4EPYA 1YNOA 2Y59A 4DANA 5ARBA 1L7EA 1TS0A 3K9QO 3T5PA 4B46A 4GWKA 2F3UA 1FTSA 5DZSA 4GZ6A 4F4CA 1JG4A 1BAPA 4AYWA 4O33A 3WX0A 4OI2A 3CPTA 2N46A 1PVVA 3IHWA 2XXBA 2ZBBA 1G2IA 4X60A 3NCHA 2FOIA 1MR3F 3ESBA 4FYWA 3QI2A 4CLDA 2PZMA 4LDJA 3T06B 4WL9A 4QXOA 1Q1NA 3PHIA 4GMHA 1E5XA 5ALIA 5FQIA 2CYBA 4MMXB 3WFJA 1OOEA 3H3XA 2ZUFA 2WUGA 4WJKB 3QE2A 2PD4A 3I6MA 4DMKA 5EY5B 3BECA 2W37A 1P7PA 4MLDA 3CZ9A 1UAYA 2ZRNA 3R23A 4PWZA 5JY6A 1SD5A 2VV6A 2Y1DA 4EERA 1GVHA 1K7CA 1NYMA 1RM3A 5DLQC 3EBPA 2Z1NA 4WOCA 1W36B 1GGKA 1U3VA 3WRXC 5ABPA 4RL6A 1CQIA 4EHAA 3KSZO 1UQRA 4X0EA 4DS3A 1TADA 4M0EA 4MBKA 4YRJA 1PJ8A 5DF7A 2CWWA 1CJTC 4NVRA 3O8QA 2XOKD 4C0LA 2OILA 4UFNA 2R8YA 5KQPA 3RC2A 1CBUA 1DWOA 2WHYA 1Z2AA 4FGWA 2JASA 3MBOA 1RCJA 5DCYA 4QD4A 1ADYA 3CUWA 5FI1B 2HNKA 3E2KA 2CMFA 3W4PA 1GUFA 1F12A 3PQ4A 2HHAA 3L1HA 3CJRA 1FZTA 5EJAA 1Z9BA 1WF3A 2ZI3A 1VGQA 1XLUA 3ZWXA 4Y0UA 1OLSB 3QUSA 1Y5IA 2WJPA 3IAM6 4QRDA 4OXKA 3LVRE 5FI7A 2Z8ZA 1XQWA 2DOKA 3JWEA 4DKXA 3HBAA 3PNLA 4GDFA 2GX6A 1A69A 1MEEA 4UPEA 4RPHA 1X15A 4YRTA 3HA5A 5BYKA 3FSEA 2YMPA 4MMYB 5ALQA 3FR7A 4IRMA 1DJBA 1NR7A 3WL5A 4M0PA 3WKBA 4RPLA 1Z39A 2AQKA 5J40A 4MJXA 1VQQA 3OPYB 5EXEA 2ECPA 1D04A 5AVZA 3H1BA 3B78A 1SG6A 3WZ2A 4MS3B 1AHPA 1IY2A 3M6XA 1YIOA 1G4UR 1WCIB 1AS3A 5M29A 1UFQA 3E4OA 4CV1A 4ZIRB 2XDAA 1U9IA 1I2DA 1Q0UA 4ZCQA 3TIIA 1MOQA 4X63A 2FW0A 4UTOA 1DBSA 3UG6A 3NW9A 2X86A 4I6GA 3F6EX 1TGVA 2AMVA 2WJ4A 4TRRA 3DYIA 3S4XA 3ECAA 3TAHA 3IC5A 1IOVA 1TM7E 3FD8A 1PDWA 3HUUA 2QZSA 2WWWA 2FWMX 1ZCFA 4L1KA 1QKJA 3WYGA 3AJAA 5KMWA 4HDRB 1DHRA 3UHAA 3JQRA 3HUEA 3VJRA 1TZJA 2PKEA 4PO1A 1FDSA 2WV9A 3ABRB 1H5UA 4PANA 2OV4A 1HYHA 5HOEA 1Z2NX 4XPIA 3M70A 5DBEX 2VTDA 4MVJP 2YZKA 4EZBA 1N8KA 3LQFA 4EHJA 4QODA 3Q07A 5KTYA 4HDSB 3OQJA 4AS1A 5DYIA 5FP0A 1HQYE 5C4MA 1S3SA 4HQOA 4IIFA 2FGKA 4BFYA 1PK8A 3W6OA 4CMCA 4KK4A 2W00A 3JXEA 2JJ2D 2OM6A 3TKYA 3NFRA 5IZCA 3ILSA 1HDEA 4KQJA 4BGUA 4JGOA 1XA7A 1QH8A 1L5NA 4BVGA 3L77A 3VR6A 3RXWA 1P9LA 3LD9A 2O9AA 2GZMA 4ZV7A 4OHWA 1T9GS 4JB8A 3EOIA 3SVLA 3U3KA 3WMWA 5JAHA 4JH0A 4M60A 1J49A 1E1KA 2OY0A 3HEBA 2Q21A 3M5PA 3AF1A 3HADA 2Y4NA 1YS7A 2QRPA 2C83A 3LCVB 4EY5A 4BJ6A 4YAWA 1IBCA 1NLMA 1VYHA 5JD4A 2WM3A 4NNOA 3TIFA 5ED0A 3HLKA 2XWJI 2V2FF 2BGWA 1GA9A 3DLBA 3V32A 4CMGA 3C8UA 2XCTB 1E18A 5AI9A 2IHUA 4J49A 5C0OE 1QTRA 4MITA 1PFQA 4C7OA 3QOFA 4EI2A 4JXSA 4G56A 5ECWA 5HZGA 3GGPA 3H7AA 4HNBA 5HMMA 1P5ZB 2QX9A 1U0TA 1OFVA 2HIAA 3EUWA 3HACA 2G76A 3C38A 1BA2A 3LBNA 3OO0A 4ERNA 1PJLA 1HT3A 3KYCB 3OPQA 3UFXB 4JGIA 4DNQA 3HJCA 3UIEA 1Y8CA 5TE9A 4CDGA 4UHCA 1RBZA 2NADA 4GP6A 4REQA 1E3WB 4REMA 2HZ7A 3R3XA 2WQ7A 1PRQA 4WUVA 4ND2A 1GPUA 1NF8A 4B3MB 3OJLA 2CJXA 3IP5A 3ZLVA 2J3LA 3S2SA 1NUAA 1TC2A 2HJRA 5F9FA 4BPRA 2O8FA 3U4IA 1ECFA 4RM3A 1EX7A 5LDHA 3RSZA 1C7JA 1UJNA 3UY6A 2V7VA 2FZLA 3S1SA 1MCZA 4JEIA 1M34E 1RCTE 3K0FA 4OQIA 3BH7A 3NZEA 4HNUA 1SK9A 4JYCA 1I7DA 3TMYA 4DA4A 3A6KA 1O57A 2BUCA 2P5TB 2X13A 3ZWCA 1A8HA 4M8KA 3K3DA 2B1JA 4MA4A 4HWPA 3PXPA 4HGRA 3U4AA 4OKNA 3LR4A 2WD8A 3VQTA 2OGTA 3QM1A 1NJ4A 1AZWA 1NE2A 3TVDA 4KBGA 1Z68A 1NOIA 3BB4A 3FZCA 2XD1A 2QDXA 4UCWA 4OGGA 2WVAA 4C7KA 2H85A 3WL6A 4OK3A 4HJ4A 2PMBA 4MA5A 3W6NA 2Y6VA 2MSWA 1HEIA 3CXRA 5HYVA 1BMTA 4Q3NA 4NK5A 5BV8A 2K7SA 3MRSA 2AN5A 2EZ9A 1DOAA 5DXAA 1Q44A 3U60B 1P5RA 2UUCB 3DUFA 2PR6A 4A91A 2I7XA 2ZBFA 1LPNA 5PGMA 3GLFE 2GVDC 3SS9X 4M7PA 5BSFA 4DDYA 3WRVA 3R41A 1FRFS 1OXBB 2A35A 2UVDA 4M98A 1P1RA 1YAHA 3IXQA 3HZHA 3PZRA 5A93A 4IBXA 1B3BA 4Y9RA 2I6QA 4O0PA 4YJGA 3AF2A 1WMEA 1ENZA 5F5YA 3P2MA 5D00A 2GHIA 4BLQA 5BNFA 4Y3IA 3UMSA 3LL7A 1VBKA 5TSDA 3DEAA 3CEHA 3QMMA 3RBAA 4FGKA 3TLXA 1ZJJA 3A7EA 4UNSA 2DKNA 2ZJOA 1K25A 3TINA 3RTCA 3E70C 3O47A 3BOSA 1LW7A 4MGYR 2HDQA 3FFBA 3SXUB 4B9AA 2X3FA 3OPRA 3QVGA 3B3XA 1V7CA 4BNLA 5T3YA 3SJBA 2R6R1 2CXOA 4GNUA 3FDJA 4JY7A 4PG6A 4PC2A 4IUBS 3OCNA 4H77A 1A4IA 3DCNA 1WNTA 5KPDA 4KQ6A 4JI4B 3ZU2A 3FCYA 1YT5A 2WA1A 4P32A 4BD0A 2RI6A 4RHUA 1JVSA 4TLMB 5U4XA 2XVXA 3UB4A 2ZSAA 3DAPA 5KTKA 3CF2A 2WHPB 3RSOA 1TF2A 1X94A 3LUGA 2H16A 4K28A 2YHSA 3RUFA 3C3DA 2VAMA 4JJAA 4CBVA 5DKFA 1OTAA 7AT1A 2E37A 5GP1A 1T1IA 1RVV1 2AXPA 3NHFA 1Q84A 1HQCA 1G5UA 4BENA 3COWA 2C0CA 5AI0A 4XUEA 4FM9A 1PKXA 1S0UA 1SC6A 4XT2B 3AF3A 2J3IA 3FNQA 5JV5A 2GWHA 4RK1A 4Z5XA 1XB2A 3E48A 3MUOA 1JR4A 5F4ZA 1GSVA 3HBMA 1U7WA 1XQXA 4OLAA 2JHGA 4EMUA 4F2HA 4MZDA 5H16A 3OIUA 4CM4A 5JH7A 3O3CA 2ZITA 4CM5A 4N4AA 4B7UA 2O48X 2ZPUA 4DSZA 4C2AA 4X3OA 4QUDA 3WMRA 3LIIA 4ZI5A 1L8QA 4YRSA 1CCWA 1BDMA 1VP3A 2QAJA 2H28A 4H18A 1URPA 4QEKA 5T41A 3GSGA 3FNRA 4MUHA 3BA1A 2PRZA 4FKZA 3ETEA 3B6EA 5F21A 1VYUA 4EHDA 1CNEA 1L7AA 5AJHA 3G8CA 4LPKA 1NIPA 3QH4A 1E63A 3SSNA 1N5MA 4BV9A 5A4DA 2IHNA 6GPBA 3JAKB 1X1BA 3E3NA 2W90A 1V6AA 3UJBA 3CZAA 1KJWA 4LE1A 1FSPA 1UPAA 2P40A 3ITBA 2TYSB 5FYDA 1IJFA 4IF4A 1JALA 1C9JA 4M9CA 4YJHB 2RARA 1QCYA 1AXGA 1HVBA 3L0SA 3PQEA 221PA 1C4WA 3AI1A 2JHPA 3ZWVA 1SXGA 4KGDA 2V7WA 3ZG6A 1NQTA 2VF5X 1AQUA 3F4BA 2OSBA 2BM0A 5DX8A 2B37A 4G1UC 4CMBA 3WQRA 3R0XA 5CT5A 4RIIA 4G8BA 5IDVA 4KAJA 1Q17A 2A9KA 3F7TA 2HHHB 1NLYA 1SPBS 4YPFA 1J0XO 3RJ9A 3WWEA 4O4JF 3HB4X 4KZKA 4Y1FA 1PR9A 4QFDA 1FLVA 1QZUA 3HWRA 1P39A 4OVDA 4F91B 4G2NA 4IGFA 5T4BA 1AMNA 3I1IA 1JNUA 3ZXSA 5ALJA 4EKIA 4BO6A 3CRMA 1H5QA 2IU4A 4N3NA 3JD0A 5LB2A 5G4YA 3TRDA 4L73A 4BZZA 3SC2B 4ARUA 2HV9A 5HQ3B 3E7FA 1P97A 3P9KA 3U4MA 4NBUA 3QLEA 4EYGA 2FRXA 1K3UB 1VI5A 1IWBB 2ZMAA 2PAVP 4KMMA 2HJEA 4LWZA 4MR8A 3REQB 3DONA 2D8MA 4X56A 5JZ9A 5I7RA 2C9YA 4KH1A 5TVGA 4EI9A 2ZWAA 5DPMA 3T1QB 1JQLB 1VL6A 3H82A 721PA 3FB1A 1S5PA 3STUA 1D9ZA 3R5HA 3T95A 2FFBA 4U0TA 1L7BA 5B4UA 4DIMA 4ZEOA 4J3FA 1KDRA 5JMTA 4WERA 2IOFA 2JIBA 1O8CA 1GLNA 5TARA 4BGVA 5IMBA 4OX9Y 4IMIB 1ODTC 2EWMA 3NKLA 1U1CA 3GJ7A 5EJ8A 4FBMA 4LZOA 4M83A 4CLCC 2FPSA 3OM0A 3TQCA 5HDQA 4EKNB 5MN4A 1X0OA 1KH3A 1U0EA 1QIEA 4IBRA 3FBTA 3IAUA 2YY7A 3UWDA 1V3UA 1E6MA 1XZPA 3N70A 3TOXA 2MOKA 2CXUA 3H19A 2VGLM 4NJOA 1UMCB 4TRNA 3S6JA 4DMHA 3B42A 3VVMA 1XVUA 5DWDA 1TIKA 5HIKA 1HTBA 2K6GA 3EGXC 3FOFC 2IK8A 3DTIA 1CVIA 1IHDA 3ACDA 3K9NA 4D43A 4KWTA 1G66A 5K3EA 5JYOA 3I53A 1CIPA 1RJFA 1XU4A 3I2FA 4TV9F 1KK2A 1VP9A 1AKTA 1QZ3A 2ZYSA 2JFGA 2G67A 2KQUA 3MTDA 1UPTA 2Q5FA 5DWVA 2DUNA 3E2PA 2PLWA 3IERA 2LCFA 5KMGA 3G23A 1U7OA 3L0IB 3C97A 3C1TA 3OSUA 2SICE 4ZGWA 1Q5PA 3MJSA 5B6IA 4GPZA 3F6BX 3CLVA 3QFFA 1ZGHA 1E1QD 3BIOA 3VNRA 4GXNA 1M2VA 2IQIA 3IF5A 4O4HB 1JX6A 2EF1A 5KWJA 1LFDB 3H4VA 2VN8A 4YWJA 4H1HA 2X2FA 3PF8A 3GLGA 3L7BA 1F8UA 4NWIA 1QHIA 3QLUA 1XQVA 4KIGA 2D74A 4RELA 4C30A 2VAXA 1SXIA 1SK8A 1TAHA 4QJBA 3ZWMA 1ZK4A 3FYDA 3S2UA 4M9SA 3AB3A 5LWQA 1S1YA 4LV6A 3D31A 1KKMA 1J4AA 1DARA 1H0KA 3IIEA 3TBHA 1W5EA 3CE9A 3Q8MA 1FUKA 3L40A 3U9LA 2W8ZA 2CCGA 5FNZA 5CXQA 2QMEA 3FI9A 3Q6MA 3PZBA 1K56D 1ZBDA 3N0VA 1G8AA 4KKVA 1E7RA 2KX7A 3P0IA 5K3FA 3R7WB 2UKDA 1QH1B 2XB8A 4RVSA 2H4JA 1FZQA 2V7GA 4N9KA 3JQ8A 2NZ2A 4HAXA 1YJAA 1YFKA 3PIDA 3H8JA 1JIUA 4UHFA 3G5UA 1MO5A 5A3SA 4PM4A 3RYHA 4ZCRA 4NZOA 3EA0A 2GPAA 3BRCA 5CT4A 4C75A 2P8JA 5G2OA 4BQEA 4P5DA 1HGXA 4JBNA 1B6GA 1E1RA 1MC5A 2C4NA 1NRJA 1LWOA 1QIKA 3LC1O 5EMKA 4LKOA 3IEVA 5A4FS 3IHBA 5FQJA 1FVXA 4G9GA 1VLJA 1T1GA 2VEAA 3H9GA 2UZAA 1UOPA 5GJCA 1XSEA 2IX3A 3N2GA 5CR9A 4F3TA 2PJRA 2CNWA 5LA6F 4W7SA 3ZDQA 4MW4A 1ZICA 2RAUA 3AUFA 3AOEC 3DAGA 1EFPB 1DAFA 4NARA 2E6KA 3PSHA 1HH4A 2CHVA 3D3WA 4RA7A 2IIVA 5LZ2A 3KEOA 1GRRA 3SZGA 3MXTA 4ZYUA 4XKJA 1F5SA 3IYLW 4EQZA 4WX2B 1KO4A 3F90A 5DHQA 1F9AA 3M1AA 3RWMB 4KZ7A 5CERA 2Q9AA 4LJSA 1UJ5A 2V6FA 3EBOA 3DKVA 2XADA 1D2AA 1IRXA 1JPUA 1CDDA 1U2RA 3JQ7B 4C89A 2PGJA 2VZLA 1FP6A 5CFMA 1YZYA 2H48A 4M0LA 1ZDMA 1UWKA 2J3WA 4LHWA 2OWHA 2YIJA 2YYYA 4OQHA 1GU7A 2H2FA 1NRIA 3NAZA 5DGCA 4S2LA 3MUNA 1QGYA 3HP4A 4F1JA 2Z6AA 2CHEA 4RJKA 4H7PA 5EGSA 3SC4A 3PNBA 2J45A 2A1IA 5EJMA 3W2ZA 2XA1A 10MHA 3MIIA 2W0NA 1KMNA 4IHAA 4HY8A 2QI9C 1Q1AA 4KK3A 2EATA 3QFTA 5ITWA 3V2IA 1ES2A 4MYRA 3OOSA 1W85A 1L8LA 3GZNA 4B35A 5JJLA 4CNBA 2QXTA 3R77A 3ZVTA 3GZ4A 4N1XA 1XXMA 1A8PA 3C1OA 3K09C 4V39A 3UOAB 4S2JA 2J08A 4Z86A 2OBFA 1BD3A 2FX2A 5BSRA 1T4BA 4G0XA 3BJMA 2FN8A 2R3SA 5DRYA 3ID6C 4EW7A 1KYYA 4AIIA 3DA8A 3QP9A 5EINA 4YI3A 2UUOA 4TYWA 4ABTA 2CEAA 3IURA 1RMQA 2QORA 2OVBA 2BR5A 2LBPA 1TQDA 3I01M 5F5NA 4POOA 4Z8XA 3UXMA 3V2GA 2TECE 4ZU3A 1Y3IA 1WJGA 5SZIA 3LXRA 2JCBA 5SZJA 4YP6A 2X0FA 3DWFA 3JARA 1OWLA 2DH6A 4S04A 3JQGB 1Y37A 5SY6A 1G21A 4MA0A 4KAFA 5KQGA 2D1TA 2ZP1A 4YUAA 2X3YA 4EJ6A 1GG9A 1Y9DA 4YRBA 3T7DA 5HEKA 1Q0PA 1GT6A 2BM8A 3ZDDA 1RI2A 2L82A 4XEHA 1JEQB 1NJ2A 5HOQA 3HO8A 2ZTSA 4MWGA 3NXSA 4TMXA 1P19A 5IJ9A 4TZ0A 4UEWA 2LPMA 5EERA 2PAAA 3AESA 4GLBA 4XOIA 2QJTA 1B6RA 4UCXA 4IJGA 4E3JA 4UARA 4Q9KA 3VVCA 5IWAB 3TLAA 3ZV6A 1VKHA 4Z9BA 4IIUA 3Q9UA 4GBED 2PS9A 3C3WA 3MT7A 4LF5B 4D8TA 3TKLA 3LPCA 4IJ6A 3DFZA 4P8RA 3LT1A 1L7MA 4RPCA 2ORWA 2FY8A 2PYPA 5C8XA 3EIUA 3LRXA 1LLQA 1IPEA 4BL5A 4QTYA 5BURA 1GPAA 4EGCB 2OAGA 2Y8HA 3OPVA 3IOMA 5DTRA 1I7NA 1MGOA 4RO0A 1OC2A 3NTUA 1KVLA 1FDRA 1SXJC 3GYBA 4INOA 1BJRE 2I4MA 3A28A 1X13A 2DXIA 1WXDA 5CNJA 2NU6B 3CURA 1ZMOA 1TOAA 2ZS8A 4EZEA 2VCYA 5E4YA 1Z12A 2PX0A 1CUWA 3ZYZA 1XK6A 3IKMB 4CF7A 3ZWNA 3TFWA 4IPTA 1C0PA 1CJMA 2R11A 4D9KA 4JP8A 1R5NA 2OKGA 4M9QA 4CMEC 2QMUA 5JSUA 1ALQA 3RF6A 1GL7A 3FJ1A 1GYPA 4LRYA 3K9LA 2W1RA 3ED5A 1YM1A 5CJPA 5AKLA 3HCDA 3PDIA 2WD7B 4HB0A 1RZRA 1MN6A 2WIJA 1XZNA 1GFWA 1SA0A 2C7RA 1H3NA 5AKGA 3ZHCA 3SMQA 4Y2VA 2OLVA 3AP2A 3OCJA 3DBRB 3ETLA 1ES9A 1U98A 3SU8A 1OFIA 3C3CA 4H7IA 4QYMA 1JKIA 3DKRA 4C21A 2W3GA 1F4LA 4QOJA 3E7WA 4OHCA 2VAVA 1A1VA 5GJBA 4AW9A 2QN3A 5JZMA 2Z2JA 1CR4A 4XJTA 4BLTA 3OQPA 2HQRA 2WZBA 4PYRA 1LV8A 4RJJA 4URXR 1TDLA 3ZY4A 3NALA 4NAVA 3WOHA 1L4YA 1KBQA 2BFCB 3FNHA 1OYOA 4DRZA 3DP9A 5KX5F 3DOJA 1V25A 2VOEA 3NFYA 1DL5A 3IKLA 3Q11A 5SYAA 5B6JA 1R8YA 1XJ4A 3UHPA 3GT0A 3CUEC 2I0FA 2XA7M 1Y8RA 1KSHA 1TC1A 4X93A 1G2QA 4PM9A 2F1OA 3WIVA 1LI9A 2QENA 5CU7A 1M7BA 4P22A 5F73A 4JI7B 5CX1B 3OCLA 4KUGA 4OQYA 3I01A 3S2EA 3L18A 4OIMA 4N6NA 2QT0A 3VDRA 2PQ2A 1Q12A 4J03A 2QKYA 1M34B 2KBEA 4PN7A 4EMSA 1THGA 1I4LD 3HYLA 1FRNA 3JATB 2GN1A 3VNUA 4A1OA 3W2EA 1Q3TA 4MVJH 1LPAB 2UWXA 4D56A 4MW9A 4EF4A 4OXIA 4NMXB 4MB2A 4V2UA 1CJUC 2PX3A 1EAYA 1MIHA 2UZ4A 2Z58A 3OZFA 3FSGA 1VSVA 3AW9A 3IGFA 4XRGA 1GTMA 1OW3B 1Y1SA 4MEJA 3S2GA 4FS3A 2WHRA 3E7XA 5BV7A 4H6PA 2Y1CA 5D87A 4AY4A 3QLJA 1A77A 3K2EA 3PV0A 3PDWA 4Q37A 3U62A 2G71A 3A9WA 4K86A 2XMRA 3G0IA 1L5HA 3QIVA 1ZXLA 2PGLA 4EUNA 2ZYDA 3KQSA 4WHMA 5IJZA 1Z13A 2VH1A 4YT4A 2H00A 4KX3A 2V3CC 3OZRA 3ESRA 1FPQA 1QORA 1IQRA 1Z16A 4KNYA 5CG2A 5ERXA 3GLFB 5E9JA 2GEVA 3KUDA 2REBA 1T1RA 1XEXB 3N6XA 1WTCA 2PIAA 4K9OA 4NMHA 2FAXA 4P4TA 3CNBA 4BE7B 4K2HA 2BJHA 4OKSA 2G36A 4HZIA 4BAZA 5GIPE 4GOJA 5EVIA 2G17A 3NJ8A 9ABPA 3D6UA 1DOHA 3UGTA 2KOIA 4EW6A 5TF4A 2CE2X 5ADHA 2VH5R 3UT0A 3C5HA 1UPCA 4IVRA 2Q6LA 4U7HA 4ZKEA 1O0BA 3DTEA 3O0TA 1H22A 2V03A 3JYNA 4EUEA 2PWAA 4IGKA 3IXBA 5I7VA 5CAEB 4AJKA 1DKRA 4ZOBA 2AKYA 3L0DA 2B61A 4HL6A 3IQFA 3VTZA 2EX1A 1EDDA 3ZCPA 4NETA 4PYNA 3NWOA 4K26A 3OX2A 1DG3A 2FPXA 2NW6A 1AJEA 4ZO4A 1KDYA 1MRZA 4U2CA 4BO0A 1E2NA 3MELA 4MGEA 1PL8A 4MULA 4D3YA 2HK9A 3AR6A 1KVSA 3HNPA 4DC1A 1J0CA 1G8MA 1PR1A 1SKQA 4DM4A 3GVIA 3QWAA 3OIWA 3UE0A 1N3BA 2P0YA 4KZ4A 1P17A 3I9LA 2J0EA 3GRUA 5DBHX 2PS3A 1XVTA 3LQRA 5L53A 1AMOA 4WI1A 5HRAA 3HCOA 1HD8A 3KQTA 2XV1A 1WHTA 4GGMX 2PWZA 3GMWA 1S8OA 1T6NA 4DSUA 3NHMA 2WWXA 1SHVA 4HLCA 2HMSA 4YACA 2OZLA 4NCNA 2DKOA 2K2NA 4GX2A 3L7YA 3OFNA 1VHDA 1DXQA 2HF2A 4M1YA 1TRHA 4FDVA 3W5BA 4FHGA 1U63A 3TB6A 1ZL2A 4RA6B 2JJMA 1UBSB 5K1ZA 2WUQA 1OIVA 3UXEA 1R0CA 4UA7A 3WK5A 1SOAA 4Z1MA 5BPFA 4HEHA 4AZWA 3OD5A 4CUKA 2IF0A 4DDSA 7REQA 1NTRA 1P0ZA 3HVUA 1EZ4A 1KI9A 1MOSA 1YSCA 2JGDA 5KNDD 1PJQA 3D2LA 4CU2A 4C1BA 3LBAA 4ALMA 3SYTA 5HE9A 1R8QA 3OTOB 2X0KA 5BR7A 1OB2A 1VE3A 4HDMB 1DV2A 2WF6A 1E9DA 1Y1PA 5HF6A 2K31A 4KYIB 3TLYA 1EW0A 2B18A 1E4VA 4PC3A 2ZJBA 4LZJA 4CQMD 3H65A 3AXSA 3BRWA 1IZYA 3GGSA 2H1SA 1MO6A 3NUGA 4C1NA 3KB8A 1W6RA 5D3MB 3KQKA 3N7AA 3IJ5A 3DCYA 1IFQA 1NVFA 2YMMA 2ZWPA 3BKWA 4BLMA 3NDBB 3CX7A 1VSQA 3X1WA 2BFDB 4LOHA 4KDEA 4F3LA 3CVYA 1MZVA 3ZE8A 5L2FA 2GEKA 1NSFA 3I05A 5F64A 2PO7A 3UCEA 2WIDA 4BVKA 2IU3A 1YJQA 1ML3A 4PO8A 1L4MA 1DP6A 5T8KA 2GHQA 2YASA 1RKQA 2FF7A 4R7GA 1YB2A 4ARAA 2ADFA 2QZJA 2C8KA 1AUQA 2XYVA 2BI7A 3T9BA 4YRAA 1J39A 2J30A 2B4QA 2XSZA 4LRWA 4FC6A 4RYDA 2I7DA 2NUAA 4F4IA 3TMKA 1IXYA 5AVOA 1EP9A 3OEHD 4KXWA 5KCZA 2F6RA 2ZR8A 4OI0A 5BMVA 2JFVA 3A1FA 3BYZA 1VCHA 2Z2KA 1O87A 3N8DA 4BFVA 3GLHA 1GNSA 3CBQA 2E21A 5CHJA 2GX5A 4D98A 5TQVA 3VR2D 2VZEA 4QLOA 4FI3F 1GU0A 1QGDA 1ZH2A 1B0UA 5K01A 5HK9A 5C8DA 4JVMA 1H8ED 2CF5A 4C6YA 1PG2A 3A7DA 1YBMA 1FJ2A 3LJKA 1EVEA 2C4KA 3HJFA 1BEZA 4MUXA 4R2HA 4PM6A 2HMTA 2QRLA 2VIIA 4GX1A 1E20A 4Q1FA 3NTRA 3CX3A 5G18A 3TSAA 3MTAA 5FLXA 3LEQA 4CM6A 3SJAA 2Z6QA 4J1TA 3TZCA 3ND6A 4MICA 2V96A 2KMLA 1EGVB 3D4NA 4F5DA 3BWVA 3LYXA 2HBZA 2AYXA 2Z9DA 4PG4A 3VPSA 1RC1A 1Z26A 3HC7A 1E6CA 2W42A 1W76A 4HFNA 2FUKA 4HQFA 4PZAA 2WU4A 3LXMA 1W4CA 1WPQA 5AOCA 4F4FA 3C8HA 1PWCA 1GGJA 1NQOA 2B2XA 2AH5A 4G25A 2G5PA 1E6KA 2G9QA 3CVXA 4Y1EA 5FI6A 4XUGB 2CT8A 3ZDCA 2V8BA 2JK1A 2H2IA 1VPTA 1YZKA 1K7FB 2C2OA 3BTOA 5JCXA 4BYMA 2VRCA 2EP5A 1BXGB 2EFJA 2IP1A 5KNBA 3SDSA 4RMIA 1VJ1A 3DBVO 5AW7A 2ZJ6A 4R84A 1GFSA 1XZLA 2JGFA 1DQPA 3A4VA 3QA9A 2OAEA 2PRFA 3DV2A 1KZYC 1NNI1 4MHSA 1Y1RA 3IVCA 3LYLA 3NAMA 4CLOA 3PICA 1OWPA 1DTEA 2WYXA 1A0OA 2F90A 2GD0A 2QBYA 1JIIA 2FZWA 4CCYB 1ZN2A 5KREA 3FAKA 3F6SA 1EX9A 4EBPA 3E3LA 3IPAA 2AFHA 2FR0A 4WZAE 1P9OA 2I7TA 4IGEA 3OZXA 5ECDA 1LF5A 3H4MA 4TRMA 1VB6A 3BCSA 1R0ZA 1XD8A 3K9WA 1KFBB 5J3JA 2XHZA 4R40A 1HE1C 2QTBA 5K0JA 2WYHA 5CMLA 3B6KA 3O2QB 3HVIA 3OJWA 4F9TA 1PUJA 1M1NB 1OXKB 2VJWA 5L8VA 1U0LA 3B5EA 4Y5FA 1KO7A 1SVNA 3V7NA 3ZCRA 3O3NB 2EIXA 2FMUA 4TTQA 1P0MA 3PJFA 5LA6B 1WKVA 4PFSA 3VP0A 2A7XA 3ZW8A 4WH0A 1RM0A 2XD9A 3T38A 1IH8A 1W5TA 1RHUA 1LS1A 1KI6B 4HKTA 4E11A 1EWYA 1ZSYA 2WT9A 1LU9A 2P1RA 3SHTA 1NR5A 4IZOA 2OXCA 3W8KA 3HBNA 1ZS9A 1TJ3A 3ZV7A 4TVBA 1H5NA 3SE7A 5DTTA 4D9JA 2PA3A 2ID7A 3FPKA 3GIDA 3N75A 3Q7VA 5TJJA 5LP6F 1PR2A 4D82A 1HDCA 2GYUA 1PFUA 4DJ5X 3E8MA 2GOYA 3E22A 2QKPA 4LGVA 4MV1A 4UBLA 1G8JA 5L10A 4U9IS 3HKEB 4IRUB 4UD6A 1W75A 2XVZA 5CFOA 3O7MA 3KHSA 3N05A 4D9NA 3PUYA 3I3OA 1FCOA 1VEUA 4RPIA 3VZBA 3CCBA 2NZJA 4K9KA 1PD0A 2C96A 1GKKA 1KSFX 1OMEA 4FHFA 2WICA 1QUEA 3OZVA 5EPEA 4UXJA 1N2SA 3VSCA 2J3KA 1HYQA 3AH8A 4HDNA 4NG2A 5I7FA 2Z6UA 2OCXA 2I4RA 4FR5A 2FJ0A 3Q7SA 4MO9A 3ELYA 3FR8A 2GJ3A 3F8TA 2PZKA 3TUJC 4XGKA 4TS9A 5IF9A 4MLLA 4D9GA 3W9BA 4QO7A 2ES4A 2ZRLA 2JAPA 3ZIAA 4RVUA 3HYRA 4DLKA 3UJ7A 1MW8X 1QP0A 1G3QA 3I5YA 4EHNA 3EY9A 4RV4A 1EZ1A 2VSOA 4LI0A